4E0BA

2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
311
structure length
305
Chain Sequence
NAMKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTHVSIKGYAGEDPTPALEGADVVLISAGVARADLFNVNAGIVKSLAERIAVVCPNACIGIITNPVNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAELKGQDPGEVRVPVIGGHSGVTILPLLSQVEGVEFSDEEIAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALVKALQGEEVIEYAYVEGNGEHASFFAQPVKLGKEGVEEILPYGELSDFEKAALDGMLETLNSDIQIGVDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
publication title 2.17 Angstrom resolution crystal structure of malate dehydrogenase from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
total genus 104
structure length 305
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e0bA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4e0bA02
3Q9UA 4NBWA 2NM0A 1NFQA 4WEQA 1U1IA 1Y8QA 2C2YA 3JSAA 4PZCA 2JD0A 2V6FA 2BD0A 2PZLA 3IUSA 1ZBQA 3UKOA 4F45A 5IF3A 2I67A 1A72A 3PIDA 4AJ4A 3WMXA 3PYLA 3D3EA 3GOHA 4AJEA 1R4NA 3H2ZA 1SEVA 3C24A 5JYDA 1FDUA 1TEHA 5U4QA 4BL5A 3H4VA 1PL7A 3BXXA 2CNBA 3FSRA 2Q45A 3G3EA 1HLDA 1Q7BA 5F1OA 5IFLA 5B37A 1C0IA 3E1KA 3KTDA 1E6EA 1E5QA 2E49A 2J3HA 2Q2QA 2G82A 4FOOA 1MFZA 3PEFA 4DLBA 3GZNB 1EQUA 4IIVA 2G76A 3H5RA 2QYSA 2Y1GA 2ZTMA 1R12A 2A9FA 1SC6A 1F14A 3FD8A 1P1JA 1SZJG 3FBGA 4MDHA 4OSOA 2VWHA 3PI7A 4D0SA 4LW8A 5TT0A 2ILTA 4OMUA 5CEFA 1SOWA 5KOIA 3DFZA 4BNMA 3ZU3A 4IJUA 1QMGA 5JAMA 1YOVA 1HSZA 2DTXA 4BB5A 2PZKA 3O8QA 2BGKA 1OAAA 1LRKA 3AOEC 1ISGA 1ULSA 1ISHA 1FDWA 1NX6A 2BI7A 4QXMA 2JKVA 4GSLA 1WMAA 3HB4X 5CDTA 2IYPA 3WQQA 4FFOA 4CMGA 2PNFA 5ER6A 2GYYA 3DZBA 3MWDB 5FFFA 3TZCA 4HFNA 4BOYA 4B8WA 1X0XA 4FFNA 1HZJA 5DT9A 3ZWWA 4BKRA 3BMCA 3MJVA 3GMDA 2ZKLA 1YB1A 1QKIA 5BR7A 1SBYA 2R2GA 4Y6RA 1NHGA 4F6LA 4A2CA 1YQDA 3DQPA 4MVJG 1EVZA 2XOXA 1DB3A 4M87A 4DUPA 3I5MA 3QWFA 3N7UA 3HFSA 1WPQA 3PLRA 1HF3A 4O63O 3ZCXA 2OOSA 4XRGA 3OEWA 1G0OA 2BGMA 5TLSA 2C07A 5TJ9A 1N7GA 5IAAA 2EF1A 3DBRA 3PJGA 4UULA 4XR9A 1ZEJA 4FW8A 4PG8A 2G5CA 3LT2A 3MJSA 1X7GA 3L77A 3KYDB 5L7TA 1QR6A 1VPDA 3AI3A 4DVJA 3GAZA 2VRCD 3JYQA 4B3HA 1DIRA 2BELA 2X0JA 1S7CA 1TA4A 1WP4A 1EUZA 3OSUA 4AJ2A 2PD4A 3B20A 3OM9A 2WYWA 1LJ8A 4PLHA 4YJFA 2A4KA 5BQFA 1IY8A 3BHIA 5TGDA 2B83A 1PTJA 4TROA 4NK5A 2B5VA 4QFDA 3OECA 4R9SA 4PLCA 4CQMA 1HT0A 4IZIA 1PWZA 4P4NA 3E8XA 4GGOA 1MC5A 1PS0A 2P4QA 2YFQA 3BMOA 3DXFA 3EZLA 5EJ2A 3V1TC 3WBBA 8ADHA 5IZ4A 2NNLD 2DLDA 1ZMTA 5G4KB 5THKA 2VNAA 1XWFA 3DAGA 3QY9A 3AWDA 3S55A 2GCGA 1JN0A 3AOGA 3R3JA 4EI2A 4Z9FA 1NWCA 1QLHA 2GNAA 5THQA 1DBVO 7MDHA 2PGLA 2BKAA 5KJFA 4MPDA 3WJAA 4CLRB 1EK5A 1P77A 1DC3A 3GA0A 5KVCA 1DRUA 2DUWA 3OJOA 1ENZA 5BT9A 1LC3A 3STHA 4C7KA 4CLXA 4YYZA 1HDGO 1GYRA 1YO6A 1CETA 4BMNA 1T4BA 4JIGA 3WYCA 2DPHA 2FSVA 1JQBA 1IHYA 2F00A 2Q2WA 4IDBA 3L4SO 2OP1A 4O1MA 5A05A 2Y1DA 4PLVA 3I9NA 4EJMA 2OZPA 3K73O 2Y1OA 4R51A 2A92A 1GCOA 4BO2A 4IDEA 4CV2A 2FHSA 3MZ0A 3P19A 2X4GA 1K0UA 4FC7A 4MVJA 1YL6A 5AYVA 5JSFA 1NQAO 1M67A 1YB4A 2JD2A 3F4BA 3JD0A 4Z0HO 1WZIA 1BTOA 4A27A 3U5TA 1U4OA 3I9LA 3FPLA 1E1LA 2Q1TA 4B3JA 1YWGO 4KQWA 2NLOA 3UOGA 3MJTA 2PKQP 2OL4A 1LSSA 2JCYA 3VZPA 1FDVA 2VTEA 5KNLA 1V8BA 4BMVA 4PLPA 3GPIA 1E77A 1PJ3A 1RM5A 2QYTA 2EJVA 1T24A 1Q0QA 3H65A 1PQWA 3N74A 1GDHA 3C1TA 3LC2O 2GGSA 4CM7A 1P1IA 2QX7A 2VHZA 3JYOA 4DGSA 4ALIA 3I83A 4JNKA 1HRDA 3K92A 1VLLA 3S8MA 3UCXA 1YVEI 1E3WA 4QO7A 1Y81A 2UUOA 5FI5A 1GYQA 3GZNA 3BTOA 2Q1WA 4XIJA 4XRRA 3KV3O 4TZKA 1Z73A 1UZNA 3EVNA 4YACA 2Q50A 1HEUA 2QRJA 1DIAA 4BQPA 3OJEA 2JJYA 4RVFA 1ZZEA 2D5AA 4BNXA 4PVDA 2P68A 4AL4A 2G0TA 4RQTA 3WJ7A 3GC6A 3GVIA 4DC1A 4AJLA 4U0KA 1DC6A 1MX3A 2J5QA 2GO1A 4IQGA 4LMPA 2BI8A 1QRRA 2DPGA 3CKYA 1Z7BA 3ZW9A 1HLPA 1N9GB 5IDWA 1QLJA 3QLJA 2X23A 1T2EA 4Q3EA 4HNGA 2X5KO 2HMUA 4ALLA 3D0OA 1PJCA 4MVJP 4PLYA 4E2YA 1SB9A 4WECA 4FJ0A 1AUPA 3NUGA 1M2WA 2B0JA 3LC1O 4CR7A 5BSGA 4MKZA 1EZ4A 1EUCA 1GR0A 3RJ5A 3X2FA 2WSBA 3QRWA 1PU2A 2YJZA 1Z45A 4I8XA 3FCOA 2ZTUA 1PS9A 2DBQA 2O48X 2I65A 1PZHA 3JQAA 1XDWA 1XQ1A 3SEFA 1L7DA 4HXYA 3EMKA 1MLDA 2SCUA 3I1JA 1BMDA 1R0SA 4ZRMA 1IB6A 3IP3A 3AY3A 4K6FA 1AHIA 3EC7A 1SNYA 4OJNA 3C85A 4NBTA 5CPBA 5F5LA 2O3JA 3HQ4O 1EK6A 1O8CA 4LMRA 3EHEA 3D3WB 4GLLA 4K26A 3VC7A 1IPEA 3JQ8B 1ONNA 2WD7B 3GDGA 2C20A 4R5MA 4CMJA 1ZK4A 1DIGA 1NPTO 2BFPA 3GGPA 4I5DA 4IIUA 3K8ZA 4YAIA 1LA2A 2VNSA 2AEFA 3FN4A 4ALNA 1E1MA 4GX5A 4J1TA 1N7HA 4CMIA 1U9JA 4W7IA 1U8FO 2I9PA 4MVJF 4E5PA 4J7UA 2HK9A 1VJTA 4PRKA 1CQIA 3NDJA 4YT5A 4CMEA 2EGHA 1VI2A 2OBNA 5AXBA 2I5PO 3U3XA 2FY8A 3UVEA 3BYZA 1SCUA 5ICSA 1NVMB 1PR3A 3VH1A 3ZWOA 4CODB 4G65A 1I2BA 3BTUA 4XR4A 4PLZA 1ZFNA 1U4SA 1DFHA 1I32A 3EY4A 4JK3A 1ZVMA 2X0NA 3VH2A 1BW9A 1DHTA 5J23A 3GLQA 3S2EA 5TT1A 2UAGA 1JLLA 1ADFA 3DR3A 5G4KA 4HBGA 3INGA 1A7KA 4IS2A 1E5LA 4MIYA 2DTDA 1VM6A 1YXMA 3ZWYA 1O89A 1B2LA 5L53A 3MOGA 4PCVA 4CM8B 1MFPA 3ICPA 4II3A 5IG2A 4OQYA 3UICA 1LUAA 2Q4EA 4YT2A 4EITA 4KTVE 1CERA 2P5YA 3QVSA 3QVXA 4BNUA 2VWPA 4I5EA 3OQBA 3JQ9C 3KO8A 2JCXA 3HJAA 2QZZA 4IPTA 1V0JA 2AG8A 4JXKA 2QRKA 3RUCA 4JLWA 4DQVA 3UCEA 1T1RA 5IZCA 1DC5A 4D42A 4BNFA 1DFGA 1E7RA 2EGGA 1BXGB 2UV8A 3JQBA 1ADBA 3T4EA 3NGLA 3KXDA 3PDJA 4K1LA 1GL3A 3LT1A 5DP2A 1ULUA 2IZ1A 3PQEA 1ARZA 2YQ4A 2C0CA 2NU9A 4M55A 2IZZA 1KOLA 3OICA 3PYXA 4UUOA 4W6ZA 2O3RA 3RWBA 1LNQA 1ZK0A 2CUKA 2HMWA 3DBLA 4WLOA 1B8PA 1A5ZA 1LDBA 2ZB8A 5ILOA 3ANLA 5G4LA 3DHEA 4GAEA 3I9MA 3K2BA 1YJ8A 4A03A 1DLIA 4CL3A 3FBTA 5LDGA 1IUKA 3V2UA 3MTJA 4AJPA 2EXXA 3KRTA 3ITDA 3W6ZA 4JGBA 3CXRA 1BXKA 1JA9A 4OO3A 4AJJA 3CZMA 4AG3A 3ZWMA 4CLOA 1E7MA 4RO0A 2H5LA 4OOEA 2LDXA 3I52A 2EWMA 4FGSA 1XU7A 3ZWVA 3HDQA 4XD2A 4FBGA 3GUYA 4WE3A 4Z3DA 2C7GA 1L7EA 1KY5A 3GVCA 1D7OA 3F9IA 5F3RA 1I01A 4TMFA 5EPOA 2WWRA 4FSHA 3QE3A 4YRBA 4WOJA 1N5DA 4L73A 4Y6SA 3ANMA 4WK6A 3COSA 2GN6A 3WNQA 4BO7A 3SLGA 5EN4A 1Y8RA 3W4JA 4B79A 1U7TA 2E48A 3ZNOA 1EBFA 1A4UA 2C2XA 3M6IA 1GQQA 1UH5A 4UEJA 1YBMA 4J1SA 3DEYX 3IMFA 4W4TA 5L40A 3B70A 4CQLB 1N1GA 1PGPA 4BIIA 5AXCA 3O38A 4N7RA 3UFXA 5L4SA 3AI2A 1Y7TA 1IOLA 1E0DA 3BTSA 3SC6A 1LQUA 1ENPA 3H9UA 3TZ6A 1UP7A 3DBHB 4BNGA 4NDNE 1KEWA 3IUPA 1JAXA 1YQGA 5C3MA 2FR1A 3H3FA 4E33A 4YA6A 3O26A 1U3WA 3F6YA 1YB5A 2NTNA 1Z7EA 1YQXA 3F47A 2B5WA 2FR0A 4WCFA 1A71A 5HM8A 4GKVA 4NI5A 3AM3A 4E6PA 4IDFA 4XYMA 3NYWA 2CF5A 2NU7A 2VUTA 4BNZA 1CJCA 4DLAA 2VRBA 1NVTA 1AGNA 5I9NA 4MVJH 4DQXA 1QORA 1PGQA 2I3GA 1MB4A 2VHYA 3D3WA 4IDAA 4XQEA 2WD7A 5TNXA 4CQMD 3DO5A 3LF2A 1ADCA 4GVLA 4WNIA 4PN3A 3AFMA 3P2YA 3GPDG 3E03A 1I5RA 4ZVVA 3W1VA 3VKVA 3VPXA 4FB5A 3VTFA 2GERA 3RUFA 5DP1A 2E37A 3QQPA 2GUGA 4R1SA 4HV4A 2DFDA 5BNIA 5JDIA 2Q3EA 1C1DB 1CDOA 3GN2A 4LRSB 4Q3DA 1PEDA 3V1UA 4E5NA 4QX6A 1CEQA 4GL4A 1LX6A 3M2TA 5KTKA 2D8AA 1BVRA 4A0SA 1MA0A 2H1SA 4CJXA 3UH1A 2X9GA 1V9LA 1JTVA 3WGHA 3RI3A 5F21A 5H82A 2X7HA 2HMSA 1OZAA 1UR5A 3D4PA 3AUTA 2YDXA 4FPXA 1LDGA 4ALJA 2ZTLA 3JQ7B 3K2EA 1IHXA 1VJ0A 3BA1A 4CM8A 4XQGA 3VDRA 3ZWCA 5JY1A 1UZLA 4IY1A 3NV9A 1W6UA 4AJ1A 3ZU5A 4MVJD 2XXJA 1E7WA 2GDZA 3IIEA 4E30A 4IXWA 1PIWA 1JKJA 1X7HA 4JJGA 4RF4A 5JCJA 1HETA 1Y9EA 4QSMA 5A9SB 1RYEA 2I6TA 3DZHA 5CDGA 3C7CB 1NR7A 4PGFA 1TLTA 1F0YA 3R0IA 3A14A 2I76A 4BNTA 2WEKA 2J6IA 1BXGA 2YHIA 4D7AA 1JWAB 4B4VA 2QHXA 1QG6A 3JQ6A 3S1LA 2P9EA 4TRMA 1LRLA 4CM6A 4DLLA 4PLGA 4A10A 5ITWA 2W2KA 3WX0A 1GAEO 5I8WA 9LDTA 1JVBA 3TOZA 1R4MB 2NQ8A 4BKOA 1K3TA 3ZI0A 1MG5A 2UVDA 2JFFA 1C0LA 3BZUA 3Q0EA 4RLHA 1K6JA 2Y1EA 4NR0A 4WLFA 3TZHA 4GX1A 1H6CA 4YAGA 4RVSA 1DOHA 4XB2A 1XKQA 1K2WA 1ZCJA 1E92A 2Q99A 1LXCA 3Q2KA 3NDIA 4R54A 5COQA 3LF1A 3KZVA 5DOVA 3WYBA 4NG5A 5L51A 2AW5A 1IL0A 2VHVA 1AE1A 1KEVA 3KSDO 3PTZA 3W6UA 2BFMA 3WLFA 4NMHA 3B1KA 3TPCA 2OHXA 3C3XA 3DWFA 1HYHA 4QEDA 3NJ8A 2Y66A 5DN9A 4UVGA 3GNSA 4LSWA 4OL9A 3KEQA 4WASA 3ABIA 4NBRA 1Z74A 2EP7A 1YS4A 3BMQA 3DDNA 4OXNA 4HFJA 4B4UA 3QVWA 1QYDA 4CPDA 3ICCA 1E7SA 2IE0A 1EMDA 4OGWA 3SXPA 2C7VA 5F1KA 3JQFC 3WGZA 4GH5A 2O3QA 3WR5A 4CM4B 1ZEMA 3RKRA 2YY7A 4OH1A 1H2BA 3JQAD 3GDOA 2X1HA 7ADHA 1MG0A 1X1TA 2IODA 1ENYA 2CFCA 2V6BA 3DMYA 1LDNA 3VHRA 2VYNA 2PV7A 4H3VA 3ONEA 4JROA 1PS8A 2R6JA 3BAZA 4OXYA 4Y98A 1HE4A 3GUCA 4I5FA 2P4HX 2WE7A 4CMKA 5KJ1A 4Q9NA 4DA9A 1LDMA 1Z6ZA 4JJFA 1X14A 3RUDA 3ZHZA 4NFYA 1E3SA 1SB8A 1TT5A 1KVRA 1XQ6A 1YJQA 2AQIA 2VQ3A 4YB8A 5LCXA 1F06A 1GPDG 3OBBA 3FTPA 1I3MA 4M49A 4HY3A 5TX7A 4CM1A 1GZ4A 1EFKA 3QVTA 3GK3A 4M86A 4BVAA 4PRLA 4O59O 2NWQA 3MTGA 1U2DA 2Z5LA 5ADHA 3T7CA 4BO0A 1H6AA 3D4NA 2PFGA 5TSDA 4PVCA 3AW9A 1O5IA 4JBGA 2O3UA 4LRTB 3SBOA 2VHXA 4ROSA 3UUWA 4IQ8A 3E18A 1WDLA 3BMNB 3OP4A 3MJCA 4GLOA 4CLDA 4HP8A 4TVOA 1XIVA 3D1LA 3RFTA 3ZU4A 2O2YA 4U7WA 1E6WA 2HAEA 1YDWA 4D3SA 3D5QA 3MEQA 2O2SA 2NVBA 3PYMA 5BSHA 4RDIA 4PIVA 2OXIA 3SJUA 3IS3A 4B8ZA 3H9EO 5KKCA 4DIFA 3ZV3A 3I9OA 2YV2A 4UVDA 4FGWA 4H15A 2GZ3A 4BV8A 3GMSA 5C7OO 2QZ9A 2XAAA 1PJLA 2AA3A 1B3RA 1GUZA 4QUKA 4R69A 4OKIA 1IULA 3WQSB 1DO8A 1T4DA 2C5AA 4UUMA 3UN1A 4B7UA 5EMHA 3AOEA 3O9ZA 2HU2A 4IUYA 2EEZA 2JFHA 3VPHA 4AJKA 2IXBA 3H9QA 4NIMA 3OQ6A 3WICA 4RLSA 2ZJ1A 2DU8A 2Z1MA 2H6EA 3NT4A 3RROA 4JQCA 4RJTA 2QW8A 1BRMA 2TMDA 4NPCA 4XDZA 2QQ5A 3S2IA 2J5KA 3D7LA 3A06A 1FXSA 1XU9A 3A4VA 3G0OA 4J6FA 4UVIA 4ND5A 3PHIA 2Y93A 5DZSA 1AXEA 1I24A 2YYYA 1C1XA 1I30A 2H63A 4BS9A 1PL6A 1E6UA 4MKRA 5CAEA 4Z0PA 3ZWXA 1I3NA 1GD1O 4Z0TA 4B3IA 1DPGA 5DCYA 1NR1A 4INAA 3ADOA 3RASA 3VH3A 5KVVA 5A5FA 3DHYA 3Q6IA 4U5QA 4TZTA 4DWVA 3H5AA 2AG5A 4BNKA 4WUVA 4EUFA 4WKGA 4GI2A 5ENDA 5BNTA 3JYNA 2EKQA 3RKUA 3UXYA 4YR9A 4G5HA 1E1KA 1ZSVA 5G0SA 3FPCA 4ZRNA 4LVCA 4RV9A 2Y0DA 2D59A 3AFNA 3NTQA 2HK7A 5EESA 5FWNA 5TF4A 3JD4A 3WDSA 3U09A 2ZIZA 1R37A 4NH4A 4EUEA 5I7FA 4U6QA 4L76A 3RC9A 3EAGA 1J49A 2E82A 5DBGA 1K6IA 4FQ8A 5A02A 1U3UA 1HXHA 1MV8A 1P31A 1QXSA 4GMFA 1P44A 2B4QA 2A94A 2HCTA 3LYLA 3CUKA 4RF2A 3W4KA 2DC1A 4IM7A 2Y68A 2HMTA 3LT0A 3WS7A 3U0BA 1AN9A 3E6AA 3NRCA 3L6DA 5G0WA 3K5PA 3NT2A 1NYTA 1P1RA 3ROMA 4XGIA 1KC1A 4R3NA 5EIOA 3V1YA 2B35A 5I9LA 1IYZA 1M76A 2YFHA 3AJRA 3OJ0A 1A9YA 3ZV4A 4Z6KA 4KWHA 1HDZA 3DFUA 4NFHA 5B4TA 3ADPA 3OIDA 3HADA 1KEUA 4J91A 1RM3A 2B4TO 4ND2A 2DTEA 3GR6A 1NPDA 4ND1A 2NU6A 3G1UA 5FI3A 1W8DA 3R6DA 4J3FA 5BNFA 1H5QA 4YAJA 4R41A 1K89A 1H2HA 4Y8VA 4N5NA 2C54A 2OO5A 1ONOA 3LQFA 3GN1A 2R00C 4J0FA 2J3JA 3UHAA 2B36A 1HDXA 3WTBA 3DBVO 5H81A 4NBUA 4DPMA 5T57A 4XQ9A 4ZQHA 4EBFA 1LC0A 4J2OA 2D4AA 4XIYA 4GVXA 1MXHA 2NVUB 4ITUA 1U5AA 4IDDA 2HQ1A 2PD6A 4I1IA 5JAZA 4B7CA 1GCUA 3ETEA 5B4UA 4MIOA 2GN8A 2V6GA 4PLTA 1A9ZA 2RH4A 5CEEA 1HDCA 5FEUA 2YV1A 4EW6A 1HE3A 4J9VA 5A04A 1WNTA 5I7SA 2VTDA 2IDZA 5L95A 3MJ4A 2B69A 4HKTA 2FR8A 4RF5A 4FC6A 1MP0A 4BNHA 3EVTA 1N1EA 4M89A 3WMWA 2AMFA 3ZWBA 2FZWA 5G2OA 5BSFA 4BNLA 2IZ0A 2CMDA 4QTZA 5I8ZA 1RM0A 5JLAA 1Q0LA 1OMOA 2P5UA 5EQFA 2W98A 3RD5A 4BMSA 1YL5A 4XYBA 1BG6A 4YQYA 4DMMA 3GRKA 3IDSA 4DIOA 1O94A 4OM8A 1XYGA 2CDCA 1PQUA 4FS3A 4KUEA 3CMMA 3GVHA 4R1TA 1PJTA 5DULA 9LDBA 4NHEA 3I4CA 3ZWNA 2AHRA 2D0IA 5FYDA 3AUAA 1PR9A 3KB6A 4YAKA 1ONPA 4PZEA 5KKAA 1GY8A 1NASA 2AEMA 3PJDA 3ONFA 1E3IA 3JD2A 4CR6A 1ZO8A 4BO4A 2VUUA 1U7HA 4R16A 4XKJA 1YGYA 5A03A 1EEHA 5U1PA 3OMLA 2YUTA 3ZV5A 4XDYA 4RPLA 5L7WA 4YJHB 3JV7A 3GEDA 3OJLA 4BO8A 1X0VA 2Q1SA 3E48A 3L4BA 4IMPA 4ESOA 5JMPA 2CDBA 2DM6A 5JW6A 3DAPA 4NJOA 1FK8A 4KUGA 4Q39A 2H9IA 1XELA 2PKQO 3WGGA 5L4LA 4N5MA 1V3TA 1HE2A 4OYRA 4XJTA 1N92A 5IN4A 2BHLA 3WTCA 2OUIA 2FWMX 4FFPA 3Q3CA 5K9ZA 2RBEA 3INRA 1UXKA 3I4FA 3OJFA 2O4CA 3JTMA 5AXDA 5G0VA 5I7EA 3RC1A 1I33A 1HYGA 1A4IA 2VZ0A 4KOAA 3RBVA 3KYDA 5TC4A 3U49A 5ICMA 3I23A 5CHEA 1NP3A 4OXKA 4XGNA 1P74A 3ZZNA 1P45A 1UZMA 1GTMA 1QV6A 2CZCA 4DTIA 3DTTA 4BO9A 3PHGA 4DRYA 4IGFA 2LDBA 1HWYA 4GQAA 1EVJA 3HE3A 3QW2A 4PLWA 1ISIA 5JXWA 3BTVA 1NVGA 3GFBA 4J7XA 2VWQA 2RAFA 2WM3A 2C5EA 3U4DA 1N2SA 2I99A 4IDCA 1V35A 3GEGA 4BNWA 3TDKA 4CV0A 1IPFA 1H6BA 3UW3A 4BGVA 1X1EA 2IRWA 2NUAA 4N5LA 3CH6A 4BHTA 3ANNA 5JFOA 1T2CA 3AM5A 4IJVA 4YQZA 4E21A 3DZKA 3TFQA 4LISA 4RVHA 1DRVA 1SO8A 4CLRA 5AQ1A 3OHSX 4GKBA 3VOSA 4Q3AA 4ID9A 1EUDA 1NAIA 4L9RA 3E5MA 1FJHA 2DBZA 2D3TA 3NGXA 2DFVA 3R1IA 2UDPA 3OETA 3RBXA 4KQXA 2AQHA 5LC1A 4YXFA 4BNVA 2GZ1A 1LSUA 1FDTA 3RC7A 4KUHA 5KJ6A 3RJ9A 1ZK3A 2JFGA 4F6CA 4HX5A 3VDQA 1ISFA 2YQ5A 4S3MA 3RUEA 4BNIA 5KIAA 3JQ9A 3Q9NA 3ASVA 1ZSNA 3PJFA 4E4YA 5DOZA 3A1NA 3ZNNA 3ENNA 4HUJA 4DPKA 1Y5MA 3W8EA 4DBVO 5A3VA 1UP6A 3UF0A 3RAJA 2D5CA 3LLSA 1NFFA 4BO3A 3B6ZA 4U0JA 5JAQA 5JDCC 4J49A 3KHUA 1PX0A 1GYPA 5EQDA 3PHJA 4D46A 3F5SA 4DXHA 2GD1O 1WWKA 3S2GA 2XF8A 3SVTA 1ML3A 4NU6A 3JYPA 5JAIA 3HG7A 2FN7A 2Q46A 3F46A 5MGBA 2GRAA 1OBFO 2X6TA 3ROPA 4HNHA 1NPYA 5T67A 4RF3A 5KWEA 4A26A 2ZYDA 5U9CA 5ILGA 1LI4A 3PFFA 1DXYA 2FSSA 3U4HA 4YJGB 3WGTA 1WMBA 2GSDA 2HSDA 1E7QA 1UP4A 3PWSA 1NQOA 3HDJA 3QWAA 1NQTA 3KETA 1GPJA 1KEPA 2ZTVA 3HWRA 2O7QA 4R68A 4ZQFA 4YRAA 5B1YA 4WLUA 3HZZA 1GFSA 1MXFA 3I3OA 2B4RO 2CSUA 2P2SA 5KJCA 1GZ6A 5A9RA 2Q4BA 4W82A 4IJWA 3M1LA 4F46A 1R6DA 4G2NA 2I3AA 3PZBA 1Y8QB 2X0RA 3BHMA 1NBOA 4JP3A 3CE6A 4J7CA 1N9GA 4AICA 4N54A 4YAEA 5LDHA 3LK7A 3P5SA 1R4NB 3FNGA 3ZHXA 1U3VA 4BO5A 2VT3A 3ZNPA 2Y99A 4IGEA 1V6AA 2NU8A 1H9BA 4E2XA 3DONA 1IZ9A 1QYVA 1EBUA 1VL6A 3DZJA 2PY6A 4BO6A 1DAOA 4WCFC 4C7JA 2ZCUA 3ZWPA 3C1OA 1BXZA 3PLNA 3HNPA 3M1AA 2DBVO 4BGEA 4WOKA 4CM9A 3P7MA 3QIVA 1UXGA 4G81A 5HS6A 3FR7A 4KMSA 5L3ZA 3OA2A 4YWJA 1HTBA 1ENOA 5HWSA 1C0PA 1D4FA 1W73A 3I9JA 5HRUA 4EUHA 3LLVA 3Q11A 1TI7A 2BMAA 3L9XA 5TQVA 2V7PA 3RBZA 4P8RA 3CSDA 3HSKA 3RVDA 3JQ8A 3L9WA 2PGJA 3VPGA 1G1AA 3V5NA 1YOVB 2X5JO 1SEPA 1KVUA 3K30A 3RU7A 3MOIA 3E82A 1I2ZA 4ZQEA 4RCVA 2EV9A 4IZHA 2DT5A 3O8QB 2XXBA 4YCAA 4E2ZA 2W2LA 2BGLA 2B37A 5DF1A 4DPLA 3ONDA 5L7YA 2GZ2A 1RPNA 1B14A 1RJWA 4OSPA 3I6IA 3WSWA 1NFRA 1JKFA 4BO1A 3ZDFA 4P4GA 1T26A 1X13A 2AEJA 3DOOA 4M8SA 2D1YA 2PA3A 4UVEA 1VC2A 4CM3A 2FMUA 4A73A 1EE9A 3DB2A 1B3BA 1PSDA 3TNLA 1XGKA 3JCZA 4H16A 4UVHA 4IQ0A 2AE1A 2FZEA 3PQDA 1TB4A 1LDYA 3BMCB 5COAA 4FFLA 1VRWA 3FHLA 4A5OA 3IKTA 3IJPA 3AU9A 1TXGA 3FTNA 1E1NA 1KBZA 5ER9A 5T8KC 3KSZO 2PK3A 3H2SA 4KDEA 4CL8A 4WCDA 4WEOA 5HTOA 2HRBA 2P9CA 3NTOA 1LRJA 1P33A 3O4RA 1C3VA 1YKFA 3DTYA 4TQGA 2Q2VA 1OC4A 3DBRB 5GZ1A 1PGNA 3WNVA 5AOVA 4FJ1A 1H94A 1LLQA 1RKXA 4NU5A 3VKUA 4D0RA 3TZKA 1B7GO 3PDUA 2ZQYA 3W4IA 4GWGA 4WJZA 2HRZA 3FNEA 3GNTA 4MP8A 3WBFA 4EDFA 3LVFO 1R0LA 4FJ2A 4O6VA 3HB5X 1GU7A 4YJFB 2HJSA 5FF9A 4UUNA 3RC2A 3AU8A 2VCYA 3GAFA 4MP3A 1WLYA 1KVQA 5TS3A 5A3JA 4CQMB 1ZW1A 2PWZA 3TSCA 5I7VA 3FRJA 4MKXA 4C4OA 2X58A 3BMOB 3OH8A 4D3DA 3LC7O 3QV1A 2FP4A 2X9NA 3Q2IA 5DNAA 5K6AA 1D1TA 3GDFA 3L0DA 1ZXBA 1J4AA 4D43A 3BHJA 3A28A 1P0FA 1ZKMA 4W9NC 4N18A 1DSSG 3JQGB 1PWXA 1JWBB 3PJEA 4JP2A 5KVQA 3E9QA 1XSEA 3DMTC 1W4ZA 4D41A 4WLNA 2VZ8A 3KOUA 2OBYA 3PHLA 3OQ1A 2HLPA 3PFWO 2XPCA 4XX0A 3TQHA 1DHRA 3PIIA 4RZIA 3AI1A 4E5YA 3AY7A 1YL7A 2GLXA 3HDYA 3QA9A 3HN2A 1GQYA 3MJEA 2WYUA 1EDOA 2ZB4A 1AXGA 4E13A 2J3IA 4AJHA 3S2FA 4E0BA 3F5QA 1ZJYA 3KYBA 2VUSA 4U8GA 4L4XA 2AXQA 1NQ5A 1E3JA 3DOJA 5I9MA 1WDMA 1JDJA 5CDSA 2E4AA 4DMLA 4ILKA 1NM5A 1KYQA 2C82A 2X8LA 5C5IA 1A27A 1I3LA 2DUUA 2EKLA 3PPIA 3TF5A 3EDMA 4TVBA 2G17A 4BNJA 4TKMA 1HDOA 1BHSA 4BUCA 4RVUA 1DDOA 4XEHA 1KIFA 4CQLA 4XYGA 4YDRA 4L75A 3GGGA 1O0SA 3FI9A 5HBRA 3PHHA 2WYVA 5T6BA 2AQKA 3DBHA 2AQ8A 3DC2A 3ZNQA 1U2GA 3CPSA 2POQX 3HFGA 4YTEA 3U62A 1BWSA 3JQFA 1M75A 2O4UX 4GBJA 1PZFA 4LSMA 3K6JA 1O95A 1ZXLA 1E3WB 1ZH8A 2TMGA 3INTA 2RHRA 5JO0A 4FIZA 4Y67A 1I36A 1MUUA 3C7AA 3NT5A 4ZGWA 3KYCB 3G79A 4WPGA 4R5HA 3X2EA 1ISJA 4BNNA 4XCVA 1SMKA 5A06A 4B4OA 1NXQA 5G0UA 4EZBA 5B12A 3TZQA 1J5PA 2Y0CA 2EW2A 1VKOA 4ZD6A 4EYEA 2ZQZA 1CWUA 4I5GA 3CMCO 4WGGA 4Q3NA 3GFGA 3ROQA 2Y67A 4R1UA 1B15A 1BGVA 2JCVA 1B16A 1G0NA 2O3SA 4MOWA 4XGKA 1XG5A 2OGUA 3F1LA 3KSUA 3NTRA 4CR8A 4YPOA 1V3VA 4DC0A 1Q2XA 1O6ZA 4CLHA 3AUUA 3WFIA 2JAHA 4RORA 2EHDA 1C1DA 3ZHYA 5A5EA 2X9VA 1B8VA 4HFRA 2WD8A 1HDRA 4M1QA 3UAGA 3ETGA 4BKUA 1NNUA 4L0QA 4XQCA 3JQAB 2DKNA 4J4TA 2O23A 1ID1A 1UXIA 4CM5A 4CMAA 4XB1A 5A4DA 3H6KA 3EW7A 5DDIP 2ZCVA 5JO9A 3U4CA 3VH4A 2YHUA 1GEEA 4D79A 2RIRA 3WG9A 4DQUA 1GUYA 5AVOA 3JQ7A 4QQRA 4RGBA 2I66A 1PZEA 1Q1NA 2FPPA 1OFGA 1R0KA 5IDXA 1E7YA 1VSUA 3F4LA 5EINA 3LSYA 2VWGA 1ZIDA 3ENKA 4FCCA 4J16A 4UREA 2ZK7A 3SC4A 3DAFA 4FFMA 3RSHA 4CMIB 1H93A 1YONA 1HYEA 4YVFA 5A9SA 3M2PA 1ZK1A 2BFOA 4P38A 4URFA 1C0KA 2IEBA 2PZMA 5ITVA 1MC4A 3CEAA 3SX2A 4FOSA 5HS4A 1CF2O 1GQ2A 1I2CA 4LCEA 5IDYA 3GT0A 3ZHBA 3OIGA 4TWRA 1S6YA 1ZK2A 4ND4A 1PL8A 4HFMA 4J1QA 1XEAA 4RPGA 1BW9B 1R4MA 3FNHA 1QV7A 3ZH2A 4AJOA 1P3DA 3F3SA 3AM4A 4TSKA 4L4SA 3IQDB 3GEMA 3V2HA 1PJ4A 1RWBA 4UUPA 3JQEA 3IKVA 4BKQA 6LDHA 3GG2A 4XJSA 5B4VA 3OF2A 3JQGA 4QFCA 1J6UA 2Q49A 5JNLA 4R9RA 1HL3A 3KUXA 4EGFA 1TT7A 3GVPA 1PJQA 1JU9A 4O5OA 2J8ZA 3IOYA 8LDHA 1LSOA 1NAHA 4PLFA 1ZSYA 4CMHA 4E5MA 4JN6B 4NFSA 2X5OA 4UEKA 1RM4A 4B4WA 1BVUA 2G1UA 2RCYA 3AUSA 3H8VA 4GPD1 1VJ1A 2GPTA 4Y9DA 5F5NA 1HE5A 3IJRA 2VYVA 3G49A 1VL8A 1EE2A 5ENVA 3KEOA 3PGXA 3H3JA 3CINA 2GR9A 6ADHA 1R15A 3WIDA 1P9LA 5IXYA 3D4OA 3FR8A 4IMRA 1UAYA 5EERA 1I10A 5GY7A 4YRDA 1ZJZA 1XR3A 4CM4A 5JCXA 1VSVA 3JD1A 2QIOA 3H7AA 4B7XA 3TN7A 3DBLB 4CM9D 4CV1A 1EFLA 3W8DA 4NK4A 4MO2A 2ZB3A 1VKNA 2Y1CA 4KDFA 3ROKA 3V2GA 5CEJA 1RYDA 2DVMA 1EDZA 2VN8A 1HZZA 2W90A 4LK3A 1NWHA 4DIBA 5L9AA 2PTGA 1X15A 1YRLA 5IJZA 1Y9AA 3WYEA 2PLAA 1EQ2A 3C8MA 3SLKA 2WMDA 4J43A 4DREA 5GZ3A 2VOJA 3PQFA 4YBZA 4ZQBA 4D45A 3DOCA 2C59A 3U9LA 4CLOB 4F3YA 1UUFA 2R00A 3T4XA 3WGOA 5F1PA 3ZW8A 1O9BA 1Z75A 2PD3A 2RHCA 3DZFA 4IJKA 2J5RA 3HHPA 1F8FA 4BGUA 5A1TA 5L4NA 3KVOA 1K6XA 3FF4A 2W2LD 2Y1FA 4MVJE 3WFJA 3QWIA 4AJNA 4ALKA 1YH3A 3K96A 4Q3BA 1FDSA 4Z9XA 3V8BA 3LZ6A 1Y1PA 3KYCA 1PZGA 1KERA 3BMNA 1Y5RA 3K9QO 1ZNQO 4ZJUA 4GGPA 2ET6A 4FD3A 1DIBA 1Y8RB 1LLUA 4ZA2A 4CMCA 4CUKA 1LQTA 3ON5A 4S1VA 2ZYGA 1ADGA 5JBIA 3VZQA 2RH8A 3ULKA 2FRDA 4RQUA 1HKUA 5C7IO 3WWYA 1LBEA 2CF6A 4GX2A 3ITKA 4RVGA 3RUHA 5KVSA 2WE8A 3L4BC 1P1KA 1B0AA 2V65A 4R01A 4AVYA 5C7LO 3OEYA 3JQCA 1GV1A 2PZJA 4RPJA 1T2AA 3FWZA 2ZATA 4NQZA 3DZGA 4NJMB 1D3AA 3EGOA 2UYYA 1D8AA 3WOHA 2HUNA 1C14A 4EEXA 4W99A 5CPFA 5CG2A 3HUDA 5TJHA 2Y05A 1JW9B 1LSJA 4ZU3A 4BGIA 5JPIA 3GZ4A 5JCJD 1B26A 3ORFA 4WCFB 1XLTA 5CP8A 3N58A 4NNJA 1U8XX 4M54A 1KY4A 3GQVA 4ND3A 4I9NA 2IEDA 3FNFA 4CMEC 2FOIA 1I8TA 4XWYA 1QSGA 3WGIA 4J1NA 2IYOA 3IP1A 1AHHA 1K5HA 1FF9A 3E9MA 3PXXA 2O50A 3VZRA 3O03A 3E5RA 1BDBA 2GASA 4DL9A 5MDHA 1P1FA 1PQPA 3PWKA 2VOEA 2BLLA 4MIEA 1PGOA 3TL2A 1SAYA 2YW9A 2QG4A 1NHWA 2EIHA 3ZV6A 1P0CA 3LT4A 2YDYA 4WLEA 3OA0A 1DJNA 2PKRA 3B1FA 1PJBA 4R1NA 1QYWA 2NTJA 1V3UA 2Z95A 2VHWA 4XYEA 4Z9YA 2PR2A 4MP6A 4ONEA 3VVCA 1PGJA 3WSVA 4ZQGA 4CLEA 1XCBA 2JHFA 1P1HA 2OP0A 4CMBA 3WLEA 4CV3A 4W7HA 2YZ7A 3WIEA 3NKLA 4FFRA 4MJLA 3AY6A 1KETA 1KS9A 4D44A 1TVEA 2C29D 4L8VA 5K0ZA 5IZCC 3AK4A 3Q1LA 3KLMX 3RUAA 2PH3A 5JY6A 3W8FA 1J0XO 3G1TA 3MWEB 3JQBC 3ZWAA 1DEHA 5KCZA 1G6KA 3QP9A 1JKIA 4GWKA 1N8KA 3IAHA 3HN7A 4BNYA 4CUJA 4LVUA 3PVZA 1F12A 4Q3CA 4XA8A 3RFVA 1U5CA 2ZB7A 3DHNA 5C37A 4AFNA 4R4JA 2WDZA 1PJSA 1H9AA 2VYND 3JD3A 3KM0A 1T25A 1T2DA 4J0EA 4TRRA 1Y6JA 1LEHA 3RUIA 1F8GA 3C1AA 2CDAA 4MINA 1M66A 1YBVA 4BKPA 2YHIB 4AJIA 5CFZA 1EVYA 1XHLA 2QRLA 2VT2A 3NAQA 4X54A 5T64A 2VRCA 3LDHA 2FPIA 1A7AA 3EZYA 4OHUA 2NVWA 2X86A 5JS6A 3VTZA 2OORA 4RDHA 2W2KB 1KVSA 2ZYAA 4E31A 1R66A 4GMGA 5CDYA 3R3SA 2HK8A 3QVOA 2BF7A 1KC3A 4JJIA 1WZEA 5GMOA 2WTBA 3H5NA 1GEGA 1JAYA 4UAGA 1UDAA 4E2WA 3WGQA 4Z3KA 3HDHA 3CIFA 4Y6PA 4K6CA 3L07A 3OIFA 2NVUA 1T1SA 1ISMA 5JC8A 3TRIA 4BB6A 2W8ZA 4E12A 3TWOA 2X0IA 2P9GA 1BSVA 3DL2A 4UEOA 3ZN2A 4EJ6A 5JDCA 1GUFA 2A35A 1L1FA 1FMCA 2AE2A 3F1KA 4PG4A 1HSOA 2JD1A 3NX4A 4OAQA 5L45A 3D5TA 3ST7A 3UGKA 4TRJA 3PRJA 1CQJA 1UJMA 4KTTE 3WGYA 3BMQB 5HA5A 4YT4A 1SPXA 1F17A 4J9UE 2IXAA 2Z1NA 2GN9A 3H9GA 3KBOA 2NQTA 2VZ9A 4IBOA 4KP7A 3GF4A 3GHYA 3NJ4A 4JBHA 2CVQA 1ZMOA 5G0TA 2EP5A 2O7SA 4I9HA 1YBAA 4PZDA 2BFAA 3PP8A 4J4HA 4O0LA 1DLJA 2BH9A 3H9JA 3WQRA 1OI7A 2HO5A 1W0CA 3GG9A 4ZICA 2W4QA 1UXJA 1SOVA 4RL6A 5DBFA 3EYWA 1XA0A 1IZ0A 5EL0A 1I3KA 4R3WA 4HADA 4JX8A 2EKPA 4BV9A 4JCOA 3SJ7A 1OOEA 4I08A 3WXBA 1TT5B 5A9TA 3RQSA 4YJHA 3WB9A 2JL1A 4LN1A 2OMEA 2P91A 3I9KA 4D3FA 4NJMA 1JVSA 1WXDA 4PG7A 4DYVA 3QWHA 4XZ3A 3ZU2A 4ALMA 3GH3A 1CYDA 3VAZA 5ES3A 1WW8A 4L4RA 4OKNA 2NADA 3RIHA 2GF2A 1X7DA 2D2IA 4J4BA 4J90A 3TL3A 4IDGA 3EUWA 1M6WA 1I0ZA 1QYXA 4DYDA 3CTMA 4EJ0A 2J3KA 5JE8A 1U28A 5DBIA 5T5QA 2CD9A 5AXAA 4NBVA 5JDIC 1CRWG 3GY0A 2EG9A 5BSEA 4OQZA 2NACA 5DCWA 4I9UA 1H6DA 3QHAA 1DFIA 2FPGA 2HJRA 1BDMA 1UAGA 2NV6A 3G17A 1Z82A 3WWZA 3RU9A 2DBRA 3LU1A 1YDEA 1LLCA 5CG1A 1DJQA 2HDHA 3JQDA 1DRWA 4U6SA 4JBIA 3RFXA 2HMVA 5JC1A 3P2OA 3L6EA 2PH5A 3IC5A 3IL2A 4K28A 1GADO 2EW8A 2YV3A 4MVJI 2NTVA 4LCJA 4E5KA 3ZGYA 4KZPA 1WAMA 2JAPA 5TRTA 4WNCA 4HWKA 1QYCA 2JHGA 5IDQA 5JYEA 2CY0A 3VPFA 5KJEA 2EJWA 2X22A 1YE3A 1QP8A 3E9NA 4OOFA 3QJ5A 4L74A 1C1XB 5CDUA 4GX0A 5TIIA 4FR5A 1CIVA 4EEZA 1PJ2A 2VYVD 1DC4A 4RVDA 4XYLA 1R16A 1UDCA 3C7DB 1IE3A 3NDRA 5COBA 2OFPA 3PK0A 3K31A 4PFJA 4YT8A 3CZRA 1H0KA 4IS3A 3VPSA 4IINA 5T8KA 4A7PA 1GV0A 4IXTA 1DAPA 4H7PA 1LTHR 3FWNA 3KLPX 4II2A 4QECA 5IN5A 4PG6A 2O3TA 1EVIA 2PGDA 3TJRA 5K6AC 1VE9A 1KVTA 4KWIA 1NTOA 2NSDA 3ETDA 3GGOA 1HDYA 3QWBA 3EK2A 4PG5A 3TFOA 4RPKA 3MCVA 5H83A 1D1SA 4J2HA 4NZ9A 4TKLA 4ZN6A 2V6MA 2Q1UA 4RZHA 1T2FA 2F1KA 4FDAA 3UCFA 2UUPA 2CVZA 3L6OO 3VVBA 3GRPA 3PGJA 4OIMA 5IXSA 1UXHA 4TRNA 2GN4A 4QT0A 3QSGA 1Q7GA 4LGVA 5GZ6A 3PWZA 5DCUA 4CUZA 1Q0HA 4QO8A 4YEDA 1VL0A 3RCBA 2CVOA 4YJDA 1B8UA 1LDEA 1M6HA 1OC2A 4E3ZA 3VZSA 1LLDA 4GSKA 4WLVA 1MGOA 3ASUA 1ZUD1 1WDKA 3BIOA 4DBZA 1UDBA 2EERA 4BQRA 2Y0EA 1ORRA 4YJGA 4FN4A 3A9WA 3PZRA 4E32A 4P22A 3I6QA 2HKIA 2DAPA 3B1JA 4W9NA 3TOXA 4ZHSA 1E3EA 2E6UX 1Q7CA 3JYLA 3DZIA 3U4IA 3GHHA 4RPHA 5JMWA 3DMTA 3D64A 1WVGA 2BRUA 4MVJM 1LU9A 2ZJ0A 2DQ4A 3GNQA 4P4LA 1E3LA 1U3TA 3GVXA 3NEPX 3T7EA 2WJPA 3OFSA 1GZ3A 4K9DA 1DIHA
chains in the Genus database with same CATH superfamily
4Y1FA 3BGDA 3Q9UA 3CWZA 3W3ZB 4BFCA 1NFQA 4TWAA 1IN6A 1U1IA 2QLJA 4GRDA 3KOMA 3G23A 3PC7A 1XTVA 4NPHA 3T15A 5CIYA 4ARVA 4QPCA 4AJ4A 3PYLA 4RHCA 4ER0A 2C4MA 4OHKA 1R4NA 2X4LA 5FBVB 3AF5A 3C24A 5DNEA 4EHHA 2G83A 1DV1A 1YS1X 1Y6RA 2VJYA 1EHYA 3R20A 3KSMA 5BV1A 3G3EA 3LA8A 4JUDX 1HLDA 1L5OA 1IZ7A 1Q7BA 3WK5A 5H3HA 4M36A 1AHNA 3PEUA 2TECE 5B37A 5IK2A 2Q9CA 5IFLA 5A0TA 2B7CA 1KK1A 3PQCA 2J3HA 3PEFA 1BEUB 3FPKA 4R1OA 4HVCA 1SUIA 2APJA 4KO8A 3RAEC 3H5RA 4ARSA 1QGYA 3DM5A 4CCAA 4FKBA 3SMQA 1E2JA 4K6GA 1F14A 3FD8A 1P1JA 1SZJG 3FBGA 4MDHA 4N1AA 3SOPA 5HZMA 5KU1A 2ZQ5A 2HJHA 4PS1A 2F1OA 2YXPX 3MMSA 5TT0A 3BKXA 5ALLA 1W4CA 3FYDA 3OQIB 4GZLA 1U8CB 3WJ1A 1JFSA 1NVXQ 4JB3A 1X92A 2C3PA 2ZR7A 4TUYB 3ZZMA 2ZT5A 2GHRA 2O6HA 3BEDA 3TK1A 1TU4A 3NP9A 5JAMA 3N2EA 3DNMA 1C7EA 2P41A 3GLHA 4C78A 4V03A 4Q12A 5EGSA 2XUAA 2IVZA 3TLAA 4KXWA 2PMFA 4ZOLF 2KI5A 1IM8A 1NVKA 1CDZA 2RGNA 3R5XA 3TUJC 1LRKA 1U2RA 2B4YA 2VDJA 3JYHA 4X45A 1ISGA 5BT8A 1FDWA 3JX9A 3JR3A 1U0HC 4BATA 2H2FA 5HDQA 2J7KA 1F2TA 1DKLA 2QVYX 4BVBA 5LMZA 3WQQA 3AVWA 4PZLA 4DUYB 1QH1A 3CW8X 1EUCB 2FSUA 4O2AB 1OH6A 3A9TA 5AUPB 2GYYA 2NX2A 5KYWA 3IXMA 1Q0UA 3HTXA 2IFTA 1NJFA 3W3AD 5JRJA 4F3NA 4C6TB 4OV6B 2CXUA 1NVUQ 3RIXA 3C43A 4H0CA 5GQSA 4ZO6A 4B8WA 1X0XA 5GJCA 3B53X 1CW2B 5ADUS 5BUQA 3Q3JB 1H3FA 3N7TA 3EVBA 3ZWWA 3KKEA 2IYNA 3E4DA 3L6BA 1OILA 5K4HA 1JMVA 5IT4A 3I39X 1WIWA 1ZBDA 3LK6A 5KYNA 1ESZA 1RRPA 2ZKLA 3GMDA 1FYVA 1SBYA 1GDTA 1RTTA 4CIXA 5IVDA 1E2QA 3SYMA 1RS0A 1YQDA 1ZOOA 1EVZA 1WW3A 3UNXA 1DB3A 2GTIA 3HB1A 2O6LA 4DUPA 4EPYA 3N7UA 1XCGB 4GBMA 2C8KA 3C98A 4MMYB 1HF3A 4BLQA 2E9SA 1SXPA 5ALDA 3NHRA 5DN6D 4P3PA 1G0OA 2XWPA 1M1UA 1T3SA 2R85A 2C07A 2QN6A 3IEPA 2D74A 4MYDA 2VAWA 1N7GA 4TTQA 2GFQA 5AM4A 4EGSA 1U8ZA 4HGNA 5DBEX 1DE0A 3KTFA 4OLHA 4D0NA 2J4DA 4G0NA 2JDID 1X7GA 1QP0A 2QPOA 1CY7A 2VH1A 3C2QA 4KIWA 3OT5A 3ZKWA 4Q4CA 4DCMA 2VRCD 1BS2A 3LVBA 4J2TA 5CIQA 4IX9A 4ZEOA 4AU1A 5FV7A 5D6OA 4ZK6A 2GTPA 2H9AA 1K92A 1TA4A 1WP4A 4EA9A 1KY3A 2IW1A 1U94A 2ZJ3A 4AJ2A 2E87A 3IO5A 5CR9A 4F4DA 4R2HA 3URKA 1BOOA 3OM9A 3TR0A 2WYWA 2IXFA 5SZJA 4YJFA 5AW6A 3VC3A 2QVBA 3PR2B 5BQFA 1G2OA 1THZA 1DTEA 2FW0A 4P53A 1V7CA 2AUNA 2HRDA 4WA8A 1PTJA 4H2DA 2O8BB 3VKFA 2VJOA 2OESA 1DZ3A 3OECA 3K6SB 1TQ2A 1T6NA 3CZPA 1HT0A 3N3AC 2P30A 3PPVA 2CXPA 2JLVA 4P4NA 5BYAA 3BMOA 2FTKE 3DXFA 1RCTE 1W5AA 3EZLA 2EWVA 3HM2A 3KXLA 8ADHA 5JJIA 3FA2A 1GO2A 5G4KB 2DMRA 5DYYA 1DCFA 1Q50A 3DAGA 3AWDA 2OGWA 2NUAB 1JN0A 2G6BA 2WTXA 4EI2A 2AOUA 5THQA 5CH8A 3HGQA 1OTXA 5CJPA 3EC1A 1DBVO 7MDHA 2XQFA 4V1CA 2PGLA 1B0PA 1P7VA 2BKAA 5IKXA 4QGAA 4YX9A 4O4LF 2JF0A 4DIMA 3WJAA 2WQZA 4KFTA 1PT6A 5GADl 3CO0S 3ZDBA 2C00A 5KVCA 3VGJA 3HCFA 3NM4A 1Z5OA 3OJOA 5B55A 1EUDB 1V16A 3KALA 2X3UA 2OQ2A 2R8PA 3AHEA 2OEPA 2C2WA 3TOVA 1QIMA 1GYRA 2V7XA 2DWQA 3AILA 1M2KA 4D74A 4LF7B 1EA5A 16PKA 1T4BA 2EYUA 3QG1A 1ZVVA 3UY4A 1K27A 3WYCA 4FB4A 2DPHA 1CP3A 3G89A 4DB2A 3LPAA 3QZUA 1BE0A 3D6NB 3EAFA 3BKWA 3KEFA 4IDBA 3D7RA 1KQNA 2WG1A 2Y1DA 4BP8A 2OFOA 1FX1A 3I9NA 4G4IA 4PLVA 2JLYA 1K4YA 3ZCRA 2RGAA 4TTIA 2WWYA 3K94A 2GRUA 2ZM6B 5HG0A 2CHGA 3GLUA 2NT4A 2O7VA 2I8LA 4I8IA 4DQ0A 2G63A 3M81A 4ACAA 5JSFA 4ZKDA 3I8XA 1M67A 1MEJA 3F4BA 3JD0A 2QRQA 4N0MA 4P82A 4QJBA 5ALWA 5FA8A 3ZD6A 5HYVA 3FLMA 5K0NA 5K0BA 2BMJA 1PT7A 4R1PA 2VK1A 1QCDA 1U81A 2PVPA 1YWGO 2BM0A 4JUFA 5SZKB 3E3LA 8ATCA 1YUNA 2RDMA 3CX7A 4HRYA 1MX1A 1OWLA 3QMMA 2DFLA 1T0HB 1D0IA 4MWGA 4XPZA 3GPLA 3PT5A 2JCYA 3U56A 1A8IA 1RXWA 1V8BA 2VVTA 2A6PA 2PSHA 2Y4OA 1RM5A 1PWYE 3WY9A 3H65A 3OO0A 2LUOA 4WBXC 4RD6A 1DJOA 1S3SA 1P1IA 3LDGA 4AY5A 1E94E 4DGSA 3OLWA 1E8NA 1JE1A 2O05A 1VLLA 1E2GA 1U4NA 1WCYA 1USWA 2CLEB 3PR1A 5LP6C 5KO2A 3OQOA 2IA5A 1I9GA 5JJKA 2P0EA 1Z0DA 1KMMA 1EFVB 1GYQA 5FULA 3GZNA 4IKPA 1KNQA 5K0FA 4OQPA 3L2OB 3KV3O 3PNKA 4HGYA 4EPTA 1QIEA 1TIBA 2X4DA 1YACA 4HH1A 3RS8A 1DIAA 1B4DA 4CG1A 1Z4LA 3VR2D 1C5KA 4C21A 3L0YA 4DOMA 2VDMB 1UJ5A 1C9DB 4GMKA 5ALZA 1GLVA 4I50B 4O4HA 4JA0A 2FX2A 4PVDA 2AMYA 4DC1A 4YUZA 1OIWA 4U0KA 3A1DA 4BGDA 3TQRA 1LV7A 1NULA 1MX3A 4PGHA 4CWAA 4JWTA 1J1IA 3SIWA 3UV3A 5I4KA 2AWOA 1A5BB 2DQKA 3NHZA 4LGMA 2QSYA 5ALGA 3PR3A 2E55A 2CNWD 1HLPA 2F1JA 3JY6A 3ZW9A 5JXHA 1SC4A 2CJPA 3CPJB 2O1WA 4C20A 1N9GB 2X23A 1T2EA 4NZOA 3RREA 4LJ6A 4Q3EA 1OA1A 2NXCA 1JXMA 3E3MA 1PJCA 3OPMA 3K9CA 4Y2GA 2VKTA 3MAAC 1AUPA 1JZQA 1P81A 3RJ5A 2P79A 3B7PA 1Z45A 4WGFA 3TZBA 3HKEA 3I1YA 4NABA 2FE4A 2REQB 4MICA 1G8JA 1EZ1A 1PZHA 1UBGA 3AFGA 1RYBA 3MWLA 4E4YA 1XQ1A 3SEFA 4HXYA 1W2HA 2XUFA 1MLDA 1ODCA 4U5XA 1RP1A 4ZVLA 2V74B 4E1BA 3DE5X 5KNCH 1XNQB 1NJSA 1IB6A 4ZRMA 2KB0A 3KHTA 3BGWA 1AHIA 4OJNA 1SNYA 1CDDA 1QG2A 4NBTA 3IV7A 2NXNA 3QTLA 4CI9A 1JQLB 5GGYA 3EHEA 2P6NA 4MB0A 3V8EA 1JU4A 1RCFA 3SEAA 1GWNA 4GLLA 4M1SA 3CNEA 3JQ8B 3VC7A 4C2AA 4C76A 3WLMA 4UNSA 1DDIA 3S6JA 4R5MA 1SC3A 1NPTO 4Q7MB 5E6UB 5LZ2A 1CUFA 2E1PA 4GG1A 3WIBA 1REQA 1UJBA 2FGKA 4DCJA 1TNDA 4LECA 2PG3A 5JH7A 1U5BA 5HKAA 4R9UC 3FSGD 4OI1A 1KFEB 4XWGA 3VOBA 1UT5A 2AEFA 1J00A 4OX9Y 3D8SA 4J1TA 3WO1A 1N7HA 3HXMA 2A8YA 1ORDA 3E7FA 3LKVA 4K3VA 4MI9A 4TTVA 4UATA 4GKAA 4WXPA 5EMJA 4J7UA 5IEBA 1D2GA 4TS3A 2RBKA 3CVJA 1N4AA 1S01A 4UCQA 4R98A 221PA 2WB4A 3I8SA 1RABA 2CN1A 4JP8A 4Q34A 2I5PO 3MQ4A 1OIVA 4ENQA 2FY8A 1XTRA 3I9V1 3UVEA 4F3TA 1E64A 3BYZA 1N3BA 2G9NA 1LBSA 1M0TA 2CLLB 1NVMB 1ZXXA 3HUUA 3VH1A 1FE8A 3ZWOA 4PC2A 4JX9A 3OZWA 1TZJA 1S2OA 4XR4A 1KO1A 1KI7A 5KQPA 4BFXA 1BDHA 2BM8A 1DELA 1U4SA 1KZYC 4RGYA 3T3EA 1QX4A 1RKUA 2QN9A 4BU0A 4D98A 1M74A 3WYAA 2X1LA 4MARA 1N6RA 4ZZIA 2EL7A 9GPBA 1GA4A 1ADFA 3WYNA 3DR3A 4BVJA 4WVLA 4FMDB 4HGQA 1VHDA 3GJXC 1SU4A 3F90A 5AK5A 1U3GA 2VQSA 1E5LA 5CT5A 2LV8A 4QBHA 3UMCA 1PSZA 1O89A 3BCRA 5G1PA 5I01A 4II3A 5FFNA 2ZE8A 2NZWA 3VTKA 4EITA 2IY8A 3CRW1 3OM0A 1CERA 3QVSA 3ANYB 4BNUA 2G5TA 3ABRB 3D7MA 3OQBA 1YHYA 2PLWA 3KO8A 3QYJA 4RENA 1MC1A 3PRHA 4MCHA 2C7PA 1IY0A 2QRKA 3DEAA 4KYUA 4JLWA 2EQBA 1FP2A 1T1RA 5DWVA 3TTYA 4QDTA 2KMLA 4BNFA 1XA3A 2QTRA 1CNEA 1E7RA 2GVZC 4DZRA 4PZ9A 1JQ3A 3HB7A 4B43A 4WSOA 1LLFA 1UADA 1M33A 3ZDQA 4H1TA 2OORC 3PSHA 4X61A 5GOTA 3T4EA 3KXDA 3PDJA 1QHHB 1VBNA 2RB4A 5DP2A 2PQ0A 4EJ2A 3TG2A 3D4LA 1ARZA 3NUZA 1YI0A 1WXEA 2HIAA 3ESDA 2YQ4A 2C0CA 4J0HA 2NU9A 1N36B 4M55A 5EPUA 5ELLA 2FP4B 2HY7A 4QHYA 3G2LA 2EJBA 1QO7A 4PYRA 2OZVA 3H7IA 4MRRA 3TNJA 4AF7A 4DNOA 1QFYA 3DXXA 1SIWA 2GEUA 4NXMB 2G0NA 1MW8X 4WNAA 1E9EA 1A5ZA 5G4LA 3DBOB 3G5AA 1U8YA 3GFRA 4GAEA 3RDPA 3K2BA 4CL3A 2QORA 1Y9JA 4YP7A 4IUBS 3OESA 1NQUA 1OXUA 3MTJA 5SY9A 4ZAYA 2QD3A 2Y1XA 2EXXA 3KRTA 1H1LA 3PHCA 4FZVA 5K3FB 2GILA 3SICE 4CF3A 4E51A 4D9IA 3BWBA 4JGBA 3S8EA 1IHDA 4DV2B 3N5CA 4NL4H 3SG0A 1ZM4A 3A9VA 4AG3A 4E11A 1THTA 1E7MA 4RO0A 3RFUA 3D4IA 5GOZA 2LDXA 5H9WA 2AVDA 2HPHA 3LZDA 3R5FA 2IYWA 3PF8A 3HH8A 4BV3A 2WJZB 4DIEA 3F5MA 4XD2A 4BYMA 4OHCA 4KXXA 3DWIA 2C7GA 1L7EA 3BB3A 2FZVA 3GVCA 4EWLA 5LLTA 5F3RA 1JHXA 3OZRA 4TMFA 2WNHA 4FSHA 4RYDA 1GG8A 4O4IA 5DYIA 5EZYB 4WOJA 2J67A 4LV6A 4Y6SA 2R751 4H7JA 5IBQA 4WK6A 1VLZA 2QKYA 3WNQA 3ZJ4A 5EP4A 1TVKA 1CEEA 2H9YA 3P71T 4D9JA 1AA6A 3O1HB 1PT8A 4B79A 3T38A 1AV6A 4ED9A 1BAPA 2CUNA 2YYSA 3M6IA 5CFQA 3D1JA 2NAFA 4AMYA 1UH5A 4HBZA 1YBMA 4UEJA 3S8YA 3DEYX 3L84A 5CDHA 2CMKA 2WUWE 3KWJA 3IMFA 1EDEA 5L40A 1G41A 3RVSA 4LDQA 1XI2A 2OWDA 4KFRA 3V4PB 3FDXA 3DCJA 1Z0ZA 2WMOB 2ZVQX 2VXYA 2PGXA 2XE6A 3FFXA 1F9EA 2Y6UA 3ESYA 3GLKA 3AI2A 1WXQA 3HSYA 5EE5B 3SGLA 3SYKA 2FRVA 1IOLA 1Q1EA 4TV8A 1RZ3A 3IAM6 4ZVUA 2OWEA 5JZSA 1XALA 1Y80A 5GJBA 1UP7A 3RNLA 4ND6A 3MFQA 1KEWA 4I6JA 1JAXA 4YALA 4IV8A 2FR1A 1C9YA 3KD2A 1QH9A 1LB1B 4KNWA 1EJBA 4Q9LA 5K3EA 1S1CA 3H42B 4GEKA 4QBGB 1KDOA 3LUPA 1ZGZA 4ZOAA 4WZAA 3KS9A 3P9KA 4EY6A 1A71A 2IXEA 4WAUA 2HA3A 4LNHA 6Q21A 5IM4F 2H0AA 4OHXA 5DNDA 2LTAA 4RTNA 4ZCIA 4F8YA 5B5SA 3IBSA 4YN3A 4XYMA 4W5QA 2CF5A 2G04A 2NU7A 2OV3A 2C7RA 4MHTA 1Q1BA 1RYFA 4DCVA 2HOQA 1FFYA 2NT3A 1J0DA 4JLDA 4DQXA 3AF4A 2I3GA 1MB4A 4RV5A 2LGJA 1DQNA 1MIOB 2E4UA 4YUWA 2FJ0A 4F4UA 1ULAA 3LF2A 1R5NA 1VIMA 1YFKA 4UMEA 3GLFB 1EGHA 1H5NA 1P2BA 2D3WA 4P31A 2J09A 3P2YA 4JYCA 1I5RA 2B34A 4R05A 4RU1A 1FLAA 2XNDD 1PEAA 1ZN7A 4K6MA 3D02A 3LHIA 4FB5A 2FX3A 4Z7OB 5IYZB 5LDDC 2GERA 3R7WA 3TEMA 3QQPA 2P2YA 4R1SA 1PAUA 1GKYA 1SHZA 2PGNA 1X94A 3AVYA 4M1MA 1PFWA 1ZUNA 3B2QA 1C1DB 3QUAA 3ZC3A 1VHTA 3GN2A 1QHYA 2BF4A 3HDTA 3IB6A 4AYTA 1UJCA 1SBNE 1ZH6A 3CZ9A 4FCVA 4MQ4A 4NAVA 3SHQA 2KLBA 4OHWA 1J2RA 1LX6A 1APBA 4TYPA 4YNBA 2Q5HA 4EOGA 3I30X 5BVHA 4K9QA 1E4EB 5FL7A 4URWR 1TMKA 1Z4MA 3PPYA 4CJXA 5LVAA 3CXUA 1XCJA 2XUIA 3C3DA 3KT6A 4IHKA 4GPAA 5WRFA 3WGHA 2V98A 1LW7A 2WPNA 3ZIUA 2O20A 3AEYA 1JILA 2I2BA 4L7VA 4NOLA 4ZHQF 2X7HA 3DMRA 2AI1A 3T7RA 4ZZ2A 4KH0A 5LQCA 1OZ0A 2WT4A 3D4PA 3K0BA 4G0YA 1N78A 3A1CA 1XHEA 3RAGA 1FXWA 2O2XA 1N5MA 3W9SA 3JQ7B 1RLJA 5EIXA 4R2KA 5ICCA 2D06A 5FA5A 4UTNA 2A58A 5JY1A 2ZRGA 2GK4A 3L5OA 4UBIA 3RAPR 3NV9A 4QDZA 5LP1A 3NHJA 2QM8A 4XWAA 5BSTA 4ZYYA 5KYXA 1CS0A 1NN5A 3DF7A 3RVMA 2I55A 1QZ3A 5HK9A 2GDZA 3IIEA 1YCHA 3LCCA 5BO5A 4DC9A 4BQIA 5TE9A 1V11B 2ECOA 2Y27A 1VYTA 5DNUA 1ZCFA 3RRYA 3KYJB 1MH9A 2ZSEA 2VJCA 3EF0A 2F9LA 2PMEA 3W2HA 3C16C 4H35A 3FPGA 2COEA 1NR7A 3DFKA 3M33A 1F0YA 4OL0A 3SU8A 4E14A 4JI4B 5J2TF 4Z4FA 1BXGA 2XNSA 1JWAB 1OXXK 1SU6A 2BUBA 2QTVA 3K0FA 3X43A 5DNCA 3A3KA 4Q47A 3JQ6A 1UC8A 4FINA 2R8RA 3MS7A 4CDRA 1ZC4A 1M0WA 3RSSA 5K99A 3UC5A 1GAEO 1AQYA 4C4PA 4WERA 2NQ8A 2IX3A 4L6CA 2C2OA 3BZUA 4EJSC 5BRAA 2AMJA 1V8DA 2Y1EA 4NR0A 4TS4A 2FZCA 2QL7A 1XK7A 1XTJA 5JSQA 1VKJA 1CNFA 1XKTA 4L6IA 1Y63A 3IVRA 3JPWA 4UUAA 4XB2A 4NENB 3U7QA 4R54A 5COQA 2Q99A 4D57A 5JAHA 1L7BA 4M0MA 1KMCA 4WXRA 3LDUA 2LE0A 1Q6ZA 3LY5A 1CUSA 2NUPB 2DP4E 4HRAA 3UK7A 3EG9A 3ESZA 3KHSA 3RG8A 4KV7A 3WLFA 3GJTA 3PXUA 4NMHA 3B1KA 5IUNC 1SQFA 2CLDX 1S1MA 1YFZA 2WU0A 3K1TA 1ISPA 3GJQA 3O8LA 3REGA 3ZCSA 4X91A 1CULC 3FY4A 1C1HA 2ID7A 1US8A 3ANTA 4NCAA 4OL9A 2XA9A 3H05A 1KQGA 4QGBA 4NH0A 3FRIA 1DEAA 2CYBA 1XPRA 3SC2A 1Z74A 1Q1AA 1YS4A 2JJQA 2PBZA 4OXNA 3BSSA 3WGMA 3E15A 1UKBA 4ZMBA 2HA0A 5ETJA 5HJEA 1BE1A 1TTPB 2ZJ4A 1ES9A 2XF2A 5GONA 3BB4A 3ICCA 1E7SA 5JFGA 3ZI4A 4WHMA 6AT1A 3GLIA 4I19A 1EMDA 3RWOA 3B1WA 3IDQA 3AV3A 1S2MA 1X74A 5LXTA 4IZOA 2ZM5A 5I7AA 1IQUA 3WGZA 4F8JA 1NVBA 1VGQA 3WR5A 4KVAA 3MAGA 4KDRA 2Z30A 3PE6A 1O95C 4KQKA 5ICEA 3QKUA 4ZZ3A 1X1TA 3I2FA 3VHRA 3KQNA 3QLVA 4JC8A 2PV7A 5BN5B 2ZDHA 3Q4GA 1ABFA 2IT1A 5K8JB 3TTXA 2R6JA 5AHXA 5KAMA 1SZCA 3LT5A 2AF3C 3GUCA 2P4HX 3OPQA 3AHGA 4MGHA 5KJ1A 1DAFA 3EVDA 1OWOA 1Z6ZA 1Z2EA 4JJFA 1QK3A 1X14A 5HBGA 3RUDA 3KKKA 3VTAA 4HNUA 4B0OA 2F1RA 3PGA1 4HZGA 1KVRA 1C7QA 1XZQA 2P2CA 3QPDA 5LCXA 4XUDA 2HIMA 3T3OA 3OBBA 4P4UA 3QKRA 1YDMA 4M49A 4NV3A 2B8NA 4HY3A 2NSYA 1XMQB 2AFRA 2ZYRA 1C8KA 3QVTA 1WXFA 1ATZA 1JA0A 5LBUA 4DG8A 3O3NB 4M86A 4IH1A 1TAHA 3T7CA 2GJ8A 3QU9A 1QIKA 4LJYA 3AW9A 5EUQB 1OT5A 4EHAA 1O5IA 1YZLA 4JELA 1L5NA 2AUTA 3SDSA 3A3YA 4KL8S 4LRTB 1ZQ1A 4Z0NA 1IHUA 1RR6A 2B94A 2Z0MA 3K5WA 3RRMA 1ZP6A 3BMNB 4U7HA 1Q14A 3F5DA 1NZFA 1MB0A 2C5LA 3OMXA 1QO0D 3KPJA 3ND8A 3CC8A 4GLOA 1WHTB 4HP8A 4RY0A 1XIVA 3D1LA 3OVMA 4KXYA 2P90A 4LV5B 3RFTA 3VQTA 5DM60 4D8UA 4D9GA 3TX2A 1E6WA 4L02A 1JDBC 3PG5A 1BZYA 5H9VA 1YASA 2O2SA 5HIAA 3N2GB 1GKUB 2VATA 3KE8A 5FH9A 3EIQA 1M83A 2WJAA 5JALA 1JYFA 4EMBA 5KKCA 3QY0A 1FP4A 4RVNA 4Y9TA 3ZVRA 2CK3A 2ZXEA 3I9OA 4FN5A 1PR4A 5F7XA 2QJWA 4DB4A 1BU5A 4FGWA 4EJFA 1P9OA 2QZ9A 4KQ6A 4OBWA 3CJTA 4MR9B 2AA3A 2K6GA 2D62A 2G70A 2WKSA 4OKIA 4MQEA 1GPH1 3R74A 5DEOA 5EMHA 3VO9A 1M72A 1C9NA 3QUSA 3O9ZA 4PFKA 2ISSD 3FDJA 1RACA 1USKA 4AJKA 1JBQA 1W0KA 3U1VA 4YMGA 3U3ZA 5AUNB 2CL6X 2FEKA 3NCTA 4NBKA 5JATA 2H6EA 3NT4A 3RROA 2B99A 4XDZA 4NPCA 3JARA 3VX3A 2J5KA 4U8HA 2F3TA 1XU9A 3A06A 1UBEA 1HH4A 2OQRA 4CEJB 4ND5A 4R0NA 1P62B 4RA9A 2Z56A 2YYYA 5KMGA 1Y3FE 1C1XA 1LQ2A 1C30A 1M6VA 2YC2C 1YOBA 3L0PA 3R0JA 4BS9A 2PUCA 1XZFA 3WL5A 4OBBA 2R4QA 4ZO7A 5CBPA 1I3NA 4IDHA 1V5IA 2PZBA 1ANKA 4MW2A 1OPRA 4OG2A 3SOZA 5A4JA 1LY1A 2OZLA 3LX8A 3OZGA 1AN0A 5DCYA 5IJ0A 1Z0AA 2R4UA 4W1QA 1NR1A 4DNPA 3ADOA 3RASA 5A5FA 3DHYA 3Q6IA 1UZUA 4GR9A 4EPWA 3NVAA 4GPEA 2XUHA 3GJRA 4GZ5A 1M8GA 4M8IA 2ACWA 3NIWA 2F43B 2XITA 3HA5A 3K6KA 2WZCA 1WA5A 4LKRA 2EKQA 1BO6A 2V8OA 3E9RA 2ANCA 3OTHA 4GGMX 2ZBRA 4MGKR 3SSMA 1G4AE 1I13A 4YR9A 4E5VA 3I92A 1RC8A 1NVFA 3W5AA 4RV9A 3IIJA 3SF0A 2V7BA 4YJ3B 4QE3A 2C98A 3PF9A 2JJ2D 4R2LA 5EESA 1VE3A 1YRBA 3OCWA 2EHJA 4RBNA 3ZVNA 3IQXA 5HKLA 4OAOA 1JHDA 1XTQA 1CZRA 2ZUCA 3NH6A 5DHAA 5K3AA 4D4LA 5DIFA 4M8KA 4U6QA 4FZ3A 3QEMB 5GV7A 1JFRA 1H2RS 1J49A 2FUG6 3Q7PA 5J1SB 3OEED 1DBPA 1X1CA 4JYPA 3MCWA 4KAFA 3W7BA 2V96A 1NBMD 1K6IA 2A5FA 1M5RA 1MV8A 1P31A 1QXSA 4HPXB 3LUBA 2B4QA 2A94A 3AB3A 3CUKA 4FFDA 1L4BA 3BEOA 4LWPA 4EUKA 2CB9A 1V26A 4ZCMA 5MN6A 2DC1A 4NYJQ 2H5JA 2HMTA 2AI3A 3VR0A 1T8PA 2B6NA 3EXAA 5CRIA 3SJBA 4FS8A 3VR6A 5ANRB 3RNOA 5G0WA 3BXFA 1GGNA 5LZ4A 1J07A 3DT8A 2G8NA 4UHBA 2MSDB 5EIOA 1BA2A 3VAAA 2IELA 4AKEA 1N5RA 1XMSA 3HPRA 5B6JA 4LHZA 4LOLA 3D4BA 1E2NA 1IHPA 2R7NA 2ZBFA 4D6PA 5B4TA 2A0WA 3LUAA 4YMIA 3KB1A 3ICWA 5JS7A 1WPRA 3DCNA 2DTEA 4DJFC 5TMEA 1NPDA 2HHCA 4ND1A 1F6DA 2ZRQA 4NCIA 4RS4A 3CVUA 2FUEA 2R87A 3N2NA 4QYXA 1EB9A 4EPXA 4N5NA 2XUOA 4UKDA 5ALIA 2OXTA 1E96A 2H48A 4PY2A 4H7KA 5J5AA 1ONOA 1V6CA 3MBOA 4C87A 5M29A 4KI7A 4R31A 4TYNA 1D2CA 4DQKA 3FMOB 2XIQA 3M4ZA 4KYTA 1AJEA 2D1RA 2CJXA 1AS0A 2MOKA 3AVQA 1AGPA 3BXOA 4MQBA 1UK9A 5AM3A 1BXRB 5BR8B 5ARBA 1DL5A 1V2GA 3DBVO 1E2UA 4PSKA 1H8HD 3M4NA 2PKWA 5H81A 4DPMA 1JNYA 4KMOA 1LC0A 4J2OA 4DMFA 4C3ZA 2PU5A 2ZROA 2CNKA 1G7SA 4Q7LA 4L07A 4XIYA 4ITUA 1QUFA 2TMKA 1FYDA 2VUHB 4IDDA 4PONA 3QFTA 4KGVA 4I1IA 4I6EA 3ETEA 4PCLA 5B4UA 5BVGB 4GMDA 1EDBA 4MB2A 1A9ZA 3IA2A 4DCGA 3LBNA 3T4PA 3JW8A 1HX7A 1HDCA 4ECAA 3PL1A 4IG9A 3SZOA 2H3EA 1PNQA 3K3PA 4U7FA 2V0CA 4MKIA 5AW4A 4KE9A 5A04A 1WNTA 1RHJA 2VTDA 2HHJA 2FRDC 2XVMA 3KTAA 3ANSA 2ZDGA 2FR8A 1YF3A 3U6KA 2V7TA 4M2LA 2B1RA 1MP0A 2GF0A 5LQMA 3EVTA 1R0XA 4JQOA 4KXVA 2BEJA 3X1YA 2C9DA 4BNLA 1UKZA 1YZ3A 3IVGA 1M5TA 2CMDA 2HCJB 4QTZA 3KDAA 4L3WA 5I8ZA 4TSRA 1VLVA 4NPAA 1ZIPA 4QQNA 5JLAA 3FTCA 3ZKAA 5JXIA 2I7CA 2ORVA 1ZN8A 2Z4TA 2M1XA 1FW6A 1TTHA 4YQYA 4ZREA 1T4CB 3IDSA 2W2OA 2V5UA 2OSVA 2GPAA 3DF9A 4HYTA 3N2LA 2IE8A 4UBNA 2CLSA 2Q28A 3ZJTA 4RJIA 2PUJA 1YHZA 1F2UA 2CDCA 3L01A 4KUEA 3O3CA 3CMMA 4FEAA 4MRMB 3KG2A 4BFSA 5L3SA 5EPEA 4N3NA 1N0VC 2GK6A 1XDBA 2YXDA 3BRCA 3I4CA 2AHRA 1QRAA 2D0IA 1PR9A 2O0JA 3KB6A 1ONPA 4AWAA 3WMEA 1E0JA 1SQSA 2XWSA 5JD5A 3KPYA 4I1SA 3HWWA 4PAGA 4MEJA 1NC3A 5EUCA 3ONFA 4KN5A 1ZO8A 4XKJA 4D9HA 3CR7A 4MYCA 1BHQ1 1DG9A 4BAZA 1PG0A 5L7WA 3DT6A 2X42A 3ZE7A 2BEVB 3OJLA 1ITZA 3SBEA 3VNSA 5JMPA 3S40A 4D81A 5I45A 2CXNA 4FBMA 2HU5A 2VXOA 4NJOA 1FK8A 3PLAE 4DEYA 2VH5R 5L4LA 1XFDA 5IKOA 1HE2A 1ZU5A 3D8BA 3H9CA 1GIAA 4XJTA 4DNFA 4RTRA 4YRNA 5IN4A 1EI9A 4O4JA 2RBEA 1NLUA 3HA7A 5JEEA 1V41E 3HJBA 4LJSA 4OHZA 1SWVA 5AXDA 1W4RA 5G0VA 2E6KA 3DEFA 4BYGA 5I4IA 5I7EA 5EC8A 1V25A 3IBYA 2BIFA 2H16A 2VZ0A 2BY4A 1QZTA 4KOAA 4OEHA 4WKPA 3RBVA 4DKXA 1K63A 4ZZ1A 5ICMA 3I23A 1OA0A 4QXQA 5CHEA 3EWSA 4F7DA 1NP3A 4X60A 4XGNA 3K0AB 3LKZA 1PRYA 1P74A 3ZZNA 1UZMA 2ZRCA 4BPRA 3FDFA 2O57A 4S1PA 4MGZR 3ROXA 1QV6A 4BVKA 2IF2A 5D84A 4DTIA 3DTTA 4BO9A 5H7XA 4B47A 3AEUA 4IEFB 7REQB 3NTUA 1Z06A 4GQAA 1GTVA 1EVJA 5DXFA 4AKGA 3DTVA 2QJFA 1ISIA 5JXWA 2IZ5A 3CTPA 4YRIA 4CEIA 2VWQA 2AG6A 4TXLA 1UBFA 3HLYA 4IDCA 1V35A 4AUMA 3GEGA 2XLCA 3OKFA 1V5EA 3TDKA 3HNOA 5B3KA 1ADJA 2K5UA 3GMIA 2D6FA 2VNIA 3M6VA 4QL3A 3AF0A 1NVDA 1ESMA 5T4BA 3VJRA 5CLGA 3U37A 2VP6A 1CRLA 3CH6A 4AS3A 3PD7A 5D5PA 5LMNB 5JFOA 3AX6A 3LL7A 4BEVA 2WHXA 1D1QA 4YQZA 3IUMA 3M6AA 5FWYA 1G3QA 2P0AA 4K05A 4JQSA 2VJLA 3ONNA 3VR1A 1W85A 5IC5A 4DGQA 4X66B 3L46A 3FGNA 1NOKA 1M34E 3F3MA 5B1HA 5AQ1A 1WSWA 4MIKA 3I2JA 4O4HF 4HZIA 2DPLA 1Z0SA 1NW7A 2M9MA 4US1R 3GCXA 2DH5A 5F2OA 2DBZA 3H1PA 3I3SR 3ZGZA 1NP7A 2WC1A 2UDPA 4PV7A 4I1PA 3NCHA 1ZDMA 2I6FA 4EYQA 4CE6A 2WYOA 3OQNA 2Z1DA 1FTNA 2ZAMA 3B9PA 5EIFA 3VPCA 3ACBA 2EVWX 5G3YA 5E8RA 2YX1A 3Q88A 4KUHA 1OH5A 4RULA 3GLTA 2FFJA 2FWRA 4UBMA 5AW3A 1J8MF 2YOFA 2VTKA 1XXHB 5FR1A 3EXHC 1T6ZA 2C83A 4Q82A 3N0XA 4KO4S 3V6MA 4A6EA 1VBFA 1VECA 1D4AA 4QYTA 1MHPA 1QJ4A 4ZOLB 2GPYA 3PPXA 3R4VA 3NZEA 1UBUS 3HKCA 5AQEA 1NXSA 3OLZA 4KR2A 3ASVA 5IW8A 1E69A 3TTSA 5K6RA 1ZSNA 3BGOS 4AZ3B 4BE9A 1E9DA 3BD8A 1N2CB 3U16A 2FFHA 2WOJA 2WHEA 5LMUB 1EINA 1OWMA 3AETA 3M1IA 3OKPA 1QUEA 3BGSA 3AEQB 2H0RA 1UP6A 4DSNA 2D5CA 3HB0A 4HNRA 1M1ZA 5AESA 3RJMA 3TGWA 1VCHA 2C8JA 3EULA 1HO3A 2HSJA 4JLSA 5H80A 1IMJA 1WWKA 2HEIA 3FLBA 3BE6A 3S2GA 5INTA 3K70D 2P11A 5I9SA 1UC4B 2OPBA 2WHYA 3B89A 4Y0VA 5EZQA 3MPOA 3ZE9A 1S9HA 2BFWA 3F2VA 2Q46A 1CVIA 3F46A 2GRAA 1N0WA 2FFRA 1EU1A 3HBNA 1CJVC 5FTNA 1ILWA 1D0VA 5TEVA 5KWEA 3PQ5A 4A26A 3MW8A 1HY3A 5CD1A 5ILGA 1TIPA 1LI4A 1DXYA 2FSSA 3CNHA 1JQJC 5JH7F 1TIKA 3WGTA 1SKUA 1ZGCA 1XAJA 3GFFA 5K8LA 4DLKA 4P3XA 1UP4A 3EVCA 4TV9A 2GKSA 1WMDA 2BH2A 3IPCA 1SG0A 2PGIA 3SS8A 1G5QA 2QR2A 1NQTA 1D6MA 1TECE 2W2VA 1M1YA 1GPJA 1VCIA 1XDSA 3FZYA 3OZAA 5LQRA 2ZTVA 3HWRA 5B1YA 5CUQA 1NT2A 2E4XA 1K7XB 2X6RA 2BCJQ 3D9QX 4WLUA 3HZZA 1IVSA 1K86A 1TMYA 2VZLA 4QDUA 1QHGA 1V48A 2FPLA 4ZVTA 5A9RA 4W82A 2C2GA 4JJ4A 1RWMA 3O8OB 3H4TA 2ADFA 3AB8A 4F46A 2VDWA 1Z2CA 2XSZA 3DTNA 3ORSA 4G2NA 5DK4A 1Y8QB 3T9FA 4B84A 3BHMA 3PGMA 1P8JA 3OZ7A 4JP3A 3CE6A 3RVKA 2AR0A 4ZEMA 3PQ2A 3ZVKA 4EB6B 1P3JA 3EOAI 4PIMA 1P4SA 1R8YA 1KI6A 1P2DA 2OB1A 3IBTA 3WGLA 4F56A 1ACLA 5K2OA 3IB3A 2P3OA 2PWYA 4IIFA 5G02A 3ZHXA 1U3VA 2QXTA 4V0OA 3OQPA 1BYUA 3G2MA 2Y99A 3QKIA 5EI5A 4X1OA 4A8JB 3PJRA 2YKGA 1OH7A 1H9BA 4E2XA 3DONA 1OAKA 1IZ9A 3KDSE 1C8VB 3TG8A 1K68A 1XROA 3VR6H 1PLKA 1R10A 4WCFC 3EQ9A 4EY3A 4YHBA 3PUHA 3C1OA 1FL9A 2R1UA 2JLWA 2JH8A 4U7GA 3NU1A 1M8FA 3GIWA 1B76A 5HK8A 3BUSA 1A8SA 1HQKA 3P7MA 4LZLA 2BVNA 2A1TR 3V4VB 2UZIR 1OXMA 1ICEA 3ESQA 4O4LB 2JVKA 3EQ2A 3VA7A 5JWOA 1IY1A 2VBGA 5HS6A 4B44A 4P2GA 4DHWA 1L5ZA 1M7GA 4LYEA 4ZDJA 1RE0A 1X7ZB 1ENOA 3I6MA 1E9CA 4PYQA 4QHTA 1D4FA 1W73A 2LNDA 3KJNA 1F2VA 3QE4A 4EUHA 3LLVA 3Q11A 5DTEA 1ZGBA 3B12A 1RYZA 3B5IA 3GUVA 3L0ZA 4D5EA 1G1AA 4IUCS 4BOYA 2ZZNA 3DNPA 5L8VA 1BCRA 3K30A 3IIIA 1G3RA 1WKVA 2LR0A 4XEUA 3MOIA 3UWKA 4R0MA 3D54D 1GNQA 4RCVA 5KOJB 2X5NA 2KM1A 2DT5A 1Z4KA 1M3SA 2R7AA 2XXBA 4YCAA 1QWSA 4FQ7A 2BGLA 2B37A 1Z6PA 4JI7B 2GZ2A 1N77A 1L8XA 3KQLA 5KCMA 1B14A 5DGDA 1XJWA 2GCIA 3NH9A 3HEBA 1NFRA 1H4QA 3ZDFA 4D8XA 1M6EX 1QPZA 1T26A 4MWBA 1BCSB 4M8SA 5AJXA 4QJ4A 1SULA 1YQEA 3ZDRA 4YXWD 2YZKA 4R7ZA 3MFYA 1P29A 4UVEA 2H4FA 1OLSB 3DULA 4FYKA 1EE9A 1I9CA 2B4AA 4CFYA 1ORIA 2WJWA 3DB2A 5BQPA 1A8QA 1B3BA 3T61A 1RRKA 1PV2A 4NYMQ 2OXFA 5EP2A 1XGKA 3SEZA 1JDSA 3EXIA 3Q41A 3N5KA 1FNMA 1DMRA 2JBHA 4YECA 4A5OA 3NAMA 4NE9A 1T3ZA 5LBTA 4UJ3A 2I4IA 3FTNA 1E1NA 2AFIA 1T5LA 1XCMA 2VT6A 2X1VA 5FB3A 5FLXA 1JQ5A 4O33A 4GM0A 1YB7A 3PKIA 3VYUB 5T8KC 1KR2A 2WNSA 1ECFA 1BVHA 3CLTD 4QBFA 2VHQA 2XMRA 3A1UA 1C41A 2PAAA 3AUJB 4TT3A 1JTFA 4EL5A 4DV1B 2QN8A 5TMPA 1A9PA 1T36B 1OAOC 4HF7A 2R1VB 2F3RA 2FZGA 2I3DA 2Q5CA 1P33A 3E9EA 4DLRA 1YKFA 5ENZA 1YJAA 1ORVA 3G2QA 5JD4A 5EJFA 1BHJA 2ZAIA 3ADBA 1NOIA 2W2TA 3UMFA 4ZK2A 1LLQA 2YC4C 4NU5A 4UTZA 3CE9A 2X0EA 2RCNA 2BHNA 3FGPA 2GAFA 4GLJA 1AIPA 4FONA 4TTSA 3A6FA 1FP1D 2ZQYA 3B1ZA 3M89A 5K03A 4UDOA 5A0VA 2Y2UA 1I4TD 2GZAA 1QX3A 4RZXA 2FPMA 4TKVB 2BR3A 2HRZA 4Y2UA 2EG5A 1FC0A 1EDDA 3RSLA 2YWXA