1VL5A

Crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
b'GSDLAKLMQIAALKGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEELHCFHKTFIFEDWCDRMNVTTEKKQELSDFIKSKPTEYYQKFKIVVEDGRVYSFRGESILMKARKPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown conserved protein BH2331
publication title Crystal structure of hypothetical protein (BH2331) from Bacillus halodurans at 1.95 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 78
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vl5A00
1KIAA 4GOMD 3C6MA 1AF7A 2CWWA 5DTRA 4NECA 4U7PB 4IWNA 3CCFA 2YVLA 2YX1A 1RI2A 3GRUA 2K4MA 2VDWA 2Z6UA 9MHTA 3BZBA 3AXSA 5DX1A 3WSTA 4PIMA 4ER5A 5E1BA 4OA8A 2I62A 2OB2A 4PYIA 3P97A 1DCTA 4M37A 5LQKA 4E30A 5HILA 4PYQA 1D2CA 5K0BA 2AOUA 3PB3A 4RTSA 2AOTA 4KWCA 4EKGA 1VBFA 1I4WA 1XXLA 2HNKA 3DXXA 4CWAA 2QE6A 2IBTA 3FZGA 1AQJA 3NTVA 2FYTA 1NW6A 3AY0A 5ICFA 1VLMA 5CCBA 5KVAA 2UYCA 1KYWA 5HFJA 2R6ZA 2YXEA 2P8JA 3G5LA 4PYLA 2EJUA 4XUDA 2A14A 3DLCA 5EHGA 1AQIA 2AVDA 1NE2A 1TW3A 3EVFA 4V0QA 2UYHA 3BWBA 2IDJA 5D1NA 2HR1A 1F3LA 2OB1A 3PX3A 5GM2A 3V97A 3LCCA 4EMSA 4KW7A 4IV0A 5GIPE 4OX9Y 3T7TA 4GF5A 3MQ2A 2WA2A 5ERGB 4IV8A 1ORHA 2EFJA 2ZW9A 5CVDA 3GNLA 4Z2YA 3SSNA 1EJ0A 1G55A 4C4AA 3IHTA 2JH9A 2HMYB 4GOLD 3OE4A 4KIGA 2IH4A 2YXDA 3MHTA 1JR4A 2H1RA 5HOQA 1UIRA 4QDKA 2GA9A 3BKWA 4YUXA 2Z6QA 3HNRA 3BGVA 3TKYA 3FTCA 3PFHA 3FPGA 1NBHA 3KPJA 3BXOA 1D2HA 1P39A 3SGLA 2PLWA 1NW8A 5HIMA 4E2YA 3UA4A 1G60A 5FUBA 4DMGA 2H11A 4OBWA 4RTMA 3G7UA 4U7TB 3LX6A 4RVFA 5CCXA 5HIJA 5IKMA 3ANXA 3B7PA 5CUQA 3DR5A 1KXZA 3EEOA 1RJFA 4DKJA 3NVKI 4H0NA 3B5IA 1BOOA 1IXKA 3HCDA 3P2KA 4AZWA 3U81A 3P9IA 3PX2A 1PJZA 2OXTA 4PONA 3EVZA 1DL5A 4FS8A 4RTLA 2PGXA 1HNNA 3OU6A 5HEKA 4C03A 2ZIFA 5EQJB 3HA5A 4Y2HA 3PTAA 4CTJA 4C05A 4DCMA 2OPBA 1I1NA 1XCJA 4RTNA 2BR5A 2CL5A 3FUVA 3MCTA 2FPOA 1VP3A 1JG2A 2EJTA 1FP2A 2QYOA 1G8SA 2Q41A 3A7EA 3KPVA 4RTOA 3LKDA 2G8NA 2NYUA 3QV2A 4GOOD 4YMGA 3A27A 3BWYA 2H00A 3G2OA 5F2OA 2ONYA 5GP1A 5DM1A 1SQFA 2UYOA 1JSZA 3LL7A 3DTNA 3BWCA 2I9KA 4X61A 2AS0A 2ADMA 3EPPA 1WZNA 1R6AA 3OE5A 1BKYA 1PRYA 1M0EA 4RSRA 2PXAA 1NBIA 4KDCA 4CKEA 3TQSA 2V7EA 3AXTA 4CKBA 10MHA 3M4XA 5BP7A 3I5UA 5HIKA 1AV6A 3UBTA 1YB2A 3E7PA 5P8WA 5D1HA 3C3YA 1RJGA 3KQMA 1M6YA 1D2GA 1INLA 3G8AA 2VDVE 3HEMA 5EGSA 3LBFA 5GINE 3OZSA 5DM2A 2ZZKA 3H2BA 5CVJA 4YMHA 1VQ1A 2P3LA 4ER6A 8MHTA 3GXOA 5DSXA 4DZRA 3I64A 5K0LA 2JH8A 5KYGA 3LCVB 5B1SA 3I58A 1YFLA 5LQNA 1OR8A 4RTKA 3O4FA 1JTEA 3EMDA 2ZSUA 1RJEA 3EVBA 3ELDA 3KPUA 4GC9A 4L7VA 2ZBRA 2B78A 3EVAA 3LDUA 4PCLA 4QPNA 5E1DA 4CKCA 2N47A 5ICGA 5CVUA 3HTXA 2IPXA 5K05A 4P7KA 3IV6A 2NP6A 3GCZA 2O07A 5FHRA 4E2WA 2JHAA 4QQNA 3KU1A 4GBED 5EPEA 3P9KA 1WS6A 3X0DA 2ZBQA 4PYOA 3TOSA 5DXJA 3GRZA 1KP9A 2FCAA 2C7OA 1G38A 4R8SA 1EAMA 3A25A 1YUBA 3HA7A 2FK7A 3NJRA 4CTKA 4QDJA 2YQZA 3OU7A 3M6VA 1F38A 2LD4A 4EK9A 4F84A 3RW9A 2PWYA 3G2QA 3R3HA 5ICCA 2XYRA 4X63A 2P1DA 3TFWA 3TKAA 3CJQA 2P3QA 4DF3A 3OPNA 1L3CA 3CKKA 4ISCA 5C0OE 4V0RA 5C1IA 2G1PA 3O7WA 3M70A 3QOXA 4GQBA 4GEKA 5GWXA 5DM4A 3M6UA 3MB5A 2P35A 3NWEA 1NV9A 3HP7A 3G88A 1EQAA 3DP7A 3P71T 5FQOA 4PYKA 4ER3A 3UJAA 1XCLA 3P9CA 4QVGA 2PKWA 1L3BA 4HTFB 4R6XA 3VC1A 3LPMA 3BT7A 2P7HA 4LG1A 4BP3A 3UWPA 3BGIA 2AR0A 2IIPA 4O29A 4ATNA 4BP1A 5E9WA 3MAGA 4E2ZA 3A4TA 3G2MA 2ZCJA 1BC5A 1QYRA 3DLIA 3UFBA 3ELYA 1G8AA 4OQEA 3EVCA 1R00A 5CVEA 3KQWA 3FPEA 5EHIA 2B9EA 2GAFA 1R18A 2OKCA 2WA1A 3OZRA 4PYNA 3AJDA 3Q7EA 4XUEA 4YV1A 7MHTA 4X60A 4RYLA 3I53A 4OA5A 3DULA 5K03A 3PLAE 3HCEA 5E1OA 3B3FA 3FPFA 5LQUA 1WG8A 5K0CA 4YUVA 1R8XA 2JHCA 2PV0A 3PFGA 5DSTA 4E33A 3DMFA 3GIWA 2ERCA 5LR6A 1MJFA 4RTRA 1ZGJA 2PT9A 3FUXA 3R6TA 3DH0A 3FRIA 2IP2A 5H02A 2ZZNA 3OFKA 4HH4A 4K6MA 5DX0A 2VDUE 3P8ZA 5LSAA 4DQ0A 2ZIEA 4OQDA 2I7CA 3ERCA 3HCCA 4QTTB 4LWOA 3KR2A 2IBSA 2PY6A 4KRGA 2QRVB 2PSSA 5DXAA 4X1OA 1P91A 2ZBPA 5MHTA 2NP7A 2YTZA 3MCZA 2DULA 1ZG3A 3KHKA 4GOND 3OFJA 5F2NA 2O0LA 4KDRA 3K0BA 4PIPA 3HVKA 5K01A 3KQQA 2DPMA 5EKXA 5K0NA 3HVHA 4LECA 1QANA 2OZVA 3GWZA 3HCFA 1JG3A 2I6GA 3SMQA 4DA4A 2QY6A 1P1CA 4QQKA 1VE3A 2QM3A 2EG5A 2P40A 1YZHA 2O57A 5DT2A 5EIFA 3T7SA 1TW2A 2F8LA 2IFTA 2ZWAA 1Q0SA 5EMKA 2P41A 2C7QA 3GO4A 5T64A 1N7IA 5FTWA 1RJDA 2P7IA 4HC4A 3SM3A 3AWIA 3BGDA 2C7PA 1EG2A 1SVUA 1Z3CA 3FUUA 4ER0A 5BW4A 3B89A 5LQAA 4P7JA 3PVCA 5EOVA 3SSOA 3SX0A 4PINA 4GUAA 5K09A 3OCJA 1XDUA 2ZTHA 3SR4A 4G56A 2NXCA 3FYDA 3S68A 3EGVA 1JQ3A 4PYJA 5FA5A 1R8YA 5LQJA 5DRYA 3ID6C 3I9FA 4R05A 1WXXA 1XDZA 2HWKA 4E70A 4YV2A 5E1MA 1VPTA 2AOWA 2IDKA 3EVGA 3TRKA 1NW5A 4WVLA 3HCBA 5CVVA 4P58A 1XVAA 1R74A 3HM2A 3EEYA 2PXCA 3VC2A 5E8JA 4HGYA 4JXJA 2IH2A 3GDHA 3ER8A 5EMJA 2FRXA 2ZIGA 3V8VA 3HA3A 1KYZA 1ZQ9A 1SUSA 3NW9A 1WY7A 5DM0A 2NXJA 4RVDA 5EG5A 4A6DA 4YV0A 2V74B 3THRA 1Y8CA 3FPJA 3QOWA 3TLJA 4RWZA 3RODA 4MIKA 1EJ6A 2ZVJA 1SQGA 5E9JA 5HIIA 5K0EA 5FCDA 2PWPA 1O9HA 2YR0A 2GS9A 5EVJA 5F2KA 4AUKA 3DUWA 3CJRA 3R24A 4ER7A 1MHTA 3TM4A 1EIZA 1SKMA 1X1CA 3TM5A 4HTFA 1KR5A 1VL5A 4ZTBA 2G70A 2JG3A 1WXWA 1H1DA 1XTPA 5LQRA 3KQVA 4YUZA 3FUTA 5BW5A 4CXMA 4BY9E 2XYQA 3CGGA 3BWMA 3CJTA 3B3GA 2WK1A 2IH5A 2PVCA 4HRAA 3LDGA 1RI5A 1P1BA 5DX8A 4MHTA 5EKUA 4MTLA 4R8RA 2CMGA 3UJ8A 2PXXA 3EVDA 1YFJA 1XJ5A 4FR0A 1X1DA 5FQNA 5GOZA 1JQDA 2BH2A 2PBFA 4RTQA 3THSA 3KPWA 3GJYA 3ELWA 3M6WA 4DM3A 3NMUF 2B2CA 1NT2A 3KR0A 2OYRA 2EX4A 1UFKA 2ZWVA 5CIYA 5KS2A 5E2AA 4M7RA 4FGZA 2YXLA 5E2BA 4A6EA 3E23A 5DRTA 2UZ4A 1JQEA 3O31A 2P3OA 3OU2A 3L8DA 1BHJA 3CBGA 1JTFA 5CD1A 3LGAA 3FYCA 2XYVA 1TPYA 1G6Q1 1O9GA 4FT2A 2ESRA 5EZSA 4MWZA 3KQOA 5EC8A 1IM8A 3C6KA 1L3IA 5KQSA 5LQCA 2QRVA 3G89A 1T43A 1N7JA 1KPHA 3LBYA 1JG4A 3LHDA 3P9NA 5DPMA 2O06A 2O05A 2FHPA 1ZGAA 2GLUA 5EIWA 5FULA 5K0JA 2AOVA 2ZFUA 1B42A 3SVZA 1FJXA 3KKZA 4RVGA 2VZ9A 3LSTA 3GRRA 2E5WA 3FUWA 1FPQA 1X1BA 5DWQA 3HCAA 3JWIA 4C06A 4HGZA 2GPYA 2ZULA 1X19A 3NDJA 5DTQA 2PX2A 4AX8A 1QAQA 5DLYA 4F85A 3KQYA 3IEIA 3REOA 4F86A 4FSXA 1VIDA 3IYLW 2IGTA 4R6WA 4P7FA 4HG2A 2HTEA 3OZTA 4FP9A 3UJ6A 5KQRA 3LDFA 1L1EA 2PT6A 3A26A 2BZGA 3T7RA 2BM8A 1RI3A 4X41A 5C9ZA 3C3PA 3FRHA 1FBNA 3G8BA 4C04A 4YUWA 4OBXA 3E8SA 4FSDA 2AVNA 1NW7A 5FWDA 2B25A 1QAMA 3KQPA 5G02A 3UJBA 5JUWA 3HVJA 4FT4A 1NW3A 4PWYA 3UJ9A 5GIOE 2OO3A 2G71A 3D2LA 4UOEA 4C08A 2AOUB 2AOTB 1IY9A 4Y30A 3M6XA 1RI1A 2YUIA 1JSXA 1ORIA 2BM9A 2XVAA 3DMHA 1UWVA 3UJ7A 4AZTA 5HZMA 3GRVA 3KR1A 3R0QA 3TMAA 4BLWA 5JR3A 5FADA 3FTFA 5E9QA 2PX8A 4P7GA 3ELUA 2GH1A 3F4KA 3SXJA 1I9GA 5DTMA 4GC5A 5FWAA 3VYWA 5K0GA 3B3JA 2KW5A 4M36A 4WXHA 3SSMA 2AN4A 1V39A 3A7DA 4MQ4A 3Q87B 2CMHA 4B17A 4RV9A 5E8RA 4AZVA 5CM2Z 2JHPA 4EKIA 4E2XA 3NWBA 2XBMA 1RI4A 3EMBA 3M33A 5EMLA 2BR3A 2Z6AA 4EVIA 1N2XA 1FP1D 5IH3A 3CVOA 3P2IA 2NNWB 4KIFA 4QPPA 3P2EA 2G72A 4FZVA 2OY0A 1M6EX 3DXZA 1QZZA 1KHHA 3EGEA 3EVEA 5BXYA 2Y1XA 1HMYA 2UYQA 3NVMB 2AN3A 4PGHA 1SUIA 2VP3A 5EMMA 3G5TA 5FA8A 1X1AA 2ORED 2AZTA 5EEGA 3LECA 3LCUA 4XUCA 5FHQA 3BUSA 3JWGA 3PT9A 3NDIA 4QTUB 1DUSA 2ZLBA 5K8VA 1Q0TA 3DMGA 3E05A 4RVHA 3UA3A 3UJCA 4E32A 2AN5A 5EZQA 3K6RA 1ZKDA 3TR6A 3TPZA 1L9KA 1VP9A 3JWJA 2NXEA 3KQTA 5EEHA 4EQZA 3CC8A 3FPHA 2GB4A 3G2PA 2PX4A 4QVKA 3FTEA 3GU3A 3DXYA 2VS1A 1SG9A 2PJDA 3ME5A 2ONZA 3GGDA 4RTPA 3EGIA 4BLUA 3KR9A 1NV8A 2FK8A 2XVMA 3MGGA 1ZHFA 2R3SA 3PS9A 4KVZA 4YUYA 3MERA 3JWHA 1NKVA 3KPYA 2B3TA 4M38A 4POOA 3C0KA 3MTIA 4HSGA 1YZ3A 3DOUA 2HV9A 5ICEA 3R9XB 1KPIA 3FTDA 3UJDA 4PYMA 3RIEA 3ER9A 3GRYA 1KPGA 4C07A 3BKXA 1JG1A 5K0FA 4RTJA 4RX1A 3UZUA 4E31A 2BR4A 2CKDA 4LWPA 4XCXA 5GM1A 3T0IA 2JJQA 4PCAA 3MTEA 1QAOA 2NXNA 3KQSA 4IKPA 1U2ZA 3HVIA 5U4XA 1YF3A 2OBFA 3VSEA 2C7RA 4BLVA 4AZSA 4PNEA 1O54A 5T6BA 4PGGA 5M5BA 3ORHA 2AOXA 2Y1WA 5T67A 4DCGA 2PX5A 2ZZMA 1XDSA 3LKZA
chains in the Genus database with same CATH superfamily
4DDVA 1F06A 3TMYA 4GPZA 4F4JA 4F3YA 5ANRB 6ABPA 1JBEA 4U7PB 3A9RA 5K3CA 1IHYA 3BJRA 1SVIA 1J2TA 3IOMA 3DONA 3GVIA 1UDBA 2ZRBA 2WTUA 1XCBA 3L46A 1JLMA 2JI4A 2IEIA 3FNGA 3K09C 2O8DA 1HFKA 1OBCA 2GFHA 2C4VA 1C7JA 3EF1A 3OTQA 4KE8A 4P53A 1NJ2A 3HV0A 1D2CA 3PB3A 2OZLB 4F3KA 2X23A 4BLOA 2D0DA 3OOEA 3INYA 5AM5A 1MHPA 1U65A 3LY5A 5KNDA 4W5RA 2IBTA 2FRDC 3NTVA 4UXIA 2HZBA 4HQOA 2V59A 1ZD2P 2QVZX 2UYCA 5DNYB 1WVMA 2WFLA 3FWNA 4FEAA 2P8JA 3DOJA 3MMXA 3I72A 1GR0A 4KZPA 4LY0A 5DT9A 1ZESA 4G5QA 4BLPA 2SHKA 4DR1B 1OIXA 3RUFA 1W73A 4RU1A 3NETA 5GOTA 4Q01A 3QI7A 4Y8VA 3WMXA 1OWPA 4Q4CA 2OKGA 3L40A 4QEZA 4BRSA 2IT1A 3HFGA 5IXYA 3UANA 3MQ2A 3ILSA 3PEYA 1LGYA 1NZJA 5CDGA 4D9HA 4ZOLA 3RJZA 4KTTE 2JAQA 2FMXA 3S8MA 4PZAA 3KWLA 4DLYA 5KNLA 3MHTA 5MN6A 1TA9A 2H1RA 4GR9A 4G2TA 4RELA 3SJCA 1ULUA 3O8OB 2VP6A 3GEIA 3N0TA 1I6KA 4OO3A 3HNOA 1NPYA 4CMAA 2I4NA 1Z6XA 3ENZA 1Z35A 1NVFA 3L8YA 1YOBA 4OIFA 4RTMA 3ICPA 3VM6A 2Q28A 1GKYA 4Z7QB 4RKWA 4UU0A 1XMIA 2XOKD 3UCXA 3E5MA 3BH6A 1DWOA 4ZVRA 3EEOA 3RUHA 3SF8A 4OQMA 2RGNA 5G0VA 1X70A 3L93A 5HA5A 3ZWKA 1KOLA 4NJEA 4RHFA 4WBNF 2CNNA 3CG0A 1NVWQ 2FWMX 1D1QA 4DCCA 3IILA 1NP6A 2ZRIA 3EDQA 4RMGA 1ESCA 4RNDB 4XZ3A 1E3MA 5ALLA 3OZUA 5BUCA 3V4VB 1ZVVA 3NNNA 5KUTA 2P9QA 3HB5X 4Y2HA 1UAYA 1BXZA 1JI3A 1I1NA 4WGGA 4YP0A 3ENWA 4PF1A 3HYTA 1LB1B 4XYLA 3IUNA 4UNQA 4ARZA 3EXHA 4K26A 1PQWA 2X3FA 3EOZA 2R5NA 1LBIA 1Y34E 3A27A 4FINA 1RAFA 4MQFB 4UREA 4XWYA 4EW1A 4NFYA 4RANA 4K6CA 3BDAA 5KNBA 5K8LA 2GX6A 3ZH9B 1JSZA 3FYUC 3DTNA 4ENUA 1I6LA 3LP5A 2JI9A 1PE0A 4JNKA 4HLDA 4RZIA 4UBKA 3PR1A 1WZNA 5FPYA 3SQLA 5A7FA 3GR6A 5JH7A 4A8TA 4Y9UA 4KACA 4RSRA 5FH9A 4EPXA 1H42A 1KYQA 1U9CA 3CZ5A 3IPYA 1AE1A 4KO8A 3L2OB 2WINI 3HKEA 3ZHUA 3BSFA 4DA0A 1JFSA 2WI8A 4GXNA 5ETJA 5ALJA 5IABA 3TSAA 1OBOA 4Z7OB 2VDKB 4CT0A 3GGCA 4I81A 3H2BA 2OA0A 4XJXA 3MC1A 1RHQA 2X1VA 5JDIA 4TV9B 1YAJA 5AM3A 2WR8A 3AHDA 3LCVB 3OKPA 3S2YA 2PUVA 4BPRA 1CFZA 1MO2A 2CFOA 2FWPA 2HNBA 3KAPA 3PHHA 1RPJA 4PCVA 5IP5A 3T12A 4AF7A 3L1KA 4C20A 2H31A 2VAXA 3EVAA 5ICGA 1Y7LA 4IUYA 5FR2A 5BO5A 4FS3A 4L2IB 3LH5A 2ZTVA 3G1UA 5JHHB 2VNJA 3QFHA 5KO2A 2CJXA 4C6HA 2JHAA 3RBXA 2J3EA 4MROA 1W88A 2HLNA 3TFOA 3W5BA 1CULC 2HK6A 1I6MA 2ZGVA 4ZJPA 4OB8A 2WBLC 4X9XA 4G01B 4XSVA 4C9BA 3OPYI 1THMA 3HLKA 4UPDA 3Q3IA 1FRQA 3M6VA 2OCLA 2ATXA 2UAGA 4F84A 1U2GA 5EJ4A 3OM9A 1TA4A 2I5PO 3AFHA 3K70C 4HFMA 1IN1A 2OVBA 2XUQA 4P2GA 3UH0A 3C6QA 4O33A 4YRLA 3E5NA 2P3QA 2H7CA 4OLJA 1YA4A 3CR8A 3GUYA 2NUTB 3M6AA 1ODFA 4V0RA 3GA5A 2GTPA 2VUHB 4RVCA 1W36C 2QD1A 3Q6NA 3E8XA 1RMTA 2IPOA 1YVEI 3A4NA 5B4UA 5HJ5A 1YQWA 4ETIA 3MJFA 4G5OA 1BRMA 1YRAA 4DJDC 1USWA 3GP3A 2PKWA 3H5VA 3VJLA 4P8RA 5T3YA 3S1AB 3PQFA 4RJJA 6PFKA 4Q3CA 2BMEA 1KDOA 4E2ZA 1NOJA 2X0IA 3AILA 4JEHA 3ETGA 3U4IA 5HDQA 3JR3A 4NENA 5JPCA 1JLSA 4PS1A 2DTDA 1E66A 4HY3A 4TVBA 4C88A 3OA2A 4E03A 4BVHA 2BYTA 4UPVA 1AUPA 4NDZA 3C3EA 3EG5A 1W1UA 4OUDA 1RQ2A 3AR2A 2H8KA 2QMEA 3ZBPA 3HCEA 4LHSA 5E1OA 2FZWA 1XMPA 3ZUPA 2W48A 3UPDA 4IAOA 5CLIA 4A91A 1J42A 2WHYA 4FDMA 2DEUA 3VI3B 2F62A 4O63O 3I73A 1YBAA 4MVJF 2XKBA 1QC5B 1A9PA 1HORA 2JFUA 821PA 1Z25A 1X3LA 2E7ZA 1P2BA 4HOYA 3R5HA 1TPZA 1ODCA 1THGA 2C5AA 1DKUA 4I4TB 5FTNA 2OYCA 4F12A 2FCRA 1T6YA 3ADPA 2Q2VA 1HYEA 4CM8A 2J59A 2Y05A 3EH1A 4YXWD 2IBSA 1V1JA 3TVDA 1T0UA 1XZBA 2NTJA 4DCOA 1G98A 2ZBPA 4G36A 4N8SA 3MCZA 2NP7A 3QXXA 3P1JA 4A1FA 1GPNA 3NTRA 4UKDA 4E2FA 3RIYA 2XRMA 3PGLA 4MYTA 3NM6B 5DZSA 3AP3A 4M7OA 2PGJA 3AINA 1BXRB 3HDHA 3TZLA 5TLSA 1Z75A 3AEUB 4LECA 3JVVA 4B2IA 2XOKA 3NONA 3DB2A 3GRFA 5CK5A 1NQVA 1VI5A 5A03A 1UF9A 2QQ5A 4X64B 2YHSA 3BRQA 2PKYX 2BE7A 4X95A 5THQA 3RHTA 4AJJA 1ZR4A 1N2JA 2O57A 1RM0A 3DVLA 4ETWA 5BORA 3WAJA 1QQ7A 2E4WA 2FR1A 4YCDA 4BASA 5IDQA 3SYTA 1N7IA 3K9FC 3KSZO 5EAIA 5CFZA 1YE3A 2GKGA 2IC5A 2JFYA 4HEHA 2LR0A 5AJHA 1N9KA 4UUNA 2NPFA 1BO6A 1UBMS 1DSSG 3FUUA 3GJ4A 3GFFA 1Z5UA 3B89A 2HWWA 4ZPXA 4H77A 5EOVA 5HJEA 2GO7A 1G4AE 4YJ2A 3EGVA 1UBLS 2MTBA 5KIAA 5JLAA 3HDTA 4MARA 1ZNYA 4HB0A 1Z5PA 4BNWA 2FH5B 2H16A 4CLOA 4BFSA 2JJ2D 4A0HA 2PM8A 2ZROA 3F3SA 1MTZA 1NW5A 3GCWA 2FVYA 4OGKA 4S0XA 4B7ZA 2V45A 4G8CA 2OD9A 4FOTA 1ZQ1A 4WCFB 2FQYA 2ZE6A 2GM9A 1EK6A 3S70A 4E5SA 3QPUA 2B6HA 5BYJA 1RHRA 1QXSA 3UQZA 1JLLB 5E7QA 3CBQA 4TWJA 3B7WA 2AF4C 2W2KB 4PRZA 3N8HA 4RS4A 3EXFB 5COBA 1BMTA 1CS4C 3K5HA 3UK0A 3VNQA 2BEKA 3DEJA 5DBEX 5FBQB 5AW6A 4HXFB 1N5RA 1MX5A 1NI5A 2PDAA 4I4IA 4ZN6A 2GPAA 2BGLA 5BNIA 1OX4A 2AC7A 1UC5B 4BAGA 3FIJA 3CE6A 4OYLA 2XYQA 5EP4A 1ZIOA 3BD8A 4D74A 2ZREA 3U31A 1MOZA 4ENPA 1KE1A 3LDGA 1GTMA 5G3YA 3QTLA 3BMCA 3OLYA 1IAVA 1Z7EA 4MS1A 5LB2A 3RRFA 3RSZA 3U49A 4ES6A 1FNNA 1MGOA 3VTKA 3ZD6A 2PMBA 3MWFA 4ZI3A 5I7VA 2E37A 1SIWA 3RAPR 2IXAA 4A8HA 4DCPA 4AG3A 4EHHA 3BMXA 1FDVA 1GPAA 4AIIA 5JSUA 3EDRA 3BILA 1HPLA 1C0KA 3PVSA 3AEZA 1DQZA 1DQNA 4L27A 5ESRA 2CJWB 2P4SA 4X20B 1W34A 5B3LA 4TLCA 1QZTA 3IEXA 5CIYA 3HCOA 3UEOA 2V1XA 1W36B 4PXYA 3V5NA 4B6RA 3EAQA 1FB5A 1KSFX 3CLUC 3D0QA 3UNXA 1XRSB 3O31A 4K1XA 4D42A 1NLUA 5CD1A 1UJNA 2XXAA 4TSFD 1W59A 4MRNA 3E2PA 3NHRA 3VR5D 2ZBEA 3D6VA 1O94D 5JASA 1DG9A 5A3JA 1KPHA 1GYPA 1Y9DA 3NQ41 4XB2A 1LK5A 521PA 2FHPA 2ZYTX 1GZUA 3FCOA 1VIAA 1DJLA 3KJZA 2DBVO 3SVZA 1FP4B 4ZHSA 2VWHA 2WMYA 4YMSA 1NW4A 1Y4DE 3M1AA 3FUWA 2J7PD 4FYXA 1IH8A 3EVNA 4M76B 3OCYA 3E9ZA 5AKGA 4F2DA 1DIAA 1FMLA 2BLLA 4EZIA 5C5CA 4GLOA 2MDTA 3VKFA 2V98A 4YJ3B 5ICSA 5JRJA 2J87A 2OBXA 2CVZA 1RM4A 3IODA 3A1UA 2A7QA 4CMEC 4EZBA 3DZFA 1QKKA 3O8LA 3VU9A 1G5RA 1TAUA 2WIBA 1YZYA 1T15A 1WDWB 3RH0A 3DGFC 3GLGE 4D9GA 1GFWA 2M98A 2OUKA 4A8JA 3CRMA 4JEUA 5GJVC 4JJZA 3W2FA 2HIHA 3O94A 2ZETA 4FHCA 4D3YA 5CCDA 3EDMA 3IDSA 2PMEA 4LWQA 2PTGA 2VPQA 5TRTA 4A8PA 3KQPA 2BP7A 5BNZA 3KB2A 1M5TA 2XCSB 3PFIA 2WIKA 3TPCA 3VO2A 1BEUB 4AJPA 4A7PA 1EFVA 1XP8A 4QBFA 5LA6B 2ZQYA 3CLKA 3L8MA 2HD4A 1N0HA 2HBQA 1N3YA 1T1GA 3FPSA 2JIQA 3HE3A 1FYVA 4KO2S 3V7UA 1N36B 1LBQA 1I01A 3I1FA 5HBGA 2H5EA 2R7AA 4JT4A 3TMAA 2FV8A 3EXEA 4BRUA 2IYUA 1NVKA 3WNQA 4CQLB 1B00A 1SKAA 2Z43A 3TIGA 1L4MA 3FZNA 4YXWA 4CU2A 5EHZA 4OSPA 3Q3HA 4UAVA 3DQPA 4HLCA 4NSNA 4B3XA 1E1QD 1UDXA 5C4IA 1HDYA 4NYMQ 2ZWMA 3JQBC 2OO5C 4KQHA 3EBLA 4EHAA 1V26A 4AZVA 1FP7A 4URUR 4DT1A 3PJDA 3BWXA 2XE6A 3F6SA 5ALVA 3NYQA 2JJ8A 3C3KA 1I9CA 3O3MB 2BH9A 1D07A 1LUAA 1O8CA 1LI4A 1FMTA 2BEVA 3AI3A 3DZHA 3IE2A 3ILYA 4FEGA 4YCSA 1S8FA 3O8BA 3JARB 3NAGA 1VSTA 2CWDA 4KK4A 1OOEA 1HMYA 1TVMA 2DHQA 3RNOA 4UBJA 1SUIA 2B8EA 1XCMA 4G0UA 1S3FA 1DRWA 3GMDA 4CM4A 1SXJB 3GH1A 5B30A 4IVPA 1CG6A 3TYXA 1XTBA 3ELBA 5IM4F 4F9GA 4WACA 1X9GA 4YMVA 3DV0A 4R84A 1YI1A 5JIBA 3FCCA 1QS0B 3L92A 4DCNA 3MNFA 2ORWA 1U8FO 3EQ2A 3NNDA 4N3AA 2O4CA 4EB6A 3H84A 2IDMA 5GONB 3RYHA 5I3ZA 1G5PA 2OFPA 2ZI5A 1H05A 2GJKA 2ZRMA 1K7XB 1U4NA 3HLTA 3KDAA 3WGJA 3L4SO 2JJ2A 4HH0A 5MN5A 2C04A 2Y1CA 3GGDA 2X8BA 4HX9A 3CVYA 4NS4A 1U3DA 1CUZA 3MGGA 2YC4C 3D7SA 4J76A 1UXOA 3DL2A 3JASB 1QUEA 1VLHA 3ZDEA 3ZI7A 5LJIA 1Z07A 2DG2A 2ID7A 1E3WA 2P11A 2YUTA 3PQDA 3R9XB 5KWSA 1A95A 4PHCA 2ARKA 4KWTA 1J2UA 1PKXA 2GUGA 2QLJA 3GRYA 4LXIA 1P7WA 1F48A 1YVRA 3K0FB 1U7HA 3OCZA 3K16A 4PR3A 3TR0A 3EIUA 3A2KA 1KEVA 1NWHA 3RAFC 1UUFA 3HJGA 2BCEA 2HRDA 3HN6A 5U4XA 2J0UA 1NUHA 4DQLA 4K28A 4PSKA 1CUFA 4TS1A 3SOPA 1UANA 4YR7A 5BPFA 3WRXA 4PGGA 4MUAA 3T9AA 1SRQA 2PYDA 1H85A 1G20B 3N8GA 1HOXA 2QA5A 4CCAA 4X84A 2C1XA 3PGVA 4PO8A 3WY9A 1Q7EA 3QVLA 1FLDA 1G17A 1Y8QA 4O2BF 5KOHA 1GZ4A 1F8GA 1KZYC 2NZ8A 3BM5A 4A1OA 5CNJA 1JKIA 1NRWA 5KZMB 3U7GA 1JZQA 4PIMA 3BSSA 2A0KA 4GX1A 1NATA 1DCTA 3KNZA 1QU2A 3T3OA 4XQ9A 4E30A 4ZDWA 2ODBA 3RIGA 4MDYA 1W6UA 4TS4A 3WL8A 3ZHZA 1E3SA 1IHPA 2ODAA 3D0KA 5LM3A 2Y68A 4AVYA 1SZDA 5GJBA 1Z4JA 3QFTA 3JD2A 1TKBA 4MGZR 2PL3A 4WN9A 2IYPA 4HFNA 1JAYA 5ESWA 5FNZA 5CITA 4G9GA 2YXEA 4FGWA 2XUOA 3GVHA 3OAAD 3HPRA 4TSFA 3DLCA 2GFIA 3FRJA 4E4YA 5JY6A 1NE2A 4N0EA 2ZT7A 4Q9JA 1WV0A 3VR5A 5JBNA 5EUMA 3FHOA 2P6UA 3MJCA 3CEJA 1D5CA 2ATCA 3LP6A 3CQ9A 8ADHA 4KW7A 3QBVA 1L7EA 5HP4A 3QLUC 3SQXA 2I91A 3NHYA 4AN4A 1W0CA 2IIBA 3CO0S 2A9VA 2P6NA 1ESDA 4JEIA 2J7PA 4MRSA 4F71A 1YQDA 5E6RA 5I7FA 4YMTA 3ZCQA 1U8XX 4FDUA 3OSZA 1JMKC 3PUZA 2IW3A 2P4HX 4OGWA 4Z2YA 1Q1BA 5L3QB 4GH5A 1BKSB 5CLFA 2CL0X 2WWYA 3EOAI 4B6FA 1T29A 1JR4A 2ATVA 1DAPA 4L0DA 4WE3A 3TAXA 1GTSA 1MV8A 2GA9A 1KK0A 2QZZA 4GGOA 4Z51A 5I4BA 4IG9A 2ZE5A 3VKVA 3UM9A 3SGLA 2ZJ5A 1FFWA 1QIKA 2WWVD 3KUCA 4ZVQA 4IDQA 1Z6ZA 3MBOA 1OH6A 1JN0A 5B2EA 1BMQA 3UHJA 4NARA 1TIKA 4WLUA 1Q83A 1VPLA 3LNTA 4INZA 4TKLA 2DYKA 3DB1A 1CUHA 2PZAA 1IXZA 2Q6IA 4B3DA 4IHJB 5CFNA 4EMBA 3ZXXA 1A8SA 4LFCB 4EW2A 4GXQA 1PJZA 1TCCA 3C5WP 1TYBE 2JGFA 4GKAA 1VYUA 2BKEA 3IT3A 1TZ2A 4IWXA 4W9RA 5DBIA 3SIRA 1DL5A 2HF8A 4FS8A 4D4MA 4F1JA 1IY8A 1ZIDA 4PNPA 3D6JA 3QEMA 5CA0A 1JIXA 2ZB8A 4G37A 3USES 1KIFA 1J00A 4R9RA 2XB9A 3PKJA 3QVGA 1G59A 5EJAA 1KAHA 2BGIA 3DC2A 1E1QA 3PV0A 4N9WA 4EJSA 2Q1TA 2Z58A 1QIMA 1WHSB 4FUTA 2W6NA 4YONB 4ZYLA 5C5IA 4PZEA 5J2UB 1U1FA 1Y8RA 4WPGA 3KPVA 3EDCA 3LKDA 4IYJA 2CFIA 2RONA 3PK0A 4WKNA 3ZK8A 3GYGA 4ZU1X 3ISTA 3MXOA 3H9CA 3R41A 4LPSA 5JWOA 2AS0A 4ZOAA 4L3WA 1HSZA 2ZUSA 2CLLB 3TW6A 4WBNB 3LG2A 5HZMA 4R2KA 1CZKA 3B1YA 1OTYA 3QNMA 3WXMA 5EJ8A 2JAUA 2IWRA 3A1EA 5IBCA 4TVSA 3UG7A 1RE0A 3TIFA 4KDCA 1KEPA 3ORQA 2EDAA 4NHEA 4DLXA 2E5LB 4AL4A 4IQ0A 4GI2A 1FMCA 5J4HA 1JZTA 2X1MA 2Z04A 2JIZD 2AR9A 3WJ2A 4RKRA 4P54A 4Q39A 1IB6A 2PLAA 3Q85A 3TSWA 1P18A 2VQSA 3FMPB 3IKTA 5DM2A 2VG8A 1SCUA 3GYBA 3OQPA 5BWMA 2V54A 3DT6A 1CQWA 4GX5A 4UFPA 1C3JA 2LP4Y 3V2GA 3CRRA 1X1EA 4I1IA 1JFFB 1RRGA 2VNAA 1Y5MA 2IYZA 2VT6A 5AKEA 5LPNA 3K6JA 3RK4A 4D9EA 4B71A 3FPAA 4FFMA 2ZBRA 1IPHA 5LLSA 3IT1A 3NUQA 1A8HA 3KM0A 4DVJA 2VRBA 4Y6GB 4BO1A 1GPUA 2ZU0C 2VRCD 4AJLA 4DLTA 3V7YA 3TRIA 1PGJA 4FPXA 2H06A 3Q8XB 3L0PA 4FZ5A 4GX0A 3U6KA 1ETUA 3VR0A 3QWFA 4LBZA 5I9SA 1NXPA 2BMAA 3TOCA 2BGNA 2ZRDA 5T4HA 2CE7A 4OFXA 3FTQA 3ZZNA 4DILA 2D2FA 1W2HA 3GFRA 4II3A 4LISA 4QDJA 4OLHA 5TX7A 5I47A 1U94A 1KI4A 2PVSA 2XCRB 1PR4A 1L5QA 4FJ2A 1KYXA 4WMLA 5TGTA 3DYBA 2NU8B 4NMHA 2ZJ0A 2HSJA 4B2YA 3QMPA 2Z2ZA 2HRCA 3QF7A 2C8VA 3E84A 3P0FA 3PTLA 2R8EA 2ZCUA 4TLAA 5IC6A 4KH1A 4E12A 2RH8A 5HQ3B 1W4LA 3MGBA 3EFEA 4CZ2A 4MW0A 1VLLA 4ZVSA 5IDVA 3H8SA 3I2HA 3IUMA 2XB2A 3CPEA 4BJ5A 3DTVB 3CPHA 1E1NA 4H27A 1NX9A 2KWIA 4JUIA 4QYMA 5CFMA 1PR9A 3RVDA 4CUKA 3SY8A 4O29A 3PUWA 4PC1A 5T57A 5DI3B 2ZTSA 4KGDA 4BP1A 1TYCA 3G2MA 4XIJA 3IJ5A 1QYRA 4W5WA 1GL3A 1QG4A 4Y2VA 5WRFA 2UKDA 3NHJA 3KJIA 3H2JA 3E48A 4OL0A 1QB8A 3A2LA 1YR7A 1ULZA 2CUZA 3AJDA 1B14A 4RZXA 7MHTA 3FMVA 1P0PA 1W35A 1XHLA 1Z28A 4KQ9A 1EDEA 4OA5A 4YJGB 1DV2A 2J08A 1D1PA 2G09A 2JA2A 3OAAA 4Q3AA 4X3PA 2F8MA 2I6SA 4J0EA 2RB4A 1E2FA 3HXMA 3D7NA 3ORFA 3A9SA 1H4VB 2Z3WA 3GN1A 3H18A 4LYHA 2OGSA 4Q7EA 4KYIB 4HYTA 3ZV6A 1OX6A 1Z5OA 3MRXA 1GGVA 1SUWA 4JCCA 1QYVA 3GJQA 4NBLA 4C7KA 3HZHA 3SBEA 4B6EA 3ZS9A 4EA6A 1UZLA 3FRIA 4YI5A 1VHQA 1XA4A 2AWOA 2WE8A 3I4FA 4KLNA 4MWEA 4RO0A 1WABA 2HRQA 3IX7A 4K03A 1E7WA 3KSMA 2W2MA 4I55F 2B21A 4KR9A 3MAJA 4KRGA 5DXAA 3SICE 2XD9A 1J5XA 3CB2A 4PQGA 2H17A 1PEAA 1I0ZA 4PV7A 2QDXA 4UM9B 3HVKA 1AF4A 3EOBI 4LVCA 1V6CA 2H5LA 5JZSA 1QRSA 5K0NA 3CF0A 3FMOB 1OLXA 3VO1A 1XQ1A 4DA4A 2I6GA 4WUVA 3O26A 4KPUB 5EUQB 2BZ1A 1HNZB 2OG2A 2W2OA 3L01A 4OP2A 4YASA 3TJZA 3H0EA 4JKOA 3PDWA 4ZT6A 3LT1A 1YFKA 2F3RA 4J43A 3W06A 2GZRA 2YRFA 2ZR0A 3SZOA 3IIMA 3GO4A 3OFVA 5DLEA 5KSYA 1QP4A 1DRVA 1EG7A 2QL6A 4FFBB 2WUEA 4DADA 1M34E 2GLXA 5E7IA 4MUMA 5ARCA 2J6CA 5K51A 1SVLA 1R50A 2G07A 1OUMA 2HFKA 4IJ5A 4L2IA 1O5IA 1TQ4A 3HCWA 3HKDB 1R6VA 1A5SB 4QNRA 2O0KA 5K09A 2B94A 1JDSA 2ZTHA 3Q8MA 1SVNA 4N0MA 5SYMA 3IAFA 4BKRA 5IKEA 3ZD8A 3R3SA 4OFBA 1ZOPA 4OHXA 3SC6A 1DXYA 4OUKX 1HF3A 1E7RA 4M88A 4B9AA 5EIAA 2QG4A 4R05A 4YRKA 1WXXA 4Z4EA 2W8BB 4YAOA 3B82A 4QBHA 1M1YA 3SS9X 3ENQA 4ESOA 3G5AA 3C6YA 1JA0A 2RIPA 5IFLA 4UUOA 1KGDA 2HPZA 1YMVA 4PLYA 5EMJA 4YMLA 4H17A 4IUCS 2W58A 4MI9A 1WMSA 4KB5A 3RLFA 1UXGA 1RXCA 3BXEA 3F4LA 4H9GA 4RXUA 3THRA 3GV0A 1ZKMA 4HDOB 4U6SA 3RPEA 4DNPA 2NYVA 2JIZA 4MCHA 5EVJA 2V0NA 1CE8B 1NNUA 3D8RA 4C0XA 2TS1A 4TLLB 3Q0EA 1KI7A 1QGUB 1I3NA 1GO2A 2QD4A 1SKMA 1X1CA 1KJIA 1X9HA 2RJNA 3QQPA 1R0LA 4L51A 4M54A 4K87A 2D0OB 4HYYA 3OUUA 1JDPA 4ZALA 1XXHB 1KSJA 3AWDA 2JB9A 4GWLA 4GEGA 3W5DA 3E9DA 5BW6B 1T26A 3GD5A 4RHCA 5KJ1A 5FTJA 3O95A 3DGEC 4NJMB 4BTLA 3GCDA 1RI5A 2FG5A 3NHKA 2VRCA 2AHOA 2PLFA 3PFCA 4BNFA 4QRIA 2QD2A 4R8RA 3ADDA 2C2OA 3AVTA 3I9LA 1V2GA 3EZ7A 2WTNA 1HZJA 2H5IA 1R37A 3KCQA 4JJ4A 4E1VA 1L5ZA 2RK6A 1B73A 3OQIB 5KQLA 3U56A 1X1TA 3I8XA 3AVUA 3ISVA 5FTMA 4KP7A 4WADA 2ATEA 1NJ6A 1XVUA 2P0AA 3K15A 3KR0A 1R2QA 1B6TA 3AGPA 3M6LA 3NH6A 4L1KA 1CWUA 1QC5A 1TVCA 3EZ2A 2CY0A 2FUG6 1XLWA 5L7WA 3M5WA 4FGZA 2Z2JA 4BPBA 4I4TA 1U2PA 1XDBA 4RSGA 2P3OA 2QR3A 1XTJA 1XZJA 2RGYA 4LBVA 5B7QA 3U3XA 3LGAA 3VKWA 3ZE2B 3H6HA 3D9QX 1ZICA 5A2QA 1NNEA 5AVQA 3LOQA 1N8TA 1CP2A 5TQ2B 1IM8A 1ONNA 1YD7A 3OSUA 1M83A 1QBKC 4IRUB 3LHDA 4LJ9A 2HW8A 4UC0A 5EGNA 1ODKA 2O06A 4UM8B 3S2GA 2VHUA 4S1VA 1K6XA 3TEFA 1P61B 5LQMA 1MH9A 2DHRA 1KDZA 3AKZA 1HLDA 1PT8A 1RLTA 1BXRA 4RGVA 3RD5A 3QYJA 1NFFA 1L8AA 2A92A 4EENA 5DWQA 1NX6A 2B30A 5BQFA 2NVWA 3AEUA 1K0FA 2X2PA 3KJEA 2BN4A 4ZCLA 3ENVA 3MJTA 4BV8A 5K2OA 1IHDA 1NBAA 3TW8B 4CV1A 2H3EA 1COWD 4D2IA 4UCFA 5BY2A 1WXHA 4EKDA 2NUBA 2D5IA 4Z4FA 1O89A 3JX9A 3COPA 1RLOA 1RWKA 3DE3X 2JJMA 2CFRA 3D5QA 2EJCA 2RBKA 3V8BA 3G85A 5HDBB 3WGTA 1L8LA 4RPHA 5IKOA 1SXJD 3QPBA 3D3WB 5DTIA 5CEFA 2VZEA 2M2IA 2WTBA 5ITZB 1QQTA 2QUIA 2CUTA 1EVYA 3A6GA 2JFGA 2MHCA 4DARA 3ENKA 2PH5A 2PRSA 1CBUA 2BJVA 3OCCA 1U7PA 1FLNA 2ID4A 2X9LA 4J2OA 4RPJA 2GUWA 6CHYA 1XO1A 1GY8A 1OYWA 1QVAA 1HDEA 3GJSA 3QVOA 3AUFA 4LHVA 2DOKA 5INTA 2QTWB 5HJ2A 1CEEA 1BQEA 3I6ZA 3JSAA 4WDQA 5U9CA 2C31A 2CLHB 2VJNA 1BWRA 5EL0A 2CYBA 2PGAA 2JK0A 4RCZA 1QIEA 1TMKA 1TU3A 2GEKA 4WCFA 1V25A 3RFFA 2KW5A 3IR5A 1TCVA 2QI9F 1C7ZA 3U3RA 5ILOA 3W04A 2XEXA 2E85A 3EYAA 4H0CA 1PT5A 1V39A 2F6RA 2GCNA 3A7DA 4KX3A 4B17A 1JLLA 1M33A 1WF6A 3PYLA 2IGBA 2YW2A 2W2KA 1GZHB 5JDCA 1KK2A 4PAWA 3EXFA 4MUGA 3ICEA 4A10A 4AKGA 4IHQA 4NFLA 1SKYB 3MWEA 4B5KA 3ZNOA 1N2XA 2Z6AA 1NMXA 3IIIA 4CL8A 1YGYA 2G72A 3FYHA 4G07A 4Q4JB 1XL1A 3HB9A 3KHSA 1M0WA 3KYDA 4H31A 5D8DA 3V00A 4RQBA 3RADC 1FYWA 1JHRA 2V9CA 2F3TA 4V24A 5EI5A 1UC8A 4LQLA 2VXOA 5FHQA 2GNPA 4HFRA 2I80A 5JJLA 4Q3DA 1ISSA 2R66A 1NKSA 3BIOA 1TLFA 4M98A 1VSUA 4L16A 2TMKA 3UJCA 5BMVB 5JEDA 3G5MA 2W6MA 5HNKA 1QTNA 3U7EB 4UZSA 1NWCA 3U5ZB 5DU2A 2GB4A 3TCXB 1TA0A 2IUEA 3MCUA 1MT3A 3QU7A 4DLVA 3I0ZA 4HWPA 4I4NA 3W4KA 3PNKA 5CTJA 2XECA 2CJWA 2IF2A 1WEHA 5ECWA 1E6WA 4X20A 3K30A 4YRCA 3T4UA 2VSFA 4HWRA 5CU7A 4YUYA 3KPYA 4XLTA 3M1IA 4NOLA 2ZBFA 2HA4A 3K8OE 4L07A 3ZNPA 4BE7B 4HSGA 4RWEA 2BL4A 2QPAA 3QX3A 2X4LA 1Z08A 1ZRSA 2VNIA 4FC6A 4OH7A 1PUIA 4DLSA 4C07A 4BNIA 2BHTA 3BKXA 5JAOA 2GBPA 3REFA 4QUBA 4DQXA 5F5LA 4QPCA 2R8RA 4WJZA 1FP4A 1NN0A 3I2IA 2VN8A 2NXNA 5BWLA 5F4BA 1YF3A 1E20A 4DRXB 3TINA 3P7MA 3JRWA 1W44A 2QR2A 3W2IA 1SUCA 4YAJA 1FJHA 2GRJA 2N3ZA 2ZUUA 5FPHA 1VJTA 4YJ3A 5KKAA 4E09A 5C8YF 1FIUA 2INGX 4NF2A 2Z8ZA 5JOQA 4Y2JA 3CEAA 4JU9A 2JLZA 2O2ZA 1CJKC 2D0IA 3OLZA 4MYSA 3BHMA 3RC8A 5IH7A 3TQQA 2J1LA 2RAVA 3WLRA 1ZRMA 2SKEA 1RRVA 1HFEL 1E59A 1VL6A 2OL4A 1UJ5A 4MI3A 3UTDA 1T3LA 2BGWA 1QQ5A 2GLTA 2XW6A 4TTVA 4DMMA 2WOOA 1PLKA 1U1CA 5G53C 4P3OA 3IKLA 3HRKA 4N54A 2MJLA 4LSZA 4MZXA 1RBYA 2PU7A 1B7GO 1PG5A 2WPNA 4TUYB 4RSHA 5LA6A 1FVXA 2HNKA 4CWAA 1D6JA 1RLMA 4C4TA 1U9ZA 3X1KA 4D45A 2H08A 2WYIA 1NW6A 2J5XA 3EEQA 3P26A 3QPVA 4G81A 3DPIA 4L8VA 5FTKA 1H1LB 1TYZA 1Z47A 2XYPA 3H9BA 2FN3A 4CQLA 1FJGB 3MM4A 4LXGA 5FDFA 2RHHA 4LY9A 2EBHX 3SXPA 4LZWA 1LLDA 4NBKA 1CQIB 1G8KA 1VC2A 3GVXA 5H83A 2XF2A 3N39C 2Q4OA 1BMFD 3COWA 2Q3FA 1BFKA 1QVWA 2TMDA 3MPOA 5EP1A 4G1UC 3VX3A 1WMAA 2CVOA 2GILA 3GNLA 4G0PA 4GM0A 4JYZA 1TZCA 2Q4DA 1COWA 1KA9H 2CHQA 4Y9SA 1U5AA 4QARA 2OXCA 3OE4A 2HBYA 2YXDA 5CLJA 3HGMA 3JARA 3WXBA 4MEAA 3IIJA 3OE7A 4OHVA 4RW0A 2FPIB 3GLGB 3FTCA 2M6LA 2Y1EA 3A1FA 1SM4A 3FPGA 4B9EA 3QXHA 2PD3A 3RIHA 5AUPB 1SXJA 2ECKA 2DTXA 1MT0A 4B7CA 1PD0A 3CTPA 4RZHA 4BRZA 3G7UA 3DBIA 1XLVA 3W3AD 1CLEA 1YDFA 1U4OA 4I99A 2G76A 3X2SA 1RU3A 4JLKA 3UWMA 4I1YA 4C14A 3KVRA 2A5YB 5G4KB 2Q5OA 3W8NA 2WE7A 4GM4A 2QQFA 5GONA 4MW5A 3AP2A 3EQ8A 4H59A 3W90A 5CDFA 4RTLA 2HB6A 3OCVA 4RACA 4F2HA 1K7FB 4FKBA 1Z29A 4IIXA 1UH5A 4KQCA 1IJEA 3ER6A 1AZSC 2OPBA 2PGOA 2ZSHA 4PLVA 2CSUA 4OHBA 4CJXA 5CPBA 4C3OB 4D79A 4EG4A 2DPLA 3AKDA 2AFVA 1SVWA 1NN5A 3I6BA 2CMKA 1G8SA 3O4IA 3QE0A 4H35A 3S4YA 4IUBS 1YL5A 2Z3VA 3WIDA 1VPEA 1WDTA 2QMHA 1GSAA 4RKYA 3BTSA 1IRIA 1PQUA 1DOHA 3K0FA 4P0TA 3COJA 1POWA 1U7WA 3L7DA 2BTQB 4UW9A 3SZRA 2NTVA 3M83A 3FH0A 5EQTA 2NO0A 3WLJA 4X8HA 4DDTA 4G5HA 4Y0VA 4E3ZA 1AMNA 2HU5A 5KSWB 4JI0B 4FNAA 1EA7A 1G20A 4L76A 1P5HA 4DIUA 2WJHA 4LYGA 1ODSA 2DH5A 3NHWA 3HBAA 2W37A 4UPEA 2AW3A 5FFNA 1C8BA 2FJPA 2IYNA 1K4KA 2VP4A 5EGSA 2FPXA 3AF4A 3IRVA 3KFLA 3B1JA 5CT5A 4XA8A 3FFWA 4PNHA 1LPAB 1E5XA 1O7JA 3GXOA 3DTVD 2WWWA 4O8ZA 4QICA 4CI9A 3MRTA 4G8DA 3MJEA 3I58A 1MCZA 5FBKA 5NULA 2AV6A 3EXIB 2IS4A 2VATA 5LBTA 3WLPA 1MJ5A 1CJVC 4R1UA 3S7ZA 3E9MA 2WYVA 1PDOA 3G2KA 4BNTA 5ALDA 4YVFA 4I1VA 4PYRA 1RWOA 3HTXA 2O9JA 1A7JA 4W5NA 1TE2A 1WNTA 2R2AA 4IVNA 2G17A 3HGQA 4JP8A 2ISQA 5B58C 5JQGF 4BE4A 2O2SA 4PFSA 1SVOA 3GGJA 1N0IA 1YJCA 4R7ZA 1NMQA 3KSRA 4XCVA 4OSEA 3T9BA 5IAJA 1GRCA 1Q1ZA 2XPCA 2ZI6A 4D0NA 1Q7GA 2LD4A 2V6JA 4JR2A 2W2VA 5EWLA 1RWWA 1NYQA 2ZT5A 5JSZA 3VNRA 4C4OA 3HA2A 3KT8A 1PIWA 1DLIA 4Z9YA 4EJMA 4J4BA 4QT4A 3CVJA 4DAEA 3AR3A 2ZTUA 1UPTA 3TTXA 4E4TA 2XMQA 4PAQA 4BGEA 4CM6A 5L3QA 1I80A 3O7WA 3VXKA 3DUFB 4B32A 4QUEA 4U9HS 5DBOA 5CB8A 1AKQA 5GWXA 2R6FA 1J9ZA 2PK3A 1R6UA 1Q84A 1TVEA 3BAZA 2BPOA 3DP7A 4ZEXA 5LMZA 4GIBA 1M2GA 3I37X 4UM9D 2PKXA 4HTFB 4U8GA 1XRMA 2OAQ1 4RK7A 3R4CA 4I50B 1NBME 1K6IA 1BROA 2VWPA 3WNCA 4DFDA 3MIIA 4C7XA 1EFDN 1NT4A 1S96A 2Z95A 2W2XA 3ABIA 3LHFA 1GQQA 2VBCA 3GW8A 3O03A 3QELA 5G3ZA 2G1UA 3S29A 3WLTA 4F46A 4R9NA 2GN8A 3DFMA 3MWJA 4DW8A 2CJYA 3A8TA 4OQ4A 1XZPA 4KFUA 2NU7B 3Q7EA 3R3JA 3L0YA 3C7CB 3T7CA 2RH4A 3CCBA 1M2FA 4W1PA 2XD4A 3FPFA 4X6XA 1W48A 4HRVA 4JJGA 1S2IA 1ZUWA 4M87A 3ZTTA 3WV4A 4B85A 2YHIB 3HZZA 4EHLA 4NBWA 3U4AA 5BYKA 2PD4A 4LDZA 2CXPA 1R5OA 1ZJZA 5B36A 4TL8A 5JECA 4JYMA 3ORSA 4NJOA 2QZ4A 3DLHA 1PL8A 3P8ZA 2PUTA 3W5UA 3DE0X 1C30B 3ES9A 1ULBA 1KY2A 2AR7A 4LV8B 3TFQA 4C2UA 2RDMA 3DA8A 1V4VA 2AJCA 1ISGA 4J1TC 4BDSA 2NVOA 3K8ZA 1C9DB 4GQIA 2JLCA 4KQXA 2DULA 4IXTA 4M1TA 4R2IA 2Z57A 1XN4A 4R01A 3A6PC 1ZJ5A 1SBTA 2HBRA 4HNUA 2JAOA 3O92A 4M9SA 3ZJTA 3IQZA 1N6LA 1CQJA 3W3AA 3HR8A 1Z68A 4MEBA 2Q7OE 4EFNA 2CLDX 1QRDA 1TAHA 3C8HA 4TKZA 5ARDA 1HT1E 1HLFA 1Z2OX 5DWVA 1ULTA 5HKOA 1KTIA 3LQYA 4CMKA 4RD0A 1XFDA 1XV5A 1XF1A 1KBOA 4KUEA 2ZWAA 3INTA 5A4IS 1I30A 1E1KA 1QONA 2DZDA 2O59A 2FFHA 1KY4A 4TWIA 4DM7A 1DWQA 2PH7A 5DEIA 2P7IA 2IYVA 5AW0A 2E1PA 1Z3CA 2B83A 1N0VC 4HDMB 5BW4A 2IYFA 3P2JA 3O2NA 1OH7A 3KAKA 4F5WA 3B6KA 3PNOA 1MRZA 3SR4A 1UKAA 3TG8A 1IM5A 1NQXA 2JLSA 5DGHA 1RABA 3L02A 3W8DA 1OXKB 1XPUA 4DR2B 5K8TA 1HA3A 4NU8X 4YV2A 3GJ7A 4G0OA 2X2FA 4HB4A 1J2YA 5AVVA 1RCTE 3S6JA 4U39A 4KYTA 3SS8A 3QVJA 2WFMA 4HJXA 1E9RA 3OO0A 5BWNA 2QW0X 1MNQA 1SN7A 2FP4A 1TF7A 2QRZA 3KLNA 3ZCTA 1E2KA 2FPLA 3HGTA 1C3VA 2NU8A 1NXSA 1ZQ9A 2O2HA 1DBSA 5F5NA 1Y9JA 1Q15A 2OCGA 4RMIA 4XJTA 2QTMA 4HNGA 3AYZB 1WKBA 3QBTA 3D3EA 3K32A 4KI7A 4BMNA 1O9HA 1U7OA 2HQOA 1Q1QA 5HQ3A 3CJRA 3NBQA 3AM4A 4LE0A 4RD4A 4X5OA 5CGZA 4OJYA 3G9TA 1R12A 3Q12A 5DOZA 3HSKA 3DTVA 4WNYA 3DLBA 4F38A 3JR7A 2I7XA 1A4IA 3KOUA 2FDRA 4LXUA 4KLAA 4J29A 2JG3A 1S4QA 1YS6A 3OF5A 5KKNB 1ACLA 1IN6A 1D8TA 1SZPA 5C4GB 3VPSA 3K6SA 4OQYA 3QE9Y 3CGGA 5EJGA 1TUIA 1EX9A 1N7HA 4ZAXA 2RCNA 3F9IA 3I1IA 3N7AA 3JZAA 1G6HA 5F23A 4C22A 3ECCA 4RD2A 3WRYA 3QVSA 4FYJA 4MDEA 2O8BB 4O2LA 2ZITA 4YJGA 4OQNA 1R0YA 3FR8A 2ENUA 2G88A 1X1DA 3KL4A 1E2NA 2FUG1 3TWOA 4J0DA 1Q6YA 4TL6A 5BYBA 4ND6A 1ELOA 1MO5A 3HR4A 1TO1E 4M3NA 3BPSA 3NMUF 1WHTA 3AF2A 2C77A 1X7DA 1IUNA 4NQRA 3ZXIA 1NYTA 4RHYA 1FL9A 1TB4A 2OYRA 4BAUA 3EGDB 1X86B 1KO5A 4ASUD 3VYVA 4Q24A 1Y4UA 4H6VA 4P35A 4WCVA 4CR7A 4MEJA 3RS4A 4DS3A 2O5EA 3CBGA 3OIDA 4Z9AA 1J97A 5IF3A 1W8IA 4FR2A 4C3UA 1DOZA 2Y1LA 1J0DA 1E1RD 5D00A 2WNHA 1GGHA 2DPXA 3VOAA 1JEEA 2LTAA 1HE8B 1QCCA 1QG0A 2WJZB 2Z83A 3AH8A 3R77A 3T3EA 5CXUA 3HHPA 5KX5B 3MJDA 5EA2A 3ZZ1A 1DKNA 2I8CA 3N74A 2DQKA 4WN3A 2YY7A 5AJTA 3NDBB 2QN7A 3ANLA 4F92B 1DCMA 4GECA 1Z33A 5DYIA 1XHEA 2IPMA 1C7FA 1B3RA 1I2AA 3NIWA 4L6CA 4OXNA 3OUZA 3NALA 1TZMA 4KPUA 4QLBA 1Y6GA 2G1PA 5TDHA 1Q7TA 1WU8A 5JI3E 2NO7A 4GYJA 5AKYA 1ADFA 2VTVA 4ZAZA 3MYYA 2O50A 2AA3A 3A26A 1R8QA 5F1YA 4FMCB 4HCJA 1VHJA 3G8BA 1S2OA 1CNFA 3ITDA 4FFBA 4QWWA 3UAGA 3VJMA 4E22A 2VF7A 4RLQA 3MWDB 5JCJD 3KLOA 1R0BA 2Q3MA 1FFEA 2IELA 5G02A 1L6IA 4TKVB 3HKDA 1EBBA 5CLGA 1BE0A 1G3MA 2W93A 1YDHA 4TS9A 4GPIB 2RHGB 2G71A 3NM5A 3D2LA 1RLUA 1IY9A 1Q77A 3ZK9A 5JBQA 3TPFA 3ADCA 2I4MA 2ORVA 1CY6A 1TU0A 5BR4A 3OCWA 4AZTA 2W8BA 3IXMA 1Y5NA 2FN9A 2HAEA 1GQRA 3R0QA 4FN4A 1YRYE 4GNRA 3FTFA 4UQPA 5BN1A 3DC7A 3F4KA 1I9GA 5BSUA 2UUAB 4Z0HO 2A88A 1YXMA 5H70A 2Z1DA 5IX8A 3ABRB 2O0JA 1N2OA 4JMPA 3WIVA 2OHFA 4FUQA 2QL7A 4OOEA 2IEZA 5DCLA 1VLZA 2VEDA 4RMHA 3AQIA 1EWYA 2QAGC 5E8RA 2W43A 4ECEA 5FOTA 4UEWA 4H7FA 4ESHA 2UXDB 1P33A 1CE8A 3EMBA 2C94A 3VYRB 4LZPA 3QI2A 4EVIA 1NAIA 4OM7A 2NNWB 4QXOA 2GERA 2ERXA 1C7EA 4OMUA 1NNSA 2O6LA 4IIYA 2QAIA 4MW7A 4WNCA 2XY4A 3FMIA 5JLJA 3EPLA 2NU6B 4A36A 5DGIA 3JTMA 4AT1A 2AZTA 4NOJA 1C3EA 2H1VA 5EEGA 4IDCA 3SHVA 4C7BA 2WZDA 2WYOA 2XQFA 5GQSA 3RKSA 3T7DA 4O2AF 4JI1B 1T1IA 2GD6A 2Y71A 4JFAA 3I39X 2JS7A 2XYGA 4GSKA 2BGJA 2C3YA 4O8CA 3TPZA 3KQTA 3JWJA 3Q2IA 2JD0A 4YGXB 1XTUA 2PCLA 2X6QA 1L7NA 3PE3A 4I19A 4NFHA 1ZW6A 1COZA 2ONZA 1TXGA 2OHHA 4MLDA 4ZYZA 2EZUA 3I83A 3RHSA 1AQLA 1H9CA 1JSLA 1E5DA 4CG0A 3L6UA 1MOPA 1X8LA 4C2AA 1AA9A 1TM5E 1M66A 4BZQA 1GZ3A 2QTBA 2MSNA 3I9NA 3TCKA 3B3QA 4PHFA 2DY0A 4BOYA 2AZDA 2WHRA 1P2VA 4Q3EA 1QHIA 4LHXA 5EXSA 1P4AA 5TQVA 1P6UA 4G0NA 5TQ2A 1CY0A 4GXTA 2WQ7A 3L7IA 4LC9A 3HH8A 4II2A 5I51A 5F4ZA 3EPJA 1JW9B 1EVIA 3DZBA 3M6IA 4JVNA 4LWPA 5GM1A 2QN6A 4IH4A 3RV4A 1I5EA 1FK8A 1K7YA 2ODEA 1WPGA 4DCJA 2H92A 5J1SB 1HR0B 1KVRA 3F97A 3GUHA 3PBKA 4AY3A 1ZU4A 2CNLA 3FF1A 4GYYA 4WJKB 4Y1RA 2E87A 1PZEA 2RFLA 3EK2A 4R7TA 3T3MB 4NAUA 1FTSA 1P1KA 4PNEA 1NULA 4CQMB 1R4AA 2Y1WA 4DABA 3R1IA 3TW8A 4W7IA 3FNFA 4OLFA 4KIWA 3SEAA 1AO3A 3U0VA 3W5HA 4E0BA 1PUXA 3GUVA 4GOMD 4MDHA 3B20A 1Z6AA 3PEEA 1KJYA 1X6VA 1WCIB 1FDSA 1QYIA 1SEVA 2QMUA 1KJ8A 3KT3A 5EKDA 2YX1A 4XWWA 4CV3A 4EJFA 4N8EA 5JD3A 2FPSA 3U4DA 3BZBA 1P3Y1 2JLXA 4WIAA 2BDUA 2D74A 3D3WA 5CYFA 4BQQA 4CKWB 5LKRA 5K8IA 1HV8A 3R6DA 3ONNA 5DM70 1D4OA 2DU8A 1KY3A 3DMDA 5E95A 4ENTA 1OYVA 1ZJJA 1ECBA 4F96A 2HGSA 3CURA 3HYCA 2WM9B 3AHHA 4F5DA 4ASUA 1A9QA 5C7YA 1V37A 5FB3A 1E3TA 4B4WA 3ZDYB 3V2IA 1FC0A 3G2HA 3B6JA 2GWRA 2Z4SA 2ZJ3A 2GPSA 2H2GA 1RQPA 4KBYA 4P4GA 3V1UA 1E1RA 1NVAA 4FW9A 3GBPA 5JYDA 3QSGA 1AQIA 2CMFA 2AVDA 1U8CB 2PS9A 4J7XA 1MLDA 1RWVA 4V3CA 1Y0BA 3S40A 2UYHA 1V1RB 1F3LA 4DUZB 4O3FA 2SNIE 2QGNA 2XUDA 4WNIA 4BU1A 4GF5A 4WLVA 4MYUA 2VJKA 4QSMA 1SUEA 1UWLA 2QMOA 5CYOA 1NONA 1ZUD1 3HM9A 2EFJA 1IQ0A 1PFUA 4NZOA 1N2CE 1Y6RA 3B1XA 3K9CA 2F2TA 4L5AA 1XZLA 4N76A 3QVKA 2M6RA 2IIVA 5A6SA 4M1WA 2IYYA 3W5AA 2IEGA 5CMLA 1YACA 1T8RA 2GKSA 1EJ2A 3CSDA 1E4YA 3A6JA 3KPJA 3LP8A 1QV6A 2PLWA 3ORRA 5HIMA 3T3GA 5HMLA 5MFPA 4OBWA 5JCJA 4AW9A 5JI2E 3C3AA 3K5WA 3A9VA 2VR1A 3QUBA 3ZV5A 3FB4A 4YP9A 4JS0A 1PJRA 2P9BA 3KFVA 5BMVA 2ZUCA 1M2NA 1R66A 2LBPA 2F1JA 5AVOA 4CF7A 2BW0A 2ZG6A 2CXUA 3P2KA 1XL0A 1BU8A 3QKWA 5L51A 4V0SA 1PG2A 1LSSA 1QTRA 8OHMA 4BYMA 5J9FA 1J49A 2XUZA 2QL9A 4IVQA 2FETA 1VYVA 2J9FB 3R7WB 1G7SA 2G5TA 1TQ6A 2IEBA 2ZJOA 2VZ8A 1T9AA 3E3OA 1MABB 2P1RA 3ZWNA 4RTNA 1JFTA 1CTQA 3A9CA 3MCTA 4WFJA 1R27A 2FPOA 3L8EA 4WZZA 2VTBB 2EJTA 5AP9A 1FP2A 4JWTA 4AX4A 5KTPA 5L3SB 1DKRA 2BF4A 1QZUA 4H60A 3JAWB 2CNOA 2QTLA 4DG9A 3DSRA 5KNCA 2CC2A 1JYFA 1ZK3A 2AUTA 2ONYA 4ITVA 5H68A 4ID9A 5DM1A 4HLNA 5TEVA 4JI5B 1Z4KA 4AYWA 4UVGA 3C5HA 1N2GA 1A2KC 4LF9B 2I2FA 4OAQA 1H2EA 1MOQA 3DE7X 1MAUA 2BMJA 2IHBA 1PTJA 3B53X 4IRXA 4NIMA 2H51A 2GHRA 2YS7A 4DRXA 2HR1A 4U2FA 1O6FA 1O95D 1EXDA 1ZP6A 2X42A 2D1SA 4KNWA 3RI3A 2XKKA 3BTOA 1SC6A 2HKIA 2QV0A 3K71B 3ZY5A 2YC2C 3H9GA 5A3RA 1T2UA 4FMDF 2OV8A 2X0DA 4N3BA 3T4PA 5F98A 1FS5A 2E48A 3C3WA 1QRRA 4Q7LA 1L4GA 3DAHA 2VH5R 5KJCA 2HSGA 3EUWA 5DCUA 4NYJR 2HQ1A 3I0NA 1Q3HA 5LQNA 1WSDA 1QX3A 4IXDA 1YA8A 1ULSA 3GAMA 3AETB 3K0CC 2JC3A 3RWBA 5JMWA 2QT0A 4B45A 2PG3A 4CKCA 1DJMA 1Z26A 4EHNA 2IPXA 3BGOS 4RA6B 1VM6A 4H3VA 3GCZA 1PJSA 2V4UA 4B80A 4XARA 2MYUA 4MPTA 2J85A 2VQDA 5EP2A 2I8LA 3O47A 3TW4A 4EH1A 5CXSA 1RAAA 5CFQA 4AP5A 5ADVA 3HI4A 1H1LA 4NONA 1JWAB 1WS6A 4ZOCA 1VMEA 3AUXA 1N9GB 4DCUA 1IK4A 4G5YA 4MW4A 3PC8A 4X00A 3SJBA 2WUGA 4C4RA 1YT5A 2PYIA 4PBTA 2H3HA 3HJUA 4FCCA 3T61A 2EWWA 1YUBA 2MR6A 1BCSB 5IWAB 1N57A 1RYMA 3OU7A 3QWAA 5EZ6B 3SK0A 2PH3A 1CQIA 2LPMA 1B1CA 2RJOA 3TH5A 3F73A 3D54D 3N05A 4QGHA 2RGBA 3EGCA 2FVXA 3LD9A 2JKZA 2B3DA 2G9RA 4Q3LA 3JXEA 3ESYA 4UFNA 4Q02A 2VP2A 3CJQA 4ECAA 1NXWA 5AVYA 5FWNA 1DLJA 2KMLA 1YUNA 1LV8A 1UADA 3H2GA 3AIMA 4KXWA 4NESA 1J0EA 4ZODA 3U7QB 4UQLA 5JNLA 5JYEA 1CDEA 1K3UB 4RE6A 5E4JA 3GLGA 4JIGA 5AW1A 2FPIA 4MS4B 4TV8B 3VU8A 1WIWA 3WTCA 3EA4A 1MKYA 4RGQA 1QU3A 5F64A 1MG5A 4X66B 2IZ1A 1UXIA 2OUIA 1NVXQ 4D4GA 2AR0A 1P7PA 3HL4A 3KT6A 4MUFA 2V97A 1KDRA 3VH1A 5CCEA 4EY4A 3SJAA 2OFXA 5IAEA 5HX7A 2XNKA 4NDNE 4X1KB 5A06A 1KQGA 3D6UA 1WULS 3OZFA 4I14A 1V0JA 3IXLA 2JFNA 3KQWA 3T0GA 3T1HB 3OQOA 2QMYA 2IS1A 1T13A 5G4KA 2GNOA 1KR2A 2G3YA 3DW1X 1UEIA 1Y5IA 2O23A 1EFLA 2X40A 2YNMA 1AY0A 3HJFA 3BMNB 2YZ7A 3HUDA 2HN9A 1LLUA 5DCYA 3FD8A 4YAKA 4M46A 1KMIY 1PNVA 1Q19A 3WS7A 4DR3B 3L7MA 3LCRA 2HRRA 2JBWA 4QLAA 5DSTA 2ZM5A 5BOVA 2BSXA 1SAYA 4BMDA 1HEIA 2EYUA 3SAJA 2IDZA 1XMSA 4G5FA 1WB5A 4KUHA 5H02A 1UL1X 2YVUA 3NFYA 2K5UA 3IPLA 2PUGA 4Q3NA 2W2PA 4BKUA 5GGYA 5LSAA 2ST1A 4REQB 1TT5A 4B48A 2RH5A 2H29A 5G40A 3KJQA 4RCVA 3ERCA 1XYGA 2C8KA 4HLQB 4RJKA 5EIHA 4KAFA 4LF5B 2ES4A 3CRNA 4H7IA 3TLGA 4CNBA 5C53B 3REQB 2VYVD 4HVAA 5K01A 1JJ7A 3FTPA 3KQQA 3JD1A 3LWDA 4WA7A 1DE0A 1A9RA 2PSDA 1V7ZA 2HDWA 1EQ2A 3A36A 5FD8A 3CYFA 4AN1A 5JCZA 1P0CA 2E1RA 3IMCA 3GWZA 4Q4AB 1E2JA 2OG1A 1JU3A 2I54A 1QF9A 4N5DA 1UDAA 3IP1A 4DBLC 4LAFA 2VTEA 2ALJA 4HFJA 3VNVA 3EXIA 5FUQA 3QLTA 3A11A 1DFGA 2R8YA 3OZBA 2DC1A 3FOZA 2PAAA 4NMLA 3DDZX 4NZMA 1BDBA 1G66A 4HC4A 4ZT2A 3AFOA 1EXWA 2YZKA 3MXTA 3OM8A 3ZU4A 2PXHA 5DYWA 3F7NA 5LQAA 4P7JA 4CEIB 2ZUTA 1JJBA 1LW6E 2ADFA 3WTBA 4NP6A 2F1OA 1XDUA 4Q1CA 1NVMB 2XHEA 3E6AA 3MUFA 2V4ZA 2BGTA 3IV9A 3BFXA 4A6PA 1DKOA 1MVOA 3CB4A 5F3WB 4YLGA 1SOVA 4AUMA 3Q3VA 1ZJWA 1A7AA 3LMKA 3CW2A 3MA0A 1U3WA 1R74A 4NMXB 2WM3A 3W79A 3N76A 1T6ZA 1NUPA 1H5UA 2FZKA 2JJYA 2ZIGA 5GTDA 1O95A 3OZIA 3R8CA 1ZM3A 4Q12A 5CG2A 3DUFA 2HA3A 4YFVA 4BJ3A 2AHRA 3WG9A 5DBGA 1V95A 2AIRA 3KDPA 1FNBA 2OECA 1GAWA 3H5OA 4BLSA 5K7SA 3CIOA 3A31A 4QXRA 4YACA 1EFAA 3IE1A 4HDRB 4QGBA 5IUKC 3TM5A 3TVTA 1FDIA 2RJ3A 4HTFA 4AB1A 1FSPA 4XTCS 1TADA 3PNLA 4A92A 2A5FA 4B3CA 1CU1A 4RZUA 1RKXA 3L0CA 4I50A 2C7BA 4D3XA 2JCSA 3G79A 3IQWA 4CXMA 3F5DA 4BMPB 3BFKA 4HDQB 2OCBA 4JXZA 2FSIA 4MLZA 1F7VA 2J67A 4X45A 3DM5A 2NU7A 4ZJZA 2RGNC 5DYNA 5LDHA 3OH8A 4K9LA 1YRHA 2I4IA 1I2MA 2BDTA 3L6EA 5FQNA 5GOZA 4KXQA 1O2DA 2W9XA 4XE5A 3DPSA 3FUCA 4ZARA 4B3BA 1KDPA 2FZ4A 3KBBA 1P9RA 3KHUA 4UARA 1CDDA 4NCIA 3GUUA 4DBVO 4UU7A 3S3TA 2W4IA 4MKHA 1XJ0A 4UVHA 4GPEA 4ED9A 2JBAB 2ZWVA 2PBLA 3AZOA 5LNK6 4AY5A 5FPQA 4DWOA 4LW8A 2KPOA 3N8NA 3QU9A 3BEDA 3EXHC 3E23A 3LOPA 1Z13A 2GJ8A 1JQEA 2HF2A 3AFNA 3TLBA 5BQ3A 2XUPA 3Q8LA 3RNLA 3WNBA 2IQIA 3O0TA 4I8IA 4JKIA 1C30A 1P81A 2WT8A 4MZDA 1AB6A 3H1BA 3VMMA 4B75A 3JALB 1ODLA 1U3UA 3K5PA 2HX1A 1DT5A 1DUIA 1F9EA 2Z0MA 1XD2B 3CNHA 3MUNA 3JQ7A 4W7HA 1DDIA 3KWFA 5DPMA 3ZDFA 5K0JA 1ZGAA 3OQJA 1XCGB 3ROEA 2N1MA 3U7HB 1TTPB 4W5TA 3OF3A 1UDCA 3LSTA 3HJCA 1RMYA 3K2EA 1U2RA 2E5WA 4WV3A 4EVRA 2WLTA 2G1AA 4D26A 3LTEA 5LZ2A 3G13A 5ECDA 4RQTA 1B8PA 1YI0A 4UTXA 2G4CA 4M22A 4ESEA 4X7PA 3EUFA 4MA4A 3UJ6A 1JKJB 1XNJA 2C5FA 1YSCA 1DJQA 5JDIC 1ODTC 4C4XA 1W4CA 2ERYA 3N2ZB 3SVTA 1T2DA 3C98A 1A8PA 1JJFA 3R9KA 3TZCA 5MF6A 3OOHA 4BKQA 4K86A 4NMWA 2C4TA 2PN1A 1HYBA 2WU3A 4N1AA 4BZZA 4HDMA 4JQCA 3UJ9A 3K92A 3QU5A 1SB8A 3K7EA 3MZ0A 5JUWA 4QREA 1N2ZA 4B3FX 5FO0A 3WB2A 3B51X 2OCYC 2H4WA 1W8DA 1DBIA 1FU4A 3QXGA 4FILA 1FFSA 3CEHA 2QNIA 4LF6B 3JYNA 3ZWCA 2XVAA 1Y6FA 1KC1A 4ZEWA 1K9SA 3CWCA 1NYLA 2CYAA 1EH5A 1QVVA 2BFOA 3N8KA 5ALWA 1RVV1 2IKSA 3E58A 4P7GA 5E9QA 4MP6A 4AQDA 1M6NA 3EMKA 1LQTA 2GHQA 4LDAA 1NF3A 3IAS6 4G63A 1U2GC 3RLIA 3L4JA 4BDTA 1V96A 1ZCBA 4S12A 2M1XA 2VYVA 1D2MA 4DJEC 5EQFA 2FGKA 1XVVA 3CT6A 4M1QA 4ZT3A 2VA8A 1PSZA 3EUAA 4X0EA 3JVUA 1KOJA 1G4HA 1TJ3A 1XZFA 3O74A 3E70C 2C2HA 4KG7A 3DCNA 1CUUA 3PXEA 4OI2A 3MIZA 2OBMA 3WMRA 4EYQA 1PL7A 2CSXA 3B2NA 3QJYA 2DBZA 2UUOA 3G68A 1NU8A 5EMLA 2GTHA 3CUUA 4QU9A 3T5AA 1FP1D 4R51A 3DT9A 4QPPA 2F8SA 1CJSA 5JYCA 1XTKA 1VE7A 3B9RA 3WNVA 3IP7A 3I04A 3H0CA 2FX3A 4AKEA 2JI6A 2EWVA 2NACA 3FXAA 2GD1O 3H17A 3HFJA 3R6WA 3AFIA 1ZJ6A 4NCJA 5FPPA 5TARA 3TI9A 2R1ZA 4BFYA 2XTMA 5ITWA 2PIAA 2Q5QA 2QM7A 2JIOA 2ZRLA 1JIKA 4WESA 2R1VB 3RBVA 2ZRAA 2EZTA 3AG6A 3GEHA 3VOBA 3WBJA 2J07A 2O8BA 2VAMA 1EE9A 2Q3DA 7ADHA 3G0IA 3L05A 4HWOA 5EEHA 1VBKA 1BQ3A 5SYNA 3CC8A 1HDOA 1SG6A 5IDYA 1VRWA 3I9V1 3IELA 1R3DA 5EP3A 4ME6A 5K3SA 1JV2B 5FLKA 4U0JA 3GMTA 3ZKWB 1LX6A 1WTAA 1P2DA 1T8PA 1U0TA 5K4GA 1UMCB 3KP1A 2R86A 3JU3A 1OI4A 4KYUA 2CNKA 1YQQA 1CHDA 1QP8A 1RFGE 2FX5A 4OI0A 4DYVA 1HURA 3KG2A 3R0VA 4IEFB 1QHEA 3E22B 1BAPA 4AXXA 1E2QA 5SY4A 4UDOA 4DOMA 4R98A 1XD8A 3OQHA 3ZXYA 5KX5A 4Y7DA 3NASA 1AGPA 5DWDA 4AMZA 4DLBA 1KMHA 1QG6A 1K86A 3STTA 3SHQA 2BFCB 3G7NA 4U2KA 3T0IA 2Q9CA 3WYEA 4BFLA 5E0KB 1J21A 4KHZA 4XOUA 3Q9SA 3DVQX 1UMKA 1JDBB 3L6RA 3Q8WA 3R20A 4L02A 3NTOA 4NABA 5CBPA 5EHXA 1DAKA 4CKEB 3FW1A 3W5CA 1ZI9A 1IEVA 2G06A 5BNWA 1Z6YA 4M0LA 4YECA 2FQ1A 1KIAA 4HP8A 3RJ5A 3RIXA 3OTHA 2NZJA 1X94A 1Z0AA 3I42A 5K8UA 2XMSA 4WY2A 1M6VA 1TMOA 1XQYA 1IONA 2GK7A 2YVLA 1DPGA 3MFYA 3RSGA 4CEJB 3BQNB 2ABWA 1GA6A 5I9IA 5KVCA 2ZDHA 3MWDA 2IYRA 4PO9A 3BC1A 1XI2A 3TUJC 1Z38A 4TKVA 1TRKA 2BBSA 1E4EA 1GU7A 4ZZ1A 1K3FA 4UNIA 3GEMA 3GG2A 3VZCA 4L8YA 3U09A 3U3KA 4I6EA 3F1LA 7REQB 1VBFA 4TYYA 1S3SA 5C7LO 1HX7A 2QUAA 2X5JO 3L06A 2W42A 1AQJA 3CF6R 2B37A 3CZRA 1GPYA 3O9VA 1U8UA 3KDSE 1QDUA 5HFJA 1YRWA 5H3LA 1XKXA 2HJVA 2VF5X 1KVUA 5FWXB 4QUKA 1U3FA 1ADCA 3EVFA 1H6AA 1VJDA 2A1TR 4IDOA 4NYIR 4Z0PA 3VPBA 2QY9A 4UHBA 3RUIA 5FBHA 3WYBA 2LV8A 3F74A 1JAZA 4IV0A 2QM0A 4U00A 4DA8A 1FQJA 2YJ5A 2YIVX 4BNUA 2QX9A 3VISA 3QG5A 1ZXBA 1PT9A 2I55A 4Q3BA 3M9LA 1BVHA 1K5DA 1H3NA 4D57A 1S9DA 5L3ZA 2GZ1A 1PV1A 2IHUA 2WKSA 3EIOA 3HUTA 2OSBA 4GZMA 4UTRA 3OWXA 4LS3A 3DBHB 1DFIA 1GLNA 1O77A 3DXFA 4KUGA 5CB4F 1GYRA 2NU6A 1C4XA 5IK2A 5CDSA 1M34A 1B2LA 4GDFA 1EXMA 3H75A 1TJ4A 3PRHA 3UA4A 4X6LA 2BHSA 1MORA 1KVTA 1CEQA 2ZP1A 1Y7TA 2AMJA 4JWKA 4DMGA 5AVRA 3FPKA 1ZITA 1WW3A 4FCVA 5CX1B 3OEED 3STHA 3TBKA 1XA3A 1C7IA 2VXYA 2D6FA 2ADOA 5CUQA 3DR5A 3K4PA 3LUHA 1VCMA 4RGYA 1I4LD 3FCAA 3QY9A 1ONOA 4K40A 4BFTA 2VQEB 3PJFA 4JB8A 1GLVA 1XCOA 3HI6A 1CP3A 2RIRA 3Q5DA 1I7PA 1VFPA 1Z7GA 2M6SA 2Y99A 3ICVA 3T95A 4A6XA 3DDWA 2PO7A 2YMPA 1DHRA 4GI5A 1TK2A 2ZJ4A 4CDGA 4EY3A 1R6BX 3BK2A 3EBOA 3HSSA 3IVRA 2COEA 4YP1A 4GWKA 1VIVA 1RAIA 1CYEA 1J70A 3B8HA 5B7NA 4FE7A 1PGOA 3RVNA 2QYOA 2HXSA 3PQ7A 4IWYA 3DVAB 4ALLA 2EZ8A 3I01A 2QRUA 5IT0A 2QE7D 1JQBA 5I7SA 1U8ZA 2CN1A 3OEYA 4Q03A 4EY7A 1AU9A 1BX3A 2OAP1 1JA9A 1VKOA 4MUBA 1JXQA 2A9KA 3E3NA 4R1TA 3IHKA 2A0UA 2ADMA 2D3WA 3C16C 4H7KA 2Y0PA 3L1HA 1Z83A 1CDOA 2KB0A 4DDUA 4GDMA 3X1JA 2J4CA 3THXB 5I4CA 5KWJA 2H2FA 2A3NA 4CDNA 4EBFA 4JP2A 1T0PA 2DHDA 5HIKA 1AV6A 4MJ7A 4P3XA 2XV1A 1XD9A 3C39A 3I9JA 1CUBA 3HG7A 2VDOB 2QIPA 3E1KA 1D2GA 1DRJA 4RIIA 1WCIA 4QDZA 2V7GA 3M2PA 4V38A 2VJBA 2HCRA 5DXFA 1B74A 3C97A 4N03A 4XGRA 3ST7A 4YRAA 2F90A 2C9YA 2GHIA 2FOIA 2O2YA 3PG5A 3LHSA 4NWIA 4S1OA 3R76A 2OQ2A 3W2HA 4A8JC 1J0CA 3I1YA 4CKWA 4NYMR 2EP8A 1RPZA 4Q4HA 5E4TA 2WVAA 3EMDA 1AG9A 1BN6A 1QIIA 2FXIA 2XDQB 4BNXA 4IDNA 4AS3A 2R6R1 2QNBA 2ZK7A 3FSRA 1MEJA 3IAUA 2NP6A 1IN4A 3ITEA 4OYRA 1O5OA 2VAPA 2VLIA 2QVYX 4IXMA 3TL2A 1QPBA 3UMSA 3A2MA 4RY2A 2YJZA 3L6CA 3QOYA 5AOBA 1AHHA 4R3WA 5JJCA 3L0OA 5DXJA 3LVFO 5DO9A 5IF9A 1FUYB 1I3LA 3H16A 4RS3A 4FB5A 1PAUA 1LCIA 3OC6A 1DWUA 4HPJB 3HA7A 1SCBA 1Z12A 3IEUA 1V1RA 3HWX1 3ZQ4A 2C98A 3PFWO 2BKUA 3R9IA 5LMCA 3R3HA 4X63A 3D8NA 3MEQA 1TEVA 2WP8J 1GVHA 1GFZA 1ZN2A 3S8EA 4R71A 1IY0A 1H69A 3CUEF 4R2JA 1XZMA 3DCJA 1NXTA 3M5DA 4MYCA 5F1KA 3CXUA 2V3VA 5JMPA 1JHUA 2VQ3A 3CLVA 3S99A 4BUCA 1T0HB 5REQB 4GQBA 1ISJA 4RDHA 5IVPA 2JARA 1YB7A 1BSVA 5JFTA 3G49A 2GASA 4IIGA 3ZWDA 1L4HA 1D2RA 3VTAA 3MT9A 1UBEA 1ZUIA 2EHDA 1VLJA 3GFVA 2D7JA 1ZOIA 4BP3A 2YWFA 4D3SA 3AVQA 1NFQA 4R8VA 3BOSA 5E9WA 1RJ9B 3VRHA 3UFBA 3RU9A 1S1MA 1ZL2A 1YHYA 4KREA 2VFAA 4U7JA 3NT2A 2JEYA 5CVEA 3L6OO 4PZUA 1OXUA 2BMWA 3NHFA 1K0UA 5B6JA 2C8JA 2XYHA 4OH1A 4LC0A 4OHFA 5A5EA 4DREA 1MX1A 1NLFA 5C7OO 4AKIA 4B73A 3QY0A 2UZ3A 1RM5A 4RENA 3B9BA 3FJOA 3D81A 2A8YA 1X2EA 2PWAA 1AKUA 5HK8A 1LDEA