3ISVA

Crystal structure of glutamate racemase from listeria monocytogenes in complex with acetate ion
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
265
Chain Sequence
AMKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHNLLDATDEEEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glutamate racemase from Listeria monocytogenes in complex with acetate ion
rcsb
source organism Listeria monocytogenes
molecule tags Isomerase
molecule keywords Glutamate racemase
total genus 95
structure length 265
sequence length 266
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3isvA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3isvA01
2JFQA 2JFUA 1JFLA 1IU9A 2OHVA 2EQ5A 5EVCA 2OHGA 2JFYA 2W4IA 3ISTA 1ZUWA 2ZSKA 3OJCA 5ELMA 5HQTA 3S7ZA 2DX7A 2JFPA 5HJ7A 2JFWA 3UHOA 2JFVA 3ISVA 2GZMA 2OHOA 5HRAA 3OUTA 2JFNA 3UHPA 2VVTA 5ELLA 3S81A 3UHFA 2DGDA 4B1FA 2JFXA 2JFZA 5HRCA 2DWUA 3HFRA 2JFOA 5IJWA 1B74A 1B73A
chains in the Genus database with same CATH superfamily
4AS2A 2FOLA 3H19A 4CM9D 1GV0A 2P2LA 3ZK7A 1RC8A 3KB8A 2QRLA 3QKTA 1R3UA 1JQBA 2GNPA 1EFRA 2QX6A 1JUDA 4MWSA 5F73A 1QVRA 4GKJB 2YNMC 4XYLA 1GFZA 4JJGA 2BGJA 1EUDA 3RVQA 3A32A 2H2AA 4HQ0A 2R1TA 1EUDB 1J4AA 3C7DB 3BRWA 3COSA 5FHQA 4C1BA 1GTVA 4HBGA 1QJCA 4CT0A 2XTNA 3PDWA 4O4IB 6REQA 4BZPA 1NC1A 1YR9A 5AI5A 5C0OE 3UK7A 1GG2A 3KJHA 4BGEA 3SQXA 3JPWA 1ZVMA 2VJNA 2W2QA 3IULA 3TBFA 5DM70 2YFYA 1QGOA 2MSDB 3BFKA 4AIIA 4NESA 1P9WA 1KO1A 2RIPA 2CV0A 3K2IA 4N49A 4D3SA 3P9KA 3TUJC 4UAGA 3ZI7A 4TZKA 1IN1A 4E5UA 3CF6R 3HKCA 4JI7B 5DW0A 3CTPA 2EIHA 1ENZA 2D06A 2WSBA 5AW9A 4NZPA 2CXNA 4E5NA 1NLFA 4R8VA 4ND6A 3HKBA 4I1VA 2ECKA 1J8MF 5K99A 4BQEA 2WD7A 4YJHA 5IWCA 3G02A 1VKOA 3N2YA 4OHWA 3TIGA 1JJ7A 1KRXA 1QVWA 4LX8A 1D2RA 1V7PC 1NQOA 2AN3A 3DFMA 1X80A 1NHGA 2ZSFA 3B6MA 3HVJA 3ORSA 3AMVA 3RJTA 3ZGXA 1E79D 2A9KA 3ZVLA 4CQLA 1TMOA 3W5DA 3RAEC 4Y1FA 2FOXA 4UBKA 1I7LA 1N5OX 1YR8A 5T3YA 3VTAA 1WR8A 2QX9A 2O8NA 3G17A 3N05A 4LNUA 5JXGA 1VOTA 1ICEA 3E9QA 1RLOA 1GDTA 3SU8A 1NT2A 3V46A 2P5SA 4C7VA 4D9EA 1GUFA 4YX9A 1GZ5A 4ROTA 3UF0A 5B7GA 3GGCA 2OG1A 3RG8A 4CIWA 4RVOA 4EGFA 1BH6A 3O1JC 1EUYA 4NFSA 1E3WB 1QSGA 4ZMSA 5I5EA 5AHKA 2RG7A 5CNKA 2WZQA 2XUJA 2WIGA 3UHFA 3BUSA 5DBOA 2GERA 1YZNA 3KAJA 4F3TA 4X95A 1G19A 2O3JA 4TTPA 2G06A 2GKGA 2KPOA 4C4PA 1TEXA 3HP1A 1KDZA 2R79A 4JU9A 2GM4A 3A36A 4L5CA 3R44A 2O2HA 2JDID 4J90A 4TLDA 3CF2A 4TSFD 2R8PA 3LHKA 5J2UB 3I4FA 5CCBA 5DNCA 3KKMA 3HDTA 4OYLA 4ZPJA 4D79A 1Z2PX 5C35A 1OB2A 2IEZA 3RU3A 2WSIA 4KH1A 1QH0A 3CLVA 4BDTA 6AT1A 4X97A 1U63A 1QTIA 3M2TA 3SPXA 4V3BA 2F7SA 1BC5A 4R6WA 2O2EA 5LP6B 5CLGA 2CVOA 1MU0A 4TKVB 1XG5A 4YQZA 2AZ4A 1EVQA 1JSXA 2DJ5A 4BVGA 4DZTA 3Q2KA 4GP9A 2C3YA 1I5RA 4IKOA 5G1OA 1DCTA 4OGGA 2O5EA 1CDEA 1N5RA 3G5TA 4PNEA 1RE1A 1MVNA 4Y18A 1AQJA 2HWKA 5T4EA 3V9AA 5JCOC 2ZZNA 1E1YA 4LXQA 5ALYA 2K6GA 1XB2A 1QZXA 1ZM4A 1KFCB 2Z2ZA 3LJKA 3PNLA 3KQQA 4MRPA 1NVWQ 1PQWA 3RKSA 3FWHA 1H23A 1ULAA 1OROA 3WIBA 4WD3A 1YTUA 3LT2A 4H7FA 3MERA 2EKLA 1XK7A 4KQ6A 4QFMA 4RL6A 2I2AA 4O8ZA 4QDZA 1AKYA 4C4SA 3G2KA 1QTRA 4XLTA 3AYXB 1XXLA 1E98A 2NZ2A 1M1XB 3BK1A 4ZYYA 5EJ4A 4R31A 2C95A 3U56A 4BFVA 4M54A 2NUAB 2X5XA 5BR1A 1U3GA 1VL0A 1C3VA 3ORYA 2UZIR 4Y2XA 1DKOA 3TD6A 1DKRA 5HR5A 1A3CA 1USIA 1YHZA 4HLQB 3ESAA 3KWJA 4FJ0A 3WXBA 2BGWA 3WWCA 1KE2A 2YW2A 1JIUA 2WP0A 3A11A 2Y1LA 3GZTB 4FHGA 3PI6A 4GC5A 4HEQA 2CLEB 4LZWA 4C4ZA 5JZBA 3MRVA 3H5LA 3KLBA 5AKHA 3U49A 3H05A 4JJ8A 3JYOA 2EJBA 3MLAA 4X20A 2R44A 1L7DA 1ZIXA 3HVKA 2WAYA 3VGPA 1A5AB 1SA0B 4JLOA 2A84A 3A4LA 4HX9A 5ALUA 5G0TA 3M82A 1RQ2A 5I7FA 1QR2A 2FK7A 1RRCA 2HK7A 2OBLA 4AF8A 3X1XA 5ITVA 4TT8A 1ZD8A 2ONKA 1Y33E 2DCMA 2VSFA 1P1CA 3NFRA 4F5EA 3ZDBA 3UMGA 2NVUA 2NSDA 4D6YA 5BSTA 1XU7A 3THYB 1Y1RA 1IHPA 4UVDA 5M34A 4C6SA 4W5NA 1HMPA 1RNLA 3AL2A 4MRAA 3NAMA 5BV8A 3UKDA 1V16A 1FU4A 1BDJA 2VHVA 4B74A 4DPKA 2XE6A 1EVIA 3MT8A 4ZAVA 3FPCA 1ARZA 2P75A 3PQ6A 3KYDA 6ABPA 2NYRA 2KMLA 3MJSA 1C5KA 3OLWA 1OXBB 5EI5A 4QBHA 5ILOA 1YHNA 2FEWB 3IC5A 4PIVA 3IXLA 3P9QA 4GR9A 3CUVA 1E3TA 2BE9A 4L27A 4JI2B 2B1RA 2FMTA 2ECQA 1NATA 2SKDA 3KVNA 3OO0A 3T5BA 3ITNA 3MFQA 1WXWA 4CW7A 5BY2A 2CYBA 2J3DA 3PSHA 4P7KA 2YKGA 3BWBA 4GX1A 3O92A 1VRVA 4HH0A 2PEYA 2DF8A 1Z08A 4J7UA 3TBKA 3JR7A 3LQQA 2IYWA 2IHKA 3OQVA 1YZGA 3QUQA 5ICMA 2NZWA 3R0ZA 4JVLA 1D1QA 1KZHA 1BCRB 1K2VN 2XUAA 4BZQA 5L3QA 2VAVA 3WQBA 3RR2A 1GXSB 4C6HA 2V4MA 3R3SA 4LJ8A 5IVKA 5FFNA 1IUOA 3I2JA 4UUPA 2V7XA 2I55A 4K05A 2XLBA 2PMWB 4AUEA 2EBHX 1R6AA 4NXNB 2PMKA 1BHSA 2J9GA 3DF7A 4ZI2A 1A8PA 3DGEC 3A31A 2WJGA 1MBZA 4BBPA 4KIFA 1X7WA 3A1VA 3UCXA 1EDEA 5L3SB 5AR1A 5KJEA 4EYOA 5TGZA 1KJWA 1CY2A 3OM9A 4HPXB 1RFGE 3K35A 1UUFA 2VBFA 2JJ1A 2I22A 3DHVA 1P5ZB 2BEKA 1SRQA 3Q1KA 4Q93A 4AZ3A 4FB4A 4MVJD 1ZUIA 1IEWA 4OJTA 1JG2A 3UW1A 4B4OA 4IM7A 3Q41A 3FPGA 2AEMA 1DRUA 3BGOS 4PRLA 1DEKA 1FK8A 3ZCPA 2V7QA 3JQ7B 2PIDA 5BSGA 3VR5A 4PXSA 4D0SA 3E7PA 3AHDA 2AJ8A 3ND7A 1VI6A 2J3QA 3CF4G 2OO7A 2A0FA 2OO5A 1PR2A 1UJ4A 1WU8A 5I4CA 2GAFA 4NQZA 2GPTA 3GJZA 5JZSA 2CSXA 2VT6A 3KTAA 2HFKA 1VIDA 5GZ6A 1P6QA 2O3RA 4WK4B 2FMKA 1XDDA 3VZRA 4Q1FA 2FRDA 1DEOA 4MW7A 1G3RA 4N5LA 1ENOA 2EP8A 4HRYA 2ONCA 5BV7A 3AX6A 5IAAA 1QQBA 5LJLA 1QOZA 2H9YA 1MO5A 2Q4EA 3EMKA 4YAJA 1XDBA 5KOHB 1EFPA 1X1SA 2EG5A 5K8VA 3DB1A 1P1FA 3UH0A 4B40A 3G23A 2I7DA 2OO3A 1EUCA 1NIPA 3QTLA 1P6XA 5BN4A 4BNDA 5A62A 4KHPB 1IZ7A 1Q16A 3PDHA 4PZ0A 4RE6A 2Q5HA 4JI1B 1WXXA 2OQVA 1YAJA 3CJRA 4DOMA 3TRHA 4OXRA 2GAIA 3OT1A 1M1ZA 5KSPA 4HAYA 5HOQA 1G7TA 2IHVA 4K40A 1CZUA 1J6UA 1STOA 4R3NA 5EIBC 3K9WA 3BWEA 3CE9A 3PIRA 1Z5PA 4PANA 1PNQA 1VDMA 3NH6A 5B3AA 4BMVA 4IW3B 3MHTA 1JKIA 5E1DA 3C3BA 2V9CA 4MCJA 1ML3A 5ENVA 3V34A 1Z83A 3F7OA 4Q3AA 3GBVA 1FMLA 2XNJA 1L5RA 2D62A 3NU1A 4LHZA 1R0YA 5JFOA 3IUPA 3LOUA 4WERA 5J1TB 3DFFA 5I4IA 1E94E 1SPXA 2D7CA 2IA5A 4NC9A 3WGVA 4TTVA 3ZCUA 2B4KA 3O8DA 5GJWC 1IHUA 1H8ED 1ZH8A 3HADA 2CYCA 1AKTA 4U39A 3F8SA 5DGCA 1XZQA 4G8DA 5E0KB 3ANYB 5DT2A 3AH8A 2AXEA 2PJDA 2ZB8A 5EUBA 3W5HA 3PKJA 4TT3D 1HDEA 2C7PA 3L01A 3FMOB 1P4HA 1J09A 2WTAA 3N6XA 4KWCA 4MVJE 1OVGA 2JA2A 2ZB2A 1FLAA 2REXB 4FQ5A 3IEMA 4ND8B 5COAA 2XNKA 4XVQA 1SQ6A 4KREA 1ID8A 3G1UA 1UM9A 4B4UA 2WJIA 3BH6A 4II7A 2QTMA 3BMOA 3V5NA 5NLLA 4EYKA 4HUTA 3H6KA 5FB3A 2NXWA 3BWDD 1E77A 4AWBA 1WVIA 3IIMA 2R6ZA 2HU5A 4WUVA 4Q19A 3BXOA 4PRKA 1ZHOA 1ZQ1A 1P2TA 2VH1A 4CCWA 4PPFA 3B2EA 4TZTA 2AB0A 4OVKA 4ZRNA 2Q4DA 3NC4A 5LMCA 2X0FA 4IXTA 1T8YA 4RF3A 3WK8A 2FB9A 4BTLA 5JARA 4E3ZA 1U4NA 3JRWA 3NT2A 4G41A 3VKUA 4YMTA 1PJRA 2OFOA 4Q7KA 1K92A 1YR2A 1LA2A 3NEPX 3LWZA 3QVGA 621PA 3RWMB 1GCOA 3LKDA 5FOUA 4DIMA 1BGVA 1HZZC 1GDDA 3NBFA 3ZXSA 5BYKA 1HKHA 2ZI4A 4J0IA 4M99A 4M87A 4M49A 5JISA 4OKNA 4CE6A 2WSMA 4R2KA 2Z3ZA 3E5NA 1GAJA 2WLTA 3KCQA 2CV2A 1WX1A 2FCAA 2A3NA 2X9LA 3EZGA 2O06A 2BKAA 2P9TA 3OOHA 4LYFA 5KYGA 1EAYA 2G5TA 2P2CA 2FEOA 3AW9A 4DARA 1SIBE 1RPNA 1JH8A 2Z98A 2NPOA 1M2EA 4LDRA 2OC4A 4YP7A 1NBME 1UEJA 5AW1A 4CYMA 3DZKA 3RTAA 4BO1A 5AVVA 4FWBA 2RGCA 4UAUA 5D00A 1CJTC 1GZUA 2ZKIA 1THGA 1IOLA 4ZP1A 1JHQA 1FE8A 2GRUA 4CM4A 5L6LB 1LDYA 3TS1A 3SF8A 2YWXA 2AE1A 3BH0A 5T64A 3SHWA 4DA0A 2QT9A 4JI5B 2F62A 3HN2A 2WBLC 2Y0CA 1SVIA 4MH0R 2FR0A 1Y7HA 3GGJA 4HGRA 3UWMA 4AYTA 4B75A 2FRDC 4DC9A 4DUGA 2YHIB 1WBDA 2QTVB 3II6X 4FI3F 2XRFA 1CUIA 4Y6PA 1U9CA 4QHTA 1FX1A 1GYRA 5HEKA 2Q6TA 4OHVA 3VU9A 3HNPA 4N3AA 4Q7JB 2VRWA 1FPMA 4RPCA 3DDOA 4EI7A 2EJVA 1GA4A 2KQUA 5EJ8A 3VPSA 3WISA 4BQQA 3RT9A 2AG6A 2GFIA 5TQJA 4OUDB 5KMGA 3ENKA 3OE4A 1LDMA 3KQHA 1LK5A 2WJHA 4HQKA 4YAWA 1AGXA 4W1PA 5ERXA 3RIEA 3ZE6A 1BXKA 1C1YA 3UATA 3WGLA 3BM5A 1QF9A 4IR7A 1VLZA 4G9EA 4GPD1 1RRGA 1TRHA 3W1VA 2VDVE 4ZQCB 1C7RA 5JVDF 3DLBA 2WABA 1YOVA 1A88A 5DGTA 3CUTA 5FF9A 5KTOA 2IRWA 2C57A 1IMOA 4I99A 1QHGA 2VJKA 4EKIA 4HZUB 1QQ7A 1SXJE 4XR9A 4AMGA 2AQHA 1WMAA 4KR9A 4D57A 1BMDA 3BKXA 3ANLA 2O2JA 4EVQA 1NONA 4WBXC 3CVJA 4RH0A 2CC2A 3X1KA 5JD6A 2ZBRA 2EERA 1YI0A 1J7JA 5AJXA 1XAJA 4IRUB 5IZ4A 1WV1A 3DO8A 4G8CA 2BF4A 2F1HA 3PR1A 3E9CA 4HHEA 1HE1C 3ZWDA 4D1YA 2KE5A 1SQSA 5D6NA 5TJ9A 3OJWA 4EKGA 3RBZA 1JKJA 3UEOA 3RAFC 1E79A 2OOKA 2PNFA 1H2ZA 2W43A 4Q1CA 1CQJB 1YQGA 1I32A 2QYSA 1JDZA 2PVPA 2Y6UA 3BE5A 3VHXB 2P2ZA 4MVJI 4DKXA 4R1PA 3SJBA 1QKJA 3C5CA 4DM7A 2I3DA 3OX3A 1TEZA 3RVNA 1AMNA 4NTZA 4EEZA 2FE1A 3P32A 2UZAA 3BN3A 3NT5A 3KVYA 5FT9A 5AM4A 2B5WA 1EINA 1B3RA 1OX4A 4LXXA 1UOEA 4IIYA 3DTVD 4KPYA 3H8VA 3GJQA 3CR3C 2VQEB 4YJ2B 3ZCVA 1JN0A 4WZ6A 4C0SA 1A9OA 3WADA 1QG4A 4P92A 1J24A 1Z25A 4CV1A 3UY4A 3W7BA 3SLGA 3RS3A 1L8AA 3N0XA 2HD4A 3P4XA 4FHFA 1EP9A 4IY1A 1T4GA 2E7ZA 5D6OA 3G0GA 4C4RA 3WKAA 4D92A 4DLBA 1FDWA 1X0VA 2EEZA 1O6GA 3AEKA 4OXKA 4LI0A 5DP2A 3FUWA 1MOZA 2QE7A 3NVMB 3ZEIA 4PNPA 2EX0A 2Z8XA 3QTTA 5GAJA 4KQFA 3TR6A 3WYNA 1EQAA 4WN9A 1NQUA 4E5SA 5HQ3A 1ORHA 2BFDB 1QIMA 4Z1MA 2P7HA 4N5MA 2IYUA 5C1OA 1DFHA 1W9HA 4ZEMA 1CY6A 3B51X 1UT8A 4D3DA 4GEKA 3QGMA 1L5MA 4BLOA 1YMUA 4PNHA 1A7JA 3PRKE 2FZEA 4L5IA 1RW4A 4GUDA 4L85A 3ETHA 3A4TA 4NMMA 1V37A 1C2TA 1NY6A 3S40A 2AUNA 2BM8A 4J9UE 4O4HB 1O6CA 1PW7A 3CWCA 1M2WA 2VJOA 4ILEA 4PLCA 1E9RA 3D8RA 4OGKA 4DS3A 1H05A 3FNBA 1YRWA 1JG3A 3L7LA 1CJCA 5LP1A 4LCBA 1KDVA 5K4AA 4MR7A 3SDSA 3D8SA 3VBEA 4KDRA 1J33A 1JIIA 2GHIA 3B6EA 1XL1A 4NG4A 4UNQA 4JFAA 1UBFA 2XDQB 3CSUA 4Q9LA 4EHKA 3SM9A 5CH8A 3RW9A 2PJZA 3SGLA 3O1IC 3ZWWA 2ZUFA 4K0RA 2J85A 1CTQA 5CFRA 3V8VA 4PS1A 2FUG1 1O5OA 2HJRA 4XPIB 5TV2A 1BMFA 1KEKA 3QHQA 3W4JA 1Z7WA 2WZCA 4GYWA 4ZVOA 1Z6AA 1B73A 2EF0A 2WNSA 2WYHA 1UK9A 4UASA 3HY3A 4ZIRA 2FSVC 2XA9A 1YASA 3ZZTA 5A6VA 3NBZC 2EFYA 1V7ZA 4B81A 2PH5A 1P91A 1XHLA 2QRZA 2H2WA 4YWJA 3ZU3A 1T6XA 1I3OA 2H85A 2R25B 5JNSA 2CFIA 1ISFA 3HXQA 5EHGA 1EE2A 4R54A 4AX8A 5AW6A 1Y6RA 5AW0A 1WETA 3CEMA 4QU0A 3S5UA 1U3CA 2RH4A 1PJ4A 3NOOA 3GQBA 2Z9DA 4UPVA 4LZZA 4YALA 5GGYA 2FQWA 2J5XA 1PJ3A 3CCFA 3ESQA 3GRUA 2MT9A 3CWZA 3NQ41 5HKAA 5MN6A 1TYEB 1HYBA 3N87A 3Q3VA 1JH9A 3AFNA 1GGJA 4YP0A 4LOHA 2B7LA 2FPSA 2A4KA 3BB4A 1HTTA 3C3EA 2ZIAA 1WDMA 3IOMA 4B3GA 4X9XA 4Z0HO 3Q0EA 1XF1A 3OHSX 1T9HA 2CWWA 1WCXA 1PG0A 5JAZA 2OFXA 5K2MA 5JDCA 1ZISA 4HZGA 2EQ5A 3BFJA 4RNDB 3W9UA 4HOYA 3U7QB 3JWPA 8ABPA 1VPLA 3VX3A 5E8JA 3CC8A 5REQB 3AETB 4DMRA 2NO5A 1DQNA 3VMMA 1CUFA 1T13A 1OX4B 3F3SA 3QOWA 4QO7A 2LDBA 2Y1GA 2CDNA 3EFHA 3DQZA 1JJIA 1KMMA 3I9V6 4REQB 3NLLA 1GTZA 4Q47A 3K4QA 4OHZA 4FFOA 3TVDA 4YAUA 4HVTA 1JAYA 2WJAA 1SC4A 5JJ5A 5KTRA 3L6EA 1KO5A 1Q0SA 2YIDA 1X1QA 2C5GA 3BXFA 3N6VA 4Z8XA 4QECA 2XOXA 5GPBA 3QOFA 3T38A 2MOKA 4BMZA 4Z9YA 3FVRA 3NTOA 2AG1A 5M2QA 1BYIA 3AVXA 1DBQA 1WZCA 2CXQA 2GJ9A 4BFYA 2Q6OA 3KEGA 3O21A 3GEIA 2B94A 2PT7A 3DEKA 3ASZA 1UKCA 3B78A 5D3KA 4X63A 4QOIA 4NJMB 3CQ9A 2Q9CA 5A3VA 4ZYLA 3R5TA 5D84A 3GCWA 1X6VA 2OGZA 4LNHA 4OYYA 2ZM6B 1BKYA 3OM0A 3VGJA 2BKLA 4RA6B 4X1KB 1OZAA 1CHNA 1K6MA 3EGVA 1WF6A 3PPIA 3TB6A 6NULA 1MKYA 4FE3A 1JHUA 4WA8A 3C3PA 1R37A 2OGTA 3G8CA 4EG4A 1VL5A 2AG5A 3NVKI 2CD9A 3EFEA 5E3JA 1XTBA 1HDCA 1UJBA 4KR0A 4QXRA 4CM8B 1UWVA 5DNYB 3IDZA 1SHTX 4UTOA 1GYPA 4HWKA 5E6SA 1O97D 2AL7A 3W6NA 3N8HA 4J07A 1D2CA 4OD0A 4QPDA 2N1BA 3EVTA 4BO7A 1YI1A 3GP3A 5I4BA 1FFYA 3DOUA 2A5LA 3F74A 4MMXB 4LIPD 1A50B 3RTEA 2R11A 3A1CA 3ZTYA 4KR6A 4RZUA 2PH1A 3DKRA 3WL4A 1MT0A 4F5YA 2IW1A 3OZVA 4MJ3A 2ZSJA 2ZTHA 3P2EA 2CKMA 3E4DA 1P1KA 1BW9A 3ZE2B 3OEYA 1OU4A 1CZKA 1NJ6A 2EX4A 3TK1A 2QAIA 2I76A 1P9OA 1ESDA 1FUKA 3HN7A 4LMRA 4ZQGA 3ZDQA 1L3IA 1MD9A 4F4DA 2WSYB 1E3SA 2NU8B 1DFGA 4KLZA 3WJAA 5I8PA 2A88A 1ZWLA 4QRIA 4HT3B 5HZMA 4HTFB 2ZJ3A 1X87A 3CISA 3M89A 3W05A 3H17A 4A3SA 5JAOA 1WS6A 3MQ2A 2V6IA 4JJIA 4LY0A 1HE8B 4R7ZA 5FWAA 2CLKB 3ZVKA 3G2JA 4QDJA 4Y0VA 1QP0A 2DR0A 1F1BA 1Q74A 3LYLA 4HVLA 5C8YB 1Z0SA 3FFAA 1AO0A 4RVGA 1GHTA 3I1JA 2XJ4A 1QAQA 3BQNB 1OA0A 3A8TA 3K0HA 1PTJC 4EATA 3IBSA 4HEJA 4INOA 5BW5A 3OE5A 4LRUA 4IJWA 2E89A 3C70A 2MCFA 4ZEVA 1K5PA 1Y89A 1QFSA 4YTEA 3KB6A 1TB4A 4DA4A 2G0AA 4IDHA 1J0XO 2JJ2D 1PWXA 3PJDA 3E9RA 5DBEX 1GG5A 1JHYA 1M2GA 4L8LA 2UYYA 1ADJA 4WY5A 1RHMA 4O3MA 1TM4E 3ND6A 2ZI6A 3AZPA 4MCAA 5JZ9A 2JIPA 3CH5A 4FPXA 4H31A 1CUXA 2BFFB 3CO0S 1AHPA 1UEIA 4KBGA 1TUEA 2J7KA 2V8BA 1TLLA 1YR1A 1KH2A 3FOWA 1UT6A 3FPJA 3K53A 4D8YA 4JB2A 4K5QA 2F55A 3OFSA 2VL7A 3QYJA 4V02A 1RVDA 1HFEL 3UVEA 5LP6F 1TUBB 2ZSDA 2HUNA 2ZIUB 3FVWA 5SZHB 1OTHA 1WHSA 3RTBA 4TL6A 1WRBA 4DQXA 1LDGA 1JZTA 5EJGA 4DJEC 2JJYA 3G5AA 2O0LA 3URKA 4OLJA 5AK6A 3B89A 1R6TA 3IAM1 2FWPA 1DCKA 3EGEA 3H18A 3ZOZA 1Y1SA 2REOA 4BYGA 4J1TC 3PHGA 4XIIA 1Z07A 4IRMA 3QFRA 4G0NA 1V9SA 2CJFA 2FKAA 1II9A 3EQ7A 1G1AA 1G3QA 2F9MA 2YC4C 1GGHA 3PD1A 1G42A 4D9HA 3FTNA 2QW8A 4L4SA 2Q5QA 1DELA 1VGRA 2HBYA 5JS1A 2RKOA 2VHQA 2UVQA 3DE6X 2P6MA 1OBCA 1YFJA 4N8DA 4YMGA 1N6NA 4IDBA 3SKVA 3CPSA 3O26A 4CM4B 3Q5EA 1A27A 3F71A 2W2KB 2AX3A 4BTVA 1KAQA 2NX2A 1EJ0A 2GJ4A 2P3OA 2VZ9A 1NWCA 1HOXA 1P1RA 1XTZA 2D0PB 2L69A 1GADO 3CRRA 5AK0A 5KNBA 5BRAA 4JS0A 3UAVA 4QJBA 5ALQA 3BSSA 3P20A 2NQ8A 1S9HA 4UM5A 1DG9A 2ZCVA 4PEVA 1BYUA 2ZIWB 2FPUA 1VCHA 2BJVA 5E4YA 3WMRA 5B30A 1U1CA 1W2HA 4JVSB 1B00A 2BP7B 4LBWA 4W7SA 4EVSA 3B1XA 3I45A 4MR9B 3MK31 2W2MA 3PE3A 3BSFA 3W6OA 3RS7A 2J6CA 1OYVA 5JNWA 3HXLA 2HJSA 3I6BA 3TD9A 3EVCA 1ADFA 4D8VA 1Y7LA 1GNRA 2IHTA 1RHKA 3DMTA 4M8LA 2YIMA 4Q4DA 1VKHA 2GN6A 4JLVA 4Y6LA 4ZOBA 4EYGA 1TJPB 3RVOA 1RS0A 1ULUA 1R4ZA 1Z5ZA 2JIDA 3DDNA 3BHMA 4YMSA 5EGSA 1L7AA 1EK2A 4CMGA 4WZBA 2DEUA 2RK3A 4ZVRA 4TM8A 2IHYA 1ENYA 2PU7A 2XADA 2R87A 1LI7A 2ZT8A 3AKDA 3PICA 4NU6A 1EM8A 4CCYA 1N8KA 5E1OA 3T7CA 1ISRA 2OV8A 1HDOA 3RGWS 3UJDA 4J2TA 5JSZB 3VNVA 3HWWA 2B4RO 3N2IA 4U7GA 3BDIA 3FYUB 3OFKA 2AFHB 1L5VA 4Q6WA 4Y0AA 3REFA 1GGVA 1WQ3A 3CVWA 1JDVA 4RETA 4KNYA 1IY2A 2CHQA 2G9ZA 3A3OA 3ADPA 3R0JA 4J49A 3OOWA 5KX5B 4MZXA 3FRHA 4WAUA 1ZGCA 2IS1A 4RGYA 4AICA 4OQXA 2XWPA 2Q5CA 4GMXA 4AF7A 4QRDA 2P6RA 1VMKA 3GUUA 4XCQA 1GXSA 1V3UA 2QZSA 4LN1A 4L72A 3ZWOA 1XALA 3AIMA 2ZTUA 4RJIA 2Q5JA 4I1YA 2G77B 5LIPA 5K0NA 3I2KA 2M6SA 1GAXA 1TJNA 2QN9A 3DPUA 4K6GA 1W0CA 3DEHA 1FFSA 1N3IA 2HPVA 2JL1A 3NNSA 5A4IS 5I7RA 3OKCA 3A2KA 3OLVA 4FOSA 1WL8A 2XBUA 1NW4A 2XSZA 1Q7CA 2X15A 2ZAMA 4B43A 3JQ6A 1TA9A 4A2CA 2B2CA 1MO3A 4IDQA 4GQIA 3NDPA 4RXTA 4D6PA 1LPMA 3U44B 3V1YA 1XJCA 3KPUA 1KJ8A 4G1CA 3IE0A 3OURA 4US0R 1AHNA 2QZ9A 3KAKA 5L3ZA 1B14A 5B64A 1LI4A 4OAPA 3IR5A 4TSRA 4HH4A 1BJKA 2GZRA 2GEBA 1KFJB 4DCMA 5BVGB 2YZKA 3H0KA 3VKGA 4NATA 3TW8A 2EBWA 4QDUA 3V4FA 1UAGA 2A0KA 2PFGA 5C7YA 5BWLA 4UVEA 5DZSA 2F4NA 2W6IA 2V6FA 3PWTA 1ECBA 1NKVA 5BSHA 5H59A 4PZLA 2C2HA 4YFYA 5THQA 4MAMA 4HNAB 1FYEA 5AKEA 3UT6A 3EGIA 2XTZA 4COKA 1CYDA 4TWZA 4CV2A 2ENWA 4O2AF 3HR8A 4PAWA 5KHAA 5BRNA 3EAQA 1AQIA 5B3LA 1GNQA 4FYIA 1I9GA 3SZGA 3Q2OA 2GS9A 1VYHA 3EEYA 4OM7A 4B2PA 1V0JA 2PFKA 2QV0A 4G36A 4JP1A 3AK4A 4BNDB 1GPH1 5JXWA 3EXFA 1ZVJA 3GT3A 1CF2O 2QAGA 1H5UA 1SUSA 4CL2A 4A6DA 3S8EA 2IYAA 2FZVA 5A06A 4QREA 4X7PA 3D4OA 3KSMA 1R0WA 1EJ6A 4HDMB 2V4UA 5A3SA 3ROMA 3LBNA 5IFKA 5DMHA 3N2GB 4U5QA 1CQIB 4GSLA 4YCDA 1XTJA 2Z0MA 1I1QB 5BQ5A 4L2IB 4CL8A 1JWBB 3DE1X 4X45A 3SS7X 3VYUB 1OGJA 4GMKA 3T9BA 4EAQA 3PC3A 1S8OA 1VSVA 2AC4A 2H5IA 3EGDB 1BS9A 1BVUA 4BLRA 3HLTA 3K09A 1H9BA 2QRHA 4XUCA 5J40A 2PSSA 3S99A 1LPAB 3O83A 3SQLA 1LI5A 5KYTA 3CH7A 2VQSA 4EOGA 4F97A 3DFUA 1H85A 4MB0A 1V26A 2DVMA 4ECAA 2VPYA 2ZJFA 5L6MB 5KINB 2WFAA 1V5WA 3VAAA 3TW6A 3WS7A 3EGXA 4QOFA 5TPZA 3EASA 2QXTA 1SOUA 1N3BA 3KEOA 2C20A 2E1RA 5H70A 1J06A 2Z6AA 1QHFA 4GMHA 3KYJB 3I9JA 5K05A 4I1UA 2E5FA 5LLDA 3MMSA 1TW2A 4ZEXA 1US8A 4HEHA 1E7YA 1AF7A 1ONSA 4OHXA 4QARA 4X84A 2OPHA 1YZLA 3GPBA 2ODNA 1D2HA 1XE3A 1KGSA 4DDHA 2PJUA 1OV4A 3LX6A 4CEJA 1XCLA 4Q02A 3AESA 1QO0D 3NBMA 2Z1DA 4JUFA 4FGLA 1EVJA 1PVDA 3CW9A 2H2GA 4IHKA 2H92A 1AE1A 4IJ6A 1CZOA 3DV9A 1GPBA 3I58A 4U0KA 2D7DA 1RMQA 2BHLA 3GVPA 4C7OA 1XR3A 1G9XA 5DTQA 4CEHA 1TYZA 5F78A 4ASUA 4R05A 1RAEA 5DTMA 3K9CA 3UJNA 2LIPA 3A3PA 3P9RA 1GL7A 3HBNA 3CB4A 4KTTE 4PF1A 1BZYA 1KPHA 2J5RA 3RLFA 2Q2WA 3UYLA 1W88A 3U3KA 2Y1CA 1GM5A 2E4UA 1QWSA 2HA7A 4REQA 3HRHA 2XVXA 1JA0A 2DRIA 2OQRA 4UXHA 4AL4A 3KQSA 4KNVA 3K70D 2IIPA 4K1LA 2N0SA 2BSAA 2Z30A 1KRWA 3VSBA 1S0UA 4CCAA 2ZI9A 1JDBC 3OY2A 3A3KA 2NO0A 3SQWA 4OQ4A 1SBTA 3L3BA 1CX9B 4MUBA 3H75A 2HRDA 1FB5A 1VIAA 2EARA 2Y8EA 4REMA 4WCFB 2IX3A 1COWA 4BASA 2BEVB 4OA5A 1YIOA 3DE3X 2QBYA 1NXOA 1W34A 4RD4A 4ZQEA 4BECA 4GDFA 1IWOA 1KA9H 2ZEJA 1GUDA 3PYLA 4BXOA 1A1SA 4YRKA 4G1VA 2QN1A 3LQFA 4BNIA 1TJ5A 1F06A 3I6IA 4KK3A 1RPAA 4UVIA 4KXNA 2UV8A 4XB6B 2GAAA 3ZPXA 3W3AH 2G4LA 2BUCA 2HREA 1KMCA 1TD9A 1TL7C 2GHRA 2KBEA 4DNFA 2QD2A 2Z83A 2OLEA 2XGOA 1K7YA 3FCXA 1THTA 2YWBA 1DKLA 3KZVA 3PTZA 3CO5A 2BHNA 4GMGA 4CFYA 2AVDA 3MD9A 5TQ0B 1QHEA 1DNPA 1XZMA 3RFCA 1H0RA 2WJPA 4DBLC 1ND6A 2J9YB 3R6TA 5HQJA 1W5TA 1N7IA 3NFYA 4GZ5A 2P30A 3RBVA 4DG5A 3FZNA 4FFBB 4Q9KA 4W7IA 4MYRA 1N2BA 1CD5A 4G0QA 4NBTA 3HGMA 3TOSA 4F56A 4JB3A 1ESMA 1P17A 3TO5A 2RHBA 5CXQA 1B43A 1DIHA 4D0RA 2BIFA 3RYCB 1V6SA 1X14A 2D0DA 1CB7A 3T7AA 4KE6A 2G1KA 3B1ZA 4MW9A 3PRHA 1GILA 2VN8A 3EOBI 3O31A 4GHWA 4II3A 4M8NE 5CT9A 4ZDWA 3WHKA 3EMVA 3F7MA 3THXB 4AXBA 2IEGA 2QRQA 2VJLA 4OXXA 4U9IS 1U65A 4CG0A 4D9NA 4JODA 4RTQA 5DULA 1U94A 3COJA 2ONZA 2ZP1A 3EZXA 1ZYUA 1U6JA 5EERA 2GXQA 4RDCA 4GX0A 5JCZA 1Y4DE 2P3LA 4BNYA 3FDXA 3U7EB 3PX2A 3ICPA 4EG8A 1PWHA 3PC6A 2FFJA 5DM60 4TLCA 3AIOA 1ZH0A 3A9RA 2XCIA 3K0CC 1Z15A 4QSHA 3VZDA 3CGWA 3E9YA 3T3NA 3K9QO 2XXAB 3GUHA 2B1JA 4EKNB 5JMTA 3NGXA 3VR5D 2XUGA 4XJSA 3UJ3X 1X1EA 4H18A 3PX7A 2J5QA 3GRRA 1ND5A 2ASVA 4AQYB 3VVMA 1GKYA 2JIBA 3QKUA 1IBCA 2JCSA 5UKDA 3BMCB 4EWLA 4ZZ3A 3GQBB 4DCGA 1BMFD 5D7NA 4G89A 3K70C 5CYPA 2BV3A 2OB2A 3CMCO 3CT6A 4WW0A 4YJDA 2ZWPA 1Z0KA 1OXTA 2E4AA 3JX9A 3L8FA 2MJLA 4JY7A 3CIFA 3AQ4A 3L82B 5D8DA 4C08A 4FMCF 2CK3A 5K3EA 4KMSA 4HI0E 2P2GA 3VR2D 2CDBA 3BCSA 2C5BA 4B8ZA 5JJCA 2J3KA 2AE2A 3NETA 1FVFA 3LHSA 1I7PA 4H6VA 1NNEA 4AF6A 1VI5A 2QRVA 1WMFA 4D02A 1FS4A 3HJTA 2R8XA 1SZPA 2WFLB 1G3IA 2C8JA 2O2DA 3OY7A 4G23A 4IP0A 4J1TA 4U7TB 2P35A 2YHBA 3WYCA 3DOOA 4L73A 3SBEA 3ACCA 4GZ6A 3U4HA 2GSDA 2OXTA 3X2SA 4F84A 3EAFA 3V1NA 3MJTA 1A82A 1EK1A 2JGFA 3D4PA 2BI8A 4E32A 5BWNA 1N6RA 3L06A 1NY5A 1ZBDA 2HDHA 3BS4A 1RKUA 3V4ZA 1JIVA 1NDUA 2Z5VA 2IW3A 1WCIA 2WA1A 1X7ZA 2XMQA 1FDIA 4A16A 4AU1A 4F91B 1Z62A 4MPTA 3ZDAA 3VO8A 5EIFA 3LBHA 1AGRA 3DAFA 3MGAA 5DNAA 2X2OA 1BE1A 4MX8A 2DX7A 3A4IA 3AGPA 3GH3A 3L0YA 1W36D 3KQKA 2C83A 2TMDA 5PGMA 1Z4JA 3ERCA 2VJMA 4MAFA 2BHRA 2OEPA 1U7TA 3D8NA 4X3OA 4YAIA 1V48A 1JPVA 3DO5A 4TVKA 3ZY3A 3AVVA 2B4AA 4ZVUA 1LZKA 1U4SA 4HR7A 4YAFA 2I3AA 3S68A 4B6SA 1ISJA 1NHWA 4C30A 1ZZGA 4A2QA 1O95C 1PDOA 4K26A 3EZNA 1VI2A 4BV3A 4RHTA 3LXMA 2RK4A 3E35A 4B80A 1HEYA 1UOPA 5FOVA 4ESOA 5FWYA 1M1YE 2E48A 1KMHA 3CONA 2BGMA 1XRSB 4GT1A 1UBTS 1C8BA 2GJSA 3QWAA 5FWYB 4JEMA 3DFIA 1YS6A 5BNZA 4N7RA 1E4EB 3OF2A 4UZSA 1RHQA 3QEMB 3USCS 5K7SA 3DMPA 4FU0A 7MHTA 5I7AA 1X8LA 3Q1LA 2C3PA 5CH3A 7ADHA 2DH6A 5JECA 4OYHA 2EJCA 1W25A 4B9AA 3MLEA 4UU8A 3O03A 3AEUB 1V11A 4P53A 2A5YB 1F0NA 2I0FA 1GR0A 1CKEA 2BVNA 4NSNA 2NQ2C 4OKSA 2OY0A 2W2VA 1RABA 4MHSA 4BQOA 4JBXA 2QGZA 5CXUA 2B83A 1GPJA 2P4UA 2QP3A 2N42A 4P31A 5IMSA 2P1RA 2WV9A 4O0MA 1S8FA 1RYZA 4QZVA 1OBHA 3JD1A 4EL5A 2O07A 4GWGA 1SELA 1N5DA 3PLNA 4GFDA 4R1UA 4Z4GA 4QDOA 4EGCB 3M5PA 4GZMA 5CPBA 1JHAA 5THXA 1CY1A 4ZT6A 3ZZNA 5IXJA 1XP8A 3DNMA 4Y2QA 1P81A 3LAWA 4U2EA 4CUKA 1W9MA 2DOKA 3K9HA 4NH4A 4DLAA 3L49A 1M66A 2HGSA 2RSLA 3HA5A 3UV6A 1FJHA 1GQRA 3OCWA 4NJOA 3T0IA 4DQVA 2FW1A 3UT5B 3VHLB 3LRTA 3OVMA 4IJVA 2V4ZA 2QN7A 1EWQA 1U2ZA 1Y5MA 1R8YA 2P2NA 3ZWYA 1FSZA 4K9NA 4E6PA 1YAHA 2VZ8A 5JMPA 3CW2A 4YDHB 4M1ZA 4ID3A 2W8BA 2B61A 4BV2A 5FKJA 2JEYA 4HG2A 1SCDA 3QSYA 4G0UA 1HFKA 1NRWA 4HATA 4IJKA 4IYJA 4C0KA 1KSHA 3ILVA 1BMQA 4ALIA 3MJHA 1PK9A 5K09A 3NEJA 1Z35A 1FXUA 1DX9A 2MSEB 1LFDB 1QIGA 1UC9A 4B84A 5AYVA 1UMBA 2AN1A 3AM4A 5LMNB 4V38A 4DR7B 1VBKA 3OJ0A 3EDOA 4IFBA 4ESEA 3LIPA 1QGDA 1BWRA 4UDYX 3TLAA 4AVYA 5KNCH 4PC3A 3U1VA 4TTJA 2CMGA 5FOSA 5TMEA 3FA2A 3NONA 3O8NA 2YICA 1K8YB 1L5NA 2CXTA 3AEKB 4AMYA 4BO0A 4EHBA 2VK8A 3OF3A 1NP3A 5TF4A 2PL9A 3ENWA 1F1JA 1AK1A 2HJ9A 3CNNA 2ZWIA 4DXDA 3A28A 4G81A 4O25A 1E2BA 2XGSA 1WB4A 1Q1AA 1D04A 3D64A 5EE9A 4E5MA 2QTCA 1XTPA 3TBHA 3VPXA 1OMOA 4O4IF 4J7CA 1VIVA 4TRNA 3WFJA 4CKWA 1Y3FE 2D1QA 2B36A 2MMGA 4ZVLA 3ZU6A 2CFRA 2C9DA 1M10A 4RSGA 4KXVA 4B33A 4E3WA 3G2QA 5BQOA 2QSYA 4J4BA 3MWLA 5EKSA 3TDKA 5EJ5A 2QLBA 2Z5LA 3M3PA 3PA6A 3ONFA 3WK9A 4YREA 4BO8A 1IYZA 2GBFA 3H2IA 1YQTA 3UXHA 2R1TB 3NOQA 4M1YA 3IE1A 1E61A 3M4YA 5LB4A 3C85A 4OJMX 3RBAA 3U4DA 2CNWA 1SB9A 4PTYA 4OMFG 5EXSA 4ZVQA 2H18A 5LD2C 4L74A 4Y2SA 1G6KA 3X1JA 2QT0A 5JNUA 3F6YA 4IEEA 3UK0A 2QR3A 2V9PA 3QJYA 4ABTA 2BISA 2BM0A 5D5HA 1G16A 3PTAA 2QTBA 3CW8X 1VFNA 1EFDN 1LSUA 3EBOA 5FO1A 3K0CA 2AYXA 4N7MA 3SDBA 1J07A 4LJ9A 3WKDA 2VRBA 3T1OA 1CZRA 2DHRA 2YDYA 4I8IA 5EE0A 2B4TO 4RQBA 3C97A 1UH5A 5FA6A 2O8BA 2A94A 2NU9A 3HYTA 2FWJA 2P6NA 4MW4A 3GUVA 3NPAA 1WUIS 1TTHA 3C8DA 5FWNA 1XVTA 4L8VA 1ZI9A 2PMDA 1GUYA 5KYYA 2GA8A 2OZLA 1E96A 3GRFA 1U7XA 2QNIA 3LC7O 1TM2A 2HI0A 3PITA 4FT2A 5H9VA 4LSZA 3MWKA 5DWVA 2CHFA 5EPEA 1LLFA 3LUDA 1JI3A 1Q0QA 4MW1A 4Y2TA 2FY8A 1QM5A 4GKBA 2GCEA 3I3OA 2X8JA 3PPWA 3TRDA 1YOVB 4JKYA 4C2BA 3KKZA 1LJ8A 3LPNA 5DI3A 1TT5B 5CFLA 4KO2S 1MOQA 1WTCA 4EUFA 1EK5A 2AF4C 5E95A 3LA8A 5LQCA 3GJTA 3L0PA 4ECEA 2NV0A 5TT1A 3WMEA 2A8YA 3QELB 3WRXA 3SC4A 4RZHA 1TMGE 1E7MA 1TGYA 3B6ZA 2Y2VA 3ZLJA 1ZC4A 5IMBA 3M1LA 3VC7A 1E3QA 2A9QA 3G2HA 1HEIA 2Y27A 1QGZA 3E81A 5TSDA 3S27A 3ZNOA 4IV0A 3IB3A 4CMBA 5L45A 1EWYA 4N9WA 5EINA 1YCGA 2YYSA 4YECA 2FWRA 4GYYA 3SIXA 3WK7A 3LGAA 4LHWA 1W29A 10MHA 1D4ZA 3R5JA 2ISQA 1JDUA 4QJIA 3R3JA 1Y6FA 1ISPA 3QQ5A 1TIKA 3PJRA 1WF3A 2FAXA 1N75A 4MZDA 3N0VA 3ED1A 1E1CA 1IM2A 4ER7A 2QTTA 1HDXA 3K8QA 4FD3A 1RKVA 5DYGA 5FNVF 3F9IA 5DISB 5IAKA 1QORA 5JJLA 2OZPA 4N39A 3TMKA 5FAXA 4DLTA 3KZKA 3PXDA 3R5KA 3R3UA 3VTZA 3JQAA 1Y8QB 5EVJA 4FFRA 3ZWXA 4BFUA 2WMNB 2QBYB 2WSLA 1GPMA 1QP8A 3HCEA 3OMXA 1OSNA 3DVLA 4F3NA 5BYJA 3TI9A 2HBZA 3HI6A 1L0BA 4RVSA 2OP1A 5JHGB 4YV2A 5LXTB 2PU5A 3HA2A 4R51A 3RV4A 4DNOA 4Z2AA 1M7HA 3FNHA 1U7OA 2GCOB 2W6CX 2FZLA 2Q5FA 3TKLA 2A1UA 3FB1A 1FCJA 2EHJA 3PXUA 4G2TA 4PSVA 5A04A 8OHMA 4W5RA 3H8JA 1ZJWA 1OTXA 3KUKA 1E1QD 1EFPB 1J00A 5EESA 5TT0A 4B3XA 5EE5B 3WIOA 2FUNB 4TOIA 2WJ4A 1Y80A 5KIAA 3IO5A 1K6EA 1EHYA 4WGGA 1H1LA 3GFSA 3KHKA 4A10A 2CE7A 2Q99A 3ENNA 3V97A 5BXYA 5CFNA 3RDPA 2FSFA 3HCAA 1IWPB 1QIEA 4UTNA 4O2BA 1LF0A 4KEAA 3U6BA 4HWRA 1YO6A 3GOQA 4AG3A 4EPYA 2WTXA 1HK7A 1KVQA 3UJ8A 4CLDA 2FQ1A 1OZ0A 2QAGB 2GK7A 4RV9A 1B8PA 1GNVA 2C8KA 4E12A 4KG7A 4QXPA 1DTWB 2HU7A 2I34A 1NM5C 3B3JA 2PQ6A 2FN3A 1ZPDA 3PQ8A 2JLVA 1W93A 1J56A 1E5QA 3WC4A 2QX8A 2XRMA 1Z5VA 2V5VA 3C4JA 2G09A 2H1WA 4QGHA 4ZC8A 3S1AA 1J2UA 5EP1A 4NE9A 1A8SA 4PYOA 1NI5A 3IEKA 1T8RA 2JDIA 3ZDYB 5E6RB 2OSVA 4IX9A 2YS7A 1JECA 1TE2A 3HYCA 2C7RA 1TI7A 1XU9A 1TCAA 2O8FB 4QTZA 4AZ0B 5EA2A 4M0MA 2PD3A 3K1ZA 4QASA 1XCOA 3K20A 2E55A 1EYZA 3P4UA 2N46A 3RIHA 3ULKA 4WESB 3VU8A 3MLBA 5EIWA 1FQJA 1IM8A 4QG3A 5DXAA 2YXLA 2GYWA 3KU1A 5TMBA 3F0TA 3VZSA 3ZV4A 4G5OA 3R5FA 5EAIA 2WHEA 1PYOA 5DYTA 3ROFA 5HFAA 3SR0A 3MC1A 1VE3A 4IIHA 3AU8A 2C5EA 3CNQS 1Y5IA 1BWPA 2RHGB 3MMNA 5HCUA 4RKEA 3PL1A 5AVXA 2FW0A 2WWIA 3RC2A 2I6QA 3IDAA 2ZTVA 2BN4A 2ZIEA 4QC2A 4L22A 3UOAB 3BC1A 1PAUA 4ROSA 3INNA 3AUSA 4G4SO 3O4JA 4ZHSA 3W5JA 4NWIA 1GTJ1 2YOFA 1C30B 3KALA 4G5YA 3HBFA 4H59A 2Y3IA 4K6HA 3TNJA 4BO3A 1PV4A 2IKSA 4MS1B 1HDYA 2AZDA 3U4IA 3UV3A 5BUCA 2E5WA 2RJNA 5F1OA 4KAAA 3ZE8A 1T9GR 2QJFA 3UPTA 2QJWA 4NAUA 4C7OB 3Q8XB 3ZVMA 3I37X 4JK3A 2VDWA 4NBVA 1KL7A 4R98A 2DLCX 4J4HA 1WNFA 1XEWY 1YFKA 3MWDA 5KTMA 3E2IA 5JBNA 4LYJA 3GUCA 5LZ2A 1QLJA 1RZVA 1Z39A 2C59A 3R3XA 4QUDA 4YRAA 5CDGA 1OAKA 3AR5A 3U9LA 4MQFA 3WX0A 1FUEA 2ZUSA 5DRYA 3RAPR 1R12A 2HPZA 1JXAA 4JH0A 1QO0A 5E9JA 1H6DA 5B4UA 3BRSA 4J1QA 3H65A 4OA8A 1NVEA 3GXBA 1ATZA 2KBFA 3AR4A 4WCDA 1PHPA 4F4JA 3AV3A 3EW9A 2FPWA 1SRRA 4YXWD 1KZYC 1Z4LA 3WRWA 4KIGA 3W6PA 3TYXA 4R8RA 4TN5A 4EYSA 5TE9A 4TN1A 1M8FA 3I5UA 2ZJ5A 1XTVA 3HCCA 5IUKC 5AJVB 1WMEA 4LDNA 3VNSA 4AY6A 4LDZA 1G8AA 2RAVA 3BD6A 4BB5A 2Y1KA 4UHKA 1HGXA 1UXHA 1NYQA 1M1YB 2BBTA 2I80A 2PY6A 3HCFA 1PI3A 4MV1A 4RM3A 4RYDA 4C4YA 4MV8A 1RXSA 1P2FA 1JQDA 4KYUA 5ECDA 1YB2A 3VI4B 3ZXUB 3ESRA 1TK9A 2EX1A 3LBFA 4QYXA 1NDQA 3D7KA 4QFCA 3U31A 2DSNA 2QHXA 2PZMA 4Q1AA 3FDIA 3DNPA 4U3JB 1U3WA 1HL7A 3DHEA 3G3EA 5DB4A 2SNIE 2O19A 1Z18A 2I3BA 2VJYA 4QYIB 4IUBS 4TWJA 5C8ZA 1PNOA 1EESA 3B9PA 4PYIA 4Q9JA 3TG2A 1YVRA 5K8CA 2JGKA 3G2PA 1G41A 3UYKA 3KP1A 1L4YA 1XX6A 4CKCA 2EGGA 4K87A 5B1HA 3WDKA 2BH9A 2HU8A 3FYCA 3IIJA 3VR6D 4KXQA 1X9HA 5KMGB 1A4XA 3HCDA 3HEAA 2W2PA 4BUZA 3OUTA 2IU4A 2GBPA 1DEXA 1ZJ6A 3WGOA 3KAQA 1WZIA 2XF2A 1SZDA 2IYXA 1PTKA 2WK1A 4FEAA 4QUJA 1HE4A 4V03A 3P52A 1LBTA 5HF5A 4CLEA 3RUEA 1CS0A 3GT0A 3V4SA 4L5YA 4GBMA 2I66A 2ET6A 4I1OA 1N8NA 2X8JB 4RTNA 2PQMA 4LTMA 3K6JA 5A3RA 4GOMD 1US8B 5DI3B 2B8EA 1W73A 3Q7PA 3ZCQA 1WB5A 2V7WA 1N4AA 1YKSA 5BN5A 5JXHA 2YBEA 3LS2A 4MPPA 3VR0A 2UYCA 4QTYA 1CY4A 4CTNA 5BO5A 4JJ6A 3FDZB 2ZRMA 1Y42X 5KC8A 1UP4A 3SF0A 4DA6A 1J99A 5F5XA 3SHOA 1T2NA 4M38A 4BFSA 4HGYA 1XZHA 2YZNA 1QMGA 2EZ4A 3EXIB 2Z2KA 2J0SA 2BMJA 1IVNA 1EFCA 4EMSA 1V6CA 1RBQA 4LF9B 2UXCB 4F71A 3KE8A 4HDSB 4Q7EA 4TL8A 4XM2A 3A70A 5KJ1A 5L3QB 1DQYA 4EMUA 4B3CA 3OPXA 4PPNA 5BN1A 4CLRA 1G6OA 1VE5A 2ZR8A 3MOSA 4HDSA 1N6IA 4KQ2A 2DWQA 4NAHA 2X7XA 4BVBA 1YVEI 4CIXA 3GIDA 4P35A 1RYBA 2LDXA 2IWRA 5ILQA 2WJ3A 4CTMA 5I9SA 2V59A 1YR3A 3DD1A 1LVUA 1SNYA 2AFVA 3EGWA 4ZMBA 5AFSA 2VDUE 5DLDA 4RCZA 1W19A 1Y3CE 1KMNA 2V5AA 1ZCBA 3MB5A 1TJ4A 2RBEA 3O2QB 2QYHA 4P2BA 5JBIA 4KFSA 2FWIA 5IK2A 2GXAA 4P36A 5I9TA 4LPSA 3E2PA 3T06B 3TW8B 4DJ5X 1C0IA 5LU9A 3TLJA 4WE3A 2CLHB 2NN3C 3AEQA 4PXAA 4F1JA 3U16A 3MVEA 3AP2A 2ZZMA 1PT7A 5D51S 4DUYB 5EE1A 5COBA 1AQYA 1KERA 4BNUA 1PV1A 2B9EA 2SECE 3NGMA 1KQFA 2WINI 1X7YA 1X7XB 2JRCA 5D01A 3UMRA 3W9YA 1TYAE 1S3FA 3INGA 4KQGA 5HJ5A 3UWDA 2XHZA 3FRIA 1T2CA 2VPXA 4RZXA 3U3RA 4CMEC 2ZS8A 4OREX 2WLSA 5C34B 4D9BA 3L40A 4WBNF 3OZGA 4IH1A 1TW3A 4DIKA 4C5CA 1J7KA 1TPYA 4O4LF 1GGFA 1FP7A 1YZUA 1E9VA 4U6QA 5E6UA 2V8OA 1T1RA 2ADMA 4FGUA 2ZKLA 4GPEA 3EPHA 2H1HA 5BV0A 2ES4A 1Z5GA 4BLVA 4PFJA 1MOSA 2QP4A 4PHCA 3N2KB 1ECPA 2VBCA 4KVZA 4TL9A 4ZXPA 4JI3B 1VL2A 2DZDA 2PD4A 3CZ9A 5SYMA 3T9CA 4OV6B 3H2YA 5E7IA 1D5WA 5T8KA 5HIKA 4NZ9A 3DOHA 3IUYA 5FL7A 1JEYB 3THYA 1KYWA 4BNTA 4EO4A 4N5IX 5LLTA 2ZE8A 4MNTA 1FMTA 4ARAA 1BHQ1 2O20A 4LSGA 4Q5IA 1D2MA 4WCFC 1VCIA 1W1UA 4A8PA 4AMZA 4BN4A 4F2GA 3WNQA 2XMSA 2OZLB 4XWGA 5DM0A 1JDBB 4C07A 5KWIA 2EFHB 2QRKA 3NIBA 4GI7A 1PX0A 1W4LA 1V7CA 3ZCSA 4BMYA 3R9IA 4X92A 3L02A 4GM0A 4D2IA 4FFPA 2CL7X 1KKUA 4KHZA 3MG9A 5JR3A 1HC7A 1KJYA 4YPVA 4PYNA 2BMFA 1YDEA 2V7GA 2EGHA 2FVYA 4YMIA 3ZCRA 5A6SA 4HYQA 2FDCA 3TM4A 1DXHA 3UJ9A 3H9JA 1P4JA 1GARA 1VJGA 2PK3A 3B53X 4HAVA 1PWZA 4OHYA 2OCLA 2C99A 3TZCA 2F9LA 1J0CA 2ZYIA 1XDZA 4B83A 1I33A 1ESEA 1X1CA 1JDSA 4JC8A 1FMJA 1NJ1A 2R6R1 2VA8A 2WYWA 1R0XA 2E85A 1QMPA 5C51B 4GDMA 3THWB 5IARA 3ZUPA 5J43A 3O4HA 3NBQA 1UJ2A 2YWCA 4FNAA 1MH9A 3ZYCA 2VP6A 5JZVA 1YDFA 1UEXC 5G1NA 1C9NA 1OU0A 1TQ6A 3AO0B 1YIAA 4P4SA 2BEWA 5C18A 3EUFA 1Z16A 4J7XA 1AZSC 4G65A 3LQRA 4Q4HA 3WGTA 2PV0A 1OI7A 4OXNA 3PNBA 4KKVA 4D9CA 1AJEA 1NQ5A 1GRVA 1O96B 5LDDC 4IIDA 1PJTA 2G04A 3C6KA 1MXHA 4YS6A 3RTCA 2J4DA 1KZ1A 2BE7A 2CW5A 4C29A 5J2UA 4PYJA 4H3VA 4KBFA 5EQTA 3W78A 5I6DA 1AV7A 1QZTA 2CVHA 1JG6A 2GVDC 2H59A 3ABOB 5JCXA 1M6EX 3NOXA 1LK7A 4U9HS 3RSCA 3K0SA 3EQ9A 3O1LA 2LTAA 4IGKA 3UGKA 1LK0A 1ONPA 3RYIA 1AZWA 3BRCA 1PGNA 1T3LA 2ZYTX 4K2AA 1GUAA 2DGDA 3B2NA 3KQVA 2V74B 3LF1A 4JBNA 1H8HD 2AFIB 4QOGA 4B73A 5KAMA 4F72A 2YOHA 1VMIA 2JCYA 3HK2A 1V2HE 3GLHA 3HZHA 1E5XA 1J9EA 2E49A 1YS1X 4ZVVA 2FMXA 3IUMA 3K8YA 3R5XA 1GAQA 1ONBA 3WLQA 5FUWA 1KE1A 5ICSA 3EPLA 5F7XA 2QVBA 4K46A 1T1JA 5CFQA 1N7HA 1T9ZA 2ZE7A 2OCPA 2EOAA 4J8PA 4J29A 1DC8A 4MYTA 1ISGA 1Z4PX 2FH5B 4RA6A 4X1KA 4Q37A 5EIBD 4FBLA 3Q3HA 1HT3A 4YUYA 3ISVA 1PDWA 4KDCA 4RWZA 4XUDA 4Q9IA 2Y2UA 4POAA 2Y1WA 5TQVA 4DN6A 2QLJA 2GILA 3PC8C 4W6QA 1FYXA 2PFSA 2BD0A 2HL6A 1QH8A 1KSFX 2C4HA 3QF7A 3CG0A 2H8GA 1T0UA 3LYHA 3EVBA 3PCXA 2PZBA 2X6QA 3ILYA 4ENPA 4TL7A 4X6LA 2P41A 3EXAA 3F2VA 3RANA 4DHWA 3Q3GE 2CUTA 3FVTA 4HFJA 2JASA 5BV2P 5GP1A 4E14A 1E4EA 5C8DA 5IEJA 2AS0A 2HIGA 3TTWA 3VJLA 3S7ZA 5GZ3A 4E7OA 3CBQA 4H60A 1SMKA 4L4ZA 3T4EA 1U11A 3QUAA 1E9FA 1CK4A 1KU0A 2KI5A 3RTDA 4DNXA 1VE6A 3ENQA 2G7MC 1KY3A 1ZN2A 4S1PA 4AJEA 2ZIGA 4IKEA 2OV2A 1P31A 1TM5E 3SLKA 4ZCMA 2H7CA 4DLLA 2WWWA 4DYVA 1U8EA 3QU9A 5GJVC 1KIFA 4X44A 4ISCA 1ICIA 1C0LA 2AMFA 1PJQA 4TV9A 4V0SA 4XJTA 2VTBA 2F3QA 2GRAA 5BMVA 3LI2A 4DLZA 1CE8B 3VHQA 1ZHFA 3E22A 4NMHA 4CDGA 1CB0A 4CMHA 1IU9A 2V6MA 2ZREA 4JLNA 5HE8A 3A06A 3FWPA 1JYEA 1TU0A 1K9VF 1WTAA 3RK1A 3WLFA 5CCEA 1OF1A 1SQ0A 3WR5A 1UDAA 2CLOB 4ETWA 4AT1A 3GLKA 2GEJA 4JP3A 4JT9A 4RLHA 1OXSC 4LYAA 3RC3A 4RCVA 2PQ2A 3JSAA 1DIAA 1P80A 1T5LA 1N2SA 4EA8A 1BN7A 3QBVA 4Y6GB 4JQSA 1SG6A 1G9SA 3EXEA 3Q3CA 1UP7A 4LE2A 1QUEA 1MO4A 2PRSA 2HSWA 3H2JA 4M36A 5K45A 2ZJYA 4ZXFA 2BFFA 1QO9A 1Y5RA 3BXXA 4D0LB 5AQ1A 1E5LA 4LSMA 1UXJA 1MAHA 3KD3A 4QHYA 1RP1A 3UOWA 1VM6A 1KSGA 3EEOA 2P9GA 3NHFA 4ZAZA 3WWOA 2M1XA 1T5HX 4HNTA 4YRLA 1OI4A 3AQIA 1R9NA 3FETA 3TX6A 1ZIOA 3V4PB 2GHQA 2FFQA 1KJJA 3VR3A 2YMPA 4YLGA 1MC1A 2X0DA 2JAPA 4W5JA 3ROKA 4RQUA 1GTMA 4Z86A 2PUDA 3BHNA 1BCSA 4WLOA 3T3MB 5EJEA 2Q1TA 5BOSB 4EG1A 4HZIA 3ZTTA 2WIDA 4KDFA 4NBSA 3AFGA 1D8TA 3LUPA 4B6EA 3QX9A 3QE0A 3RH0A 4YRTA 4WKOA 5I8WA 5CW2A 3RSSA 4KGZA 2ZOSA 2CNKA 1U3DA 4GOND 2EIXA 3I12A 5IM5A 2I6SA 4XUEA 4RNCA 2O2IA 2QJOA 3PU6A 3AM1A 5BSKA 4I46A 4BGVA 1GZVA 4JOQA 3BSWA 2JAWA 4O2LA 4CEIA 3QYPA 4GBED 2JAXA 5JFGA 2DH5A 4NPAA 1ZKMA 3D8HA 1O97C 1X13A 1T6YA 1QFXA 4CHTA 1V95A 3JAWB 2WNIA 2AK3A 4N3CA 4YDQA 1DX4A 3E84A 2FZKA 4QSMA 4PRYA 3I6YA 1RLUA 4DJFC 1WPXA 5TXGA 2RI1A 2QMUA 1T2DA 2RC5A 3QE9Y 4NYJR 3R8XA 3X1ZA 1GPNA 4DAEA 2ACEA 4WY8A 3M6VA 5JROA 2ZT7A 1TD1A 1YTLA 5SY9A 1YQ9A 1U8ZA 4NEQA 3U13A 1VL8A 3H3FA 1JT2A 2V7VA 3JATB 1QDLB 1SEVA 3STWA 3T95A 3HWSA 3ORQA 4R2LA 5I9MA 5B2EA 1U8FO 2ZJOA 2CUNA 1M0WA 4ZOLA 4OB8A 1NW5A 4YRSA 4IZOA 3ZIAD 1EBFA 3OQOA 4TKUB 4XCVA 1Y9EA 3ID6C 3N6RA 1A4RA 1QHSA 2YINC 2HIAA 4UUQA 1GZSA 3IIEA 1KYQA 1X0XA 3GJ4A 4G0ZA 5LCXA 3L7OA 3VOAA 3GDHA 2ETXA 4PAQA 5EFZA 3DEJA 3U9SA 3RYCA 1N4DA 3S2YA 4DC1A 2SCUA 3LDUA 2HXGA 2F8TA 2H1CA 2PZEA 5JVDB 1J5PA 2GD6A 4FZRA 1IB6A 4G0MA 4MROA 2IYLD 3OPYA 4WK2B 2GFQA 2BOVA 4NR0A 3D0OA 4YAOA 3Q98A 1KR5A 1PK7A 3N86A 4II2A 2QUAA 1U1DA 3N0RA 4NKRA 5F12A 4YYEA 3RC8A 2AX4A 3TCXB 1JSRA 2ZJBA 3ZHVA 2ZVQX 1RZUA 3N5CA 2WFMA 3HTXA 4LWOA 2QY6A 3IAXA 4HZUA 2JLRA 4E2ZA 1TZJA 3PUVA 3DTTA 1HKUA 1SUWA 3HXKA 2AZXA 3KDPA 3ZD8A 5C1DA 3W5VA 4LC1A 2V3CC 5G4LA 2R7AA 2QRJA 3EIQA 3ADKA 4K6FA 2Z09A 3FDZA 2ZRDA 4GOLD 1RJWA 1GLGA 2PVCA 3HRKA 4NYIQ 2WG0A 3RJZA 1JKJB 3TPCA 3TB4A 2OG2A 3ZWPA 4M98A 1N25A 3Q6NA 4F9TA 1HY3A 3D2LA 4CR8A 4DLYA 4I4CA 4MK4A 1P77A 4QBFA 2C92A 5LD2B 3BX1A 3LUJA 1V5FA 1Z2AA 4D81A 1DC7A 1E0KA 3UPUA 1DJMA 4LCJA 3JR3A 2ZR0A 2WF5A 2OD9A 2C5SA 4S1TA 3SIRA 1HOTA 1XD2B 2ZRJA 1ZLYA 3OTHA 3V2GA 5A9SB 2L2QA 5A4MS 5C8YF 2GTHA 1DAFA 3AFHA 3E05A 1ZCFA 2RG1A 2VWGA 1RZ3A 4HVAA 4KXYA 1KJQA 4R0VA 4FYMA 4M1MA 1UT5A 4TKMA 1RZRD 2VDWB 1QB8A 3P27A 1DKUA 4RTPA 3DZ8A 4GBGA 3SJAA 1LLDA 2BFBB 5ALVA 4EG0A 3CNHA 4P83A 3ILHA 4OX9Y 5KQLA 1VL6A 2ORYA 4N4AA 4RWEA 4MUMA 1J49A 4QDXA 1PW5A 4H0NA 1BEEA 3X0DA 4DVJA 2JKVA 2G9UA 3K16A 2H1FA 2W7TA 4GGOA 4W8GA 1W4BA 3JQ8B 2VLBA 1S9DA 3BRWD 2OMEA 1JEQB 2QRPA 2JEZA 4ITUA 1II8A 2QUHA 4RK6A 4XDYA 4JJAA 1SKYE 4XH9B 2WVAA 1CQWA 2Z9BA 4J43A 1OKKD 4JLDA 2I62A 4PCVA 4Z7NB 1NW3A 4GGPA 5DYWA 3TRFA 3FKSD 1T2VA 3OIGA 1Z5OA 3DTNA 3B5EA 5JDIC 3PHLA 4RVFA 2IPOA 4EW2A 4LK2A 1JHDA 1NASA 3IMKA 4H1HA 1O6FA 4JUDX 1PE0A 4KPFC 5E8RA 3B5JA 1R3DA 4DREA 3PFBA 3DV2A 4RA9B 4S05A 3VV3A 4DCCA 1NG1A 5GONB 3RUPA 3PCRB 1UKYA 5TPWB 2A1IA 2FV8A 1NW9B 2W6JA 4AJHA 4TWIA 1V5EA 4YCMA 2BKVA 2VYFA 2ONJA 3S55A 1ULZA 3V1UA 4JBGA 3TE6A 3EOAI 3L8HA 4F5WA 2Z57A 4BPBA 3TNDA 2XT0A 3DL2A 3RYFB 5FA8A 1N6KA 4B46A 3OT1B 4FXPA 1JAHA 5AXDA 4KRXA 3UO8B 4KQCA 3V7FA 1X86B 1ORTA 1LNSA 2Q5IA 3N8KA 3MTDA 4PX3A 4R8MA 5GJCA 3LPAA 4YCBA 4D42A 1S8AA 1MGOA 4BE4A 4WOPA 3QE3A 1HFWA 3KYDB 3JYNA 1WULS 2C4WA 5CGQB 4DR1B 2G67A 4L50A 4FZJA 5IXSA 4OM8A 4K9OA 4YRQA 3DW1X 4F93B 3SSNA 3HV2A 5DNWA 4FDAA 1LTKA 2P8SA 3QMWA 2PR7A 4FONA 3Q0TA 3IRVA 3NNDA 5H1YA 3KR0A 2Y4OA 3FJ1A 3I42A 4JIGA 4IO0A 5DEOA 3X2FA 1TOAA 1WMSA 3GDGA 4ZODA 3W2EA 2AKEA 5LNK1 1E3LA 1P2VA 2J41A 3DM5A 2I1LA 3HU3A 3F7TA 3ZLVA 4BRWA 4MGEA 2C5HA 2GDZA 1BA2A 4XTRA 2Y66A 1ZJ4A 1N5MA 1D6SA 3IKLA 3H3XA 4C3ZA 4ZD6A 3GFRA 1XL0A 1RJFA 2FQYA 4DYHA 4CLXA 4FR2A 3VZBA 2Q7XA 1FX0A 1P44A 3F2IA 1XNJA 4D56A 2AIRA 2X1HA 4IOLA 3Q7QA 2OGUA 3K9FC 3Q15C 4ZJPA 1DCMA 4IEFB 4POOA 4IS3A 1NXSA 3ESXA 1E9CA 3BE8A 4X3CA 2BEJA 3D8BA 4KWHA 2HMTA 3WV4A 3W5CA 3BAFA 4CEHB 4LYEA 4I4LA 3G85A 1EDOA 5KC9A 1K97A 4UVHA 1J5XA 2FEKA 4WTOA 4LF6B 3UUWA 4UQLA 2W90A 2ZE5A 3M8KA 1O6BA 4KLCA 2ZYVX 3VJMA 3ZI0A 1X7WB 1P61B 1S7GA 1LZLA 4QT0A 1RI4A 2R97A 5AVTA 5KJCA 1VIMA 4BIIA 4W5WA 3NORA 4P3YA 4DMKA 5COQA 2JFGA 2X9GA 3GI1A 1BVYF 2KLHA 3LZDA 1NVXQ 3B20A 4B7XA 2DMRA 3UH1A 2ZUUA 1QPGA 4BV9A 2XKBA 1Z0DA 1IQPA 3CUYA 4I5FA 1Y8RA 3QKSA 1NR1A 1B23P 1ZAKA 4C0LA 1EUZA 1Q3KA 2CXSA 4HAOA 4YRJA 3UKOA 4IDNA 3I30X 5JWHA 4EFDA 5CFZA 1MRZA 2IF0A 4IO1A 5I9LA 3HPQA 1O57A 3IDFA 4HH3C 3RSFA 1OB5A 1E0SA 1TYDE 4G0OA 2WUVA 3MINB 4CT5A 2MR5A 2W4IA 3CX7A 5LBUA 2Q07A 4OI4A 4TTAA 3ZX5A 2O48X 2QDXA 3EMBA 4YJGA 1NVAA 4AD8A 1VLQA 1X7XA 1A4IA 4RCYA 2EQAA 3LYAA 1Q6ZA 3GMDA 5AM1A 3UCEA 5TQ2B 1BFUA 1Y9JA 3Q9NA 3COZA 3QSGA 2ENUA 4AJOA 3GJ3A 5HZKA 1G9TA 2IGTA 2R0QC 3S8MA 2X13A 2XA2A 4LBVA 2WPNA 3BPSA 3JATA 3LD9A 3TTVA 4YHBA 1KPGA 3OLXA 2OBNA 4P3NA 3SYKA 4FDVA 2WWYA 2Q8QA 3ACDA 4FOPA 4FEEA 5K1ZA 4DLRA 5IJ9B 2POCA 2XY4A 3ANMA 4MVJP 2HIHA 4OGLA 5CD9A 4IVPA 2XODA 4HDAA 4XRGA 4JFRA 1RLTA 1SCNE 2JH3A 4LE0A 3W90A 4E1BA 1RZRA 1QP7A 2RAPA 2R65A 3B1YA 3MXOA 1BX1A 4HWOA 4TXNA 4UBOA 5TMDA 3WL7A 3H84A 4KQKA 2DY0A 1PSZA 5F2EA 2B8JA 2BCEA 5E6RA 3SI7A 2WE7A 3ZX4A 3SSAA 4FB5A 1W4ZA 3ZW7A 5CB4F 2EFGA 1P60A 4OH1A 4DCTA 4G5XA 3OCZA 1NUAA 1X39A 2QW0X 4LK3A 3WO0A 4ZJYA 4CTJA 5CVEA 1NXTA 5CX4A 4R5MA 1M5UA 4W1QA 1ZEMA 4B7AA 2CWDA 3GDFA 4C78A 4DLSA 4RS3A 3QU5A 2PZAA 1VFPA 1Z34A 3GJRA 2GH1A 3I0NA 4HS9A 4RLSA 3TLMA 1PP4A 1UKAA 2XCUA 5FFMA 1FUIA 5ESDA 1IXSB 1XZPA 2F67A 2O14A 1ZXBA 2V54A 2VEDA 2ZWOA 3AI1A 5ED0A 4XVUA 5JAUA 5E0OA 1K7XB 4XB1A 1R6BX 1TZBA 1QDEA 2I6XA 3IJ5A 4IG9A 4TUYA 4KI0A 4FDUA 4OXQA 4ZZ2A 4C89A 2B37A 1TECE 5DSZA 1NNUA 2P1ZA 2QQEA 1OH5A 2W6ID 1PS0A 3TLKA 2PUWA 3MS7A 1TJYA 2PLRA 1KEUA 1P5RA 1H8HA 1JTEA 2R84A 3CRNA 4M0CA 3ZQUA 1UWLA 2DQSA 3HY4A 2GQ0A 2OV1A 3E7DA 4M55A 2C0PA 1L4FA 3JV7A 1PFWA 1TUBA 1UBCA 2VR1A 4GNRA 2VP9A 5KYXA 3GK3A 2A0YA 1KEEA 1S2IA 1UDBA 2CXRA 3O2NA 2WZBA 1ESNA 5DCWA 4BN0A 1Y7IA 3W0LB 5I7OA 5C53B 3WGNA 4JQYA 2WAAA 4TYPA 5EYPA 2CE2X 3K4HA 1ECJA 1UWCA 5A9TA 3TGLA 1T3HA 1JFTA 2GEFA 3FMGA 1HR0B 4YRDA 3ZS8A 4FYJA 2GKSA 1L7NA 2AOVA 2JZOA 1BN6A 3BKWA 3OE1A 1JEQA 3V6MA 4EGAA 4AQ7A 1DBPA 1E2QA 3LSYA 3D6VA 5BR4A 3U9TA 4BNLA 3RK4A 2FZ5A 3EY9A 5D5QA 4CDNA 4DXAA 1C7IA 4WJZA 4E31A 2YJGA 4QM7A 1PJZA 4QU5A 2O2GA 2BY4A 2AD1A 1NQWA 4QXOA 1U8AA 2ZBUA 1AKNA 3EZYA 4H7JA 2WNHA 1IG0A 4IOMA 3KVOA 3KIPA 1XA3A 3ITEA 1G4UR 3FCSB 5GTDA 4I9NA 1E6CA 4GXRA 2D5BA 2II6A 4IVQA 1L7BA 2ZIZA 3IQGX 5B5SA 1BXGB 1OFUX 4ZDKA 1DPFA 2QZPA 1P2UA 1I5OA 2H5JA 3FLBA 2M9MA 4LVCA 4D8TA 4DXHA 1QHHB 1BEZA 1CZHA 2I4TA 4QQKA 1P1BA 3ZV5A 4FDLA 4B34A 4I9HA 5CA0B 3IV9A 4R68A 4WACA 1QH8B 4MLDA 5CM8B 5AVOA 5HRUA 1XTIA 3L7JA 4WBNB 5C8XA 5KYVA 1EUCB 3ZC3A 3I5YA 4E88A 1JFLA 2O5RA 2D0IA 2OZEA 2QLMA 4IOJA 5HG0A 5ICCA 2VATA 3T1YB 3HBAA 1DDGA 1A04A 4H17A 5BSMA 2X0KA 2JS7A 1ZDMA 4MVWA 5JVDA 2QA5A 3DTVB 4QKQA 1XTSA 1P0FA 4XZ3A 5I7VA 5IM4F 3F3KA 4AP9A 1H0KA 1RBMA 4M9XA 3C3CA 4BAZA 1VGVA 4IHAA 5F4ZA 1QCCA 5F35A 2HK8A 4EUSA 2NPIA 2C2WA 2PR2A 1YNOA 1F4PA 4YJ3B 2OQ2A 3HNOA 3IAFA 1KI2A 4N0PA 4ZPXA 4AJKA 5DEIA 4CETA 5K0CA 5CIYA 4BJ3A 4CGZA 3FSGA 5FTKA 1YJQA 1REQB 3NUZA 4H3HB 4ZRDA 5DM1A 3JQBC 1SBNE 4J16C 3IELA 3MHPA 5M3BA 2PUCA 2Q50A 4GE0A 2P5YA 4FX2A 1S8NA 4F7WA 2OKCA 2UUCB 1F9AA 3EF0A 4H1UA 4TVOA 2FEXA 4C3UA 2O2XA 4DYDA 5LDHA 2YQZA 3RG2A 4ZYUA 2PPLA 4DJTA 1DXQA 1NUUA 2R4QA 3N7UA 1ESCA 2F8SA 2C3OA 2H5LA 3FDFA 1CIPA 1FSSA 4LC0A 2YCBA 4E2FA 1G21B 5J23A 3F49S 1WEHA 1U0JA 2WILA 4HFMA 4NE2A 1SY7A 2J33A 2EWMA 2MMCA 4Q00A 5DNVA 4L51A 1ST2A 4M8KA 4MV6A 1R8JA 3UUEA 3V48A 5FUVA 4F12A 2OK8A 3SKYA 4LF5B 5FBHA 3NRBA 1W49A 2DU8A 4GE3A 4GLOA 4QOJA 1P7PA 1AS3A 3OCJA 5CDUA 1W96A 5CEEA 1GTRA 3K5HA 4MINA 2EZTA 2ZVJA 1RWKA 3P9PA 1S4MA 4FTWA 3KOOA 3OSUA 2D4HA 1QHXA 2AF3C 5GV7A 4CMJA 1W87A 3CA8A 4KUHA 5F52A 4CMCA 4E15A 2XKAA 3PGVA 2UVDA 3RSOA 3DYBA 2B7CA 4IJ5A 1SU7A 5HS6A 2MU1A 3U7QA 1BQ4A 4ER6A 3DL7A 1I4OA 3FYSA 3IH5A 3BJEA 4HK4A 2C77A 3PP8A 4U2GA 5CHYA 3AJ9A 3VISA 4BMCA 3LUAA 3NH9A 1RHJA 2GMWA 2JK0A 4MIEA 3BCUA 4YMWA 2F00A 2CEAA 1KDYA 3REOA 2Q29A 4G3XA 3AZQA 1PG5A 5T4FA 4KYVA 4AJ1A 2FRVA 2RB5A 3D59A 4QGBA 1OI3A 3KU4A 2FSIA 2O52A 2OLKA 3DGFC 4UMVA 3REGA 4UNSA 4M88A 2AXNA 1M1UA 2C00A 2VDLB 3ZCXA 4D45A 2QGNA 1LVHA 3OWOA 3D2BA 5KNCA 2HMWA 4ZT4A 4X61A 1GPUA 4OK3A 2W6PA 4PX2A 2P1DA 4CEIB 1QAMA 1E20A 1XMSA 4LBZA 3KAPA 4Q1EA 4KJXA 4DIFA 4F4CA 1C0KA 5DGHA 3G49A 2UU9B 3DKVA 3JZAA 2JLBA 1OAOA 3PK0A 3ZQ6A 4CV0A 2MYTA 1X8JA 2CD7A 3WYDA 5AUNB 2P2DA 4B5KA 2VOEA 3PWKA 3A6FA 2BZ1A 3HKEA 5CXXA 1DTSA 1QFJA 2GZHA 2Z43A 1COZA 3CXUA 3Q9SA 2FLKA 5G4KA 5GZ1A 1WOYA 3JAMA 2JIMA 2R7NA 4AJJA 4HSGA 2BGKA 4X20B 1PL0A 2O2ZA 2X2FA 4MW2A 3GDWA 1BJTA 1F51E 4H4DA 2GPNA 3UCFA 1C0EA 4M1KA 3VHRA 1I0ZA 3GFTA 4I81A 2DPLA 4RZSA 3R7BA 2ZB3A 2WQ6A 1N34B 4NHEA 1WXDA 4S0XA 1JSCA 1DIGA 4HUQB 4UZEA 1M9NA 2JFFA 5E2BA 3VTKA 2EV9A 3WRXC 1DAMA 3H83A 2FETA 4O29A 4LI3X 1E99A 1PD0A 1RU3A 1J2JA 3DCNA 1GNLA 4UXIA 4WOCA 3ZG6A 3HXTA 1W5AA 2O1EA 3PF9A 1IL0A 1GOTA 3ZU5A 1KO7A 1UAAA 6YASA 3MJEA 2V0GA 1Z22A 4JWTA 4C6TB 3ROGA 3O3CA 4RKRA 4BP9A 3GDOA 2W6JD 1E69A 2XWJI 2W0SA 3PCTA 3R3WA 2FX5A 2JJ8A 2ZR7A 1K6IA 2C2MA 4CMAA 1QH9A 1NLYA 3LHDA 3AUUA 5JO0A 2AJDA 2OTCA 3BGIA 1MX5A 1RXIA 1R88A 4L9AA 4F7DA 4J6FA 1VSTA 4R1LA 1USKA 2HV8A 5AO9A 4EBBA 4H15A 1DP4A 3GVCA 1YT5A 3CLTC 2PUHA 2CXXA 4IPTA 3IAS1 3GJ8A 2NUPA 1GRCA 2RBGA 2UZ0A 3JWHA 1W6RA 2YFHA 3AF5A 1SVNA 1XMPA 1ADCA 2G1AA 3A6LA 4JNCA 1WXEA 5BW6B 1L4BA 4EPRA 1FLVA 2WMDA 1YACA 4Q6BA 1V2GA 3DZBA 1N1DA 1NOJA 2WKRA 4U7PB 4Q05A 4R8SA 4OIMA 4ZO9A 1G59A 3RFUA 1I30A 3ETDA 3W4KA 3LTEA 5H9WA 5JSUA 2I99A 4S3MA 4Q9DA 4P4SB 2JFXA 2ODAA 5IS2A 2W58A 4LE1A 3RPEA 1KQGA 4EY8A 4LQ4A 2XDWA 3ISTA 1KNQA 2YZGA 1EGMB 1JF8A 1ZJ5A 2HQRA 3ROXA 4DBVO 1NJSA 1Z7GA 5TR9A 4OLFA 1NFFA 1TKBA 4FI3C 3ECAA 4CL3A 5J5AA 1AK2A 3OJCA 2DERA 4NRDA 4J0JA 3VYVA 1J2EA 3WZMA 3IBCA 3H5WA 2FW7A 4IDAA 1WZEA 4L3WA 1FPQA 3EUWA 1NU6A 3MMXA 1JXOA 4RGBA 5BOVA 3TIFA 3A9CA 2BFWA 2HCJB 5DM2A 4A6XA 4BMPB 1V5IA 4EPXA 1QFZA 4K03A 3WL6A 5BWBA 3GJ7A 2ZGVA 3HJBA 3PVZA 4RYLA 1HSOA 3E58A 2O5CA 5AKLA 3TECE 1M7BA 2D2IA 1O87A 4CIAA 2JARA 1SR8A 2XRZA 4JVNA 3RABA 4XVHA 1QK4A 1TM7E 2VH5R 4JJEA 3GPDG 5AW3A 5DTIA 4Y1RA 5JIBA 1VLJA 2R1VA 1I9CA 4FHZA 4LRQA 1GZHB 3QX8A 3BJZA 4OQMA 3ZDFA 3CE6A 1XFDA 5CH5A 2VJBA 2GPYA 3DJFA 2H1SA 4N48A 1P5FA 1HZZA 1P2GA 1YS4A 2PKYX 1L7RA 2V65A 3EXG1 1X7ZB 2HHAA 1TIBA 3MA0A 2JD2A 1NURA 1OXXK 3K1JA 2QPTA 4WVFA 3OTIA 1XRNA 3BMQA 4CKWB 4ND1A 3ND5A 4WOBA 3SX2A 5CA0A 2F3SA 1T2FA 2ADOA 1KTVA 1CLEA 2PXCA 3KB2A 4Q1DA 1D6JA 4ZOEA 5FYQA 5LLSA 1FYVA 4DLVA 1QIKA 2IP2A 2V7QD 1WZUA 2A0WA 4PO1A 3V80A 5ESRA 1XQ1A 1IVSA 4HYYA 4OJYA 2PX6A 4R83A 2XUFA 4CQMA 1QK3A 3HCOA 5J58A 1QRRA 2AW5A 3F6PA 2WJVA 4TUYF 1MLDA 1LU9A 2GWRA 3G9QA 2P9CA 4Z3DA 5I3CA 2FGKA 3WAGA 4NV0A 1Y3BE 2IP4A 2LGJA 3KR1A 3OCVA 3BCRA 4JLAA 1QZZA 2IIBA 4FHEA 3HYNA 4AWXA 1P7VA 1LW6E 4LVOA 4UUMA 1RC1A 4PFQA 5AVQA 1MENA 2JHAA 4YJ3A 5EIHA 1NRJB 2ZE6A 3C5HA 5JXJA 3ZQ4A 3AOEC 2V5UA 1B8OA 2PBRA 3P2IA 2XJ9A 2B69A 3E15A 2O8EB 2PYDA 4N40A 1BAPA 1E62A 3TGWA 4X1IA 3MS2A 1QC5A 3GU3A 2YZ7A 1U8TA 4YJHB 3RCBA 2FUEA 5LP6C 3WB9A 2IV7A 1PR4A 3DA8A 1I51A 2WA2A 2F64A 3I2YX 2X8LA 4Q3KA 4MEBA 4MVXA 3O3NB 2WMYA 3KQUA 2J0EA 1NE2A 1R6VA 3H2BA 5A2QA 3K8OE 4DWVA 1TKAA 2NQTA 5E4JA 1RXCA 3PWZA 3O0DA 1NVMB 1X74A 1XTKA 1G20A 2WSSD 3GBPA 3SS8A 4P4UA 3FUUA 1KJNA 5C31A 1MZVA 1A95A 4R2XA 1R6DA 2CHUA 1CY0A 3CLUC 1IY0A 3LH5A 2BKXA 2MYNA 5HF6A 5SZIA 4EGSA 1EE1A 1Z0UA 1R27A 2QAGC 3ZHBA 3QI7A 2CEKA 4M0PA 3ZGOA 4DUZB 1GCUA 5KWJA 4OQZA 3WK5A 2CMHA 2J30A 3E27A 3OPVA 2A9FA 4FGWA 5E9QA 3WQHA 3E03A 1SEPA 1Z36A 2CMDA 3PPYA 5KYUB 1M83A 1D7OA 5TEWA 3RNOA 3I62A 1H2XA 3W2HA 3TJMA 3QFHA 3T3GA 1L8XA 4BMDA 3U7FB 4PG6A 4Q4HB 2WC1A 4KUEA 4P4NA 4G0XA 1LNQA 2QNBA 3G5UA 4RW0A 3HB9A 2JLCA 4RIEA 4WLNA 4WZBE 3IP7A 2COUA 3NHBA 4XM0A 1S5PA 4UUNA 3TQOA 3QBTA 5DASA 1UMBB 5WRFA 2CNWD 3S7TA 4ERNA 3BQ9A 4JMPA 1MNAA 4UJ3A 3U44A 4RZ3A 2BUAA 4RU1A 3VMFA 3F3YA 3NAZA 4Q03A 3IR7A 3PDUA 4FGJA 2X1LA 3PF8A 4ZYWA 4EF5A 4TTSA 5L3VA 5J4HA 3UUGA 3D31A 5J63A