1VL5A

Crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
GSDLAKLMQIAALKGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEELHCFHKTFIFEDWCDRMNVTTEKKQELSDFIKSKPTEYYQKFKIVVEDGRVYSFRGESILMKARKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (BH2331) from Bacillus halodurans at 1.95 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Transferase
molecule keywords unknown conserved protein BH2331
total genus 78
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vl5A00
1EJ6A 4V0RA 3JWJA 1R6AA 5DRTA 4CKCA 5EMJA 3TFWA 5FHRA 1H1DA 3TQSA 4M36A 5FA8A 5EKUA 3EVZA 3PLAE 3A25A 5K0LA 1I1NA 4MIKA 4C05A 1XDSA 5DTQA 5EIFA 1JTFA 2P7IA 1G8SA 3DR5A 2N47A 4JXJA 5FTWA 3UJ7A 2WA1A 4PYNA 5EMKA 3TOSA 3FTDA 3DTNA 4MTLA 5K8VA 2ZWVA 3UJAA 2Z6UA 3U81A 1G6Q1 4PIPA 3DMHA 3RODA 4P7KA 4PYMA 5F2KA 5FA5A 3FUWA 4MHTA 4CWAA 2OZVA 3EGEA 1AV6A 4U7PB 5C0OE 1ZGAA 4PYQA 3LHDA 1XXLA 2QYOA 1YFJA 4M37A 1ORHA 1BKYA 3NDJA 2OYRA 4CKEA 5DX1A 2QRVB 3KQTA 3ER9A 4OX9Y 4ER0A 2PX5A 3UJDA 1IXKA 2ZTHA 1JTEA 5HILA 5LR6A 1F3LA 4QPNA 2VDVE 4YV1A 3LKDA 3DMFA 5GM2A 4C4AA 4YUWA 5LQNA 3MCZA 3OU6A 3P9NA 2CKDA 1VBFA 9MHTA 2BM9A 1BOOA 1KR5A 3HA5A 5EZSA 1EAMA 1NW7A 4YMGA 5M5BA 3FZGA 3I9FA 2P41A 5CVUA 2P1DA 3UJ9A 3VC1A 5GIPE 5G02A 2XBMA 3UA3A 1KPIA 5E9QA 4BP1A 4MWZA 2O06A 5GOZA 5DT2A 4GC9A 5K0NA 2AN4A 1X19A 2UZ4A 2O57A 2AVDA 3LCUA 4R8SA 4RV9A 4OQDA 2P40A 3R6TA 4DKJA 3FUXA 4ER7A 2B9EA 3QV2A 3M4XA 1KPHA 3BGIA 3NVMB 3ORHA 4HH4A 4XUEA 4OA5A 1RJGA 5EPEA 4CKBA 4PYJA 1IY9A 1G38A 3O31A 5GWXA 1XDUA 1TPYA 5DSTA 3QOWA 5E1DA 3TKYA 5JUWA 1KHHA 2H00A 3FPFA 2DULA 3UZUA 3HCCA 3X0DA 2NP6A 2EFJA 5K0BA 5HIMA 3KQWA 1EIZA 3P9IA 2G72A 3K0BA 3M6WA 5EIWA 3BGDA 2IBTA 2XYRA 3SM3A 5E1MA 1T43A 2ZIFA 5DPMA 4E2WA 2OB1A 3NW9A 1R74A 4BLVA 3MQ2A 1WG8A 5GINE 3PB3A 4M38A 3PX3A 5HZMA 3HVJA 2AZTA 4C03A 1JG2A 2IH2A 2Y1WA 1VE3A 3A7DA 3FYCA 5FHQA 1NBIA 2ZULA 3BWYA 3TLJA 5C9ZA 5DSXA 1HNNA 1P1CA 1EQAA 1VIDA 3BUSA 2PXCA 3ELWA 4LWOA 3TRKA 5CVEA 1YZHA 3IHTA 2G71A 2HTEA 1QAOA 3I58A 2ZIGA 3MAGA 5B1SA 3FRIA 2JHPA 1QZZA 4KRGA 3SSOA 3SSMA 1MHTA 4Y30A 2AOTA 5T6BA 1N7IA 3M70A 5FCDA 1AQIA 3HCAA 3LBYA 3GDHA 2JH8A 3EVFA 1TW3A 3P71T 4NECA 4P7FA 5EHIA 2PJDA 4PGHA 2O0LA 4DF3A 4F84A 2YR0A 3DMGA 3DXZA 2EG5A 2EX4A 4OBWA 1R00A 3PFHA 2C7PA 3I53A 3LDFA 3MB5A 1D2CA 4Z2YA 1IM8A 2ESRA 2ZSUA 2H1RA 1VQ1A 5EHGA 1M6YA 3RW9A 3UFBA 2B25A 1JG4A 4LG1A 3ERCA 2XYQA 4GBED 4GF5A 5CM2Z 3EVAA 3MTIA 1XVAA 5ICEA 4RTNA 3CC8A 5FADA 3SVZA 2WK1A 5CVJA 1WY7A 4PYKA 5E2BA 3SSNA 3VYWA 5HOQA 1YB2A 4HG2A 4HGZA 4DCGA 3LL7A 3LCCA 3MCTA 4PCAA 1MJFA 3G89A 5H02A 2ZBRA 5K03A 1ORIA 5DTRA 3HP7A 3HVIA 2FK7A 1X1CA 2GLUA 3EMDA 1L3BA 2ZBPA 3KPJA 3Q7EA 4FGZA 2V7EA 3V97A 3EGVA 4IWNA 4C04A 5EOVA 3G8BA 3TR6A 1FJXA 2AOVA 2HMYB 4P58A 2AOTB 3PS9A 2CMHA 4YUVA 4E2ZA 1DL5A 4A6EA 5HIKA 1X1BA 3BKXA 5FUBA 5K09A 3QOXA 3OU7A 3M33A 4C08A 1Y8CA 3HA3A 3OPNA 1SKMA 3KR9A 4FSDA 3THRA 2AOXA 3HTXA 1D2GA 1KYZA 2OB2A 2PKWA 3FRHA 3GXOA 5KS2A 3B89A 2QRVA 4PGGA 2FHPA 3E05A 2IH4A 4PWYA 3FUTA 1NW8A 3CJTA 3HA7A 4CTKA 3LX6A 1SG9A 1JQEA 4YUXA 3EVGA 5LQKA 1YF3A 1G55A 1KPGA 1Z3CA 2P3LA 5LQUA 4FSXA 1FPQA 1N7JA 5CCBA 4RTRA 5FWAA 1QAMA 5K0FA 3KQMA 2FCAA 2ZIEA 3M6XA 4KW7A 4HRAA 4F85A 2G8NA 2PWYA 3FPJA 3AXSA 1VPTA 3GCZA 2FRXA 2ZZNA 3BT7A 1AF7A 1PJZA 3I5UA 4R6WA 4KDCA 3JWGA 2UYOA 3EGIA 3WSTA 3CJQA 4E31A 5LQRA 1OR8A 3R0QA 3LKZA 2B2CA 2QM3A 4XUCA 2Z6AA 3BGVA 3TMAA 4XUDA 1EJ0A 3IYLW 2UYQA 1L1EA 3BWCA 3KHKA 5D1NA 2JH9A 2BH2A 3UA4A 4QVKA 4XCXA 3SX0A 4RTLA 2HR1A 3G5TA 1RJEA 3MERA 2R6ZA 3LBFA 4GC5A 3OE4A 4PYOA 1FBNA 3KR1A 5E8RA 5U4XA 3UJBA 1SQGA 3NMUF 2C7QA 3R24A 2YX1A 4AZWA 4FT4A 2IDJA 2JHAA 3E23A 3O7WA 4GEKA 1SQFA 2AR0A 4IKPA 5EKXA 4L7VA 2OO3A 2ZW9A 1NV9A 2F8LA 2HNKA 2P3OA 3FPEA 4GQBA 4P7JA 3SXJA 3V8VA 3JWHA 2YQZA 2Q41A 3UBTA 4O29A 2QE6A 2PX2A 3JWIA 5FQOA 1YFLA 2V74B 4KDRA 1XTPA 3T7RA 3THSA 4RVFA 4U7TB 5FQNA 5IKMA 1M0EA 4QPPA 5EEGA 3P8ZA 1AQJA 2BZGA 3HEMA 2ZLBA 4HGYA 1ZHFA 1ZQ9A 2PBFA 5F2OA 3GRVA 4C07A 4QQKA 2VDWA 1X1AA 3MTEA 1QANA 1BHJA 1KIAA 3LCVB 5DM1A 3GU3A 1O9GA 2R3SA 3BWMA 3EMBA 3G2MA 4KIGA 3KQQA 4QDKA 4V0QA 2K4MA 3G2OA 2JJQA 2PLWA 3HM2A 2ZZKA 4AZTA 2UYHA 2PT9A 5E1OA 4E2XA 4RTJA 5FULA 2Y1XA 3CKKA 2ZFUA 2G70A 2NNWB 3F4KA 3KQOA 1TW2A 4X1OA 3NVKI 1Q0SA 3ELYA 1L3CA 3KR0A 2BM8A 3BKWA 4AUKA 2YVLA 5EMMA 2HWKA 3GRZA 2FPOA 2AN5A 1R8XA 4GOMD 3G8AA 5HEKA 3R9XB 4RVGA 2GB4A 4OQEA 3SGLA 2XVMA 3CJRA 3DXYA 5DM0A 2NXNA 3E7PA 3LPMA 2ZBQA 1SUIA 3A27A 3DOUA 3NWEA 2IH5A 1N2XA 4DCMA 5GP1A 2PGXA 4BLWA 3O4FA 3EEYA 1INLA 3SMQA 5EMLA 1NBHA 3FTCA 2AOWA 4ER5A 4CXMA 5ERGB 2JG3A 3GWZA 3T7SA 1RI4A 3KQPA 1JQ3A 1P91A 2B78A 3TKAA 1RJDA 4PYLA 4E33A 3E8SA 4EVIA 1FP2A 2BR5A 3NJRA 4HC4A 5T67A 2IPXA 4EK9A 2LD4A 5JR3A 1P39A 2CMGA 3OFKA 1RI3A 4GOLD 5EG5A 3G2PA 3PX2A 5MHTA 3EVCA 4E32A 2PX8A 1JQDA 5GM1A 3AXTA 4ER3A 1G60A 5EC8A 5DRYA 3A4TA 4PINA 4GOOD 2HV9A 1L3IA 2QY6A 1VL5A 5HFJA 5ICGA 2VZ9A 3FTFA 2CL5A 2I6GA 1QAQA 2ONZA 2PV0A 3UWPA 3DUWA 4FT2A 1VLMA 1XDZA 3HCEA 4CTJA 5HIIA 2ZVJA 4P7GA 2OKCA 2AOUB 5BP7A 10MHA 3CBGA 4M7RA 1XCJA 5LQJA 1O9HA 1L9KA 2XYVA 5KYGA 3P9KA 2GA9A 3UJCA 3C3PA 4E30A 5LSAA 5DM4A 2ORED 1PRYA 5DXAA 3ANXA 3DH0A 2C7OA 2AN3A 1RI1A 2NXEA 3KPUA 4RX1A 2UYCA 3P97A 5EGSA 2NP7A 5DWQA 1NE2A 3HVKA 3LDUA 1UWVA 3ID6C 3PVCA 1I4WA 4MQ4A 3OU2A 4X60A 5EQJB 4FR0A 3GRRA 2BR3A 2EJTA 3FPHA 5C1IA 2ZWAA 3DULA 3KPYA 5DTMA 2JHCA 3Q87B 5EZQA 1VP3A 4UOEA 5K0JA 1DCTA 4HTFB 4BP3A 7MHTA 1BC5A 4RTMA 3EVBA 4ATNA 1V39A 3OZSA 3A7EA 1NW6A 1I9GA 4IV8A 5DM2A 1SVUA 2PWPA 3G88A 4E2YA 2IFTA 4LECA 2AVNA 4LWPA 2PY6A 3GIWA 3K6RA 2YXEA 3LECA 4QQNA 4KIFA 1O54A 5KVAA 3OCJA 4QTUB 5E9JA 3G7UA 4FZVA 3L8DA 1M6EX 3A26A 3KPWA 5K0EA 5E8JA 4DM3A 3FPGA 5D1HA 3TM5A 2P8JA 4YV0A 1JSZA 4X61A 4PIMA 4QDJA 3LDGA 5EVJA 2E5WA 4R6XA 5E1BA 3DXXA 2ERCA 2NXCA 3DLCA 3BWBA 3M6VA 2P3QA 2P7HA 4QVGA 5K05A 2YTZA 5LQAA 2IBSA 1JR4A 3OFJA 3G2QA 3ER8A 3MGGA 3PT9A 3HVHA 3EVEA 1YUBA 2NYUA 2EJUA 4HTFA 1ZG3A 4X41A 3HNRA 1WXWA 2WA2A 3B3GA 3D2LA 3AWIA 4FS8A 1WS6A 3IEIA 3B7PA 3OZRA 3B5IA 3R3HA 4H0NA 4IV0A 2ZZMA 3KR2A 3P2IA 3I64A 3ME5A 4RYLA 3FTEA 5K01A 3RIEA 3P9CA 4C06A 4GOND 3KQSA 5GIOE 2PX4A 3EEOA 4OA8A 3KU1A 2VDUE 5CUQA 4Y2HA 4DMGA 3CVOA 3KQVA 3GGDA 1ZGJA 3KKZA 4DZRA 2GH1A 4X63A 4RTPA 5K0GA 4OBXA 5T64A 1NKVA 2I62A 2O07A 5CCXA 3OZTA 4PNEA 2ZCJA 2AOUA 2PXAA 3S68A 5E2AA 1YZ3A 3EPPA 3CGGA 1RI5A 3IV6A 3NWBA 2A14A 3GRYA 1KYWA 3VC2A 3ELUA 8MHTA 3C3YA 4BY9E 3PFGA 2OPBA 2YXLA 3KPVA 4AZSA 3FUVA 5EEHA 3AY0A 3ELDA 4YMHA 5E9WA 5ICCA 1DUSA 4WVLA 4R05A 3UJ8A 1UIRA 3AJDA 4RWZA 3NDIA 2I7CA 3REOA 2GS9A 3T0IA 3UJ6A 4F86A 1R8YA 5CIYA 2H11A 3HCBA 1UFKA 3KQYA 4RTKA 5KQSA 1XCLA 4EKGA 4YUZA 1NV8A 3H2BA 5K0CA 3EVDA 4DA4A 3GRUA 2DPMA 3TM4A 2FK8A 2Z6QA 1RI2A 1HMYA 4BLUA 3P2KA 5DX8A 2VS1A 3BZBA 3SR4A 1X1DA 3GO4A 2ADMA 2YXDA 1EG2A 2PXXA 1WZNA 3HCDA 2PT6A 4B17A 2YUIA 4RTQA 1NW5A 5BW5A 2B3TA 1XJ5A 5CD1A 3CCFA 3C6MA 4QTTB 1Q0TA 1QYRA 4PONA 1KP9A 1B42A 4ISCA 3LGAA 2GPYA 3PTAA 1P1BA 2PSSA 3DLIA 5KQRA 4G56A 1FP1D 5BXYA 1R18A 1KXZA 1NW3A 2IIPA 2VP3A 3NTVA 5IH3A 3P2EA 4AX8A 4RTOA 3C0KA 4R8RA 5HIJA 1U2ZA 5F2NA 1F38A 3DP7A 4FP9A 4EKIA 2PVCA 2NXJA 5ICFA 2GAFA 2OY0A 4E70A 1JG3A 3FYDA 3GJYA 5DLYA 3BXOA 4KWCA 2BR4A 4EMSA 3T7TA 4DQ0A 1NT2A 5DXJA 4AZVA 4PCLA 5FWDA 5BW4A 4ER6A 1WXXA 4POOA 1ZKDA 4EQZA 3M6UA 4K6MA 5DX0A 2CWWA 1D2HA 2ONYA 1VP9A 3FUUA 3B3FA 3VSEA 2O05A 5CVVA 2KW5A 2OXTA 1RJFA 3B3JA 1JG1A 3GNLA 2FYTA 4RVDA 4PYIA 4RVHA 2OBFA 2IP2A 4YV2A 4GUAA 4RTSA 2P35A 3OE5A 2XVAA 3TPZA 4YUYA 2C7RA 4RSRA 3HCFA 4WXHA 2IDKA 2IGTA 5P8WA 1SUSA 4A6DA 1G8AA 2AS0A 4HSGA 1JSXA 3C6KA 3LSTA 4ZTBA 3G5LA 5LQCA 2G1PA 2I9KA 5CVDA 4KVZA 3MHTA
chains in the Genus database with same CATH superfamily
2JJ1A 5EMNA 3EFOB 2QNIA 4RGBA 2O5VA 3VZDA 2A1TS 1GADO 2X40A 1MVOA 1H1DA 4M6WA 3RV3A 3LW8A 2OAP1 1JEQA 5FORA 2QZZA 2XE8A 3A4NA 4M9SA 3AM5A 3TSAA 5DM70 4JLBA 4Q3AA 3L8EA 2AEJA 4FZJA 4YJGB 4C01A 4JXJA 2VDQB 1D2NA 4EUEA 1GQYA 5KI6A 5DBIA 4AJ4A 1X1EA 1P81A 4FGKA 2V4ZA 3BHNA 3EZFA 3DBVO 4G0QA 5EMKA 3RYTC 2VCHA 3PYLA 1EVLA 3REFA 4UTRA 5A3QA 2PBZA 4BX9A 3U81A 2M6LA 1DEHA 3DMHA 1KJ9A 3CNLA 1CP2A 3OD1A 3IDAA 1M0SA 1SCNE 2DBRA 3WG9A 1H9BA 3CB2A 4E1VA 1UT8A 1ZGAA 2H4XA 4BNGA 1QHSA 3M4NA 1IQ0A 2VF5X 4W5OA 4Q48A 4Q4JA 4DJFC 3OZCA 2P9EA 1U7WA 3B5JA 4NONA 1QMPA 1G5QA 3HZRA 1NXXA 3PNLA 1X74A 4YV1A 2A84A 2PH3A 1RYBA 3AW8A 3C7KA 4N0QA 4C6TA 2EBUA 1T0HB 5IJZA 3K05A 4PLPA 2BVNA 4E09A 4YCBA 1X3LA 4LOJA 3TZKA 1SIUA 3COVA 4BX2A 3T34A 5DTIA 1D04A 1RHJA 3EDMA 4OHVA 3AERA 2CLLB 3QP9A 2VT2A 1GZ7A 2ISQA 2WT4A 1VE6A 3E27A 3FZGA 4KQ2A 2IV7A 2ASEA 3UJ9A 4CL2A 1W4LA 1KZ9A 4H6PA 4JLSA 5JW6A 4K9QA 1DELA 3MUFA 3PEUA 1KO7A 1QOZA 1VJDA 3O92A 2CXRA 3TTTA 4DV7B 1Q3HA 4GIBA 1ECLA 1LC3A 1XMJA 4RVCA 3RU9A 1OXVA 2BEVA 3WAKA 4C88A 5KYYB 3AONB 5TMPA 4LSWA 5D85A 1BOFA 3MWDB 1RJGA 1L5KA 4DYDA 2BH9A 4CGZA 2FSIA 4JBYA 3ICCA 3AP2A 3L8HA 3IPXA 4RVNA 3QOWA 4MUXA 4W1PA 4C2BA 1OX4A 2H9AA 4ASUD 2RGUA 1A5AB 4UAVA 4C3ZA 3FPFA 3BH6A 2YJTD 3OO1A 2CHEA 3QW4B 5DTJA 5JCPA 1MDFA 2WD7A 3JYLA 3KCNA 2VJAA 1GZHB 1TK2A 2R65A 2ZIXA 4TZ0A 3SM3A 1T43A 1T8PA 2ZIFA 2IIVA 2DR3A 5DPMA 5B3AA 1SEVA 3SDZA 2Z2ZA 2Y0CA 3MQ2A 1L5WA 1CUDA 3A32A 3ZWDA 4JI0B 3KXKA 2ZSBA 3PX3A 4N12A 5JFOA 2ZRNA 4CEHA 3IULA 5ABPA 1S2MA 2ODNA 4Z4CA 1VE3A 2G1PA 1YR1A 4EAQA 3RS5A 1YNSA 1X7DA 1F8YA 1P6UA 4XFDA 5DW3A 4M0DA 1E6CA 3GHYA 3MCVA 2I4TA 3WB9A 4DLTA 4JJIA 2VOJA 1VI5A 4A2QA 5ALVA 3SSOA 1QZZA 5G4KB 1T24A 2C2YA 5C7OO 4QU5A 2IK8A 2VYCA 3VDXA 1J2JA 5F3DA 3CINA 2XOKA 2C9YA 2VJNA 3ZDZB 4NECA 3SJ7A 1SQSA 1BS1A 2CYAA 2QZ4A 521PA 1OLXB 4B6GA 1DEAA 3JCZA 3WB1A 3HNOA 3HL0A 5I9LA 1UT5A 4HV4A 2OCIA 4ENSA 4JVMA 5KX5F 4B3MB 3L49A 3RUFA 1D2CA 1T4DA 2Z30A 2J9YB 2QT0A 4WZAE 2VF7A 1M6YA 4KWTA 4Q7JB 1HO3A 1Q0RA 1ZOPA 1QZXA 1DKOA 1EKXA 4XIJA 2XNHA 1QFSA 1KSHA 4DM7A 1HDRA 3UF0A 4QM7A 3FH0A 2IOYA 4FYHA 2OAEA 3KJXA 2JCBA 2CNLA 5IWCA 2GK6A 5G41A 3QIVA 4R54A 5ED0A 1EEHA 2HCTA 3QYAA 2CD9A 4FGZA 4TVOA 2H7XA 2I3GA 2Q6VA 4BV9A 3CUKA 2D8MA 2D2FA 5DLQC 2D2XA 4C21A 1YJXA 3O1JC 3KEOA 2C1ZA 3PNMA 1E1RD 4HNUA 1TZBA 3B6JA 3DTVB 3KRTA 4LHSA 3O93A 4B6PA 4C78A 5I51A 1N92A 3OU7A 4OM7A 2X0DA 2LZ0A 5JAPA 3Q12A 3V42A 3ETGA 1YR2A 2JJYA 3D0QA 3DPSA 3KV1A 3H6GA 3B89A 1M66A 2CVZA 3V1NA 1YI8A 1UQRA 3TQCA 4MPPA 4EJSC 3V8BA 3RBZA 1RPZA 3PEEA 4LWQA 3C85A 3VKGA 4F7DA 4EW6A 1JQEA 5K2MA 1C3LA 4D74A 3O90A 1DG9A 4GMHA 2B7BA 4JKOA 3WRYA 1WBBA 4TZKA 4PPQA 3ZWYA 4E03A 1SQ6A 1V9SA 3C6XA 3JXEA 2DY0A 1RWKA 2C9ZA 4TWBA 3GROA 3OETA 4RS4A 2QX6A 2P4SA 1VPTA 4JKYA 4QLOA 5AXAA 4ZDWA 1OXXK 3ANMA 4B6RA 1UUFA 1DJMA 4M7PA 4TN1A 5H9WA 4Q93A 5FP0A 3EGIA 3P2YA 2KYRA 3AINA 3GLGA 1H8HA 2QM3A 2GN0A 4URYR 2FMKA 4NCHA 5C31A 5DLDA 3I5MA 2FV8A 2CFTA 4Z3OA 4D6YA 3HK2A 3D3JA 3SLRA 3EDQA 4Y2GA 2XB4A 4QUKA 4YJ3A 1RVV1 3ZE8A 4S3MA 1M83A 4RA6A 2W8BB 1GTL1 4CFZA 1H2BA 3UJBA 1ESMA 5FBVB 1FTWA 1V37A 1XZNA 2PUBA 5T8KA 2FN8A 1P0IA 2OCAA 3RYIA 4B7CA 2BBOA 1QNLA 1G9TA 2HYIC 3A3YA 1LJUA 3JY6A 1J0AA 1OC4A 1NV9A 3B9BA 1QS0A 1XDBA 2C3MA 3QVLA 4REOA 5IAEA 1UIMA 4LY3A 3ZYCA 1PYGA 4H3VA 1GTG1 4RLFA 4O29A 5FQOA 4E94A 1GGKA 2IWRA 2YH2A 3BJRA 5JFGA 3DQPA 1A7JA 1TQHA 2ZJ4A 3CNBA 1MO5A 3F6EX 3HDQA 1EAYA 5EEGA 4XB1A 4MR7A 3LKVA 3K0FA 4R2IA 4QGBA 4KHZA 5KNLA 4HGYA 2IUEA 2O3UA 4K6GA 1JWAB 4JNKA 3S2SA 1PUIA 2X2EA 2JJ1D 3CLTC 1KY5A 2QX7A 2VEDA 3PRHA 2NLOA 1X1AA 3WK9A 1XUOA 4H1WA 5CA0F 1U0GA 2MSWA 5LOVB 2XXAA 2D5CA 4RWEA 5EYPB 4LYEA 3WV5A 4Y7CA 3B60A 3O8DA 3QLJA 1IXYA 1K6JA 3G1UA 2XB6A 3DDSA 5JAIA 1T8WA 2JJQA 3BD9A 2ZZKA 3PHIA 4CR8A 2HCBA 2RH4A 1F1BA 3D6FA 5C80A 1QU3A 4PX9A 2QT9A 2PRYA 1PQYA 3F4KA 1YULA 2I4OA 3O4GA 3R4CA 4H7DA 4X1OA 2FCRA 1L3CA 5LA6A 1JT9A 3BKWA 1HDGO 3ZV6A 5ADHA 4BX3A 1JXOA 1J07A 1PK8A 1Q83A 2FPOA 2VPPA 3C7TA 1Z4OA 3GXBA 2HA7A 3GBVA 3PDIB 3QLEA 4FC7A 4S1TA 4TLDA 5HEKA 2CDNA 4OJTA 3WRXC 3JVUA 2ZYSA 3F90A 2NXNA 3E7PA 3A1NA 3KAJA 5HF5A 4NC9A 3R9XA 2JIBA 4HDSA 1XCMA 5K8JB 3P0EA 1TAGA 5AKLA 2YN2A 4BKUA 2OK8A 3PEVA 1IN8A 2A9JA 2YHAA 4L4RA 1S8AA 1VLHA 4NE7A 1B2LA 3IHLA 5H70A 4L08A 3ZCTA 1EFPA 2QENA 3HP1A 4TRRA 1MO2A 2X9VA 4X5OA 3TKAA 3GD5A 4LN1A 5BR7A 5JI3E 3WYAA 4PEVA 1KGSA 4LBWA 1ZONA 4MQEA 3QPWA 2CE2X 1M2VB 3QKTA 5MGNA 3N6RA 2ZRCA 1TYAE 3K3PA 3NOOA 3GRCA 4X54A 1ARZA 5D3MB 3RYCB 4MULA 3VR2D 1RI3A 1U1EA 3P0IA 4FLMA 1AC5A 1OXBB 3NG1A 3EVCA 5AM1A 3CMCO 1KDPA 4NV0A 4BTVA 4D8WA 1ZQ1A 4LDQA 4ZK6A 4QDUA 2IX3A 3AKZA 3IVMA 3UUGA 3OO0A 4QTZA 5TF4A 4G5XA 1C9JA 1ZD1A 3JVIA 1NXSA 1Z5WA 4RHFA 3GQVA 2VQEB 1H9AA 2DUJA 2V6IA 4D1YA 3KEFA 2REXB 4UHEA 1TUGA 5HIIA 2B4KA 4KBYA 5A9SA 1EX9A 1SUAA 3KTDA 3L05A 1EP3B 2DHRA 4YAWA 4M7RA 3ENQA 4Z8YA 4EPXA 4EG4A 2O6LA 3MJRA 4HDAA 3SQMA 3RHSA 3VHRA 1QIGA 2NSJA 4KMOA 1P2DA 1W4RA 3FFTA 4LC1A 3EBLA 4LZLA 3GLIA 3MM4A 1JHOA 3LNCA 2R00C 1KE2A 2HDWA 3KPUA 1PEKE 3OJOA 4IOJA 1DMSA 4KGZA 4RJ2A 3DMDA 4XI9A 1KEVA 2JGJA 1GG2A 3VDRA 3ZWCA 4CT5A 2GPSA 3AG6A 4WFQA 5F1PA 4BRUA 3STXA 5TGDA 2PDAA 1R9JA 2I8CA 4DMCA 1WAMA 5BWBA 1T9GS 1I13A 4UOEA 1H2RS 4D25A 7MHTA 2Z0MA 1DAIA 2WOOA 1CS0A 4PY2A 4ATNA 4CM8A 1SD2A 4PR3A 2GA8A 3R5FA 2VP9A 4N03A 3ZKWB 1EDBA 5K7SA 3JSAA 4L8GA 3ESBA 1J2YA 3QEBZ 2CDBA 4LXHA 2RKOA 1CF9A 2I4NA 4ENQA 4JQZA 3WP0A 3GIWA 2FEAA 2JJ8A 3X1WA 2B5OA 3VOTA 3H11B 1LK5A 1L4FA 3ZW7A 5KPDA 1IOLA 1O77A 2BFAA 4LA4A 4CMAA 1OKKD 1RLOA 4ZVTA 1SAYA 3A26A 4DCPA 2E49A 3EQ9A 2ZR7A 1E6LA 5B64A 4DMKA 3K8QA 3D8HA 1OU0A 3HDJA 1XF1A 3BE6A 3IP3A 1F51E 3K0SA 1ZIYA 2IOHA 4XFKA 5HW0A 1D6SA 4YASA 3BSYA 4QDJA 4AY6A 4UMFA 4C0JA 4EF6A 5TPZA 1LZLA 2Z9DA 4TSFA 3LA6A 3DXXA 5AK4A 1KK0A 3LG2A 1QYDA 2L17A 2W2TA 4OM8A 1IAQA 2YTZA 3WY9A 2IL1A 2E21A 3QFFA 4PAGA 3RJ9A 2WMNB 4RM2A 2OZLA 4BV3A 3RASA 5I7FA 1HT1E 1RWWA 1UJ6A 3PQ6A 5C3UA 1K8XB 4FS8A 3BGWA 1XDDA 5KIAA 3B7PA 4TRNA 2Q4BA 3FZYA 4U7HA 3O8RA 4CN8A 2BFDB 2GEVA 2Q28A 1E9DA 3KQSA 3WB0A 2ZXUA 1NQUA 1T29A 1R4AA 1MJ5A 1NN0A 4RZHA 4KQKA 1T8RA 4ND5A 2II6A 1Y8RA 3R3YA 4F38A 2DETA 4RDIA 4HEA6 4H9GA 4LSZA 1U0EA 4BNLA 1W0KA 4A82A 1TO6A 3C6ZA 3EPPA 3DLHA 2HH9A 3JR7A 1COZA 3C3YA 1AUOA 2A9KA 3RTCA 1XZHA 1Y3BE 4AZSA 4BJ6A 5M04A 1QBGA 1G5PA 1H5QA 2MSDB 1VC2A 2H0QA 2Y76A 3L7KA 4IXWA 4RMNA 1RBQA 4TL7A 2JFGA 1UIRA 3OC6A 1NVVR 5H8WA 3BE4A 3NDIA 4F86A 1SCAA 2Y99A 2I76A 1R8YA 1TCUA 2EEPA 2EJBA 3N2NA 5THKA 3TNJA 1DKQA 3D6AA 3GEGA 7REQB 4RTKA 5MFPA 1J24A 4WL0A 2G36A 1RPNA 1G0OA 4GXRA 3FHLA 2BMJA 2FK8A 2BFCB 2IGBA 2Q45A 3ZV5A 1NFQA 4ARUA 4I1YA 4CG3A 5EE1A 5KYXA 1MRZA 1HDEA 1C3VA 1NQOA 1EG2A 1SH7A 2PXXA 2V7PA 2X4LA 2ZI4A 4TUYF 1GCGA 4NXMB 1NW5A 3ZZ1A 3H2SA 3H3XA 3PUZA 3ENNA 5F7JA 2CEAA 4LHEA 5KWSA 1Q0TA 1JT2A 2C5BA 2ZYRA 1MABA 2GK4A 2FUG6 3KLNA 1X80B 2ZS7A 3T15A 2J87A 2Z57A 1IN6A 4O4IF 5HTKA 2O2DA 4MWGA 1EZZA 1DO8A 1FXWA 3FB1A 1GL7A 1NW3A 4DV3B 2RHMA 4YCAA 4KXUA 4X85A 2GPBA 1YQEA 1U2ZA 3OQHA 2IW1A 1RJWA 3NEPX 2QMEA 2QRKA 3IAHA 2GAFA 2BAGA 4CQJA 2YWHA 3FYDA 4GOXA 4ZJYA 3DLAA 4CQMB 4HMPA 3GF4A 4QT0A 5AIAA 1LSOA 2AMJA 2R5NA 2WTAA 3Q6MA 4FMDF 3SYRA 3UYKA 1NIJA 5LU9A 2V55B 3L0CA 3PGJA 1NASA 4PTZA 3CCBA 1KAMA 3D5TA 3R1IA 2OGWA 1OQAA 1VDMA 4EQZA 2BHNA 1IRXA 1M7HA 2CWWA 2EZTA 2YZ2A 2OV2A 1G9XA 3AJ8A 1UOOA 2GJKA 3SHTA 4J4TA 4BNUA 2WM3A 4HDOB 2ZUEA 2KW5A 4PTYA 1OZAA 3KLMX 1FW8A 2FYTA 2RFLA 3VH4A 2BKXA 3ETLA 1DC4A 4IYRA 4QFMA 3VR3A 3C3WA 3EPJA 5B7GA 1GGFA 4ESEA 1KC1A 1BXGA 1C29B 2V03A 4N01A 3BSSA 1AKTA 1XAJA 2I2BA 3PFCA 3C1UA 4RSRA 4RJJA 4UHDA 1FP4B 2D7CA 1NJGA 1KFBB 2AS0A 3GB9A 3IGFA 5EJ7A 3OE1A 3E9NA 4ZTBA 3ZDEA 3K31A 4CDNA 4BLQA 1X8JA 1PS0A 1QFMA 3HPQA 4HVAA 2OBMA 1U8AA 3CLSC 4JWTA 4UE2A 3ZGXA 5KOJB 3OM9A 3JWJA 1K8QA 2PSEA 3NIGB 3PUVA 4C89A 3UOWA 3TQSA 2RJOA 3SG0A 3HXKA 5I7HA 1L5FA 2DFDA 4MRNA 1PBNA 4MYHA 3MT7A 4D57A 2V45A 3J7TA 3GBPA 1LI4A 2XB8A 3A05A 3CX7A 3ZWPA 1OX6A 3U61B 1QVAA 2WA1A 3WLHA 1UODA 3A6PC 4U0JA 2Z1NA 1RXWA 2AK2A 1PNVA 3W5UA 4HAOA 4LDZA 1W47A 3DEJA 3X43A 5CDYA 4N3BA 1MB4A 2XJ9A 1UMKA 2O4UX 1VA4A 3VH3A 2OGTA 4ZTUB 4LXXA 4YPVA 3BVPA 2NGRA 5CXXA 2DECA 4ZQHA 1CJMA 3ETJA 2FY8A 1BKYA 3F7MA 3LDAA 4BFZA 1BCRB 1KK2A 3RSCA 1A8HA 5BUCA 3EQ7A 4HB0A 1QJ4A 3VX3A 1KI7A 5K8IA 3ZXYA 4RORA 3SBOA 3R0JA 5HRCA 3N5CA 5SY9A 3EULA 2X13A 1FU7A 4RPHA 1Z9BA 2OCBA 5H4HA 4KU4A 2AJCA 3DCIA 2QE7D 3IQFA 3MJFA 2CNNA 4MKGA 4LDJA 4UDYX 4BHTA 1XTBA 3AY6A 1XK6A 1SWWA 4GM1A 3WGUA 3FSGD 1WWKA 3MBKA 421PA 2J3KA 1QX3A 1ULUA 1P0QA 2XBMA 5E9QA 3W5IA 1KEEA 4YP0A 1P1RA 4P1ZA 4ZVUA 3GLGE 1TZKA 2DKFA 1KBZA 4Q4DA 5DI3A 4OXRA 3QNUA 1VRCA 4CLRB 2BDUA 1R37A 3C8MA 2ZK7A 3LCUA 3N87A 4GQIA 3BFPA 4JJFA 4QEKA 4D9CA 1XQWA 2WM8A 5C8DA 5HR5A 2G3YA 1BW9A 3WDMA 4JI6B 3CH6A 1ZMTA 2HLHA 2X8AA 3G2JA 3O31A 3DGFC 4HLUA 4PO8A 4FFLA 2ZYWX 4RCVA 3NUQA 4TLMB 5GWXA 3S1AB 3TKYA 5E1DA 4ZOLB 2GRJA 1K8ZB 2NZ2A 4Y1EA 3HUTA 1UP6A 2D5AA 1OLXA 5K0BA 5KTKA 2VAPA 5KQLA 1NL3A 2XGOA 2RGNA 2TMKA 4UAGA 3QXJA 1EM8B 4BLTA 2GJ9A 1CQZA 3C7DB 1OFGA 4HTAA 1FDUA 3B51X 1W4AA 4YCDA 3U7GA 2F9LA 2PSHA 5E6RA 4DCSA 5BR1A 5GINE 1XD2A 5F78A 1UOEA 3NM6B 1PR5A 3WK6A 3QJ5A 4ESVA 4WOCA 3GMDA 1Z6XA 3DO6A 4DRXA 1MC8A 1CEXA 4LCJA 5LZ8A 1P1CA 4QJ3A 3WGTA 4UHKA 4QA9A 3AUSA 1K88A 2XMZA 2EKDA 2HGZA 1YZHA 2ZBEA 4INAA 4L85A 4ZT4A 4BYMA 2J59A 5G53C 1KYQA 1JWBB 1TEVA 5AUQA 1QH8A 1W48A 4HB4A 5D00A 3T7DA 1YS4A 3LOUA 5TC4A 1DC7A 4ZAVA 1QUEA 4X6LA 3GVXA 4RS3A 1DMRA 1RHQA 2EYQA 4L4UA 4PNHA 2EZ9A 1OLUB 3UTDA 1GQSA 4R0NA 3MMNA 3PQEA 3FKSD 4W7HA 3GNTA 1TC1A 3KKMA 2ID8A 1P4HA 1JFSA 5CAEA 2H1RA 3RW9A 2VAWA 3QXHA 4IZHA 1B8UA 1KMNA 2Q8PA 4JT2A 5JXHA 2BMEA 4PRKA 2BRUC 2FFBA 3C8HA 3ZJUA 1AS2A 3G6KA 4C3VA 3H83A 3V2UA 4RIHA 1RTTA 4KLRA 4P92A 3MAAC 4Y9SA 1OFUX 4P81A 4HGOA 3VR2A 3W5BA 5DU2A 4AW9A 3LL7A 3LCCA 5BSMA 1GGNA 1Z82A 2I4MA 3QKSB 2ZBRA 1Y8QB 2COKA 3QVOA 3SR3A 2Q9CA 3TTVA 3UT5A 1R9GA 2FG6C 2AG1A 1MIHA 3EMDA 1SVWA 2FG5A 2MMGA 2BUBA 4ZCIA 3TBKA 4Z3KA 2VHEA 3H65A 2AOVA 3CN7A 2WYIA 3O4HA 1BMQA 1V95A 3K5IA 1ZCJA 5EPOA 2EZ4A 2WPDA 1DEOA 3NCTA 4NRDA 3R7DA 2JVIA 3RBAA 5ALMA 4F92B 1B41A 2ZUCA 4PHTA 2XVXA 1CZUA 1NGSA 2GN1A 1YDGA 2HNAA 2H9YA 2QTBA 2KX7A 3D4IA 3L84A 3LRPA 3M6FA 3E05A 5JLJA 2NU6A 3MMZA 1KDZA 3UNXA 1HXHA 4MS3A 4B4KA 4FGUA 2J8ZA 3RUDA 3RYIB 1J7KA 3Q0EA 4RLSA 2H1FA 3W7AA 5CCBA 1FPQA 2FRDA 3EC2A 4BIIA 1NM5C 3BRWA 4JU8A 3NQ41 4XPIA 1XRJA 3M6XA 4FOLA 4G4JA 2BTEA 4N5NA 1MZPA 1OWOA 2QLJA 3C3JA 1WMDA 2QP3A 5CHYA 1XRSB 2VDKB 2Y0EA 4YCMA 1XELA 4QYMA 2FXIA 2LKDA 4GOKA 5T3YA 2PZ8A 1PSZA 5C3MA 4YBZA 1BVRA 4WFKA 4XUCA 3C4VA 5EUBA 1G3UA 3FYUA 4A8JC 1DHTA 2FSGA 3K35A 4R7GA 3F6CA 1Q22A 3H2YA 4IOMA 1UJNA 3K0HA 3FETA 4N8DA 4URHA 3SX0A 2WKQA 1RJEA 1TF2A 2IHYA 1UMBA 1ABFA 1LC0A 3VPGA 4ZT6A 2WSIA 3KT0A 4OU4A 4X20A 3PPXA 4E08A 1N8TA 2C07A 1BFDA 2RCNA 4URUR 4MW2A 4QGGA 1X7YA 2CNWA 4JEMA 1E2JA 2JHAA 5JECA 2G88A 2TS1A 5JRDS 2QNBA 4AZ3A 1TC2A 1E94E 4YRCA 1IWPB 1D6NA 1L5RA 3GDOA 1HT2E 2OHOA 2YMLA 5IZCC 3VR3D 1LPNA 5KTMA 1DBWA 2OLKA 4MRMA 4AMYA 4YRZA 4QTXA 4HBZA 4IS3A 4QRHA 4UMEA 1XTPA 3L8MA 4HB2A 5IKMA 3CX6A 4QPPA 3S2EA 2YJ3A 5BYBA 2I6TA 4UUMA 4UNIA 3RVOA 3U60B 2I55A 1D8AA 5JVDA 3FOEC 1PT7A 3THOA 1DTSA 3OCUA 3F7NA 1EVJA 1QANA 1L1RA 3MSXA 3JASB 2FI1A 4YXWA 4BO9A 4URXR 2XCSB 3PDCA 2PD6A 1M34A 4DSUA 3IIJA 1U80A 1ZCAA 3ZH9B 1HPLA 4MA5A 5D3MA 4Q4HB 3PV0A 5D8DA 1N7GA 3SHWA 4EW1A 5E1OA 4AP9A 4Q12A 1QYXA 3WGIA 1C4XA 4KR7A 4XH9B 1GKLA 5K6AC 3D3QA 1E63A 1Q0SA 3H4TA 1EDZA 3NBQA 3C3CA 2ODQA 3RBVA 2H65A 3FDJA 2CJXA 3JVVA 2DQSA 3VHXB 5IC4A 3U4MA 4PV7A 1XAIA 2IYOA 4GOMD 4PQGA 4US2R 4ARSA 1VE7A 2R1UA 3DHWC 4MEJA 3CJRA 4KPEC 3SZUA 4P4UA 3OP1A 2GJ4A 3IDOA 3NWEA 3WIVA 4B4VA 1MQAA 4HWRA 1GCOA 4HCJA 3EC1A 1CEQA 5FWYB 5IPFA 2GBFA 3KLOA 3SMQA 1NBHA 3Q40A 3LK7A 4YXWD 4M1OA 4DMRA 4DLWA 4MPDA 2BJHA 2YJ6A 4JSYA 2C0QA 2CB9A 2V7VA 4H7EA 4A2PA 2GCNA 1DJNA 5HHTA 2J3EA 1L5VA 3M3PA 3FOAA 4QFDA 4XIFA 4LXIA 4NJEB 3KJQA 1N3YA 4IX1A 5A6SB 2LD4A 1PR9A 2I2FA 2WTMA 2QD4A 3DAFA 4H27A 5IUKC 3TL2A 2IXEA 4MVXA 4TMXA 1YGPA 13PKA 1EFRD 2Q6LA 3Q3JB 4YGXB 4ZAZA 4GNRA 3CWQA 2OA0A 1W4ZA 3R6DA 4X71A 2CXXA 2RMKA 5F7XA 4ZVMA 3UMMA 2J1LA 1KRHA 4Q9IA 3WLJA 1IVYA 2I6GA 1C4KA 2HZBA 1QAQA 1RLUA 3G9TA 3ZHQA 3UQZA 3KEMA 3LBIA 1SBHA 1JV2B 1G41A 2F1OA 4P7GA 4QSMA 4EPWA 10MHA 3ZWKA 2GEDA 5FBHA 4P4SA 4Q7KA 4Q9JA 3C3PA 3SWWA 1E3WB 1G8PA 1Y7TA 4OHPA 4DR2B 3L82B 3OOHA 2FWNA 2CHGA 2CLOB 4IZOA 4ZVKA 4BJ1A 4HVCA 4S12A 1MEEA 3EMVA 3NGXA 4QRDA 4KR2A 1NE2A 1Y6JA 3NOQA 1IBKB 2RAPA 4XRGA 5GONA 2IYLD 1TF5A 5CEFA 3R7WB 2VH5R 3OP4A 1Y1TA 4L72A 3BAZA 3CW2A 3UKDA 2O8DB 4RTMA 3VR6A 1GT6A 1YS1X 1MT3A 4M8NE 4MHOA 3G88A 3KL4A 4REQB 1DQRA 4UM5A 4FB5A 3FNQA 3JD1A 1EWYA 3NAGA 4UC0A 4EWLA 4LWPA 4Q1BA 1UEIA 1NBMA 4QEDA 5LMNB 1QB8A 2Q3FA 1X2BA 2LDXA 1YMUA 1ZXLA 1YR3A 2NQTA 3UMVA 2HKIA 2XPCA 3PC7A 5EESA 5JWHA 1XRNA 3EVTA 4NEQA 4BJ3A 4CVNA 2R6AA 2WP0A 1FDSA 2E18A 1Y8RB 2E37A 3BB3A 1JNYA 1IN5A 2BT4A 2FPGA 2XYGA 4NQZA 1T2DA 5E4FA 4ZWNA 1I1OA 5MFZA 3O4VA 3I5YA 1HV8A 2YWDA 1K3TA 3C41J 1NN3A 4YV0A 5FO1A 1RS0A 2CXQA 3HLTA 2JATA 4QBFA 5HGJA 3U26A 4AQYB 1C7QA 2NO4A 2P7HA 3TGPA 2RGRA 2DPXA 1EA5A 4CQNA 4GOJA 4FS3A 2GETA 4DNPA 3GFGA 2AFHB 2EJUA 1ZG3A 3PSAA 3EG5A 1W6UA 3IP8A 1J09A 1PL7A 3E48A 4GYWA 4TN5A 2WR8A 5KTSA 3IT2A 2D1RA 1RE0A 5DM60 3JQAB 5A62A 2ZR8A 2BHRA 5JALA 3KO8A 1M2KA 3MMXA 2PSJA 1SOAA 2IIBA 3I64A 3ME5A 4UQOA 1GPWB 5G0TA 3IR6A 4LV8B 1SUDA 3TBHA 1G7CA 2WWFA 2O7NA 2QNRA 2XMBA 3T4PA 3DUFB 1VHJA 4RL4A 2IYZA 3R8XA 1O6FA 2XDQB 3NYQA 4MGKR 4E14A 4O2AF 2QJWA 3KKZA 1K0UA 3K9CA 3PYMA 1NRXA 5HKLA 5BSKA 1N1DA 2E4ZA 2RB5A 4EYQA 3ZEIA 1PI3A 2C8VA 3W4IA 3L1IA 1OU4A 2VT6A 3G8CA 2WFMA 3E7WA 3N74A 3VC2A 3JAMA 4KB5A 5THQA 1I0LA 5LWQA 4BO2A 2I6SA 1D1SA 1FTSA 1K66A 2AN9A 3E53A 1W36D 3G2IA 5IAAA 2IXTA 5BVHB 3CNOA 2DR0A 3DW1X 4D7AA 3G2LA 4Y2PA 3ELDA 3KZCA 4B3FX 4P4NA 4YP1A 4AYXA 4YPOA 1HLFA 2YHBA 3ZVKA 3NHPA 5JY6A 1V25A 2YMPA 3ESAA 4QDXA 4EHFA 3B3AA 3NUGA 4GE3A 4WD3A 3H2BA 5SYNA 5TQVA 4EEKA 2IZ0A 4HAXA 4MUBA 4E1BA 1YIOA 3K9FC 4GX0A 5DASA 3P2KA 2WSSA 3U4GA 1HE1C 4IO1A 4FB4A 5F9FA 4DADA 2DT8A 3K1AB 3RSZA 3DE6X 2IQ5A 2RGGA 1E5DA 4P5EA 4Y2YA 2AEMA 4BN4A 3CRVA 4MLDA 3L9WA 2XQGA 4NABA 2XH8A 4RTQA 5CX1A 4ENUA 4AYTA 4BVAA 2ZJFA 4DSOA 5PNTA 3QH4A 1XTSA 1DDGA 1E2UA 5DBOA 3GH1A 4DGQA 2QTMA 2VG8A 3F3KA 2PSSA 4IDNA 3NAZA 3BG5A 5BN4B 2YJNA 4Z9AA 4EI9A 5A02A 1LRJA 1W25A 2VP3A 4WCFC 1PZNA 2OOKA 1ODSA 3EAFA 3EXFA 3FCYA 1I4TD 4U39A 4XASA 2GNOA 5FIUA 1UXGA 5FNVA 2FW8A 4FP9A 4EKIA 4YR9A 5JXIA 4J07A 1HOTA 3Q7PA 1HORA 3IVXA 3BORA 3DHYA 3WRWA 1JAYA 4FDVA 4MCIA 1WKCA 1E3IA 1DVRA 1TM4E 1XMVA 3IP7A 4BO8A 3SF8A 5FBQB 1M9NA 5I3ZA 2NXWA 1N6RA 3SZLA 3W1EA 4YECA 2QM0A 1ZKDA 4DR6B 4ABTA 3K73O 4FCVA 3Q3HA 1VP9A 3O4JA 3OCYA 1PJRA 1EGVB 1TK9A 3B53X 3EIEA 4I50A 5CVVA 3T0FA 4ZHQA 3K4QA 1FUKA 2OXTA 1XHFA 3FUCA 5COQA 2EC5A 1JG1A 1UMDB 4YDQA 2NO0A 2IY9A 1KS2A 2VPWA 3C3DA 3MVEA 4FOPA 4P93A 1T9HA 4TMTA 2CXHA 4TROA 2JS7A 3H9JA 2BTOA 3KYCB 4G37A 5M34A 4G09A 5EJ2A 1P74A 1R4MA 3CRNA 4I81A 1E2NA 4RHYA 5IBRA 1CQIA 1ULAA 3FYSA 3I28A 3IAM6 1CZNA 1GUBA 1RAHA 1P29A 4U7JA 4I1OA 3T7JA 1NF3A 1XKQA 1TM5E 5CDSA 1IL0A 1AK2A 3RUAA 4DCCA 1QGED 3QMVA 1E4EB 1K5HA 1KNQA 3N28A 2PLAA 4M8IA 2IS6A 3R6WA 1E5XA 3LQYA 4QO8A 4B7UA 3AVOA 4LVNA 2YQ4A 2W6ID 1X1QA 4LXQA 4HNSA 4ZD6A 4C05A 5DTQA 4XXHA 6ADHA 5JS1A 1GPMA 3NATA 4FYWA 1IZZA 1S5PA 1YIDA 2IJGX 4K9RA 5AK0A 5AM0A 3SI7A 3VTZA 4M8KA 3NJ8A 4F9FA 2D1YA 1ZA2A 2GM4A 4PYNA 1ZJ4A 4GPBA 2BGKA 1FNBA 3GLTA 2Y3IA 2PHZA 4TYYA 2NU7B 3EGDA 5K8CA 3DONA 5EFZA 2JCSA 3B1XA 2CXOA 1ADGA 3W78A 2BL4A 1A4IA 5F2KA 2HBRA 2RK3A 1UWLA 3NHZA 5CURA 1PS8A 4E4RA 1MRNA 3S27A 3LVQE 2GDZA 4C6HA 1O1YA 3UKOA 1BO6A 1N2JA 3OSZA 1M1NB 2C2KA 4W5JA 1KDTA 2LRHA 3GDGA 5LOVF 3W5HA 4NX2A 2ZAYA 1NP3A 2VDVE 2YHSA 3EXFB 1W4CA 3NHFA 3GLHB 1S9HA 2NZYA 5C1OA 1ULSA 4F8EA 1BA3A 1SIBE 4UU8A 2OMKA 2GRUA 3TW6A 4EENA 1DLIA 1Z4QA 7MDHA 3WLRA 5I01A 9MHTA 4IICA 1KR5A 1QZ3A 4U7DA 2WU4A 3AIKA 3H6KA 1O95D 3IRUA 4CRWB 1R0BA 3BMXA 3VVLA 1OFTA 1JMYA 2AL7A 1YZYA 4P36A 3RK4A 2ZBDA 1UEJA 2E7ZA 2PWBA 4DDUA 2FPLA 3ABQB 4IGIA 4O25A 3RF6A 4HWGA 1X19A 4I08A 3T1YB 5AVWA 2OLJA 1LPBB 1L5QA 2P40A 3BILA 3FUXA 4JXXA 4BDTA 1KPHA 3N76A 5FT9A 4IIHA 2GCIA 3WYFA 4OA5A 1TAQA 1QH8B 1ZJ6A 1G38A 1YHYA 3Q9NA 1Z7EA 2FQXA 2C5LA 3D0OA 3P52A 3DE5X 3I09A 3MJCA 4QDOA 5C4IA 3KETA 3GL9A 4ZU6X 1D3AA 3CGWA 3V55A 3DYVA 2EYUA 1DRUA 4U9UA 2R1VA 1E5LA 1X7XA 2WVGA 1V47A 4H17A 4HZGA 4QAQA 4Y2QA 3ZU2A 1MTZA 1A95A 3DEAA 4IL5A 1W7AA 3WHIA 1S3SA 3D6JA 3R7LA 3DAYA 1MGPA 1RW4A 1PLLA 3D6VA 3TW8A 3SJZA 4JLUA 5B4VA 4UCQA 2BFFA 2R68A 2X3UA 4LGYA 2WJ6A 4D4MA 4FHFA 1BVHA 4IAOA 5L3SB 1T36B 2ST1A 1U0LA 1X8XA 2VK4A 3HL4A 2QPTA 4WASA 2ZVDA 2ZRPA 1FOEB 2A88A 4M2LA 1U0BB 3M1YA 2HB6A 4ZEMA 4YJFA 2QUHA 4RMIA 3VOSA 4LYJA 1Q95A 4CT0A 3M4YA 5JYCA 4Z4HA 3QTLA 2JARA 5AJXA 1UT6A 4JR2A 4C4OA 3PXDA 1QYIA 1BN7A 4GR9A 4D43A 2G4LA 2K5UA 4URWR 4EA7A 1CY0A 3JAKA 1I0ZA 3PLNA 1JU4A 1O6CA 4UTZA 5FTKA 1UWKA 3ZK9A 1PT6A 4X97A 3OX3A 1CRQA 4FTWA 3HGMA 3JZFA 1O3YA 2C7BA 2GNPA 3KEQA 5HS4A 2W6CX 2HYDA 4F84A 1QHHB 2C7PA 2JKVA 4ZZIA 1KK3A 3PFHA 2EZUA 2NAFA 4LJKA 4MUGA 3MB5A 4PGMA 3I05A 4FFNA 4H77A 4L02A 5ALUA 3T54A 4CG1A 2QUBA 2XADA 1DBIA 2VXCA 4ERXA 4I66A 4JFRA 2JNWA 5K3OA 4OV6B 1YWGO 1ML3A 3HDYA 1V3VA 2ZUBA 4J3JA 2IYTA 5EERA 5CVJA 1WY7A 1O6GA 3MQFA 4WHMA 3WHKA 3HI6A 1L8XA 5FOXA 2J45A 1DCKA 2XE4A 1XA4A 1Z5VA 1CX9B 1OYVA 2OC9A 4HY3A 3T7KA 1XTIA 4BBPA 4WNAB 1MX1A 4FZ5A 5GY7A 3TQQA 1CUJA 4BQFA 2D1FA 1AK1A 4J1TA 3Q7EA 1PR3A 4YUWA 1EUCA 2FSSA 3BXPA 4YMVA 5EOVA 2PYZA 2H07A 3WHPA 5JD5A 1NWCA 3PSHA 1TVMA 2AXQA 1MNQA 5IJ0B 1RM0A 4GLFA 2DSNA 1S3IA 4L8YA 2QN9A 3TNYA 4HS4A 3O9ZA 1CVIA 2N3ZA 2DUUA 4M21A 4QX6A 4CF3A 1OKKA 4J7CA 2PKWA 3LWDA 2EJCA 1J5EB 1B23P 2D0OB 2PT5A 4ONEA 5TPWB 2EKBA 5DTEA 4H7PA 1IY2A 4BMXA 4D3ZA 2H57A 1C0EA 4DEXA 4BEWA 1R0XA 3M1AA 3ZHRA 4R1NA 4UFNA 3TW8B 3T5AA 4HGQA 1Y82A 3IUYA 5BRJA 1T1SA 1VPLA 3RVDA 1SRRA 1W5EA 3AVQA 3PR2B 1K0FA 4DV6B 2RE8A 1XRQA 4RCYA 3SVLA 5G4LA 1J23A 1JHRA 2B4TO 4D02A 4PSUA 1FJHA 1U8ZA 3MTAA 1L4UA 4Q0MA 4QQFA 2WE8A 1NT4A 5JAMA 5ILQA 2DHCA 4IRUB 2JIPA 2M32A 4I5GA 5FBZA 1GTJ1 4MUKA 4NDZA 2B2CA 3ET4A 4UTPA 2P79A 2UYQA 4BVLA 4QPZA 2SCUB 4AKTA 3EH2A 2BJVA 2Q29A 2JH9A 4NLLA 3HV2A 4UM8B 1WTCA 3L7DA 1UZAA 2I1LA 3LLCA 3BMNA 4QVKA 3EZNA 4XCXA 3RVSA 4AJPA 1M7BA 4I8IA 1S8NA 1IK6A 3OEED 4PYOA 2GHQA 3KT6A 1RADA 3RSQA 1L5NA 3L0PA 3R24A 1LTKA 3G8YA 3GPIA 3PEYA 4NOLA 3INTA 5ES4B 4KITB 1GO2A 4MR9B 4LTDA 2TMYA 4DT1B 5FAKA 3CE6A 2PD4A 4CN9A 1KBQA 4MR7B 3UBTA 3NTUA 4B4DA 3AKYA 2GTHA 1BZYA 3HWRA 4L4SA 2ZBFA 1M0EA 1H3EA 1W5FA 3HH8A 2PJUA 1JVBA 1ZLXA 4AYWA 1D0IA 5DBGA 4D9EA 4F2DA 3BIWA 3FVTA 4ND8A 3GJ6A 1WQ1R 1LS1A 3QFRA 1ZK2A 4YGYA 5GAJA 4YRJA 3D64A 1QQTA 3DE3X 2WICA 3G9QA 4Q5IA 5DN9A 1E79D 2VK2A 2A7QA 1ZX1A 3EMBA 1HWYA 1KH1A 4ARAA 2WWXA 5FLEX 1PR1A 2VDPB 4Q1CA 2WYOA 4RY9A 3WNCA 2PLWA 4L57A 1YDMA 1JLLA 4YACA 5E6SA 2G5TA 2JD0A 3UC9A 5DBHX 1G63A 2P9QA 4BBAA 2J46A 3IP1A 1JDSA 1S1MA 1TQ2A 3LOQA 3PDIA 3T6KA 2EHJA 2YDXA 3S2IA 5DB4A 3IR7A 4ZVPA 3OH8A 4TSKA 2QZ9A 2YYZA 2F9FA 3QJYA 4MLPA 4CM9A 3ZNNA 1BQEA 2GJSA 3GEMA 4NFSA 3AR3A 1SC1A 5IF3A 3CZMA 3D54D 3ZGZA 2XNJA 3EXAA 4UDXX 4BO4A 3CA8A 1ATZA 2Y05A 4KK3A 4Z9FA 4J6FA 4I8DA 3TCNA 5GP1A 4RZQA 2FTKE 5ALOA 2DVMA 2CVPA 1PJ3A 2XT0A 2ZYUX 3HFRA 3VZBA 3DWEX 1OFVA 3PK0A 5TSDA 3PFWO 3ZDXB 4CXMA 4EVQA 1ZBDA 4ZXPA 3KNZA 2FR0A 3HBAA 4BNVA 3WL4A 4JC0A 4S1WA 2R6HA 4JH0A 3SKVA 3W5SA 3OT4A 2MYNA 4G2TA 4LPSA 1FRNA 4OMFG 1FQOA 3DZGA 3BMNB 1IHUA 4PLZA 2BDTA 2Q3CA 1IIBA 3PX2A 1CY4A 2QAGB 5K3AA 4A0QA 4BFWA 2A0WA 2A5DA 1AGPA 5IM4F 1CZHA 1BKDR 2JLZA 1E58A 5DRYA 1LPMA 1QP7A 1GITA 4YP5A 1R2QA 1YBMA 2XTJA 4MYCA 1YB6A 5KYNA 1KMMA 1ZJWA 3VU8A 1K68A 1QFZA 1VGQA 3U13A 1SA0A 1VKJA 4KTVE 5BSWA 3HY3A 2VLBA 3QSYA 1GKYA 2H1IA 2Z8ZA 1S96A 5EIEA 1S4QA 1V11B 1UC5B 5GGYA 2PV7A 2P0AA 2PH5A 4MP3A 4CMIA 1YHZA 4ZVQA 4PX3A 4JLWA 2ASVA 2QK4A 2Z5FA 4C76A 4TQUS 1Z5ZA 1XNJA 3RVNA 4ALIA 4HD8A 3ID6C 2ZT8A 3BCUA 1R0YA 1AS3A 3H99A 4Y98A 4YRTA 2E6UX 4GX2A 3TCKA 4MPJA 3TSCA 4X6XA 4RD3A 4WXRA 3SC2A 4O3FA 4M0LA 4EJMA 3GGCA 1QO0D 2OCLA 3C87A 4ZIRA 2FP4A 2Q3LA 2PFKA 1F8FA 2H5IA 4EYEA 3LO8A 5IKOA 3MFQA 4EUSA 2OEPA 1N9GA 2ZRFA 3K9NA 3CLTD 4J0HA 5DYWA 2ZYTX 4C5CA 5HM6A 1XWWA 2VJOA 1AGYA 4RD2A 3ZCPA 5CFQA 4BEJA 2GN4A 4LV5B 4PZAA 4QQNA 3QU5A 4JEHA 4BVGA 5JCXA 4GP7A 1ZSVA 3G2KA 5DNDA 1M6EX 2EZ8A 2W2NA 2ZJ3A 1GSIA 1J42A 2XNDA 3O0DA 4ZGWA 3VU0A 2FFJA 1N2SA 3JALA 5LP6F 1Z37A 1RAGA 3GZNB 4X1KB 1LU9A 2C2XA 5BSUA 3K32A 4JL8A 2ZCVA 4NJMB 2I29A 4Q39A 2DFTA 4N0MA 5BWLA 4D4KA 1IULA 1J8FA 4PPNA 2OO5C 4G4IA 1Z4JA 2IEAA 4B6FA 3TN7A 1EXVA 3FB4A 5BSEA 3BE5A 3KVVA 3AUKA 4WKNA 3L7AA 5FUVA 2ZUFA 3DS8A 3NALA 1NF8A 3IAXA 1A71A 3DZKA 3DGEC 4W5RA 3G02A 2W37A 3A3OA 4G97A 5KOHA 1FU8A 2YCLA 2ZAGA 3U1VA 1ORVA 1I6MA 4WK6A 4HDKA 3RIEA 2C98A 3TUJC 3WK4A 4TYNA 4R68A 4A1FA 1QE5A 2XITA 1DXQA 4Y2HA 1NFRA 4AJLA 4HUTA 1P7WA 4NEGA 4OLHA 4FE4A 4X64B 5CB8A 1E9VA 3WXBA 4RJLA 2DFPA 4MVYA 5T64A 4JOSA 2ZCJA 2V98A 1QLJA 2GN8A 2HWXA 3DB2A 1W9HA 4X45A 4XGRA 4JA0A 2ATXA 4KCGA 4Y7DA 4IQ4A 3T9CA 2XKJE 3LCMA 3UICA 2CNDA 2RHBA 4L8FA 1NATA 4MWDA 4OQNA 3KPVA 1MBZA 3OZVA 3E81A 4IV5A 2HU8A 4JBIA 4LNAA 4U00A 3KXDA 1QQBA 5CT4A 1MOZA 2W0MA 4TT3A 4YCNA 1GTZA 2VAXA 3B38A 3QYJA 1DUSA 2OFXA 3ORRA 3USCS 3ZZUA 2VAMA 3IKLA 3SC2B 1RWVA 2D2VA 2PGLA 5SICE 3LFHA 4UD2A 1DKRA 3QVWA 4CM8B 4L75A 4ZZ2A 5EA2A 1L7AA 1XCLA 1YR7A 3N2KB 1QK5A 2FVYA 3L46A 2G04A 2JFHA 1G17A 3DMYA 4LC0A 5IJAA 1L9XA 1BMFA 3H97A 2V3CC 3MT0A 1M2WA 5GPBA 1RLJA 2X9NA 4YMIA 1E6EA 1GDHA 4M9CA 5FBKA 3VVMA 3BCRA 2RK6A 1B14A 3OEHA 1C80A 4OUDB 3NWOA 4ZVSA 3MWDA 3ZI4A 3UFXB 4AXBA 3W3AD 4NMHA 1WV0A 4I50B 3DBIA 1NVWQ 2O7QA 3CCFA 4O4JA 2ECPA 2QXYA 3C6MA 3OJFA 3CB4A 4TV9F 3ASVA 5CLQA 3LGAA 4Z1OA 3H4MA 2ZVQX 3UV6A 2UYGA 4DIBA 1HE3A 1B0PA 1H23A 3C0KA 3FNGA 1SXPA 1F38A 2XQKA 3DP7A 4YMLA 5JSFA 3QFHA 1E62A 3NTLA 2NXJA 4FCWA 4O4IB 4F3KA 3AC0A 2OY0A 4UXIA 4PLTA 2JIZD 3GLFE 4NCKA 4YIKA 3F9IA 2HPHA 4ARCA 1D0SA 3DBRA 2P0EA 3M3HA 4QGFA 2QM7A 4HLCA 4QQRA 2CEKA 4IILA 1KO1A 2PX6A 4OLBA 3IEUA 5DX0A 2OL4A 1Q7EA 2G9RA 2J3LA 1D2HA 3VX4A 1Y3HA 3KXPA 2UXCB 4RE6A 4KBFA 1O97D 2WUVA 1IQPA 1N0WA 2FEKA 1XXHE 2FPUA 2WEKA 1CJSA 4RVDA 5KTPA 2ZI5A 4W5HA 3WSWA 4DQDA 4L4ZA 2A67A 2O3TA 2PCLA 4YRMA 4WPGA 2C7RA 5P8WA 2IGTA 3E3MA 3JQQA 2FWJA 4U7GA 1TKRA 4LOAA 1WXHA 4HSGA 2I9KA 2Z3WA 2XMGA 1FP7A 1N2ZA 2BW0A 2VJKA 5CVDA 4YMWA 4KVZA 5FYQA 3T3EA 4BZQA 3KQLA 4EA6A 2MSNA 2XD4A 3DV0A 4TV9A 1ZUNB 1EZ1A 1KJIA 2DT5A 1KKUA 4FCCA 3USES 2B98A 5JTTA 4RV5A 1K7YA 3FFBA 3NIWA 5IFKA 3P9PA 1I1NA 3PLAE 5BW6B 1FYVA 5EIFA 4YAEA 3PGVA 2Z1MA 2PVPA 5F35A 1U7HA 1WMEA 1LX7A 4NFYA 4ZCMA 1W9MA 1ZN8A 1LW6E 3GJSA 4ALKA 5F21A 2XKBA 2UKDA 3F47A 4B35A 2WYUA 4GGMX 4WGFA 1SCBA 3C98A 4ZREA 2RGEA 4EA9A 1ISSA 1KMQA 3SAJA 3F46A 1U1FA 1I6KA 3N8GA 4EJFA 1FNDA 2ZB2A 3DM5A 4JROA 3LVBA 5BV8A 2FN7A 1E2QA 3GLVA 1XRLA 3IPYA 1YB7A 3PC4A 3IX7A 2J08A 3RK0A 3CTMA 4OHBA 3GLFB 1UM8A 4NCXA 2F3PA 4K2AA 1GJRA 3GYGA 4FFBB 4AROA 1GNLA 2N46A 5MF6A 1OWNA 1VLQA 1YRBA 3TJMA 4PLGA 4R8LA 3F97A 1UKCA 2ZTHA 2WUWE 4XX0B 4L16A 2EVWX 1UZLA 5CRIA 4AMVA 1Z5NA 6Q21A 3PR1A 5B5SA 4QUJA 4J1NA 4D0RA 4G4SO 5JNWA 4W8OA 3P9NA 1V16A 1KH2A 1E5QA 2J3QA 2RH8A 1W2HA 5KJCA 5EZSA 2AA3A 1XC7A 3I1IA 1KEEB 4WZBE 3IDQA 3JD4A 1XFAA 2RCYA 4MVJH 1BEZA 1SFRA 5AICA 3G0HA 1SBCA 4I7EA 4IJQA 4ZI5A 2IEGA 3REGA 3UA3A 2W6QA 2VYFA 3WFJA 4TYWA 2GKSA 1FVXA 2E4YA 5EIBD 2YUTA 5K0NA 4LX0A 3TW0A 3HR7A 2WFLB 3CZPA 3DAGA 3L7BA 3O8QA 4MGHA 1E3SA 4YJ3B 3QV2A 1VG0B 4N4AA 3M4XA 1SU7A 2I3AA 4QNMA 5FI3A 3M9XA 4CLDA 3NNSA 4DIDA 3FR8A 3QBDA 4O2BB 4R0VA 1T2AA 2EU8A 1C7IA 1TPYA 5TIIA 1Q7GA 3OKAA 5B4UA 1KTIA 4AKHA 2WQ7A 1SUPA 1UFVA 2IXAA 5K8LA 1M1UA 2YNMC 1J8MF 2O6HA 3HCCA 1EB8A 1SUEA 4R2KA 2LCQA 3KQWA 3O6VA 4O4LF 4LXYA 5DIFA 4ZV9A 4WACA 4TT8A 2CB0A 3CX4A 5JNUA 1UQTA 3FZNA 1H85A 1DKLA 4PZLA 1P2FA 3OE7D 1XMPA 1K8YB 1Y33E 2C97A 4YMSA 5AOCA 4M38A 4QJBA 1YE3A 2HF2A 1ODCA 2AZTA 2Z04A 1SC9A 2P2ZA 1VLJA 2FZEA 4WKBA 3ACDA 1HT0A 1PUXA 4FFPA 4L95C 4WKGA 4AT1A 3ICOA 4HFNA 2Y68A 4HNGA 5HCIA 1E7MA 3WWYA 4XJSA 2Q6OA 1CK4A 2VF8A 4X6YA 4F97A 1U90A 2I9PA 3G17A 4LXGA 4H6VA 4BQQA 2HTEA 1S4MA 2BP7A 2ZIGA 1R88A 4O6VA 5BPFA 2JHPA 4KRGA 4PC6A 4V1CB 1DFHA 2B34A 3CNEA 2EKPA 3PIIA 1FS6A 3DZFA 1RZ3A 3U3MA 1ZUD1 3KC2A 3AUTA 1RWNA 4PSAA 4DIFA 1AQIA 4E6PA 4UEKA 4FEEA 5CFMA 3BFJA 5K4AA 3A2LA 4ZK2A 1G0NA 3F4BA 5DK4A 1JDZA 2VK1A 3DAHA 1F7VA 1EBFA 5I5GA 2WD8A 1NW4A 2AXEA 3LDFA 3GJ5A 4OHWA 4F2WA 2F17A 3V48A 4XVCA 3KD2A 4FDUA 4URFA 4EI7A 1IN7A 1GPYA 4CW7A 5IK2A 2YOHA 3SE7A 1YL6A 2JBWA 4I1VA 3ZY6A 4IIJA 4YR7A 4XRRA 5FI1B 1E1YA 3NIFB 2FWMX 1XVAA 1NYRA 2VSYA 5FF9A 4BJHB 5IARA 3RT9A 2DWUA 4IVNA 4A0FA 2I33A 3KKNA 3O95A 4I1SA 1GLNA 3QFSA 4DCTA 4HG2A 1ZH4A 3R5XA 2Y0DA 4OKSA 4V1CI 4PCAA 5KWEA 3KYIB 2B7LA 1EHYA 1F5SA 4WY5A 3VYTB 1QRDA 4YWHA 5CDUA 3AK4A 5K2OA 1WB9A 1M2GA 2LPMA 2H85A 1GU1A 4IEFB 1J0XO 3HRIA 4JUBA 4D96A 3QWBA 2X5NA 4TKVA 3QI7A 5AW6A 3NRBA 4QOSA 4ZI3A 4UHJA 3BKXA 3PJEA 2XF2A 1I36A 2JIMA 1PNOA 1TIKA 2FHSA 1GQFA 1XG5A 5HCUA 5KHLB 5IYZB 1JR3A 3UATA 4A03A 1MAAA 3AHGA 2IH4A 2VQ3A 1O5OA 4GQAA 5JMPA 2IEBA 5I7WA 3I92A 3TZLA 4F6RB 1HE8B 2F3TA 3ZNOA 2WHYA 2A3RA 4W8GA 3HXLA 5L3QA 4OHYA 3X1DA 1WMAA 3U44A 2IE8A 5GMOA 4L5YA 1B7GO 3OZDA 3R3UA 4LK3A 4R7TA 3OLXA 1SG6A 5BPHA 3I2HA 4FDAA 3THXA 2H2FA 2R6JA 2OAGA 2WIDA 5IDVA 1XB2A 4UUPA 3VZQA 3DQZA 5LKAA 1XAGA 1M2OA 1VB5A 3MN1A 1VKNA 1QF9A 5ELMA 1N9ZA 3LKZA 1T1IA 4XUDA 1WEKA 4B3TB 4YP6A 5D1NA 3K8OE 1KFJB 3AM1A 2G76A 1C30B 2HA3A 5A5GA 2HA6A 3ZBTA 1LJLA 4XM2A 4LISA 3QXXA 1LZKA 2FETA 4LNUA 4JB8A 4OB8A 4QYXA 4F8JA 5EJ6A 3PI6A 1CF4A 1NU8A 5U4XA 3E6AA 2FFAA 1SQGA 1AG9A 3NV7A 3PVSA 3V8QA 5J1TB 2JK0A 2Y2UA 5TQ0A 1SU4A 3P7MA 3HGQA 1FJGB 1GL6A 1V8BA 2HK9A 1CYEA 5CAEB 4C4PA 1WETA 2N0SA 1ZVQA 4PRLA 3I39X 1ZXBA 2C3YA 4GLBA 4LTMA 2NAPA 3L7NA 4FX5A 2YVKA 3MLAA 5C7LO 4EGCB 4QOGA 1UH5A 3I2JA 5AI8A 2Q5FA 2X3FA 2Z8YM 4DSZA 4BKOA 1NLFA 3VYUB 1XT6A 1OROA 2FUCA 4FR2A 2HU2A 4B82A 4RV4A 1PJAA 2BGLA 1X15A 1ZHFA 2JAHA 2IHVA 5F2OA 2OFOA 1P0PA 3GVPA 3HB7A 4GKVA 4KI7A 4JNCA 5BSTA 2IZOA 1MC5A 3PNSA 4ZQBA 4F4FA 3QLUA 1EK2A 1HDOA 4IDGA 4L76A 1SC6A 3WL8A 2OORA 3G2MA 1L8LA 1CSEE 1DGQA 3FCXA 1ZH6A 1JYFA 1ODJA 1TTHA 1V8ZA 3HM2A 1LDNA 1OAKA 4JODA 2I5PO 2ZTMA 2PT9A 4ZQCB 4EABA 5IYZA 2BGRA 3NVKI 1B0UA 4JP8A 3HZZA 3JARB 1CBUA 1VLLA 3L93A 2WJZB 4ZO4A 5FUXA 1W87A 2QLTA 1M74A 4I4TA 1AURA 1GRRA 4OK6A 1E2BA 2KPOA 4F2HA 2O2XA 2V0GA 2HTFA 1A7UA 1PD1A 4D9HA 5CG1A 1NA5A 2XVMA 4L9SA 1ZRNA 3MS7A 4R69A 4G8BA 1XHLA 1EIWA 5EWJA 3E0QA 4HDMB 1GG8A 5KVSA 1U6KA 3GPDG 5TMBA 4GZLA 2AQKA 2FGKA 3SYLA 1VMKA 1XP8A 3EEYA 3WJ7A 5JPDA 3D3EA 1GY8A 5EMLA 4LRUA 3VNVA 3E2MA 4AXXA 2HI0A 3PXXA 1ZMOA 2NIPA 4MIYA 1PWEA 2RIRA 5EVCA 3ROEA 4X8LA 4EZIA 2BI4A 2GMWA 1A9TA 2JFZA 4XR4A 3ZHVA 3RKSA 3WGNA 5JZSA 3EQ6A 4KFCA 1PSDA 1YE5A 4PZEA 3PCRB 4ZHQF 3A6DA 4XE5A 1QIFA 4H31A 4Q3BA 3W3AH 2W6IA 2J0EA 2CWDA 2D74A 4G5SA 4UJ3A 2MR6A 3FM9A 2R7LA 4EPTA 2JEYA 2C00A 4K9PA 2PX8A 3MWKA 1ISGA 3GDFA 1N6NA 4DQLA 3TF5A 1VG8A 2O1XA 1G21E 3JZMA 4Z3DA 4C87A 1HX7A 3RU2A 2C1XA 3K30A 4G0XA 4AZ3B 2QY6A 2FPIA 3L0BA 1I2CA 3P96A 4QULA 1NPDA 1U2DC 1BE6A 1GKUB 2ZSAA 3R41A 5AW9A 1YJBA 2XQFA 1Y0BA 1VLMA 3BHJA 3DPIA 2VQSA 1OXKB 2ZVJA 5CNKA 1OCEA 3AHHA 1M5TA 3CBGA 3PFKA 1CTQA 3TQTA 3EX7C 1FZQA 3IESA 1G8KA 2H1HA 4J8PA 3EG9A 1UPAA 4JA2A 3VZSA 3WZMA 1I4DD 1C4WA 1ZRHA 4QRIA 1I10A 2WWIA 2XE7A 4CLEA 2NXEA 1B26A 2VDWB 4TXHA 1RT9A 5T6MA 4GW3A 5KNBA 2OENG 4D97A 3QX3A 1YT5A 4MQ4A 3AESA 4NXNB 4HNRA 4W8HA 4ZVRA 3T4EA 3KPYA 5DTMA 4EVSA 1FDIA 4REQA 1DCTA 3SEAA 2C82A 1KQ3A 1A5SB 3IE2A 2O8CA 2RAVA 3IAFA 3ONVA 4JUDX 2V7UA 2DHQA 1S9DA 3M8KA 3L7OA 1I9GA 2G9NA 4DV1B 3ICWA 2JKZA 1QX4A 1C14A 1NDQA 2WG0A 4PZUA 2PCJA 2J3JA 1ADFA 1I6LA 3IPAA 4IQGA 4W5QA 2RHRA 4PZDA 1ZVKA 1JL3A 4QXOA 1JSCA 1P19A 3A6ZA 4QFBA 2NO5A 1JXQA 1Z2CA 2ECOA 4XM0A 2Q6IA 5TJ9A 4G5OA 4LJSA 2YS7A 4G5YA 1BXGB 5K0EA 2YV1A 3JQFA 2VFAA 3OF3A 4KWEA 2RAFA 1N57A 2RBEA 1H8HD 1YDEA 3GJ7A 4XJVA 4BGEA 4FGWA 4TRMA 2XT9A 3QEOA 4RKWA 3B1JA 3K0FB 2IOQA 3GEEA 2DEUA 2Q49A 4JXZA 4ZQFA 1P4JA 2P3QA 2H4JA 1RNLA 3PL5A 2GX6A 4GD3Q 1BXZA 4KRXA 4X41A 3VKUA 5LMUB 5ENZA 4HN4B 7ABPA 3JYHA 1UZNA 1NVFA 1UBOS 1ZSNA 2WKWA 3EC7A 4ADSG 3R7FA 1J0BA 3EUWA 3LT2A 3OZRA 3SDSA 1DBSA 2WJ4A 1O87A 2DFKB 4GBGA 1NNUA 2O2ZA 1W0JD 4LKRA 3E0XA 1GPUA 5DHQA 5K3CA 3VSDA 2TMGA 4RMJA 1T8YA 1YB5A 1QK3A 4IGKA 1WB5A 4V2IA 4BKQA 2REQA 4FILA 3KQVA 4DZRA 1SXJE 3FDZA 5A71A 4RTPA 2VSQA 1PJ2A 4HX9A 4ZTZB 5CCXA 3NBYC 3D4BA 1TTQB 3NPAA 4R1TA 3C3EA 2PXAA 2Z98A 1NRIA 3U37A 3LNTA 3HKCB 4LQDA 2F4NA 4WZZA 5KYUA 1EMDA 4ZT3A 1SN7A 1BH2A 4P0PB 3BSWA 1MH1A 2Z9BA 2PU5A 2A4MA 3DKRA 3A1CA 3LH5A 1LBQA 3FHTA 3P0JA 1Z22A 4DB2A 1Y1SA 4K86A 5F4ZA 4L78A 1RPAA 4EP1A 1ZITA 1THZA 2P9JA 3L41A 2O8CB 4LSMA 3GGOA 4KKXB 4D81A 5B55A 1Q19A 2I3DA 3KJZA 3LX5A 2DFNA 2IXFA 4NYJQ 1XMQB 3QF4A 1IJKA 2XAUA 1GEGA 5CJJA 3JQRA 2QD5A 1AKEA 2CNWD 1XRRA 1XEWY 3JAWA 3KAKA 3KS9A 3LIIA 1DUVG 3AI7A 5DI3B 1SBTA 2D3TA 2BBWA 4PSVA 1X1DA 1AA9A 2J5RA 2Z8YA 3N07A 4HF7A 4KK4A 3SR4A 4AKEA 4QC2A 2BI7A 3PUJA 1TAHA 1HTTA 2DRIA 3BX1A 3EA0A 3KP1A 3N0RA 5JSQA 3OQMA 3Q8MA 4NCJA 3CT6A 3IO3A 4II7A 1E9BA 1K4KA 3MZ0A 4J90A 1RJ9B 1P77A 5FUMA 3FTNA 1FFXA 5AD1A 3EN0A 1DIHA 4PHCA 1O7JA 3UGQA 4BU0A 4XVUA 2W22A 4QNNA 1IQUA 2I87A 1XLTC 2ZE5A 3CF6R 1YCHA 2J0VA 3G0IA 3AVYA 1UPCA 1NR7A 4OHMA 3D3WA 4RTOA 3PXEA 4OBEA 1MJHA 2BHTA 3LFTA 1WCIB 2CVOA 3NNNA 5J2UA 3GFTA 2WZQA 4TLLB 1EM6A 3K7EA 4EL5A 3HHEA 2RKBA 3O82A 3GJYA 1YMVA 3A70A 1TKBA 1IMJA 2R8RA 3L18A 4P3NA 5AJZA 4UVGA 1A4XA 1H2AS 5HFAA 2HT6A 7ADHA 2DUNA 2HM7A 5TRTA 2OP0A 2FSPA 2WTXA 3D5QA 3PRKE 2P9GA 1Q1GA 1WOYA 1RQLA 3EXG1 4A91A 1PCXA 4NBWA 2CV1A 3ISTA 3ZXXA 5F1KA 1D03A 4F3RA 5KDOA 3HMQA 3DL4A 2WDZA 1M75A 1CY1A 1MD9A 4RABA 1WD7A 1U7ZA 2OBFA 4HQOA 2QVBA 2ZRAA 1JDNA 1YC2A 5B1HA 2DC1A 2XCRB 1QRSA 1N2BA 1UPTA 2VZ8A 2P35A 2E4WA 1OYOA 3LPCA 2Q5QA 1U9CA 3C74A 3I8OA 2C59A 3O8CA 4FKMA 4N3CA 2GCOA 4HPJB 7GPBA 3CVYA 2PUCA 1EFAA 4L8LA 1JKJB 2QGFA 3LJKA 5AUOB 3MHTA 3QK7A 3OI7A 5KYVA 3GN2A 3H1TA 5CA0B 1YA6A 2G9VA 4YJGA 3TFWA 1T9AA 3B7GA 4KRFA 1Z0DA 1ACJA 1P5JA 4IF6A 4LRTB 5CNIA 3B6IA 5IVIA 3R20A 4X3OA 1BKSB 3VKHA 3NBMA 2V4UA 2IE0A 4A8JB 4NL4H 1OFHA 1WNTA 2AUMA 1N32B 1GUFA 2BFDA 2PYIA 3HB5X 3EPLA 3P0HA 3OJLA 2Z6UA 1F6BA 1PG5A 2B35A 5ALDA 3ULKA 4AMUA 4N6GA 3RH0A 3VQTA 3WLAA 3MSCA 1KSGA 5JAHA 2VPTA 3IAAA 1RXCA 3O3MB 2EATA 4INPA 4JUCA 4L9AA 3E1GA 2Q5OA 4FJ1A 3EUFA 4U7PB 5DF1A 1I33A 3ZHZA 1NOIA 1FQWA 2JGDB 3C48A 1FFXB 3MTQA 1R0SA 1AQNA 4TWAA 1FU4A 2ZYGA 5DGXA 1GA4A 3VKVA 3D81A 1P2TA 1BWRA 1T1EA 2WJGA 2QRVB 2D0DA 2YIJA 1IPFA 1ICEA 5HILA 5A06A 2C5AA 4GNKA 3T1VA 1ENZA 3AI1A 1VIYA 3OOYA 1LBSA 3SKYA 3OA2A 4NFLA 3QBEA 5J2UB 2ADFA 1TGYA 3NHJA 3RTDA 1F3OA 3U3OA 4KQWA 4D4JA 3QPDA 4Q9LA 4ED9A 1YOVB 2YRFA 4K40A 1G6KA 5BQ3A 2NYRA 4NBNA 4OHRA 1PQUA 2FOLA 2AMVA 2JDIA 1OPRA 5MN4A 2OP1A 1E0KA 3ABIA 5LQSA 1MQ8B 3SZMA 3FGPA 3IQDB 2V0NA 4ZDIA 1NVXQ 2NW6A 1HZZC 1ECJA 4OF4A 4IFEA 2AN4A 3WDLA 2UZ4A 3TUZC 1AN9A 5AKXA 3TVTA 4QJIA 1B15A 1K98A 4AO7A 1W581 9ABPA 4DLPA 3GZJA 3U9TA 1FFSA 5EPEA 3R7SA 3DJYA 3S8YA 2NPOA 2O20A 2HCJB 5A4DA 3U16A 1NN1A 1SD5A 3OEYA 1Z4PX 1DPFA 2Z08A 3AETA 3H1GA 1SM4A 2H00A 1CNEA 4I5FA 4DDTA 4DCVA 5LMCA 4BQIA 3M4ZA 3OFND 4CUZA 1ZD8A 2ANCA 4D82A 5JC8A 1AB5A 3JS5A 1OX4B 4MUNA 4MKHA 5EIWA 5SZJA 4B4UA 1IN4A 1B6GA 2ARKA 3BGDA 3A6HA 2O48X 2QTVB 3HE3A 3IT3A 5E1MA 4ZCSA 2GXAA 1DC8A 3KXIA 4EYOA 4WKCA 5AHWA 2WHPA 4KGVA 2QP9X 4Q7MB 4TZ6A 2FKAA 1KAHA 4Q4AA 2QXTA 3S29A 2QTZA 3TJRA 1JG2A 2IH2A 3N0WA 3Q0IA 3TLJA 4R8VA 3RJMA 2ZULA 3WBFA 3BD7A 2FSUA 5AKKA 5KMGA 3V34A 2COEA 1YQXA 1VIDA 2IZ1A 2PXCA 3ELWA 1NMSA 3TRKA 2BTQA 3I45A 2ATEA 4GO1A 4MQMA 3UMCA 4ICIA 4PG8A 1UPXA 2ZTLA 3LLVA 3AOGA 4NPHA 4RPKA 2TRSB 3N6XA 5TVGA 3TM5A 3DZIA 3AZPA 3A9TA 3BEOA 2VIIA 3AEKB 3DV9A 1NLZA 5ISMA 1NONA 2X7JA 2ZIZA 1QHHA 3LPLA 4MV8A 3TMYA 1GR0A 1KO5A 3ESCA 5LA6F 2BY4A 4ALMA 3HXMA 1W52X 4N7RA 4M89A 3AR2A 1UADA 4XYGA 3U3KA 1EH5A 1G3IA 3OHMA 1E0SA 1HL3A 4OFXA 4RAOA 5DHFA 2EG5A 3U4IA 4OFBA 5BMVB 5LUBA 5JV5A 2R4QA 4TVBA 4DTIA 3V8PA 1V9LA 3IT1A 1USIA 2ZRHA 4GZMA 4WKOA 4GMKA 4QREA 3ZWQA 5BSGA 5I6DA 3HU1A 2EEZA 1KWGA 3KVRA 5GJVC 1DDOA 2ACKA 3TTWA 4GVPA 3F73A 1I2AA 1OC2A 2QX9A 3EWSA 2PKRA 1KFCB 4D92A 1NVAA 3VYWA 4KQIA 4F21A 1UPBA 1ZHHA 5AM3A 3AFMA 3BXZA 5SY4A 4HGZA 1XTRA 4B1FA 5B2FA 3SN6A 2R8PA 3FZEA 4DCGA 1DQNA 3ZDYB 1PUJA 1SVNA 1UK8A 2EGUA 1C8KA 3OT5A 4V38A 5M3BA 3V1MA 3VR1A 4JGBA 4JIMA 5HMMA 2C3PA 3V8MA 1X1CA 4JYMA 5E2IA 1NHGA 5AXBA 3MJSA 1GDDA 1P73A 2QV7A 2WV9A 3ACBA 3EGXB 3KDSE 2JGLA 3Q6IA 5IHPA 1EGHA 1PU2A 2D7JA 2X5JO 5HIKA 4RZ2A 1U2QA 4Y2VA 1NJ8A 3EK2A 1HYEA 3FI9A 4MDEA 4O63O 1ADYA 1Y8CA 3ZVMA 1RCTE 1AN0A 1NR5A 2IEDA 2XRMA 2V0CA 3AUJB 2DP4E 1K9SA 2GZRA 1VMIA 2ROQA 3QKIA 3IXLA 4EG3A 1SD1A 3GAZA 1LVUA 1I14A 1XJCA 3LWBA 3H2JA 5AVKA 5JWRA 4LRWA 5JYDA 5LKRA 4Z4EA 4DZZA 3LX6A 2BGUA 2O2IA 3WDSA 2WV7A 2ZANA 3KTOA 4P3XA 1WXDA 1JMVA 2OBLA 2SECE 3QX7A 3S55A 1XKLA 2BGGA 1UBRS 4MKXA 3BXHA 1C0IA 2PKQO 2Z09A 4P4SB 5JDCC 4TWRA 1WUYA 3FPBA 3LVRE