3ISVA

Crystal structure of glutamate racemase from listeria monocytogenes in complex with acetate ion
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
265
Chain Sequence
AMKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHNLLDATDEEEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glutamate racemase
publication title Crystal structure of glutamate racemase from Listeria monocytogenes in complex with acetate ion
rcsb
source organism Listeria monocytogenes
total genus 95
structure length 265
sequence length 266
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3isvA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3isvA01
5ELMA 3OJCA 2OHGA 5HRAA 3ISTA 3UHOA 2OHOA 2JFXA 2JFPA 2JFQA 2W4IA 2EQ5A 5HJ7A 3S7ZA 5HRCA 3S81A 3ISVA 2JFOA 5HQTA 5IJWA 2DWUA 1JFLA 2DGDA 1ZUWA 3UHPA 2JFZA 2OHVA 2JFYA 3HFRA 2ZSKA 2JFVA 5ELLA 2VVTA 3UHFA 2JFUA 2DX7A 4B1FA 5EVCA 3OUTA 2JFWA 1B74A 1B73A 1IU9A 2GZMA 2JFNA
chains in the Genus database with same CATH superfamily
4WESB 1LDBA 2AI2A 2A9KA 1JLLB 3FDXA 1WP4A 3HFJA 4LNHA 4QUIA 4B32A 1HR0B 2NXCA 1B8PA 5FTLA 1Z28A 1OQAA 3S5JA 2F1IA 3JVVA 1PJAA 4D42A 2Z6QA 1E4EA 4JAVC 3HGTA 4JJ4A 4RH3A 4CCYB 2GA9A 4LXYA 4PN3A 3DZHA 3TI7A 5J2UF 1GAQA 5K4HA 5JH7F 1UMCA 5ARBA 3E9CA 5K8JB 4H1HA 2ORED 4O4LA 3FWZA 1JAHA 2BIFA 4N6GA 4P4LA 1P3DA 4EY8A 4IUCS 2VC2B 1B93A 1YUNA 3ZI0A 1E9EA 1JDBB 3HKEA 1JFRA 2EX1A 2QSYA 2GRUA 2XXBA 2CLCX 3EVTA 4K9LA 3PDIB 2WTEA 4OYHA 4YP5A 4DTCA 3MJVA 1RZRD 3O8OA 4ENRA 2NXWA 1JFSA 9LDBA 4Q12A 3KQLA 4ZQHA 1K4KA 3CE9A 4UUMA 5JS2A 3ZGLA 1P6XA 3ONVA 2OSVA 5A06A 1SD5A 3DD5A 3WQQA 1K6JA 3K72B 4TZTA 1DG1G 1RJGA 1SK9A 1LI5A 4EVQA 3DE7X 1L7MA 2B94A 2GBLA 3C85A 1C7EA 2P4EA 5F76A 2Q3BA 4YREA 4W99A 1EGAA 4HDCA 5AR1A 3KKNA 5HYVA 3F98A 1DDIA 1SOVA 2GZDA 1QLHA 5CHYA 3S40A 1IHPA 1TIPA 4GZ6A 2L42A 4S24A 4FN4A 1N92A 3G2HA 2IYSA 4L8FA 4F4UA 1KEEA 1N9ZA 1O2DA 4S1NA 1NYRA 3TUIC 3NDJA 1C7ZA 2H4XA 1KA9H 2DT8A 2YVAA 2CBXA 5GZ6A 3MWKA 1YJBA 3D02A 1C7IA 1LI4A 2PT7A 5KWEA 4AL4A 3EISA 4J0IA 1J7JA 1DPFA 4CT4B 4WFJA 1X7WA 5DULA 2RBKA 5KO2A 4JXJA 4ZV7A 5F7XA 1VL0A 2P30A 2QVLA 1JT2A 1TRKA 1AUVA 3EZNA 1J8DA 4ND3A 1NR7A 2CLKB 3ISJA 1DAKA 1Y7TA 3A4IA 2I29A 3V7UA 4IJQA 1QK3A 3CLRD 1T9GS 4BNKA 1P2UA 5EP3A 3CTPA 3KBOA 1T5LA 1WUIS 3DUFA 1EX7A 3O8DA 1W96A 5AK3A 1LNSA 1RAAA 3BHIA 3GEGA 1MG5A 4QPZA 1SUDA 3JQPA 3PHCA 4F92B 3FSGD 2ETXA 2CLMB 5TX7A 1L1FA 4BLUA 2FWJA 3QU7A 3EY9A 1LJUA 2JCBA 3EUAA 4MQEB 4PG4A 2R3SA 1X7XB 4LJ6A 3C8MA 3EVEA 4DN6A 2CL6X 1MC1A 2FJ0A 5A6SA 2RSLA 1U9IA 1XAHA 1Q50A 1T5SA 1E3EA 1A8SA 1WMSA 1JKIA 1V4VA 2B98A 3JAWB 1YBAA 1Z29A 4I1IA 4X41A 4H7PA 4FJ0A 4AKTA 3CONA 2BZGA 2JD2A 3B1XA 2HMSA 2FG5A 1SQ0A 1M1UA 1P0QA 3EZFA 4WA7A 4IDBA 3E7PA 4TS9A 4FS3A 1M34A 4LE0A 5CVJA 3IOBA 3GLIA 1ISSA 3B1ZA 3OTGA 2O5RA 4FC7A 4ND1A 3PI6A 5CW2A 3PK0A 4EVIA 2V1UA 1MXHA 2A84A 4WOPA 2XWJI 4E09A 1GPKA 1KH3A 4AY5A 4J0JA 4C0WA 1B0AA 1M2NA 2FN8A 2NZVG 2DY0A 1Y4ZA 3GBPA 4COKA 4GC5A 5K01A 2EBUA 4Z9BA 2Z3VA 3SN6A 3MWEB 5EY5B 1IVNA 2QV0A 2BTQB 3NIBA 4J3NA 2PL3A 4UAVA 4ZRMA 4DMRA 5IUNC 1NFFA 3TSWA 5I51A 5KYGA 2GM3A 3P5SA 3IR5A 5HOEA 5EKDA 4BLQA 1WUHS 1VIVA 2B8JA 3UT5A 4R0MA 1JDNA 2I9PA 2FCRA 3OPYI 4H7HA 5MF6A 5DW0A 4Q02A 1I5EA 1DOAA 4WERA 1JKXA 1LK7A 2B82A 4D96A 2P40A 3UMRA 5LP6F 1DAIA 2GEUA 1YR7A 3S29A 4BQEA 3HJTA 3KQKA 4Q4JB 1AY0A 1FSGA 1ORVA 3GH3A 3DBLB 1V8BA 4WESA 3O1JC 5IN5A 4ZWNA 1IG0A 2ZPUA 4PX9A 1UXJA 4WXMA 5EXTA 4YRIA 1P4SA 5LWQA 2OBMA 1U8EA 1U0TA 4ZVNA 4XUCA 1BU8A 2H7YA 4PG8A 5KC9A 1XP8A 3IEPA 4HTFB 1LSUA 2GSWA 4ZVRA 1GPBA 1VHLA 1WF3A 2QAIA 1MGPA 1Z4MA 4GMXA 4UEJA 3TE7A 2MCFA 1EK6A 1MP0A 1S1MA 3BD9A 2W2QA 3IB6A 3U6BA 1WZCA 4FB5A 1T1RA 2FHSA 1UBJS 3RS2A 5LQKA 1SVWA 2D1QA 1JNYA 2EEPA 3HJRA 4TWJA 3TKYA 4OREX 2QT1A 1FLNA 1KJNA 3PDIA 3ZYCA 2SNIE 2OA0A 1T2EA 3E9EA 3M9WA 3X0DA 3QW4B 4MSUA 1XXHE 2V6BA 2XB4A 4DILA 4BJ6A 2BRUC 1SHTX 2FQYA 4BB9A 3FXAA 2QD1A 5IP5A 3ZNQA 1H6BA 1HUQA 2HA3A 3F5FA 4J1TC 3RTCA 3DPSA 3D2BA 3PHGA 5CR9A 5EZYF 3VR6D 2PX3A 3CISA 4CF7A 3D3KA 1T5BA 4IPTA 4Z0PA 1XYGA 4ARUA 1E7WA 1D2MA 4NYJR 4D9MA 1G5QA 5FUBA 4Z5XA 3CUSA 4L73A 3WGJA 2GESA 4GM1A 3MSXA 2X5NA 4QJ3A 1JHDA 3EFBA 2GR9A 1Y98A 2IELA 3IESA 4PX3A 1CDEA 2PMFA 3VO9A 1JH9A 3G2LA 4CMKA 3GUUA 1D04A 3W3AA 4R98A 3OPMA 4UFOA 1G3IA 3DFMA 5ALQA 5GQSA 2WJVA 3SEQA 1FUKA 4YHBA 4B35A 2XB2A 1U2PA 3T3GA 2C4MA 2VRBA 2W0MA 4HEQA 5IMBA 4MCIA 3TOZA 3IUYA 4QWWA 2OY0A 2QGZA 2YW2A 2O59A 1CJTC 2Q4BA 4O59O 3AETB 4V0KA 1WU7A 3UBTA 3T1OA 2DJIA 3U1BA 3KRTA 1FSSA 3T1VA 5TB5A 3LIIA 3M82A 3RVKA 3F7TA 3GGCA 3HR7A 1GG5A 1N5DA 3UPTA 1BMTA 1VB3A 2X4DA 3H1EA 4QWMA 4M9SA 2W6PA 1SXPA 1UANA 1YHNA 2F00A 4NJEB 4OK6A 5FEMA 4OQYA 3WA6A 3KJGA 5JNVA 3MHTA 1SCQA 1MGOA 4YDSA 4ALNA 1MEOA 1E2UA 1GAWA 4JOCA 4LV6A 4OLAA 1UOEA 2IOHA 1IHOA 3DLBA 3LOQA 2YFYA 4CF3A 2FTKE 1ZRHA 5EJ5A 1M75A 3B1VA 4R1UA 2B3TA 2D0IA 2YWEA 5EIWA 5BV1A 3FKSD 3KVOA 3COJA 3UW3A 1KWKA 3UWOA 2BI8A 3M5DA 4ZHQF 2JFVA 1WXQA 1TB4A 3OIUA 3UKJA 2ORWA 1UBOS 3W6OA 4IQ8A 2FU5C 4L02A 5ESDA 4EAAA 4XI9A 3P9KA 5DSXA 2CT8A 1WCIB 4FZ3A 1Z0KA 2A30A 3FMFA 1N34B 3MTIA 3O3OB 1YR9A 2BKAA 2NU7B 2ZTHA 5LUBA 5FBRB 2X5XA 3EEQA 3K2EA 1M6WA 2JHFA 3R23A 5FLYA 3ZIUA 2J9RA 1VLHA 4D44A 1PFKA 3K5IA 4FXPA 5LM3A 1UBUS 4Q93A 1Q1AA 3O2QB 4HDMA 1RHKA 3GJXC 4K9KA 3RJ9A 3FLEA 3MIZA 1GYPA 1SKMA 1WSWA 3USCS 1P7VA 3NM6B 1GPWB 3NEJA 1L5LA 3VSAA 3WG9A 4F4FA 4DG8A 1YA4A 2BTQA 1K06A 1F2UB 3EDYA 2I3ZA 3PD0A 3UCFA 1ZGGA 3E7FA 4U7PB 5BY2A 4GNKA 2A57A 1SVLA 2AHOA 4L4RA 4XASA 4GMDA 1S2OA 1YFLA 4K81B 3UO8B 4RACA 1OU4A 2E4XA 4BNMA 3AUUA 4JL6A 3KOXA 4FS8A 1EFHA 2D4HA 2DTEA 4LZPA 4ME6A 4WK0B 1U81A 5J43A 5EJ7A 1OBCA 1SKYB 2BFOA 3RW9A 3B5JA 1KBZA 4UNQA 1TU3A 1YFKA 4D3DA 1EGMB 3G02A 2JIZD 1DHRA 4M83A 5IS2A 4LC0A 1QQ5A 3HA7A 3DXYA 3ROXA 1BRMA 3S4YA 2O8BB 4RPGA 3KU1A 1EDOA 4U7FA 3BF8A 2SECE 2D54A 4ER0A 3SWWA 4JEUA 1FTGA 4JP8A 5CFZA 3UW1A 2Z3WA 4AFNA 3K20A 2BGTA 1NAIA 3R0IA 1IRIA 1QHXA 4JJFA 1ORIA 3FPEA 4PYKA 1G8GA 4NYIQ 3ZOKA 4B2LA 2QTVB 4KMMA 2YHAA 3BGVA 3NS7A 1MV5A 2GBIA 3SM9A 4QODA 1ZC3A 1Z26A 3L04A 5CDFA 3F5DA 1P7ZA 3QXCA 4LJ5A 2WTUA 1ODSA 2WWTA 3IPAA 3ER9A 1NBMD 1T24A 3RBVA 3L0ZA 3FMPB 4MUMA 3UFXB 4P81A 3SZGA 3PJRA 3DE0X 3OJXA 5IVKA 4ESOA 2XDQB 4BFLA 3ZY6A 3QF4B 2AOUB 1K4MA 2C58A 4TMVA 2WU4A 4DS3A 3M4JA 1FMLA 4KDEA 3P45A 1P2BA 5I7HA 1T8TA 2IEIA 3I04A 3A9RA 4UZFA 2I34A 3DYIA 2WU1A 4ZPXA 5BV2P 5FOUA 4OQFA 1IJBA 1NDQA 3T9BA 1RMYA 1TK2A 1W4ZA 5HM8A 5JZBA 1YC5A 3FKJA 1JPUA 3F1KA 1GNTA 3U4IA 3C1TA 4G1BA 1BCSA 4JT8A 3I4CA 5TQ2B 3DT8A 3V7NA 3MS7A 5EIOA 2QRVB 1SG9A 3PFFA 3EZYA 3BSYA 3K9LA 1FYEA 4JXKA 4PHHA 4EJSB 2WM2A 4HQNA 4L4UA 2ECOA 3TWOA 2F48A 1XDWA 3TBKA 5K4AA 2O8DA 3ORFA 4U7DA 3AP3A 2A0XA 4NY1A 2FR1A 5L6MB 3DOEA 5KEIA 3U4GA 5LP1A 3LKDA 1W73A 3P2MA 3PEFA 3NTLA 1T6YA 4XIJA 3GLSA 2G5TA 2GHTA 4AK9A 2FPRA 1DI0A 4FX2A 1CD5A 2E87A 1TMYA 2J4FA 4HZGA 3M1LA 2FR8A 4LWOA 3LOUA 1H8EA 4HXFB 2FRDC 4BO4A 3QBEA 2FUKA 1K9VF 4Y2VA 2XW6A 1ELOA 2PQ0A 4RSGA 4ZCMA 5KUTA 2FJPA 2G6BA 5JS1A 1HT2E 4FZ5A 3HO6A 3CRZA 5T4EA 2RGDA 2QRNA 1ENYA 4WKCA 4DV7B 1ZPDA 1PSWA 2AOWA 1L4FA 4OHCA 2BFWA 5KX5A 1ZS9A 3O2NA 1EB8A 3D3WB 4DM4A 5TPZD 5BSFA 1EZZA 1T9ZA 3SY8A 3FOWA 4PHCA 1P33A 1GG2A 2YXLA 3WNBA 3OETA 3GGPA 1UAAA 1DC5A 4L4XA 3I2JA 4D02A 4RBNA 1R0CA 3T3OA 5GZ1A 2GJ8A 3ZU2A 4TSFD 4LJ9A 4RCYA 1U04A 1SCDA 3H1AA 2VDMB 4MV6A 4MB6A 3X2FA 4C3UA 1AKVA 1RADA 1GT91 2GCNA 1SXJC 1NXWA 2ZIWB 3G5UA 4LFAB 3AUKA 3ESDA 3I01A 3W4IA 2ATCA 1F2UA 5AJYA 5HFJA 1TUGA 4RFLA 4R40A 2MMGA 3AGPA 3VBEA 4J43A 1BDJA 2YVKA 1P19A 3H9GA 3Q7SA 5BVHA 4PLVA 3IKVA 1WEKA 4TS1A 1MOQA 2WJ6A 2EWVA 5ELLA 3R5FA 2GPSA 5BR1A 1KVSA 1QG4A 1RSZA 3H84A 1OYWA 1A04A 2V7TA 4PC6A 4U7JA 4Y2TA 4MULA 3TTTA 4Z0NA 4EG8A 4Z54A 4M9RA 3CRQA 3CWCA 5FOTA 1DMSA 1BD4A 2QL6A 5DPMA 3CURA 4YO7A 2IP4A 1OT3A 2PNJA 3IBYA 5A2QA 2O23A 3UJ7A 4AMBA 1PEDA 3WC4A 2X1LA 2JGIA 3GRZA 2W6MA 3LT4A 1K89A 4BO1A 4X1YB 1QYXA 4Q21A 4D4MA 2ZUUA 5J5CA 3WIBA 4Y2RA 4MUKA 1FUIA 2BFMA 2BGKA 2PSEA 2PSJA 2XMRA 3F9RA 3HH8A 4QARA 3BULA 3W5DA 4K9QA 1XDDA 3KG2A 2F9MA 5K0SA 5I3ZA 1XU4A 4ARVA 2P3SA 5LQSA 3ZD7A 4CV1A 3DDNA 2QVBA 3FHJA 4WLUA 2HFKA 4MKZA 3U80A 3VDNB 4AS3A 3QE2A 1Q3TA 1DEXA 3WLRA 5SICE 2XA1A 1Y63A 4KQJA 1E2MA 4PYLA 3D7SA 2HLPA 3P26A 1OSNA 3L4JA 1G3UA 4AYTA 4G8BA 3UFXA 2JCVA 1E59A 1YBVA 4JI1B 1QR2A 1T8UA 3ZCTA 2IRWA 3BRWA 4D9BA 1QDEA 1R9JA 4AJ1A 2F90A 4HLUC 4ZAVA 1NUQA 4OQQA 5EEGA 1RAHA 2X6TA 2IUYA 4J16C 3V4FA 3GJSA 2ZPAA 4G89A 3D7MA 3OQIB 1MUUA 3TN7A 3QUTA 1DEHA 3SHVA 2TRSB 4M0CA 1MF7A 4BJ1A 1PVVA 1RAGA 1X1BA 3L3BA 4GYWA 4J9UE 4M9ZA 4E70A 1Y8AA 5CW1A 3WYEA 3KEQA 3BJMA 5F9HA 4UPEA 2FN3A 1YUBA 1HQDA 3D81A 4INPA 5H83A 1ZOOA 1UXHA 4YFYA 4XJTA 4ACAA 1AS3A 4B3FX 1ZLXA 3ZHZA 4FMDB 1ZD9A 2J07A 5DLPA 1I7PA 3OJEA 4BGEA 4RTSA 1JG4A 1XMQB 3D6HA 2F6RA 2NYUA 2QRVA 4EABA 1QAOA 3T7SA 2PT5A 3FZYA 5DU2A 1IQRA 4HB0A 3FPGA 5JO0A 2ZBGA 3P4YA 4YRRA 2WJIA 4KMOA 1DAFA 2QX8A 3HN6A 2ZR9A 4CBVA 1G6OA 1JA0A 3LHSA 1CUCA 3EZGA 3I61A 2V65A 4N3CA 3THSA 5CVUA 5LMNB 1T9AA 3R40A 1GL3A 4B2PA 3N3BC 1RYNA 1QFYA 3B1FA 3NHAA 5LQUA 1TKCA 3OOYA 3S8MA 3UT6A 2UKDA 1E9BA 4QGGA 1VRWA 3EZ9A 3GB9A 3RIGA 4M38A 2I7VA 2CMDA 4DJJA 2JIBA 4PSCA 4IVQA 4R3WA 2ZAIA 4DR3B 4MKFA 3PHBE 1AG9A 1BGWA 4JA0A 8ABPA 4AUNA 1O4WA 5JYCA 3PVSA 2V6JA 4RIHA 4BMDA 4JC5A 2LV8A 1USWA 2ZJ5A 3G79A 5E9AA 3CV3A 2ORVA 4TS3A 3MCVA 1N8TA 5A7FA 3I2FA 3IRUA 3D3WA 2WIKA 3IALA 1GNQA 4DA6A 3DOOA 2PH5A 1J5EB 3FPKA 3LPMA 4GXNA 5TARA 3U7HB 4DLKA 3RB8A 1E4VA 2A88A 1SQ5A 1IEWA 2VRCA 3L6OO 4G9EA 4F2DA 4R2IA 2R8BA 1U0OC 2P62A 1JXOA 1NTRA 4EA6A 3V7WA 2ZZMA 4AJEA 4CG2A 3OQNA 3N1UA 4JXZA 2QIPA 4OHVA 2YV4A 2ZT7A 3HDVA 2ZULA 2XKKA 5DWDA 5U4XA 4Y9RA 5WRFA 3U7IA 5LQRA 1E6CA 1TJ3A 1TT5A 1OFTA 2V97A 3O4IA 3WRXA 5B3KA 3A28A 5C18A 5BOSA 4CEIB 3QITA 2QIOA 3SG0A 4HNUA 1RAFA 2YJGA 3R0JA 3RFVA 2Y05A 4GQBA 2G3YA 3H2YA 4EY5A 3GLGA 1L5HA 4BOYA 1O6FA 1E1CA 1U2GA 2V6FA 2DFVA 1SG0A 1COWA 4YI5A 1OY1A 4CI9A 5B12A 4UD2A 1UFQA 2FI1A 1I0LA 2NYVA 3AFIA 2VHEA 4NABA 4Q9AA 3KQUA 1KZ6A 3UCXA 3GP3A 1N1MA 4AJHA 1QH9A 1NVUQ 3KZOA 4JDPA 1DCTA 2D7DA 1I2ZA 1KO5A 3NHJA 5B1IA 5GIOE 4CMEC 5B7GA 2B0JA 4W6ZA 3UH1A 1OA1A 2HD4A 3TXAA 2HU2A 1F12A 3TPZA 3LLCA 4N0DA 4W1PA 5D84A 5DYTA 3SR0A 1R5OA 3V8PA 5BVGB 4ZREA 1JS1X 2W2LD 5AW8A 3NDRA 2WSSD 4YP6A 3S1AB 1ZJYA 5LXTF 2G08A 2ZBVA 4JFAA 4ZV9A 4N4AA 1JHUA 1OGIA 1F5NA 3GJYA 1Y3HA 2HHJA 4S12A 4ERNA 3GNQA 2XGSA 3KS9A 1UAGA 3RSQA 3QE9Y 2HJGA 1FVFA 1U2ZA 3RG8A 3V9PA 5I7UA 2CUKA 2QVGA 4HB3A 4OIFA 5IJ9B 2XWSA 1X0VA 3ZE8A 5ICEA 4URWR 2B1GA 4TWZA 5FI3A 3UXEA 3AM5A 1A2QA 1N3YA 3CZAA 3OX4A 1YQDA 2WSYB 3ND9A 5D3ZA 5K2MA 3ST7A 4DCVA 1AXRA 3PEUA 4G5OA 3EA4A 4DDTA 3G7UA 2EWWA 5AVQA 4UEWA 1B6TA 2ZJ0A 3TLAA 1EWRA 5AKHA 4V03A 3ZWAA 4CUKA 3DBHB 5I4BA 3HYTA 1B1CA 5LPNA 2EBFX 3UJAA 4UM9B 2H1LA 3L4BA 2ZU6A 2P7IA 3ZJYA 1BKSB 2AZ4A 1G5IA 2OHOA 3IDZA 2PIAA 3V8NA 1GG8A 1XVUA 2WWRA 4XX1A 3FHLA 2Y1KA 4UW9A 2PUGA 3UN1A 1QHIA 2IQIA 1FPQA 1YDEA 2HXYA 3LO8A 5FD8A 3U4AA 1IY8A 1GGEA 2GYVA 4MS4B 5DYWA 4F5WA 1AMUA 2WD9A 5A7HA 1Z0FA 4J0KA 4KTVE 1YIOA 4PFJA 2GN6A 1RPNA 1UEXC 4DMFA 3ZKWA 3PFHA 3F49S 1MQAA 1PZEA 1M0SA 1PWHA 2PWPA 3LXRA 4J0CA 1EUCB 4XR4A 2JEZA 3R3XA 1MFPA 5LA6F 2AFHA 2BFFA 2QTGA 1G98A 2FEAA 4MWDA 1PL6A 1RWBA 2OESA 3BS4A 2C9MA 2JA1A 1ECFA 2O1SA 5FORA 3SR3A 1E7QA 5JU6A 5IM5A 1AZTA 4HLDA 5CT6A 4IIBA 2VEOA 2Y4OA 2B92A 2G5PA 2JJYA 1ZNZA 1K7FB 5CVTA 2HJHA 3RD5A 1WUTA 1SC6A 3HQ4O 3OM0A 4IH4A 4QOEA 4LE1A 1PD0A 1ODKA 3JZAA 4B3RB 1P9NA 1P0CA 2ASEA 3D6NB 1Z2OX 2XWPA 4JB3A 4OJQA 1H2XA 4WEOA 3CKLA 5EA2A 2C03A 4A2QA 4HN4B 1L0BA 3MT0A 1GPNA 1AV6A 4DUZB 3EFEA 4QUAA 3WGVA 1NV9A 1GAJA 3OWXA 5LU9A 4ILEA 2CXSA 2A3NA 4BMOB 5KVCA 2IWRA 3R3WA 2GZMA 2QM0A 1T29A 3HHEA 3THOA 1S7CA 2X0IA 1KBQA 4O4HA 4WZZA 3VFDA 1FFHA 4JASB 1NC3A 4FONA 4R8RA 2VWPA 3RS9A 4F1KA 5GONB 4GE3A 1JR2A 2WA1A 1AUQA 1P39A 2ERCA 2YQ4A 4G01B 2PLWA 4R3UC 3RGWS 3N39C 5HIKA 4W5QA 2FAXA 2O2XA 3FCUB 5GJVC 1DO0A 2W2VA 1TVMA 1XCMA 3ASVA 3CB4A 3AFGA 5D6OA 5A05A 2VP2A 4D3ZA 4E2ZA 1HYBA 1VYUA 3PUYA 4F8YA 5ADVA 2ST1A 4Z7JA 5AW4A 2YUTA 2JDIA 4WOKA 1IN7A 1XTPA 4JC8A 3G8BA 3KXDA 5LNK6 1J07A 2L19A 3VDMA 4MWCA 5D86A 5JS7A 3KSRA 4II7A 3ITDA 3KJZA 4R8LA 3JQ9A 3QFCA 1BX1A 3NRCA 16PKA 1T4MA 4M37A 1CHDA 1T0UA 1R0ZA 4H6PA 3SZRA 1JYSA 3D8TA 3FTNA 3ZTTA 5TV2A 2A33A 1QO9A 4DDWA 4XFDA 1N3IA 2AT1A 2JAPA 3EJ6A 2G1UA 2ETVA 3ORSA 2C9CA 1T4BA 2GCIA 1N7IA 3PE6A 4FYJA 2OAGA 5BSEA 1UWLA 2VDKB 3DEKA 5DXJA 1JR3E 5DRTA 3K35A 3MCZA 3QYAA 1BIFA 2Q3MA 1JQBA 3PXAA 2YWJA 2JLZA 3S8EA 2WSMA 4KBGA 1LWNA 4MARA 1HLPA 1L3CA 1G5HA 4N1AA 2PJZA 3B20A 3P9NA 2JH3A 2DXIA 4P6VF 1JQDA 1OTXA 4I50F 1N8NA 3ADPA 3ROMA 4QTYA 4I5FA 3MYRA 2OORA 1WW2A 2V8BA 3EXG2 4LRQA 4CT0A 1G66A 2CWWA 3IBSA 5AHXA 5FFMA 1T36A 3W5UA 4MPDA 5A4AA 1OBVA 5FL7A 3S81A 1QUEA 1BWSA 1RIIA 2Q3JA 4GO1A 3R41A 4F4HA 4Z8XA 1CB7A 2GEDA 3OESA 5I9SA 3DEAA 3E7WA 2I0FA 1W85B 4PSAA 3SMQA 2DF8A 2ZI5A 3GT4A 3DBHA 1ZI9A 2V5UA 3A1DA 2WBLC 3LYAA 3M33A 4INZA 1U7ZA 2ZDQA 4G67A 1EE1A 3C3EA 2D00A 3HLYA 1TJYA 5AOAA 3G2PA 1VKOA 2O1EA 1F51E 2Y2VA 3S1LA 5DYIA 5JSZA 4QPNA 1OI2A 3BE4A 2PKQP 2C2OA 2Q5LA 4UM5A 5HGJA 3K32A 2C7GA 3AFNA 1D9XA 2ADFA 4V0OA 1C2TA 2BZ0A 2C2YA 5E4JA 4U2KA 2ZIGA 3PGLA 1HE3A 1Q0SA 4GVPA 3SZLA 1H1DA 4PSDA 2BEWB 1MX5A 3I37X 2IH4A 4MIKA 3K0FB 1QHGA 3PUVA 4OFWA 1WUJS 4ASUA 3T35A 4B4WA 4INOA 1I10A 2IU3A 3WB9A 1B1AA 3HXOA 2IPLA 2WB2A 3MM4A 5JQGB 1II8B 1R4AA 4U00A 5EHIA 1KJ9A 3R3YA 5AVSA 4LWQA 1EGVB 5CA0F 2XD4A 2BZSA 4OJMX 3DNMA 2P41A 4QJ4A 5A3RA 5AVKA 4JUBA 1Y0BA 2XGGA 5FAXA 1WVGA 1HX7A 2ZIAA 3N2KA 1ZSYA 3ZVKA 4GPEA 3AOEA 5G41A 2AUNA 3VPHA 1THZA 3U31A 4MW9A 4HQOA 5A0TA 3I2KA 1HZZC 4WVFA 3RASA 5A5GA 1NNUA 2DU8A 2TECE 3N87A 1ML4A 5JY6A 4P83A 1CRZA 2HRQA 1Z68A 1J24A 1VYTA 3RFXA 3WFZA 1LCIA 2IJGX 3HCEA 3KUCA 3T52A 5LKRA 4YO8A 5B2FA 2WJZB 2RAPA 4FGKA 4EHBA 3E35A 1JEQB 3WFJA 5DHFA 4EUFA 1G1MA 2H4FA 4HQRA 1LTKA 1BN7A 2ATIA 1HFJA 2WHQA 3FCXA 2DR2A 1UH5A 3EIFA 4MIYA 2WHPA 4HF7A 1HURA 2GCGA 4MI3A 3RU2A 1QDUA 3T7EA 5C1IA 2X58A 3E5MA 4D5GA 2FOLA 1EVZA 3GT7A 4JSYA 1D5WA 2VJPA 2WU8A 1NJ6A 2ODNA 2QGFA 3OZTA 3VH1A 2AW3A 1YR3A 1ONPA 2QPLA 3AG5A 2IYWA 1XTRA 4V0NA 3TPCA 4BVEA 3NALA 3NVKI 1LSSA 4AT1A 5G0VA 4LFBB 3MS2A 4WV3A 4G0YA 4EY6A 1GCAA 4OP2A 3FOEC 3IBTA 3QENA 1ZD5A 4MI9A 4NTZA 1X86B 3KPYA 4PGAA 2O06A 2C7QA 3LQ2A 4PRKA 3AP1A 3GBVA 1ULSA 4E94A 1IU9A 3ZIAA 5GVRA 3U44B 4F21A 2ZB4A 4DEYA 5BR8B 3X2EA 4DCMA 2WWHA 3DONA 5AW6A 1R9MA 4P2BA 3KOYA 4R6WA 4ZYYA 4XVHA 4TV9F 3IIMA 5C2JB 3WGMA 5DYGA 1EBBA 5DGTA 3EXHA 3SDBA 5CG1A 3TTUA 4HVLA 4KFSA 2YWXA 3IKTA 4HVAA 2Q5IA 3ANNA 2AC2A 3BTUA 3EFOB 2G82A 3ISVA 1L2TA 1U2QA 1SHLA 2X6QA 2ZAOA 3FZNA 3NRJA 3ONFA 4TN1A 5LBTA 3W6PA 4L76A 2OG2A 3V5NA 1J2UA 3H9UA 4RKFA 2P4SA 3STXA 4RTRA 4R1NA 1VKHA 2X8BA 2ZBPA 5BV0A 1RWKA 2ACVA 3WVNA 2ZS7A 4EYOA 4YRDA 3E9NA 2BCEA 4QOIA 4UTOA 2CB0A 2OVBA 5IKOA 4ZI2A 2CNLA 5I4IA 3AU8A 4YROA 5HE8A 3RTEA 2MSNA 4P31A 3LLVA 2FEOA 3DE5X 3DZDA 4UFNA 1H6AA 3LF2A 2IZOA 4IRMA 3ZOZA 4DAEA 1UKYA 5JY1A 4FKMA 2IV3A 4E07A 1X92A 4X95A 3DE3X 3RIXA 1OH8A 4LK3A 1AUXA 5CX1B 4D79A 3SFTA 1NVMB 1YIDA 3HHPA 1BVRA 1SWVA 2CUNA 4FM9A 1CQWA 1U6KA 1V11B 2ZR8A 4CIDA 4QDXA 2WF9A 4DABA 5CEEA 1G6KA 3TIVA 3GFRA 6LDHA 3PRHA 1V16B 2DT5A 1YQEA 2VSQA 1ZL0A 3KDAA 4KFTA 4KO8A 4MW5A 3RAFC 1O95A 4N54A 2YYSA 5F4BA 1HKHA 4MW6A 3TIFA 4KHZA 2GKOA 1OIVA 1TTHA 4HUQB 4F8EA 5C35A 3LX6A 1E0DA 2GKGA 1Q2UA 3K92A 4QU9A 1HYQA 2FLKA 4D6YA 1HM5A 1RLIA 1TYZA 2OD7A 3L8GA 2VNAA 3DB2A 4HAIA 2OZVA 4OQNA 1TEHA 1TZBA 3OCZA 1T8YA 3IVAA 4ZQEA 3G82C 1YVRA 2WU0A 4DHWA 4IYRA 4TYYA 1E8DA 1BYUA 1NXPA 4FFSA 4FHDA 4EG3A 1EK0A 2Q1YA 2IEYA 3NJ4A 5EVCA 5LR6A 5AVOA 1NW4A 1ZK1A 2VATA 5A5FA 3EXEB 4B2YA 2YVLA 1CEQA 4OTZA 1II0A 3B52X 4NHEA 4WNIA 2QENA 4EPYA 4N03A 3T54A 6REQB 1L4UA 2OHGA 2IWHA 3GX1A 4DSZA 1XKXA 3OTHA 1L3IA 2B20A 4QFCA 1FDRA 2JI4A 1FBTA 4MR7B 1Y5NA 3ZHXA 3NC1C 1WTCA 2JLAA 5FBZA 5I4CA 4QNRA 2Q4RA 1YXMA 2JEYA 4IV0A 5J2UB 2VDUE 4CN8A 3G2JA 3ESXA 5G40A 5JH7B 1S02A 3NC4A 2CLEB 3GA5A 1GADO 3VDRA 4XDYA 4EZBA 4RJ2A 1TCCA 3WHKA 4DZTA 1MJNA 4PR0A 2OT3B 1MO4A 4ZVTA 3MCUA 5SYMA 1KC3A 1KXJA 3U9TA 3WLMA 4RX1A 5EKSA 2CFTA 2ZWIA 1DAGA 1MB3A 5A1TA 2H7XA 2QTMA 4FFPA 4GU5A 4GQAA 4X1KA 2HHLA 1QOPB 2Y71A 2YC2C 3A1UA 3KNZA 1H2HA 1AQ6A 2H1SA 3LYHA 3ONNA 4N12A 3I2GA 4C4TA 5JECA 1B0PA 3U40A 1KR5A 3IYLW 4LNAA 1JECA 4ZTBA 2C5EA 1CQIA 3RUAA 4X7BA 1BXKA 2XYPA 2QD5A 4FE4A 1C9KA 1L5ZA 3BE6A 3L4SO 1SZPA 2C1XA 3U44A 1ST3A 1Y5IA 4C4XA 3C74A 5JXGA 2W42A 2XNDD 3JQEA 1LC3A 4H15A 4CIYA 5CH5A 2Z6UA 2AG0A 1QZ3A 5JCJD 3IT2A 1V3TA 3QWBA 3BHJA 5LBIA 4R1OA 2FPKA 3C1OA 5JCOC 1WOYA 1H9AA 1DT3A 1TFUA 1TF5A 4UU8A 5FJJA 4BE4A 1HE2A 4CDMA 2B7LA 2GJ4A 2IYTA 2NZ2A 3H42B 3RYCA 1QGUB 1SUCA 3ERCA 1U6IA 1ZQ1A 4CNQA 4LHSA 4NE7A 3MQ4A 5E2AA 4A03A 1XCGB 1B6RA 2OWEA 4P5EA 3HBFA 4UXHA 3SPXA 1QOZA 1NP6A 2ZZKA 2AJLI 2J3IA 3H2BA 4QICA 1EFKA 4X71A 1KZHA 4DIEA 2V7WA 3FLBA 1SRQA 3GBSA 5CM2Z 4AJ4A 5I7SA 4ZI7A 2GRJA 1TZMA 3EH1A 2OCIA 4QTZA 3RTAA 4HN9A 1B4DA 4ZVKA 2UZ4A 3FZEA 4HLNA 1YMQA 3P9PA 3SE7A 2HA5A 3ZHYA 2WQZA 1FU8A 2R47A 2I6GA 4ZP1A 1B3BA 2ODWA 1FMJA 4OQDA 2PZAA 1BQ4A 2Q62A 1A69A 2VA8A 3S6JA 1NVKA 5I45A 2VDJA 2HF8A 3KHSA 4HCJA 1MDBA 1U8UA 5HKKA 2W8BB 2MR5A 2VF2A 5DM4A 1TC1A 1OD6A 1AS0A 1JLRA 2Z5VA 3RF7A 1R0XA 2A3RA 3X2SA 5H68A 1D6NA 5IM4A 1V16A 4LYDA 2YQZA 1OX5A 2VDLB 2ANBA 2V3CC 1Y9ZA 2HHAA 3F8SA 1O87A 4P22A 3FN4A 2YDYA 3U4MA 2HRBA 1L7OA 3H8JA 1H2YA 2W8ZA 4MHSA 2PUAA 4EY3A 1R6XA 3JVDA 4PPFA 4X93A 3TI9A 3TRJA 1R4ZA 1EBUA 1SXJD 4F04A 1G5PA 2WIFA 3DVLA 3NXSA 3ZHSA 1A95A 4E6EA 1QYIA 3AZQA 4GGPA 1QHHA 3DHYA 1GGKA 3BK7A 2X22A 3HCOA 3KHUA 5HS4A 4H7DA 4NBSA 2PMBA 1NXQA 3ABRB 3GR6A 4AN1A 1NTOA 4ZGBA 4IOKA 3NKVA 4O3FA 4OSPA 1EU1A 1A9RA 1Q16A 1TIKA 3QWHA 3A1CA 4MCAA 1HORA 1XWIA 3V4PB 1R5NA 4ZALA 3SMVA 1LPOA 1QNLA 2J5KA 6REQA 3HKCB 1QV7A 3C2QA 1EX9A 3MGBA 3PJDA 2WG2A 1M9NA 5CLGA 1NSYA 2Q5FA 1F7UA 4H17A 1TQ8A 3AONB 3KOUA 2QYHA 3RLFA 4DR1B 3V1KA 4XYMA 3V1NA 2FW6A 1K98A 2ZCVA 3EXFB 3PNOA 1VG9B 4XIGS 2O3TA 4AICA 4BFVA 1KAGA 2R65A 1L7RA 4URFA 5FQOA 4DADA 4BFTA 2DUMA 1MOZA 5T41A 1IVSA 2BSXA 4KP7A 2B1QA 2RI6A 3OEHD 4FHFA 3CXRA 3NBFA 4P4TA 4UUBA 5FWYB 4D1YA 3ETCA 1HNXB 1SELA 4P3YA 1I3MA 3CKYA 4O0MA 1W0JA 3WO0A 1NKTA 1BXGB 2VWQA 3MTJA 2H06A 3MCWA 4LBWA 4MUGA 1CXZA 1OX6A 2RARA 3BVPA 4JD5A 4PQFA 4QU0A 1VMKA 3L6UA 5D5PA 5C31A 2E4WA 4Z2AA 5HZMA 4RS3A 1SEVA 2MOKA 2QEQA 1QGOA 2QM3A 1D4ZA 1TQ4A 3A3PA 4NMLA 4V2IA 4J0DA 4OSEA 5DNWA 4CL2A 3O95A 5JSQA 2VPIA 3M81A 2HMVA 4XGNA 3C24A 1DBSA 3HC7A 2O2YA 5JCPA 1I1QB 1WXEA 2J5RA 3C8ZA 1IN4A 1KO4A 3TG8A 3DHEA 4FU0A 4UQPA 2PKRA 4OAOA 1NQAO 1J0XO 2WJPA 4KACA 3UGTA 3MAGA 4D57A 1NW6A 3GRPA 3VNSA 1X7ZB 4RHXA 4L15A 3RARA 2F3SA 5HRCA 3ZW9A 5GIPE 1DUVG 1UDBA 4CF4A 4ZZ2A 4OHXA 1E3TA 3LYUA 3QG1A 1M7BA 4OATA 4DYDA 2CUTA 3VHXA 1O77A 2O6HA 3GLFB 2WFLB 2WLTA 3EZ2A 5CFMA 1I30A 4PQRA 2CC2A 2ZXFA 1ZNQO 2BEVB 3ZU5A 4CLEA 5CDUA 4DSUA 7YASA 1FLDA 3OE1A 3LO5A 4A2WA 2WILA 3D4LA 3OFVA 5C8XA 4XFJA 1GU7A 1BDMA 3ETDA 3W5SA 1IJKA 1DJPA 3IKLA 1OWMA 1ORHA 2ZTSA 5BUZA 1OROA 5CT8A 5ITWA 1DE0A 4R1SA 1MZPA 3NX4A 4TT3A 1ORTA 3G2OA 4CMGA 2CHEA 4G0NA 1A9YA 3A7DA 5IF3A 5AK0A 4EFKA 3HA5A 5J58A 1W87A 3NJRA 1EFPA 5KWSA 2GAIA 4UBOA 1A96A 3FCSB 3B6KA 1U1CA 4Q37A 2N1MA 3UA4A 1P9LA 1R27A 3BT7A 1ZGJA 2CKDA 4MGIR 2EFDB 1K7XB 4XLLA 3WX0A 1U0BB 1A7AA 4J03A 5EE9A 1QAMA 5G0TA 1UOPA 1V95A 3IVCA 1P1FA 4P4SB 3TKLA 1RJ9A 2UZ1A 1DUSA 4W9NC 1N75A 2PGDA 5HIIA 1WM1A 4MYSA 3QSYA 4Z9FA 1EVKA 4INJA 3IEXA 4FLFA 1QGZA 1Z75A 2OM2A 3OC6A 4XQ0A 3VYRB 2NZ8A 3PXGA 4NCNA 3RC1A 1Q7GA 3HDYA 5DHAA 1FYWA 1HDYA 2C2BA 3JZMA 3KQTA 3C15C 4HDAA 5FL3A 5D51S 2YHSA 3V34A 5JHGB 1ISGA 4KSCA 1H9BA 2QBYA 1UJ6A 3I1IA 3OLQA 2GK6A 1TYAE 2VSNA 3AERB 2I6XA 4JBIA 4N5MA 4DMCA 5TEWA 3MRTA 1S7GA 5AXAA 3K0CC 4EDFA 1YULA 1KEPA 3A1WA 2PKCA 3KUXA 3GCZA 4RGQA 1RACA 2A9QA 1YCHA 1ETHA 3ZLTA 1BE0A 1PL8A 4ZYTA 1JJAA 4BKPA 2R00A 3AY0A 2VYFA 2GEKA 1NDHA 3N0XA 1XL1A 2CMHA 3SEAA 4II2A 1E8MA 3RUCA 5IEJA 5EMMA 1DTWB 2WKSA 2ZSEA 5LZ7A 5B6PA 5JO9A 4YRJA 3C3DA 3AESB 1IN8A 1SAYA 5AKIA 4IUDS 4CTKA 3CXUA 1A8PA 3TQTA 4YCCA 3LKBA 2H11A 3EQ7A 1AF7A 5THKA 1TUIA 3HKCA 3VISA 3ACDA 1JDSA 1Z9BA 2XNKA 1SHJA 2IOFA 1QV6A 2RGWA 3K8QA 4IFBA 4OK5A 4EPTA 2PZMA 3HKBB 1ZRMA 1AB5A 4G2TA 5TGTA 4EY7A 4PGFA 4C0LA 2EV9A 4EJFA 2R8RA 5IM4F 2X0EA 4J0HA 3OLCX 4QM6A 3BFJA 3U61B 2HZBA 2QX4A 1IDN1 2AFVA 1G21B 4XQCA 4BNWA 1R66A 1WSAA 5F3WB 1ZJ6A 3K6SA 1TJ5A 2QZJA 3VNUA 2YXNA 4QUKA 1GG9A 5JJKA 4P7KA 1T3LA 3HRKA 1N1DA 5CB8A 2KS6A 2GD2A 1IYZA 2VLBA 3EW9A 2ZJBA 2I22A 4O2RA 1GN8A 4YALA 4L9AA 4HMQA 5T4FA 3X1MA 1MJHA 1WMEA 4ND7A 1W94A 1ZNWA 3HACA 2VYCA 4RK4A 2WJHA 3MHPA 4DDVA 2G7ZA 4YAUA 1GKUB 1L6RA 4BAUA 5LC1A 1Z37A 1U63A 1GUAA 2QN1A 1XRMA 1F14A 3FYHA 3RYHA 2C82A 1Q57A 4BEBA 3ECAA 4D56A 3DV0B 2ZTUA 4GPAA 2XF2A 3PUHA 2UUOA 1UZLA 1H1TA 2RONA 1PR1A 1E98A 3GUCA 2I6UA 4I5DA 2BBOA 4JGGA 4QXAA 5J4LA 2YWDA 4XAQA 3VU9A 1TD1A 3RROA 4M0PA 1YE3A 4CU5A 3SR4A 5DHTA 3T06B 3ZV6A 3PNBA 4EDHA 3JD0A 3W77A 1H6CA 3UAVA 2JKZA 3F6BX 4PO9A 1XD2B 4IIUA 4LDJA 5CFNA 3KTFA 1QGED 2DOKA 1DLIA 4KQIA 1T1GA 3ROZA 1FFDA 2CYCA 4UMDA 2WV7A 1IZ9A 1EE9A 2JCGA 1VJTA 3EBOA 3JQ7B 1G3RA 4G85A 1DKOA 4JJZA 4F5EA 4CKZA 4J4TA 3FWHA 1B8UA 1XKQA 4KN9S 1R6VA 1RDFA 2WJAA 4BASA 5EOVA 3EGDA 5AJUA 1VHJA 3IVMA 3QPAA 4HDOB 5C8VA 3B9RA 5JNLA 5IRCD 1KY4A 4HNAB 1ADGA 1EAYA 1N6LA 3EQZA 1NVFA 4HC4A 4UUOA 3ZLVA 2AR9A 2HWWA 3EPKA 5K09A 4BVKA 2XE8A 4RD4A 4YR9A 1KFKB 1WXIA 1KE1A 4YYEA 4BNJA 1U2DC 4K6MA 3DKVA 1ODTC 3A0UA 2VHZA 1E0AA 4NULA 3AH8A 5FLEX 4A9AA 3RFUA 2J7PA 5JSKA 2WI8A 4YRLA 4V0RA 1E3DA 5FOSA 2FDXA 5EQTA 4BNDA 4TTPA 5A3VA 1AGRA 1EYZA 5IKPA 1KI6B 1C0IA 3BQ9A 4NJMA 4Q7KA 3STYA 5BV7A 2P27A 5M34A 1WBBA 1W2HA 1P60A 4CKWA 1E62A 4CEJA 1QH8B 4HOYA 3WOHA 4BO7A 2K6GA 4HWPA 4UAGA 3TQQA 3OPXA 4ZZ1A 2G8LA 1CEEA 4KKVA 4BLVA 3AERA 3URMA 1XPOA 3CNNA 2WKWA 1OLSA 3B1YA 1PLLA 3H8SA 1MORA 4NE2A 5ALMA 5HMLA 2Z9BA 4UDXX 5B37A 1IC6A 4QFDA 4JLPA 3T7AA 3KZMA 4DCUA 1HF3A 2BHTA 2FE1A 1NQ5A 4GDFA 4M0MA 4PFQA 1W4RA 4D6XA 1NLYA 4XZ3A 1G5TA 5CFLA 3E05A 1R4MB 3GRRA 1W5AA 3R7SA 2XSZA 2Y0DA 1P91A 4AN0A 3QY0A 2XBMA 3DMRA 4AY2A 1ETUA 3D0RA 4DQ0A 3VO2A 4F46A 3BCSA 5IZCC 3WXMA 1VPVA 1NATA 1G6HA 2ZIVB 2I2CA 4BKQA 1SN7A 2RGEA 3KL4A 4EPRA 4JZYA 3FPCA 2UYCA 2L2QA 2Z2XA 3OA2A 5E6RB 2A78A 1S3GA 4K5QA 2GVNA 1OI4A 5EXSA 3GDOA 1VP9A 3JTEA 1AKEA 1X1RA 3IAXA 3STWA 2ZS9A 3KAJA 3BBLA 5K3SA 1VBMA 1YJCA 1BEEA 2A59A 3SSNA 2VPZA 4KUEA 4DV2B 2CV0A 1H2FA 1HNNA 3KT3A 3OF2A 1UMKA 3MWGA 4Q5IA 4DV0B 1KPHA 3JYHA 5JI2E 2GCOB 3TPFA 2A2ZA 3HVUA 5JC1A 1E9RA 3BWVA 4HGZA 4HNGA 1M1YE 2DQKA 2I4OA 2ZYDA 1OJLA 3ICVA 2EBWA 4IHJB 4MWOA 1JB9A 1J9ZA 1Y9JA 3MPUA 3TVYA 4OQEA 4I1PA 5GY7A 5JAHA 1UFRA 1NW8A 4DYVA 5T67A 2VZ8A 3P9YA 5EJFA 2XB8A 3ZDXB 1G4AE 1M2HA 3KTDA 2H7CA 4WZAE 2W58A 5HBRA 5LDHA 1YJ5A 3PNSA 4DOMA 4ZQGA 3TSYA 1QC5A 2Z5GA 5CURA 1Q74A 3ZDBA 4YACA 3GZ4A 3F8WA 1L7QA 3WK6A 4IO0A 1WE2A 4RLQA 3ZC3A 3O90A 5JXJA 2BGUA 1XZKA 3O8NA 4YCJA 3R0QA 2Y27A 2WZQA 4JVMA 1N0VC 2E82A 2HMYB 2O8EB 3DP7A 4OXIA 5CNMA 3SNHA 2D59A 3A1SA 1E6MA 4AKGA 2WP0A 4YX9A 5FYDA 3O3NB 2FOIA 1EI9A 3O26A 3ZGOA 2ZRAA 4PLYA 4F6RB 5IFLA 5TQJA 3ZQJA 1Z7WA 3BJRA 4ZT5A 1YOBA 2MWMA 1E7RA 3FKQA 1XD2A 2PFGA 3CLUD 2ONJA 1HLDA 2A1UA 2BUBA 3HDTA 3SKXA 1AKWA 2Z8YA 3OPVA 4LYEA 2A5FA 5I7FA 1EESA 3JQ7A 1DWPA 1V7QA 4JC0A 4XB1A 2I80A 4DCPA 4KYVA 5CGQB 1U31A 3J80A 5CH3A 2VDWB 3ORYA 1KJZA 1W9MA 1BH6A 7REQA 5FTJA 5CFOA 4K8RB 2RHDA 3I3SR 5LL6P 2TMKA 3LS2A 3JPYA 5HR5A 2ERXA 3JASA 3O2JA 3CJQA 3ANLA 2NQ8A 2I62A 1IJEA 1ISFA 1C9DB 1WXXA 1X38A 3ASUA 1JIUA 1HG1A 4PRLA 1ZGCA 2VJOA 2BEKA 2GBLC 4MRRA 1CUZA 1RWXA 4PTZA 4QBFA 5C7YA 3MBOA 2QT9A 5MFZA 4MUIA 1ZD3A 1E1YA 1YJ8A 5D1HA 5KNDA 2P9ZA 4FLMA 2FPIB 4ECAA 3EQ9A 1KK3A 1GSIA 2HAEA 1OXMA 2K5UA 2WYVA 3CBGA 1FRVA 3EF1A 4X84A 1ZEJA 1ZICA 2DWUA 2J59A 3CVOA 1E69A 3B6ZA 4HQ6A 3G9ZA 3UHJA 5CXQA 5ECGC 3OZWA 3GDHA 2PZ8A 1ZIOA 1KI6A 2I6TA 3P0EA 4GW3A 3QUQA 4HNQA 4QYXA 3AEKA 4E46A 1NSTA 1WZNA 2NO0A 3MOIA 3RJMA 2DKNA 2IEAA 4ABTA 1QH8A 3R75A 2IPXA 3LI2A 5F9FA 4Y7DA 4ERXA 4CM9D 2JJ2A 2OLEA 2F1JA 5ALTA 4FZRA 4MP3A 3QHPA 4I55F 5DLQC 4TSRA 4N3AA 4KXMA 1WXDA 3E1GA 4WRRA 2ZK7A 2PJRA 2HUNA 3KO8A 4DR5B 5DWQA 3SBEA 4IGAA 4BAZA 4ROTA 4NV0A 3Q2KA 2C2MA 2F3QA 4I1UA 1HKUA 3GROA 3VUFA 2DCMA 1CY1A 2QYSA 1TDJA 3ZZTA 1QJCA 2PMWB 2PRJA 1TQ2A 3WHIA 5ISMA 1Q5PA 4W4TA 5ALHA 2V5AA 4BWFB 1D3AA 2J3JA 2RCYA 2IW1A 1JXQA 4FEAA 4AUKA 2WPNA 5ADWA 3I62A 2CFCA 1PS0A 4WVLA 4G0XA 5BR4A 3UBMA 1NWCA 4Y1GA 1C9JA 1V0JA 2VVTA 3K9HA 2C9YA 3HCPA 1GLNA 4L1KA 5EGSA 3CO5A 1AN9A 2R79A 3OKFA 2JG3A 2UUCB 2EKPA 4LGCA 1U9IC 3A26A 2GAJA 1Z6AA 2GILA 2OFXA 4OHRA 3CPHA 3ZDYB 1NHWA 2B35A 4BFXA 4A36A 1UFOA 1I13A 2IPAB 4IRXA 3C5HA 5LXTB 2WTBA 4AG6A 5DI9A 3AVXA 1YBMA 3NWOA 2DFTA 3BB4A 4Z9YA 4CKBA 1MIOB 4JP5A 4JSRA 4KLAA 1Z7EA 3KSAC 2ZSHA 2BBWA 2W00A 4PYIA 2VJCA 4C21A 4QQKA 1CR2A 2VP6A 3RUHA 1ZUNA 2GCOA 2LCQA 3J81A 4DWOA 3IJPA 1GDHA 1TXGA 3ES9A 5KDLA 3NH9A 3ZQKA 1XP5A 2ZJOA 4IHJA 1QHNA 1FTQA 4R2LA 3E5NA 3JVIA 1CVLA 4Y2SA 3M4ZA 3T4UA 4F2WA 1KK2A 4RQAA 1Z12A 3QI7A 4P7GA 2ISCA 5AK4A 5E0KB 1H42A 4FE3A 5KTSA 4WBSA 5FOVA 3F2IA 1NG1A 2JLBA 1D1PA 3MGAA 3R9XB 4RVGA 1FW8A 1AHNA 1ZIYA 1KS2A 4I2NA 2BCGY 1M5RA 4LV8B 1JQ3A 3MCTA 1RWNA 2WT8A 3HBMA 1L1EA 3LCRA 4O29A 3T12A 3TRIA 2PKYX 2PVPA 4M9QA 4ER7A 2FZCA 2WE8A 1WULS 5EESA 3NHFA 2JLSA 2HOQA 4J9VA 1CLEA 2CNWA 2JARA 4ITVA 2ICAA 4LG1A 1NKSA 1P3JA 1GFZA 3U62A 2O8EA 1NR1A 1I8TA 1XXHB 4ZXFA 4CRWB 1PR5A 2GVDC 2WF8A 1OB5A 4UQLA 1ZCBA 3LX5A 3T9CA 4X94A 4QUDA 5EJAA 3QNWA 1TF2A 3D6UA 4JUDX 4QUHA 2Z95A 3CN9A 5K05A 4ZI5A 1RCFA 1KC1A 3LQKA 3HXKA 5CVEA 3PUXA 3RUEA 4CL3A 4CMJA 2Y3IA 3U7EB 2CE2X 1NF9A 2Y2UA 1BHSA 1BYIA 2HX1A 3KDPA 4B84A 4CKEB 1TM3E 4RVOA 2P2SA 3QTTA 4XX0A 3U1VA 4Z53A 3PENA 1X19A 1M54A 1JWLA 2F3UA 1Z2AA 3RQSA 4EVRA 2C0PA 4RJJA 5B5SA 1OYVA 2WG0A 5BXYA 2V8OA 4DCSA 5IHPA 1H2RS 1C1XB 2YIJA 4ZT4A 5C1OA 4HAXA 4Y7CA 4E31A 4E12A 1EK2A 3SXUB 4UBJA 1NE2A 1FC0A 3IT3A 1IPEA 3PX7A 1K7EB 5L3QA 2XVZA 5DN9A 4MR9A 3L1JA 1DEAA 4KWEA 4YP0A 5LIRA 1KPIA 2PWZA 4L8WB 4YT5A 4L78A 5BMVF 3DLAA 3N0WA 4UPVA 4EB6B 4YFVA 3DLPX 121PA 1R0BA 1MW9X 5ED4A 4RELA 2G36A 4OXRA 4NFHA 3P0IA 1R15A 1ZK3A 3SYNA 3HVRA 4MV8A 3X44A 4RJKA 1WSDA 1RM3A 5I01A 1U1DA 2FSPA 1T34A 1Z3IX 1O3YA 3HVJA 3P9QA 4FW8A 4M98A 4CKXA 1G8SA 1DUIA 3BF7A 3IOCA 3UC5A 3RVRA 1MHTA 3HFRA 2NVBA 3HGMA 3HYLA 1PR9A 3LQ1A 3QOYA 3KQWA 5FUVA 2CCGA 4QBTA 4C76A 3FGZA 4HGQA 3AK4A 1VLVA 1ZVJA 4W5TA 4RDXA 2BCJQ 1YL7A 1DKQA 2C88A 4XYEA 2WLSA 3CGWA 3RFTA 3SGLA 3GFSA 3UV7A 2M2IA 5DX8A 1T5DX 4D25A 3IP7A 4Y6RA 3ZZUA 2R2AA 1FY2A 1HZJA 3BORA 2VHCA 5K6AA 5A04A 3D64A 4G4IA 4MUAA 3L8HA 4TRRA 2PX8A 3FB1A 1Q21A 3O4GA 3SQWA 4Y1RB 1G16A 1KJWA 3H75A 1G7SA 4GOJA 4IX1A 1GARA 3QI2A 4MGEA 4UVEA 4WJKB 5DI3B 2BFCB 4BLWA 1IN1A 1K8ZB 1S2GA 1QNFA 1JWAB 1ZN8A 2I99A 3OQJA 4K7JA 4PPYA 5DX1A 5DSTA 4A92A 1C8VB 1PFUA 5K7SA 4HG2A 3ZWQA 3QY9A 4AXXA 2PNFA 1V5FA 4LXUA 1NAHA 1H69A 1SURA 2PO5A 4KXLA 2X0RA 4PQEA 5C32A 2OQRA 4JJKA 3FUXA 5LIPA 4KO1S 3O5AA 2V9ZA 3TZCA 4BCDA 2J33A 2RH4A 4E22A 3KAQA 4LW8A 2G0AA 5DNUA 1FCJA 1XU9A 3MF4A 3TSOA 4I50B 4WNAB 1RWVA 1BMFA 1AXEA 3DFIA 3EMKA 1Z4IA 4FFBA 1IATA 4ZVLA 3OZCA 3VR2A 2FFAA 4UBKA 1MW8X 1E1NA 1WPXA 4DLZA 5DTIA 3GEHA 3BA6A 2IXBA 3IIIA 5KOYA 1QUFA 3UMVA 2AGVA 5H80A 4M49A 5L4SA 3QYFA 5IAJA 1XZIA 1GQRA 1CJSA 3EYAA 3ROGA 5FTMA 1IK4A 3GU3A 1MH1A 2YASA 5FBVB 3NKFA 3WYGA 4Q48A 1E3JA 1PZNA 1QHFA 2CLOB 2E7ZA 2H0RA 3GCWA 3WGNA 5B4UA 4LHXA 5I7WA 1V47A 4XUEA 4FKZA 4ID9A 4KAFA 3DW1X 4RPCA 4DFDA 1SIWA 5P8WA 3LWZA 4A2CA 4ETNA 5FRDA 4BGDA 2A94A 2EGGA 3ZHOA 3L40A 4EFDA 4J75A 2QA5A 3KKMA 3ZTWA 4DQUA 1USUA 4TXLA 4DR2B 4Y2GA 2N0SA 4KH1A 5EI5A 1RZUA 1X42A 1DVRA 3AYZB 4KDFA 1QBGA 1UXKA 2J6HA 5KHAA 2H85A 3AIIA 4DPMA 3FPLA 4JLWA 1XXHA 4H27A 4LOIA 1XJ0A 1J22A 3T4EA 3HUEA 3G0GA 5JNSA 2HLHA 3BFVA 1WIWA 1PQWA 2FX5A 4JVNA 4XGQA 3JD1A 1NVBA 5D2CA 2PL1A 4BNHA 5KTTA 1CUHA 4I9UA 1FSPA 2B36A 3B2NA 3INNA 2SKEA 4G5FA 4QQNA 5HK9A 3DDCA 3NT2A 2W83A 3NFYA 1OCEA 2GUGA 4G56A 2ZJ3A 3V4SA 2PM8A 4DUPA 1HL3A 4M0KA 3EPRA 4S1WA 1RTKA 3OZEA 3TLZA 4EM6A 1ECGA 4P7BA 4AIIA 4UOZA 4WXPA 1C3XA 2VWGA 2WF5A 2ZI6A 4HFNA 4YGYA 1YGPA 5GTDA 2BGWA 3ILHA 2HA4A 3HYNA 3K6KA 3SNKA 1G8HA 1CUYA 1XEXA 2DWCA 2WF6A 3BG5A 1VB5A 1M83A 4MQUA 1KDZA 5KOJA 4EW2A 2WR8A 1WHSB 5DNCA 1XA0A 1DZIA 4U02A 4D8UA 5IYZF 3VTZA 3GLHB 5HE9A 1A5SB 4LCJA 2DYKA 4K88A 2F3TA 4EB3A 2NQTA 2OLJA 2BM9A 5CVVA 4QLAA 5BQXA 2X8WA 2QMEA 8ATCA 5BSRA 1IUNA 4HX2A 3UAGA 4B0OA 2FRXA 4UHDA 1CE8A 4QFMA 4BRZA 2RCNA 1SXHA 3A9TA 4MIEA 1C5KA 1YKFA 3GA7A 4ESVA 2PXHA 2HA2A 2RGRA 2WHRA 3RT9A 4J3FA 1KMNA 1KOFA 5I5EA 2VYVA 2UYYA 3A3NA 4GOMD 4RZ3A 3U3KA 1G291 4FIZA 3WMGA 4QAJA 2HU5A 3EODA 4F6LA 5ALLA 2NTYC 5HJ7A 3FTPA 1WABA 3IUBA 1TGYA 4M36A 4W7IA 2K2WA 3LBFA 4RHUA 1ZGHA 5B1DA 3DWIA 5BOVA 5DGIA 3VSBA 3WV4A 1TRHA 5CPBA 3BMNB 2HJSA 3CZ5A 4H1TA 4QDUA 3NJ8A 4HWGA 5HVNA 2WWIA 3HA2A 3NOQA 1QP0A 1PJTA 4HDRB 2G67A 2FZGA 3KQVA 3NBMA 2R4TA 4GLBA 4NP6A 5L3SB 1NE7A 1TW3A 3B53X 4MK4A 1I24A 2ZRQA 3ND5A 4U7WA 4IG9A 1IFXA 1L6IA 2I1WA 2FR8C 1T1EA 1V4NA 3RVLA 3VPXA 4AQDA 4DCCA 2QP4A 3G5TA 3VC1A 1O5TA 3E4DA 2XZDA 1THTA 2G6TA 3SVZA 4CHTA 3QPWA 1M8KA 1WDTA 1ECCA 4PICA 1J23A 3E5HA 4QJ5A 2O8FB 1J56A 4C4PA 4RL6A 3RVQA 2GMWA 4Z7NB 1OB2A 2FMTA 1K5PA 2QS9A 3PKJA 1A7JA 2KLBA 4PXSA 2MHCA 3KUUA 2IY7A 4A91A 5F51A 2FW1A 4BP9A 4D4GA 4AKIA 4C2AA 2GNAA 4AMYA 1IEXA 4GOLD 1HGXA 4X63A 5HGXA 2ZJ2A 3THWB 2PGXA 1F9EA 2FUNB 3WQRA 2ID7A 3BX1A 3PR1A 1TEZA 3PWTA 4HZUB 5JZOA 4LJ7A 4ZEMA 1UBEA 3M6IA 3QEOA 3I45A 5KQMA 2IE0A 2LD4A 3R1IA 3MILA 2CLDX 2HSEA 2BBTA 2KYRA 1L4LA 2FPXA 2Q8PA 2VRWA 3CZMA 3D0QA 3W9UA 4REQB 1EFAA 1STOA 3X3HA 1PN3A 3BZUA 4FTWA 2IH5A 4D8XA 2AB0A 3LA6A 4B8WA 1AK9A 1CR0A 4CT5A 1J25A 1MLDA 4AWBA 5KYWB 5KYKA 4UVGA 4FB4A 3R74A 1GGNA 2VK2A 3FMIA 5EJGA 4IIJF 6YASA 2H2FA 1UDWA 1UZNA 1TUBB 2PUTA 5HS6A 2R6ZA 4O8CA 1Y3AA 4TWIA 2IYXA 3R3VA 3GD7A 3QVGB 3KWLA 2DUNA 2HA7A 4M6WB 2OMEA 4C30A 3RRZA 2NO9A 1W30A 1RNLA 5M3BA 3KC2A 1Q0TA 2LCFA 3PRYA 2XB6A 5DDIP 3Q9NA 3T95A 1DKUA 2C96A 3AI3A 4NEQA 1D8TA 2ZE6A 1VHDA 3C3YA 3KPUA 4V0LA 4YXWD 2W4IA 1XUOA 3IOMA 1H65A 2ZVPX 1TVKB 2ZOSA 1Q0LA 4UATA 4J29A 4LJLA 4BZPA 3UXMA 4R2XA 4JLVA 3VYSB 3E9RA 1E3LA 1M72A 1MJ5A 1X39A 1ZWLA 3HN2A 3NBYC 4GOXA 3RVOA 3QEMB 3V4VB 1IHYA 2CNBA 2QN9A 1LSOA 1CFJA 4WLEA 2YIMA 2X4GA 5CPFA 1APBA 5CIQA 1ZG3A 4IDOA 1CYEA 3JSXA 4LSWA 2FEXA 3BE8A 1KNQA 2VHTA 2O14A 3E23A 1Z2CA 3ZCQA 1V96A 5ITZA 5JAZA 1VSVA 3K9FC 4CLDA 1EWQA 2IV2X 1RC1A 3NXKA 5IT9A 3W06A 4PNEA 2WQ7A 1DCFA 1IBMB 4AJPA 4BWYA 2BVNA 1CS0B 3ROQA 4Y2YA 3HJAA 3BTSA 1WX1A 1DTEA 2AN1A 2H07A 2H92A 2ZTVA 1VKJA 3FTCA 3KLMX 4PINA 2V0CA 4Q3LA 1N36B 1LTQA 2HDNB 4KDRA 4C7JA 3C14C 5E0OA 2H48A 1CF2O 1VHQA 2NTNA 3GZNB 3SKVA 2X7HA 5IT0A 1L4NA 5EE0A 3PHIA 5AKLA 2XUPA 2H9IA 2XT6A 3VV2A 3ENKA 2C3MA 3QJGA 2XT0A 1II9A 1Y3DE 3CCCA 5DCLA 1WKVA 2AJ8A 2XTMA 2B9EA 3I8XA 3KKLA 4Q6WA 2OC9A 4JEHA 1ZR2A 1A4IA 1CETA 5LSAA 5EE5B 2AMFA 2FUG6 5L3RA 2OYRA 1NX9A 1TU4A 1R18A 4KG7A 4NAVA 4RVSA 4ZO9A 4FGJA 4I6EA 1HDXA 3VX4A 3KYIB 2CKMA 4Q34A 4ZO8A 5ENZA 5EMLA 2VOJA 5GJBA 2WFMA 3RT1A 4CM8B 4B3GA 2YXBA 3BWBA 5FUYA 1V3VA 1KQ3A 5LQAA 3TUZC 1L5MA 4IG4A 1XROA 2Z9DA 3TNDA 1CF9A 2IA5A 1UOQA 3HU3A 3P9XA 2I5PO 4J94A 2NPFA 4IICA 4HBZA 1UMDA 5EE1A 3ZR4B 1J90A 4KR6A 3KHKA 3QUBA 3SI7A 3MT7A 1XWFA 4IXNA 1WDMA 4TMXA 4BE7B 2FFRA 5JD5A 1Z4NA 4MW1A 4NECA 4D45A 1QMGA 3MINB 2IYAA 3D6AA 1PCXA 3LKVA 2F43B 3QPVA 4JBNA 1R1DA 1RLOA 4OLJA 3AKYA 4H6VA 1X80B 1M3SA 3UWKA 1VLQA 2XZPA 3I6YA 4FEGA 4Q3CA 5DLDA 2HF7A 3OCWA 2NU8A 2Q0SA 1U02A 2DAPA 3OMLA 4PFSA 5I9MA 2JH8A 1VJDA 1EJ6A 1JPNA 4FGLA 2P6MA 2YJ3A 2ZRPA 5AW1A 2F4VB 2WU3A 3IOYA 4GYJA 4RZSA 1NJ1A 4XQGA 1TO2E 4BQRA 4CIXA 5J4YA 1WBDA 1G64A 1J8QA 3DJYA 2B4RO 4WOJA 1LBHA 1NULA 1VECA 2BGLA 3JXEA 3O4RA 3VH3A 3WRXC 4LCEA 3BA1A 3GOQA 4JNCA 1UUFA 1X9IA 3FMGA 3IQIX 2CXUA 3KHTA 4B4KA 1ZOIA 4EYEA 2ESRA 5HXAA 4JUFA 2QV7A 1U2GC 2ZJ4A 4WNCA 4EJMA 2YV1A 5BUQA 5HMMA 1RP7A 2V6MA 3HB4X 3WKEA 3GVXA 5FNVB 4JEIA 4E32A 3N59A 4M6WA 3RSSA 5AVZA 1OBOA 4P7FA 3ZVMA 4C05A 1SQSA 1GOTA 1LDNA 2O6LA 1V6CA 5CJPA 3NH6A 3ACBA 1NW9B 4YDHB 3V80A 4OGWA 1XSEA 2VTVA 2QR5A 1TYDE 3D6TB 4QD3A 3X1KA 3H5AA 4AZ3B 1Z38A 3OHMA 5CXUA 2EX4A 1ORWA 2CB9A 4CKCB 2NADA 3F3MA 3U9SA 1I4TD 1NI5A 4D8WA 4EKNB 4AKHA 4GBJA 4QSHA 1MEJA 3G0DA 2B83A 3N7AA 5ALPA 1L5KA 2TSYB 3V6LA 4D9GA 3A7EA 5AYVA 4X1IB 4JYAB 4DT1B 3G0IA 1CY0A 3H2SA 2CSXA 3AVVA 5FH9A 1W25A 1VGRA 2C2KA 1X87A 2FVXA 4FNMA 2X9NA 2XRYA 3P8ZA 1ZMTA 3LM8A 5E7IA 5BSUA 1F9AA 4R84A 2JFYA 2LGJA 4PLWA 2VIIA 1C7JA 2EWMA 2CJWA 3B1WA 2WOJA 4ZO4A 1B41A 1D1QA 3UV6A 4B82A 1PYDA 1KJYA 4H0NA 1G18A 1HMYA 3I01M 1RQPA 1CUGA 3G2QA 3K9NA 4M1ZA 4Q1EA 4E1BA 1R4NB 4YRNA 5JROA 2I66A 1T5IA 3OT1B 2QNBA 3L4BC 1BD3A 1FP6A 4LDQA 2VBFA 2O8VA 1W5BA 3HG7A 3KJNA 5FWDA 4YUWA 5IT4A 2UXBB 3MWYW 4JHXA 1T43A 5EWMB 1V37A 4NU8X 1U98A 3IVRA 4AC9A 1YB4A 3GZNA 4OFXA 3IQDB 4BMVA 4GECA 2NZJA 2EFYA 4Q3NA 5J23A 4RWEA 1Z5NA 2JFOA 1WBJB 3P19A 1ODFA 1AB6A 1Z36A 2QJRA 1AIPA 1PJ4A 5B2ZA 2DUWA 4K86A 4BEWA 5TIIA 1FQOA 1XTKA 5KKNB 3EFHA 1XLWA 1HETA 3RR2A 5KYYB 3NHLA 3EEIA 3LGSA 4AJKA 2SCUB 2NUAA 4QATA 4BFZA 3VZPA 1P2FA 4YMWA 1JIVA 1WOMA 3KQSA 3TBHA 2H1HA 1VE1A 1DADA 2Q5JA 2G06A 1JQLB 2ECKA 4GP6A 1H0SA 2A9PA 4LZZA 4N8EA 4QDZA 3CNHA 4GMFA 4RDIA 4D92A 2RC5A 2IVZA 2J3QA 2FMXA 2G17A 4YJ3A 3RTGA 3GGGA 1WDWB 4CWAA 4WJLA 2I2DA 3LUGA 1N2EA 3E84A 4UE2A 2WHXA 4WEQA 3GG9A 3C8DA 2FPGA 2ZSUA 4OHKA 4DCOA 1B15A 4NS4A 2WNIA 2WKRA 3DLIA 2ZDHA 4EPVA 5AP9A 2RGCA 4F3CA 3A2NA 1ZH8A 3UVEA 3PQEA 3K15A 3IBFA 5COAA 2BFDB 3W8DA 5FKJA 5KINB 2XY4A 3IX7A 4HFRA 4RKQA 3S8YA 3K7EA 4OXQA 2XXAA 4FWBA 3N8KA 5EFZA 5ADHA 1JALA 2IHNA 2XE6A 3OQMA 3ZX4A 2VJDA 2Z0MA 2GOYA 5G0SA 3ULKA 1ONOA 1Z18A 3CEJA 1HK7A 2R87A 4R2KA 3FUCA 5SYNA 3EOZA 3R2JA 3PCTA 4DV1B 1RWWA 1CUXA 3U4CA 4KR3A 1Y7LA 3KLNA 3SOZA 2EG9A 4ARAA 3V4OA 4TKMA 4F3YA 1LJLA 4WPGA 5AI5A 4XGRA 3DMYA 3IV7A 1YVPA 2O8CA 3JALA 3BMXA 2XAUA 1FRNA 1XKTA 2C4WA 1SA0A 2IL1A 2VDOB 2X23A 3JATB 3KZVA 2XMQA 2VNIA 3L0BA 4GEKA 1YR2A 4L8LA 5ENDA 5FAKA 4PCUA 3L93A 2OAQ1 2VJYA 3RYTC 4QBHA 1T8RA 1SIOA 3GGDA 1SKYE 2C4HA 2OQ2A 3AB3A 4KRGA 2NUPB 2WOOA 4ZMSA 3JQ9C 3LCVB 3Q7EA 1OTYA 5ALFA 4ZVSA 5AW0A 2IZ6A 4WZBB 1JYFA 2ZSBA 1UPTA 3HEBA 2PA3A 5ES3A 3UWPA 1ESMA 1RU3A 1YVDA 5FNVA 3U49A 4H18A 1C8BA 1AD2A 2OB1A 8OHMA 3HEMA 1C7QA 1NR5A 1TYEB 2LPMA 3MJFA 4XIIA 5DW3A 1TA0A 4GI7A 2QYOA 4ZTUB 1U94A 4KO2S 3KVVA 1BQEA 4IUBS 5BNWA 4XDZA 2XUZA 2GLUA 2BMWA 3ANXA 1EJ2A 2OYCA 4EG6A 5KOIA 4MH0R 2BI7A 1CIJA 3OM1A 3T5MA 2NX2A 1GQFA 3AF6A 1YVEI 1P1BA 2J45A 4IZIA 2D5BA 2NT4A 4DT1A 1MO2A 3H7AA 3QVJA 1V35A 3O8QB 4LY9A 2PDAA 4QT4A 3SQOA 4RK7A 4YC7A 4UHBA 1EVEA 5EINA 1HT0A 1U3VA 2X0NA 4C43A 2OORC 4R54A 1BFKA 3M6LA 2HREA 1CUFA 1QS0B 1YB6A 2PWBA 4A73A 4RIFA 4F5DA 3KR1A 5IWCA 4A5OA 3FD8A 2R11A 4KPUB 5I9TA 4N48A 3GCGA 1O4VA 2BP7B 1C29B 5KHLB 4EX7A 2Q5CA 2YYYA 3HBLA 3QTLA 4DKXA 1N7HA 1GCIA 3BXGA 3QMPA 3HXPA 3ZDDA 2CFIA 2XCUA 1C3EA 1R4NA 4RTPA 3C6YA 3LP8A 3PBKA 4JIGA 4J4BA 1E7SA 1E99A 1GTMA 5ESRA 4IDEA 4NNOA 1Z17A 4EHFA 2FNAA 3QKSB 1YMVA 3DKRA 2EBHX 2X5KO 1PR0A 4E2FA 3UMCA 1N2JA 2VQEB 3DD1A 3OZ7A 4X7MA 1YC2A 1UJ4A 1WB5A 3LY8A 5J2TF 3RS3A 3V48A 3WLEA 4M54A 4LGYA 3C1UA 4DJAA 3MGKA 5FWYA 4XVRA 5DHPA 4PBTA 2C4NA 2IITA 4MAMA 3VVCA 1G8JA 1KSFX 5DGCA 2WT4A 4O4IB 1PLJA 1R37A 3DZFA 4CLOA 1CCWA 1OAKA 3KZKA 2YWHA 4I9GA 4HAVA 4ZT6A 2FMFA 1W88A 3OFNA 4QL3A 5JARA 3KJFA 1YR8A 4J91A 3FPAA 3RH0A 5JAIA 1AMOA 5GV8A 1GEGA 1OXKB 1RYYA 4FFRA 2BFAA 1BMDA 2V55B 2CMKA 4WJZA 4YP1A 2PS0A 3G68A 3VH2A 2O3UA 1BSVA 5K3FB 1T3HA 2QUAA 4I3HA 2GPWA 2Z1DA 3NCHA 3Q8XB 3RFFA 4EY4A 3F4LA 3KXKA 3V97A 1KO1A 4Y2HA 1W36B 3LLUA 1K1EA 3BC1A 5FUQA 3ZHTA 4CTMA 3AOEC 1W52X 4EW1A 3GPLA 3N3AC 1BCRB 4TVBA 1RCUA 4FQ8A 3S55A 3CF4G 4F3NA 3RRMA 1GNPA 2J3MA 3IUQA 1MAUA 4UEOA 5D8DA 2BFDA 3PF9A 3JQGA 4WSOA 1UKCA 2ZWVA 5HUQA 2UXCB 2CDAA 3AKCA 2NXNA 2AOVA 5ALNA 1TGVA 3ZK9A 2W7TA 1TVEA 4Q3KA 1H22A 2PFKA 5THXA 1NNSA 1YZFA 1T2UA 1E2HA 2HTFA 2J08A 4P98A 4IIFA 4DBLC 2BN4A 5I4KA 1U8ZA 2RAVA 4TSKA 4ZCSA 4ZEVA 3PWKA 3EX7C 3K70C 3BAFA 3TRHA 1EZ4A 1YQTA 1L7DA 4YBRA 1Y7PA 5NULA 1XHLA 2G1AA 4AZTA 2QK4A 1DQRA 3P20A 3D7KA 3IDFA 3TZHA 3M6XA 4G41A 4JI7B 1G2QA 2WIBA 3C6QA 4UBNA 2HADA 1SZCA 1THMA 2J32A 2W6IA 2F1RA 2QUKA 3JATA 4GPIB 1G7TA 2FZ4A 3NWBA 1KYQA 4BIMA 4ZYVA 1U65A 2UZIR 3JVEA 1LVUA 4LKRA 1OHHA 1JR3A 2P9BA 1I7DA 2Q9AA 1PL7A 1IM5A 3JPWA 1EG7A 4YEDA 4MVJE 1KFEB 3FYCA 3TD2A 2NUPA 3O9MA 1RXWA 4BNGA 5KJ1A 1K3FA 1RYMA 2R7LA 2DJ5A 3L0SA 3LUHA 2EQAA 2X3FA 1J2RA 1P80A 3MMZA 2ZSAA 4YRKA 2QRHA 5IBRA 4I0WB 3HVKA 1U6JA 1B23P 1CIPA 3HU1A 3DBOB 3O1IC 3W3AD 1G38A 1VSTA 4TZ0A 3RVMA 1CB0A 3HZOA 3LC0A 3V46A 2NM0A 4YV2A 3QPCA 1SCKA 3HJUA 3DBVO 3IPYA 1NPYA 3F9IA 3F73A 3GVCA 1EFRA 1L5WA 2ZI7A 3EVBA 4G09A 3Q12A 3D2CA 3EXHC 1GN9A 2I78A 4U6QA 2DKOA 4RZUA 4RVHA 5E6UA 4ZCLA 1M76A 1GDDA 2I67A 4JX8A 4KODA 2HJ9A 4UVHA 3WMFA 3DMDA 3ESQA 4A8JB 5FA8A 4DMLA 4REMA 1NP3A 4NAUA 1SOWA 4OH1A 4YQYA 4QYIB 5ALYA 4OH7A 2ZG6A 3TL2A 4D9KA 3O8QA 2Z6AA 1UBGA 2GD0A 2QU7A 3JYPA 3MAJA 1E2PA 1Y9DA 3DL7A 3R5TA 5ILQA 3FBWA 1ES9A 1VPTA 2RBEA 4G24A 3UUFA 4RULA 4RFSB 1SOUA 5E1DA 2OXEA 2R68A 3GEPA 1RYBA 3C5CA 2XBLA 2XQJA 2IQ5A 4Y98A 1WTAA 4S1VA 4ODIA 3G9XA 3SICE 1LZLA 5DGDA 3VC7A 1J1UA 1ABEA 4KFCA 3OSZA 2FZLA 3OF3A 2V7GA 1UIMA 3DOJA 4LDPA 1OFUX 3OCJA 4IMRA 4A15A 4RY8A 1S5PA 3LL7A 4WBXC 3A6HA 3DFUA 2HK6A 5C8ZA 2VN8A 4GPZA 2I6QA 5HG0A 4I4TB 3E3OA 2H51A 3H1FA 4UU0A 3PFKA 5EXEA 3R09A 2QOEA 3OUTA 3TR5A 2JFNA 4MUYA 1BWRA 2OUIA 4NENB 4UMVA 1OX4A 4KAAA 1UEIA 1O95C 4QOSA 5CA1A 5TJ9A 1U7DA 1KZYC 5CBPB 4QUJA 1SPXA 1B8NA 3WSVA 1EEHA 1FFSA 3CF0A 3EIWA 3ELUA 1RM5A 3DV9A 4D0LB 1JR4A 1PUIA 1JG1A 4QEKA 3WGZA 2EF0A 4P08A 5JAMA 4ZYLA 1KP2A 2Q0QA 1GAEO 1T9CA 2F8MA 3KAKA 2VKTA 3G0CA 2C7OA 1KORA 3AG6A 4ZT7A 1NMQA 5K3FA 5HQ3A 3THYB 1OWLA 3V42A 1RQGA 1VPDA 4F9FA 1KI8A 3GRAA 3RFCA 3BM5A 4KQ9A 4RDCA 3UZUA 1NYLA 1CY6A 1RYFA 1S2NA 2PQ2A 3O4VA 5ESXA 3PGMA 2FFBA 3TX6A 3U3OA 4LC1A 3UOAB 4OI2A 3IAM1 4RTMA 3THXB 3B1KA 4QEZA 1BCRA 3B6EA 2CXXA 2VJMB 1FLVA 4TKZA 4HPXB 1LBEA 2A9VA 3H18A 3RBZA 2C5GA 4IXDA 4D97A 5LYJF 3TGLA 4NF2A 8LDHA 2XF8A 5EVJA 1P4AA 3C6BA 1EFLA 2O0HA 2WAXA 2WM8A 2OZLB 3TQSA 2HT6A 3VR0A 3JQAA 2XUJA 1LPMA 3I1FA 4JGBA 5C5IA 1D9ZA 1JXAA 3DDHA 1NI4A 2Z83A 2AC4A 3LQFA 4G63A 4RMNA 3TR6A 5JAPA 3IIJA 4LDNA 5A9RA 4OLHA 1WLSA 1W6RA 2PX0A 3EWIA 3NFRA 3W5CA 3MD9A 2YYAA 2XYHA 3V8BA 2GLTA 2I4LA 4FDMA 4OAQA 3V3KA 2PBFA 4C1NA 1UP6A 4GGMX 2DBZA 4CMIB 4YRGA 5K0CA 3PLAE 4WW0A 3TNJA 2RGGA 4DR4B 2H5IA 2QT0A 5AFSA 3W3ZB 1A1VA 1T91A 4MIOA 2XKAA 1QTIA 2O0LA 1ZZGA 2CBZA 3TSAA 3GHYA 1ACJA 3QELA 3N0RA 5CFPA 2ZRCA 1UMBB 2QMZA 3EAQA 1GLVA 4POAA 1UDCA 5I7EA 1EXWA 1O96B 2DBRA 4HHEA 2C77A 2VUTA 4WHMA 2ZANA 1E9AA 2RIPA 1LDGA 3Q3IA 2QTAA 3KP1A 2VTBB 5DOZA 3TJZA 2PMKA 5A2GA 2QAGA 5AUOB 4LECA 3TQIA 3N07A 3ZK7A 4B1FA 1HEIA 2IOFK 3KKKA 4CR8A 3IBCA 2OLKA 3HDJA 1B8VA 3LMKA 4WADA 4D9HA 5MDHA 2JIOA 3T5DA 3NIDB 3NYQA 4CMCA 4ISBA 1KAEA 2EIHA 4I55B 3IQHX 2XNJA 4RVCA 5JVDF 2VP0A 3Q3CA 2GKSA 3TOVA 3LECA 5BPHA 4QT0A 1TTPB 4ZCRA 3QLUA 4HWOA 4AMGA 1JF8A 4GH5A 1Y5MA 4Q7EA 1P1CA 2PPVA 3ZQUA 1DL5A 3FNQA 1IN5A 2P9TA 9ATCA 3U3JA 1DFHA 1AKTA 1JKMA 2BGNA 2W4QA 2A14A 4DMMA 2GF9A 3STUA 1JTVA 4FUTA 5ICSA 4RFSA 4B6EA 3IB3A 4BVLA 1DXOA 3DHNA 3DL0A 4IDGA 5CDSA 3NHRA 1WO8A 2YX1A 5GOZA 3TSZA 4E3WA 2WZBA 4Z0TA 5B7PA 1ZR4A 5AI9A 4RTKA 1I94B 3QNUA 2VPQA 4CV2A 5H1YA 4H1WA 1LGYA 2FQ1A 2R1TA 4U63A 5HZKA 5F73A 1LBTA 3FVVA 3N8HA 4OHFA 3BKWA 5GOTA 1J99A 2OAP1 2EZ9A 3USES 2JGNA 5FADA 4HY3A 2XQVA 4I4TA 1JJ7A 3PJFA 3ZHQA 1FL9A 3CPJB 1BXRA 4GL2A 1QE3A 1SU6A 5CXSA 2QMUA 3L7BA 2QUBA 3S68A 3MG9A 4YDQA 1YQQA 1SU8A 4MS1B 2OBNA 2PTHA 5F1KA 5AHKA 4KQEA 2JLCA 3A4VA 4IGKA 2Q1WA 4LYFA 3RRBA 4DPKA 4EK9A 1AOXA 3L49A 1E2JA 1AK2A 1H0HA 4NRDA 2ZJFA 3TB6A 3WZ2A 1C8LA 1ULTA 2G28A 3W0LB 2RG1A 1JTEA 2QRLA 2JLVA 3DH0A 3H6GA 3IURA 1PHPA 1K0FA 4IXWA 2JAQA 2QZSA 1F8YA 1VSUA 2H17A 2JAWA 2GYUA 3L6CA 1PZMA 3OI7A 3AUJB 4RXTA 4EYQA 1YU9A 1DTSA 2M9MA 5LQMA 2B4TO 3SX0A 1PGOA 1T25A 2LIVA 3BEDA 4EWLA 1DBPA 3HCDA 1Q1QA 1XBTA 1ULUA 2BJVA 2QQFA 4D9FA 4DPLA 1TYCA 5L4LA 2XUHA 1MB4A 2PUVA 2QLJA 3AR8A 1MQSA 3LT5A 3N2LA 1TLTA 3UH0A 3WA7A 3MCAA 4JJ7A 5IBQA 5T4BA 4AVYA 1K3TA 2QW0X 4CL8A 2FFQA 2C92A 1GGMA 2XYQA 2IP1A 4RTLA 4RTOA 3KOWA 2FWAA 4DGQA 3INTA 3WS7A 2P3OA 4CM4B 5TS2A 3WYFA 4DRXB 1SXQA 2RHBA 1TT7A 2XMDA 3ODPA 4Z4QA 3ZJUA 4J2TA 1KO8A 2CDBA 1HL7A 1Y8RB 3B85A 5LKAA 3GL9A 3H97A 1LDYA 3E6AA 4OAPA 2R66A 3GEMA 2HK9A 4W9RA 5M04A 2IY8A 2ZJ7A 2M1ZA 1Z5VA 2I4MA 2JFQA 1AE1A 2XTJA 1ZYUA 3Q7IA 4LSMA 1CJMA 1CZKA 3CZPA 1R12A 4XLTA 2NGRA 4WLNA 1PK7A 5AM5A 3F74A 1JLSA 1RBYA 1DAEA 5FUWA 3DDZX 3I9JA 3QLJA 2EOAA 1EXMA 1YI0A 4B47A 1XQ9A 3A14A 4N82A 4F9EA 2P4UA 2GJ9A 2GNPA 4JL5A 2VSXA 3BXEA 1OXSC 4BZQA 3NEPX 1ZITA 2EGUA 1KMMA 3Q2IA 4C3VA 4ENWA 1FJGB 3EA5A 3K0SA 2B6NA 3L6EA 3BRWD 3D4PA 3IA7A 4TLAA 5CYFA 3T0GA 2QRGA 1JHOA 2FG7C 1VMAA 3C7KA 1Z07A 4TROA 3ZD9A 1RWQA 1UMBA