1VL5A

Crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
GSDLAKLMQIAALKGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEELHCFHKTFIFEDWCDRMNVTTEKKQELSDFIKSKPTEYYQKFKIVVEDGRVYSFRGESILMKARKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown conserved protein BH2331
publication title Crystal structure of hypothetical protein (BH2331) from Bacillus halodurans at 1.95 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 78
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vl5A00
4KW7A 1EIZA 3ELYA 5ICFA 2B3TA 4IV0A 2FK7A 3F4KA 5K01A 4QDKA 2AOXA 5HOQA 1WY7A 3FPFA 2UYOA 4R6XA 3HTXA 1NE2A 3DLCA 2AVNA 3E7PA 1RI3A 3G8BA 2NXJA 3P2EA 1YZHA 4C06A 3P97A 4PNEA 3TKAA 2PJDA 1KPHA 4PCLA 3UJ7A 4HGYA 4LWPA 3OU6A 4X61A 4YV0A 3EVCA 5GM1A 1INLA 3DMFA 3UJAA 4OA8A 3AJDA 5E1BA 3THRA 3SMQA 3R3HA 5EHGA 1H1DA 3OZSA 4X60A 1KIAA 3FUTA 4QQKA 2B2CA 3I53A 3SVZA 5C0OE 3C6KA 5CM2Z 2HMYB 4HTFB 4GOOD 4RTOA 5F2NA 3IV6A 1SUSA 4ER6A 2ZSUA 3HA5A 4X41A 2EX4A 3LDGA 3OPNA 4AX8A 3T7TA 4EVIA 1NW8A 3V97A 5F2KA 2QE6A 3BKWA 2GLUA 3MHTA 3CJTA 5EZQA 2CMGA 4Z2YA 2JHCA 3GGDA 4YMGA 2IH2A 2IBSA 1I1NA 5BW5A 1JQEA 3LL7A 1AV6A 3LKDA 1KP9A 1SG9A 2G70A 4PYMA 3G5LA 3MQ2A 4RVHA 3RIEA 3SSOA 4PCAA 3A7EA 4MQ4A 4P7FA 3G5TA 1FP1D 3DMGA 2Q41A 3HM2A 4ER5A 5LQCA 5FCDA 3C0KA 3EVFA 5K0EA 2EFJA 2F8LA 1NW6A 3HCCA 4PIPA 2H00A 4RSRA 1RJEA 3DTNA 3O4FA 3EVEA 1JG3A 3KPVA 4DKJA 3L8DA 3KPJA 5EC8A 2ZWVA 2I62A 5ICCA 2NXCA 2IDKA 3GIWA 4MWZA 4MHTA 4RVGA 1VPTA 3UJ6A 3OFKA 3FRHA 5DXJA 5DSTA 1SUIA 3BWYA 1B42A 1OR8A 2PT6A 3C6MA 3EVBA 4HSGA 4C03A 1YFLA 10MHA 1ZG3A 2GPYA 5CD1A 1SQGA 1P1CA 5EMLA 5C9ZA 4OBWA 2AZTA 2IGTA 1L9KA 3FUUA 1R8XA 3R6TA 1ZHFA 3NVMB 3ERCA 5CVJA 1JG2A 3GRYA 3LBYA 2V74B 2PXCA 2NP6A 1JSZA 4OBXA 4HTFA 2BM8A 4QVKA 1L3CA 5K0LA 3UA3A 4ER3A 5K05A 2UYCA 3KPYA 3T7SA 2JG3A 1O9GA 1O9HA 2ZULA 3ANXA 4GEKA 2AOUB 1NBHA 5DX0A 5EKUA 4YUWA 2AVDA 3E8SA 2B9EA 1EJ0A 4E70A 5CIYA 1L3BA 1YUBA 2B78A 3FYCA 4IWNA 3EGEA 4AZWA 1DCTA 3NW9A 4HC4A 3MB5A 5EVJA 1RI2A 3SGLA 4EKGA 3PLAE 5P8WA 2FPOA 1X1AA 4PYQA 4M38A 3G89A 2FHPA 5GINE 3FUWA 2P3QA 4FSXA 2P35A 3KR9A 3PFHA 3WSTA 3LGAA 3ER9A 1Z3CA 1P1BA 2GA9A 2WA1A 3I64A 4RTRA 3HVJA 2Z6UA 3A7DA 3DH0A 3PB3A 4QTTB 1MJFA 3DUWA 3CCFA 4GOLD 5DLYA 4BLUA 2HR1A 1NKVA 1BOOA 3B3FA 3QOXA 3PTAA 2G1PA 1X1BA 2CMHA 5DT2A 5HFJA 2OPBA 4O29A 1VQ1A 1P39A 3OE4A 3P71T 4BY9E 1SKMA 3KHKA 4FT2A 2PGXA 5K0GA 1IM8A 3UBTA 3KQOA 3TM5A 2O06A 5E9QA 3NMUF 3B89A 4OX9Y 1ORHA 4AZVA 4YV2A 5DSXA 1Q0SA 2UYHA 1G6Q1 4DM3A 3GXOA 3DULA 5ERGB 2K4MA 3OCJA 3BWCA 3G8AA 3M33A 3LECA 1R18A 4ER0A 2AOUA 3FYDA 5LR6A 5K0BA 4NECA 2XBMA 1EJ6A 2YXEA 1BC5A 3TPZA 5FTWA 3QOWA 4V0QA 1ORIA 3SX0A 3BT7A 1QAQA 5LQUA 4QPNA 4GC5A 2AOWA 1XXLA 4F85A 2HTEA 2PXXA 4E2YA 3A26A 3KQTA 2ZZKA 3KU1A 3BXOA 3CVOA 3FPJA 4HG2A 1SQFA 1N7JA 1QAOA 4GF5A 4CKEA 2YX1A 3LX6A 4CXMA 3GJYA 3EPPA 3LCCA 4KIFA 4LWOA 2R3SA 5DXAA 2A14A 1KPIA 2AN3A 3VYWA 5E1OA 5CVDA 3E05A 1N2XA 3UFBA 3LPMA 5GWXA 3REOA 3OFJA 3QV2A 5FUBA 5FQNA 4EKIA 4KDRA 2P3LA 4FT4A 1V39A 1EQAA 3CJQA 2P7IA 3EMBA 3KQMA 4FP9A 4QVGA 4R8SA 1EAMA 4Y2HA 4POOA 3UZUA 3MAGA 1KYZA 2AN4A 2IDJA 2QRVB 5FQOA 3BUSA 5DWQA 1NW5A 2VDVE 1AQIA 1RI5A 2BR5A 4RWZA 5DTMA 5K0CA 2O07A 3UJCA 4ATNA 2ZBPA 1G8SA 2QYOA 2IH4A 3EVZA 4C4AA 2ZIEA 3HP7A 5EIWA 5FULA 2ERCA 1D2GA 4KVZA 3EGIA 2DPMA 1G38A 4QDJA 4R6WA 3BZBA 2G8NA 5FA5A 4FSDA 3HCAA 3HVKA 4QPPA 5MHTA 2I6GA 5LQRA 1QANA 3NWBA 4EK9A 4PONA 3M6UA 5DM4A 3A4TA 4H0NA 1D2CA 3IEIA 5EIFA 4RTSA 3HVIA 5ICEA 1JQ3A 1YF3A 4R05A 1NW7A 2NNWB 2P3OA 2YXLA 3FPEA 2ONYA 3G2QA 2ZIFA 4HH4A 4QTUB 4RTJA 5D1NA 1VLMA 2AOTB 2ZBQA 7MHTA 1N7IA 2OY0A 5JR3A 1AF7A 2O57A 3EVAA 2VDUE 2YUIA 5LQKA 5F2OA 2JHAA 3UJDA 4BLVA 3FTDA 3DXXA 5LSAA 2ORED 5DTRA 3HA7A 1P91A 4OA5A 2OBFA 3A27A 4LG1A 1ZGJA 1JSXA 4PGGA 4AZSA 1EG2A 4HRAA 5DM2A 3M6XA 3SSNA 2ZW9A 2FK8A 2EJTA 1F3LA 2BM9A 2QRVA 4ISCA 1WG8A 2H1RA 1VP3A 2IP2A 5DM0A 2PVCA 2GH1A 3OZTA 4KWCA 3M70A 4XUDA 4K6MA 3FRIA 2YQZA 1L1EA 2PWYA 2ZWAA 3O7WA 5EG5A 1KXZA 2C7RA 4OQEA 2UZ4A 1JG4A 1QAMA 2HWKA 3KR2A 5EKXA 5K09A 2O05A 3EVDA 4DCMA 2IFTA 3ELUA 3OU2A 2JH9A 5KQRA 3X0DA 2ZTHA 4E33A 1XJ5A 3A25A 2BH2A 2XYQA 3HCBA 2PX4A 2WA2A 3TMAA 3CKKA 3MCTA 2PKWA 1TW2A 3TOSA 5EMJA 3CBGA 5ICGA 4CWAA 2ESRA 2ZZNA 3P9CA 1WZNA 2QM3A 2AOTA 4DQ0A 2ZFUA 4ER7A 5EZSA 5T6BA 3JWJA 2HNKA 2EJUA 2G71A 2AR0A 3LCVB 2OB1A 3M6VA 5KVAA 3NDIA 5U4XA 4JXJA 2HV9A 3SM3A 4IKPA 2E5WA 1G60A 1M6EX 3DXYA 3FTCA 4RTNA 1RI4A 3IYLW 3B7PA 4CKCA 1TPYA 1XDUA 3PX2A 3RODA 2OB2A 2P1DA 5CVEA 2PLWA 3KQPA 1U2ZA 4MTLA 4P7JA 4E2WA 3FUVA 1XTPA 3MCZA 1PRYA 2QY6A 3DLIA 3I9FA 3LDUA 4RTKA 1M6YA 5FHQA 5E2BA 3HA3A 4E30A 1R8YA 1R00A 3KKZA 3LKZA 4PINA 4QQNA 3TKYA 5K0NA 4RX1A 3EGVA 2OZVA 4ZTBA 4E32A 4X63A 2YTZA 3DXZA 3MTEA 5EEHA 2NYUA 3ORHA 4E2ZA 4FGZA 1FPQA 5H02A 3EEOA 2I9KA 5K0JA 3FTFA 2ONZA 4PWYA 3SR4A 4IV8A 3KPUA 3IHTA 2BR3A 3R9XB 2AOVA 3H2BA 4DCGA 2VDWA 5HIIA 3BGVA 5HIKA 1ZGAA 3R24A 4FR0A 2YVLA 1UIRA 3HEMA 4C08A 1BHJA 4GUAA 3HCEA 4CKBA 3GDHA 1XCLA 5DX1A 2OO3A 3K6RA 3C3YA 2Y1WA 3DOUA 2OYRA 4YUXA 4M37A 3S68A 3UJ8A 5FWDA 1JQDA 4PGHA 5DTQA 5GM2A 3DMHA 4RV9A 3KQSA 3M4XA 5HIMA 3GO4A 1G8AA 3O31A 4RTQA 1JTEA 3CGGA 1X19A 5DRTA 1M0EA 2WK1A 4PYNA 5FADA 5BP7A 2IH5A 1KYWA 4XCXA 3JWHA 1IY9A 3NWEA 3SSMA 3LBFA 1XCJA 3PFGA 3B5IA 1KPGA 3R0QA 3CJRA 4AZTA 3MGGA 4GQBA 3OU7A 4KRGA 3GRZA 3ME5A 4C05A 2C7PA 4C04A 2FRXA 4EMSA 5T64A 3PX3A 5M5BA 1KR5A 2PXAA 1HNNA 1I9GA 2FCAA 2ADMA 1XVAA 2ZBRA 3P9NA 4Y30A 3FZGA 1R74A 2PY6A 5KYGA 5CCXA 3BWBA 5G02A 4RVFA 2Z6AA 2ZLBA 5E1DA 3HCDA 3NVKI 1R6AA 2JHPA 1Q0TA 4FS8A 4DZRA 4XUCA 2R6ZA 1FBNA 1QYRA 1VP9A 3Q7EA 4PYLA 1X1DA 5E2AA 1D2HA 4E31A 2O0LA 3FUXA 1NV9A 3HVHA 2CL5A 2BR4A 3EVGA 4M7RA 5IKMA 3NJRA 3CC8A 3G7UA 2XVAA 5GOZA 3JWIA 2PX5A 5EMKA 4P58A 3TRKA 5E9JA 5BW4A 4RTPA 1YFJA 8MHTA 3P9KA 1UFKA 3E23A 4EQZA 1G55A 1VL5A 1WS6A 3AXTA 1IXKA 3AXSA 3NTVA 1TW3A 1X1CA 2P8JA 2DULA 1KHHA 5LQAA 5HIJA 1VIDA 1RI1A 3JWGA 4G56A 5HZMA 1FJXA 3KQWA 4KIGA 3T7RA 3PT9A 3VC1A 5JUWA 5K8VA 3OZRA 2VZ9A 2JH8A 4BP3A 3D2LA 4FZVA 1DL5A 1NBIA 3P2IA 2AS0A 4PIMA 4WXHA 3TFWA 5LQJA 2PT9A 2G72A 2ZZMA 1NW3A 4RVDA 1NV8A 3MERA 2Y1XA 1ZKDA 3AWIA 3GRVA 4YMHA 4DF3A 1RJFA 3VSEA 3KPWA 1PJZA 1AQJA 4DA4A 5DM1A 4V0RA 5E8RA 4P7GA 2ZCJA 2KW5A 2FYTA 4AUKA 2YR0A 1Y8CA 5GIPE 2IIPA 5KQSA 1YZ3A 3ELWA 4F86A 2XYRA 3KR0A 5EQJB 4HGZA 3FPGA 2PV0A 3P9IA 5EMMA 4YUVA 4A6EA 1UWVA 2N47A 3DR5A 5EOVA 3V8VA 3KQQA 4PYJA 5K03A 3G2PA 4LECA 5D1HA 3M6WA 2P7HA 4MIKA 3KR1A 3HCFA 1L3IA 3P8ZA 3LCUA 4YV1A 1ZQ9A 3FTEA 2GB4A 3U81A 4CTJA 3G2OA 2C7QA 2EG5A 3GCZA 4RTLA 3GU3A 5GP1A 5IH3A 9MHTA 5E1MA 2NP7A 4R8RA 2AN5A 3P2KA 2Z6QA 5LQNA 2PX8A 2IPXA 3G2MA 4XUEA 3SXJA 1RJDA 3EMDA 5EEGA 3I58A 4GOMD 3FPHA 1YB2A 2P40A 3PS9A 4P7KA 1DUSA 3HNRA 3BKXA 2V7EA 3G88A 4L7VA 1BKYA 3C3PA 2GS9A 2PWPA 5DRYA 1RJGA 2NXNA 1QZZA 5K0FA 3BWMA 1VE3A 3UJ9A 4E2XA 5FHRA 2P41A 2UYQA 3DP7A 4DMGA 3OE5A 3Q87B 4OQDA 5E8JA 2GAFA 3KQYA 3EEYA 5CCBA 2XYVA 2JJQA 3B3GA 2OXTA 3UWPA 1HMYA 5EPEA 4F84A 4YUZA 2XVMA 3BGDA 3TR6A 4U7TB 4BLWA 3T0IA 4A6DA 5CVUA 2CWWA 2PSSA 2PBFA 2YXDA 2H11A 5C1IA 1JG1A 3K0BA 3ER8A 1VBFA 2I7CA 2ZIGA 3ID6C 5B1SA 4B17A 3RW9A 1SVUA 2VP3A 1MHTA 5GIOE 5CVVA 4GC9A 4WVLA 1WXXA 3BGIA 5DX8A 5E9WA 5EGSA 3TQSA 2IBTA 4YUYA 1XDSA 3PVCA 4M36A 5FA8A 2CKDA 2VS1A 2NXEA 3GRUA 4UOEA 1JR4A 2BZGA 3GRRA 5CUQA 3VC2A 3LSTA 5DPMA 3UJBA 4CTKA 3LDFA 5T67A 4PYIA 4PYKA 3I5UA 3NDJA 4U7PB 1JTFA 3GWZA 3KQVA 4GBED 3THSA 2LD4A 2ZVJA 4RYLA 1NT2A 4PYOA 2OKCA 1WXWA 1I4WA 2PX2A 5FWAA 3UA4A 4X1OA 3TLJA 1T43A 1O54A 4GOND 5EHIA 3MTIA 3GNLA 5HILA 3ELDA 3TM4A 4BP1A 4C07A 3AY0A 5BXYA 2C7OA 4KDCA 5HEKA 2B25A 1FP2A 3B3JA 4RTMA 1F38A 1XDZA 3LHDA 5KS2A
chains in the Genus database with same CATH superfamily
5DM70 1WUIS 3OTOB 1YZUA 2A1UA 2WYIA 3GOHA 4QL3A 4A23A 4UAGA 1U0HC 3ZR4B 3DLPX 2Y8EA 5A62A 1VXRA 1WZEA 2I67A 2VZ0A 2F3RA 4FI3F 3EWSA 2CMDA 3LT1A 3AKZA 3CXRA 2AIRA 3TKAA 3PGMA 4HMQA 1FVHA 1ZVJA 2WFAA 4HLUC 4ZC8A 4HGYA 4NABA 4I1PA 1LLDA 2FWAA 3B6EA 1UADA 1FLVA 1I4EB 2WD8A 3EQ2A 4DCTA 1UXIA 2W93A 4PANA 4EAQA 2W8BA 1VFPA 2D00A 4GYWA 2HPAA 3BCUA 1WSWA 3MWEB 1AX9A 1ORTA 3SBEA 2E7ZA 3C7CB 5H68A 4X60A 3CWQA 1Y37A 3MJFA 4X93A 3LZ6A 1NJ1A 3F8SA 4G4SO 3C6KA 1ZL0A 4JH0A 2IV3A 3PHLA 1TI7A 2X8AA 3QYJA 2B1IA 1OYWA 1DQZA 3U4HA 1VDMA 3HB7A 3LWZA 1R0WA 3RSSA 2PN1A 5I51A 1L5SA 3ZPXA 4E5DA 4LHEA 5EWJA 1RQLA 1AUOA 1VLJA 2J45A 2LCIA 4IJWA 2ZE6A 2RH5A 4J90A 2FFHA 5AKYA 4A2WA 1TX4B 1JQEA 3MXTA 1MEEA 3UQYS 2D59A 3MN1A 4B46A 1KARA 2QRZA 3PDHA 4ILKA 5AJZA 1OLSB 3AVOA 3R23A 3SQWA 2XNSA 2GTIA 4IZIA 3TUZC 3KT0A 1SCDA 5B6JA 4MGEA 3HU1A 3OF3A 1EQUA 3L9XA 1RJEA 4L51A 4MVCA 1N0IA 1Z29A 3EVEA 4YRMA 4ZMBA 5LL6P 4WD3A 5E7QA 3SJZA 1XZNA 2DF8A 1HXHA 3DAPA 4MHTA 2YYSA 2ODNA 4MW6A 1V8PA 2VZ8A 4MW1A 1T3GA 1L7EA 1IUKA 1YRLA 1VI6A 4B74A 5DNWA 4S04A 2JLSA 2P5SA 4QHTA 4ZFNA 4NPAA 2JNWA 3LBYA 1PX2A 2NP6A 1RPNA 5JDCC 1Q0ZA 1W44A 3O5AA 4IAOA 4O4IB 5F9MA 3R4CA 5BUQA 1L3CA 3IPXA 3OCXA 4BKOA 2ZI7A 1KMMA 4OK5A 4W1RA 5U4QA 3FCXA 5DYTA 1L5FA 1NQUA 3COJA 1I3KA 2UXCB 1EJ0A 5CIYA 2AN9A 2QVZX 3MJVA 1RZUA 1TYAE 4U00A 1ZKMA 4HDAA 1CWUA 4BLTA 4OMDA 1YK1A 4TZKA 3P45A 4B79A 4PN3A 2FHPA 4P0PB 1SAYA 1Q3KA 4C30A 2G06A 3BWDD 4GPTA 3B1KA 5HBRA 3VMFA 2HYIC 3CEPB 1Z0FA 2CXUA 1HWYA 2BMVA 3UW1A 5DHUA 2GPJA 3DH0A 4G07A 1Z6GA 3R7NA 1V4VA 1TCVA 3B3FA 1MO6A 4ETWA 1GU7A 2G1PA 2V7TA 4R2MA 3L7OA 3PUHA 3AONB 4UPVA 3TUJC 4MAAA 2FW6A 4F96A 4HNSA 5JWOA 2I4OA 2G9RA 2IYPA 5IDVA 1PNRA 1Q17A 2NZ2A 1ZSYA 3LFUA 4DZZA 3AHCA 4YNBA 1TD1A 3SAJA 3KQOA 1N1GA 4IDFA 5D5HA 1WQ4A 4BKUA 4C9BA 1H3NA 4Q9DA 4DJJA 4UE6A 2XOXA 3SZUA 2D1YA 1FDSA 2QZ4A 4AM8A 1PSDA 3ANYB 1K4YA 3L04A 1ODJA 1VSUA 4NTZA 3UK0A 3E5NA 1XZLA 4QE3A 2CXNA 5B7GA 1FUUA 3AEXA 1XTIA 1LY1A 4NDNE 1DRVA 4UEJA 1ABBA 2TMYA 3U5TA 3OCUA 4YRZA 3VYVA 1QQ7A 4LCBA 4D99A 2XBMA 3ILHA 2BL4A 1JXAA 3JZDA 1TJNA 1GA4A 3NIGB 2IU3A 4R1TA 3TZBA 2C88A 4BL5A 5AWFC 4QEZA 1N9GA 5CXSA 3AHDA 3KU1A 4Q9HA 1HI9A 3Q4GA 1Z8HA 3FYUC 5JYDA 4K3UA 3PVZA 4OOEA 5EJFA 5KI6A 1IMJA 2AXEA 2C2HA 3Q7PA 4QRIA 3GA5A 1XMSA 4CXMA 1WTAA 1J9ZA 2DY1A 2GNPA 3OA0A 3NALA 1FDIA 3D5QA 3OO0A 4OI2A 4PS1A 5U1PA 1KPIA 1L7RA 2I71A 1MPTA 1UC5B 1VKJA 2C4WA 1L5GB 1KSHA 2GAIA 3H17A 3T7EA 1TZBA 2AQIA 3LPMA 1SUBA 3TLXA 1Y8ZA 2XQVA 4WKPA 2BGJA 3JQGA 1VMIA 1RE0A 2APJA 4U7GA 4EY7A 1NKTA 3QVWA 1RRMA 1WXDA 1CSEE 1POXA 4OHPA 4Y2XA 1WABA 1Y1RA 4ZAWA 5KO2A 2A57A 2I29A 3LYLA 4RMHA 2ZB3A 4DR1B 1GCIA 2BR5A 3H2SA 2QPLA 2HNBA 3EYAA 1T4CB 2SNIE 3GCWA 1SOAA 3AEQA 5FPTA 1V0JA 5KWSA 1WBJB 4J3JA 4C20A 1GPDG 1EX1A 4KMRA 1A98A 4QGGA 4TQUS 4YAJA 1DAEA 4DLXA 2O0MA 2XUQA 3RSHA 3H5LA 4YJ3A 1DMSA 1QONA 1M72A 2LUOA 3MQFA 5EKSA 1FTNA 3HRHA 3FE2A 2UZ1B 5IN5A 2OCXA 5HQ3A 1E0JA 2ZCVA 4LQ4A 1BXRA 5KX5F 3HVIA 1PF7E 1QO0A 4U63A 4X24A 3B1JA 3FDZA 2DWOA 3UAZA 2F9MA 5BT8A 5B4UA 1S89A 4XWKA 5L3QB 2E4XA 1G4HA 2C1EA 1FY2A 3JYQA 1SOUA 1CUAA 3UK2A 1QO7A 3RFCA 2D2XA 1G8MA 5DW3A 4BC1A 1FFDA 5LZ5A 4DZTA 5BVHA 2DUMA 1V8DA 3THYB 3D4BA 4AIRA 1BS1A 2WPNA 4JJAA 5E6SA 3O9MA 4LG1A 4B8ZA 4MOWA 1Z2PX 2ARKA 5I5EA 2JIBA 3FBTA 5EVCA 3TIFA 4Z3OA 1I80A 2GBLA 2RJ3A 5HFAA 3R7WB 5JNRA 3DONA 4IF6A 4EHAA 3VHXB 2XZDA 2IZ0A 1OMOA 2JIMA 3M49A 3OCZA 2ZWAA 1L1EA 5KTYA 2NWQA 1KXZA 2ZBVA 3EXFA 3HA2A 3OIWA 2GZSA 1IJKA 4KFTA 1Z22A 4YJHB 4MINA 3OQBA 2CLEB 3NBFA 2JGIA 2RI6A 4RELA 4RIHA 1L7XA 3CPHA 4JCCA 1NG1A 1EFCA 2ATVA 4C43A 3MAJA 4EUNA 3JCZA 5C4GB 1D5WA 3NAGA 5T8KC 1WDMA 3PUKA 4PFJA 4CMAA 4H6WA 3B52X 5JQGB 3CKKA 2DLNA 3IA2A 1SU4A 5J59A 3HY6A 4JOCA 4DLYA 5ICGA 4J4TA 4CWAA 1FFSA 1AKRA 2BYTA 3VPDA 2PUAA 1CUZA 2GEFA 4FD2A 4X1YB 3TW6A 1VHLA 2HSEA 4H27A 5H70A 4FKZA 4I4TA 3OLYA 3V5NA 4HDNA 3U39A 4QHSA 4KPYA 4HS4A 3NDIA 4ZJYA 5EE1A 4TV9B 5F1OA 2H4ZA 1OT3A 4GX5A 1MGOA 1R5BA 3H11B 2GZAA 3MXOA 3L6DA 1CE8A 1G60A 4ZV9A 5C8VA 5DHSA 3IYLW 3FMPB 3EFHA 3LLVA 4CKCA 4ES6A 3I5YA 3UJHA 4ZVTA 3UOAB 2X15A 5JHGB 4DUGA 4OFBA 2AC4A 3TIXB 2H4JA 3KQPA 4KRYA 3RBVA 1XTPA 3U37A 4Q7LA 3DLIA 3G0OA 2ZJYA 4WK2B 4KO4S 3TNJA 3JAWB 3NHAA 2W6OA 2XB9A 1GAJA 4H7PA 3RC2A 1O95D 3KALA 3H5TA 4FFMA 4F97A 1C80A 2D5IA 4JDUA 3L0ZA 5DNCA 1NN5A 1FPQA 4LRWA 4FZJA 4G63A 4JYZA 5IJ9B 4CUZA 4HDQB 3KSZO 4UFOA 1U80A 4AMUA 4BB0A 2B8NA 2YFQA 1YZNA 3LC2O 1TNDA 3D2AA 4BAGA 3I0NA 4F71A 3DV0A 4C08A 5EXPA 4RAOA 1B6TA 1B0PA 4ZGWA 1CUGA 4PGMA 1TYDE 3MOSA 3WLIA 3K6RA 2C5LA 4AY2A 4GHWA 1U3GA 2VJDA 2PTHA 4M37A 4OGKA 1XOIA 1RYBA 2D1QA 4XD7D 3KOZA 2VH2A 3CSSA 3ABIA 4RV9A 4N7RA 1SXJE 1UXHA 4LJSA 2O2XA 3DEHA 3GO4A 3GD5A 2X0FA 1DDOA 1N78A 3L6OO 2M9MA 1V5EA 3M6AA 5H81A 2JJ2A 4HXFB 3V8NA 3HFRA 5FADA 3SG0A 3VUEA 4CRWB 4C2TA 1FJHA 1QH1A 3WGGA 2RC5A 4HWKA 4BU1A 1OPXA 3NB0A 4JLUA 3EBOA 1IN6A 2FPRA 2H57A 1Q77A 4KNVA 5T64A 4EW2A 2AWOA 2Z9BA 2OHXA 4HFMA 1ZCJA 4KUGA 4JJ6A 3P9NA 4LOKA 1YKGA 4R1LA 1GUDA 2P3SA 4MKHA 1R74A 2XNKA 3W1EA 2E48A 4EFDA 3WLSA 5HF8A 1UXOA 3MM4A 2Q3MA 2HCTA 1FPMA 2JHPA 3KM0A 5MGNA 3GDGA 3HXOA 3P0JA 3Q2IA 1RWKA 1UMCB 3COSA 1GTMA 1UBFA 1EUZA 1XZJA 5DNAA 1W4LA 1YQ9A 1ZI9A 3R6WA 1C8VB 1MX5A 3GJZA 3EVGA 3UMBA 1O95C 2ZYIA 3GXBA 3OLXA 1GHTA 1T0IA 4PAWA 4JIGA 4AY4A 1QE5A 3JWIA 4S1VA 4P58A 1CY8A 4ERXA 4OHXA 2CDAA 3JZAA 5REQB 4EB6B 1RVV1 3WL6A 1EE2A 3KU4A 4JA2A 4QYIB 3R7SA 3SHFA 4Z4HA 5C5EA 3HJCA 2FWIA 3AETB 3H05A 3UAVA 3VH3A 3PRJA 1GCGA 5BWLA 1PJ4A 4TXNA 4HAIA 5C37A 4HADA 2BE7A 5K8LA 3D43A 2FG7C 5EUMA 3ESXA 3PI7A 1FJXA 4DQUA 5C4IA 1EGMB 1VJCA 2H5IA 3F8WA 3OP4A 3ZWPA 1B1AA 4TN1A 4YCNA 2JBHA 3OCWA 2GYYA 2I78A 4NCIA 4Z4EA 4R0MA 4B80A 2H65A 5KOHA 4QJIA 1QG0A 1AZWA 3QLJA 3SD7A 4R68A 1NV8A 4CUKA 2DBRA 2X8BA 3IIKA 2J5KA 2NUAB 3RSZA 2QD5A 3K9FC 3KPWA 5K7SA 1PJ3A 1U7OA 5K9ZA 4F04A 1XCPA 3AERA 3AV0B 4P7GA 3DT6A 4TYNA 2HSJA 1QHSA 4D25A 2AC2A 3VFDA 3SJBA 2GZMA 1F51E 1KI4A 2K7ZA 2PV0A 4YH1A 4KDEA 1YVDA 2OLJA 3GJ7A 1J2JA 4KI0A 4YUVA 4BNZA 2XGMA 5GJBA 5EOVA 1PT8A 2QHXA 2XQIA 2I8CA 2QRNA 4LUCA 1ISGA 2JZCA 2ZSEA 4I08A 5EJMA 3EGDA 2FPGA 1H3EA 3O26A 3B3AA 2FPPA 1F0PA 2YJNA 2CDNA 3W6UA 3WHKA 3ZZMA 1SXQA 1E5DA 1YO6A 3G68A 4N3GA 2JJMA 2PX3A 1MX9A 1XQWA 3WRXC 3UAWA 1EXMA 2F3SA 4KI7A 4M1SA 2HA0A 2Q8PA 2HJGA 1SK9A 3P2KA 3VPXA 1HH4A 1EHYA 1T4BA 1OXSC 2VRCD 2WW8A 1QHYA 5DVZA 2PGOA 3A4LA 1E6EA 2V98A 4BPBA 3VDRA 3L7BA 1O96A 1D7AA 3BB1A 2YXPX 1MB4A 2GN1A 4FDLA 4R1SA 4GEGA 4BNXA 1OBVA 4Q1AA 4BFTA 2PFKA 3HKDB 5IDXA 1MA0A 1NOKA 2QX7A 3LY5A 4JSTA 4J3NA 3VR4A 5D86A 1T26A 4M3NA 5JJ5A 4ON9A 2ZRKA 1F48A 4TXLA 2ZT8A 2MDTA 5EPOA 1YVPA 2RKBA 1A9OA 1ILEA 1NMQA 1XAHA 3SIPA 3EARA 4PZPA 4XWGA 4BQFA 3KETA 1MG0A 2ZCUA 4Z8XA 1QS0A 2PH3A 5JCJA 2I3GA 5EIEA 3NTXA 3TZQA 5KJEA 1Z26A 4RY0A 1E8MA 5CK4A 4Q4JA 3WLEA 5AVKA 1CUCA 2ZPAA 5L3SA 4FUQA 1T9AA 5AVUA 3EIEA 3GDFA 4ZANA 4RF3A 1COWA 3R75A 4CDGA 3E2PA 3TQSA 4IHJA 1XROA 4KITB 3AI7A 4GR4A 4DYVA 4YUYA 4J49A 4BIIA 4G89A 1J8MF 2DQZA 2QNBA 4MGIR 3F6PA 4CI9A 4BNUA 3LDFA 1PS9A 1ONSA 1IEVA 4IIXA 4RA9B 1H5QA 1WHTB 1CUBA 2G9UA 1M8GA 1ZONA 2C0QA 3KZXA 3GLFE 1JSCA 1WL8A 1RYFA 3C3AA 3LUKA 1WXWA 1I2AA 2DCMA 3QNUA 4FILA 5ADHA 1A2KC 1SB8A 5IAAA 5LOVB 4R1NA 4ALKA 1HE8B 2XUIA 2H0AA 2QN9A 1H5UA 3K70B 2O8EB 3E9RA 1R64A 3ENVA 1HDZA 3ICWA 3NR2A 4JLKA 5AO9A 5B7PA 1JLLA 3CZ5A 1ZIOA 3UWSA 6GPBA 3UJ7A 1LVGA 1LI7A 5JANA 2BGWA 3PNLA 2ZSDA 3OY7A 4MPTA 2OBLA 5CB4A 2PRKA 1TUEA 1XXHB 2WQZA 1XQVA 3WYCA 3U16A 1XDWA 4QOIA 2KB0A 4EG4A 1Q2UA 3TRFA 5LCXA 4QA9A 1EK6A 4RU1A 3ETJA 4NJEB 2LBPA 4OHFA 5CM8B 4HYTA 2ETXA 3ZDFA 1DTEA 4C4PA 1ZUHA 4KQJA 3MBKA 1TA9A 2AA3A 4J6EA 4YLEA 5TQ2B 1P7PA 4B85A 2W6NA 1Q74A 2Q07A 4LDAA 1UJNA 3FNRA 1A3CA 4KBGA 4W8HA 3ZCSA 5JAIA 2PBRA 3OZSA 2PMFA 4FQ5A 1TM3E 4ND4A 2ZJ4A 4NZYA 3RAPR 4BQOA 1TF2A 1JU3A 2JRLA 4U7WA 4ZHSA 4PBRA 3H75A 4B34A 4XX0A 2Z1DA 2V6GA 3V2GA 4BQNA 1OB5A 4KLNA 2H17A 1Y81A 3TDMA 4WEOA 4EVIA 2NIPA 4HS9A 5F4BA 1WPRA 1OW3B 4ITRC 1Z6AA 3PGLA 4WXRA 5DIZA 2Z4RA 3AH8A 1R0BA 4AF6A 4MICA 2RHLA 3SC3A 2LKDA 3O95A 3TBHA 1MV8A 3TEJA 1R27A 1BE8A 1GQQA 5ICMA 3SS7X 2JJ1A 2WWVD 4HNGA 2ECFA 5BY2A 2WQ7A 1WU8A 1IZ0A 2NQ8A 3DVRX 1YS4A 4HWRA 4O2LA 5FBWB 1I4OA 3OVMA 5ULLA 4D0LB 1G3QA 2ZKLA 1L4GA 3KJIA 2ORYA 1QKKA 3PEVA 3WFJA 1QO0D 1D7OA 1QIIA 2W2LA 3P2OA 3L8DA 3WY9A 3PQ6A 3NEYA 2NXCA 3ZN2A 1QVAA 1Y5MA 4Q9JA 3R44A 4INZA 1ZJ4A 3JQFC 3C48A 3C6MA 1PWXA 5BSEA 5JSQA 10MHA 4RFVA 2VQDA 3K1JA 3DOCA 4B33A 2FG5A 1P7WA 2PGDA 2GZ2A 4ZHQB 1FNMA 1PR9A 2EJCA 4WCVA 1ZK1A 2ZTSA 3ACDA 3WVNA 4ENRA 5J1SB 2AHOA 3ZGYA 4CG3A 3GRYA 2FPIA 2OMKA 2W43A 2P9QA 4CEHB 3ZWNA 1JSZA 2YHSA 1XZIA 3PNQA 4CHGA 2BGTA 1LPSA 3I39X 4MUAA 3JQ7A 4P4LA 3CWCA 4QVKA 4D45A 3OIUA 4YO8A 1O87A 2E5FA 2O7NA 4IHAA 3EPJA 1QOPB 4XQGA 3ANXA 5JBNA 3C87A 2X6TA 4HGNA 4RACA 4G2TA 1TAGA 2YQ4A 5FFFA 4A8TA 1Q16A 2IEGA 4G26A 5K6RA 2PRYA 4B4UA 1XRJA 1QG2A 4OLJA 2EGUA 1Z2EA 4RVNA 3IUPA 1O4VA 4IX9A 3LLCA 2VBIA 5DTEA 3SGLA 1ESMA 2J32A 3BD9A 3OO1A 4ZTZB 2R6GA 4PYQA 1A77A 4M21A 2D2VA 2D2FA 1YR1A 4ZT6A 3BAFA 3D8NA 3V2UA 2FW1A 3W2GA 3WSTA 4FWTA 4UAJA 5EJEA 3KX2A 3SF8B 1Q7RA 2UAGA 4G8DA 3I3OA 1OREA 4DLBA 2OCDA 2LNDA 2QTHA 2WSBA 4CL8A 1ZVQA 5CYGA 2VHVA 2NLOA 1NKVA 1YZTA 2AMLA 2R87A 1ECGA 1XZEA 1K6IA 2C4NA 1KK0A 1PW5A 2CMHA 3AU8A 4M1ZA 5TPZA 1W29A 2GCOB 3RYHA 2B61A 2JFHA 3Q1LA 4O29A 5J9FA 1WNTA 1BFDA 3P71T 3V6MA 2GZRA 2IPMA 3B7WA 2NO7A 1I94B 4LF4B 5A06A 4TMKA 2JI7A 3QVXA 1XWWA 2P9HA 3JSAA 2AZDA 4FIZA 4ARZB 4OX9Y 4ACAA 4ZCMA 1RAHA 2ZSHA 3GXOA 3KSMA 1BYIA 4D3YA 2W2VA 4AB1A 1E96A 4A2CA 3ZE8A 3M33A 3CURA 3F5QA 3T9EA 4NECA 4C1NA 1TKBA 4PZYA 3SOPA 1O77A 2AK2A 3RVRA 1ORIA 1B23P 3CKMA 5JPCA 4DSZA 2B0JA 3BQ9A 2WJWA 4LRQA 3PD1A 3GRKA 2X0DA 3TXXA 3OPYB 4D8UA 2YW2A 3SYNA 4DDHA 3CVOA 3OJEA 3PC4A 4KAXA 4CM7A 1H2RS 3IMEA 4HEA6 4N1AA 5I7VA 4HXYA 1SOMA 4JLSA 5A6SB 1MUUA 3OMXA 4L9WA 1JPVA 4TV8F 4YP9A 4KIFA 2GBLC 5JADA 4ZXFA 2ODWA 3LUFA 1CUXA 2EKLA 3RUIA 4CT4B 2DH6A 3IIMA 2NUTB 3E05A 1L4UA 1WKVA 3P9ZA 3UFBA 1ATIA 1RMTA 1NZDA 4X1KB 4FGLA 1WW2A 5BRNA 4AICA 2RHDA 4R8SA 3EEBA 2Z9DA 4MYTA 3U60B 3LRPA 2FB9A 4XYBA 5DWQA 4D4LA 1XU9A 4G2NA 1Y42X 1FRNA 2NSJA 4FUTA 3LCJA 3O38A 4Q34A 4MVJF 5AM3A 1JFTA 2QTVB 3L02A 4DJEC 2O07A 2WTEA 2YY7A 5DYWA 5JVDF 2ZBPA 1OU4A 1C30A 5JLJA 5EIWA 2GAOA 4EJSB 1T8UA 1Q12A 3A4NA 3PA6A 3L4BC 5IFKA 4JBIA 3LKBA 3I5XA 4COOA 4EYEA 1CETA 3T95A 2IXTA 3U40A 5GZ1A 2WMDA 4BYGA 5DM4A 3WK8A 3EOBI 1CUWA 2QSJA 4GYJA 1WUYA 3RF6A 3ODGA 4M1TA 4C0KA 4EYSA 2CLDX 2XMBA 1JHDA 3NYQA 1Z63A 2X0EA 3HO8A 4L8YA 1GQSA 3AUSA 4BX0A 1P0CA 4JWKA 1AQYA 3GPLA 1FTWA 3DWGA 2ETVA 3W2TA 1E1QA 2ORED 2J08A 2YNMA 3BXGA 4LNUB 1SUFA 2E4AA 4KAJA 1ETUA 5FO1A 5B64A 3USCS 2CSXA 3U4MA 2PQ6A 4AZSA 3R0JA 3F8TA 3E5HA 1CUIA 4KMOA 5DM2A 1JT9A 5FWNA 3RAEC 3F67A 4MO9A 3FAZA 5COQA 1GPAA 4EMUA 1VB3A 1GZHB 1Y3IA 4QAQA 4J2TA 4DC0A 1XMIA 2J0QA 1SHZA 3C6YA 1YU6A 4M1OA 4OHOA 4YO7A 1NP3A 2HA7A 1E0DA 2H8KA 1JG4A 2QJWA 2R7LA 4HDOB 4PAMA 4PIVA 4Z0TA 4C7KA 2DEUA 5BVGA 1EHIA 5K09A 2CBGA 3R41A 1KI1A 2XUJA 4I8XA 3F5DA 4CMIA 3F7MA 1GZUA 4U2BA 3ZGNA 3K31A 1EDDA 4KTTE 1OV4A 3HCBA 4WKCA 3FOEC 2NMVA 3QE0A 1N2CB 1P0PA 1X80B 3ZV6A 1EIWA 1JIKA 1JXQA 4MV6A 5GONA 4BNWA 3RKSA 1WB4A 4LY6A 2H2DA 3AOGA 5CMLA 2YV4A 3FPAA 5FPQA 4BTVA 5B3KA 4LRXA 4GOKA 2W2QA 2IKQA 2Q62A 2C3YA 2QD4A 4PAQA 1AGNA 3KJFA 4RCVA 5ALZA 1TJ4A 4H1HA 1U11A 2OB1A 5TQVA 1AM4D 3ZQ4A 4ZCIA 5KVAA 3CVWA 2RK6A 2L2QA 3EE6A 3TLMA 2C5SA 2H08A 1YR6A 5SICE 1XJ0A 5CA0A 4NK4A 4RH1A 3FKJA 5CDFA 1FC0A 3OOJA 2D5BA 2H2IA 4EO7A 3JRXA 3K9QO 4NBUA 1E8NA 2FWPA 5DN6D 1TJ5A 1NQOA 1I4LD 4AYWA 2XCLA 1PL7A 1XN4A 4Q02A 1MAHA 5IP5A 3Q3CA 4WGFA 4AMVA 4RTKA 1MORA 4WHMA 2GZHA 5G40A 5IWAB 3PC6A 3QVMA 2XGJA 3H04A 5DK6A 4LRTB 1SCNE 1YZKA 2Z2IA 3O2NA 4GL2A 4ZZ2A 1I1HA 5LBUA 3R74A 1QORA 4ZTBA 3SHTA 4R81A 2P65A 1XMXA 4E2ZA 1G41A 1NOJA 3TB6A 3V1MA 4M0UA 5AOCA 3OZUA 2A33A 1XEXB 3H1TA 3OX4A 1QZTA 4OHMA 2TS1A 3O8QA 3GMIA 1MB0A 4I5IA 3VKWA 5KTPA 4MJLA 3CB4A 3FSEA 1M66A 1VYUA 3VX3A 3ZDZB 1U3FA 1IXSB 3HEMA 4N49A 3S0JA 5EE0A 4ZICA 1Z4MA 4HD8A 4KPEC 5DJ5A 2Z1MA 3HJNA 4ZT5A 3ND5A 3GRPA 1M2OB 4TXMA 3I1YA 3PSAA 3SI7A 1NR1A 2A0XA 3DDCA 4JKOA 3T7AA 5ELMA 3T8YA 4OQZA 4ZO7A 4NL4H 3GAMA 1Y3DE 3V9PA 2OQRA 1A88A 1HYEA 3DMHA 1QIJA 1T8TA 3QEMA 4NKRA 3C14C 3IKMB 4MYSA 1OU0A 4IDCA 5HK8A 2VKQA 1JHMA 3EISA 3PC8A 3A06A 4YXWD 2OV3A 4LJ4A 2FLKA 4F6RA 4O5AA 4NXNB 1P6QA 2K87A 1AT1A 1SEPA 3NHJA 3QG5A 2OA0A 1TT7A 3AV3A 3OU7A 3TOXA 3SYMA 1WTCA 3FVVA 3PX3A 2YS6A 4B5LA 5JNTA 1FNCA 1YJCA 3WK5A 2I5PO 4WJKB 4D9KA 1OH6A 2ZBRA 3PL1A 1NL3A 3P52A 3JPWA 4G5YA 3T3DA 4ZVVA 5B1HA 3IAM1 4UBLA 3HE3A 4BKPA 4E5UA 2BKXA 4F60A 1M1NB 3ROGA 3VMMA 3KZKA 4NNOA 3R7FA 2QSUA 4PW0A 2Q4EA 4RHFA 3GIDA 1YR9A 4CLOB 1FFCA 1HTTA 2G5TA 3TAHA 1DOHA 3TX6A 1JEEA 3N0XA 3NJRA 3ZK7A 3JATA 1DJNA 2BFNA 3T12A 4YFVA 3QE4A 4R71A 5I7EA 2ODPA 3E0XA 3J7AC 2QMYA 2PX5A 4O2BB 4BHTA 4DA6A 2WWGA 1YONA 3UK7A 1UXGA 3AI1A 3LWBA 4XCQA 3AO0B 2OG1A 4GBGA 1YHYA 3CIFA 4KE8A 3NTVA 1JR6A 1CFZA 2Q5FA 1X1CA 1LV7A 2DULA 5LKRA 1WCIB 3A36A 4KIWA 3FMIA 1M7GA 1UEIA 1OROA 2FHSA 3MLEA 4PG6A 1T24A 1ZC3A 4O4IF 2W6PA 3KSAC 1NNEA 4MA0A 3M3PA 2FY8A 2IYNA 3KZCA 1DUVG 3A37A 1A04A 1H0RA 1OY1A 3DAFA 3ENZA 3H5VA 4JL5A 2XPCA 1N1EA 1V1JA 4LJYA 3LM8A 3B1FA 3KB2A 4X64B 4BVGA 4UQLA 4HPXB 1IOWA 2XDYA 3MERA 4AWXA 4UHHA 3DB1A 4KYUA 5AHKA 1LJUA 4BX9A 5JZ9A 4N3NA 3ZJTA 4JP2A 1NYLA 1BDJA 2H7XA 5LNK6 2BKEA 3SZGA 2ZCJA 4RHUA 4LZNA 4KDFA 4BCDA 2XYRA 3DAGA 3D7KA 3HZRA 3I23A 4P34A 5BN5B 1VE9A 3AR3A 4LK3A 3ZIAA 2JJ1D 2NACA 4P86A 1I36A 3N70A 4A6PA 1ID8A 3QWFA 4LYAA 2FG6C 2CLSA 5D1HA 1QUEA 3DBIA 1I5EA 4MWGA 1L5HB 4TVBA 4QZVA 1Z45A 3T3NA 2GKGA 3W2HA 4BZWA 4XOUA 1L3IA 3JY6A 3PDUA 5FLKA 3A1WA 4RKEA 2RAPA 4YV1A 4ND2A 2I2CA 3V4LA 1QU2A 3N2KA 2IUFA 3JQ9A 4A7PA 3C1OA 2JGFA 4Q4DA 4H3KB 4GRAA 1OI3A 2C7QA 1BG6A 3M9LA 2QYTA 3GU3A 3R5FA 4HAOA 4MS3B 1HZZC 2B4KA 4FGUA 4ND5A 1AQUA 1E69A 4PO1A 3UM9A 1HOTA 5HVNA 3OC6A 1NFQA 3RC8A 2ZYUX 2D0OB 3I2GA 1AMNA 5EEGA 3I58A 1C7QA 1KY2A 2CXHA 2FGKA 2FN8A 1XRNA 1GV0A 1Z7YA 1WXGA 1YJ5A 4Q82A 5C8ZA 2HPZA 3QOFA 4NS4A 3AHHA 2ISQA 1H3FA 1KJQA 1VYHA 3CH7A 5GTDA 1WM1A 2HIHA 1HL3A 2VJMA 4DMGA 4F2GA 5IAEA 2WWHA 3NOVA 5DHPA 2FFQA 4QFCA 2CDCA 2GAFA 1IHUA 4ID9A 2P2ZA 5KVSA 3R3VA 2E37A 5EPEA 4WCFA 4CCWA 4Y2PA 3T0IA 3LLUA 2Q1TA 4MARA 5DASA 5F7XA 1DAGA 2F1IA 1DWOA 1T25A 3H5RA 3IEXA 2GEVA 1JR2A 2GEUA 2ZG6A 3VR5H 2A1TR 1EYZA 4JOBA 1FOEB 5DI3A 4Z49A 2PX6A 1Y1TA 2CHVA 5KUTA 4A0HA 3DEFA 1Q14A 5CVVA 3PFNA 2Y6VA 2A0WA 3Q10A 3B70A 5ITSA 4QJ5A 5AM5A 1W5SA 4DM7A 1QZ3A 4DIKA 4QUBA 1DNPA 1G64A 1XDSA 3S4YA 2GD2A 2XD9A 4CI0B 3E18A 2XT0A 4LQDA 1KRHA 3VO2A 2XYHA 4EG6A 1Q0TA 3UAOA 2QE7D 2Q3EA 4JT8A 4QQRA 3HH8A 4PYKA 3W5VA 4I9FA 3U09A 2YZKA 1JG7A 1Y9AA 4LVOA 2LD4A 5TJHA 4I1OA 4QLBA 1JHYA 1HT2E 3QI7A 1AKMA 2WHPB 1WDWB 4F2WA 2IS4A 1WKBA 1WUTA 2VOJA 1H4SA 1JDTA 4M6WB 4K81B 1RWVA 1KKLA 2Q6VA 4YASA 4J16C 2IXFA 2PSJA 2IPAB 1EFHA 5HJEA 2B25A 1F2UB 3EQ8A 3T5DA 2VRNA 4DB4A 1ODIA 3DE5X 3VJLA 4R5MA 1Z62A 4RK5A 5IVDA 1VG9B 1KAMA 1SBCA 1YS9A 3WADA 3I9MA 4YAGA 5BNZA 5IKEA 2CLIB 3MJTA 1V1MB 3U7EB 2QW1A 3FPLA 4DA8A 1P1JA 2AJTA 2I4NA 3HTXA 4DPLA 2FUKA 4YDHB 2I33A 2KBEA 3ZK8A 5JSFA 3KZ1E 1FVXA 1MO3A 1XZCA 3UHPA 3EG9B 5GM1A 1JSLA 4PE5B 3Q9LA 2A9VA 2NVOA 4BVAA 1MEOA 3IDQA 3ZVKA 1JGTA 4OUKX 3HB1A 1P74A 4ZU3A 5EFOA 1W2HA 3W90A 3ED5A 4Y6PA 3PKJA 1NW9B 3EFOB 4KYVA 2H48A 2XE6A 4JASB 2R1VB 3NFYA 1UANA 2GCEA 4YMUA 1KO1A 4IS2A 3A05A 3OFSA 3B60A 5I9SA 4TXHA 5C8DA 3JQPA 4G5XA 2E21A 4LGVA 2ZYHA 3T7TA 3WICA 1YZGA 2GBGA 2WAOA 2ZJ7A 1YRQA 5JHHB 1OBHA 1UAAA 3BKWA 4WSOA 1J0BA 1NSFA 1FYEA 3VDQA 1X9GA 1USVA 2FZKA 1LWNA 1BXGB 3MINB 4POAA 3K1AB 4RD4A 5DBEX 2WNHA 4EZIA 4LY3A 5DYYA 3BXFA 4NSNA 2RBEA 4D96A 1TUBA 2Y71A 4ZRNA 3MQ2A 3V4FA 5FTMA 1KJZA 1MIHA 1UMBB 1LDGA 1CUJA 3CPJB 4X1IB 5TT0A 1J5PA 4Y18A 2FPUA 5IUNC 2J87A 2R62A 3TI9A 2I4IA 5PGMA 1ZIDA 3ZGLA 1XNHA 2HWUA 3QYPA 2F64A 1NONA 1RIFA 1XRPA 3NH9A 5HSGA 3QIAA 3EOAI 3BVPA 2ZSFA 4FZ5A 4RSRA 4CKWB 4D8YA 5IF9A 1QRDA 1F9AA 1RPTA 5ELLA 4MUGA 5JWHA 1KOFA 1VPTA 3UJ6A 1ARZA 3FRHA 3NYIA 1CUFA 3ND9A 2PT6A 4EGQA 4WY5A 1QYIA 1V7ZA 4U6NA 3WL5A 2Z9CA 3LWNA 2UVPB 3MCVA 2XT6A 1KIMA 3L1IA 5HKAA 1WB6A 4CQLA 1E1QD 4TS3A 4KO3S 4MITA 2JLQA 1FFGA 2YNMD 5EQFA 3HBAA 1CNFA 1ZD1A 1FSZA 3COYA 1L5KA 9LDTA 1MF7A 4CCYA 3IBSA 4ER3A 2W6CX 2PH1A 4ONEA 5E6UB 4D4IA 2VP0A 3QFSA 1YJAA 2X7XA 2V4MA 4U7FA 2I65A 3DFZA 4LYJA 1O9HA 2WLTA 5HF5A 4BMOB 2Q45A 3FOAA 3E8SA 3CR7A 3AKDA 2I2BA 1G18A 3TPCA 1TK3A 3DOFA 2CJWA 4J0GA 4II7A 4QULA 4AZWA 2JAOA 4RMGA 3VPSA 3TCNA 1DXHA 3JSXA 1CJMA 3OSZA 2ZREA 3GARA 1YRAA 3KS9A 1BX3A 4F0JA 1PNQA 2AFVA 4D5GA 4TYPA 4ADSG 1HE3A 3M6IA 4QIHA 4YJ2F 2NU6A 2HDHA 4MV7A 2XCOA 1NYQA 2LR0A 1PHPA 5H82A 2P9YA 1EWYA 3BSWA 1CZLA 2DAPA 1GTSA 4BFWA 3Q3HA 3QXJA 3VKVA 4X97A 3VU3A 1AH2A 2HHLA 2X8JB 1K8RA 5H9VA 1EP9A 4YT5A 2YCLA 4X20B 3L79A 3DMRA 1C4KA 1U2PA 1RCFA 2YWFA 4RKFA 1KK1A 5A0FA 1PT9A 2YMMA 3LPLA 3AHEA 4QFBA 3WLTA 1UAYA 2QAGB 2DUUA 2VDKB 4NJMB 1V8BA 4DM3A 3IQWA 2WQ6A 3JVVA 4H4EA 4HEHA 1Z36A 5EXTA 4K0KB 2EWWA 4AG6A 1NVTA 5ALLA 4CF5A 2VHWA 3BF7A 2FPSA 1VKHA 4ZYUA 2VL7A 4ABTA 2CFCA 4NARA 3U0BA 3I0ZA 1DIBA 2C77A 2XMQA 4AVYA 3RSFA 3DEZA 1NXOA 1LPBB 3GNQA 5T4HA 2R25B 3D4PA 2RI0A 4Q7EA 3KQTA 4E2YA 3P4YA 2YNMC 1VPVA 2YZ2A 5G4KB 2HW8A 4OQPA 4PPQA 1B16A 1U2QA 3ZDRA 2V9CA 3K0CA 3GB9A 3ZU3A 2ZTVA 3PQ3A 1G5QA 2C5AA 5K3CA 2QYSA 2VYNA 2QZSA 5C51B 2H3EA 2JGRA 2ODTX 1OXXK 2FRDA 1QJCA 1KI6A 2AN3A 2EFDB 5FB3A 2ZIZA 1X15A 4UTZA 2JAHA 1N8SA 4N5LA 3TJZA 3UMJA 2XV1A 1VHJA 3MGAA 2G7ZA 4GXRA 1UJ4A 4MB6A 4UCXA 5J2TF 4F92B 2AFIA 4B48A 1YL7A 3BMNA 3CLKA 1PEYA 1V25A 2WM9B 5AHWA 2FSVA 1SCIA 3OCCA 1E6UA 4ME6A 4F5WA 3D31A 3UF0A 3OKPA 3L6CA 4OCZA 2HHCA 4RWZA 4BV3A 1NMSA 2FMKA 2VK1A 4CW7A 2WAXA 4NNPA 1MBZA 2BMEA 2G28A 5IS2A 2ZU0C 2IH4A 2PS0A 1UXKA 3PEUA 5K3FB 1QH8B 1TZCA 1PFUA 4MQ6A 3W8DA 2DPMA 2DSTA 3QQ5A 4YT2A 3BZBA 1ZK3A 1GUAA 3H3JA 1DG3A 4UTXA 3ZV7A 1CF4A 1H0SA 4GXQA 3BIWA 1U9YA 2BFFA 4PPNA 2F62A 1K2VN 5JTUA 1PD0A 3M6UA 4DQKA 5B58C 4HT3B 1U7XA 2CYAA 4INOA 3OOSA 4N40A 2D5AA 3QKTA 4RTSA 2JJ8A 3KDSE 5BQPA 2EAUA 4JENA 2D0IA 2F2TA 4J4BA 3WKBA 4PNHA 2FMFA 4U39A 1NF9A 5IDWA 1EPUA 4AKGA 1US8B 5EHQA 1ICEA 2CXTA 4P83A 3N6XA 2Y9MB 1JDPA 4CKYA 1P7VA 1X7YB 3VSBA 4KIUA 3I2KA 4QC2A 4MUYA 1K6MA 1J2EA 4BAUA 5IU6A 2O54A 1P91A 5HJ7A 4DWJA 4LX0A 1ADYA 5EIAA 1GZVA 4ZVUA 2L69A 5KSZA 4YCBA 4ZVLA 3PV0A 3M6XA 1Z5WA 1ZK0A 1UIMA 2PRSA 3DHNA 1O89A 1NJGA 2EJTA 3MGCA 1P1FA 4MH0R 2JDIA 3U44A 2AZ4A 2XVYA 1QX3A 2F6RA 1ADCA 1SUAA 2GH1A 1BS2A 1SVIA 1VHQA 2VXCA 4XUDA 1LB1B 4CEIA 2QM8A 3WAGA 3WGLA 2C7RA 5CA1B 1HDOA 2OKGA 2GHIA 1F7UA 3OZEA 2WNIA 1PK8A 3BZUA 4XIGS 4OHVA 1JLKA 3A3YA 4LSMA 3VPFA 1O94D 1GADO 1I33A 1EK2A 1KZ7B 1JEOA 1P4JA 2BEWB 4DCJA 2GEKA 3A25A 4HH3C 1OFIA 4RJJA 5EJ6A 5GOTA 2Z30A 1RLTA 1KQ3A 3H6HA 2D13A 4XEHA 1K7YA 3DEJA 3P2YA 1T0PA 5FKJA 2HD4A 3TLAA 2WIBA 2QTWB 3UXMA 5EMJA 2GPNA 4EX7A 3VPBA 1HYGA 5C7LO 4K5QA 1JECA 1PGQA 4OEHA 4BGDA 3D6NB 3QXSA 1J24A 2DWUA 3HKEA 1QG6A 4KH1A 3QUSA 1N0HA 1P5HA 1VCOA 2ZSJA 2QRJA 5EZSA 2V0NA 2CEKA 4WK4B 1AB6A 1JQ5A 2P69A 3RWBA 2CV2A 1XWIA 1T3SA 2AG6A 2C2MA 1X7GA 3QYFA 2P2LA 3ZIAD 4AU1A 2GTHA 3HKBA 1AUVA 2OEPA 1V7CA 3IUMA 1JQLB 4LDNA 4UNQA 4UVHA 1DOAA 2F9FA 3EFEA 4C0WA 3PJRA 1TQDA 2A92A 3DFKA 4FLMA 3F98A 4ZOLB 2QTCA 2ATCA 4D0RA 2BP7A 3UWKA 5A02A 1Z5PA 5CVEA 4OJQA 5IAOA 4XCVA 1IY1A 1U2ZA 1KU6A 1XUOA 1Z73A 4UNRA 3ADOA 4LJ7A 3TSOA 2GF9A 3I2YX 5HS6A 2EFCB 3OPXA 3OQMA 1T6NA 1U8TA 4YMVA 1R8YA 1A9SA 3KKZA 4S1PA 3TAXA 1F5SA 2VDJA 3KHTA 4HLDA 2IHBA 4MWEA 5K0NA 2ZI5A 4V24A 3HM9A 1VA5A 3BM5A 1XZFA 3U4DA 1OXKB 3ORHA 3AUYA 4WAUA 2Q1WA 2VPZA 1VGRA 3AX6A 1X74A 2J9XB 3GCDA 3R0ZA 3C7DB 5SY9A 3VR3D 4DG9A 4IDDA 5JT1A 2WIJA 4EQ6B 4FDMA 1JIUA 1W8DA 2H1LA 3CNBA 5K3SA 3FPCA 4RO0A 3DCIA 4JZKA 4MS1A 5FTJA 4RAQA 3QGMA 1RQPA 1ODFA 2NZYA 3A1DA 5AVRA 1RLMA 4NIMA 4N48A 1SBTA 1ZD5A 2GRJA 2Z5VA 4ISBA 4DBVO 3HRIA 7REQA 1KYXA 5F12A 1JALA 4ROSA 3FJYA 3X1YA 3HCEA 3T9CA 1YTUA 2Z2ZA 3E2IA 3Q8LA 4C7VA 1O94C 1H69A 3DOUA 3NU1A 4JOQA 3GDWA 1VJGA 1YI1A 4NK5A 2ASVA 4OM8A 4U02A 5KOJB 3MUNA 1OA1A 1C41A 3WLFA 3H3XA 4DLRA 4N12A 4CTMA 2PLNA 1DP4A 1HDXA 1E2KA 1XKTA 2I03A 3E9YA 4PC7A 4RPKA 1QIGA 5CDUA 5LDDC 4YT8A 3H2IA 2BGLA 5BRAA 3AESA 5CDFE 5J2UF 3LHFA 4Z4QA 3MWJA 5KIAA 1JZTA 4PPYA 4RDCA 3GEGA 2UXBB 4EY5A 3MT8A 1W5BA 1S5PA 2RGNA 2I87A 4I1IA 4CLRA 1KEZA 3R5SA 5KJ1A 2MIIA 4RETA 1Z4IA 1T2VA 3PNMA 5J5AA 2VYCA 2WUGA 1Z25A 1XZGA 4ECEA 2AKEA 5F3WB 1D09A 5B53A 3PENA 1MOPA 1UPAA 2QRPA 1NBWB 2DKOA 1GZ3A 5CLQA 3WKEA 2YASA 3IV9A 3KAPA 1R4NA 1KRXA 3WQQA 2AC7A 5TGDA 4IIUA 5I7RA 1AO0A 2QN7A 1ACMA 3IAS6 1BNCA 4HY3A 2GCPA 2XJ4A 3ZWAA 1M2GA 3KTAB 3ZWYA 2RHMA 1NX6A 1EGHA 2WOOA 1IQRA 3CM0A 3KKKA 4UBIA 1NV9A 3CW2A 3MWGA 3U3MA 3EN0A 5HXAA 1GKIA 1K7FB 3A8TA 2GKSA 4YCSA 1SEVA 2XD4A 4DLAA 1IN4A 2HT6A 3AYXB 5TX7A 1L1RA 1UBNA 2I4RA 1CRWG 4NCJA 3OZDA 8MHTA 3A6DA 1VIVA 1QLWA 3AOEC 2YYZA 4P4SB 3KFLA 4MYDA 3AXSA 2PGIA 1CYEA 3W78A 3QBDA 1S3FA 2G36A 3FNHA 2VYQA 3FWZA 5JRJA 5HZMA 1OTXA 1QDEA 3KC2A 3A1NA 3TNYA 3VQTA 1PLJA 4AY5A 3EULA 5ARDA 3ZHZA 1HLDA 4OSOA 3RJZA 2GPSA 4WOBA 4WCFC 1Q84A 3MAAC 3RTGA 4FLFA 5F5XA 4FZVA 1EP1B 1FYDA 1UXJA 3KYJB 2XUAA 5A2GA 4HNVA 5KTOA 4CGZA 2W71A 2DTEA 2ZAGA 2ZIAA 4JYBA 5KKAA 3X44A 3JD3A 4DQLA 1SQ6A 5LQJA 4KH0A 1MB3A 5EJAA 1OFUA 3DTVB 3ABRB 4EPWA 3N3AC 2IPNA 3ICPA 1XTTA 3CU5A 3AUKA 1MV5A 1EG7A 2IEYA 1YIAA 2OV1A 1YDGA 2PT7A 4FYIA 4K87A 4Y0NA 2GN4A 1Y8CA 3NNNA 1X94A 1BFUA 3H5NA 4F4HA 3ANTA 4PXAA 5H3CA 2IIQA 2VQ3A 3B2NA 4AFNA 1DELA 1P6XA 2JGKA 3EIHA 5B2EA 1P3Y1 4BKRA 2ZI6A 3C6BA 1IRIA 1G3IA 2BGRA 1ZUWA 2HRDA 4KX5A 5D6NA 2LXNA 1NN3A 2HUPA 5ALKA 5JYBA 1B14A 1REQA 4DIMA 3G6KA 2QPTA 2P6RA 1RWPA 2FMIA 3OJ0A 5C8YF 2IHYA 5L8VA 3CH5A 4M87A 3G2OA 4CTJA 2PH7A 4GLJA 3L6BA 3DZFA 3Q6NA 3EEFA 5E4FA 3TD2A 4R8RA 5DNEA 1FSSA 1A7UA 1KI2A 5FBRB 5IDQA 3T0GA 4XUEA 5AM4A 1TMKA 4GNRA 4YCLA 2BFBB 3CNNA 5A6VA 2VNKA 1E1RA 1A9YA 5FAKA 2QRUA 3IPCA 3ASUA 3I04A 4NCKA 3ZWMA 4BVBA 3FCUB 4HYEA 1BX0A 5SYAA 4DSOA 3G88A 1G4AE 1RYMA 2GS9A 3AB8A 1M34B 2W7TA 3LOQA 5HNKA 3DVQX 1HE1C 4OP1A 2BE9A 4DR2B 5KTTA 1E2MA 3N39C 1GUYA 3FDFA 3ZS9A 3JQBA 2BONA 3CX6A 2XHEA 4IDNA 3PRYA 4BX3A 1P44A 5SYNA 4I8DA 4OHZA 5HGXA 3A1UA 2NGRA 3DDNA 3IBYA 4OK6A 5EFZA 3ZKWA 1E7MA 3J81k 1Q0PA 3KKMA 2RHCA 4NE9A 3S2FA 2QV7A 5D00A 5BW8A 1ZVKA 2Q28A 3ID6C 3GFGA 4K28A 4AUEA 5I4KA 1U63A 2I6XA 2JATA 4XAQA 5DCWA 2G83A 3WDLA 4ZYZA 2PUFA 4YRIA 4C0AC 4R9RA 3N3BC 1R6VA 1N6HA 5LZ9A 1U2RA 5HZGA 2BTOA 5I47A 5ITVA 1U5BB 1AIPA 1UFQA 2JAUA 4KGVA 1Y98A 4FSHA 4PZ9A 2W83A 1ST2A 4PZ0A 3GVPA 1MAUA 2WP0A 3TDNA 3SYRA 1DBPA 2ZUEA 3G0DA 3ILXA 3QFFA 1FS5A 2PK3A 4FCCA 5E6RB 3HJHA 2ATXA 1XD8A 4JL6A 4Q5IA 4XB2A 3ZHYA 4YQFA 5FWXB 5CFOA 1VSTA 3GHHA 3RIHA 4X9XA 5ESDA 3R9IA 1J9EA 4BQPA 3GZTB 4H0CA 1PJTA 2Z2JA 5HZKA 3THXA 1ZEMA 2BELA 2YOGA 5IXJA 1I6MA 3RJ5A 4N9QA 4MAMA 1QO9A 2XKJE 4MV4A 1G21B 1Z8FA 5EA2A 3RUDA 3SJAA 3W8FA 1K5GA 4DCUA 4KODA 4HNRA 4KW7A 4OI1A 3ELYA 2XE8A 3IP1A 1S2LA 3T7JA 2QBYB 2CZGA 4X94A 4HAVA 4BVJA 5D7BA 3HDVA 3TZEA 5HYVA 1E79A 1HE5A 4R7GA 1II8A 2EL7A 4AZ0B 2W0MA 3SN6A 1Z06A 2B98A 1U28A 2P78A 2UZ3A 4O4HF 3FAKA 4OFZA 1XPJA 4MDFA 3TXAA 1UL1X 4UDYX 4KOEC 4BB9A 1ZZEA 1CF9A 4JCOA 2X0KA 3A6GA 5LZ4A 2PKXA 4IJUA 4MX8A 2E87A 1N25A 2X9GA 2R1TA 3DMPA 3EBPA 2W00A 4L8WB 4HJRA 4OI4A 4XDZA 2IYXA 3SKXA 1J8YF 1P5ZB 1XP5A 3OZFA 1ZK2A 3GEDA 5EJGA 3SEZA 1XMOB 2Z56A 2P6PA 1XTRA 3W2EA 4D4KA 2JIQA 3T06B 4HTFB 1E4EA 5KYYA 2O8CB 2ZSUA 4PXSA 4QDOA 4PNPA 3HDTA 1O5IA 2K5UA 1GU0A 1Y63A 2GETA 2ONKA 3DFMA 3EWNA 5ANRB 3R3ZA 1NW8A 4ENUA 1W8IA 1J4AA 5ARBA 3SFVA 2QG9A 4KOAA 3DF9A 1E7QA 2GPTA 3RWMB 4NZ9A 4Z2YA 1FU4A 1NXTA 2JHCA 4CR6A 3LUBA 1ZMBA 2IH2A 1OWOA 3GN1A 1JA9A 1VZ3A 2GHTA 4GDMA 4WPGA 2F3QA 1RPZA 4NBVA 1ZMOA 3CR3C 2GM4A 3KCQA 1ILWA 3L05A 2XMGA 5KSOA 2GF0A 3CRQA 3QWAA 3L8CA 4ALJA 3NGMA 5LC1A 1XE3A 5K0EA 1JPNA 5FUQA 1KORA 1OUMA 2FKNA 2XUFA 1RKBA 3FHLA 4BBPA 5BSHA 1KY5A 4KO8A 1POWA 5I6DA 3PA8A 1QQTA 1VLLA 2CNWD 4Z0PA 4A5SA 2H9IA 4PS0A 5AI0A 4B3CA 2JLYA 4XYLA 3RIMA 1FP4A 1P0QA 3R8XA 3UKJA 1QZXA 2VT2A 3VNBA 2O7VA 1ZG3A 4M46A 4PTZA 3AI3A 4P6VF 5IASA 1AOXA 1DCMA 1R3UA 1L4MA 1SBYA 5DCLA 3GJSA 4EGSA 5JH7B 3BE8A 4OBXA 4CCSA 1S2IA 4MP6A 4H4DA 3T1VA 4HOYA 5KQMA 1L8AA 5CHEA 4KXYA 3HXTA 4P81A 3A6HA 2BEUA 3DT9A 2JDID 3QP9A 4RHXA 2ZULA 3SQDA 3JZIA 2AOUB 1EVQA 3GLUA 4IDOA 3ACCA 4W8GA 2FRDC 3KKEA 4BVKA 4BV9A 4DM4A 2QLFA 1ODKA 2MSLA 2P9CA 3FYCA 2OG2A 1YUMA 2J3MA 3IVAA 4JNKA 2C5EA 4GGPA 2MSDB 1U5AA 2Q2VA 4PXYA 2ZS7A 2OCKA 4E0BA 1CS4C 4OYYA 5FDFA 4IIFA 1HDRA 3KR9A 1JHZA 2BKUA 4B3BA 3IEMA 3VUFA 1WZCA 5TE9A 2R1ZA 1SCKA 4CIDA 1EXNA 1QOQB 1JFSA 1T6ZA 3FDXA 2QX8A 4PQYA 1NR5A 1K66A 1X8XA 2WNSA 5FUYA 4B2PA 1D4FA 1X1BA 1Z2CA 2CE7A 3F9IA 4KGZA 4ZMRA 2A5YB 3WDMA 2C7VA 1SPXA 1P39A 3RYCA 4BQEA 3UV7A 4HRXA 2AE2A 1PJLA 2GRUA 5IBPA 3T54A 4HDMB 4C7OA 4RABA 2O3JA 3DNFA 4QWMA 4WKBA 1V37A 4QFDA 4OHRA 2VH1A 4IINA 3OWXA 5A9TA 1XMVA 1E59A 3SCZA 3QEAZ 4P22A 2PL5A 3AUFA 1Q0UA 3P94A 1TLFA 1NULA 3GVIA 1L5VA 4KE6A 4RSGA 4ZYXA 4U2FA 1JNYA 1TEHA 2FMHA 5J4VA 3LCMA 5FH9A 3EY9A 3E7XA 2HA5A 1KJYA 4IH9A 1Z7GA 4AX4A 2ZYSA 2IW3A 2GDZA 2ACWA 2Y3IA 3D8UA 4D5EA 3SX0A 1YRHA 1VCHA 1IDN1 2NUPB 4PX3A 2B8EA 1MR3F 2B30A 2EU8A 1TUIA 4JC5A 5KZMB 3VTZA 5KNBA 1MOSA 4OGGA 4PEVA 2Q0XA 3ZZNA 5FFMA 1CZUA 4Z7QB 1UEJA 1WIWA 5JW6A 3W9SA 2QLNA 1DXOA 1CKEA 1EJBA 3I6ZA 3OD5A 4QG7A 5DBHX 3PX7A 3PHIA 3LX6A 4MWSA 3VI4B 4H6XA 2HO4A 3OT1A 4OQMA 3WL4A 2V6IA 1NVVR 3M34A 2JL1A 3QUTA 5AKGA 5EYPA 2MHCA 4NAVA 2FFRA 1NAIA 3GJ5A 4RM3A 5E1OA 1A95A 1D1QA 3FGNA 3TDKA 4BWVA 2Q2QA 3JS5A 2NO9A 5FOQA 3RBXA 2ENWA 1NXVA 4JDPA 5CLIA 2FDCA 1FNDA 5AUOB 1ZS9A 2AT1A 3W7VA 2Z3ZA 1EQAA 3CJQA 3I9V6 4M9ZA 5CBPB 1G8FA 4Y2HA 3CW9A 2AYZA 5KYKA 5AFSA 1IJBA 2NXWA 2PM8A 4R7TA 3BUSA 4F5ZA 1U8UA 1ZJYA 2GXUA 4Q15A 1KBZA 1E3DA 2MYTA 4RKQA 4F4DA 5LMUB 1AO3A 4Z9FA 3G7SA 2Q1UA 5B3AA 3UJCA 3SZ3A 4UUNA 1RPAA 1QP4A 3H65A 1TVKA 2ZIEA 3HP7A 4URXR 3NVKI 3LXUX 2DHRA 4MWOA 1WMBA 1Y7IA 4KNYA 2GA8A 4GZ6A 3VH1A 1J97A 1E5VA 2IUTA 4FBMA 4K9QA 5G3YA 4L57A 1FXWA 1AGPA 3ZYCA 2WJVA 4PO9A 1EE9A 1KY3A 2CE2X 2M32A 2RI1A 3DHWC 1M2WA 2ZXEA 2HSZA 4NOLA 4U7JA 1IBCA 4NLLA 3IEIA 2WIFA 1MJGA 2J9FA 2ZUCA 1EFPA 2EX1A 4R05A 1NW7A 4JX8A 1P3JA 4NULA 4P36A 1DRKA 2YMQA 1NW4A 1NVVQ 2O0HA 3MILA 2D3TA 3PXEA 2QSYA 2FSFA 3DW1X 1QQBA 4RHTA 2AJDA 3LO5A 3K09C 4MA5A 1II0A 2E4UA 3IKJA 1SVMA 4FHZA 1MB9A 3EIOA 2ODQA 1RHMA 3HA7A 3C1AA 4O4JA 4EF4A 4F46A 2D2IA 1E5TA 2BSAA 4KVAA 1IUNA 2BTEA 3SSNA 2FUEA 2IYWA 4NU6A 5EWMB 1DARA 5JNUA 2VSXA 4BFCA 2A7XA 2Y9PB 2AMJA 3K73O 4I6GA 3BS4A 1V11B 1Z4QA 1RBQA 2AFIE 3ABSB 3AMVA 3DOHA 1D2MA 1D4ZA 4W9NA 1JJ7A 1K3UB 1Z75A 4DV2B 2W6ZA 1LS6A 3THWA 2HWWA 1Q57A 3M8KA 3TMYA 4M7WA 2GVDC 1RADA 1QAMA 2QTBA 4A8JB 2HWKA 2V4ZA 4J4HA 3KUDA 1Z0ZA 5F7JA 1G0OA 2IYZA 4N8DA 3EA5A 2FSUA 3SEFA 4UC0A 2WWWA 3G8DA 4D2IA 4HDKB 3TLBA 2AQHA 2PSEA 2ZTHA 3MT7A 1YVEI 1CDZA 3GLGA 3EBLA 4OXKA 5A5DA 1GA1A 4R2WA 3COZA 3F5SA 1B8NA 3D2CA 1BWPA 4C29A 3TMAA 4J1QA 3MCTA 5FPPA 3VR4H 2QB5A 4B3SB 4GI7A 4C3UA 2CBZA 2VAPA 5BSGA 3QV1A 2ZSBA 2ZZNA 3P9CA 2MINA 1JFFA 1Y8RA 2E4YA 2QM3A 3GT0A 3NBXX 4W5JA 3ZBQA 3PWTA 4DDKA 1U0GA 4ZOCA 3G7NA 3I1JA 4YRRA 4QT4A 5CD9A 5HHTA 1OFGA 4ZKEA 3K72B 5AXDA 5LBIA 5DKFA 3TSYA 3X2SA 3EMVA 2DFLA 2Q29A 2RGNC 4CMBA 1SKYE 4F9GA 2O1WA 4JGGA 1EFVA 2BEJA 2B5OA 4QYMA 5K5EA 1QFZA 1KWGA 3A4MA 3OTHA 3SLGA 4YLGA 4LDRA 4LGYA 4WZAB 1KGDA 2B82A 4M55A 1ENOA 1DLIA 1JPUA 3F7OA 4JQSA 2VFAA 3T3OA 3PDIB 2WSYB 3GUYA 2UDPA 1U2EA 3BCSA 4XQEA 2ZPUA 2F55A 2EZ4A 2C58A 4E30A 1P45A 1OH5A 3FB1A 1X0XA 1F20A 4B76A 1CZRA 3MTEA 4CQMB 1E1RD 4HKTA 3OG9A 2VJPA 3L18A 3UC5A 1N5MA 4A36A 2C29D 3ND8A 2I9KA 2BJVA 3FSGA 3AGQA 4W5WA 3FCYA 2IOHA 2AOVA 4IRMA 2VF7A 3GG9A 3RC9A 1HLPA 3LQYA 3LUPA 3MUFA 3O2SB 1WY5A 4L6AA 4B3HA 5KB3A 4BO5A 2KQUA 4DCPA 2PS9A 3QZUA 2JFBA 4Y9DA 4DDMA 1VC2A 1TEVA 1XCLA 1H0KA 2Y4OA 4HVLA 2QRHA 1IONA 1KAHA 1MTOA 2VSNA 4FHGA 4TSFA 4BO4A 2BFEA 3OEWA 2JLXA 3P0HA 2XCUA 1FQJA 4EPVA 2PRIA 4B81A 1E1CA 5DLDA 3PXAA 2BLNA 2OQIA 3QBVA 5ALRA 1J0AA 4HCJA 1LRKA 2AEEA 4V2UA 3A6EA 2MYUA 1JLHA 2I8LA 4TL9A 5KYWA 2CXOA 2WWIA 1N5DA 3B2QA 2Z5GA 4JZYA 1P75A 3X3HA 2J33A 3X2FA 3BJEA 4N6GA 4TUYF 4ENQA 2O2EA 4H35A 1PAUA 2R7KA 3JQAA 3NVDA 1Z15A 4HDRA 1CV2A 1LCIA 3AKEA 3QHAA 4CUJA 5JYCA 3EUFA 5F4ZA 1R0XA 4OI0A 3GFSA 3D6JA 1T3ZA 1LF5A 4FONA 3A1EA 1CQJA 2C00A 3UT5A 3FZYA 4EHBA 3PJFA 4X90A 4NH4A 3IBCA 3GFOA 1TJPB 4YLYA 2O8FB 5AKHA 3O4JA 3R9XA 2NYAA 2XRYA 3ANLA 2O2CA 4LOIA 4AO7A 4FFRA 4BGEA 1KEKA 1RACA 1F2TB 2EIHA 2O5VA 3DL0A 4RM2A 3Q6MA 4C4ZA 5ALGA 4IUBS 1N8TA 3FUXA 4YP6A 4FHFA 4F3YA 2WDPA 4Y2TA 5KAPA 4EKYA 1LNZA 4M7RA 3CC8A 3WGOA 2E9SA 4U2EA 3WKDA 1IC6A 6ADHA 2PKRA 5GOZA 1HNXB 3SE0A 3ZX4A 1CP3A 1RYNA 1CZHA 3P9KA 2A0YA 3ZGOA 4CKXA 1XHFA 3I6YA 1ZJWA 3ZOKA 4AG3A 3HCOA 4CV1A 1ISJA 5IVPA 1KHHA 1GDHA 2ID9A 1DTWB 1QK3A 3JWGA 1IHOA 3QVTA 3GLHA 4G25A 4G97A 5EJ7A 1YFKA 4UE3S 1J25A 1A9XB 1NUTA 1WV0A 2GT1A 4BBJA 3SX4A 3NHZA 3SXUB 4EMBA 4PSDA 1M5RA 1ZXXA 1BGXT 1QVRA 2EXXA 1W4ZA 2QX4A 3DTYA 3T3IA 3TOCA 5JAZA 3WQHA 1CPYA 2QL5A 4M38A 1YBFA 1Y6ZA 1YCHA 1LBSA 2R8EA 2ZATA 2ZITA 4JQYA 5FUXA 2VTKA 2RKWA 5G53C 5LYYA 3WX0A 4TS1A 1RKUA 3BTOA 5D3QA 4LA4A 3OT5A 1T36A 3IO5A 3PZBA 3RKRA 4X7MA 1YJXA 2G08A 2HU8A 4XQCA 4DNFA 3MJDA 4DREA 5DNUA 1WVMA 4QBGB 2SICE 2AH5A 3ZUGA 3EXG1 3HCPA 4IDPA 4TWJA 1WHSB 4A6EA 3H4MA 1O0BA 4MV3A 3ZWXA 1GRQA 2BTQA 1ZJZA 5I9TA 3KQQA 1CQPA 4LECA 5LM3A 1ML4A 5JRZA 1BXZA 1OXTA 2P7HA 4MIKA 5HKBA 3PWZA 3HCFA 4P84A 3ZHVA 5FTKA 3Q41A 5ES3A 3Q11A 3EZYA 4H6PA 4HL6A 1DJLA 1BE0A 1F14A 1HQYE 4MR7B 4PR3A 2AYYA 5FV7A 4QYWA 2EFGA 1SNYA 1ZM7A 5B12A 9MHTA 1J42A 1IHXA 3GPDG 5JCPA 3BIFA 1UJ5A 1ID1A 3SDSA 3CS3A 1RFLA 4ZYTA 1GXSA 2ZI4A 1ZMRA 5EIHA 3AR7A 4DGQA 4PF1A 1QFSA 1ZR4A 1RJDA 3KWJA 3T3GA 3DZGA 3QI2A 1W46A 1VPWA 1N3IA 2WUVA 4AJNA 2Z3WA 2WFLA 1F12A 3LAWA 3FWYA 1M67A 1U28C 3HSSA 2EW2A 5F7ZA 3ZKAA 2H6EA 1NA5A 5FBQB 3P96A 1B0UA 4MR8A 4REQB 5JXJA 3DP7A 1NNUA 1UK9A 3OE7D 4OQYA 1TTHA 5LU9A 1XZAA 4NBKA 4OQDA 3C3CA 1LDEA 1DBWA 1VYTA 4X45A 1CRPA 1AHPA 1CZNA 1Z47A 1CT9A 3PXGA 1YE3A 1R0CA 4QBKA 2Q0QA 5DTIA 5LIRA 2WVJA 4L2IB 3H9UA 3W0LB 5KDDA 4DJAA 4BO3A 1TM4E 1IOZA 2YJGA 4JBNA 5KNDD 3Q1KA 1QGDA 4DMCA 3DTVD 2GJKA 2VAWA 4L0QA 4YMGA 2JKVA 2HX1A 2YY6A 3VV3A 2I54A 2WIAA 5E9WA 2BGGA 1FNSA 2J85A 3HDGA 4CF3A 5EZYA 1SA0A 3GRUA 4X65B 1JR4A 1X86B 1R8JA 4Q3NA 5THKA 1EUDA 4H7DA 2HRZA 4YT4A 2PRZA 4RDXA 2JFPA 4ZAYA 4GBED 3FF4A 1UK6A 2PQ0A 1X7ZA 2IUYA 4RYLA 3RYFA 3JASB 3MLAA 2IEZA 1TZ2A 3AGPA 3E5RA 1QTIA 3GFTA 4PO3X 2X8LA 5T3UA 3ROKA 3KKQA 3EX7C 4Y1FA 1QRSA 4GOND 3WRWA 1O1YA 3TH5A 3BTVA 3RLFA 1W0KA 6ABPA 4P3PA 4FMBB 1I7NA 2HK9A 4U9HS 4WLUA 1ZWKA 4XOIA 1AKEA 4LJKA 5H80A 4FYPA 4HNAB 4LYYA 4C7JA 2CNNA 2V7XA 5AVJA 1F17A 3TJMA 4IOJA 1KEEA 1E6WA 4GI1A 4UXHA 1FX0B 1FFXB 2KM1A 3ECCA 1WY7A 2VAVA 3QWHA 3U6BA 3R9WA 4BFLA 4DKXA 3GRFA 3V42A 5H0IA 2PUBA 3KWMA 3BMOA 2CK3A 1AKYA 2NW6A 2RHOA 3PPIA 2A67A 4R40A 3V4PB 3WIUA 4EKNB 4PNEA 5JC8A 2XNJA 1DJMA 4URUR 2VSOA 3OU6A 4IFIA 2QNRA 4RJLA 3TL2A 4YV0A 4OQNA 5AVXA 1T4DA 5BURA 1FIUA 4ZIRB 2WM3A 2J6CA 4PLCA 3SMQA 4QUEA 1YB4A 2D1TA 3IKTA 2QQEA 1E3WA 5EHGA 3Q7RA 3I53A 4MKXA 1B6GA 1IHPA 4TTSA 1PGJA 1JHRA 2R96A 3D0KA 3O91A 4RHYA 1TUGA 3BSYA 4NENB 2ZRLA 1UBCA 4LEIA 4RF2A 1QKIA 1W52X 2IE0A 1XQXA 2QJOA 2Y67A 2CZQA 2QQGA 3RVSA 1LDNA 3P32A 3O1JC 3PJEA 1RHRA 1PDOA 2HLPA 4HZUA 4X3PA 4ZCRA 2ZTUA 3OQIB 2J8ZA 1HFEL 2BFCA 3LX5A 5ED0A 3EQZA 1Z7EA 2XOKA 2W6MA 1S2MA 4RV4A 2KLHA 4CQNA 1R1DA 4AKIA 2VYFA 4LXQA 2RBGA 1SG9A 5CCDA 2OHVA 1G1MA 4HLCA 1MIOA 3OZWA 2R11A 1U90A 3JYPA 3T9AA 3KJHA 1EVEA 1I3CA 1L4EA 4K2AA 2F8LA 3K4PA 1LTKA 1DKRA 3C8HA 2J0VA 1BEEA 2VAMA 3KPVA 4FHEA 5ADUS 1Z28A 4IHKA 1COZA 1KO7A 4MI3A 1KAOA 4LY0A 2F3TA 5TNXA 1VSQA 2SECE 4LF9B 4KB5A 2Q3FA 4XGIA 3TG8A 1QJ4A 1QH9A 1WD7A 1QHHB 5EPUA 5FLXA 3ZD6A 3WZ2A 4JROA 3P2JA 1U0EA 3B9PA 3H5OA 1U0OC 2NYVA 2XX3A 1TGVA 1I3LA 3Q8XB 4UW9A 1JV2B 4XJXA 3ZY4A 2V74B 3KQHA 4ZYYA 3BWXA 4FHDA 4MV5A 4F93B 3CW8X 4MNTA 3UA3A 2CVPA 3Q85A 5D8DA 3BH0A 3JRNA 1AA9A 3LW8A 4W4TA 1DEXA 1KP2A 1O9GA 2FW0A 2JJYA 1L7NA 5DHAA 5G1OA 5DX0A 3D3WA 5EKUA 3WFZA 1KO4A 3KZOA 2VRWA 4G1MB 1QHIA 3UFXB 4FFSA 2B78A 3N2LA 3OUZA 1FFEA 5KYTA 2ZTLA 1H9CA 4ZQCB 1ZQ1A 2UVQA 4BNDA 3AEZA 5FR1A 2R4QA 1OLXB 2FR1A 3FIJA 1RAEA 4EKEA 3I4CA 1N75A 2XUHA 2W2PA 2YRFA 4KQIA 1Z5OA 4YJ3F 5HGJA 5KNCA 3IOMA 1Z6ZA 4N76A 1EWTA 1S0UA 2WTBA 1RWMA 4DY4A 3DAOA 2IZZA 2YJZA 4YN3A 2BEVA 1KVTA 1AQNA 2IHTA 1QF9A 3G8YA 3GFVA 1I7PA 2KHZA 3RO7A 4WEQA 3UB4A 3VDXA 3W1VA 2CHUA 1H4QA 3FJOA 1U1GA 1ZUNB 2RSLA 3AVWA 2Z8YA 4G65A 3ZE1B 4E09A 1IATA 1NMXA 2NO6A 1CS0B 1RYDA 3UJPA 2PIAA 4ETMA 1KNQA 1SZCA 3GEHA 4S1WA 4HNUA 1AKQA 3SMVA 1BWSA 3V3KA 3WSVA 2W6QA 3GFFA 4Y0VA 1W5EA 4H2DA 1G6OA 1WSBA 4FFNA 4E3ZA 4FINA 4LOHA 5F35A 4B9EA 4OP3A 2CXXA 3T94A 3TWOA 1HA3A 3H5AA 3IE0A 1IM5A 3I45A 3R4VA 4ASUA 5TMBA 5AESA 5A03A 1E77A 1R18A 2Y1EA 6NULA 3K9LA 3LYAA 1ZK4A 2PIDA 2Q9CA 3KZMA 5D6OA 5ALNA 3VOAA 1L5WA 4BRZA 3GAFA 3QOWA 2HC9A 4V0QA 5M3BA 1QAQA 3HB9A 4PLWA 4KLCA 5GAJA 3S70A 3VDNB 1S8OA 4D6YA 2HTEA 3K96A 4DLTA 1CNEA 3C39A 4GO1A 1E7WA 3AI2A 5SY4A 3WI7A