4E0BA

2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
311
structure length
305
Chain Sequence
NAMKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTHVSIKGYAGEDPTPALEGADVVLISAGVARADLFNVNAGIVKSLAERIAVVCPNACIGIITNPVNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAELKGQDPGEVRVPVIGGHSGVTILPLLSQVEGVEFSDEEIAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALVKALQGEEVIEYAYVEGNGEHASFFAQPVKLGKEGVEEILPYGELSDFEKAALDGMLETLNSDIQIGVDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase
publication title 2.17 Angstrom resolution crystal structure of malate dehydrogenase from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Oxidoreductase
total genus 104
structure length 305
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e0bA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4e0bA02
4CLHA 3VTFA 4IMPA 2Q46A 3E03A 1PS8A 5IN5A 4AJIA 4WLVA 2SCUA 3AY3A 3PI7A 2NVUB 1T26A 3O9ZA 3BA1A 3OBBA 2QX7A 3GZNB 1LDMA 3QIVA 2JL1A 5LCXA 1MXHA 5ENVA 1J0XO 1LDGA 2QZZA 4Z0PA 1GPJA 1GTMA 2V7PA 5C3MA 1B3BA 1YJQA 3PRJA 4GX0A 1DHTA 2O3RA 1I2BA 1PJ3A 1NQOA 5U1PA 2GSDA 2X0NA 3D3EA 2EKPA 1YOVA 1GYQA 3F4BA 5L95A 2VUUA 2BFAA 3GZ4A 4J7XA 3FWZA 2GLXA 2GN4A 3FBGA 1BW9A 4B7CA 1XCBA 4HXYA 3AUTA 4DGSA 4L4RA 4MVJE 2UUOA 4BQPA 1ZIDA 1SB9A 4IS2A 1GD1O 4NBVA 2PD6A 4AICA 3GEGA 5TJHA 3AU8A 5EN4A 4YRBA 1VPDA 1AXEA 4GMFA 3M1LA 3H9EO 5JC8A 2PKQO 3D4OA 2QHXA 4KP7A 4L76A 2DFDA 5DT9A 2O3JA 3D0OA 1ADCA 1DIHA 4TQGA 1PQWA 1R4NB 3GHHA 2DUWA 5DBFA 3TDKA 1WNTA 1SPXA 2XXBA 1LX6A 2BKAA 1TT7A 2R2GA 4IJWA 1PR9A 5COBA 1GZ6A 3WQQA 3ONEA 3PYLA 3NTRA 1UP6A 4BGVA 1I3KA 4YCAA 1T2CA 2X9VA 3KEOA 1YBVA 4AFNA 4UUOA 4J7CA 1I01A 1RPNA 3PYXA 1E3WA 4RF3A 3LU1A 4XYEA 2RHCA 4BS9A 1YL6A 3MTGA 5IZCA 1PZFA 4NBUA 5IN4A 5GY7A 5BSFA 1U8FO 3PWKA 1N92A 1YL7A 2B5WA 1HWYA 1RYEA 1UR5A 3WJAA 3K92A 1DLJA 1GCOA 4YVFA 3RU7A 1TLTA 3JQEA 3GQVA 2QIOA 3NJ4A 1M66A 3I9JA 1YWGO 1TXGA 3OJEA 3QVTA 4MKXA 3ZNOA 2OBYA 1LRKA 1PGQA 3NRCA 4JGBA 3KRTA 2RH4A 2AQKA 1NYTA 4PIVA 1Z75A 5EQDA 5JCJD 4OL9A 4JJGA 3JYOA 1MUUA 3KM0A 1ZK2A 4BB5A 5CEJA 3ZWPA 4FFPA 1PJTA 1LU9A 3A28A 4KWIA 4M49A 3TNLA 1K89A 5AXBA 3RUEA 3PJDA 1ZH8A 2WD7B 3GRPA 3ITKA 2V65A 3WFJA 3MCVA 5DDIP 5JSFA 4FDAA 4BKRA 2AEMA 2ZQYA 3GEDA 5IZCC 1L7EA 3TPCA 1YS4A 4WLFA 1HTBA 4K6FA 3G17A 4A0SA 1A5ZA 2R6JA 2WWRA 4Z3KA 3U5TA 1YB5A 3FNEA 1E3SA 4ID9A 5L53A 5FI3A 3K5PA 3P2OA 1LC0A 2C07A 4D3FA 1VL0A 4WNIA 3KV3O 1V9LA 4AG3A 4DIOA 2GZ1A 3GZNA 4O59O 4YJHB 3W8EA 5AQ1A 2Q1WA 1GUYA 3OMLA 2YHIB 3MTJA 4YJDA 2FPPA 3E9QA 4QXMA 4GX5A 4B3HA 4RPKA 2GDZA 5JC1A 3I9MA 3HN7A 1DBVO 3DXFA 4A10A 3WBBA 2Y1GA 4BNMA 4HFMA 1ENZA 4FD3A 1WDLA 2PZLA 1PZEA 2Y93A 2JD2A 2X0JA 4GGPA 2I5PO 5AXCA 2NQ8A 2GYYA 3D3WB 2QG4A 3GAFA 4QT0A 4XDZA 3WMXA 1ONPA 4R5HA 5A9TA 4B7XA 4J49A 1ZMOA 1EUDA 4ZU3A 5EINA 1YDWA 3ZU2A 3OA0A 3ZWMA 3OEYA 4FC7A 1GU7A 5JW6A 2ZYAA 3ZHXA 1M76A 2UAGA 2GR9A 4J1NA 3QVSA 2P4HX 1U3UA 3JQ7B 1HETA 2NUAA 3WGYA 3MEQA 2HRBA 2UDPA 3PLRA 4HY3A 3NT5A 4OSOA 1PGOA 3DAGA 2P9GA 3RCBA 1HDOA 4OOEA 1JDJA 4M86A 4GSLA 4CL3A 4I9UA 4XJSA 4CUJA 5A3JA 2A94A 4HFNA 3NKLA 3NEPX 4JIGA 5ILGA 2VNSA 5TF4A 4C7JA 4ZHSA 4QO7A 4RO0A 2WYUA 3RKUA 2DPGA 3RVDA 1R15A 3NAQA 4H7PA 3JQ9A 3FRJA 4BMVA 3HB4X 2PZKA 1GEEA 1QLHA 1CYDA 4GKBA 3FTPA 2DTDA 2E49A 4R4JA 4A5OA 3NYWA 4BNXA 3ROMA 3IOYA 3QLJA 7ADHA 3MJ4A 5CHEA 2AA3A 3OICA 3FN4A 5JCXA 3GRKA 2CF6A 2I76A 2G17A 5IDYA 3IIEA 4CQMB 5F5NA 1DIGA 3JQCA 4YAIA 5L7WA 2WEKA 2WJPA 3OJLA 3JD3A 5IDWA 1J49A 3PDJA 1NPTO 4I5FA 2GN9A 4WEOA 3KTDA 5B4TA 3ZNQA 3KUXA 2B69A 3U4DA 1T25A 1UXGA 4YPOA 5KJ6A 4O6VA 3CUKA 4ND2A 3UVEA 3JQ9C 3GGOA 4YQZA 2C54A 4MP6A 4R3WA 1PQPA 2WD7A 4DC0A 4F45A 3HNPA 3CIFA 2ILTA 4ZGWA 3GG2A 3BMQA 4KQWA 1FJHA 2DM6A 1DFHA 4EDFA 2O4CA 2BFOA 2D4AA 5I9MA 1B8VA 1XHLA 1P3DA 4Y6PA 3DDNA 3RKRA 3F1LA 2AXQA 5H81A 1SB8A 1U3TA 3SBOA 4HADA 4Q3NA 5T5QA 5AXAA 1HKUA 3MJSA 2O23A 3I3OA 4WNCA 3UAGA 2RH8A 3CKYA 2QRLA 4YJHA 3UGKA 4B79A 2JCXA 1UJMA 1EFLA 3U49A 2YHIA 2FZWA 3EYWA 3EC7A 2JJYA 3H8VA 3ZV6A 4A73A 3T7EA 1R0LA 2HK8A 4FJ2A 3HDHA 3D7LA 3SXPA 5DP2A 3WQRA 4WCFA 1PL6A 3WYCA 4DQVA 2FP4A 1DOHA 2Q4EA 4R3NA 1N7HA 3INTA 3JQAA 4YAEA 1VLLA 1Y8RB 5BNIA 1EVJA 2O3UA 4CMKA 2UV8A 4FS3A 3LT4A 4QSMA 4OYRA 1A9ZA 1I2ZA 5CP8A 3FBTA 1NBOA 2PLAA 4BNJA 4KWHA 1PQUA 1R37A 1UP4A 1KOLA 2J5RA 2ZKLA 4P4NA 1YL5A 2FSSA 3PIDA 5G2OA 4CM8B 4DLAA 4M8SA 3OFSA 4IM7A 3W4KA 4GX2A 2GN8A 4IY1A 3LC2O 4BO8A 4R51A 4RCVA 3ZWOA 1ZNQO 3UCXA 3QSGA 1LDBA 1GZ4A 2BGKA 2UVDA 1IUKA 1GL3A 4WLOA 4WCFC 4E5PA 2VRBA 3NT4A 2VYND 4PLWA 5DCYA 1FF9A 4PG7A 4FJ0A 2WMDA 1R66A 1YB1A 5IDXA 1E7YA 5L7YA 5BQFA 2GRAA 3BIOA 2Q50A 1PJQA 3UCEA 5KJFA 3EK2A 2GD1O 3KZVA 5B1YA 3SLKA 3HUDA 3WWZA 2AEFA 1QR6A 1YH3A 3GOHA 3VH1A 4K6CA 2CVOA 4FIZA 2Y99A 3RC1A 4LMPA 4J6FA 1W0CA 3Q2KA 4L4SA 4XIJA 1BGVA 3LDHA 5FF9A 4E5MA 3Q2IA 2P4QA 4AJOA 3FPCA 3WJ7A 4Z3DA 4E2YA 1P1JA 2OP1A 3HFGA 4Q9NA 3V2HA 1IZ9A 1U4OA 2EKLA 1P31A 5TNXA 1FXSA 3IP3A 1GZ3A 1GPDG 5DN9A 1DSSG 2Y0DA 5LC1A 4G65A 2Y66A 1B8PA 4JNKA 2EV9A 3CMMA 3NTQA 2ZB7A 1KERA 1E77A 2OZPA 2NU8A 2E6UX 4CV0A 3B70A 3PJFA 2J5QA 4CV2A 1LSJA 3OEWA 4OKNA 4R68A 3T4EA 3V5NA 3X2EA 2FPIA 3ZZNA 1M75A 4PLVA 4CMEA 5I9LA 3KLPX 2BELA 4M89A 1BMDA 2J3IA 1V3UA 5JDIA 3VHRA 2ZIZA 3DFZA 2UYYA 4NZ9A 1DJQA 1NAHA 1YXMA 5AYVA 2EGHA 1O89A 3D5TA 2ZQZA 4UUMA 3UCFA 2VRCA 1EE9A 4I9HA 4CL8A 3WS7A 2VZ8A 4UVDA 3PVZA 3W1VA 4FBGA 2AG5A 3ICPA 4IDFA 5JAIA 5HA5A 3FF4A 8ADHA 2W2LA 2JHGA 4I08A 4PLHA 1VE9A 4IJKA 1EVYA 1X15A 1FDSA 3K31A 3IMFA 1X1EA 2GERA 3ONFA 5FEUA 3OETA 4ALMA 2Q2QA 4UUPA 3BXXA 2X23A 4MINA 4IS3A 4CMEC 1OC2A 2PGLA 1HYHA 1VKOA 5TT0A 3I6QA 4HP8A 4OXNA 1ENYA 2X6TA 1EDZA 4RV9A 3I9LA 5JDIC 1NWHA 2ET6A 4IGEA 1ZFNA 4AJ4A 4PG6A 1DXYA 4EUFA 2G5CA 2B0JA 3ASUA 2C2YA 4MIOA 3HN2A 4YJGB 4N5LA 3FR8A 4WEQA 4CM8A 3ULKA 2OHXA 2CFCA 1RM3A 1NWCA 3PHHA 3FPLA 1E7SA 1PU2A 1XWFA 2FRDA 4EBFA 3OQ1A 3DFUA 1SNYA 4HWKA 4U6QA 3T7CA 1HZJA 1XQ6A 1G0NA 2D59A 4Y8VA 4CM7A 2HMVA 5L4LA 3PQFA 4ZN6A 2BMAA 4H3VA 3UOGA 4IINA 2I99A 4GQAA 3W6ZA 1GV0A 1NPYA 3ON5A 3LLSA 5KVSA 2IXAA 3S2FA 3PHJA 5H83A 5KIAA 1M6HA 3H3JA 4UEOA 4ZD6A 4WECA 1YE3A 1VSUA 4BO0A 5A5FA 3NUGA 5G0UA 4UVHA 4E2XA 2JCVA 3C7DB 1ARZA 3NDJA 1ID1A 1QORA 4O0LA 3A9WA 5A9SA 1QV7A 1U28A 1Y8QA 3OA2A 4TKLA 3WGGA 4LN1A 5A4DA 4A26A 3JCZA 2Q3EA 2O48X 1XA0A 1HSOA 1PJBA 4NU5A 2BGMA 4AJ2A 4CMIB 4EZBA 1PSDA 2VWQA 1YDEA 3I1JA 2HDHA 4UVEA 4GI2A 3GDGA 4WE3A 2DC1A 1U8XX 2X7HA 3KB6A 3H7AA 4R5MA 1AXGA 2NU6A 3RWBA 2BRUA 1J6UA 2P5YA 1T2AA 4XYGA 4WLNA 3E48A 2Q45A 3VVCA 3H6KA 4ITUA 3O8QB 1WPQA 1Q7BA 1WVGA 4XGNA 1Y5RA 4DUPA 3RIHA 5JY6A 5K6AA 2JHFA 2C5AA 5BNFA 5TT1A 4Q3AA 5IJZA 4L0QA 3ZWVA 3OHSX 5I9NA 1NFFA 5GZ3A 4R1TA 3BHJA 4GX1A 4LMRA 4XYBA 1I8TA 4XGIA 3FI9A 4FJ1A 4DA9A 1I3LA 2AE2A 4YT4A 1VRWA 3CEAA 1UXHA 4AJEA 1KC1A 1Q2XA 2FY8A 1ULSA 3IDSA 3VKUA 4YEDA 3LYLA 4NMHA 4MIYA 1OC4A 4BNIA 1YONA 3GPDG 3Q9UA 5HBRA 2P2SA 4R9RA 1JU9A 4YR9A 3OJ0A 2ZB4A 3I52A 3DHEA 4CQLA 1T24A 2EGGA 4CJXA 3WGOA 2W98A 4BGEA 4B8ZA 4BNTA 1X7DA 2YV2A 2B4TO 1ISJA 5K6AC 1V6AA 3LF1A 3PGJA 4QUKA 1ISFA 2PH3A 1NFRA 3WNQA 3WOHA 1NVMB 1BDMA 3AM5A 4BNZA 1P1FA 3R0IA 3P7MA 2FMUA 2FWMX 4GKVA 3E5RA 4YJGA 3GUYA 3HG7A 1E5QA 3ROQA 2YDYA 4IDGA 2AMFA 1C0KA 3DMTA 4L75A 4FFOA 2YV1A 3Q6IA 5ITVA 4NU6A 3LVFO 9LDBA 5JLAA 4BNLA 3CTMA 1QSGA 3HDQA 3S8MA 5F21A 4B8WA 4R16A 1PWXA 3EY4A 3L07A 2YQ4A 1PL8A 4BOYA 2P91A 4F3YA 1UP7A 3UICA 1K2WA 4ND5A 3PFWO 3RFVA 4NI5A 3KYCB 1NVTA 4WGGA 1I30A 4O1MA 3W8DA 1QYXA 4CMCA 1F12A 3IJRA 3K6JA 4WPGA 3VC7A 2CZCA 1CIVA 4YBZA 1OFGA 1U3VA 3GVXA 3DZKA 4LSMA 2G76A 4RQTA 1PJ2A 2WE8A 4RVGA 3GF4A 4LCEA 4XB1A 4J3FA 3I6IA 2O7SA 4R41A 3C1TA 2CNBA 3DMTC 2HUNA 1ULUA 4UVIA 3BHMA 1XGKA 1PJLA 4KDFA 5A9RA 1DB3A 4DBVO 1R16A 4XQGA 5BSEA 4W99A 3A06A 3VVBA 1WWKA 4CMIA 2Q2VA 4D45A 4PVDA 4WUVA 1EUZA 3UUWA 2VCYA 4BNWA 1U9JA 4PLZA 3HSKA 1P33A 4XR9A 3U4CA 4CR6A 4QO8A 4E5YA 5BR7A 4JLWA 1H5QA 4W9NA 1E7QA 1ZXLA 2X9NA 4BL5A 2A4KA 1B8UA 4FN4A 3ANMA 4EEXA 1NR7A 2GUGA 2P5UA 2V6MA 2WDZA 3ZH2A 3NGXA 1KVRA 1ZZEA 3MJTA 1H0KA 2BI7A 1V3VA 4IJUA 1IZ0A 2X86A 3QRWA 3O8QA 4JCOA 1UXJA 4MVJG 3KLMX 3TJRA 1E7WA 2Z1MA 3QW2A 4KUHA 4DRYA 4EITA 2BI8A 5DBGA 3WLEA 5BNTA 4JBHA 4FOOA 4E5NA 3ZWWA 1E5LA 5JYEA 4BKOA 1B7GO 4RZIA 4HUJA 5JO0A 2DFVA 1BRMA 2POQX 4DYDA 5JY1A 5MGBA 3FHLA 3PTZA 4YAGA 1OOEA 2EERA 5CFZA 3GVPA 1C1XB 3BMCB 4GLLA 3KETA 3S55A 4N7RA 1YQXA 4DLLA 1E3JA 3B1KA 1UAYA 4Y6SA 1N9GB 5IZ4A 2ZTLA 4NNJA 4NPCA 1EVZA 1XR3A 4MP3A 5KKAA 1X0VA 4BB6A 4PRLA 1P44A 3RUFA 4FFMA 1ZK0A 2Q99A 2X58A 2X0RA 3GGPA 1EZ4A 1GADO 2EP7A 3JQAD 2ZCUA 2HKIA 1LLQA 1KY5A 4TKMA 4PG4A 4WLUA 2OGUA 3QVWA 5HRUA 3D4PA 3AY7A 3U3XA 2XAAA 5IXYA 4J1SA 3S1LA 5HTOA 4FSHA 3V8BA 3P2YA 1EMDA 1W6UA 3MJCA 3IQDB 3IL2A 3ETEA 1H6CA 1G0OA 4CM1A 3STHA 3VH3A 4FPXA 1XSEA 4E5KA 4GVXA 1VKNA 2ZJ0A 3F1KA 1ZCJA 4IDDA 2UUPA 1HSZA 4R1NA 4R9SA 2ZTUA 1DLIA 4YT8A 2I65A 1S6YA 3H9GA 4RQUA 1VJTA 5BSHA 3BMOB 2PNFA 2JFHA 3RUCA 2RIRA 5DBIA 2FOIA 1CQIA 1EK6A 5JDCA 5JYDA 3K2EA 3JQ6A 2H6EA 3M2PA 3Q11A 1JLLA 3KYCA 4RLHA 1JA9A 4DREA 4BQRA 2JAPA 3DOJA 1Z82A 4NR0A 1JAXA 2DUUA 5L3ZA 1HYEA 9LDTA 2I3GA 3IKVA 5C5IA 4O63O 4WLEA 4B3IA 2F1KA 2NVUA 3ZWYA 2B37A 4I5DA 1CERA 2BFPA 3D5QA 4ZA2A 3GA0A 4D42A 4K26A 1XU9A 2W8ZA 4OXYA 2VWGA 4CUZA 1KVQA 3E1KA 4U5QA 2PZJA 5ICMA 4UUNA 1XLTA 3LC1O 3QVOA 4BO7A 2OXIA 1MXFA 1ZUD1 2B4RO 2EHDA 5CDGA 5THQA 3BTSA 3WFIA 1C3VA 2D2IA 5EQFA 5TRTA 5KCZA 4PGFA 4MIEA 2NV6A 3ZWAA 4BNHA 3WGHA 1QXSA 3A1NA 2I6TA 4KTTE 2E37A 2J3KA 1LDEA 3PHLA 1Y7TA 2JD0A 3TOXA 3JSAA 1D4FA 3GUCA 4EUHA 1PJ4A 4I8XA 1F8FA 5EJ2A 4RVDA 4K1LA 2IYOA 2Y1CA 4JBGA 4WCDA 2LDXA 2VTDA 4BV9A 1T2FA 5DOZA 1P9LA 2B36A 3ENNA 2G82A 2VYVA 2BFMA 3PDUA 3PQEA 4PRKA 3JQFA 1BDBA 4XR4A 3VZPA 1U7HA 1B14A 1V35A 4P22A 1R4NA 1DDOA 2RBEA 5JMWA 1WDMA 1C1XA 3H2ZA 3BMCA 3PHGA 2QYSA 2Y1DA 4YYZA 4BMNA 1GYPA 2W2LD 1ADBA 1T4DA 1NP3A 4UULA 3PPIA 1IPFA 3DC2A 4PVCA 4ESOA 3GDOA 3GFGA 1QYCA 3GH3A 1O95A 2OO5A 4J90A 4XQ9A 1Q0HA 2Q1TA 1Q0QA 2O3TA 5DOVA 4Q39A 1HE2A 4MKRA 5CG2A 1YKFA 1LLDA 3GVHA 1XYGA 3L6DA 3LT1A 1XU7A 2DBVO 1U5AA 1ZJYA 2LDBA 3B6ZA 5T6BA 4BO2A 4CLRB 1P1IA 2PKQP 4CM3A 3VOSA 2DVMA 2FR8A 2FPGA 3BYZA 2WYWA 4A27A 4IGFA 1O8CA 3UH1A 3JQFC 3CH6A 3CZRA 3DZBA 1XQ1A 5TX7A 3RQSA 4BKPA 1UAGA 2B35A 1DHRA 2J3JA 1I0ZA 3QWHA 5DF1A 3GN2A 2X8LA 2IZ1A 3ZHZA 2O2YA 5ER6A 1PTJA 5ENDA 1V3TA 4TVOA 4J91A 1LEHA 1U3WA 1X0XA 3E9MA 1CEQA 4K9DA 1UXKA 4TRNA 3CMCO 1ZSNA 5LDHA 1E1MA 1T2EA 2NM0A 3QV1A 2F00A 5TQVA 2OOSA 2D3TA 1ISMA 3D4NA 3KBOA 5ES3A 5U4QA 5CDSA 3BMOA 1U4SA 3ITDA 2HMTA 2JFGA 3FTNA 4OOFA 3ZN2A 5KJ1A 1A9YA 5KOIA 1A72A 1E3EA 2HLPA 2CD9A 2OL4A 3JD4A 3QWBA 4HKTA 4IMRA 1L7DA 2D0IA 5K9ZA 1JN0A 4TRJA 3LZ6A 5L7TA 1EBUA 1A7AA 3NX4A 4YB8A 3H9UA 4HV4A 4WKGA 3ZDFA 4E2WA 1Q0LA 1I2CA 2IEDA 3KSDO 2J3HA 1IYZA 1SBYA 1YVEI 2VUSA 3P5SA 3R1IA 1E1KA 4FOSA 2C0CA 2Y68A 2EG9A 3WGZA 3DBHB 4DL9A 4CLDA 4NFYA 1MG0A 2RAFA 1ZXBA 1PL7A 1S7CA 3OECA 4RVUA 2YQ5A 3JYLA 5KKCA 3MWDB 3BMNB 1YQGA 4KZPA 4Q3DA 4ALLA 3LT0A 4PLTA 2PA3A 5DCUA 3X2FA 4ALKA 5A3VA 2D5AA 3MJEA 3DZFA 2GCGA 3D3WA 4R01A 2W4QA 2ZATA 4KUGA 2EW8A 4XX0A 4MP8A 1BSVA 3TZCA 4JJFA 4I5EA 1U2GA 3AOGA 1PX0A 4QFCA 4E6PA 1VM6A 4DBZA 1QLJA 3F3SA 3QHAA 2QW8A 3ANLA 4Z9XA 3AW9A 1UZNA 4BVAA 4JXKA 3COSA 1LC3A 4IDBA 3NTOA 4D3SA 3U0BA 4ZICA 5ICSA 1JAYA 1MFPA 4EI2A 2Y0EA 5IFLA 1MC5A 2OMEA 3CSDA 1HXHA 3I5MA 3JQ7A 1LRJA 4RGBA 1Y5MA 3EDMA 3A14A 3WGTA 3RASA 3AFNA 1IE3A 1N1EA 1U5CA 3PEFA 3E8XA 5T57A 4DMLA 1VJ1A 4C4OA 1H94A 4S1VA 4RF4A 3VPHA 1O5IA 4J0EA 3JQ8B 4HNGA 4ILKA 4MDHA 4R54A 3JYPA 2YUTA 2HMWA 3WGQA 2C59A 2B4QA 2NSDA 3DAFA 3SEFA 4YXFA 4A7PA 2CF5A 3VZQA 1D1TA 4XQCA 1HLDA 1O94A 3DZIA 3TZKA 1TI7A 2IEBA 4BNNA 4W7IA 2OUIA 4CLOB 5IAAA 4J4HA 1E3IA 1Q1NA 3DQPA 4RLSA 4GWKA 1B15A 2EJWA 4Y9DA 3VAZA 4CLRA 3LQFA 2ZYDA 3NDRA 4CM9D 4DLBA 2VHVA 1NPDA 3EGOA 5KWEA 4Q3BA 3EVTA 1NQAO 4CQMA 3DEYX 3P19A 5TS3A 1PZHA 2HAEA 1GQ2A 2VHZA 3DL2A 3H5NA 1N8KA 1VL8A 4IQ0A 3H2SA 4P4GA 1DIRA 1YQDA 4ZRNA 3TRIA 3WTCA 3ZWXA 1E0DA 1MLDA 2YY7A 1E7RA 1PR3A 3HDJA 4JJIA 1H2BA 4XD2A 5F1PA 3AI1A 4IJVA 3MOGA 1GQQA 1ZKMA 1H6DA 1M2WA 2X4GA 4N5NA 2Q2WA 2ZK7A 1I24A 5H82A 1TT5B 3G0OA 5EESA 1V8BA 5A05A 1O6ZA 1TB4A 4ZRMA 1AGNA 3L9XA 4JROA 3PWZA 3QY9A 2OBNA 4TRMA 1YGYA 2YW9A 3HFSA 4EGFA 2H9IA 4Z9FA 1HRDA 1PGNA 2D8AA 4P4LA 3C3XA 3PLNA 3DB2A 3LT2A 4UEJA 6ADHA 1I5RA 1FK8A 2BF7A 2JAHA 2OP0A 4B4OA 4ND1A 4NG5A 2C2XA 2NTJA 3H3FA 5AXDA 1HL3A 4EW6A 1XG5A 1ENOA 2PR2A 2V6FA 3RJ9A 4PLYA 3SJ7A 4KUEA 1ONNA 1H2HA 5F1OA 1RM0A 4YT2A 4J43A 1B3RA 3DZGA 4BO4A 1DFIA 4ZJUA 4BNYA 1NAIA 1CF2O 4XYLA 3GN1A 3ZCXA 1CWUA 2QYTA 3HJAA 1GUZA 4IXTA 4FR5A 3L6EA 2DBRA 4M87A 3BMNA 2FZEA 5KVCA 1P1RA 3D1LA 2PGJA 3RFXA 4U6SA 3VH2A 1K6IA 1Y8RA 2EJVA 3QA9A 2C82A 3UXYA 2JKVA 2CY0A 2YV3A 1EE2A 1SEVA 4EJMA 3OSUA 1BWSA 5CG1A 1E92A 1EVIA 2Y05A 2GN6A 3N7UA 3CE6A 3DBRB 1DC6A 3G1TA 4PLFA 2VOJA 4TROA 5A02A 1ONOA 2J5KA 2NU7A 4LISA 3WMWA 4FW8A 3L9WA 3SC4A 3G79A 2OFPA 4A2CA 4GBJA 3QWFA 4BNVA 1KC3A 4GPD1 4XWYA 3LF2A 2O50A 4XRRA 1HDRA 1DIBA 3IUPA 3ADPA 4G5HA 3C1AA 3KSZO 4D46A 3KO8A 1N7GA 1LRLA 4BGIA 4AJPA 4CMAA 3ORFA 5DNAA 1KVTA 2QZ9A 2YDXA 1I10A 3JQ8A 4AVYA 4MVJP 1ZW1A 3IC5A 3HADA 1Z74A 3JYQA 3L77A 4URFA 5JMPA 2NACA 3TOZA 4WK6A 3RSHA 1MB4A 1R4MB 3HQ4O 1BXGB 3INGA 4IZHA 5A1TA 5JE8A 3Q1LA 3QQPA 5A06A 1HDCA 4Q3EA 3GNSA 4XEHA 3F4LA 4OAQA 4F46A 4MKZA 2GZ2A 4C7KA 4CLOA 5I7SA 3JYNA 1IULA 1OMOA 2VWHA 2X5KO 3OF2A 3PJEA 4IBOA 2ZB8A 3ONDA 1LQUA 2HU2A 1OI7A 3EHEA 3R3JA 1RJWA 4OXKA 1U1IA 4D0SA 3GVIA 2NVBA 4DVJA 4DMMA 3ICCA 1I32A 3WR5A 1WP4A 1DRVA 1G1AA 1LDNA 2NADA 4N5MA 2GPTA 3E9NA 3SVTA 1FDWA 4D41A 4FGSA 2VZ0A 1WW8A 4FCCA 5T8KA 2E82A 2VHWA 4Y67A 1WDKA 3VZRA 4OIMA 2DT5A 2Z1NA 4AJHA 3MOIA 3AOEA 3GK3A 3NJ8A 1ISHA 2HJSA 2HRZA 2PZMA 4RPJA 4RPHA 1TT5A 4DTIA 3GGGA 2WD8A 3HDYA 1JWBB 1LDYA 3ABIA 2IDZA 3DTTA 4QX6A 1E6UA 4XB2A 3HHPA 3LK7A 3VPSA 4DXHA 3GT0A 3TQHA 3QWAA 3ZV3A 3GVCA 1LI4A 1HE3A 4R1SA 3WG9A 1UZLA 2Z95A 3KVOA 4HFJA 4J1TA 1DPGA 1D1SA 5COAA 5B12A 3F5SA 3I4FA 4E2ZA 1Y1PA 3ZWNA 1Q7CA 2BLLA 3U9LA 3IKTA 4IDAA 1KETA 3CZMA 1W73A 1HF3A 3C85A 4M1QA 1C0IA 3QVXA 5T8KC 3U4HA 1I33A 2AEJA 2PFGA 4IIVA 3H65A 3AOEC 1QYDA 1QKIA 2ZTVA 3NGLA 4YWJA 5G0TA 3WYBA 3PK0A 5HS4A 3JQDA 1JTVA 1JKJA 4AJLA 2NVWA 5HWSA 1NHGA 2RHRA 4RVSA 2FR0A 4DQXA 4HFRA 4OQZA 4DPLA 5L51A 2NTVA 1HZZA 4PFJA 1CETA 2BD0A 1E3LA 4G2NA 1E3WB 1WZEA 4XDYA 3BHIA 4LK3A 4XRGA 5L40A 1JQBA 1XELA 4IXWA 2EKQA 3WICA 2VYVD 1FDVA 5T64A 5KJCA 5ADHA 4CM4B 3DAPA 2VZ9A 3NV9A 4A03A 1B2LA 4ZQBA 2VT3A 1J5PA 4DC1A 1KS9A 2GF2A 5IDQA 3OIDA 1DC5A 1ML3A 5DP1A 2NQTA 4KOAA 1NTOA 1EDOA 3G1UA 5JBIA 1Y81A 2C29D 3O26A 4R69A 1UDCA 4D3DA 4IZIA 5A03A 4BGUA 2FHSA 3IUSA 1K3TA 4CUKA 1NQTA 4H15A 5AVOA 3WIDA 4CV3A 2AW5A 5GZ6A 3JV7A 5CDTA 2GASA 1J4AA 2Z5LA 4YACA 1R4MA 4OSPA 1MG5A 2YHUA 4BKQA 1MP0A 3DONA 1VC2A 3EW7A 4TMFA 4TWRA 3RAJA 1WAMA 5MDHA 4KTVE 4KQXA 3I9KA 2IODA 2OORA 1GR0A 4NDNE 2CDBA 1LUAA 2I66A 3CINA 1N5DA 3W4IA 3O03A 3S2IA 1GFSA 4LGVA 2PKRA 4I9NA 4XA8A 1TVEA 4ND3A 1RM5A 1DC4A 1LNQA 2DTEA 2ZCVA 4BIIA 4IPTA 3GMDA 1UZMA 2CVZA 4BMSA 1ADGA 1H6BA 5EIOA 4FC6A 3ETDA 1OAAA 3N58A 2EF1A 4WOKA 4L74A 8LDHA 1NFQA 1KEVA 2HJRA 3G3EA 3ZU3A 1RYDA 4MO2A 5B4VA 1PS0A 1YBAA 2DPHA 4KMSA 4NBRA 3K73O 3H9QA 4RL6A 3JD0A 1XEAA 1G6KA 2CDCA 4TSKA 4W6ZA 2JCYA 5A04A 1LSSA 3OP4A 2EP5A 4NFSA 2VOEA 1LA2A 3GNQA 4RDHA 3WWYA 2PD3A 4Z0TA 1A4IA 3KXDA 3RFTA 3WSVA 3OIGA 5AOVA 5I7VA 3HZZA 3QWIA 1F14A 1HYGA 4O5OA 4RVFA 5TJ9A 2HMSA 5JNLA 3ROKA 3ZU5A 4DIFA 1ZMTA 4S3MA 4N18A 4BNGA 1NXQA 3DBLB 4OMUA 3AM4A 3QJ5A 4EYEA 3KOUA 1ZEJA 2IYPA 1R0SA 3AK4A 1E6EA 2JD1A 4N54A 5F3RA 4DQUA 2IXBA 4FGWA 5U9CA 4W9NC 1SOVA 2WTBA 2GO1A 1ZSVA 2DBQA 3GPIA 3O38A 4QFDA 1QG6A 2XPCA 3I23A 5B37A 4E33A 1P1KA 3RC7A 4LCJA 2WYVA 4E31A 3Q9NA 4XCVA 3ZV4A 1YBMA 4J4BA 1NVGA 3IS3A 4F6LA 2QRJA 3UN1A 1MV8A 1C0LA 4OO3A 4CM5A 4MPDA 3OH8A 4PLCA 3HWRA 5CAEA 3FWNA 4B4WA 2FSVA 1F0YA 3AU9A 3C1OA 1ZEMA 3H5RA 1JKIA 2C20A 3JQGB 2DKNA 4XQEA 3ZGYA 3EAGA 1MGOA 3MZ0A 4R1UA 2G1UA 3W8FA 4GH5A 3VKVA 3UKOA 3H5AA 3VPGA 4OGWA 1B0AA 2P68A 2A92A 3PZBA 4UEKA 1X7HA 1ZO8A 3E5MA 1LSOA 1Z73A 2X1HA 1PGPA 2CUKA 2XXJA 3M2TA 3KYBA 4QEDA 4BNFA 4CM4A 2BH9A 3SC6A 1CDOA 2TMGA 4P38A 1NNUA 3WYEA 1JVSA 1UUFA 1FDTA 5GZ1A 2I3AA 1X13A 4CR8A 3VPFA 1Q7GA 2HMUA 1FMCA 1QV6A 4ZQEA 2VWPA 1I36A 1SMKA 1IL0A 1O0SA 1LLCA 4J4TA 1BVUA 3RBXA 3U09A 4I1IA 1AHHA 1ZK4A 4J2OA 4AL4A 3EZYA 3UF0A 4CR7A 4F6CA 4UREA 5JXWA 4GAEA 4XJTA 4P8RA 2FR1A 2X5OA 4MVJA 5BT9A 5KJEA 3BMQB 3W6UA 1Y9EA 3WQSB 5J23A 5DCWA 2AQIA 4CQMD 5T67A 3C7CB 3AUSA 4YDRA 4E4YA 2P9EA 4JP2A 2NLOA 4NQZA 3WBFA 2AE1A 3EMKA 4J9UE 1CRWG 1HEUA 2X0IA 4CLXA 4YA6A 3FNFA 2HK7A 4YAJA 4DYVA 1VI2A 3V2GA 5IG2A 3ZHBA 5JAMA 2IZ0A 5JDCC 4OM8A 4ONEA 2B5VA 2CVQA 3LSYA 3OIFA 1EQ2A 4GLOA 5TSDA 3RU9A 2Q1SA 4E12A 1A71A 1AUPA 1E1LA 2PGDA 3DTYA 1DFGA 5L4NA 1LQTA 2V6BA 2VHYA 2XOXA 3BTUA 2X22A 5C7LO 4EEZA 1HDZA 3GHYA 4J9VA 1LSUA 3L4SO 3WIEA 7MDHA 2C7GA 1TEHA 3IAHA 4WCFB 1AHIA 1V0JA 3GLQA 3AUUA 4JP3A 1CJCA 2R00A 1QMGA 2EW2A 2BGLA 3AI3A 3E6AA 3JQAB 5COQA 5G4KB 5KVQA 3ZWBA 4OQYA 4TRRA 1ISGA 1QP8A 3K9QO 5L45A 2NNLD 4IUYA 3DHNA 4LVUA 4NFHA 2V6GA 1WXDA 2B83A 2VRCD 3PXXA 3UHAA 1JW9B 1Z45A 3T4XA 1SZJG 1K5HA 3DR3A 4J16A 3DBLA 4EJ0A 3F5QA 1OBFO 1I3NA 4YQYA 4II3A 2O7QA 3TWOA 3AUAA 3V1YA 4BKUA 1JKFA 3MJVA 3GFBA 1N9GA 4Y98A 1ZJZA 1Z6ZA 2NWQA 2DU8A 4PG5A 1GY8A 4L8VA 1JVBA 4RDIA 3OJOA 2VQ3A 1EBFA 2HK9A 5EMHA 4ROSA 1RKXA 2PV7A 4NK4A 1E1NA 4HNHA 3C24A 4L73A 5KTKA 1MA0A 3CXRA 4YTEA 3B1JA 3WDSA 2R00C 3OQ6A 3ZI0A 4K28A 4ALNA 4BV8A 3RUIA 2NU9A 2VUTA 4FFLA 4BNUA 1IHYA 1UH5A 1PGJA 1T4BA 4IDEA 1DRUA 3JQGA 3PP8A 1W4ZA 4G81A 3JTMA 3F9IA 4BO5A 5JS6A 3PQDA 1SOWA 3GEMA 2RCYA 4OHUA 1RWBA 3ROPA 4GWGA 4RF5A 2QQ5A 4XKJA 4B4VA 1K6XA 1X14A 2O3SA 2YFQA 3ENKA 3GDFA 1H6AA 3MWEB 4FQ8A 4IQGA 4LW8A 3G49A 3GG9A 4NBWA 3RC2A 1F17A 3UFXA 1ORRA 4TZTA 2AQ8A 4CODB 4XZ3A 4Y6RA 1P45A 5GMOA 5JO9A 2CSUA 3OJFA 3DMYA 2Q4BA 5G0VA 4MVJI 4DPKA 3WXBA 5JAQA 1GV1A 1Z7BA 4D79A 4YAKA 4CPDA 3N74A 1ISIA 4RORA 3S2GA 2IZZA 1QYVA 3HE3A 3W4JA 1WMAA 2WSBA 1MFZA 2DTXA 3VTZA 3PFFA 1X7GA 4NK5A 1DRWA 1KVSA 1U7TA 2O2SA 1C0PA 2Q1UA 2Y1OA 3LC7O 3F46A 1QRRA 4YRDA 5I8WA 1BXKA 2EIHA 3AWDA 1KEWA 3VDQA 3JD2A 4J2HA 5I7FA 3ZHYA 4D44A 5CPFA 1KEPA 4FFRA 1IY8A 3TZHA 1D8AA 1XDWA 2VNAA 4WASA 2IRWA 5TC4A 1XIVA 3SX2A 1MX3A 1VJ0A 2D1YA 4NJMB 4W7HA 4Z0HO 3RUAA 2NTNA 4LVCA 4NIMA 4JX8A 4PLGA 3V2UA 2I67A 1DC3A 1A4UA 2GZ3A 5BSGA 3TFQA 3KEQA 2AG8A 4RPGA 4YJFB 1AN9A 5LDGA 3DOOA 3AFMA 4NH4A 4QECA 1T1RA 4ALIA 4PN3A 5ITWA 5G4KA 3B1FA 1SCUA 4E0BA 3EZLA 2CMDA 3F47A 3TL2A 4UAGA 4EUEA 3GMSA 3INRA 4FB5A 5FI5A 4J0FA 3IJPA 2VT2A 1MC4A 4PZEA 1U2DA 4PLPA 2O4UX 3VZSA 1PJCA 3GNTA 4IQ8A 3E82A 3PIIA 2PTGA 2YJZA 1NQ5A 3L6OO 5FWNA 3RUHA 3V1TC 2A9FA 3WSWA 4BO9A 3BTOA 3JQBA 5JCJA 4ZQFA 1DEHA 3AI2A 1O9BA 2BHLA 3KYDB 2ZYGA 2PK3A 2TMDA 1AE1A 2W2KB 5C7IO 3R3SA 1ZSYA 4JQCA 1L1FA 4X54A 1BG6A 4ND4A 2FN7A 1IOLA 1IB6A 1GCUA 2C7VA 2ZJ1A 5THKA 2J8ZA 2DBZA 1X1TA 3RC9A 3GR6A 1ENPA 3TN7A 1VL6A 1H93A 1YO6A 3RBVA 4BNKA 5TIIA 1KEUA 1P0FA 3EUWA 5G0SA 4DWVA 5A9SB 3ST7A 4BO3A 1PIWA 5C37A 1Y8QB 4JN6B 3ZW9A 1IHXA 4BO1A 1K0UA 5KVVA 1M67A 4II2A 3ASVA 4L4XA 1DO8A 3I4CA 1K6JA 4OKIA 4D0RA 4CMBA 2QRKA 3JQBC 6LDHA 1M6WA 1HE4A 3FNGA 3IP1A 4GVLA 2HQ1A 1ADFA 5FFFA 4BUCA 2I9PA 2JFFA 1LXCA 3HB5X 5EL0A 1KIFA 2WE7A 2YZ7A 4CM6A 4PZDA 5EERA 3Q3CA 1PEDA 3U4IA 4TZKA 1RM4A 2VHXA 3H4VA 1JWAB 1XKQA 1F06A 1VSVA 4L9RA 2VTEA 1OZAA 1C1DB 4BHTA 1SEPA 3WNVA 2Y0CA 1Z7EA 2XF8A 1F8GA 4NHEA 2IE0A 4PG8A 4Z6KA 1ZVMA 1BVRA 3PWSA 3E18A 3DBHA 4KDEA 4RF2A 4ZQHA 1KVUA 4EJ6A 1LLUA 1T2DA 5G4LA 1GDHA 4E30A 3WX0A 1WMBA 4W4TA 5L9AA 1N1GA 3M1AA 4WJZA 5F5LA 1DJNA 1YRLA 3TFOA 4LSWA 1D7OA 1P74A 3RI3A 3ZV5A 1H9AA 1LBEA 3VPXA 3ANNA 1T1SA 3VH4A 3AY6A 4NJMA 4H16A 3V1UA 3ZW8A 1LTHR 4E32A 2AQHA 3BAZA 4U7WA 4XGKA 1GEGA 3RD5A 3WLFA 1Y6JA 4E13A 4CQLB 3KSUA 5F1KA 1R0KA 1NHWA 4YJFA 4D43A 5HM8A 2H1SA 2O3QA 2ZTMA 4Z9YA 1R12A 2W90A 2C5EA 3CPSA 4J1QA 3A4VA 4RPLA 3H9JA 4M54A 1GAEO 4IIUA 5TLSA 2PD4A 4MVJH 2WM3A 3D64A 3VDRA 1NR1A 4RZHA 3RJ5A 4M55A 3TZ6A 1DAPA 2PH5A 3QE3A 4GMGA 4I5GA 3C8MA 4GSKA 4JK3A 2HCTA 3I83A 4J7UA 3SJUA 3DHYA 3SLGA 5CDYA 5IF3A 3OM9A 1I3MA 3TL3A 2DAPA 4B7UA 1PWZA 4ALJA 5K0ZA 1A27A 1B16A 1NASA 1DAOA 4PZCA 1SAYA 2H63A 4XIYA 2X5JO 3DO5A 3KYDA 3ZU4A 1SC6A 1HT0A 2HO5A 2W2KA 2YFHA 3FCOA 1PJSA 3BZUA 3K8ZA 5EPOA 3NT2A 3U62A 2G0TA 4AJNA 5A5EA 4CMJA 3LLVA 1YB4A 2GNAA 3WTBA 2Y1FA 1NM5A 5JAZA 2AHRA 1PZGA 1GYRA 3GAZA 5HS6A 4PCVA 5ILOA 4YT5A 4AJKA 5JFOA 2VN8A 3I9NA 1QYWA 4B4UA 1DIAA 1KY4A 5L4SA 3ZNNA 1TA4A 3DWFA 1E7MA 1GUFA 5DULA 1B26A 5DZSA 3WGIA 3AM3A 3O4RA 2ZB3A 3OQBA 4MOWA 3TSCA 4MVJF 4E3ZA 3JD1A 5C7OO 1H9BA 4QTZA 2EWMA 1E6WA 4BO6A 4YRAA 4RJTA 2D5CA 1P0CA 1Y9AA 3RBZA 2X9GA 3PZRA 1N2SA 1YOVB 4UVGA 3ZWCA 1EEHA 5I7EA 1P1HA 4U0JA 3F6YA 4WOJA 1BW9B 4MJLA 5KNLA 5I8ZA 2E48A 3L4BA 5FYDA 1NX6A 1P77A 1ZK1A 2CDAA 3TZQA 3PJGA 4MVJD 1D3AA 3PGXA 5TGDA 1LJ8A 3I9OA 1C1DA 1WZIA 4CMHA 3RUDA 4HBGA 3ADOA 3UW3A 1UDAA 3K96A 3FR7A 4XYMA 2PWZA 1CQJA 4GL4A 4LRTB 1SO8A 1HDXA 1YJ8A 3R6DA 4CV1A 4E21A 3FD8A 2P9CA 3WB9A 1KYQA 5IXSA 4ZVVA 1EFKA 2DLDA 2J6IA 4JBIA 4OH1A 4B3JA 1EUCA 4NJOA 1HDGO 4AJJA 1HE5A 1ZBQA 5CDUA 3L0DA 2VYNA 4INAA 4CMGA 3DZHA 4TVBA 3L4BC 3DBRA 5JPIA 2DQ4A 1HDYA 1FDUA 3DOCA 2Q49A 3PYMA 4DPMA 4CLEA 1EK5A 3GY0A 5G0WA 3M6IA 3PHIA 4U8GA 3B20A 4LRSB 1ZK3A 4QQRA 3Q0EA 1KBZA 4Q3CA 1PS9A 4MVJM 3FNHA 2H5LA 4U0KA 3TF5A 3K30A 1GQYA 1C14A 2A35A 2Y1EA 3DBVO 1BHSA 4OJNA 2Y67A 1BXZA 5CEEA 2E4AA 4CM9A 4D7AA 1R6DA 3C7AA 4ZQGA 4HX5A 2EXXA 1IPEA 4W82A 3KHUA 2EEZA 2GGSA 1WLYA 3BTVA 3K2BA 5ER9A 3EVNA 3NDIA 3QP9A 2HSDA 1A7KA 2PY6A 3RROA 4DIBA 3AJRA 3S2EA 4FFNA 3ZNPA 5B4UA 1UDBA 3ETGA 1BXGA 1EQUA 4GGOA 1BTOA 4AJ1A 1W8DA 3DZJA 2YYYA 4NBTA 4IDCA 5CPBA 1HLPA 3FSRA 1UXIA 4RVHA 3GC6A 5CEFA
chains in the Genus database with same CATH superfamily
4FT4A 3SI7A 4B4KA 4CLHA 1DRKA 2YC4C 2EP8A 2O8CA 4LDNA 1A77A 3NHMA 2NQ2C 3B3GA 4OI1A 4K40A 4X84A 3F9CA 4AJIA 4ZYTA 4BGDA 1ZCBA 3VYRB 3AKZA 1E3TA 3ER9A 1JKMA 1F60A 1SUWA 4KGZA 1LCIA 1EGQA 2YNMD 1NLZA 1UMDB 2P4EA 2SKEA 1XTKA 3BA1A 3SOZA 4U2GA 5E4JA 4IEIA 4ECEA 3RS4A 2ZU0C 1U7XA 2FG6C 2Q4TA 1CNEA 1VRVA 5ENVA 2ZJ3A 2FPPB 1RI5A 3IHKA 3PC3A 2R8YA 4FHEA 3VO2A 5LN1A 3I39X 1B3BA 4K9NA 4NOLA 4MITA 3VC3A 1YR8A 3A11A 4GX0A 3JWEA 4AZ3B 1PJ3A 1WDWB 1NQOA 4HI0E 3ZJUA 5ADVA 3KJHA 4QQ8A 2ZP1A 3F4BA 5FUVA 5L95A 3O6VA 1PR5A 4A6EA 3FWZA 3B1ZA 4PINA 4YRMA 3GLIA 1NSTA 3NV7A 1XCBA 3TQTA 1DOZA 1GO2A 5LR6A 4MVJE 3E7DA 4MUFA 1VP3A 1WXEA 5AOCA 1FOEB 1EYZA 1EFPB 3HM2A 2A0YA 4KXLA 1NONA 3TMYA 1SCKA 4DT1A 1GD1O 5JZ9A 1XAGA 1F6WA 2AN3A 1Z0AA 2PRKA 3KPWA 4ER3A 3DEFA 2PD6A 5AW2A 1MT3A 1NV9A 5DHRA 4N01A 4IH1A 4L57A 2ODNA 4CKWB 2XVXA 1A95A 4UTZA 2FN9A 4CTKA 3ZV7A 1AXEA 1EP2B 4DAEA 1QPGA 4YBRA 2CXUA 1U65A 3EGEA 4BVHA 2PKQO 3O82A 1QRSA 2UU9B 4KP7A 4HH0A 5DW3A 2O3JA 1YI8A 4YCLA 4MULA 1CZUA 2RHJA 1W36D 3O1LA 1UFQA 2QY9A 2P7HA 4CNBA 1R9NA 1WD5A 3CW8X 4YXWD 1AG9A 2DUWA 5EIXA 1WNTA 2RIPA 1ZMRA 2P11A 2UZ1A 2XXBA 5DI3B 2BKAA 1ESEA 5LM3A 3EPJA 5H5JA 1GZ6A 4EYKA 3IO3A 3SYLA 3WQQA 2P1DA 1QF6A 3NTRA 4CF3A 4BGVA 3O0DA 1D5WA 3UMRA 1LPNA 3MWLA 1KU6A 1YBVA 3ESBA 4HEA6 3GLVA 4YMTA 4XYEA 5K8LA 3CLSC 1E3WA 1E61A 2RHCA 1Q1AA 3KD2A 1PWEA 4U9UA 4TV9F 1PR4A 1P7WA 1A82A 2Q41A 2XEDA 3G9UA 1YHNA 1U8EA 3N8NA 4K9OA 1PZFA 5IN4A 3R77A 1CUBA 5GY7A 1JG4A 3BQNB 1N92A 1YL7A 2ID9A 2PCJA 2ZRQA 5EIFA 3S5JA 3K92A 1SK9A 4BFLA 3M6FA 3RFCA 1P75A 5T4EA 2GXQA 2FPGB 5AK5A 4DDHA 2ALJA 1TLTA 1ZNZA 1XQYA 4DV2B 1TXGA 2J6BA 2GT1A 4HGYA 3SDZA 2VHEA 2Z8ZA 3KL2A 1KI6A 4MQEB 5JQWA 3NRCA 2EIXA 2JATA 1YCGA 3C70A 1E63A 2XQJA 3I32A 4BV3A 3R41A 4F9FA 3DOIA 1NYTA 3D2BA 1Z75A 3IAAA 4LJ8A 2LIPA 4S1NA 1J00A 4OL9A 4RIGA 3AR9A 4JITA 3PNBA 4YI5A 2GZHA 4GLJA 4V0ME 1O94D 4FYHA 4H77A 4HMPA 5CEJA 2HQOA 4JJ6A 5FTJA 1LU9A 4AKHA 3TNLA 2W8BA 3SKXA 1C4OA 1K5PA 5KTYA 3GRPA 4KIJA 1N6PA 2V65A 1L5LA 3WFJA 1UOOA 5JSFA 4BKRA 3ER6A 3KIPA 3QLVA 4UQOA 4C6TA 2P3LA 521PA 4BFWA 1J0AA 2I6QA 4M1YA 2UZ3A 1FYVA 4OFBA 5DIFA 1NW3A 3G9TA 1UC4B 1QDEA 2DX7A 2Y4OA 3GPCA 2ZJ7A 3II6X 4K6FA 1F6BA 4OTZA 1WJGA 1A5ZA 1C50A 1FXUA 3EULA 4YIHA 3CO0S 4PPQA 4ID9A 3H8WA 1E3SA 1SUCA 1WKCA 2NXNA 5EXXA 4M6WA 4O1HA 3H5IA 2C07A 3LX8A 4XFJA 5ESXA 3S0JA 1C2TA 2J0SA 1J8MF 4WNIA 5ALUA 3YASA 3C3MA 1NXOA 2HEGA 4WHMA 4DIUA 3L1UA 1XZDA 5KWSA 1J9GA 3I0MA 3B12A 5AQ1A 3DKKA 4QFMA 3ETHA 1WEHA 1GUYA 1ULHA 2R44A 2GZDA 3OMLA 2O8BB 1Z2EA 4U1RA 3R76A 4FI3C 2OXTA 4UUQA 3I9MA 3WLOA 1KA9H 3BWDD 4GPBA 3AHDA 1DBVO 3Q0IA 3FHOA 3HCBA 1E1DA 1L5WA 2XB2A 4D97A 1YCDA 3BFPA 4HFMA 4A9AA 4QPPA 5K6TA 3O0TA 2A7QA 1WZCA 2Y93A 3OEHD 3QLVC 3O8BA 4O33A 4OQMA 2QG4A 3N70A 2QZ4A 3KUCA 4XDZA 4TTTS 3MT9A 1U6IA 1HFKA 4BE9A 4NTZA 1EUDA 3VPCA 2AK2A 3GWZA 3IAM1 2X1MA 1JQJC 4TMTA 1YZTA 2ZRJA 1L8XA 1JZSA 1P2GA 2QRNA 3ZOZA 2BAGA 3DF9A 4AUKA 3L7IA 1GU7A 1LF0A 4R1PA 2HM7A 3EISA 2ZYAA 4AG6A 1XZAA 3A4NA 3IDOA 3KKLA 4QUAA 4A6PA 5DLDA 2MINB 2HRBA 1OBHA 4KX5A 2LCFA 3DAGA 2EARA 2P9GA 2HOQA 2I2XB 2O1WA 3PXEA 4CUJA 1ZKDA 4CL3A 3T38A 4R0NA 4ZOQI 4HFNA 1VJCA 2RHWA 1YZKA 2GCEA 5KVAA 5D6NA 1Z6YA 4ZHSA 5C52B 4QO7A 3PQ2A 3U2QA 2OV4A 2QR5A 2BJHA 5JH7A 4WZBE 3QU7A 1V5GA 5CT8A 1QP0A 3RVDA 4RA6B 1NVKA 1B1CA 3HKEB 2FH5B 1PK9A 4KXFB 5DSTA 2B98A 3EB9A 4PY2A 1GAQA 1NUPA 4YMIA 3OOWA 5EHXA 2JLZA 1NN1A 1QLHA 1N2CB 3NS7A 2E49A 5BY2A 1P0PA 4RMJA 1JFLA 4ASUA 1V8PA 4GF5A 2PLWA 3HA7A 4EARA 1J0DA 4C2AA 4P36A 5K6RA 1B4DA 1F2UA 3DLCA 2I3BA 3EZGA 3UWPA 5CEFA 3LECA 7ADHA 1DKMA 1Z33A 1YQUA 3CT6A 1DC7A 2YRWA 5EQJB 3FN4A 5LJLA 3OZAA 1VYUA 2DH6A 1L9XA 2CF6A 1XMVA 2VA8A 2XCIA 4KV9A 2HBYA 1ZH0A 4C6SA 4QE3A 4M1EA 5F5NA 1T29A 3MGAA 2GMWA 5MHTA 4RQBA 4YAIA 2IV2X 1U7DA 1XZCA 5HMLA 2WJPA 2GFQA 3X1JA 3W5DA 1J49A 5LXTA 3UJAA 1NMYA 2FVXA 2GN9A 2PEYA 2RAPA 4TS3A 4WEOA 4CM5A 5SZJA 2P2GA 2YJ5A 4XGRA 4BX0A 2B69A 3FUWA 2WOOA 4KPGA 1WB9A 3HCPA 3LL7A 4YPOA 5KJ6A 1Y8ZA 3CUKA 3ZXYA 5F2NA 4EQZA 2I0FA 2PHZA 5I8PA 3D6AA 5I7HA 2VQ6A 1RXUA 3GGOA 4OUDA 1UZAA 3C7KA 2C54A 5T6MA 1ZIYA 1N2BA 2XNSA 1VHJA 1G66A 4F45A 1TM7E 3MPUA 3HNPA 4DMFA 2I3ZA 1E4VA 3IPXA 3STTA 5HGJA 3HJRA 5K0LA 2ZT7A 1LFAA 4M0MA 5K09A 3ESDA 2VHCA 2DM6A 4KQWA 4MQ5A 2BFOA 5FTKA 4HYYA 2AS0A 4DY6A 3DDNA 3LM8A 4L6IA 1HGXA 4C22A 4D96A 5LMUB 3DFMA 4F4CA 4CXMA 2AXQA 2R60A 5H81A 2P1ZA 1SB8A 3K0HA 5A4IS 1VL1A 2XI4A 1OT5A 4HADA 4BJ6A 3Q15C 5T5QA 4BU1A 2EFYA 5AXAA 1HKUA 2Z2YA 4MCJA 1H85A 1Y9JA 1N8TA 2QQGA 1K88A 3LG2A 4WNCA 1KOFA 4XVCA 2RH8A 5AVKA 2QRLA 1OV4A 2JCXA 3TEFA 3K71B 3P20A 1K8XB 3C16C 3M9WA 1G8FA 1RC1A 1P18A 3AB7A 3EC7A 3EYWA 3H8VA 4P5DA 5GVRA 1UMKA 3FNRA 1R0LA 2RGRA 3GJ4A 2RGXA 3FCXA 3HDHA 2CEKA 5LZ8A 4LZOA 2YV5A 4L4YA 4CEJB 3WQRA 3TLMA 4YR7A 3BWBA 4OK5A 2DFTA 3FPBA 4I4IA 3R7FA 2F7SA 2ZBUA 1A8HA 4R8KA 3V97A 2BE9A 5AJYA 1TO2E 1I5OA 2CMHA 3HKDB 3VFDA 1EVJA 4YCCA 5L3QB 1CRPA 2X41A 3NHWA 1D9XA 4EKEA 2UXDB 1ACJA 5LQCA 4F6RA 1GVHA 3LT4A 3ZZUA 1I2ZA 5FPKA 4UD2A 2IU3A 2R8RA 3A9TA 1NBOA 2ZSFA 3FYHA 4KWHA 4F92B 2QD5A 3IAS6 4YRPA 5TB5A 1EIZA 5DE3A 5CNMA 2J5RA 1N4DA 3UH0A 2ZJ4A 3CZAA 5JRJA 4NE9A 5HX7A 3PIDA 4WT7A 3HCOA 5J4HA 1XRJA 3KJZA 4RD3A 1Y1TA 4BRSA 2BGTA 4Q03A 5SYNA 4WOBA 2P5SA 1D4AA 5CCDA 4IV5A 2XNDA 3TCKA 3K05A 3CEMA 3HU5A 1ZNQO 1WW3A 3OKPA 2LCIA 1H3NA 1ZCFA 4PGHA 1KI3A 4U2CA 3GI1A 4HVCA 4WMLA 1IUKA 3NPMA 4C43A 4F8YA 2E4VA 4W9RA 1XZPA 2VRBA 1BS9A 3RARA 1N6KA 3QVGB 5DNUA 4BTVA 4FJ0A 4PZPA 1JT9A 1VL5A 1YB1A 2OHGA 2QRPA 4FKBA 1E7YA 2J3QA 1K06A 3DAOA 5BQFA 5CB4B 3ZLJA 2GRAA 3G8YA 4FWIB 3THSA 3UCEA 5B1YA 1NXPA 3KZVA 2Q1YA 4H1WA 5EE1A 2AEFA 1X8XA 5C51B 1BE6A 2WA2A 1L7VC 3NYQA 4F04A 1BKDR 5ULLA 1TADA 1GN9A 1M0WA 3EFOB 1W0CA 3LDHA 3TLGB 3Q12A 4LJAA 3KPVA 4AJOA 3AF3A 3FPCA 3HYCA 2CHQA 2CZGA 3WJ7A 4E2YA 2FCAA 4DDWA 2YJGA 1JG3A 3MWEA 4OHPA 2NSHA 4KDCA 5B2EA 2OP1A 3TKLA 4PFSA 3GJXC 2Z6AA 2W22A 2P35A 4KE9A 3V8EA 3V2HA 1J0CA 1IZ9A 1J0BA 1SKQA 4JMPA 4X63A 5FTWA 3TTUA 5FADA 1PR6A 4CI9A 1A1SA 3W9SA 4C03A 1Z62A 5DN9A 1B6RA 1DSSG 2Y0DA 2ZSJA 2BIFA 4G65A 5LC1A 3H2JA 3VSCA 4W8OA 3U39A 2Z98A 1XQ9A 2XCRB 1Q7TA 1JDBC 1GGEA 1KERA 2GAAA 2OZPA 4YY3B 3UJDA 2VJQA 3H4MA 2Q07A 3OEWA 1OZGA 4JEMA 2LW7A 4D57A 3L8CA 3UK0A 1TTTA 2Q2NA 1XTBA 1Q92A 4EF5A 2OQRA 1I1QB 1ZGZA 3LQKA 2DYKA 4JLUA 2ZVJA 1ZGJA 3LBAA 3BK7A 2NPFA 1U9ZA 2JLBA 3QIAA 1PUJA 3BOSA 2OKGA 4KQGA 2IYAA 1V1RB 3D6FA 4H6WA 4DLZA 2IYYA 2ZIZA 4ND7A 2AXEA 5AK3A 4NZ9A 2XECA 1DJQA 4GBMA 3HRKA 1O89A 4MEBA 4BO4A 1WP9A 3UCFA 2VRCA 1EE9A 3F3KA 3GA7A 4I9HA 3S7TA 5JZOA 3HJBA 2WWIA 3EF3A 2X8AA 1XU4A 1O77A 1OTHA 5LMZA 2RI1A 1IG0A 3IDFA 3HM9A 2LXNA 4ZXFA 4LC1A 3AETB 5KDOA 4I8IA 1EG2A 3H2GA 3K1AA 3IXQA 4PLHA 4MRMA 4Z3OA 4XH9B 2G5PA 1FDSA 2WRZA 1D04A 4RAOA 4U2FA 3G2OA 4YO8A 4DR1B 2C5LA 1C4KA 3OETA 3ONFA 2H57A 3FA2A 3U48A 5ITZB 5JSZB 5K8JB 4UUPA 2WI8A 4G0VA 2HHCA 1IWPB 1GPH1 2X23A 2GX6A 1DEOA 4DCNA 4LOAA 2PGLA 1VKOA 3IHTA 1P8JA 3Q7EA 4J0IA 4M9QA 4OXNA 1ENYA 4JIMA 1IK4A 3WB2A 2X6TA 4EG7A 1EDZA 3M81A 4HS4A 3K70D 3I9LA 4O4IB 1H4SA 2C04A 4CM9A 3TE6A 1OV6A 1XMPA 3SF8B 1CE8B 3V1NA 3VX4A 1THMA 4BU0A 1BVHA 4EUFA 1UBGA 4PXSA 2C7OA 5K05A 2Q5LA 4YJGB 5EXEA 1CR1A 2W6JD 1T10A 4WEQA 3CEHA 4DUGD 1RM3A 3OWXA 4RFSA 1W5TA 1K5GA 4KBGA 1OGYA 2AR9A 1E7SA 1PU2A 2FRDA 4KAXA 4Q93A 4EBFA 5KYTA 1XQVA 3GFRA 4DN6A 3RJZA 4JI2B 4I3GA 2IWRA 2B94A 2P75A 4US1R 4LV8B 3RVPA 5MFZA 1A76A 3EG9B 4L3WA 5EFOA 2D59A 4JA2A 3AP2A 5L4LA 3PQFA 4H3VA 1PW7A 4TM8A 1I14A 3M1YA 2I99A 1S2DA 2ZITA 4GQAA 4F11A 1NW8A 5AP9A 4EHLA 4BXOB 1NPYA 3LLSA 2ORIA 2XMRA 3ZJTA 2JGAA 3PHJA 5H83A 5KIAA 1FSPA 1L4LA 1M6HA 3HZHA 2NX2A 2R87A 3JX9A 4C21A 3W1EA 4FEEA 3MRXA 1S8NA 3SHOA 3RSZA 5HRAA 4C6HA 1O6GA 3NUGA 3OCJA 2F48A 2FCRA 4E2XA 3D3KA 1X7XB 2VPTA 2FMXA 3NDJA 1ID1A 3JAKA 1OX5A 2O2IA 3A4YA 3OLXA 4KACA 4O0LA 4PU0A 5T4HA 3EIFA 2HLDA 4WACA 1SUDA 1QV7A 2FRDC 4TKLA 1KYVA 2HUPA 5GONB 3OOEA 3KXKA 2HFKA 4KWCA 3OCVA 1KEEB 2PTHA 5CLGA 4DJEC 3FNQA 3SQLA 2IHTA 3HKBB 2W2XA 4JP1A 2GZAA 4NU5A 2GEFA 4GWLA 2YWBA 4AJ2A 2FVYA 4CMIB 3S1AB 2C2OA 1PSDA 4PNZA 3DLBA 4JVSB 2VWQA 3DSRA 1H8ED 3I1JA 4HNAB 2HDHA 2ZEJA 3R8XA 2VJMB 9MHTA 2OOKA 2B3TA 2WBLC 3DZ8A 2ZE6A 1JJFA 3KB6A 4W5NA 3D1VA 4R5MA 2QTLA 2DG2A 2IE8A 1OHHD 1KDVA 1T2AA 1OD6A 2CKMA 4MJ3A 5EVCA 2Q45A 3LKVA 5JCOC 1SKAA 1BEUB 4UCWA 4DLRA 3H6KA 1BD4A 1CUYA 4LE2A 1WVGA 4ZCLA 5I7RA 5AJHA 1O7JA 1WUHS 1ZPDA 2BSXA 5B3JA 4ENUA 5K6AA 3DKIA 1IN8A 2A5YB 2EFCB 1NOJA 5FO0A 2PKWA 2V3WA 3MINB 4Q0MA 2GKOA 4MLZA 2MJLA 3OHSX 5I9NA 5CTJA 5GZ3A 1E6LA 3B13B 5KX5B 3TINA 2I1VB 3SQOA 1ZN7A 2O6LA 2X3YA 2XKAA 4XGIA 4XYBA 3RH0A 1HH4A 1JQEA 4MDFA 2QPTA 3T5BA 1PVVA 1D2RA 4H3KB 1IBRA 3NONA 1VRWA 3CEAA 1ZN9A 4AJEA 2W6IA 2WU1A 4NENA 5ALJA 2HF2A 3HCEA 2CLFB 1W2WB 5D3MA 4DM7A 4ED9A 3MXTA 3IDSA 3OIYA 3Q10A 4MNTA 3VKUA 4PAOA 3E05A 1WR8A 1AV7A 1P81A 1VJDA 2REQA 1NNSA 1EP3B 3CG4A 1CUIA 2DJIA 3G1WA 1YNSA 1ZP6A 1K7CA 2P2SA 3Q9UA 2RARA 1GZUA 2YQZA 4YRCA 2VPQA 1GILA 3AUXA 1O96A 1WU7A 5AESA 2HXGA 4OQNA 5LKRA 3NAZA 2Y76A 4WKBA 5AK6A 3DHEA 3SBXA 1T24A 2EGGA 5GPBA 3EDCA 2FW6A 4BNTA 1A3CA 3FTQA 4INZA 3TTYA 1UBOS 3AB3A 2B4TO 5B3JC 5K6AC 1E64A 1V6AA 4QUKA 1ISFA 2CE7A 2D8MA 4QOHA 4RK4A 1BDMA 1F5NA 3CE9A 3AM5A 3QYAA 2I4RA 4LWPA 4YROA 2BKUA 3R0IA 5JADA 4V3BA 4F2PA 5HUJA 1Y1RA 4DUYB 3DOFA 2XBMA 4A2WA 2FPXA 1HNWB 2R6FA 2F8MA 2JGDB 2IYXA 1A2KC 4NS4A 4U7PB 4JL5A 4P3KA 2P0AA 4FFWA 1W2HA 1PV4A 1SHZA 1E5QA 2R48A 4OG2A 3EEYA 1SXJD 3DL0A 4GKAA 4JCCA 4QU0A 5MN4A 2AMFA 2WMYA 5LQJA 1TRHA 1UK9A 1VG0B 1J9ZA 3EGDA 2C4HA 3MSCA 1YZLA 1KQPA 1Z16A 5DTQA 3VR3D 1IZ8A 3VU3A 2ZIVB 4MLDA 9LDBA 4JVNA 2W11A 4TOIA 3HKCB 3LA6A 3O47A 1MAAA 3ZD6A 1QSGA 5TVKA 3S8MA 3EXEA 2AVNA 1Q7RA 1RWPA 1XKLA 3OOSA 3PUJA 5IWAB 4U2DA 4YDSA 3P27A 1RS0A 3A04A 2OENG 3A58B 1GGMA 3L07A 2C94A 4NL4H 2FF5A 4WA8A 3U0VA 2P91A 4BOYA 3M4NA 1T15A 3UICA 5HGXA 4ND5A 1M3SA 3SHVA 1E9EA 4DFDA 1FP4B 1I30A 2IZOA 2VH5R 4O1MA 1H23A 4LBYA 1C9KA 4X85A 1X92A 1F12A 3IJRA 2CBGA 3K6JA 2MHCA 4RMNA 1RDFA 3VC7A 1CIVA 1OX4B 3DZKA 3UJ6A 5ED0A 4BFSA 1FEZA 2G6BA 3GF4A 2DWCA 4FVTA 4R3UC 3RSCA 4S12A 2IOQA 5U4QA 1RQPA 3KSMA 4TTAA 1OLXB 2FW1A 4J3FA 2Z2XA 1KDZA 3RK4A 1ES9A 4R41A 1ZOLA 1GVNB 2CNBA 3FLMA 4R2MA 4UVIA 3PX7A 3BHMA 1XGKA 4HNQA 2HW8A 2HGZA 4KDFA 5A9RA 1S0UA 1E2UA 4RULA 1TMKA 1R16A 1TF2A 3AIIA 4KH0A 4XQGA 1QC5A 3ZIDA 5BSEA 4QLAA 4L07A 4D45A 5LD2C 2JIBA 5IEJA 2V98A 5DNDA 2VCYA 1X6VA 1GPAA 3NTVA 5JPCA 1F48A 5BR7A 4CR6A 2QW1A 4QO8A 1NMZA 2IV3A 2J0UB 1H5QA 2XUJA 3EOZA 4B2IA 2X9NA 3HJTA 2A4KA 2FWJA 3P97A 4R8RA 3TLYA 1VHTA 4LF7B 2DLCX 1KRXA 4ISCA 1NR7A 1ZC3A 1WMSA 2R751 1Z6PA 2WDZA 3KZXA 4J3NA 3NGXA 5H7XA 2IYVA 4IF4A 4TWBA 2W6PA 1H0KA 3QPUA 4IJUA 4L5JA 3TJRA 2P4SA 2ECPA 3QRWA 3TSWA 4B6EA 4EY5A 1D09A 3KLMX 3TRHA 3QW2A 3MD0A 1II0A 3T06B 2OBBA 7AT1A 3NPAA 3U9TA 4ETMA 2D54A 4Q18A 1X2EA 4FOOA 1P2DA 2GJ9A 3G0BA 4XXHA 4F5EA 5J2UB 1ORTA 4TL9A 4YALA 5JYEA 5MFPA 1N25A 4Q3KA 1WXGA 1NJ6A 2PGXA 4X62B 1NY6A 2DFVA 5HQ3A 4JLSA 4R7GA 1ZONA 3O9MA 4KE6A 5DHPA 4RUKA 2WFMA 1PLLA 4UMVA 2FFRA 1OOEA 1UBJS 2EERA 2FLVA 2IYEA 3EE6A 1MJGA 3OOJA 4A91A 1DXHA 3KETA 2ZJOA 4P98A 2R4QA 3R7SA 1XWIA 3S55A 3FOFC 2HQSA 3A4TA 3EMDA 3S6JA 5FT9A 4CKYA 5J4KA 2XOKD 3ZYZA 1VBFA 3B53X 2BTQB 4BTLA 3MLBA 2ZTLA 2O2JA 5KKAA 2FEAA 1UJ2A 1ZUWA 1MNAA 1X0VA 3VR5A 1UFOA 1P44A 1OASA 2IQ5A 4OJMX 4W1RA 4KCGA 2A84A 1NIJA 1O54A 2X0RA 2VT7A 2VK1A 2X58A 3ESRA 1YR9A 2QSYA 4C06A 3MAJA 4DHWA 2HKIA 1ID8A 1LLQA 3N59A 4WLUA 4PG4A 4D9IA 1V6SA 4EL5A 2QI9F 2OGUA 4F4JA 4S04A 1Y3AA 1EESA 4RZUA 4YPFA 4PIMA 2WVHA 3CUVA 3SS9X 1JMKC 4G4GA 5EKSA 2XAAA 1SQ5A 2E87A 4EF4A 4KLAA 2ZYHA 5IXYA 4KR0A 2XT9A 2ACWA 3ABQB 3N2KB 5JATA 1IMJA 3QMVA 3EC1A 5KOYA 5HTOA 5IM5A 1EMDA 3CLUD 3RVQA 4YNBA 3D8BA 2PUFA 4GI1A 4B80A 1Q20A 1KK0A 3OY7A 4JR0A 4XLZA 1Y42X 3STHA 3VH3A 1FYXA 1XSEA 4FBLA 1CJMA 1JFTA 1G3UA 1IQPA 1P4GA 1VKNA 3DDCA 1ZI9A 2TMKA 3MTIA 4LRXA 16PKA 2V4UA 3D6NB 4G4SO 5DK4A 2HA6A 2ZM5A 2UUPA 1WE2A 1QP4A 4RXMA 4R9SA 4ZARA 4JI3B 4M1WA 3EZ6A 1QU3A 4KN9S 1VGVA 5JPDA 3R3XA 4LS3A 2IU6A 4RQUA 7GPBA 4HC4A 2PNFA 4EKDA 3DVAA 3IKMB 5LSAA 2RIRA 2FPWA 4UTNA 2FOIA 4DLSA 1CQIA 4QJIA 1IOWA 3SX4A 2Z4TA 1SBIA 1IY2A 3KYCA 4RLHA 2ASVA 4HLUA 2JAPA 9LDTA 5L3ZA 1JAXA 1RVV1 2DUUA 3CG0A 4FMPA 1YA4A 3IUMA 5REQA 3SEQA 3IKVA 4GE0A 4O63O 5C5IA 5JXGA 3OD5A 1X87A 5D5HA 3EWIA 3FKSD 4M46A 2B1RA 2CJXA 3GA0A 4YAWA 4D42A 2GPWA 2W8ZA 1RPJA 4EGQA 2VWGA 4CUZA 4EHIA 2XGJA 3E1KA 2O7VA 2OZVA 1DMRA 1QX4A 5I7SA 5ICMA 2ZUDA 2XADA 3WIVA 2ZXUA 2ZULA 2VIIA 3ZXIA 5JBNA 3U7QB 4ME6A 4BO7A 3OO1A 1GZ5A 2PH7A 2WIDA 2E2WA 2OXIA 3VYTB 4R9VA 4LJ4A 3B3FA 2YXEA 3AGPA 2B4RO 4MK4A 1SUSA 2EHDA 4U7JA 5H80A 5I9SA 5D86A 4DCUA 5THQA 3BTSA 2GAOA 1G8PA 2JFXA 4JXJA 3NBYC 2QROA 3LE8A 3N2EA 4LE1A 3T5MA 4TSRA 1X7WA 1JR4A 1N0HA 2B20A 4BNHA 1XAIA 3WNZA 5KSPA 4UHJA 2E37A 3INNA 1IRIA 3NB0A 3OWOA 2JAUA 4MKHA 5ED4A 2RDMA 4ZI5A 3LVRE 1RMYA 5HJEA 4HHEA 4HLUC 2GM4A 1OBCA 3JSAA 1SBCA 4RH1A 2WWWA 3GUCA 4WZBB 4EUHA 5HM6A 3EODA 2F3PA 2JA2A 2I4IA 3T5GA 3V3TA 2PT7A 3PF8A 3WO0A 2J41A 4E2FA 4EPRA 1IQ0A 4I3HA 5EWJA 3FJOA 1EINA 2QV7A 4AXXA 3RG8A 2G82A 2VBFA 5KTPA 1U7ZA 3TKYA 3PDUA 4PRKA 3R7WB 5K20A 1JEYB 1A7UA 5HTKA 3EDYA 3R9IA 1U7HA 2IW1A 2Z8XA 4UDNA 3WE7A 1SXQA 2OAP1 3DH0A 1CYEA 1OLUA 4MR7B 4BZQA 4MQMA 1WDMA 4EG1A 4Y2PA 1C1XA 1G2IA 2Y1DA 3T7IA 3S28A 5AI9A 2DLNA 5BMOA 1ADBA 2IS1A 4OHFA 4UULA 5AOBA 4J3JA 3MBIA 2AMLA 1O95A 1UBSB 2OO5A 4HDKB 4O0MA 3VJMA 3BICA 4AC9A 2N47A 2WWYA 3QW4B 2Q1TA 3MMSA 4AQDA 1GWNA 2J85A 4C0BA 4Q39A 1U3DA 2F2TA 1TAUA 4H2DA 4TQUS 1QHHB 3ORHA 1W4BA 3EH2A 3DLPX 1SHJA 3DT6A 1XU7A 3FKJA 4QJBA 1EFHA 1P0QA 2OCBA 4PTLA 4QYWA 2WF6A 2XZTA 3AP1A 3C1UA 3DMGA 1SXIA 3QPBA 1Q14A 4YRFA 1WUJS 4CLRB 3K9GA 2HN9A 4D2IA 4CEHB 4ZOAA 5IVHA 3BYZA 3VXKA 2VPIA 2WYWA 4A27A 3B5EA 1JBKA 5AVJA 1TX4B 3BSSA 1H4VB 2DOKA 3H3XA 4A8JA 2AGVA 3CH6A 3DZBA 2C9DA 1OILA 1NBEA 2FA9A 2B35A 5FJIA 2DUJA 5TDHA 1XJCA 1R5JA 1HEIA 4GPTA 3SS7X 1ZHOA 2X6QA 3CJRA 3X1YA 2O2YA 1EKXA 2P9YA 3IQGX 4TVOA 3PEWA 3KQUA 4J91A 1IVSA 3L8GA 1CEQA 1GTL1 1QM5A 1UXKA 2ACVA 1O95C 1K8RA 1ZSNA 2OO5C 4ZOBA 3ZHUA 3JASA 2PUCA 1E1MA 3QV1A 2QZSA 4KPUB 1PDWA 1FP1D 2F43B 5ES3A 3D4NA 1U4SA 4MQLA 4MQ4A 4L27A 4ZGBA 2JFGA 2H5JA 4FD2A 4BZZA 1FFWA 1OJLA 4P35A 1DV1A 4QWWA 4TLLB 3ZN2A 1A72A 2XGMA 4CZ2A 5AIBA 2CD9A 4PZYA 4HKTA 1LS6A 1OVGA 2QTWB 2X7JA 3EFHA 2PRSA 3C8DA 3IAM6 4A8PA 5GJBA 1EBUA 4WXMA 3SSOA 4YB8A 3H9UA 2BGRA 5FP0A 3IXLA 4G5YA 4E2WA 3WGUA 1CUZA 4A8JC 2NUTB 4MRNA 1QH8A 2J3HA 1YVEI 1U0BB 3BIXA 2VUSA 1WUYA 4IHJA 3MTQA 3QEAZ 4OIFA 2P69A 2EG9A 4LRWA 5LQDA 3MD9A 4MJ7A 3DBHB 1AT1A 3CWZA 4MUIA 1VQ1A 3KB1A 5DVZA 2JAOA 2RAFA 1PFKA 3LBIA 3QOYA 4QULA 5BR8B 1V25A 5PGMA 1L7BA 1L5VA 2H1RA 2WJ4A 2V4ZA 2KE5A 2RBGA 2VDWB 3K94A 4J03A 5K3BA 5KKCA 2I7VA 4UBIA 4Q3DA 1NI5A 3LT0A 4ALLA 3EZ7A 3R4VA 4TL7A 4TT3D 1L6IA 3IODA 3SZUA 3QK7A 1G5PA 3X2FA 3GD7A 3DZFA 4R01A 3D3WA 3GJ8A 3P4XA 2AOUB 1P4RA 2ZATA 3OSZA 2EW8A 5CT9A 5ALGA 1TMYA 4MP8A 1TJ5A 1SCDA 4F2WA 4JJFA 1U04A 2BR3A 4QGFA 2I7XA 3AFOA 4X0EA 2JJ2D 4ZYWA 1WSWA 1PX0A 4UXIA 3RJTA 4KIGA 1PK8A 1VM6A 4W5RA 1C7IA 4W5TA 1E4YA 2I7TA 1V4BA 2XUGA 5FL3A 3SZGA 2QW8A 3ANLA 4IDNA 3QG1A 4TVKA 3C3PA 4D3SA 3AEXA 1UJBA 4KXUA 4Q1EA 2XUHA 5ICSA 1JAYA 4NBKA 5EZQA 2Y0EA 1XTTA 3BE4A 4HN2A 2WG1A 4IJQA 5IFLA 2PV0A 3I5MA 3X1MA 2Z58A 1FSFA 4B45A 3UOAB 1JP7A 3RASA 3AFNA 2FWBA 5K1ZA 5IU6A 5HCUA 1IE3A 2P4UA 2HPZA 3E8XA 3Q5EA 1J8FA 4IFBA 5T57A 4DMLA 3WOVA 3OG9A 4JUBA 4D5GA 2C2WA 1BIFA 2FQQA 4LI3X 1L3CA 1OIXA 2I2BA 4KQJA 4J0EA 1RMQA 1UZUA 2PXCA 2J4DA 1KQ3A 1OWLA 4K8RB 3N75A 3A25A 1RCTE 2YUTA 1P5RA 3LUBA 2MCFA 4AZTA 2RGNA 2C59A 4D8YA 1RKVA 1N7JA 5FBQB 3H1TA 4OQDA 4UZFA 1I7DA 4L78A 4ZO4A 1I7NA 2CF5A 2X2OA 1D1TA 4HX9A 1T36A 1HLDA 4XQCA 2LKDA 3DZIA 5K2MA 3TZKA 1F0KA 2YJTD 3HJFA 5DNWA 2COUA 2IXFA 5EZYF 2FDXA 2DHCA 1EXMA 4J4HA 2PGNA 3IOCA 5IAAA 2ZBVA 3MFYA 1FIUA 3HGQA 3OZTA 3THXB 1ZJJA 3HI6A 4RH0A 1X1CA 3LQFA 3MJDA 5C1IA 3D5EA 4WFQA 2V0GA 1U2PA 4XJVA 3VYUB 3V4ZA 3EVTA 1NQAO 4FFDA 5J4YA 3BWMA 3DEYX 3Q7QA 2RGEA 2GWHA 4AZ0A 4XVRA 1GPMA 3ZU6A 1F38A 1N8KA 5J1SB 2ICAA 4KWEA 5HJ2A 4Z5XA 1XO1A 1DIRA 4KJZA 5CJPA 3UK1A 1FQWA 1JB1A 3WTCA 3ZWXA 1MLDA 2YY7A 3HDJA 4MW9A 5E0OA 5U4XA 1H2BA 2C3OA 4LF8B 4KO8A 5BWLA 3MUNA 1XN1A 3AR4A 2YKGA 5CVDA 5E3IA 1ZKMA 4LZZA 3M5DA 5F73A 4BBPA 3NNSA 1M2WA 3I1IA 2RGNC 5TMDA 4IO0A 3UA3A 4RZSA 3D2LA 2R6R1 2R65A 3RTCA 4F1WA 3G0OA 4X8LA 5CBPA 3SIPA 4D99A 1FVXA 3M3DA 5D5QA 2IPLA 2F9MA 3PWZA 1PD1A 4M1KA 3Q7PA 5DTMA 2H9IA 3W5HA 4Z9FA 1ECLA 1HRDA 1PGNA 1ZX1A 1OWPA 1ZUHA 2D8AA 3C3XA 3DB2A 2EHJA 2V5VA 3I6BA 3N0WA 4JDPA 4M9CA 3G6WA 6ADHA 2F4NA 1X8KA 2BF7A 2GZMA 2JAHA 1TA9A 1L5HB 1ZH4A 2GF9A 1V5FA 1WL8A 3IVGA 4HLQB 5AXDA 2BSAA 2E9SA 2OYCA 2AFIA 5HZMA 1QK4A 2WUFA 1XG5A 3OLQA 4KZKA 3CNBA 4P7JA 5ILQA 3VHXA 3QF7A 5A4FS 1JX6A 1ONNA 1H2HA 4RVCA 1BXRB 3ACCA 5B7NA 1KDRA 2Z5GA 3GA5A 4XTCS 4QYMA 1URPA 3ROEA 2QLBA 4ZKEA 3DZGA 1JH8A 2AUTA 3E22B 1QIHA 4L6AA 5CM8B 3I5XA 5AKJA 2CL0X 5C3UA 3GN1A 3NM6B 4M60A 1Q95A 3GFVA 4O2RA 5LLSA 1GUZA 4FR5A 2DBRA 2F1OA 4WBSA 3W7VA 1XI2A 2Z83A 4GXNA 3LYUA 4TWAA 1TGVA 1T3LA 3AB8A 1RAAA 3DQQA 3IUYA 4HN4B 1ZNWA 4RA9A 3WLAA 4ZJZA 2WUVA 1ZICA 3P2MA 1RXEA 4N0QA 4RJ2A 2JDIA 3VH2A 3W79A 1O58A 3GJ7A 2AKAB 4L15A 4C7XA 2OAEA 4ZI7B 5FWXA 2CY0A 1MEEA 3F5DA 4TWJA 1OUMA 3V8VA 3A4MA 1K7SN 2GN6A 2XRMA 4D3XA 4P2GA 1XJ0A 2HJGA 4B31A 3OM1A 1QHYA 1TM3E 3RKSA 3G1TA 4Y9SA 4HDSB 4TROA 5A02A 2WSIA 5LL6P 1G2OA 2W2QA 4DV3B 2J5KA 2NU7A 2PSDA 2GPJA 2I7CA 3PB3A 2YVKA 3PQ4A 3QUCA 3L9WA 4FEYA 3SC4A 3ZXUB 4ZEMA 3G8DA 1UAAA 3NDBB 3ZIUA 1BDIA 5JG7A 4M36A 5BO5A 2K87A 4UD6A 3IP5A 3WA6A 2UYHA 5JU6A 1G20E 3D8SA 3R24A 3RV3A 4Y7CA 4LY3A 3IUPA 3U4GA 4KX3A 5JANA 3C1AA 4RD4A 4LAFA 3WV5A 1V5WA 1NLUA 1UT6A 3RSSA 4BGIA 2FRXA 2IF0A 1XVIA 4MQFB 4ON9A 5DNAA 2WG0A 2FUKA 2ZIXB 2QN9A 4XB6B 4CKBB 1I10A 3MC1A 2Y1XA 2P2ZA 4BVJA 5FI1B 1DCTA 1X74A 4UZEA 1VMAA 1SBZA 1LJUA 3IC5A 3JYQA 3L77A 4URFA 3ZQ4A 5JMPA 1F4PA 1PSWA 3AVTA 4H4EA 3RSHA 1X38A 1A9QA 2JBWA 5LVAA 5AW4A 2FK7A 1BXGB 1JFFA 3GRZA 3R44A 4ZHQF 2FPOA 2XLBA 1M6NA 5IBRA 5TGTA 5JE8A 2ONJA 4NZMA 4KRFA 3M4YA 3X1WA 5AI4A 1HDCA 2HA0A 3OCUA 4Q3EA 4NCNA 4XEHA 1GRRA 2FW7A 2OO7A 3L93A 4LYDA 1YB2A 4FGLA 4OAQA 2BSQA 4HDRA 2PUDA 4KVAA 1CJVC 3ANSA 1NT4A 1Y9DA 2VWHA 1W9HA 1ZAKA 2REOA 3KYJB 4IBOA 4KO2S 3ONDA 3U19A 2BH2A 3FM9A 1XL1A 3EHEA 1QVWA 2QD3A 2W6MA 5K8VA 4OQEA 3GVIA 3WZLA 4DMMA 2SCUB 1N32B 3WR5A 2VZLA 3TXXA 2IU4A 1XRNA 1G1AA 1FB5A 2R6DA 2I4TA 4TXLA 2QXUA 2I34A 1XA4A 2GPTA 2PJZA 3KR0A 3E9NA 3FZYA 4ITVA 4N5MA 4NH0A 4X8HA 4D41A 1WBBA 1SG0A 5IMBA 1MJGM 3G0DA 5D85A 2KI5A 2E82A 2OV2A 4R31A 4K9SA 3RSOA 3V46A 4ARZB 2Z1NA 3DEJA 4QOIA 2ZE5A 3AOEA 1VLQA 2R2AA 3NJ8A 2KPOA 1CK4A 1JSCA 2KM1A 1Z68A 2HJSA 2HRZA 4KYTA 4RPHA 1TT5A 5JS8A 4DTIA 3Q9SA 1ECFA 1ZOSA 2VTKA 3DEKA 1W49A 3NCHA 1TTQB 1N3LA 2P27A 3H5VA 4M8IA 4XB2A 5CA1A 2IDZA 2QU7A 3DTTA 1E6UA 3K0FA 3HHPA 4QX6A 5DRYA 4GC5A 3GT0A 4V02A 5E6UA 2QL9A 3WG9A 4J1TA 1MF7A 1WY5A 2LKCA 1V95A 3LY9A 1VIDA 1DPGA 1M7BA 2Z9BA 2BFFB 2CCGA 4TV8A 1W85B 3LQRA 2IY8A 2E4UA 5IAEA 1UK7A 2GEDA 3KWFA 1LPOA 1XCOA 3KCNA 4RJJA 4LXUA 1DXOA 4Q5IA 3I37X 5AVTA 1AZTA 4JJAA 3CZMA 2HA7A 1T2VA 3HCAA 1HF3A 2JJMA 1EVQA 2VAVA 4UAUA 2G88A 1C0IA 2C96A 3QVXA 4Q4HA 3U4HA 2D2VA 2ZS9A 1F51E 4NMMA 4PW0A 2AEJA 5KOJA 2D62A 2BM9A 2ZIAA 4F71A 1M1NB