1VL5A

Crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
GSDLAKLMQIAALKGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEELHCFHKTFIFEDWCDRMNVTTEKKQELSDFIKSKPTEYYQKFKIVVEDGRVYSFRGESILMKARKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (BH2331) from Bacillus halodurans at 1.95 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Transferase
molecule keywords unknown conserved protein BH2331
total genus 78
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vl5A00
5E9QA 3KQSA 1FBNA 1VP9A 1KHHA 5DLYA 4V0QA 3HCEA 3EVGA 4GC9A 1INLA 4RYLA 1RI5A 1JQ3A 1L1EA 1SQGA 3K0BA 4E70A 5DPMA 3AJDA 4UOEA 2FCAA 3AY0A 3DP7A 4YUVA 4FS8A 3GO4A 2YXDA 3HA5A 2FK8A 3NW9A 5FQNA 2CWWA 5LQCA 1NE2A 3G2OA 1R8XA 3G7UA 3R6TA 3KQYA 4HH4A 3TM4A 2IH4A 3OU2A 4MWZA 5LQUA 1G8AA 3RIEA 2B25A 5P8WA 5H02A 2AR0A 2ESRA 2B2CA 5E2AA 3KQPA 2PXCA 4P7JA 2IGTA 1R74A 3LSTA 2FYTA 1U2ZA 5EMJA 3MERA 2JG3A 3QV2A 5HOQA 5DXJA 4FGZA 2IH5A 3GNLA 3CVOA 4E2ZA 1NW6A 5FA8A 3CBGA 2ZULA 1P39A 4GOOD 3TM5A 4ER5A 2YX1A 3UJBA 5M5BA 2QRVB 2QYOA 3M70A 5LQRA 1VIDA 4MHTA 1FJXA 3A7DA 4KWCA 2PT6A 2ZW9A 3DLIA 1G8SA 3DULA 5K0LA 5HEKA 4IV0A 5F2KA 1YB2A 2DULA 4A6DA 5BW4A 2AN4A 2OBFA 3KU1A 3OZTA 4RTMA 2JHPA 5CUQA 4M37A 3VC2A 1VE3A 4CKEA 4YMHA 1L3BA 2XVMA 5LQAA 1P91A 4RTSA 2CKDA 4GOND 4E2WA 2O0LA 3DMGA 1O9HA 2QY6A 1JG2A 3BXOA 3G8AA 4RTRA 5CM2Z 2YXEA 3LL7A 5FQOA 1V39A 4HG2A 1AQJA 2YQZA 1QAMA 3CGGA 2EG5A 2P8JA 4QVGA 4ER6A 1WG8A 4GC5A 5K0CA 1G6Q1 1JSXA 3BGIA 1IY9A 4RVHA 2GAFA 4C4AA 2GA9A 4LG1A 2ZBQA 5LQNA 1F3LA 3HNRA 4LWPA 4MIKA 4RTPA 4F84A 2YUIA 2XBMA 3UJ6A 3VSEA 4M36A 1ZKDA 4OBXA 4M38A 3H2BA 5EGSA 4V0RA 5GWXA 1XCJA 2ZIGA 2OB1A 3FYCA 4BP1A 3KHKA 3T7TA 3B3JA 2C7QA 1NW8A 3OZSA 3TRKA 3CJTA 3M6UA 4H0NA 5F2OA 2HR1A 3LDUA 3R3HA 1JG3A 1L9KA 1SQFA 1YZHA 3G2QA 2P41A 1VP3A 4GOLD 1X1BA 1D2CA 4C07A 1L3CA 4HC4A 3LCVB 3MCTA 2P7IA 2G71A 4DCGA 4AZWA 3LPMA 3DUWA 2UYOA 4C03A 2H00A 2PY6A 3LBYA 3LBFA 3MB5A 4RVGA 3MCZA 5E1BA 5DT2A 3VC1A 5IKMA 4RTNA 2PX4A 4BY9E 3LGAA 2P40A 3RODA 5LQJA 2G72A 2IBSA 1I9GA 3GRUA 2NP7A 4KDCA 1QANA 4HGYA 3ORHA 5BXYA 3FUWA 4E2XA 4RV9A 2XYQA 3Q7EA 1OR8A 3KPYA 2B3TA 4YV0A 3M6VA 3QOXA 1JQDA 4PYMA 5ICFA 2ZZKA 1P1BA 4RWZA 1G38A 5DWQA 4QPPA 1M6EX 1XVAA 2LD4A 4AZSA 2O06A 1QAOA 3OU7A 4KIFA 5HZMA 4O29A 3PFHA 5LR6A 5K0EA 3HTXA 2ZBRA 1JQEA 2JHAA 4OA8A 3KPWA 3HP7A 3I9FA 3UA3A 5E2BA 5C0OE 1SUSA 2PWPA 4OA5A 3S68A 1KIAA 3ID6C 5DSXA 1UWVA 2PBFA 5K03A 3NVMB 1WXXA 3IV6A 2ADMA 1UFKA 2OZVA 4FR0A 3M4XA 4FSDA 1NBHA 1NT2A 2P3LA 3SGLA 5F2NA 1ORHA 4QPNA 3EVFA 4U7PB 2HNKA 4AZVA 4DCMA 3G88A 1D2HA 3TLJA 2ZIFA 3KKZA 3OU6A 3GGDA 5K05A 1WS6A 2ZWVA 3Q87B 3B7PA 2ZBPA 1BOOA 3FRHA 1KPGA 2GH1A 2EX4A 3P71T 4RVFA 3EMDA 4HRAA 1SG9A 3EEYA 3UJDA 5GM2A 1ZG3A 2VDUE 1JG4A 3C6KA 5CD1A 3HVHA 3NTVA 1XDSA 2ZSUA 5CVEA 1Q0SA 4OX9Y 4YUYA 4HGZA 3FYDA 2Y1WA 5ICEA 4LWOA 1KR5A 5HIJA 4ZTBA 1ORIA 2PGXA 1ZGAA 3KR9A 1KP9A 5GP1A 2G1PA 2XYVA 3DR5A 2VZ9A 1ZHFA 4RVDA 3MHTA 1JR4A 2UYHA 3EVZA 4JXJA 3C3PA 1NBIA 3DXXA 2P7HA 3M33A 3DXYA 1JG1A 5EZSA 2Z6QA 4RTKA 2IH2A 1KPHA 2F8LA 5FADA 3DMFA 1VPTA 5LQKA 3L8DA 2YTZA 2PKWA 5K01A 5T6BA 1QAQA 4X41A 1T43A 3FPJA 2NP6A 1BHJA 4ISCA 3SM3A 4PYOA 4CKBA 5EZQA 1D2GA 4PIMA 5K0NA 2PXAA 1N7IA 3BUSA 1VQ1A 5K0JA 2AVDA 2HWKA 5EKUA 3A27A 4GOMD 2OPBA 5ERGB 2UYQA 4XUEA 2QM3A 4EMSA 5E1DA 4ER7A 1AQIA 1O9GA 3LECA 3HA3A 1WXWA 3EVBA 1IXKA 3LCUA 5DM2A 3GCZA 4LECA 4YUZA 1RI1A 1N2XA 2JH8A 3P2IA 5E9JA 3GDHA 2IDKA 3TMAA 2H1RA 3SSNA 3LX6A 4YUXA 3I5UA 5K0GA 3CCFA 3FPHA 2A14A 3HVKA 3TKAA 2Y1XA 1TW2A 2WA2A 4XUCA 2B9EA 2Q41A 2ERCA 3GXOA 5T64A 2IPXA 4KVZA 2I62A 2PJDA 3TOSA 4B17A 1I4WA 3NDJA 1UIRA 5DM1A 2IBTA 1BKYA 3PFGA 3P97A 3PB3A 4C08A 2Z6AA 1SKMA 2G8NA 4A6EA 5GIPE 4POOA 5CVUA 2AVNA 5DX1A 2HTEA 5CVDA 1DUSA 5E1OA 4RTLA 1QYRA 3T7SA 1XCLA 2XYRA 3LDGA 3EGEA 2R6ZA 1KYZA 4P7FA 1B42A 3V8VA 2NYUA 4PIPA 10MHA 4CTKA 2WK1A 5K09A 2DPMA 1DCTA 4X61A 2BM8A 5JUWA 2BZGA 4BP3A 4E31A 3ELWA 5GINE 1KYWA 1O54A 3AXTA 3MGGA 2C7PA 3A25A 1EJ0A 5EEHA 2OB2A 2IDJA 2QE6A 3KR2A 4QQKA 4FP9A 3KR0A 2FRXA 3CKKA 5FUBA 4YMGA 5CCBA 4RTOA 3SX0A 1WZNA 2P1DA 2NXCA 3FUXA 5CIYA 4P7GA 3BGDA 4R8SA 3G5TA 3DH0A 1R00A 2AOUA 4PCLA 3VYWA 3O7WA 5HILA 5GIOE 5CCXA 2ONYA 4PYLA 5HFJA 3ELDA 2OY0A 3ANXA 3HCFA 2XVAA 3P9CA 3T7RA 1HMYA 4PYIA 4CXMA 3THSA 1WY7A 5E9WA 3G2PA 2FPOA 4IV8A 5FHRA 4ER0A 3GU3A 3JWGA 3KQVA 4P58A 3GRYA 3UA4A 3UJCA 4EQZA 3UJ8A 3EPPA 2GLUA 3DLCA 5DRYA 3U81A 2I9KA 3CC8A 4L7VA 3G5LA 1EAMA 5IH3A 3B3GA 5ICGA 2FK7A 3EVCA 2WA1A 4RSRA 3SSOA 3HCDA 4E33A 5C9ZA 1AV6A 1PJZA 4ATNA 2H11A 2I7CA 4XCXA 3IHTA 2ZFUA 3DMHA 3LKDA 1EG2A 5CVJA 3A7EA 5HIIA 3BWBA 1XDZA 1PRYA 5DTMA 2ZWAA 3BGVA 3SSMA 3WSTA 2GS9A 5CVVA 4KDRA 5KQRA 2VS1A 2ZLBA 3KQWA 5GM1A 4FSXA 5FCDA 4YUWA 3A4TA 1VLMA 3HA7A 2AOTB 4EKIA 3OFKA 1F38A 4DMGA 3FUUA 4DKJA 3G8BA 1FP2A 3TQSA 1X1CA 2HMYB 3B5IA 4AX8A 2IP2A 4DF3A 3C6MA 5FTWA 1RJGA 4G56A 4X63A 4E32A 5FWDA 1YZ3A 1R6AA 2AS0A 3EVDA 1YFLA 4RX1A 2V7EA 3TKYA 1MJFA 1ZQ9A 3DOUA 1RJFA 3UZUA 2O05A 7MHTA 4HSGA 4FZVA 4PONA 3HCBA 3EVEA 3K6RA 4OBWA 3G89A 4X60A 3E7PA 2C7OA 2PV0A 2AOXA 3HCAA 3PT9A 5HIMA 4YV1A 3GIWA 2AN3A 4MTLA 3HEMA 5EKXA 4F85A 1JTFA 2GPYA 3R9XB 1JTEA 1RJDA 3FRIA 2BR5A 3HCCA 5KQSA 2EJUA 2QRVA 4R6WA 4OQDA 4PWYA 3FTDA 1H1DA 4QDKA 4WXHA 5D1HA 3JWJA 3P2KA 5E1MA 4CTJA 3ER9A 3FPEA 2CMHA 3BZBA 5ICCA 5EVJA 5JR3A 2ZIEA 2OYRA 3R24A 3FTFA 2B78A 4AUKA 3REOA 3KQQA 3FUTA 3UJ9A 3LCCA 1R8YA 3QOWA 5G02A 2YVLA 1IM8A 4C05A 3NDIA 3OCJA 1YFJA 1M0EA 3IYLW 5MHTA 3M6XA 3PX2A 3PTAA 1X1AA 5DM4A 3PLAE 5FA5A 3E8SA 3EVAA 2HV9A 5BW5A 4QDJA 5K0BA 1TPYA 4R8RA 1ZGJA 3GRVA 3OE5A 2JJQA 3P2EA 4NECA 1RJEA 3O4FA 3R0QA 4KRGA 5EHGA 5LSAA 2VDVE 4PNEA 2UYCA 4PYJA 3DTNA 4R05A 4OQEA 1Q0TA 1Y8CA 1L3IA 3A26A 2O57A 4FT4A 1AF7A 4RTQA 4EKGA 3P9IA 3E23A 3OPNA 3AWIA 4K6MA 4PINA 5EMMA 2P35A 2N47A 3O31A 4BLWA 2AZTA 1KXZA 4RTJA 3BWYA 2ORED 3NWBA 1SVUA 3BKWA 2UZ4A 2PVCA 2P3QA 3F4KA 5EMKA 3CJQA 3P8ZA 4KIGA 5EQJB 2JHCA 2AOTA 3BWCA 3TR6A 3MTEA 3UFBA 4ER3A 5DRTA 2CMGA 2AOVA 3MAGA 4HTFA 4XUDA 3FZGA 5B1SA 3BKXA 2BM9A 4PYNA 4Y2HA 1Z3CA 3MTIA 2PX2A 4MQ4A 1NKVA 4PGGA 3FPGA 5BP7A 3X0DA 5KS2A 3FTCA 2PXXA 4AZTA 1BC5A 1I1NA 5U4XA 3I53A 1XXLA 4FT2A 1X1DA 1NV8A 2KW5A 4BLVA 4KW7A 4F86A 5K0FA 1MHTA 1RI3A 5EIFA 3SVZA 5T67A 4E30A 3TFWA 4E2YA 5EC8A 3C0KA 1M6YA 3KPVA 1XJ5A 2JH9A 3LHDA 3D2LA 4WVLA 3EEOA 3BWMA 1N7JA 1JSZA 1RI2A 1XDUA 4EVIA 3GWZA 4U7TB 1FPQA 5EIWA 4Y30A 2PT9A 5EOVA 2BH2A 1NW7A 4QQNA 2AOWA 3HVIA 3JWHA 2AOUB 2V74B 4M7RA 5DM0A 4PYQA 5EG5A 2PX5A 3P9KA 5E8JA 3EMBA 5EMLA 5GOZA 3ELYA 2C7RA 3PX3A 5FULA 3GRZA 3OZRA 5D1NA 5HIKA 3T0IA 4Z2YA 2YXLA 2NXEA 1QZZA 5EEGA 1FP1D 2ONZA 3GJYA 5EHIA 3CJRA 2BR3A 3V97A 4C04A 2NNWB 2OXTA 1NW5A 1RI4A 4DQ0A 3ELUA 3I64A 3MQ2A 3LKZA 4PGHA 4QVKA 3RW9A 3DXZA 4BLUA 3NMUF 3KQOA 3PVCA 4IWNA 5FHQA 3NVKI 2OO3A 5EPEA 3KR1A 3IEIA 2PX8A 4YV2A 5KYGA 3C3YA 3NWEA 4CKCA 2E5WA 3UJ7A 1NV9A 3ME5A 2ZVJA 3B89A 1VBFA 3OFJA 4P7KA 1NW3A 2NXNA 2K4MA 3FUVA 2FHPA 3KQTA 3SR4A 2ZZMA 3GRRA 2BR4A 2CL5A 5KVAA 2VP3A 4C06A 5DX0A 2EFJA 4DM3A 8MHTA 2EJTA 3G2MA 3M6WA 1EQAA 1P1CA 3SXJA 1R18A 5FWAA 2R3SA 2Z6UA 2ZCJA 1HNNA 3AXSA 3HVJA 1SUIA 4IKPA 1X19A 4GUAA 4X1OA 4GQBA 2YR0A 2O07A 3KPJA 4PYKA 4DA4A 5K8VA 3THRA 2PSSA 3TPZA 4PCAA 4QTUB 2G70A 5DTQA 3KPUA 5C1IA 5DTRA 1DL5A 3UBTA 1EJ6A 3EGIA 1G55A 3E05A 3HM2A 4R6XA 1KPIA 1TW3A 2ZZNA 3BT7A 2OKCA 3JWIA 2VDWA 4EK9A 3SMQA 9MHTA 3ER8A 3ERCA 5DXAA 4GF5A 4HTFB 2PWYA 2I6GA 3LDFA 3KQMA 4GBED 2ZTHA 3UJAA 1VL5A 3NJRA 3FPFA 5DX8A 2IFTA 3OE4A 1XTPA 5E8RA 3I58A 4CWAA 3FTEA 2NXJA 2GB4A 4GEKA 4QTTB 4DZRA 2IIPA 3UWPA 1YF3A 3PS9A 2AN5A 3P9NA 1G60A 1EIZA 5DSTA 3B3FA 3EGVA 1YUBA 2P3OA 2PLWA
chains in the Genus database with same CATH superfamily
1MLDA 3KQSA 3DYBA 2MJLA 1A27A 4Q7EA 4LPSA 3U44B 3RAEC 4OY3A 4OB8A 4G4SO 3FVVA 5AW5A 5BMVF 4IDCA 3DHEA 1V4BA 1KEPA 1GADO 5CB4F 4FCCA 1UPFA 2HSEA 1WF3A 3NW9A 3BE6A 4RD4A 4RDCA 4X1YB 1XNJA 3FWNA 4F71A 5LQCA 3O91A 1O95A 1RYNA 3L41A 1F12A 3TM4A 1Y34E 4IDPA 1QKJA 1RYYA 3OU2A 2QG4A 3QTBA 1JHOA 2I6FA 4P3KA 4RH1A 5AVKA 3TLZA 3VPFA 3TCXB 5P8WA 1ZGZA 6CHYA 4IGEA 4V1CB 1B8PA 3GRCA 1Z5WA 2IGTA 1KK1A 2IXEA 1OJLA 3IIEA 3IOYA 4DRXB 3KX2A 2ASVA 2MR6A 3C43A 1K06A 4HDQB 5FLYA 5FPHA 1YE5A 1KO8A 3C3EA 3OE7A 3PFKA 1EWTA 2NU7B 1P7YA 1M2HA 4KOAA 4JI3B 2XRYA 4Q9DA 4QUJA 2YX1A 1CPYA 1QG0A 1WMSA 4WDRA 1RXVA 2H65A 3WGKA 4DYDA 1P44A 5EKDA 2OAEA 4KWCA 1EP1B 3VGPA 5J1SB 3QPAA 2C8JA 1T4BA 2HK7A 4R1OA 4TVBA 2JPDA 1T6YA 2A67A 4TMXA 4YRIA 5CU7A 5HEKA 3LQKA 3EFOB 3CRVA 5BOSA 3BQNB 3FYUA 2KS6A 2MR5A 2GF2A 5LBIA 2OBFA 4EHNA 1MOSA 1B26A 2UAGA 3KZMA 2O5VA 3BE5A 4HV4A 2D7DA 2SCUA 2WWWA 3HACA 2QLFA 2WOJA 1C9EA 1YS2X 3FTQA 4RZIA 3O8CA 3PC8A 4D8XA 3DYIA 2ET6A 4NDZA 4OHXA 3ZV6A 2ZR7A 1AQJA 3VVMA 3UK0A 1GP2A 3RYFB 1DB3A 1EUQA 1KMCA 2Q29A 5JH7A 4D80A 2GEBA 4RACA 1NONA 3GGJA 4RDIA 4I3FA 2VAMA 3UMVA 1RLJA 1Y89A 4K0RA 2FEPA 1BROA 1VG8A 1YDGA 3PI6A 1TNDA 3QVGB 1FJGB 1MRNA 1U28A 1YBMA 4MQBA 5IBRA 3KTDA 4NDNE 5BN3B 4GYYA 1BCRA 4CG0A 3DTTA 1II0A 2IOYA 2VWQA 4Y2SA 2J9YB 2XWBF 3L7OA 3W8EA 3E3AA 3THOA 2HR1A 4FKMA 4LGYA 2BZSA 4JI2B 4MTCA 5JATA 2R5WA 1KZYC 4OQPA 4ZVMA 2YYYA 3R6GA 4LFBB 1PFWA 1QO7A 1RAAA 3R0JA 4QIHA 4YMUA 5AW2A 1JEYA 2B92A 4INAA 4TM8A 5FL7A 1A97A 1HSOA 4Q9NA 5KAPA 4A2WA 1DAHA 1FBTA 2G71A 4BX8A 4HDMB 1NWCA 3KKMA 1HZZC 2Q7XA 1Z0ZA 3Q3JB 4C03A 2PY6A 2X42A 2HI0A 1UQTA 1O97D 4RVGA 5BWMA 1K3UB 4LCBA 3RE1A 5A04A 2OBLA 3NUQA 3AUKA 1AUPA 1S2IA 3NIDB 4JT2A 2WUWE 5EP4A 4HD8A 3CR3C 4EIWA 3C7KA 4P4SA 3NPMA 1FLDA 1PR6A 1UFQA 1VI6A 1YB5A 2FN3A 2YZ7A 3DYVA 1KZ6A 1RACA 5LJLA 4IH1A 2B7LA 5HJEA 1W0JA 2GGSA 1GQYA 2QV7A 1TM2A 3KJFA 2IIVA 4EHBA 1P1BA 1X7XB 2A1IA 1G38A 3BXPA 2C84A 3RC2A 4XFKA 2O06A 3AFGA 1Z26A 3JASB 1QTQA 2Q4TA 5LN1A 5IEJA 1GXSA 1KFKB 1TT5A 4JL8A 4M1WA 3CF2A 1Q0HA 2H9AA 2YNMC 3A6LA 3QKRA 3FZYA 3UOGA 4G01B 4ML3A 1ZNWA 3PQ2A 1ADBA 3HB0A 1QFJA 3IVRA 3KFVA 4OA5A 5G3ZA 3TZQA 4AFNA 3WQHA 4AJOA 4ZVLA 4MMYB 2Z0MA 4TLLB 1YDHA 3O2NA 3EVFA 4U7PB 5DWVA 4OHZA 4F4CA 3QE0A 4AZVA 4J4TA 2XUIA 1DCTA 2NUAB 1MT0A 2WYUA 2ZWVA 3QNUA 4XSHA 4B3GA 2J7PA 4XASA 4ZREA 2A57A 4JLOA 5CA1B 4QVIA 3O1HB 1DFHA 4FI3C 3GCXA 2FU5C 3R8FA 3IUYA 3M5CA 4CLOB 1HDEA 4XWTA 8ATCA 2Q2OA 3HJNA 1UBEA 3IQEA 1FRFS 3CEAA 4HDNA 2I2FA 4JP8A 4PX9A 1UT8A 1XTBA 4LWOA 2XWJI 1GNSA 4QQRA 1COWA 2EXXA 1JNXX 1ORIA 1NGSA 2G1PA 4NAHA 3DR5A 1ZHFA 2UYHA 3L4JA 1FUKA 5E6UB 2WEKA 5F4BA 4XR4A 3M33A 1P7WA 2AXNA 1TM1E 2F1KA 2XDWA 2V5UA 1N2OA 3OZWA 3R77A 4I5EA 4MUJA 2GD0A 5BSVA 4GPTA 3KK0A 3UMGA 3VX3A 1MQAA 1LC0A 2B1QA 4LDNA 2BEWA 1IBRA 3INYA 4QRIA 3WLRA 4DXDA 5JC8A 2KI5A 4GS5A 1WDTA 3VU3A 1H4TA 1GRRA 3H99A 4EG4A 2G1JA 2NP6A 4A0SA 1QBGA 2VHEA 2SKCA 1N6HA 1JR3D 2AKAB 2Z2KA 1A1VA 5AHRA 3SJAA 3A3NA 2BE9A 3KHUA 3JD1A 4AZ3B 1R50A 1D2AA 2FVXA 3QHQA 1K63A 4BBPA 4GP6A 2HBQA 4I4TA 2Y92A 1AQIA 4MS4A 5DTJA 3LA8A 3SCZA 1T6NA 1W0KA 1YVDA 2C20A 2C5AA 4RY9A 3I0ZA 2O6HA 1GGFA 5CP8A 1RI1A 2EP7A 5CLFA 1J7JA 4JGIA 1QGUA 3ZDDA 3SSNA 4JJIA 4LSZA 1J07A 1GKIA 2GILA 1C4WA 4QNNA 5K0GA 2A9FA 1P31A 2A14A 2QZ9A 3AZQA 5BT9A 2C29D 4DV5B 3BHMA 4E2FA 5DYNA 3M9XA 3K6KA 1MJGA 1V25A 3K5WA 2PFKA 3JV7A 3TPFA 3EF1A 3QPBA 4MCHA 3HSKA 1KARA 2F17A 1C1YA 3DLTA 3SC3A 1H0KA 3GA5A 1FC0A 1RDFA 3EF0A 2AZMA 5TLSA 2QN2A 1KJYA 1W2WB 3NFRA 1EWVA 4H35A 3DT9A 3FCSB 3ODGA 4GBJA 2Y0PA 2J41A 5E1OA 3I6BA 3IAUA 2OK7A 1OXKB 4S3MA 2OG1A 5F23A 2RBGA 1S5PA 1AKMA 2JJ2D 5E6SA 4D0NA 3ZE0B 4UFNA 3RV4A 2BI4A 2YRXA 3RYCA 4WRRA 1BA3A 3EFEA 4BVJA 1WCIB 3FKSD 1EFVB 4CPDA 4TKVA 3L77A 4QPJC 3UUEA 3WWZA 4ITRC 4UATA 4BTLA 2IUTA 2ZJ0A 4OXQA 4FYPA 3L8MA 5CURA 1ZD5A 2PEZA 4J7AA 3ZJTA 4KDEA 1H4SA 3RAJA 2GLTA 3TG2A 3K0SA 3V4VB 1DFGA 1IJBA 2BGUA 2PA0A 4ZCSA 5FUBA 4D44A 1E6LA 5AM2A 1V8FA 2ZVDA 3NYRA 1R4AA 2DBVO 3FWKA 2YHAA 5LYJA 2EZ4A 4FYMA 2NV6A 4YYEA 2H1IA 1TUBA 3OQMA 4AG6A 3FOAA 3PNLA 4XM0A 4GOJA 3PUJA 1RXCA 4LE2A 5B6JA 3EDRA 1SC6A 1QVZA 3H11A 3HKEB 1X8JA 4HNVA 3UT5A 2IA5A 2XVYA 4IJKA 1U7XA 1NMYA 5KDDA 2OHIA 1YASA 3NIGB 4H2DA 5FHRA 4EG3A 3W6NA 4FYIA 4MV6A 3UJ8A 1U6IA 2GEKA 5HX7A 5CFNA 2EP5A 1UK8A 2UKDA 2X58A 2LCQA 3U62A 1ZVVA 5BN1A 4ZDKA 1GVHA 4N5NA 5FP0A 4ZYZA 2CXRA 4GI2A 4X97A 1GVNB 2II6A 2EJVA 2Q07A 1N8NA 4U02A 5IBPA 1ZCBA 5TF4A 2YFKA 2FAXA 3DL0A 3SX4A 3LA6A 3WZMA 4DC9A 2ZWAA 4FE3A 5ADHA 4TQUS 2BEUB 2OCGA 2COEA 3FSJX 1PKXA 2AIRA 2VJKA 3CZQA 3E4CA 4G1EB 2XHZA 3E15A 1T6BY 4AQDA 2AOTB 1DO0A 1NOKA 3AHDA 3U31A 1RJ9A 4RENA 2PXHA 1E60A 1AVTA 5LKRA 2VP9A 3KD2A 1QHSA 2E85A 2EFHB 2I2CA 1VJ1A 3HUDA 4UZEA 4UFPA 1UOEA 2QR5A 3MM4A 4IJWA 4A3SA 1T2CA 2BFBB 2WAOA 3IXMA 1O4VA 4I6JA 5DJ5A 3VZDA 2GXUA 3WIDA 3WAJA 5CNJA 4FJ0A 5A3SA 3AR2A 1PSDA 1MC4A 1T8WA 4XYMA 1V4NA 1CW2B 4G0NA 3TG8A 5T7BA 4DV2B 1EH5A 1SBYA 3MBOA 3HO8A 4ZGGA 3DTVB 4E09A 2YMLA 3S55A 4J0QA 1QTIA 1AKWA 4NICA 4TV8F 1E6CA 5B1HA 4OHCA 3T3DA 4IGFA 1TTQB 2QAGC 3ZV4A 4D43A 4D9EA 4ESHA 5E7MA 3QVWA 1AM4D 4KV9A 4QT0A 5HKAA 4S05A 3FTDA 3RTCA 1HF3A 2G5CA 4M49A 4CMGA 4OFWA 3W8RA 3JATA 4JLVA 1AIPA 5FI3A 4S2UA 3CVXA 2PKYX 5JQGF 1WW8A 5JAQA 1JBQA 3L4BA 4BASA 2CMKA 1QHHA 2XNCA 16PKA 3W8FA 3R20A 3QOWA 3EIXA 1QB8A 4GKVA 5G02A 1IM8A 3KZVA 3Q9NA 1U8CB 2DUJA 3SDBA 3V8QA 1E3TA 2VJYA 4BJ6A 2W70A 4ZRMA 4FVTA 3ZBUA 4BVKA 4NMMA 3BMOA 1GSAA 1ADGA 3PPVA 1P5HA 2CJWA 3E8SA 5BR4A 1ZHOA 1EUZA 1Y3IA 1NZDA 4AAYA 4KRGA 4TKMA 1FP6A 4ZK2A 2YZMA 1A4RA 2HAEA 2V55B 2NQ2C 2H52A 2AC4A 2GCGA 1ILWA 4X6UA 4Y98A 2EZTA 1J56A 3B9QA 4HADA 1HDCA 1MIOB 3REGA 4R8VA 1P1JA 4K9LA 3UXMA 1SBCA 5CT4A 4DT1B 1UXOA 3W5JA 1X86B 2AMFA 3FR7A 3WIBA 3H1EA 2ZU6A 3JQAD 2GA8A 5COBA 2P35A 5EMMA 1Y1TA 4KMSA 2E9SA 4NF2A 4F4FA 1JKXA 3I2HA 2ORED 3NWBA 3G0HA 1ZNYA 4P4SB 5KYKA 1DBRA 3FFWA 3Q9UA 2P4SA 3WK8A 2JK1A 4LQCA 8LDHA 5CJPA 2FP4A 3NV9A 1OB2A 1OV6A 4AY5A 3VNRA 1UFVA 1TO6A 1WE2A 3ACBA 3BE4A 2HMAA 5ECDA 1E2KA 4DJDC 1NJ6A 1J39A 2W6JD 3MAGA 4HTFA 4IVPA 4DWVA 3EC7A 5B1SA 2PFGA 1VMIA 2C2BA 1ACLA 4DR3B 3KFLA 1NQAO 3IBCA 2NUPA 2NPFA 1XZCA 3KLNA 1PTJC 3ODPA 4EVRA 4X8MA 4ZHQF 3K1YA 4YROA 4ZCIA 3WJ1A 2C07A 2VQFB 1I1NA 2XA9A 3KDAA 3O8OA 1PR1A 5T3YA 2IITA 2R5NA 3WG9A 3AUXA 1CU1A 4LXUA 5B37A 3UBMA 2CXOA 4JEUA 3ZZ0A 4BE7B 4DA8A 5JISA 1Z3IX 1FNSA 3THYA 1NTRA 1UC4B 1W75A 2WWFA 3OFND 2V0GA 1PLKA 3II6X 2QBYB 2GBFA 1I5EA 1IXZA 4HUQB 3S2ZA 1ACMA 2BDTA 4P6VF 4XGNA 3FHOA 4C5CA 3N74A 2VTBB 1K1EA 1UPUA 5EIWA 2COUA 2PT9A 1V3UA 2AOWA 2AOUB 2WF9A 4CW7A 2N46A 1HEUA 1THGA 2X2EA 1MG5A 5EMLA 1KI7A 1C8KA 3K94A 4BO8A 2FMTA 5LYJB 4BX9A 3JVDA 3GLFB 1QH8B 2NXEA 1KBZA 3LFTA 4QECA 1D5CA 1D1SA 3C87A 3CNLA 1Q50A 1VE7A 2JFYA 1A0OA 3CRRA 1XZGA 4OMFG 1GL7A 3IJEB 1ZI9A 2VT3A 1FUIA 4TMYA 2VIIA 4QU0A 3DEKA 3MQ2A 4LI3X 3WIEA 5ED4A 1CCWA 3DB2A 2QGZA 1C1DA 3LQ1A 1USGA 4NJEA 3G9ZA 1Z4NA 4RK0A 3K0KA 5AIAA 4F4UA 1TL7C 3DOJA 2V03A 4X5OA 3RQIA 4P3OA 3OFJA 3BULA 1I7NA 1MX3A 2FWRA 3KHSA 2K7ZA 1SBHA 4V0LA 4BO9A 2DRIA 3OLXA 1GZ3A 1YONA 2RCNA 4OM7A 4LWQA 4RJIA 3D6NB 3GD7A 3SXJA 1EI9A 2VPPA 3IDZA 4IICA 3I39X 4WXYB 4BDTA 2KB0A 1XYGA 2PMWB 2AFVA 3LK6A 1NR1A 4RQTA 3FOFC 1DO8A 4OQXA 3TDKA 1N77A 3QU4A 1X19A 3DTYA 4OKSA 4Q48A 4V0MA 3PLRA 4PCAA 4R8KA 1DOZA 4D3DA 1A9RA 1WABA 2P2DA 4BAZA 1Q77A 2X22A 4LFCB 5BQXA 2L82A 1GLVA 1YL7A 3ENNA 4NK4A 1DVRA 1Q1BA 5EAIA 3NXKA 5TR9A 3RG2A 3G8DA 4JOBA 3NYIA 1XZQA 4MA5A 5IVIA 2Q50A 5HKKD 3Q72A 1G16A 4J1QA 4M1EA 3TZBA 2MHCA 2E7ZA 3ITEA 1SG6A 2H5JA 5BV2P 2CV2A 1XEAA 2XYHA 5IP5A 3WMEA 1G5QA 3ESYA 3I58A 3UOAB 4DTCA 5CDHA 4MRAA 2WMNB 4QEKA 3V3KA 3G3EA 4OQYA 3E3NA 2HYIC 1Q3HA 4TRMA 4UUOA 3LBHA 1U11A 3CTMA 4LOIA 1TQDA 1TAGA 1ZUNA 2WJZB 3EGDB 1AB6A 3OIVA 4TMKA 2QPTA 4X8HA 4ZTUB 3EXG2 4X92A 4JT8A 2O0JA 3F3KA 4V0QA 1GDTA 5CFZA 3IFSA 1YQWA 1VLJA 5H3CA 3GG2A 1AZWA 5DH9A 4INPA 3TOZA 3U4HA 3LP8A 1OROA 1T25A 4ACAA 3AY0A 2G08A 5DBIA 1R0BA 4B4VA 5FBQB 2FK8A 4QEDA 2G1KA 3CFYA 1I4OA 3UG7A 3IC5A 1S6YA 5A4AA 1N5RA 2QRZA 5E38A 4CQNA 3LTNC 1PU2A 3G7UA 3FX2A 4HH4A 2AG1A 1L4FA 4H6XA 4DIEA 2QD1A 2L18A 4KYUA 1HE4A 1FSGA 4PLFA 5CT6A 4MYRA 2YJGA 1WW2A 3M3HA 3ST7A 1IOLA 2B2CA 3BFPA 5E2AA 2AQIA 2CLLB 4R1MA 1ECJA 1J9EA 2A84A 1P4SA 2IOFA 2PGLA 3ILHA 4N65A 4RA9B 4RGYA 2V5VA 4E6PA 1Z82A 4Q9IA 5BR8B 2IQ5A 1RZ3A 5ALSA 1ZR4A 1ZU4A 4HGQA 5DXJA 4FGZA 2DERA 1W85A 3GNLA 2OD2A 3BSWA 4DANA 2W2MA 1A8QA 4EQ6B 2O2IA 4UCFA 2DFLA 3TZCA 3LPCA 2XTMA 1XRSB 4OU5A 4DQKA 2D2VA 2QLNA 1QG6A 2Z4TA 2HMSA 4EKDA 5LQRA 2QB5A 3A2LA 3CVVA 1VFNA 2F43B 2PK3A 3OECA 3GG9A 3JYPA 5J2TF 1T5DX 3DZ8A 4FYHA 3U7QA 4BKPA 5ED0A 2ZRNA 1VL8A 2ZRMA 3BGWA 1T9HA 3D4OA 5LZ5A 1K8YB 1L5HB 4JWKA 3H4IA 3A9RA 2ENWA 4Y2YA 4BV9A 4RPJA 4DSOA 3E2MA 1VE3A 3H17A 2ZJ2A 1VLZA 3EISA 1CC1S 1E3QA 4DV6B 2P2SA 2HQOA 1XZMA 3ZIUA 4HG2A 1SZJG 2YQZA 3CGGA 3R5KA 4IIUA 4KXFB 4CT5A 3BJMA 4G97A 3TUZC 1EGQA 1W6RA 1P2FA 3RF7A 3FCEA 1RQPA 4IXDA 4ZALA 2PG3A 4E1AA 3QRWA 3BMCB 4BKUA 5HRAA 4WA7A 4BO5A 4IWYA 4OH1A 3FOBA 3DOHA 1EVIA 4H7DA 4J0FA 3U09A 2WWRA 2X5NA 1KAGA 1D1QA 3W5AA 4UTNA 2VF5X 4Z9XA 4NHEA 2C7VA 1T91A 1JX6A 3SZRA 5KYNA 1L9KA 3COSA 4PLZA 2AYZA 1DX4A 3GEHA 3LT1A 4CM9D 3F8WA 2LKCA 4TT3D 4Y9UA 4C07A 1W2GA 4P5PA 1NQXA 3GFTA 2HUNA 4OKNA 1LRLA 3ZEAA 4QGHA 5CLLA 3TQSA 4MI9A 5H70A 2OYSA 1T3TA 3A9UA 3N87A 4N7MA 1FYVA 3W3AA 4YQEA 3V2HA 1MTZA 1VB3A 1ZP6A 1L8QA 4LOLA 4CN8A 4JEIA 3VC1A 4GDMA 2W6CX 4O2LA 1SB9A 2PKRA 3VU8A 3PE6A 2HEIA 2G72A 2XMQA 4OHFA 1EDOA 3FPCA 4OIFA 3NATA 1QH1B 4DR2B 1GRNA 2F1JA 3QVGA 5BXYA 1VYUA 1QF9A 1XAJA 4X54A 2QRJA 3MS4A 3STYA 2IYPA 3FNBA 3BOSA 3M6VA 1UXGA 2PUTA 1QWSA 4J91A 4RS4A 4C2TA 4NBSA 2FSPA 4LAFA 3UWOA 1YQUA 2EJWA 1F8YA 5DWQA 3RYFA 3ZLBA 5KTYA 4OO3A 1L7AA 1Y3BE 3K2IA 1FP4A 3IEKA 2VP6A 1GG5A 4D9BA 3TI7A 1XZJA 4R2WA 2H9YA 1ZAKA 5L4NA 1LQTA 2GM4A 2ADFA 1W9MA 1S2OA 3WADA 3MINA 3QUQA 2OQ2A 1SBQA 1SUSA 3S68A 3UHAA 2VHUA 4N54A 2Q49A 2FEOA 3PR2B 2J08A 4O8ZA 5JCPA 5CGZA 1SCJA 1KU6A 1UFKA 4K3VA 4D0RA 4PX3A 1U7UA 1JKJB 3CH7A 5AH0A 4GWLA 2V7BA 3WVNA 1FOEB 1QHHB 3KJGA 1E3LA 5F52A 2ZIFA 3JQDA 1P9NA 1GITA 1SH7A 2AG5A 5FQNA 1K7EB 3PQ5A 2PSHA 4A8PA 1UOOA 4C7JA 5AW9A 2VC2B 5KINB 1DJNA 1IYZA 5CVEA 4J0CA 2NSJA 2EKLA 1FVXA 2XCIA 4IXWA 2VP4A 2RB4A 4BNHA 4M8IA 3B1WA 2O59A 3TRDA 4ILEA 1G8KA 3ZE1B 1C3JA 4JENA 3KXIA 5LU9A 2BD0A 5AJUA 3TN7A 2WKPA 4MX8A 1Q1GA 3QEBZ 2OAQ1 3NTLA 1I4EB 3VR5D 4AXBA 3KAPA 4IHJB 1KWGA 1JG1A 4KI7A 1U2DC 3GPIA 4FHZA 2YBEA 3DL7A 3VPBA 4INOA 2OO7A 2JGNA 5EUMA 5J4HA 1R6XA 2H18A 1AS2A 2VTDA 2H7VA 4ISCA 4H27A 2BP7A 2PSEA 4CKBA 4HAIA 4FM9A 4Y2TA 4P2BA 1JFFA 1TZKA 3GBVA 2VSOA 3BS4A 3TSZA 4JVSB 2REBA 3T9CA 1PT5A 4BQRA 5CBPA 1V1RB 3S8EA 1L4YA 2CSUA 5AXBA 4ON9A 2XMZA 2P0EA 2IEBA 3B8EA 4P93A 4B43A 1WXWA 5LXTF 2HCJB 4A10A 3AEZA 3GI1A 4HATA 3GLGB 5ALWA 2PSJA 4LRYA 1KYVA 3ZHYA 4DLSA 3IRVA 4A36A 2FI1A 4LYGA 4S1VA 3ZI7A 1RMYA 1WSWA 3VPCA 1L5GB 3HVKA 1K97A 3LOUA 1O6ZA 4AKSA 4MP3A 2C61A 5JWHA 1IQRA 3H84A 2ERCA 3W04A 2G6BA 3S1SA 2QJTA 3HKDB 5EJ9A 1N1DA 2ZDQA 4ZCQA 5ALOA 2VAXA 2NWQA 1E0KA 2D1SA 1OXTA 2UVPB 4ZU6X 2P4QA 2PU7A 3QI2A 1G7TA 2WF8A 4TYYA 2WJWA 1AGYA 3UK7A 4JUIA 3ZHCA 4JJ7A 4UNRA 2XYRA 5CD9A 1F6BA 4LF7B 3LGXA 3O2SB 4B87A 3IQHX 4EI9A 1EZZA 1DG3A 3DNPA 4Y2RA 1NRIA 1HYBA 1R5OA 3STXA 5K09A 3LP5A 3R5SA 3FKSA 3LBAA 1WULS 4OATA 3FF1A 4RY2A 1TGVA 3QKIA 4HRXA 5DE3A 2OB2A 1KVSA 2ZYRA 4I1YA 1MO5A 1IPFA 1YAJA 2R751 2HJGA 3EQ6A 1V3VA 1U3CA 2WT4A 4MVCA 4AN0A 1U8TA 4P4NA 5E7IA 3RIXA 3BSYA 3SX0A 4O1IA 2F3TA 2P1DA 3FDZA 4XZ3A 4EFDA 3DWGA 4U7DA 4WN3A 3TTSA 3GJSA 4QUEA 5T57A 1KS2A 2DWQA 1JAIA 3AFOA 3FNHA 3SR3A 3X1KA 1GPMA 1SOMA 1G63A 2NAFA 1HLFA 3FCOA 3THSA 3A28A 2ZSHA 4GLFA 1P4GA 1K4KA 1EGHA 3AM4A 4JA2A 4L27A 4BNWA 3UJCA 1JXQA 2VPZA 3EPPA 1UOQA 3DEFA 2PZLA 3QKUA 5TQ0B 2REXB 5CT8A 1IIRA 2NQTA 3AG5A 1TCAA 1UKYA 1KH3A 5AVJA 1PJZA 5EXSA 2A9PA 2AFHA 3BMNA 3QNWA 4CM8B 4RZUA 3PQCA 2P9ZA 2E0IA 4TTAA 2XNJA 3EZ6A 4NBUA 1EFRD 2G63A 4GMHA 4YP0A 5CB0A 4MVJI 3BGVA 4PQGA 5GVRA 3SSMA 2QLBA 4UD2A 2AG8A 5KYWB 3LX8A 4DREA 1ENYA 1G5TA 2FW8A 2YJZA 3HJRA 1TOAA 2QTRA 1G5FA 3FH0A 4OM8A 3UXEA 4C88A 2BRUA 3OFKA 8AT1A 3OQ6A 5GGYA 3RABA 5JWOA 5JJKA 4OOFA 1ODTC 4QM6A 3K09A 3WWDA 2JFPA 3Q15C 3O4GA 4JBYA 4CF7A 4H1WA 3V1UA 5HM6A 3TO5A 1K2WA 4L9SA 2Z1DA 2V7EA 4O2BB 4Q7JB 1DCKA 1VLHA 2VQSA 4OXNA 3PJDA 1AXEA 5AYVA 2E89A 5LBTA 2CVFA 1WUTA 4Q6WA 4QBKA 2PV0A 2VHQA 1L5HA 1DIRA 1U7OA 2C9ZA 1XQ9A 3O8NA 3T3IA 3T9DA 2IHNA 3PEVA 1YUMA 3OJFA 4MTLA 4NJOA 5JJBA 4LK3A 2RK6A 1Y3HA 2QMOA 3IIMA 3K2BA 1Q14A 3UTDA 3A6HA 3G85A 3FRIA 2OP0A 3U3DA 3W4JA 4A5SA 3UEOA 4EB8A 4O4IF 5D7BA 2VZ8A 3VR6H 5TIIA 1HQYE 4MZDA 3GUVA 4QLBA 4F92B 3IP1A 3KKEA 3V3TA 2IS4A 1SJ9A 2CMHA 3M2TA 3K31A 2ZRIA 3CO0S 1BWRA 3TUIC 2O2CA 1QLJA 2WMOB 1ECLA 5CLQA 5IMBA 1R8YA 1M2VA 2YWEA 1Q3KA 3CW2A 9LDBA 3NDIA 2CXPA 1L4BA 1OC4A 2MIIA 3IYLW 3H9GA 3P9QA 2HU5A 3E9ZA 4XJXA 4OEHA 1M0EA 1C30A 1AJEA 2QAGA 5TQJA 2NZUG 4GMGA 1MRSA 3THYB 2O20A 2ZUCA 3LUAA 2XZDA 1Y37A 3CZRA 4TPKA 4YDHB 5CYGA 2NSYA 4RVCA 5DBGA 3U3KA 1NAIA 4GX5A 1RD4A 4OJKA 5BW5A 3GUUA 3GRVA 4FBMA 3UAOA 1PYGA 4LWZA 4LX8A 1G5RA 5LQMA 5HSGA 3NIBA 1V8ZA 4BO6A 1J1ZA 1FK8A 3RVOA 4UVHA 1V41E 2JAUA 1N8KA 2RC6A 4BNIA 1P75A 4FT4A 1ZOIA 1F60A 1X9IA 2HRZA 3NKLA 3O73A 4LGVA 5AK0A 3WP0A 4RTQA 1GCOA 4WFIA 2OV3A 1B1AA 1FFAA 1UC9A 5AKGA 2VYNA 2ZYHA 1P3Y1 1Y9AA 3BWYA 4N1AA 2R85A 3TQQA 3WLIA 1BWQA 2WWGA 1ZUD1 4EELA 1C3EA 1M0TA 3L0YA 5DI3A 4H7KA 2A1UA 4K05A 1MAAA 1ZEJA 3BWVA 2OO5C 1P2UA 4L28A 2C5FA 2WAMA 1H9CA 3VYTB 4GPBA 2RARA 4DDMA 3QE9Y 4GICA 5H5JA 3BXFA 3L6EA 2OK8A 1KZ7B 1Q1QA 2FV8A 3P0RA 4I19A 4MW7A 3PUVA 4G8JA 1IQ0A 3R9KA 4LDPA 1FDOA 2XTAA 3BKXA 2FFRA 4V0NA 1VCIA 2DLNA 1H65A 1NHWA 2RHCA 3MYYA 4ZIRB 2CK3A 3FPGA 1E6WA 1SCUB 3BB4A 1SOWA 2AFHB 4KJXA 3RVDA 3WR5A 4AZTA 4CM8A 3KSBC 1YCHA 1T35A 5FPPA 1TTPB 5F5XA 4XFDA 1E4YA 1I0IA 3EYWA 3T15A 2ORIA 4O4IB 4RJKA 4A2QA 2JJ8A 4LYHA 1NVKA 4IEIA 1DRJA 1UBLS 3GP5A 3PNSA 3QOFA 2B6HA 1XJ5A 3V7YA 4MR8A 3CINA 1M75A 5DCWA 4C01A 3EEOA 3BWMA 4AJPA 5KEIA 4DLLA 1PD0A 4GVXA 1B0AA 2D7JA 4Q4AB 5IX8A 4CGZA 4BO7A 4EITA 3EZ2A 1FMJA 4HDSA 3KLOA 2GXSA 2WNIA 3YASA 2RGUA 4Y2GA 1LLCA 1GUYA 2V6GA 3QP9A 1F9EA 1XI2A 3P9KA 4W5JA 2A8YA 2C5LA 2NSLA 2J0EA 3OQNA 2HGSA 1DXYA 4P83A 1AMUA 4BQFA 4JZYA 5HR5A 3D7NA 5BXQC 1BJTA 1NNEA 4FE7A 3FIUA 4DQ0A 2VSXA 1AO3A 1OAOA 2G07A 3UWDA 4EHIA 4YO7A 3NVKI 4HZGA 2QLMA 3EG9B 4MVJG 4XKJA 3ZIDA 1Y8ZA 1E89A 1YZGA 4HH3C 2P4UA 1DJLA 3OTIA 3QKSA 3KB8A 1I9CA 2H29A 3MGCA 4MVJE 1L5VA 2I4TA 1GUDA 2I2DA 3JVVA 1YDFA 3QVTA 5AVVA 4EGSA 2I7TA 5EWJB 1CUZA 1FQWA 3KCQA 5FPSA 3JARA 1HLGA 1R18A 4QLAA 1P1RA 1ZRNA 4WAUA 1EGMB 1L5ZA 1QKKA 4MV8A 3DPSA 3PUYA 3PVSA 4R0VA 4WDQA 2LVBA 3A10A 3JAKA 3VR3A 2J3KA 2PZ8A 4Z0NA 4F8EA 4X1OA 1HSZA 3W05A 3W8NA 2GTHA 4BDSA 5BYKA 4Z4IA 4YT5A 3HJGA 3ICPA 3AETA 1SIOA 2RHOA 3TPZA 1PVOA 3PIRA 4ND4A 4HDKA 1IE3A 2FKAA 4JX8A 3BK1A 3CPSA 2GM5A 4KZKA 1JFSA 4RAQA 2HX1A 1DKOA 1LD3A 1X1EA 4JMLA 1GILA 4KMRA 5GQSA 3T9EA 3K8OE 3MGAA 1O5IA 1J2UA 1DAMA 4XE5A 4JSTA 4R8LA 3I9MA 2I6GA 1GL9B 4LJAA 3BHIA 5IG2A 3ZN2A 4OI4A 4O4JA 1A88A 1V1RA 2GERA 3AEXA 2ZBEA 3CT6A 4MYSA 4C7OA 5F1YA 1RADA 2Y68A 3ND9A 2GN4A 2GWRA 1OFUX 4RVOA 4ZQIA 3GFSA 2AN5A 3OICA 3ZJ4A 4M98A 2XEXA 3DOCA 3UH1A 4YAUA 1GEGA 2P3OA 2XTNA 3QKTA 4K03A 5E9QA 4BN4A 2ZRCA 4PZAA 3VR4A 5EYPA 4E5YA 1QIGA 4FGJA 5DLYA 3HCEA 1F8UA 2BMVA 2HU8A 3H1GA 3MPUA 4HN9A 1L1EA 1QTNA 2XSZD 1KE1A 3BXXA 1D6JA 4CQMB 3S0JA 3VZQA 3DZFA 2ECPA 4YIHA 2VUTA 1W36C 3EIEA 3DNFA 1F06A 1VPEA 2WD9A 3LIIA 3EDMA 1NUSA 5K0TA 2V0NA 3JRNA 4IJUA 1E5TA 1T9GS 3B53X 1GR0A 4NR0A 1R8XA 1RHKA 4FFOA 4QU5A 4Z2AA 3HO1A 2B30A 5LQUA 1LI5A 1UMBA 3RIEA 2RGGA 2JDIA 3GFOA 2AR0A 1NXOA 4Q0MA 2TSYB 5G41A 2LV8A 3TNDA 4MVJF 1VM6A 1KYQA 3LSTA 3NEAA 1NRJB 1CRZA 1E2GA 4XAQA 1BGXT 1KP2A 1YVRA 4IIEA 2FEMA 3QPDA 3ZJYA 2ONKA 4CL3A 5KC9A 4D8VA 1BEEA 3QV1A 2ZI7A 1MB9A 5CNKA 2NAPA 1QJ4A 1RQXA 3M5DA 5BYJA 4HZIA 2JZCA 5F73A 4LZZA 3M4NA 1CZLA 1Y7HA 3U3RA 1E2FA 2BFAA 3A7DA 4WFJA 3DLIA 1VCOA 1ZBQA 2A0KA 1SC1A 1NLFA 1A5AB 2R1VB 2AXQA 4R7GA 3ZWQA 2TMYA 1NNSA 2OHXA 3OPQA 5H59A 1OBHA 3MA0A 3LUBA 2PO5A 2F7SA 2ZPAA 3GN2A 1GN9A 3S5UA 3KO8A 2CBZA 1JDNA 1W4ZA 2IYRA 1WCIA 3G6WA 3PU6A 2O0LA 4XX0B 3EF3A 3I92A 4C22A 1TQHA 3AP1A 2HADA 1KZ4A 3V55A 4EB6B 4ER6A 4W7SA 1RVDA 2P8JA 3WI7A 5BV7A 5AXDA 4DR4B 2ZETA 2P65A 3W6OA 3NM6B 5ELXA 4CM3A 1DLJA 4GMXA 5JANA 1KEZA 2EWVA 3F3YA 3UMMA 2GA9A 4P4UA 1I7LA 3VH3A 1EM8B 4FEAA 2MMGA 2Q4OA 3UJ6A 5KNBA 1QH1A 1SIBE 1CF4A 4OBXA 1BW9B 4UFOA 3L7MA 4M46A 5GWXA 4Y6QA 4EY8A 1Z7EA 3MFQA 4BP1A 2NSDA 3LZDA 2H5EA 2WHQA 3VNQA 4B4UA 721PA 4PPQA 1KEVA 2DFKB 1E9EA 3GVPA 3QOYA 1IATA 1ZL0A 2EQAA 4QWMA 5H7XA 3RIGA 1EXDA 1YZHA 2HRRA 1X77A 4KYVA 4Y6PA 2PZBA 1FYFA 4RFSA 3O9MA 1PJQA 1YS7A 2YWDA 3NBYC 5A0FA 1H6CA 1NVAA 1ZNQO 1FY2A 5IAOA 2ZPUA 3AH8A 3ITKA 1U3FA 1WPXA 3W79A 1P3JA 4LGCA 3TTYA 2UYOA 3JZMA 3OMWA 4N12A 1LJ8A 1ZVMA 2PJUA 1IEXA 1O96B 5KWIA 1Z56C 3MXOA 1IN4A 1KJNA 3PNKA 3LZCA 3CUUA 3I45A 1ISIA 1E32A 4KQIA 3ZWVA 3TTXA 3U7JA 3GVHA 3WJ2A 2ALJA 5LA6B 1I9GA 1RQ7A 4B9AA 3E03A 1HUQA 2VJDA 1EA5A 4Q16A 3BIWA 4RQUA 4C89A 4CM4A 1J99A 4D9KA 2BZ1A 1JPUA 3BBLA 4W4TA 3PL1A 1JQDA 1EM6A 3SKXA 3VUEA 1K5DA 5GMOA 3BSFA 3IX7A 1XVAA 2H0QA 1W88A 1J97A 1LTQA 1QAOA 1B3RA 2V9PA 1WQ4A 4NFSA 4EG1A 4F4JA 2O8BB 4MKFA 2PH7A 1JEEA 3DV0A 2C4TA 1CZRA 1JQEA 2ZBRA 3H3JA 5F9FA 1GPDG 4NXMB 1RWBA 5KWSA 1CNEA 1OILA 4ETMA 1WQ3A 1VA4A 1YR8A 5EN4A 1T2EA 4F5DA 3K9FC 2ATEA 3UUGA 5IC4A 2FUG1 2H4JA 4RA6A 1QQ6A 5K03A 4IJVA 1JHQA 1ZJ6A 5J5VA 4NZMA 3TTTA 4Q66C 2I1VB 3PXBA 2D06A 1XBTA 3OJLA 3P71T 2GH1A 3NIWA 1CJTC 1V2GA 3TQIA 4A26A 3UM9A 1ZSNA 4HGNA 2GZDA 4W7IA 4CTMA 5J4KA 5JZBA 1R4MA 3PHGA 1Q0SA 3W9SA 3U60B 1C0IA 3AESA 4MV5A 4TMTA 1HE1C 3R9XA 3M0EA 5JO0A 1E4EA 3NALA 2PUCA 3BICA 1XZFA 3GV0A 4WLOA 5C34B 1TYZA 4BP9A 3JZDA 3G1UA 3N7AA 5CX1B 1DAIA 3OG9A 3AUUA 4F3RA 3LKVA 5FIUA 3DDHA 3QKWA 4G89A 2OV1A 4Y9SA 1KMNA 1RLUA 2FOIA 4RK5A 3LIPA 1EHIA 1K2VN 1Q7BA 1G291 3F6SA 3OLWA 2RBKA 2JS7A 3QF4A 4L5CA 5KB3A 4MGEA 4BV2A 1XIVA 2MSNA 2MDTA 3CSSA 2QN1A 3SIPA 2XUKA 3A6EA 4JJ4A 3SLRA 1TLTA 3SKVA 1AGXA 4BNDB 4DJ5X 3Q7PA 3L4KA 2O8FB 1SC9A 4YJKA 3OOYA 2BBOA 5EHZA 2ZYVX 3GDWA 3Q8XB 1X6VA 3FTNA 3MD0A 2R86A 5BUQA 3CLUD 5DB4A 4HQOA 3B2NA 2RBEA 3A27A 3KDSE 1TM5E 2MSCB 3QUAA 3MWLA 4P9NA 1AUQA 1OBCA 2PUWA 4Q9HA 2ZUWA 3CB4A 4KQMA 1MX9A 1ZM7A 1CERA 1ODKA 1W4AA 3DLPX 3QX7A 3RWBA 4A6XA 6YASA 4EF6A 1DWOA 3K9LA 3DT6A 2P2NA 4KBFA 5M04A 3RC3A 5JG7A 1E1NA 1CFJA 2J9ZB 4RZHA 4E1BA 1M7BA 2J6HA 4W1QA 4CLOA 3SY8A 3LRTA 2CD9A 2HT6A 4K9QA 4P32A 2W58A 1V9LA 2IW1A 4K6FA 1IU9A 3G0OA 4FFBA 2CNKA 5TXGA 3WGVA 5IWCA 3JARB 4B4KA 1YI8A 3RYHB 1RVV1 4F2HA 2WT8A 4KFTA 2JCSA 1RWQA 2YCBA 3A9SA 4JELA 1G3IA 3EBPA 3I4FA 4QXAA 5CVDA 4G0YA 4YASA 4YI5A 4DMHA 4YY3B 3L8CA 5LL6P 1U0HC 3I4LA 2WD7B 5H8WA 3EGCA 4DA6A 3HV2A 4IAOA 5JTUA 4Q34A 3RUAA 4PQEA 3TSAA 4UUPA 1A5SB 4AC9A 2G28A 1WHTB 5DNAA 1DTWA 4TLBA 4J16A 1JL3A 5DGXA 2H2DA 3AGPA 4IOLA 4M21A 3OT1B 2NO0A 3FLBA 3I2KA 3KSUA 1GGMA 1E1RA 3TNJA 5K3BA 4RTOA 1VIYA 1PBTA 1O2DA 1R4ZA 2F1IA 1FFCA 4ND6A 3W2FA 5I5EA 3L6CA 5I6DA 2CFRA 4BKQA 3NZEA 1SQ6A 1GTSA 5JVDA 4KUEA 1N3LA 4ZJZA 4JXXA 4HDSB 1ZEMA 1JIIA 3OEEA 3HCFA 5HFJA 1KZHA 1FS6A 4JU9A 5JBQA 2NU6B 2FGKA 1H2WA 4N6NA 4BVHA 5JXHA 4D4MA 1PUXA 2IGBA 1WVGA 4P58A 2V97A 2EERA 2EFEB 1Y4SA 5CFPA 2QBYA 2BBSA 1VSVA 4PO8A 3RVMA 3AEQA 3LCJA 4QBHA 4UVEA 5HQ3A 1G8JA 1I36A 3AQIA 3EDYA 4ME6A 5IH3A 1OFIA 2W6PA 3BX1A 4CUKA 1VJRA 3T5BA 4BE9A 2ZAIA 5EIEA 4LPKA 2OGTA 3K8YA 1QOZA 4J07A 3S8MA 2DEUA 4LDRA 4ATNA 1ZZGA 3DFZA 3FSRA 4JLNA 3WLNA 3IHTA 4RCYA 1AV7A 4PSKA 3DXFA 2BT4A 3UJPA 5K0SA 5A5FA 1XNHA 3AUTA 3BWBA 1WSAA 3SYRA 1ZJ5A 1RQNA 3AUSA 4PGMA 1OREA 2EKQA 3AR6A 1LVUA 3DKKA 5KWJA 4LXTA 3SIWA 3TZKA 1T13A 3AZPA 4YUWA 5CW1A 1CJVC 3JRXA 4IDQA 3SX2A 4AKGA 1SCQA 2BFPA 3O3MB 1DKUA 2AUTA 3QGMA 3ZV5A 1SBNE 1R0XA 1XCBA 2CJPA 3E53A 3PUZA 4HY3A 5G2OA 4WGGA 5A6SB 5BPHA 4OH7A 1Z75A 3JQ6A 4P8RA 4HXYA 4TS3A 3VOAA 3B6KA 3KIPA 4G8CA 4YLYA 2FHSA 2AL7A 4RX1A 3LPDA 3T6KA 2VCHA 3COJA 1AOXA 3OPYA 3W9BA 3I3SR 4A0GA 5FUMA 2IXFA 3PXAA 4NX2A 4X8LA 2C5GA 3UZUA 1GD1O 1ANKA 3N7TA 4MRPA 1DX9A 1J42A 3LS2A 3QQPA 4D3YA 5LD2C 1VKNA 3PT9A 4IIFA 4CEHB 1QZXA 1BFKA 5AVWA 1PQ4A 5TY0A 2JKYA 4U5XA 1DT3A 2XQKA 3MYRA 3U7HB 3RHFA 1VJ0A 2PRZA 2V59A 4MUMA 2AZDA 3L0BA 4HXEB 1PJ8A 3QEKA 3D3JA 4PWYA 1WCV1 3PG5A 13PKA 3KXPA 3OKPA 4J6FA 4GX1A 2P9BA 2VK2A 2GAAA 3SZ3A 5KX5A 2DYKA 4LE0A 1WD5A 1UKEA 5BVGA 1Q3TA 3OIDA 4RS3A 1JLMA 4Z9AA 4WBNA 3K0CA 3H13A 3LCCA 4HXFB 5K3CA 2BFWA 4MLPA 3K6SB 1UDCA 2PJZA 3C6BA 3ET4A 2JARA 3LL4A 2DBYA 3AQ4A 5FXMA 5EWMA 3QKSB 2Y2VA 4HB2A 1Q1EA 4MDFA 5AVXA 1Q44A 1R4NA 4GL4A 1Q21A 2VP5A 3OE5A 1JH8A 3NM5A 5EHGA 1AGRA 1UBOS 2D5IA 3V1YA 4IOMA 2XOXA 1VIMA 2W8BB 1XVUA 4GSYA 3SP1A 3DMDA 3SFZA 4DLNA 3N5CA 3BMXA 5K99A 4NL4H 3A26A 4F6CA 3VYRB 2I6XA 4OI0A 4AO7A 1M2KA 1AMOA 5TGDA 1VCNA 4R7TA 3OEYA 4FIDA 5AM0A 4LHYA 2YBDA 3BN3A 3N6RA 2VDQB 2B99A 5GV8A 5DHSA 1JVBA 3GCGA 3KAJA 3O8QA 1PQUA 5KDOA 1TT7A 4O33A 4IUCS 3HGQA 4KKXB 1Y1RA 1E5QA 3DAHA 4NAVA 3ZHRA 2EW8A 2N9UA 4MIOA 1RM5A 2NO7A 3C3CA 4NBTA 4TXNA 3TR6A 1H42A 2ZIVB 5DVZA 4MJ3A 3EY9A 1SC4A 5KYYA 5AUOB 1EK6A 1ZOPA 3MT7A 2J9XB 2HA6A 5KYXA 1PEYA 3FZGA 3U5TA 2XV1A 3IOEA 4WECA 3J7TA 3MWEB 1L7RA 1E3WB 4N9QA 4Q5IA 1ZIOA 4LZOA 3V48A 4UULA 2V4MA 4KE8A 4QSHA 2CMFA 3U3MA 3VO8A 4YRNA 1MRZA 4MGIR 2QZJA 2RI0A 3KNZA 5K0FA 1MHTA 4BNLA 4Y1RA 1G9XA 1LJLA 4R0NA 3SVZA 2F1RA 5ITVA 3I61A 1VBNA 4NNOA 3QXHA 5D3KA 4RZ3A 1G66A 5K8LA 1SWWA 2G0NA 3OESA 4UTZA 5C35A 1F4LA 3KV1A 5L8VA 1E7YA 1YI0A 4N6GA 3UQYS 2A88A 4XR9A 1IY8A 4JKYA 4QM7A 1QYVA 3WE7A 2YN4A 4QXOA 3KFXA 1LCIA 1PFYA 2PIAA 3A6KA 2JFQA 4ZYTA 4RD6A 3GK3A 5HKOA 5F3WB 1JF8A 1DC3A 3KHTA 3IAS1 3M2PA 5FULA 2VHTA 5HJ5A 2DR0A 2VT6A 2XUQA 3T0IA 4DQLA 4EDHA 1WXQA 4M9XA 4E21A 1EZ4A 5EEGA 4L75A 4NH4A 4DIDA 1EJ2A 4KG7A 1R0YA 1YOBA 4JB3A 1NBEA 4TSFA 5C53B 3CNQS 4CCSA 1X7HA 1S4MA 1I80A 2OHJA 2RH9B 4PGHA 4CFSA 5I9SA 3H9BA 4ZOAA 1U0NA 2G4CA 2WVJA 3AZOA 4U2KA 1DC5A 4DMRA 2XNHA 2H3EA 3B6IA 5ARCA 2WSLA 4LZAA 5K8JB 2Y9PB 4ZQEA 3UAWA 2ZZMA 2O8EA 1DS6A 3OEWA 2Y1LA 4BNVA 5BWLA 3T7DA 3DNMA 1RPAA 1CUYA 5CYPA 2GEVA 2V7GA 4GPIB 4ZRNA 4AWXA 1IL0A 1Z68A 5BSGA 1ZOLA 4DUGA 1Q7GA 4B7XA 1W96A 1C2TA 2HA0A 3IMKA 4J0DA 3C3MA 4V03A 2PM8A 2EFYA 4C4YA 3U4DA 5AVTA 3PDUA 4QOEA 3OF5A 1TTTA 1EQUA 2XCSB 1XTVA 4XB2A 1M5TA 3GCDA 5I8WA 3I5XA 1UXKA 2WYHA 5AI6A 4YAGA 3HNOA 3VU0A 4EY7A 5ADVA 5L3QA 4F0JA 1EFCA 1B2LA 4R6XA 1AC5A 2CDRA 4IMPA 3MJSA 4W5TA 4L9AA 2C3OA 4FGSA 4J1NA 3SMQA 1D9XA 3K1TA 5AVYA 2EWMA 4GF5A 2DOKA 5C4GB 3SHFA 2PAFA 3A32A 3WNVA 1DUVG 3NHRA 1DIGA 4RD3A 4EG6A 3HDVA 1CEEA 3GAMA 3V4OA 2GYWA 1QR2A 4ZAWA 2YMMA 4CHTA 2LCFA 3SC2B 2LZ0A 1XLUA 2BFMA 3EQ9A 3I9LA 1DAGA 2WIDA 5HE8A 4BTEA 1YIOA 4GVPA 5REQB 4E5KA 2JFXA 1YF3A 4MAAA 2W11A 4LS3A 4ARUA 4C87A 1KDVA 5LP1A 5IXSA 4OUDB 3ZGYA 4B09A 3ZJUA 4MVWA 3RBXA 2JL1A 4G24A 4YAIA 4GC9A 1REQB 1V5GA 1F5NA 3FGOA 4GLOA 2YQ4A 4LSGA 4DJAA 5L53A 1GJRA 4CQMD 3A1EA 3VFDA 3JX9A 4IIVA 3VOSA 1W4RA 3EQ7A 4LXQA 5D5PA 5TJ9A 1STOA 1RE1A 3CLUC 2XF2A 4JLKA 4OYHA 5KPDA 4UBLA 1ZH8A 3P52A 4YRDA 3VAAA 4JKOA 1XMQB 1JDVA 2OE2A 5LOVF 4RHYA 1A9XB 5DP1A 1RXEA 2Q2NA 1P4JA 3T7IA 3KL2A 3GAZA 4ZZ3A 5JRZA 1U0EA 4DC1A 3JQ8A 2ESRA 1I4LD 1KVRA 1E7WA 1MAHA 3OTQA 5AHKA 4EJSA 3L05A 3UKJA 5GONA 2ZYTX 1R74A 4EPXA 4BOYA 1QX3A 2J1LA 1GU1A 4K46A 4ACBA 3MGKA 4CGYA 2HSDA 3LUPA 3LHKA 4WBXC 1R0CA 4QPCA 1NA5A 1D4AA 3Q0EA 1HDZA 2ZEJA 4KVGA 3TXXA 1AXGA 5C1OA 3WNDA 4HAWA 4ND1A 3JQRA 1P39A 2YOGA 4PAGA 1TJ5A 3OCCA 4YRTA 5I7AA 2PR2A 4Y67A 4L22A 1Y9EA 3LD9A 5A02A 3U80A 3EC1A 4LJRA 2WINI 5K0LA 2C0QA 2IPLA 4QWWA 3D8UA 4RKEA 5GZ6A 5TS3A 1UDAA 5F7XA 3H6KA 4B75A 5F1KA 1Z39A 5GJCA 1JS1X 2GNAA 2YXBA 1RZRD 4D81A 1LU9A 4MWTA 5CUQA 4UAJA 2WUGA 3C1OA 2HK9A 2IYOA 4ZOBA 4D2IA 5FF9A 3FG9A 3C3AA 5IK2A 4ESEA 3H5LA 3H42B 4D98A 1DBIA 1HQCA 2Q9UA 3DMGA 4PSDA 3G8AA 1ZK2A 2YXEA 1X7WA 3O5AA 2EW2A 2Z8YM 4I1UA 2D5BA 1B76A 1NUHA 3B5EA 2C4WA 2GUGA 4LYDA 3KJEA 5K1ZA 3K92A 1EUCA 1N8SA 1Q0RA 1DAFA 1PVVA 2SNIE 2ZBQA 1F3LA 2VUUA 3WKDA 1RWKA 3D02A 3OY7A 3HFSA 1PLLA 1KY5A 4IMIB 4K9NA 4EYKA 4E14A 5IASA 3CSDA 3OIGA 4Q39A 2WKQA 2O19A 2W6OA 4DMCA 5KTRA 1L7BA 3TRKA 3M6UA 5YASA 2ETXA 4U2EA 1XRQA 2O1XA 4ZQGA 3NDBB 1AHNA 1F2UB 1JFRA 1CRPA 1PZNA 4MV7A 1BRTA 3FM9A 1ZC3A 3VDXA 4P98A 4X6YA 3ET5A 3THXB 3VPGA 4LVOA 3DGEC 4ASUA 5LMUB 3L9WA 3D59A 5FV7A 4FS3A 1T3SA 2TECE 1O6FA 3A2MA 4U6NA 4UEKA 1Y7LA 4Y3UA 4DWOA 4JJFA 4IGKA 1M1YB 1SFRA 5BQ3A 2C83A 4K7JA 1P2TA 1YRBA 3A1UA 4XPIB 4DBLC 3ZYZA 3O8BA 1GGJA 3GLTA 4ARSA 2B7CA 1JA0A 3KYCA 4IJ6A 2J5BA 2W2QA 2X8WA 5HZGA 3N59A 4AWAA 5CH8A 4YCNA 3T1OA 3G6KA 4KGXA 4D41A 2W6MA 4FHDA 3H5NA 2CDNA 2M9MA 3GR6A 3OJEA 4JQOA 4LHXA 2BHRA 4PYMA 5JS7A 5KUTA 2DBQA 3HR8A 4B6QA 5ALFA 4CL8A 4Z1OA 2DFDA 1M6VB 3PHHA 4EHFA 2J30A 3RPEA 4LNAA 4S1NA 5F9HA 3OU7A 3UCFA 3KOWA 2A9QA 2BCEA 2P11A 1DIBA 1F1BA 3W5UA 4J1TC 4U8HA 5FEMA 4ZEWA 1M72A 1BKSB 2PYZA 5ESWA 2EBUA 3KPWA 4ZMSA 3VH1A 3L0CA 3KSZO 3UT0A 2FY8A 3ON5A 4L4XA 4Z86A 3SAJA 5EY5B 4HDRB 4AVYA 121PA 2ZJZA 1Q11A 1PX0A 1SKAA 1ZM2A 5JSYA 3F5QA 5JCZA 4YRFA 4JYAB 3RTAA 1I2CA 3AB7A 4QBFA 5LP6B 4HUJA 5AKKA 1D2HA 3DV2A 4TTTS 4F3NA 5FAKA 2ZQ5A 5IF9A 3A04A 4LQDA 3AKZA 1M6HA 4R40A 4YFYA 3B7PA 4OHVA 4QYIA 3GZJA 1E5LA 2XLCA 2FLVA 5CYFA 2FH5B 1QPZA 4LY6A 3H04A 2FSVA 3TVTA 2BF4A 3BAZA 2V7UA 2ZTLA 2BFFA 3FA2A 3FWPA 4LF4B 2WJAA 3ESDA 5BRAA 1OKKA 3DTVA 4ECAA 1VGRA 1JUDA 1BCSA 3UFXB 1R0KA 2PGXA 2V7QD 4PFJA 4F56A 4FINA 1N32B 2YVKA 2H1FA 4RVDA 4B3DA 3MHTA 4X71A 3KJXA 3UW1A 1YAHA 4X1YA 1ZCAA 4W5OA 1H2AS 1MVNA 4M83A 3FPLA 3LWBA 4G5RA 4PPFA 4ZQCB 1XMSA 3Q7IA 4R54A 4Z9BA 3CMCO 5B1YA 1CUFA 1VKRA 4LHEA 2K6GA 1BO6A 4XGKA 1F5SA 3K7EA 5DNYB 5J2UA 5DSZA 1T6XA 3G2NA 2J0QA 4X91A 2BGGA 1SXJE 2UXCB 3ZWDA 1QAQA 4DLPA 4V0KA 1GRVA 4GPZA 4O1HA 4KU4A 4YBRA 5BVHB 4NMWA 2QR2A 4D96A 3QEAZ 3BUSA 4PC7A 3IA2A 3DZCA 3T95A 1ZJWA 1Z5NA 3RK4A 4WMLA 1TZ2A 1Q16A 1W5AA 4J9UE 5TVKA 1J8FA 4OFZA 4M0EA 4NY1A 5FTNA 3LECA 5C8YA 3EUAA 4DBVO 1S3GA 1R10A 4G36A 1QOQB 1CUDA 1TFUA 2OV8A 3MIZA 3MUOA 3R3JA 1WKBA 4NZNA 2QTVB 1NX6A 2BJHA 5EJMA 4NAUA 1DPFA 1K4YA 1XWWA 4WT7A 4GP9A 1CUHA 2D5AA 5B3AA 3MEQA 3ZDCA 4IDFA 4UHHA 4G0VA 1ADYA 1J2YA 1BEUB 3VOTA 4CV1A 3ZHUA 2ZT6A 3GLRA 4XUCA 3V4SA 3AR4A 3U9TA 4W5RA 3USCS 2QX8A 1SUBA 3L3BA 3NDJA 7ADHA 1Q92A 2GPJA 4ZI7F 5ARBA 1Z6YA 4B9EA 1RRCA 3FFAA 2OVBA 1HORA 4D1YA 4HYEA 3PEEA 1OBFO 2A9JA 2AC2A 3E5NA 2AVNA 4BZZA 2HTEA 1UBFA 2XSZA 2ZSDA 4JB8A 4MO2A 2Q5FA 1UMCA 1T5HX 5IVKA 2I1LA 3TQOA 4RV4A 1HDYA 3AX6A 2I6QA 4GECA 1DJMA 1IVYA 3PFWO 3ROZA 2G77B 3VSCA 2R97A 3UW3A 4CKWA 1ZN9A 5JXJA 1E1KA 4FNGA 5I4KA 2PPVA 4Q12A 4X61A 5CAEA 3C6YA 1J1IA 1E94E 1IUOA 4TTPA 4UBNA 1CQJB 4O3MA 1FFXB 1Y9ZA 4RHFA 1XNQB 3AVUA 1TEXA 3I9KA 1PCXA 4R5HA 1PL7A 1YGYA 3JQ7B 3KYJB 3QXJA 1M2WA 4B3MB 1GNTA 1EK5A 4KN5A 5ETJA 1CUEA 5K6AA 2OXEA 4LQLA 2XCRB 1U7HA 2ZANA 1ZA1A 1U1EA 1SD5A 2FFAA 2GCOB 2E55A 2ZJ3A 1GTZA 1W73A 3KVVA 4XRRA 4BL5A 4OXYA 5B7GA 4WZBB 5KTPA 1MFPA 1PN3A 3BQ9A 3W3AD 3ZQUA 4C7KA 5FPKA 3UUWA 4DC0A 3HN7A 3VYWA 1FX0B 2I4MA 1JA9A 2EFCB 3GA0A 3NP9A 3MCWA 1SXJA 2P5TB 4NOKA 3DR3A 3ZE8A 2CXNA 1WY7A 1MUUA 4JC5A 1NP7A 2RGBA 3IRUA 3PJFA 2ZTSA 3ZVLA 3IP3A 1JECA 4G5GA 3VKGA 1YU6A 1F0YA 1S1MA 3CC8A 4URZR 5AM1A 5CCDA 3U4GA 5AVSA 1B74A 2WTAA 5KYUA 3NKVA 4D45A 4HFRA 3QJYA 3C2QA 2ZREA 2VKQA 3OTGA 1GR1A 1Z06A 3RLFA 5DTIA 5FBWB 2OLKA 3H1TA 1ODLA 4MHSA 1VI5A 1NBMD 4MV3A 4X1IB 5A9SB 3R3VA 3A7EA 3IEUA 3AJEA 3N07A 4JJ6A 4WKPA 3FSEA 9ABPA 5L45A 2GYUA 3TZEA 3VNUA 3K32A 2BTOA 2A6PA 5KYXB 5HK9A 3QK7A 1T9ZA 3PHLA 2IVZA 5KYYB 2ZATA 1TO2E 2WILA 4PGFA 4F6LA 3NHFA 2OLEA 1MT3A 1FLNA 3L4EA 2D0OB 5HF8A 5CLIA 3T3MB 4F11A 1DZIA 1EB9A 3WWCA 2C8VA 1GPYA 2VBGA 1UXJA 3RBAA 2QUHA 5TT0A 1I3NA 2X3UA 4WOPA 621PA 5IVHA 1KZ1A 1M9NA 1SB8A 3LCRA 2FF7A 4RY8A 3WDSA 3WLKX 1NQTA 3NI2A 1MJFA 1D6MA 3GMTA 2WJVA 3DOUA 2OECA 4IOJA 2FR0A 1BQEA 1L7PA 4X84A 5FOSA 2QT0A 1QH0A 3DLBA 1HYEA 3E7PA 1HH4A 3GDFA 5A4JA 3D1LA 2EKPA 4YRGA 3LC1O 1KS9A 1O4WA 4ERXA 5IJ0B 5MN5A 1PTKA 3ADCA 1ESMA 3T7AA 1SUEA 4QATA 1VHWA 2QQEA 1C9DB 1YU9A 5JAHA 1H1DA 4KSCA 3CKYA 4MGYR 4B8YA 5J4YA 5KNCD 3ER9A 2OVFA 5FH9A 3H6GA 3U19A 5EVJA 1HL7A 4LZWA 4G4SP 5D87A 4KH0A 1FDIA 2WWYA 4BVBA 1QONA 2XT0A 3DD5A 4IIJB 2I1QA 3CW8X 2QMZA 1NJ2A 5AW8A 2H1LA 1W9HA 4WNIA 1U5BB 3LMKA 1U5CA 2QMYA 3CN9A 4ZICA 3UENA 3N8HA 4URWR 4D7AA 5FOTA 2JFVA 4D8YA 1W46A 3OAAD 4XYEA 1SZDA 1FJ2A 1SR8A 3AVPA 1TZBA 4NECA 3ZS9A 4BKMA 1BS2A 4N41A 4YMIA 1CDOA 5ALHA 5AUNB 5C8YF 1XA4A 3F90A 4X94A 3I5AA 4DCUA 1NFQA 1H3FA 2QSJA 2O57A 4OQQA 3HWWA 3QH4A 5D8DA 1UBCA 4DLTA 1SZCA 1OCEA 4Z8XA 2IY7A 3C8MA 4COOA 5FJJA 4EKNB 1IHUA 5L9AA 2A0FA 2HLDA 1G3RA 3B48A 4KLZA 4R3WA 1IVNA 2RSLA 3V1KA 4FFDA 3TJMA 2WB4A 3L1KA 1ENZA 2LTAA 1AHIA 1NVGA 3PRYA 1VBKA 4YXWA 4IUDS 1CE8B 4WBSA 4WNAA 5I45A 3QA9A 1XN4A 1Q17A 3SYKA 4ZAXA 1NVEA 5T4HA 5PNTA 4FBLA 1NSYA 2NU9A 4MKGA 2AOTA 5EQJB 1UKVY 4ICIA 3MCUA 3O95A 4KGDA 3ZHZA 1PX2A 4PSVA 2VWGA 4QLOA 3V4FA 4O4IA 2QRGA 4XUDA 3VR5A 4BYGA 3UGKA 1FPMA 1NLZA 4KXVA 2WTXA 5CT5A 5B1DA 4GZMA 1O0BA 1SCNE 1BDMA 4C4ZA 2Q8QA 1JR6A 4MDHA 1V8OA 4EYGA 5CR9A 2KJQA 5H9WA 3Q8MA 2DPHA 2CE7A 1AUOA 1JE0A 2RHJA 2ZRBA 3LYUA 4Z0PA 5LZ2A 4CM5A 1JDSA 3ZY3A 4BIMA 3DWFA 3SEAA 3RS4A 5C7LO 4CRWB 2Z1NA 2ZS7A 4XA8A 5EC8A 4PG8A 4KREA 1SXPA 3HBJA 2VAPA 3IJPA 4FMCF 4ZV7A 3GLVA 1N7JA 3PUIA 4L95C 1XDUA 4A8JB 1PYOA 3ZCUA 2CXHA 3C6XA 1R64A 2OCYC 1L0BA 3C1TA 3HKEA 2H7YA 3QIVA 4IIJF 3WLSA 3IMCA 3NOXA 4JC0A 5B2FA 2NO5A 3SBEA 1H5QA 3BFXA 4PBTA 1JALA 1XELA 4UEWA 5FLEX 1GPBA 2HXSA 1NBME 1U2QA 3FY4A 3OZRA 3ZC3A 3TH5A 3ZNOA 2C2ZA 4NYMR 2ONZA 3TYXA 3U7IA 3CG4A 5CXSA 5DISB 1MV8A 1O8BA 4D5GA 5IZCC 3V1LA 4U2CA 4C04A 3I62A 2HGZA 3PHIA 5DBHX 5HDBB 1G0NA 3N8IA 4HLQB 4C3UA 3W1WA 3IMFA 3ORSA 5H3LA 4ESOA 3KQOA 1YC2A 1IMJA 3KR1A 2XUGA 1CV2A 3IA7A 3IEIA 3HBFA 1NN3A 4H60A 3EQ2A 2JLXA 3PHCA 4TT8A 1H2BA 1XZPA 1VBFA 1LFAA 2P4HX 4ISBA 1JFLA 3KQTA 3NX4A 4GSKA 4HKTA 3F7MA 2CL5A 1LXCA 4NNPA 3RFVA 4CIVA 2VP3A 4D9MA 3S7ZA 2GEJA 2P6UA 1FXWF 4FMDB 5JJ5A 3CG0A 3NHUA 2NO4A 2WPNA 4KQGA 4RFVA 1M6WA 3M6WA 4KAFA 2FPRA 1MQ9A 3V4LA 1Y1LA 4IQ4A 5DDIP 4TKUB 4UUMA 2HMTA 4MUAA 1KI3A 4X95A 2F62A 3KLPX 3CZAA 3UMYA 4PYKA 3RU7A 1N8TA 1GA1A 3JQGA 3I0MA 3P2YA 3RVJA 3SBXA 3PDIB 4XARA 4YALA 1KXJA 3C5WP 1RLMA 2UXBB 2WP8J 5JDIC 1EJ6A 2C0PA 4PANA 3FIJA 2ZR9A 1NT4A 3SE0A 1KYYA 4OSPA 4EK9A 3C8ZA 3ZDQA 1V37A 3KT3A 1VYVA 2FETA 3BF8A 3BXHA 1A7UA 2QZ4A 4N0MA 4P35A 4UEJA 5KTMA 2RHDA 2Q1YA 1JAYA 1SO8A 2HRCA 2X7JA 3JZFA 4I08A 1OI2A 1VL5A 4WK6A 1RR6A 2AYYA 4CWAA 3OZEA 3PYXA 1CHNA 2NXJA 5CYOA 1QIMA 1Q0ZA 3M83A 3LT5A 3RVQA 1U9JA 1S8FA 3EZGA 1CE8A 4H4EA 1Q74A 3B85A 4WNAB 3V8BA 4DZRA 3BWXA 1DCMA 1O94D 1ZVQA 4D92A 1F7UA 1LLDA 2YRWA 2VK1A 1OZHA 2X1VA 4YFVA 4EMTA 1DGQA 2R4QA 3QPWA 4YJDA 1KEEA 1NYLA 4C4RA 1Q7EA 5AJHA 1PT9A 3EZLA 2HN9A 3CPJB 3LQYA 4TWAA 4KH1A 4ZVPA 2JAQA 3Q0TA 2HW8A 3OBBA 2RHGB 4KV7A 1ZH6A 3C4QA 1NJFA 4A7PA 4E4RA 4E70A 4OHYA 3OZUA 4BGVA 5JJCA 3LF1A 1E61A 3N05A 1Z9BA 3T3GA 3MTBA 3O3NB 5E6UA 1DHRA 3IP8A 4OPMA 5T5QA 4LTDA 4F2WA 1G17A 4Q47A 5LXTA 1EXNA 3STHA 1TM7E 2QAIA 3LDHA 1Q1ZA 3K4HA 3CLHA 3QEJA 1COZA 2B25A 4D9HA 1N92A 4WUTA 4LCEA 3EXFB 1PNOA 1Y8AA 2V96A 3AESB 3OO1A 4I0WB 4L9RA 4NG5A 5IF3A 3LX5A 4D57A 3JVEA 4IIJA 4KAXA 3TR5A 4R83A 3VO9A 1WLYA 1UDBA 3FRJA 4UHBA 2LDXA 3O7MA 3ANNA 3CVOA 3L1VA 5FA8A 3FMOB 5B7NA 4R1NA 3KVOA 2AX3A 3G23A 4O1MA 2CK3D 2I4OA 4GQIA 3QE4A 1Y82A 5G4KA 2QRVB 2DFPA 1BYIA 4LV6A 4EENA 5FBHA 1PJBA 1XFAA 3UV6A 1EE2A 4NEQA 5F12A 4NMXB 5IARA 2B8JA 2MTBA 3GJXC 4E51A 4MARA 4V2IA 4RA6B 1ABFA 1T3LA 3LLMA 3R9WA 4PHFA 5DGDA 3V8MA 4BN0A 2PNFA 2R6FA 3H4TA 1FFXA 4NVRA 3C3KA 4EUNA 4YMHA 3BEDA 1IQUA 1PJ3A 2WG1A 3ZWXA 4JI8B 2DWPA 4RPLA 2XB2A 5JPCA 4B3CA 1X15A 3ROTA 5E6SB 2XNKA 1A98A 2Q6LA 3CEMA 1TDJA 2PKQO 1UBSB 3QXXA 5BNIA 4MUIA 1O6BA 4RVHA 2OORC 3X1XA 2WBLC 3S29A 1RQRA 1UBJS 2OZEA 3ZLJA 2VUHB 3HNRA 1E64A 4EVQA 4ONEA 2F4VB 3HGMA 2WFAA 3AOEC 1C1XA 1QX4A 2AK3A 2FOXA 1IBCA 3UPTA 4OK6A 4V0RA 4M8LA 2N3ZA 1XCJA 4QYWA 4LYAA 3DONA 4W9MC 3HDJA 3SQXA 2C4VA 4P31A 2C7QA 4EUSA 2BN4A 3WLEA 3GFRA 2Y2UA 1N5OX 2EQBA 3BGOS 5KKCA 2C4UA 4JITA 3ONDA 3R3HA 1KNQA 1P33A 3BCSA 1XVVA 4GKAA 4NOLA 5LD2B 3QU7A 5HK8A 1CRQA 4FOTA 3GJ3A 3GLSA 3R3XA 3GT3A 5TX7A 1XKLA 1YJBA 4PXAA 4HC4A 4NCJA 3HB7A 2WM3A 3FZEA 5AJVB 2Z95A 3IIKA 4BO3A 4BCBA 2ZRDA 4MWOA 5K8UA 2JAPA 1N36B 1YVPA 4MS4B 4AJLA 4YRBA 3VRHA 3K70D 1UP4A 3IH5A 2J4CA 3H0EA 3MCZA 3D6MA 4FFPA 1CDDA 5BSUA 3ND8A 4DIOA 3FDIA 1NKSA 1P6XA 1FX0A 4RBNA 1RPJA 2YASA 1ZKMA 2RKOA 1RKXA 1BW9A 3AYXB 4MB0A 1QYXA 1PFVA 3GRUA 4L4ZA 4BNMA 2EYQA 3S27A 3OLCX 2FN8A 1FRZA 1GL6A 1HBJA 3WO0A 4MVJP 5EWLA 3BMQA 5JMWA 1QIEA 1HFJA 5J2UB 1Y6QA 4TGLA 2VNSA 1ZIDA 2EDAA 3NFYA 4J16C 3ABQB 4P0QB 4AZSA 4NBNA 3KTOA 1OLSB 4BZXA 5HZMA 2OL4A 4JBIA 2HREA 2W8BA 4UPVA 4DM4A 1ULSA 1J4AA 2BTQB 2VYCA 4HX5A 3GRPA 3N2ZB 3JYNA 4G2TA 5SYNA 4K86A 4OA8A 1RYBA 3BD6A 2BMWA 2QSYA 3ETCA 1WPGA 2ZSIA 2DVMA 3K0EA 1EVKA 1G5PA 3HABA 4HLUA 2BBTA 4Z7NB 1E3EA 1KZGB 2CVPA 2O0HA 3GRAA 5T4FA 2IE8A 1GFZA 1YR3A 4HB0A 3EODA 4Q3OA 3OZXA 1NBHA 1NUAA 1X1RA 1MOZA 4MKRA 5ENDA 4ZVUA 3TL6A