3DWFA

Crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
271
Chain Sequence
EKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNVLSNERW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
publication title Mutations of key hydrophobic surface residues of 11 beta-hydroxysteroid dehydrogenase type 1 increase solubility and monodispersity in a bacterial expression system
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase
total genus 101
structure length 271
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dwfA00
1X15A 1YJ8A 3D4PA 1B0AA 1KEPA 3FTNA 2NVWA 3DBHB 4Q3BA 4BMSA 1RM0A 3NT5A 4EI2A 2OFPA 1HSOA 4RCVA 3V1YA 1WZEA 5JXWA 1PJBA 4B4WA 1YDEA 1DDOA 4YJHB 3WGGA 2OP0A 4A73A 3TF5A 4MVJE 5A5FA 1UDAA 2C59A 1EDZA 3PJDA 2EV9A 1NTOA 3BMNA 1HDGO 3AM5A 4R41A 4WE3A 1GCUA 3VVBA 3RFXA 1F06A 1PR3A 4MVJP 1YVEI 3C3XA 2PZMA 1K6JA 4NBRA 1BXZA 1HXHA 4DBVO 4D7AA 3TFQA 3ROQA 2HMWA 3GDFA 1VSUA 2PZKA 4BMVA 3OA2A 2DU8A 1TEHA 1GUZA 1NFFA 1ADFA 4BO5A 3H9UA 2DT5A 2R00A 3DAFA 2AQKA 3ONDA 5TJHA 3GAFA 1LNQA 1SPXA 3E9NA 4XR9A 1B8PA 1W6UA 1U4SA 2YV2A 4DUPA 2B69A 1C14A 3QWHA 3GMDA 3PHIA 1CDOA 4WGGA 4DVJA 1NPDA 3F9IA 1KETA 3GK3A 3SVTA 1IZ0A 3JYQA 3GRPA 1YOVA 1D3AA 2X5OA 3D7LA 4CMJA 3ASVA 5JMPA 1F12A 5L45A 3OJOA 1HE4A 2HK8A 4OKNA 1O89A 3E03A 4PFJA 3GHYA 1R37A 3S8MA 3UH1A 1PS0A 2NTJA 1C1DA 2G0TA 3VDQA 4J7XA 3JD0A 1Z6ZA 4BKOA 1BMDA 2HMUA 3K9QO 4B3IA 1ULSA 2GASA 2Q2VA 4W6ZA 4LK3A 1KERA 4N5MA 1VKNA 3E9MA 3RC2A 4XCVA 2HLPA 3AI2A 3GEDA 3IC5A 3LT1A 5IN5A 4E13A 1VPDA 5I9NA 2CDCA 2QZZA 3KVOA 2P9EA 1MGOA 2FWMX 3OSUA 4PN3A 2EW8A 4WEOA 1NXQA 2VYND 2AXQA 3RKUA 1N7HA 4RLHA 1R4NB 4YAKA 4WOJA 4ONEA 3HDQA 4J7UA 4BO3A 1ISJA 1LEHA 1C1XA 4PLPA 3HNPA 1Z45A 4ID9A 2YHIA 3K92A 4NR0A 3NT4A 4LRTB 2AG5A 4XQGA 1PJCA 3HQ4O 2C5AA 4G5HA 1HETA 1XG5A 2EW2A 4J16A 2GF2A 5J23A 5JY1A 1SB9A 2VCYA 3GDOA 3TL2A 1JVSA 2BRUA 1EDOA 1JQBA 4WNCA 1TA4A 1KYQA 1IE3A 3EUWA 4OQYA 3JQAA 1A72A 4TZTA 3ST7A 4JP2A 3JQEA 1OAAA 2D2IA 5BNTA 1LLQA 3HFSA 4XWYA 3S2GA 2VWQA 1U3WA 1PS9A 1V3UA 2GZ2A 2ZJ1A 5TNXA 2VHWA 4IQ8A 3TJRA 4OXKA 3WMWA 1U3VA 2QQ5A 5MDHA 1DIAA 4EITA 4BB6A 3ZHYA 1P1KA 2E37A 1IULA 3PI7A 3GVIA 3Q9UA 1DSSG 4IPTA 3AK4A 3GMSA 1SZJG 4RF4A 5JO9A 3NEPX 3RQSA 4BNIA 2GGSA 4MKRA 3KLMX 4I5FA 4PZDA 4D3FA 3WWYA 1NNUA 3ZWWA 3F4BA 3TZCA 2O4UX 2R6JA 5JO0A 3FWZA 2D59A 3GA0A 3GAZA 5THKA 4OSPA 4M86A 3GPIA 1KOLA 1IYZA 3GZNA 1GPJA 5EQFA 4DIOA 5FFFA 4DLBA 4YT8A 4DPMA 4BNKA 1HT0A 5ER6A 4CQMB 1MXFA 1NQAO 2HK7A 4GMGA 2VUUA 3FNHA 4BO4A 4WEQA 1YOVB 2H1SA 1K2WA 3AM4A 3JYOA 1IHXA 3KEQA 1I3LA 3I9MA 1WWKA 1C3VA 3OEWA 1LC0A 1C1DB 3LSYA 4KUHA 4WCFA 1MV8A 2OZPA 3N7UA 4YA6A 4K1LA 3VZQA 1E1KA 2X0RA 1LDEA 4E2WA 2VRBA 4Q3EA 1R0LA 4FCCA 3WG9A 1ZCJA 2AW5A 2PKRA 3H3FA 4TQGA 3HADA 1SMKA 2GNAA 2BH9A 3VOSA 4CR6A 1ZEMA 3QHAA 4R1NA 4BGVA 5T8KC 1XSEA 5EN4A 2QIOA 1E6EA 1K6IA 3H5NA 3MCVA 4OJNA 1H6CA 4WPGA 2NLOA 2BFOA 3H8VA 5CDYA 3R3SA 3K8ZA 3A4VA 1LLUA 1P3DA 1GU7A 3GVPA 1HE3A 1C0LA 2H9IA 3PJFA 4O5OA 4AICA 3MJVA 2B83A 4CMEC 3AY6A 4GSKA 4IS3A 2YHIB 2UUOA 2FRDA 4TKMA 5A1TA 4NBTA 4Q39A 3JQ8A 4GAEA 3NJ8A 3QVWA 2X9GA 1I8TA 4J1NA 3UHAA 5JBIA 1NHWA 1QSGA 5IDXA 4ITUA 4O0LA 3ZNNA 3SLGA 4I9NA 3UFXA 3NTQA 3HG7A 1YQDA 2O3QA 4CLDA 4F45A 5A5EA 3W6UA 1F17A 4JCOA 4WLVA 1CF2O 4G81A 5DBIA 3Q11A 3QJ5A 4K26A 4ND5A 4CMCA 4DMMA 3NUGA 4NJMA 5ICMA 4CLHA 3FF4A 1DFIA 2VWGA 1K89A 4QX6A 1H5QA 1EVZA 3JQBC 2FR8A 3IOYA 1AN9A 4PLYA 5THQA 5ICSA 1DBVO 2VTDA 4BGIA 2CFCA 4DLLA 4BVAA 3OM9A 4B7UA 3RUEA 2G1UA 1V3TA 4GGPA 2J3IA 2PD3A 4I08A 1JWBB 4BNUA 4CV2A 2C5EA 2H6EA 5CG1A 4IDDA 4BQRA 1E0DA 4FC6A 2Y99A 3DC2A 1QR6A 3O9ZA 1JKIA 3S2IA 3ENNA 4E31A 4YRBA 3JTMA 2R2GA 4LGVA 5AXDA 4LSMA 2Q1UA 3WFIA 2YFQA 5JC1A 1P1RA 4UREA 3V1TC 1FDSA 1MXHA 1EK6A 3U62A 5ADHA 3DHEA 4IJKA 1H93A 2QYTA 3U0BA 1U28A 3EHEA 3H5AA 3K5PA 3Q9NA 1KVTA 4FJ0A 1YBMA 5F21A 1B7GO 2HAEA 5I8WA 1B2LA 4FS3A 3TZHA 4BNMA 4A7PA 4KDFA 4WCFB 4JBHA 3OETA 1EMDA 2C54A 1J6UA 3QSGA 1XELA 2NNLD 4WCDA 1P1HA 4E5MA 1Y9EA 2WMDA 2AEFA 4TSKA 2VNSA 4MINA 4MVJD 5JCXA 1N1GA 3F47A 2WD7A 4ZQBA 5AVOA 5A9SB 1FXSA 3C24A 4R3NA 2HDHA 1KVUA 4P4GA 4BNGA 1Y8QB 1Q7GA 3ZU3A 4E33A 4R5HA 4QFDA 4QEDA 1ZIDA 2O7SA 4AVYA 4BNNA 5JE8A 3T4XA 1WPQA 4A26A 5ILGA 5A02A 1X14A 4TZKA 3IUSA 4QT0A 1LSUA 4J49A 3KSDO 3MOIA 5TRTA 1NWCA 2G82A 4J6FA 2PFGA 3JQ8B 1LLCA 4Y67A 1SOWA 4R1SA 3L07A 3AI3A 2EKQA 1U8FO 1OC4A 4B7XA 3QW2A 2O3UA 4YXFA 2BKAA 4FFRA 1T2DA 4PRLA 4CM3A 4XZ3A 3JQ6A 3NX4A 1YGYA 3ITDA 1LJ8A 1R15A 3I6QA 1T25A 3W6ZA 2G76A 1A4IA 1M67A 4S1VA 1V6AA 3TZQA 1ISFA 4NJMB 3WYBA 4K28A 2Q49A 3GH3A 3WGQA 5TS3A 1YBVA 3RIHA 5AOVA 2Y93A 3G1TA 4ZD6A 4BNWA 4BOYA 5FI3A 2PKQO 1NFQA 1HLPA 2NWQA 3DAPA 2JFGA 4IM7A 4KWHA 4ALIA 2OL4A 3DBLA 2HCTA 4O63O 3EDMA 3GEGA 1LU9A 4RVHA 3V5NA 4KOAA 2Y0EA 5T57A 3WB9A 4YQZA 1YB5A 4E3ZA 1KY5A 3DMTA 3TL3A 2IZZA 4J1TA 2NADA 2A94A 4EDFA 3ZN2A 5BQFA 3KSZO 1Q7BA 1V9LA 3UW3A 3CPSA 1WNTA 4KTVE 4W7HA 4YAGA 1L7DA 3FPLA 3PGJA 2CDBA 4BV9A 2DUWA 9LDTA 4BO7A 4HFNA 4ALNA 3SX2A 4IQ0A 2PD6A 4OQZA 4AJJA 4BUCA 1I32A 2VZ8A 4J7CA 4DWVA 1Z73A 3KM0A 3PLNA 4AJIA 1LDYA 5IXSA 2RIRA 2CMDA 6LDHA 1YRLA 3QWIA 1WW8A 4IXWA 2VHYA 2QW8A 4E0BA 1K0UA 4OM8A 3GFGA 4BNZA 1Y1PA 4TRJA 5L95A 2AA3A 3RFVA 2ZB3A 3RC1A 5KJ6A 1JA9A 1PQUA 4J4TA 3QVTA 4LMRA 3FD8A 3R1IA 2IYPA 1OI7A 1E3SA 3BYZA 4ND2A 1AXGA 1XU7A 3C1OA 1IOLA 1PS8A 2VTEA 4QTZA 3DMYA 4X54A 4AJ1A 1MFPA 4E21A 5L7TA 2C2YA 4CMGA 2O2YA 3I4CA 1HZZA 4MIEA 4PLTA 2H5LA 2PNFA 3L4BA 4G65A 2HRZA 1M6WA 1DHTA 3PJEA 5DCYA 2VYVD 1PZEA 1KC1A 2GZ1A 1R16A 2OMEA 5A04A 4CJXA 2O4CA 1PL6A 5C7OO 1DHRA 3PYXA 1DIGA 1T4DA 4YEDA 3TWOA 1TT7A 4UEJA 3G3EA 1H2BA 4MVJA 3P7MA 3RC7A 4TRRA 3WDSA 3GRKA 1ISMA 2W2LD 2J3HA 4YAEA 4ZQFA 5KOIA 1F14A 1P9LA 3GQVA 4RQTA 1PJ3A 4IDAA 2NACA 2VHXA 2Y1CA 3ZNQA 2PR2A 3D1LA 4LN1A 1YBAA 2EF1A 5JCJD 3K73O 3HZZA 4W99A 3CUKA 4CV0A 3N74A 3F46A 4EEZA 4BNLA 3PEFA 5DN9A 5CEEA 4Y6PA 1TT5A 5TT0A 1IB6A 5EIOA 1Y7TA 2QRJA 2D4AA 3SXPA 3DOOA 4CMIA 4OMUA 3D0OA 1VI2A 1O6ZA 4M8SA 3AI1A 4QECA 1UP4A 3ETGA 4FOOA 3RASA 3D4OA 1O0SA 1ZJYA 2OHXA 3MJCA 4FJ2A 1HKUA 2RHCA 4WLNA 4FQ8A 3FTPA 3ZW9A 1W0CA 3DHNA 1W8DA 1F8GA 1X13A 2DTDA 2GLXA 1M75A 2DC1A 2GERA 3KSUA 1I2BA 4QO8A 2G17A 5EPOA 5T6BA 5CPBA 5IDQA 4GLOA 3T7EA 4E12A 4KDEA 4OOFA 5A9RA 5G4KA 4PGFA 3DZKA 3RU7A 3M2TA 3AFMA 2Y68A 1BHSA 4FC7A 4P4NA 1SEVA 3IUPA 1T2CA 3JQFC 4MIOA 1A71A 1R0SA 4WASA 3QV1A 5KWEA 4PLHA 5JSFA 4AJ2A 2QZ9A 2IXBA 1KIFA 2VNAA 4PLCA 3LK7A 3I9LA 2GR9A 1RWBA 3AOEC 5BR7A 2JAPA 1ADGA 3HHPA 3DBHA 3H9JA 5IJZA 1TLTA 4CLRB 1FDWA 3UXYA 1H94A 3ADPA 5IDWA 4A0SA 1N1EA 1BTOA 4YJHA 3GNTA 2CSUA 1A5ZA 3PRJA 1I01A 4BGUA 1BVUA 1ZK4A 3AFNA 4BNFA 4KP7A 5MGBA 1UXIA 2DPHA 4DPLA 1SC6A 3LQFA 4R54A 3HUDA 4XEHA 1HDOA 1G6KA 1SO8A 2JKVA 2Y1GA 1A9YA 4JNKA 3ROKA 1GYQA 3HN7A 3WYEA 2YDXA 3B20A 5B4UA 1P45A 3A06A 5K0ZA 3CSDA 4Q3CA 1QKIA 3KYCA 1I3MA 3Q3CA 4LRSB 2Q99A 4ZN6A 3AM3A 3ICPA 2C20A 5JY6A 1ISIA 4FFOA 4O59O 4U0JA 3NRCA 1NASA 3PYLA 3JQ9A 5COQA 2Y0DA 4OL9A 4GPD1 4U0KA 1DLIA 5KIAA 1I3KA 1H6BA 4CM8A 5CDTA 3IKVA 2HK9A 3JYNA 3O8QA 4IGEA 1XDWA 3WSWA 2EG9A 4OKIA 3CZMA 3HSKA 2ZTLA 4LSWA 2XXBA 4CM7A 2YQ5A 3LDHA 5HWSA 3ZV4A 3RUAA 2GYYA 1KVSA 3ZWAA 4PZEA 3WXBA 1T1RA 5LDHA 2JCVA 3ETDA 1Z7BA 4KWIA 1OMOA 3GG9A 2W2LA 4CV1A 4EZBA 1MG0A 4TROA 3GVCA 5CAEA 2OUIA 4ROSA 4R1TA 3JQGA 2ET6A 2X86A 2YV3A 1Q0LA 5IDYA 1R4NA 3VH1A 4YQYA 3ZH2A 2AG8A 3AU8A 5AXAA 2YQ4A 4FPXA 1GZ3A 3M1LA 4J2HA 5JCJA 4AJEA 4BKRA 4NI5A 5G0UA 4HNGA 3ZW8A 3PP8A 3JYLA 3UGKA 4O6VA 2VT3A 2EP5A 3I1JA 3JQ7B 4YCAA 3QWAA 1EQ2A 1FDTA 1AGNA 1HYHA 4HKTA 1DAOA 2PKQP 5IZ4A 4R51A 4WECA 4MVJM 1LRJA 1LC3A 3GOHA 5BNFA 4MKZA 3WGIA 4FR5A 2BMAA 4WNIA 4CR8A 4DIFA 5TC4A 1ZK0A 4HXYA 4P38A 5A05A 4MP6A 2Z1MA 2CD9A 4KZPA 4BHTA 5KVQA 4RPHA 1CQIA 5JMWA 3I52A 4RF2A 5F1PA 1DRWA 3WNVA 1CEQA 4XQCA 4CLEA 2I67A 3NKLA 5DNAA 4GX5A 1GV0A 2O3TA 4YRAA 3VPFA 2C7GA 3S1LA 2PD4A 1ZJZA 1ZXLA 1HLDA 4E32A 2QHXA 1PWZA 5G0SA 1QYXA 2X58A 5B12A 2C7VA 2JCYA 3RAJA 3KYCB 1UDCA 5I7EA 3H2SA 3WBFA 3D64A 3FRJA 4NHEA 4D3SA 1EEHA 1ZSNA 1AE1A 3QVSA 4YB8A 5JDCC 4C7JA 1ZUD1 4DLAA 1Q7CA 3O38A 3LT2A 4CQMA 2NU9A 2HMTA 4WUVA 1ZSYA 4JGBA 2DKNA 3EK2A 5U4QA 2CVZA 4U6SA 5DULA 4CM8B 5FEUA 1BW9A 1ZXBA 2OOSA 2NU7A 4TRMA 3RUIA 1X0XA 1QV6A 3O8QB 4CQLA 4AL4A 4XJSA 4XDYA 1S6YA 2OBYA 5DP2A 2OP1A 1PQPA 1MB4A 2BGKA 4YR9A 5KKCA 4FGWA 4BKPA 1WZIA 3VKUA 1QYVA 1XR3A 4INAA 1MLDA 1BXKA 4B3JA 2D8AA 3PZBA 5G4LA 3EW7A 2HJSA 4DXHA 3NDIA 1LSJA 2LDXA 4YWJA 3C7AA 1N7GA 3D4NA 5EL0A 3JQGB 4R1UA 3F4LA 4LISA 7MDHA 1O5IA 2DM6A 4CMKA 4YJDA 1B8UA 1RM5A 4EBFA 1VL8A 1Z7EA 3E82A 2X0IA 2FN7A 2Q1WA 1GY8A 3COSA 1GUFA 2VUSA 4KMSA 4EUHA 3RROA 5BSGA 5U9CA 3ZV3A 1EFLA 3WJAA 3BMOA 1X1EA 4MPDA 1DJQA 3RBXA 5DOZA 4BO8A 2NM0A 3RJ9A 4YBZA 1DC6A 5TLSA 2PTGA 2GCGA 3OA0A 4IDFA 4PVCA 4AJNA 5F5NA 2O3JA 1PL8A 4MP8A 1I10A 4XQ9A 2NU6A 1P1FA 2AMFA 3WBBA 4FFLA 4TVOA 1U3UA 2WYUA 3ADOA 3BHIA 1PSDA 3JQCA 3ZWYA 3FWNA 4GVXA 2GN4A 3OECA 5KJEA 3H7AA 2XPCA 5IZCC 1HDRA 3OQ6A 4XD2A 3ZZNA 2X8LA 1WXDA 1IPEA 2AEJA 1GAEO 5DF1A 1EE2A 1JKJA 3ZU2A 1P0CA 2B37A 2W2KA 3HWRA 4RGBA 2Q2WA 1L7EA 1EVIA 4JJIA 4J43A 4MJLA 1MX3A 4EW6A 1LRLA 4BO2A 1PGPA 1H9AA 1ADBA 4ALMA 1SCUA 1QYCA 3K31A 1AHIA 3DONA 2O2SA 3KXDA 5HA5A 2R00C 3Q2KA 5AQ1A 4K6CA 4FGSA 5IF3A 2IXAA 1SAYA 2AQIA 2HJRA 1LRKA 2D1YA 2JD1A 3BAZA 4R4JA 1HDCA 2P2SA 1ID1A 2GSDA 2Y67A 3BTOA 1T2AA 1BW9B 1XLTA 4JXKA 5TF4A 1YL7A 1N2SA 3DFZA 4CQLB 3RSHA 1CRWG 2PH3A 2ZB8A 1HSZA 5H82A 2PGJA 4UVHA 5EJ2A 5LCXA 1JWAB 2RAFA 3VVCA 3DR3A 1YL5A 2ZK7A 2C29D 3LC1O 3QQPA 3VHRA 5A9SA 4FN4A 4H3VA 4M89A 4ZU3A 3ULKA 3ZWXA 4ZJUA 3I9NA 1OBFO 3GN1A 2JHGA 5JDIA 1Y8QA 4YT2A 2WD8A 3GUCA 3UAGA 1ZBQA 1P1JA 3SJUA 5K9ZA 1AHHA 4D0RA 3PWSA 4HNHA 2ZATA 4QSMA 3DFUA 4Q3DA 4R16A 5TSDA 4J2OA 3ZHZA 3IS3A 2ZJ0A 4QQRA 2C2XA 3NTOA 2Q46A 1LQUA 4CMAA 2Y1FA 4HADA 1BGVA 1ZVMA 4Z6KA 1ENOA 4RZIA 2CDAA 2W4QA 3C1AA 4N5NA 5FI5A 1E1NA 3GVXA 4BQPA 1VM6A 5JPIA 3BMOB 3F1KA 3F6YA 4RVFA 2I6TA 1P1IA 3ANLA 4RVGA 1QV7A 2TMGA 3JD4A 4UAGA 1N92A 1UJMA 3V2HA 1NX6A 1U4OA 3FCOA 1E6UA 1E3EA 2RH4A 4MVJH 3LC2O 2DBZA 4B4OA 4I5GA 2A92A 3LF1A 1LSOA 4JQCA 5ES3A 3A28A 4ZGWA 4RL6A 2VYNA 4NU6A 4E2YA 3FPCA 4OGWA 3PHJA 1GYPA 2X4GA 1N5DA 4IMRA 4PG8A 2ZIZA 1E7QA 1PJQA 2HKIA 5A3VA 5KJ1A 1ONOA 4UUNA 4C7KA 4GX2A 5ITVA 2W2KB 4GI2A 4IS2A 2ZTUA 2RCYA 2DBRA 1KC3A 3PQFA 5TIIA 1EUDA 3U09A 1CERA 2FR1A 1S7CA 3WGZA 3PDJA 3CE6A 5T67A 1EBUA 1RM3A 4K6FA 5CG2A 2V6FA 2IDZA 2Y1DA 2E49A 4DA9A 2DBVO 1XQ1A 3ON5A 1XEAA 2NVBA 2OORA 4CLXA 1JN0A 4BO9A 4G2NA 2B5VA 2Q4BA 2WTBA 4DC1A 1CQJA 2X5KO 3ANNA 4Y8VA 3MWEB 1UZLA 4N18A 3NDRA 1HZJA 5JYEA 1XA0A 3DQPA 4B4VA 3QIVA 4GX0A 1QP8A 1PGJA 3ZWMA 1E7WA 1YQXA 2GN9A 5FWNA 1M2WA 1ZEJA 2D5AA 4ZRMA 4DGSA 4ND1A 5HBRA 1I2CA 3DBVO 3IQDB 2VUTA 1V8BA 2X1HA 3W8FA 3WGTA 4LW8A 3KLPX 4ZRNA 4YJGB 1QXSA 2J5KA 3E5RA 1LTHR 4Y9DA 3ONEA 3B1KA 4Q3AA 3F3SA 1GPDG 1R12A 5AYVA 1X7GA 1E1LA 4LVUA 3HB5X 1T4BA 4EEXA 4WK6A 1LQTA 1XIVA 3EYWA 4AJPA 3WLEA 2GPTA 3RFTA 3K2BA 4J91A 4E5YA 4GBJA 3U4IA 4II3A 3AJRA 1ISHA 3KETA 1NM5A 1UXJA 3LLSA 1TXGA 3ITKA 1VL6A 5KJFA 3LZ6A 5CDUA 3BIOA 2YV1A 1QORA 2YHUA 3VC7A 3BTVA 1U2DA 4PLGA 1W4ZA 3HE3A 4J9VA 5T5QA 4J1SA 3AUTA 4CM5A 2PY6A 1WDMA 1DC5A 4K9DA 3GHHA 1Z74A 2E6UX 4D79A 1G0NA 3SEFA 3SLKA 3UKOA 3M1AA 2CVOA 3GG2A 1XKQA 3LF2A 2VRCD 4CUJA 1VE9A 3PVZA 5G2OA 5A9TA 1PL7A 4MVJF 1DRVA 4GWKA 1I36A 4N5LA 1TB4A 3AU9A 1FJHA 4QO7A 3VTZA 3KRTA 4RPGA 2BLLA 4IDGA 2P5YA 4BNXA 1QLJA 3LC7O 1NQTA 2NQTA 4JK3A 1ZK3A 4XDZA 1NR1A 2ILTA 2VHVA 4CLOB 4MVJG 3F5SA 1HE2A 4H16A 4ZQHA 4J3FA 1PQWA 1NAIA 4W9NC 2WWRA 3W8DA 2G5CA 2Q45A 4ZQEA 3EZYA 4CL3A 1LDBA 5CDSA 1GQQA 4Y98A 5LC1A 4GL4A 3HDYA 3HDJA 1F8FA 4XIJA 2IYOA 4GH5A 3ZI0A 2GUGA 3FI9A 1NFRA 3ZWVA 4IZIA 3L9XA 3B1FA 4H7PA 4I5DA 2EHDA 3IKTA 2P91A 3ZV6A 2ZQZA 1Q2XA 1JW9B 2JAHA 2JL1A 1PU2A 4XGKA 1BG6A 3OJ0A 1B8VA 5ER9A 2H63A 8ADHA 3JV7A 3W8EA 5CEJA 3B1JA 3DBRA 1HDZA 1LDGA 1WP4A 1EBFA 4CLRA 4XRRA 1VKOA 2BFMA 4I9UA 5CEFA 1I33A 5I8ZA 4EJ6A 2PGLA 3NTRA 3M2PA 5A3JA 1Y9AA 3JQFA 2Q2QA 1MUUA 2CUKA 1XWFA 4CPDA 1LI4A 4GQAA 3VZPA 4MKXA 3PGXA 3TOXA 5EINA 2FY8A 1UZNA 3HFGA 3AOGA 3ZV5A 1DIBA 2EWMA 1I24A 4MOWA 3VH2A 4CM6A 3PPIA 4BS9A 1PX0A 3VZSA 5H83A 3INGA 1OZAA 4CM9D 3WIDA 5L53A 1LXCA 4YRDA 1V35A 3WICA 5B4VA 3TSCA 4JJGA 4D42A 4RPKA 3ZWNA 5IAAA 1G1AA 1WVGA 3WTBA 2UV8A 4I5EA 4L75A 1DOHA 4TMFA 1T2EA 2EJVA 1DAPA 5JC8A 3JD1A 4M55A 1LX6A 1EFKA 4WLUA 3GPDG 2VT2A 3HDHA 2OBNA 3HB4X 2HSDA 3AWDA 2I3GA 3H9GA 3RUFA 4RVDA 4ESOA 1YDWA 2VQ3A 4U7WA 3U4CA 3OJFA 5I7SA 5H81A 3BMQB 3DO5A 1ARZA 4XYLA 1UZMA 3ZWPA 1ZO8A 1GYRA 1NVGA 3QWFA 4R5MA 1E77A 1P74A 3DMTC 2EGHA 3VTFA 2DVMA 5C37A 5GZ6A 3NAQA 1E5QA 4DYDA 1X7HA 1WDLA 4HY3A 3ZWCA 1B3RA 5EERA 4IGFA 4XA8A 3WNQA 3TFOA 3VPGA 3GN2A 3WS7A 2VOEA 1QYDA 3AUUA 4A10A 4BV8A 2VRCA 3L6EA 3RU9A 3W4JA 3PZRA 1ONPA 4Y6RA 1C0PA 3FBGA 3VPHA 4A03A 2VHZA 3RWBA 4IDBA 4E2XA 1BWSA 4XB1A 3MJTA 1EK5A 1UDBA 2NV6A 4B3HA 1IPFA 1PGOA 3U3XA 2UUPA 2B4RO 3JQ7A 2WJPA 3D3EA 2O3RA 1WLYA 2BD0A 1EUZA 2AE1A 3WLFA 1JLLA 1YQGA 4NZ9A 3RUCA 2ZYDA 4Q3NA 3FR7A 3VPSA 2CVQA 2UYYA 3DBRB 4TVBA 2F1KA 3PJGA 4NMHA 5KVVA 3R3JA 2F00A 3EMKA 2I3AA 3IAHA 1BXGA 1C0IA 3O03A 3DEYX 3A9WA 2DFDA 3CXRA 3KYDA 5L7YA 1KS9A 2O23A 3K2EA 1LUAA 2P5UA 4R9SA 4W7IA 4YJFB 4DTIA 4J4HA 5G0TA 1M6HA 3BHMA 3AUSA 4JX8A 4I8XA 1XCBA 3L4BC 2I76A 3VZRA 3Q0EA 4PLWA 3B70A 4NBUA 6ADHA 4RV9A 4EGFA 4UVDA 3RC9A 4M49A 1E3WA 8LDHA 2PV7A 3DOCA 4EUFA 4GKVA 3WR5A 2IE0A 2V6GA 4ND4A 2DTXA 2UDPA 3SJ7A 2FR0A 2QG4A 4BNJA 1C0KA 4L0QA 2FP4A 4PVDA 2VZ0A 1M76A 4CUKA 4WKGA 1MC5A 1NQ5A 1YXMA 2JHFA 2POQX 1PJ4A 2CF6A 3JSAA 3G0OA 4A2CA 1PR9A 5TGDA 2E48A 3CINA 3E1KA 4DMLA 4MVJI 2ZYAA 3MTGA 2FMUA 4OYRA 3DXFA 2VYVA 4FIZA 2PK3A 4NDNE 3PWKA 3ASUA 3ENKA 5L3ZA 2IODA 1YH3A 2BFPA 3EC7A 4Z0PA 3DZIA 2YJZA 1WAMA 4DQXA 3U5TA 1BSVA 4GGOA 1H0KA 1GADO 2AEMA 5G0WA 3I4FA 3NGXA 4UEKA 5JW6A 2B4TO 2I66A 3JD3A 1E6WA 4XRGA 3G1UA 1YL6A 1F0YA 3H9QA 4UVIA 4UVGA 1CWUA 1ZK1A 3AY3A 4J90A 3KHUA 3TZ6A 3AW9A 3VPXA 1ZK2A 1ENYA 1ZMTA 3OIFA 3PDUA 1R4MA 2ZB4A 5FF9A 4CM4A 5C7IO 4BKQA 4Z9FA 1E7YA 4C4OA 3T4EA 1IL0A 5ITWA 1GZ4A 1Q1NA 1R6DA 1GV1A 2Q1TA 5IXYA 5I7FA 5K6AC 3E18A 3PXXA 2NSDA 3DZHA 3JQAD 3OBBA 1T24A 2JD0A 4BO1A 3Q2IA 3WWZA 2IZ1A 4NH4A 2AQHA 1NVTA 5GMOA 1D1SA 1SB8A 4R01A 3SC4A 4UEOA 2CF5A 1W73A 5DZSA 2ZCVA 4AJLA 2YUTA 4JP3A 1BXGB 3OQBA 4B7CA 1OOEA 1UXHA 3G17A 3CMCO 5B4TA 1J0XO 3KYDB 1K3TA 1P31A 2GDZA 3N58A 4U5QA 3IP3A 1EZ4A 3LYLA 4XKJA 1DB3A 4MDHA 3JD2A 1R0KA 1NP3A 4RLSA 4YVFA 4ALLA 4AJOA 3NJ4A 4DRYA 4MO2A 2SCUA 2I9PA 5AXBA 4S3MA 1PGNA 3C85A 1U9JA 2P68A 2J3KA 1E3WB 3PIIA 4XIYA 2O50A 1ORRA 3KB6A 4B4UA 4CM1A 3PHHA 4FOSA 5L4SA 2W90A 2CNBA 1R66A 5GY7A 1LLDA 3UCXA 3TN7A 5IN4A 4CMHA 4IZHA 5IZCA 1EVYA 1CYDA 3JQ9C 3MEQA 2HUNA 3TOZA 1KVRA 2EXXA 3WIEA 3C8MA 1HDXA 2GRAA 3IDSA 4JBGA 3D3WA 1YE3A 3L77A 4R69A 2V65A 3O26A 3PTZA 3WSVA 2PGDA 3EZLA 1UXKA 3MZ0A 3H9EO 3QLJA 1CJCA 3O4RA 2DQ4A 4RDHA 4Z0TA 4GSLA 1GEGA 1DIRA 2JFHA 3LLVA 4ND3A 5L51A 5IFLA 5A4DA 1VJ0A 1QLHA 2IEBA 3ROMA 3ZU4A 3I83A 4TRNA 5ILOA 5AXCA 5B1YA 2Q50A 3CEAA 3OHSX 4BO0A 4RJTA 1NR7A 3GR6A 1UP6A 3VH3A 3OJLA 4Z0HO 4JBIA 5I7VA 3L6OO 2Y05A 4ALJA 2GD1O 3EVTA 3E5MA 4EJMA 4YYZA 1R4MB 2YW9A 4CM4B 4DQUA 1LBEA 2Y0CA 4M1QA 3A1NA 3E8XA 3GNQA 1RPNA 4OXNA 3RUDA 1X0VA 4XYEA 3PFWO 4XB2A 3H5RA 1GQYA 4TKLA 1D1TA 4FD3A 1VJTA 2B0JA 4ZA2A 4DL9A 4OOEA 5T8KA 2A4KA 2J6IA 2J8ZA 5KJCA 1ZZEA 5L4NA 2IEDA 3L4SO 3STHA 2X6TA 1VLLA 2DLDA 1OFGA 4FW8A 4OIMA 1I30A 1CIVA 4Y6SA 4HFMA 4OO3A 3ZHXA 4CMEA 3KOUA 4E5KA 1TVEA 4RF3A 4XGNA 1U1IA 1NPTO 2GN6A 4BL5A 3FNGA 3GEMA 3UCEA 3F1LA 2XF8A 4ILKA 3WQQA 1ENPA 3PQDA 5KTKA 2PZJA 1GTMA 2B5WA 1XQ6A 4II2A 1U7HA 4UULA 4OSOA 3DZJA 1JVBA 3ETEA 4Z9YA 1GL3A 5TT1A 2B36A 1DIHA 4DPKA 1NAHA 2HU2A 1I5RA 3RUHA 5HTOA 3OH8A 5JS6A 3ABIA 2QYSA 4RQUA 3UVEA 3BMNB 4J1QA 4RVSA 4CODB 3JQBA 4NG5A 1B16A 2YY7A 3FBTA 4BMNA 1QRRA 4W4TA 5BNIA 3L6DA 2X0JA 4IQGA 4U8GA 5L4LA 4B79A 5BSEA 1YB1A 2ZKLA 3UCFA 4YAIA 1Q0HA 2WSBA 4NU5A 3D3WB 3GVHA 1GR0A 2ZYGA 4JLWA 4ZQGA 4GWGA 1Y5MA 4NQZA 2BI7A 4F6CA 3AY7A 3OMLA 3FR8A 4PLFA 4L4XA 2Q3EA 4F3YA 4IIUA 2Z5LA 3T7CA 1N9GA 3TZKA 3U4HA 2RH8A 4HP8A 3PLRA 3P19A 3QVXA 5JNLA 1VC2A 3P2OA 2QRLA 4AJHA 2BF7A 1EVJA 4UUOA 1O94A 5L7WA 2DPGA 1KVQA 2DBQA 3W4IA 1XYGA 3F5QA 2FPPA 3WOHA 4JN6B 4YJGA 4ZICA 3BXXA 4YDRA 3GC6A 3NYWA 3KYBA 2D5CA 4RPJA 2NTVA 3WGYA 3TPCA 1MP0A 1T1SA 2EERA 3WX0A 2XAAA 3C7DB 2EJWA 1U2GA 3H6KA 2ZTMA 4A27A 4BNYA 3DTYA 1D4FA 1RM4A 3KV3O 4NFYA 5ENVA 3RVDA 1O8CA 3GGPA 4TWRA 4DQVA 4XR4A 1DO8A 4L8VA 5L40A 3MJEA 4I1IA 4RVUA 4YTEA 1HEUA 2D0IA 3C1TA 2BFAA 4BNHA 2EIHA 3DZGA 4FBGA 4DREA 1E3IA 5EESA 3FNFA 1XU9A 5JAMA 5BSFA 1C1XB 4PG5A 4IIVA 1IHYA 4BO6A 2X5JO 1E3LA 3GGOA 3BTUA 3TRIA 1GD1O 3ZNOA 3U49A 1ZMOA 3QY9A 5I9MA 3JCZA 1UP7A 3PQEA 3ZGYA 2PH5A 3P2YA 1NPYA 3SBOA 4ZHSA 3OFSA 3OEYA 5DP1A 1GDHA 2E4AA 5DCWA 2RHRA 3BA1A 5JYDA 1G0OA 4JJFA 3WQSB 1JAXA 5GZ3A 1OC2A 4KQWA 3WTCA 3WGHA 5KVCA 3EGOA 3IP1A 3JQAB 1JDJA 5CFZA 2J5RA 4CLOA 1ONNA 3IIEA 5C5IA 3FN4A 1HYEA 1KBZA 1E92A 3R0IA 1VSVA 4U6QA 4QXMA 3H3JA 2WYVA 1BVRA 3UF0A 1E5LA 3BHJA 1WMBA 5G0VA 2OXIA 3P5SA 1UUFA 1IUKA 3DWFA 3UOGA 1GCOA 1JTVA 2W98A 3E9QA 5CP8A 1FMCA 1U5AA 1E7RA 1ZKMA 1A7KA 4E4YA 2QRKA 3OP4A 4PG7A 5A06A 3KBOA 1WMAA 1WDKA 3OIGA 1HWYA 4W82A 1QYWA 2J5QA 3L9WA 2PLAA 3DB2A 4IUYA 1NWHA 4J0EA 4NK4A 3ZWOA 2C0CA 3GLQA 4RZHA 5L9AA 3WJ7A 1GZ6A 1N8KA 1TI7A 3DL2A 1FDVA 1U3TA 4P8RA 4WCFC 3WQRA 3QA9A 4PRKA 5IG2A 1QG6A 3ZCXA 3GFBA 1N9GB 2DFVA 4E2ZA 4W9NA 2NTNA 3RBVA 3GZNB 3PIDA 1UR5A 2FZWA 3K6JA 2P9GA 4AG3A 3OICA 3ANMA 4D46A 3IMFA 1P77A 1RYDA 4NFSA 3RI3A 1ZW1A 1KEVA 5JDIC 3PHGA 1MA0A 4MP3A 1DEHA 1E1MA 4D43A 1KY4A 2O7QA 1P33A 1JKFA 4OH1A 3TNLA 1ENZA 1UAGA 2ZB7A 4LCEA 2V7PA 5BT9A 1U5CA 3OJEA 3QVOA 3OQ1A 1SEPA 3HN2A 2BGMA 3DDNA 3INTA 3MTJA 3QRWA 2WEKA 2O48X 3MWDB 5TQVA 4QFCA 2NQ8A 2VOJA 4P22A 5DBGA 4GVLA 2PWZA 2ZQYA 4KUGA 2Z1NA 1HE5A 3CH6A 4HFRA 4WLFA 4AJ4A 1PJ2A 1UXGA 2JFFA 4IY1A 4PLZA 3X2FA 4PLVA 3A14A 4RF5A 3GUYA 2JJYA 3GT0A 3R6DA 1UAYA 1I3NA 1B15A 1VJ1A 3H2ZA 1L1FA 3DTTA 1PZHA 1YB4A 4JIGA 1J49A 1H6AA 3RD5A 1T2FA 2EP7A 5KNLA 3VAZA 1J4AA 2FHSA 2P4HX 2I99A 4XQEA 2B35A 4LMPA 3I9JA 2JCXA 3KTDA 2PZLA 1H6DA 3BMQA 2HRBA 5U1PA 1Z75A 2WM3A 1Y8RA 3I3OA 1HYGA 2FOIA 3PHLA 4ZVVA 2Q4EA 3HJAA 1XHLA 4KTTE 5CHEA 3V1UA 5JAZA 3PFFA 4AJKA 4D44A 2IRWA 2Z95A 4GLLA 4ALKA 4BKUA 2BI8A 1PWXA 3QP9A 4WLEA 2HMVA 3H65A 3GGGA 1PJTA 2UVDA 3WMXA 4XGIA 2HQ1A 4IDCA 3TDKA 2IZ0A 1DRUA 2NVUA 4OHUA 4CUZA 5DT9A 1M66A 4I9HA 1X7DA 2EEZA 3UN1A 1MC4A 1NVMB 1SOVA 4UVEA 4IJUA 5COAA 4NJOA 4YACA 4F46A 4OXYA 4DC0A 1ZFNA 2I65A 7ADHA 4IJVA 4J9UE 4RO0A 4EUEA 4KQXA 1A9ZA 2A35A 4HBGA 4IXTA 1PZGA 1A4UA 3WGOA 4NNJA 1IY8A 4YJFA 3OF2A 3WFJA 2AE2A 3L0DA 3E48A 3I9KA 4R9RA 4D3DA 4E5NA 3ORFA 5COBA 1BRMA 4L4SA 3RJ5A 2GO1A 5TJ9A 2X22A 3CKYA 3AOEA 2Y66A 4E30A 1LDNA 4IMPA 5DOVA 1EE9A 3BMCA 1MFZA 3D5TA 4J0FA 2WD7B 2YYYA 4NFHA 4L4RA 4RORA 1B14A 5DDIP 4NK5A 3KO8A 2V6BA 4NIMA 1EUCA 1NQOA 1O9BA 2X7HA 2EKPA 2WYWA 2XXJA 1DFHA 4IBOA 5FYDA 4WJZA 1V3VA 1PJSA 1RKXA 1GEEA 4BB5A 4H15A 4HFJA 3QE3A 4URFA 1V0JA 2FZEA 5BSHA 4RPLA 2Y1EA 1H2HA 4M54A 3DZFA 4FB5A 2VZ9A 1J5PA 1ML3A 2HO5A 1DFGA 1Q0QA 1RYEA 1VRWA 2EGGA 3BZUA 3FHLA 3I6IA 3S2EA 1P0FA 5B37A 3TQHA 5CDGA 3CTMA 3GY0A 1HL3A 3JQDA 1A27A 3WYCA 3ZWBA 4CR7A 4L9RA 4CMBA 5HM8A 3IL2A 2B4QA 2X9VA 4D45A 2QX7A 3K96A 4FSHA 1PJLA 2FSVA 1NBOA 1LDMA 3ZNPA 1NHGA 3NDJA 4Z3DA 4JROA 3CZRA 2P9CA 4YT4A 1Y8RB 4EJ0A 4GX1A 4R3WA 1SBYA 2OGUA 4PG6A 1KEUA 3G79A 3ROPA 2BHLA 3INRA 4EYEA 5C7LO 3IJPA 1DJNA 1YKFA 3DBLB 1O95A 2C82A 3EAGA 3Q1LA 5EQDA 2J3JA 5KKAA 2ZTVA 1ADCA 1ZH8A 3AUAA 3NGLA 3K30A 2WDZA 4YPOA 1DC4A 3D5QA 3VDRA 3LVFO 3EY4A 3C7CB 1ZNQO 4N7RA 5TX7A 4Q9NA 1GFSA 1DLJA 2CY0A 3UICA 4LCJA 3DZBA 2NVUB 1SNYA 2AQ8A 4M87A 1U7TA 2Q1SA 2C07A 2TMDA 3KUXA 1H9BA 3ZHBA 4HX5A 3NT2A 4FFMA 1KEWA 1PZFA 1YWGO 3V2GA 2VN8A 3GF4A 1K6XA 4B8ZA 4UUMA 1A7AA 3CMMA 1AUPA 2W8ZA 2JD2A 2PA3A 3SC6A 3V8BA 5JAQA 4WLOA 2XOXA 3GNSA 3LT4A 4KUEA 4CV3A 5JFOA 3G49A 5KVSA 2EKLA 4DIBA 3ZU5A 3U9LA 4XJTA 5K6AA 1EQUA 1Z82A 1PGQA 3I23A 4BNTA 1B26A 1LSSA 2Y1OA 3DHYA 5CPFA 5EMHA 5A03A 1YO6A 2FPIA 2GZ3A 5F1OA 2YFHA 3BMCB 4WOKA 4NBWA 2X9NA 1QMGA 1ZSVA 4DBZA 2BELA 1XGKA 4R68A 3V2UA 4PG4A 4CL8A 1I0ZA 4D0SA 4BIIA 3E6AA 1HTBA 2X0NA 3RCBA 3I5MA 4IJWA 4XYBA 4CQMD 1LA2A 3OIDA 3LU1A 2O3SA 4AFNA 2DUUA 5F3RA 2NUAA 3W4KA 1NYTA 4F6LA 1I2ZA 4IDEA 1E7SA 4XYGA 3PWZA 4HUJA 2A9FA 5T64A 1K5HA 1BDBA 3IJRA 2E82A 4E5PA 2VWPA 3NV9A 4HV4A 1HRDA 1Y81A 4NPCA 1Y6JA 4FDAA 4FFNA 3DOJA 1AXEA 3PYMA 2VWHA 1X1TA 4J4BA 4QUKA 4YT5A 4GKBA 1DXYA 1U8XX 1E3JA 1FK8A 3I9OA 1D8AA 3UUWA 5HS6A 4BGEA 2CZCA 1YJQA 3M6IA 5F5LA 1P44A 3RKRA 1Y5RA 3GDGA 3RBZA 1FDUA 2ZCUA 1E7MA 5JDCA 4B8WA 1HF3A 3B6ZA 4CM9A 4L76A 4DYVA 5I9LA 3ONFA 2P4QA 4FFPA 5JAIA 2YDYA 4FJ1A 1BDMA 2DAPA 4XX0A 3MJSA 1FF9A 1YONA 4XYMA 3FSRA 4YAJA 1T26A 4Z9XA 5LDGA 1UH5A 1CETA 3LT0A 4RDIA 4A5OA 3PK0A 4LVCA 2AHRA 1TT5B 2WE7A 5JLAA 4E6PA 2WE8A 3MOGA 2RBEA 4CMIB 2UAGA 4IINA 1DC3A 3W1VA 2OO5A 1B3BA 2LDBA 1JU9A 5HS4A 4PZCA 4MIYA 5HRUA 3BTSA 3S55A 3S2FA 5KCZA 2X23A 2GN8A 3FNEA 1MG5A 2BGLA 3QWBA 2FPGA 2FSSA 1GUYA 4Z3KA 2NU8A 4L73A 1GQ2A 3VKVA 3MJ4A 5DBFA 2YZ7A 1IZ9A 1D7OA 1DPGA 1PEDA 3KZVA 5DCUA 4BNVA 4O1MA 2DTEA 3DAGA 1HDYA 2V6MA 5G4KB 4NBVA 4HWKA 4L74A 4P4LA 1JAYA 1ULUA 3GZ4A 3ICCA 3KEOA 3X2EA 3H4VA 4N54A 5C3MA 5GZ1A 3Q6IA 1PTJA 1VL0A 2HMSA 1PIWA 1RJWA 2I5PO 3VH4A 5F1KA 4GMFA 4PIVA 9LDBA 1ISGA 4UUPA 3EVNA 1YS4A 3JYPA 3U4DA 4D41A 5ENDA 4PCVA 2D3TA 3CIFA 3ZDFA 4OAQA
chains in the Genus database with same CATH superfamily
2JJ2A 2V55B 4R2LA 4HLCA 2BHNA 1VMIA 4JKOA 2OV4A 1SR8A 1D2GA 1H23A 4ZAGA 4AB1A 4BMSA 4Y0VA 4N48A 3T38A 4GC9A 4RCVA 3HXTA 2NW6A 4TXNA 2OGTA 3I1YA 1RAHA 1PJBA 2BSQA 1YDFA 3EF1A 2M2IA 1DDOA 3VGJA 1FTGA 1IBRA 1QFXA 5TGZA 4A73A 3MINB 3TF5A 2R44A 4AN1A 5A5FA 1K7FB 1KZ4A 3PJDA 2B92A 2EV9A 4JKIA 5AJXA 3BMNA 3DC7A 3NHMA 2G4VA 4R41A 3ZGXA 3VVBA 1IDN1 1F06A 4NESA 4ZOLF 1PR3A 1NBMA 3GEHA 3FDXA 2ALJA 4J75A 4ZYTA 1RD4A 5GGXA 3TB4A 3LLMA 1C9MA 1ZUWA 2ARKA 4TTIA 4PC3A 1SN7A 4C87A 1VPVA 1WEHA 3EBLA 3ROQA 4EP1A 2RGXA 4OI2A 4R8RA 3T95A 5HF5A 1MJNA 8AT1A 1SQ6A 4M8KA 4I36A 4BMVA 4NENA 2DU8A 3HCFA 1KMIY 1WHTA 1NFFA 4LE2A 3KWLA 4RXTA 2IZ6A 3DAFA 4BLPA 2AQKA 3ONDA 1C1HA 1LNQA 2GHTA 2OGZA 3E9NA 5KYYB 2FEWB 1Z2DA 1EI9A 2PJUA 2JFXA 3GCXA 3VSDA 3F6EX 1B8NA 4DUPA 2MINA 1BO6A 4F93B 3EE6A 3PHIA 5DYTA 3OT4A 1NPDA 1CUZA 3F9IA 3GK3A 3SVTA 3T7DA 1ZHHA 1QK3A 3GRPA 3ASVA 4G4SP 5JANA 2JNWA 2IYSA 1WD5A 2CL6X 3CW2A 1R00A 4HNRA 4Q4LA 3N2NA 4OKNA 1O89A 3MRTA 2ZAMA 5LLDA 3GHYA 2VK8A 1R37A 4OHWA 4AY6A 3UH1A 2NTJA 4M2LA 3FMIA 5H4HA 1E3MA 4RA6B 2VCHA 4PS0A 2JANA 3ZBQA 2Q2VA 2WA1A 2IYZA 1EHYA 1KOJA 2CHEA 3EVEA 2ZWVA 4REOA 1VKNA 1N8SA 4LJAA 4XCVA 2HLPA 3L02A 3UAZA 3WB0A 3LT1A 4KSCA 1VPDA 1IRXA 5DHPA 5I9NA 3A1DA 2LW7A 2UZ1B 2WOOA 4NCNA 1OBVA 1TADA 4C0XA 5GONA 5AKIA 5CB4A 2DWOA 3C8UA 1JLHA 2EW8A 2AXQA 2OZLB 4WSOA 3RKUA 1DBQA 4QXQA 1OFTA 2H1VA 4RLHA 4YAKA 4JI8B 1DWUA 4WOJA 1ISJA 1LEHA 1TUBA 3HNPA 1ZG3A 1Z4JA 1D9XA 1ORIA 1QBGA 3NT4A 2ZJ6A 4ACAA 1XZAA 2AG5A 1PNVA 1PJCA 2BL4A 2YY5A 1AGPA 4LY3A 1S3IA 3HACA 4G5HA 4P4UA 3DEIA 3L5OA 4FUTA 3TSYA 2NXCA 3LH5A 4I4IA 5AW5A 3DKRA 2A5DA 3ET4A 3ZKWB 1WA5A 1EDBA 1IOVA 3B5IA 1JVSA 4AT1A 4Z4FA 1HG0A 1SU6A 2Q6TA 5BSRA 3UGTA 4QPNA 1JFVA 4WY2A 1RQ7A 2VF8A 2WZCA 3MGCA 3V4PB 5BN1A 3LLCA 2GPNA 3BXFA 1T3ZA 2IDJA 2DHQA 3NUQA 4E7PA 4Z53A 4OP1A 1TVKA 2D2IA 4JT9A 4TKUA 2V8OA 3KXKA 3OMXA 4TGLA 1H05A 1L5HB 2O7NA 4YECA 3WWOA 2WTEA 4FDTA 3DWEX 4WXRA 4XTCS 1O9GA 4L3WA 3TTYA 4LJ9A 2CMHA 5IVDA 3B48A 1JYSA 1KMMA 1OB5A 5CJPA 4Z54A 3IV6A 4OXKA 3TRKA 5LIPA 2C1EA 4NF2A 4Q21A 2YWJA 3WZMA 1C3JA 1G8PA 1LWNA 1Q50A 2E6KA 2LBPA 3DPSA 3ROFA 2AKAB 3B51X 3EISA 3PI7A 3ZHYA 5BMVF 3GVIA 3Q9UA 1DSSG 2VP9A 1GVNB 1Z3CA 4QRHA 1SZJG 3MTDA 4XM2A 5AHWA 5JO9A 1SBNE 4KAXA 5CU7A 3RQSA 3H1TA 3KOYA 4MQFB 4I5FA 2UYGA 3W5IA 4D3FA 4DARA 1NNUA 7GPBA 2O4UX 1OFHA 1PWHA 1UBLS 3IAM6 3PDWA 3F6RA 3QLEA 2D59A 3GA0A 4X95A 3S7TA 5THKA 4PYRA 3Q12A 5GVSA 1YT5A 4FX5A 3VNRA 2PR7A 2FZLA 1RPJA 1IYZA 4MI1A 1GPJA 5EQFA 4YPFA 1HTTA 2AI3A 5CIYA 1NX9A 4KXYA 2MYPA 3AB3A 5I45A 1NQAO 3DEZA 3GRCA 2I2AA 4BCDA 2UYOA 1YOVB 2DE0X 2H1SA 4WEQA 1H1LB 2PGXA 1QQTA 5KZMB 1F9EA 3BBPA 3CLHA 4CIDA 5LP6B 3UFBA 4GZ5A 3K32A 4CU2A 1N4AA 1KZGB 5PNTA 1LC0A 1C1DB 2O9JA 3G8DA 1JE0A 1TOAA 1GUAA 3URKA 3ZK7A 1MW8X 4HAXA 2X0RA 3M49A 5HJ7A 1LDEA 2V7QA 1NRXA 4R83A 5EMMA 3OE5A 1SXJD 1WU7A 1DKQA 1YK0A 3ZCVA 1X87A 1CJUC 1K5PA 3AR3A 3HADA 4PX2A 1Z17A 2GNAA 4ZKEA 1DX9A 4D99A 1OI3A 4IHJA 1R0XA 2Q5QA 5K4AA 5AW9A 2PNJA 1GGHA 1Y1QA 2AJBA 3R09A 1XSEA 4PSDA 4XWGA 5B3LA 4ZZ2A 1PVVA 3KR9A 1B0PA 1H6CA 3R0QA 3S5UA 4V2UA 3LDUA 3E7XA 4M36A 4PYIA 4EFNA 5J4HA 2YC2C 2XB2A 5BVGA 1OWLA 4LHYA 3MQFA 5CR9A 3GVPA 3PJFA 2H9IA 1P9OA 1S01A 1SHJA 2ZJAA 4ZU1X 3SR4A 3UZUA 1L4NA 2VSXA 4CMEC 2VAWA 2WTXA 2PLWA 4Q39A 1C0EA 2O6HA 3TQIA 2PIAA 3QVWA 4K9QA 4OHMA 1N1DA 3UHAA 3ZTWA 1V7QA 2IH5A 4DR7B 3DPIA 2OPHA 3DKVA 4HSEA 1Z88A 2AVNA 4U7FA 4BB0A 3VU3A 5IBCA 3ADDA 1SC1A 4FT2A 4P31A 1PL0A 2XTZA 3V48A 4JGIA 2O3QA 4CLDA 1QFYA 1H2FA 3QENA 3W6UA 4JCOA 4H1HA 4RTPA 1YJ5A 4WADA 3RLFA 3GLFA 2DHRA 4F5ZA 3Q11A 3QJ5A 1PT5A 4K2AA 1NVKA 4ND5A 3ELDA 3G2JA 1UPAA 4UD2A 2FGKA 3NUGA 2OHFA 3RW9A 2H2HA 3MXOA 3R9XB 4QX6A 1O77A 5A7GA 1C9KA 1A2OA 2WJGA 1SVKA 3BQ9A 1KAHA 1R6UA 1KK1A 2V59A 5LA6B 4BVBA 2VIIA 3PT5A 1DBVO 1JKJB 5K99A 3FVVA 4YRIA 1P4RA 4DLLA 2OO3A 2XNSA 3HMKA 3U4QB 4NOLA 4L6IA 1V3TA 3MS2A 1Y8CA 2J3IA 2EEPA 1JWBB 1R8YA 2C5EA 1VL2A 2OT3B 2WUEA 4R0MA 2O2ZA 4BQRA 1E0DA 3C7KA 3E7PA 5LZ9A 3W06A 2J08A 3DC2A 5ESXA 1XNGA 4IDQA 4RMHA 1JKIA 2BCEA 5ALXA 1CJBA 2HTFA 4E31A 5D86A 3JTMA 4YRBA 4JXJA 3PFHA 4LSMA 1PX2A 4OHVA 4D56A 5JC1A 3GLFE 3DEKA 1EK6A 4Q4HB 1T6XA 3HRHA 5JS2A 3GFTA 5HMMA 3U0BA 4BIMA 1OI2A 1FPMA 3Q9NA 2A84A 1I2AA 4BX8A 1YBMA 1Z35A 2PX0A 1QC5B 2F59A 3CVVA 1XD2B 2HAEA 1OLXB 3SDSA 4YCLA 5I8WA 4S1PA 4AU1A 3TZHA 3RVNA 2QE7A 4M38A 4WCFB 1KZHA 2A9KA 4JU9A 3OETA 1X6VA 3E27A 1NKSA 1UXOA 3SS9X 2H2GA 2YZKA 4H4CA 3TSOA 5I3CA 2NNLD 1P1HA 4E5MA 1U5BA 3VUFA 5CVTA 1GOTA 1RACA 2Q0XA 2VJMA 2WWXA 2AEFA 4QARA 4RV4A 4TSKA 5FXMA 4M7OA 3QBTA 4W1RA 1I6MA 5AM2A 2WD7A 4ZQBA 5JCXA 1S3FA 1XWWA 4KVGA 1SBTA 4R3NA 4C1BA 4QGSA 5A2GA 2HDHA 3RVKA 4BNGA 1Q7GA 1JR6A 4FFBA 4QFDA 3D81A 4G89A 2XJ9A 1PLKA 4AQYB 2O7SA 4AVYA 3JVEA 1AM4D 4HX9A 2G6TA 5ILGA 3K0CC 2IVZA 3BJIC 1NULA 1TYCA 3G2KA 1IHOA 1Z0IA 2V4ZA 2JC3A 3K1AB 3IUSA 4OV6B 4QT0A 5J2TF 1ZR2A 4J49A 1DTSA 1TJ4A 3T1QA 4IV8A 3E84A 4MHTA 4NNOA 3PNSA 4LF8B 3GJRA 4PFQA 4DLSA 4J6FA 2PFGA 2VNIA 3DVLA 2HRQA 4FB4A 3ZLUA 4NAUA 3NTVA 4Y67A 2RJ3A 1C29B 4Q03A 3PFNA 4GO1A 1Q6YA 3B2EA 3COPA 1WXQA 2HSJA 2VHTA 2JB9A 2WWFA 4FDUA 3S2ZA 2ZG6A 2IEYA 4NECA 3UFXB 1RQLA 1ND6A 2PSFA 1X7WB 1YR6A 1JA0A 1ZICA 3W90A 5DTRA 4XZ3A 1A3CA 3ITDA 4N8SA 4L3VA 1R15A 4FCWA 3I6QA 1AV6A 5HR5A 3O7MA 1CUFA 1UOPA 1X8LA 4RHYA 4CQNA 3HO6A 1A4IA 1M67A 1W8IA 4S1VA 1V6AA 3UHPA 2DUJA 3EIOA 4B17A 1ISFA 1ITZA 1F8YA 3DGFC 2XDQB 2P6UA 1NW4A 2V3VA 4LC0A 1W19A 3LYUA 3WGQA 5TS3A 2GF9A 4G8CA 5AOVA 4MVYA 3RIHA 3R24A 5K3AA 1NSTA 1N7IA 3SEQA 1GKYA 4WESA 4CCWA 3T3NA 1G5FA 3DYVA 2JFGA 3I12A 2AOUB 3NBAA 1KOGA 3HVIA 2QQGA 3AL0C 3CLSD 3DFFA 1RJGA 3GEGA 1YZKA 3PUIA 3UHJA 4NL4H 3L1IA 3RK1A 3V5NA 1ZM9A 3T1VA 2DY1A 3AJAA 3WB9A 1DWPA 1W4LA 2J9XB 1JVNA 4IXNA 3L0PA 2CFTA 3VA7A 1W52X 4P3KA 3B60A 3C2QA 5HNKA 7YASA 2J4CA 4A2WA 3TL3A 4KAFA 5C8YB 2CW5A 1ZMXA 3H11B 3KELA 4UBNA 4UHKA 2A94A 2GD0A 2OXEA 2I55A 1DO0A 1HOTA 5FJJA 3FHJA 4EKGA 2G71A 3FYCA 3KSZO 5BQFA 2GYUA 1Q7BA 5C1OA 1RXVA 4KTVE 4W7HA 3DTVB 3A9VA 3DYBA 3ESXA 3O2JA 2C98A 3PGJA 3SS8A 4EABA 4XASA 4HFNA 2QU8A 2WB4A 3RU2A 1KY2A 4LJ4A 4AJJA 4HTFB 1CQJB 1TF2A 1Z73A 2Q21A 3EH1A 4KBFA 5GM1A 3GCGA 2XX3A 4B0OA 3LX4A 2WC1A 1IOZA 1NZFA 2FFAA 1I2DA 2XB9A 1SD1A 3KAJA 3EOAI 2RIRA 3PG5A 5IXSA 1YRLA 4RX1A 4GC5A 1AB6A 1WD7A 2TS1A 3RNLA 2J33A 4LYDA 4CEJB 1EHIA 4EQZA 2KS6A 4W7SA 3CRNA 1QZTA 4LF5B 4BNZA 4AXBA 2H4JA 1Z2NX 2GJAA 2EC5A 3B13B 1EU1A 1NQXA 5HZHA 3RC1A 2NP6A 1JA9A 2AYYA 1RWXA 5JD5A 1WPGA 4O1HA 3R1IA 4TTQA 5D6OA 4LY0A 2ON6A 1R50A 3CUWA 3HI4A 4BP8A 2RBGA 5HZMA 1IOLA 1PS8A 4QTZA 2SICE 4NMWA 3IO5A 3OJCA 4U39A 2YWBA 4X54A 4TVKA 1TM5E 4E21A 4ZI7F 2EATA 4CMGA 2V9CA 2JI6A 3I4CA 4NARA 4DV7B 3K0AA 5SV2A 3QIAA 2W5UA 1EDEA 3ANSA 3RK0A 4B8YA 3FOCA 1DE0A 1H0SA 4G5QA 3TCXB 1R16A 2FQQA 5A04A 5C7OO 2H4HA 3PX7A 1AS0A 4L08A 3U2QA 1C8VB 4B09A 2YVAA 4UEJA 2E5LB 3A6PC 1H2BA 4B6JA 1ZCBA 2BCGY 2VKTA 4KQ2A 1Q3HA 1KHHA 1V43A 1XEWX 3M8KA 2X8JA 3CBGA 4K03A 4TRRA 3I01A 1ISMA 1DWQA 1Z5VA 3LD9A 3WDSA 5BWLA 1G1MA 2B98A 2IV3A 2NXEA 3D7KA 4ZAZA 1E4VA 1NL3A 1UEXC 1F14A 1P9LA 2AG0A 3NBKA 4JCCA 1P4AA 4KFUA 1N77A 5C31A 4RQTA 1Q84A 1ZC3A 2SHKA 1SQ5A 2WT8A 4IDAA 1F0NA 3EB9A 3O9MA 4RTOA 3T7AA 3F7OA 1YBAA 1M9NA 2EF1A 1C7JA 4KX3A 5FBVB 3K6SB 3O1IC 4XD7D 3G9UA 3IPAA 4FHGA 4AG6A 4EEZA 2XCTB 5DN9A 5CEEA 4F0JA 2JGJA 5EIOA 1T9ZA 2QRJA 4ARBA 1REQA 4Z4QA 4CMIA 3GV0A 2ODAA 4DT1A 4M8SA 5ALVA 5EIWA 3ETGA 5B6IA 2HHCA 3EC2A 5P21A 1DMRA 3CJQA 3D4OA 3TK1A 3ORQA 1YRHA 4DCVA 1A4XA 4RK6A 3VO8A 1WXEA 1E2UA 2QLBA 4FQ8A 1IJFA 4INZA 1W0CA 3INRA 2GLXA 1F8GA 3IUBA 5CVEA 3I2FA 3K35A 1D0IA 1RCTE 1SZCA 4TV8B 4JVLA 5EZSA 5EYPA 5IDQA 4K6KA 1XQYA 2QW1A 3I72A 4F3RA 5G4KA 1E64A 1QGYA 2FZ5A 3TLGB 2ISCA 1GPWB 4OI1A 4B7ZA 1E8MA 3GRFA 4RSHA 2Y68A 3N3AC 4AF8A 3D8HA 2RGDA 2A9OA 1V16A 4RC9A 2JFPA 5BR8B 1JJBA 4GLJA 4A6DA 3DLCA 3THOA 1CC1S 3K6RA 5B3AA 1W0KA 1Z18A 1X8KA 4YH1A 4PBRA 4DABA 3I9LA 3N8HA 3NHYA 2RGWA 4KRYA 4BC0A 1SULA 1JSLA 3GBPA 1VGVA 2RJOA 2KPOA 2JAPA 1AA6A 2DBYA 1XTBA 3R5XA 3G8YA 2IYFA 2LV8A 3GLKA 5BV0A 2P9ZA 3QKTA 5FA8A 5IJZA 3K0SA 4N9QA 2ZI5A 3A1UA 5EGNA 2H17A 1WM1A 1IM8A 2GMWA 2Y1XA 3RAPR 4DUGA 5IDWA 4UXHA 3U16A 4YJHA 1BTOA 5JADA 2CSUA 2QQEA 3PRJA 1I01A 2GVZC 3Q3EA 3NNDA 4BGUA 4WCVA 4EY5A 3DV0A 1T8UA 1NC3A 4KP7A 2L18A 5F2EA 2DPHA 4I5IA 1K88A 2FMHA 5AK5A 4H7KA 4V02A 1HDOA 3THXA 4F9FA 4KPUB 1G6KA 1J97A 4JNKA 2OBFA 1A9YA 2WM9B 1S8NA 3HN7A 5AJUA 3MCTA 2OCIA 2FSUA 3HMQA 4ZC8A 4MW9A 4KH0A 3ZLJA 3HB0A 5LP1A 3I8XA 2I4RA 1DKLA 2EFHB 1EZZA 3CSDA 3RREA 5I7WA 4Q3CA 1QKIA 1LK5A 3DMGA 3UMVA 4ZV7A 4KWCA 4BPBA 2BFFB 4C01A 3RU3A 5H80A 3QFRA 1R88A 3FNBA 1XNRB 3TSZA 1IHPA 2B2NA 3JRNA 4QWWA 4TMWA 3VZBA 3FLEA 2C20A 5JY6A 1ISIA 4LI0A 3U44B 1H0RA 3DE4X 4ZIRB 3NRCA 1NASA 4PPYA 5TQ0B 4FX2A 3GRUA 3JQ9A 3AR9A 5COQA 2JLCA 2NZ2A 2XTNA 5LIRA 1P7PA 3OPYI 4M9SA 2MU1A 4GEGA 4LC1A 1SZDA 4QIHA 1IN4A 1DLIA 2BKLA 3G0IA 1B1CA 3UOWA 1WF3A 3MJFA 3IT1A 5EWJA 1JBKA 3A04A 1P72A 1C41A 1CX9B 4H1VA 5BQPA 1O95C 2J6HA 4GYYA 4IGEA 1SY7A 1XDWA 1BD4A 5K8LA 1AZSC 4HDMA 5U4XA 1WW3A 3CZMA 4O2BF 3VM6A 1LBQA 1SVWA 1Y1KE 4LSWA 5IC5A 1FNDA 2I4MA 3LDHA 4MTCA 4J03A 3RJZA 4EG6A 4K9RA 2ORED 2GYYA 3EGVA 1GPBA 5ECGC 3ZWAA 5EXTA 1AQNA 1O6BA 5JD3A 1ECBA 3AI7A 2Z3ZA 9ATCA 1T1RA 2YZMA 5F23A 1PQ4A 2JCVA 3EJ6A 3KU4A 4G0YA 3TRFA 4KWIA 3VNAA 3O3NB 5I48A 3RYHA 2W2LA 4BLSA 5I7UA 4RK0A 3RRBA 3U3KA 2O5VA 5JXIA 1YDHA 1T6NA 3QU9A 4F06A 2WWYA 4GD3Q 4R1TA 2YV3A 5IDYA 1R4NA 4NZOA 2QDKA 1O96A 4RZ3A 3HCOA 3BDAA 4D4GA 1G5QA 2CNOA 2XZPA 4QHYA 2I1QA 5JCJA 1M0EA 4AJEA 1P2UA 2FZGA 3MSCA 3QVKA 5G0UA 3JASB 3KAQA 4BVFA 2QS9A 4BCCA 2F2TA 5CB4F 3PP8A 1H4TA 3RIXA 1NXPA 2VT3A 2EP5A 5GONF 1QQBA 3I1JA 4IH9A 1EQ2A 1FDTA 1VBKA 2CHVA 4MS4B 5HF9A 3FGNA 2VC2B 4YRFA 3ZQJA 3FZGA 4R51A 3HJGA 3OLWA 4JB8A 4OATA 1D2HA 3AHFA 5DT2A 3Q3IA 3U7QA 3BRCA 1QIFA 2XKKA 4HEA1 2D7DA 2BMAA 3I01M 4U9HS 4X91A 4C07A 5H4GA 3VNVA 1XVIA 4U5XA 2A5LA 4RDCA 1ZK0A 1GPUA 4DZTA 4H3HB 2Z1MA 2Q6IA 4KZPA 3B8HA 1MABB 3W9SA 4B3RB 2YVQA 1CQIA 5AUNB 5JWRA 1U9YA 1PHRA 4I2NA 4ECAA 1CRPA 3QPDA 4TL6A 4C4YA 5KQGA 1U3CA 3AINA 3NTLA 4EENA 4XFJA 4PC1A 1JG7A 1V8PA 1G8JA 3V4RA 3RG2A 3V97A 2HXGA 1JG1A 2C7GA 4MZXA 3WHPA 4XVUA 3W3AA 4WBNB 2EFGA 3WE7A 2QHXA 2Z5FA 2ZYHA 3CX3A 4O4LA 3TW4A 3NAZA 2G8LA 5KC9A 4RFLA 5FUWA 3HJFA 3NBZC 3PFIA 4ARVA 2JLUA 3NH6A 4LRYA 2PMDA 1U11A 3QLTA 1VMKA 2FQYA 2P1RA 3DEHA 3L43A 4NHEA 1OE0A 2YASA 1SD2A 2ZB2A 4D3SA 1EEHA 2CC2A 1ZSNA 2FP4B 1AE1A 3BRSA 2XBLA 1WBDA 4RSRA 4LVOA 4UNRA 1CVIA 4GNRA 4UBJA 4NE2A 4IHQA 5C46F 3S1AA 4ZC1A 1Q7CA 3GD7A 1KWGA 1Z0JA 2GNOA 5AI4A 3KXLA 3HXKA 4QPPA 2NU9A 3RRJA 4WUVA 3LIIA 2QP3A 3D6FA 1KYXA 1UZUA 1S2NA 3SQOA 3G6WA 1PG0A 2A0FA 2BFWA 3RS5A 3B12A 4Y7DA 3O8QB 2YZNA 2WAOA 2WAYA 2IWHA 4CQLA 1UJ4A 1S6YA 3HCBA 4H18A 5K01A 4LC9A 3ACBA 4B6FA 4OHKA 5FTMA 3MRSA 3DE7X 2O54A 2B1QA 2BGKA 4YR9A 2RHMA 4ZDJA 3TBHA 3O2SB 4HS4A 2IBSA 3X44A 4E3WA 1F7UA 1JG6A 3K20A 3TKYA 1BXKA 5JNVA 4EUNA 2IXDA 1LGYA 3EW7A 5K05A 2GHRA 4QOSA 1IOWA 2PJZA 2MCFA 1LSJA 1IEWA 2PCLA 1A69A 2R1VA 4EW1A 1K5DA 3R0ZA 3TAXA 1NSFA 1MBZA 4BJ5A 1P0IA 5EL0A 3BAFA 7MDHA 4PGGA 1O5IA 2XXAB 2DM6A 3L6UA 1MN6A 4DRXB 3CVUA 1C7FA 3VR3D 5J43A 5E9JA 1VL8A 4BAGA 2BGRA 2V7WA 2R9VA 4KQIA 4EVSA 3Q0TA 2C3UA 1G9SA 1GY8A 4JJ6A 5ETJA 4BTVA 5ALEA 4IHJF 1SQSA 4KMSA 2DRIA 4EUHA 1VBMA 4JFRA 4MAFA 3J7TA 3ZV3A 3WJAA 4EMUA 2B7BA 3ADKA 2OHOA 4QE3A 1VHLA 2X76A 4YMTA 3NUZA 4X7BA 5AW6A 4YBZA 1DC6A 5IYZA 2PTGA 1NN1A 4DS3A 1N2ZA 3OA0A 2ZSHA 3KE8A 3UMRA 1KEEB 4Y2JA 1GG8A 2O3JA 3KOZA 1ZGJA 3ZE6A 3I09A 1TJ5A 3A0UA 4JELA 5C1PA 1P1FA 1N1MA 4X1YB 2R5FA 1G55A 4FFLA 5JZSA 3GLIA 4HVAA 4JLKA 4ZVUA 1CJSA 2P6RA 4JASB 1NNSA 4GF5A 3OECA 4X65B 4HHEA 5HQ3B 1PFKA 1E6LA 1PJAA 3I2JA 1HDRA 1VXRA 5IZCC 3ZZNA 4XD2A 3VVLA 2DX7A 1WXDA 2DFLA 2OSBA 4UPVA 5AM0A 2V0GA 4F84A 1XF9A 4ZYUA 5CD1A 2XGJA 2SCUB 5A3RA 1P0CA 1DIOB 1WSBA 4INOA 4IIGA 1TE2A 1SURA 4HC4A 4XIFA 5F7XA 1KQFA 1LRLA 1VG9B 1UMDA 4Q9KA 2O2HA 4B34A 1SCUA 2WVJA 3K31A 2ORVA 1Z36A 2O2SA 5DH9A 3LPNA 3OE1A 2R00C 2ZIFA 1WB5A 16PKA 3Q2KA 4LXGA 4E70A 1D07A 4FGSA 3FFWA 2KWIA 5A0FA 5K3BA 4DV3B 2JD1A 4PGMA 4E22A 3PT9A 1C5KA 1P75A 3KOOA 2AFIB 4QJIA 4RD2A 2PUAA 1EQAA 2O19A 4IWYA 2CFIA 1UPBA 1U04A 2QAGC 3EUAA 4YMHA 3M6MD 3I39X 1KP2A 4MRMB 1QCZA 2CDNA 2Y67A 1T2AA 1XZCA 3RAGA 3COJA 1XLTA 2NU7B 4FQ5A 1YL7A 1L5GB 3NVDA 2QRVB 1EVQA 3DFZA 1VSQA 1QYIA 5H82A 5I7AA 3SYRA 4PCAA 2R6AA 2BZSA 3DXXA 3L8EA 3CFYA 4RJLA 3WLTA 1O3YA 4BFWA 1BX3A 4OL0A 2LKCA 1L5MA 2X13A 3NP9A 3A1CA 1FW6A 3LC1O 3CQ9A 4OCZA 3VR2A 2BF4A 3KQWA 3DMRA 3LHFA 5AJHA 2XDWA 4ZU3A 1HBJA 2QMEA 4Q48A 1W7AA 1OBFO 1N2BA 4G5SA 4L95C 1HE8B 2F1HA 1Y8QA 1Z12A 3DFIA 5SZKB 2PXXA 1AUOA 4TZ0A 4UNIA 3QVJA 1YS7A 1JGTA 3EFEA 1ZBQA 3PNLA 4FZVA 5AI0A 2HWXA 1CY6A 4RS3A 1Z0FA 5J2UB 1EB8A 3PWSA 2ZATA 3QHQA 4Q3DA 4PRYA 1EK2A 4J2OA 1MR3F 3ZHZA 4G67A 4QQRA 1UMKA 3BWDD 4CMAA 2Y1FA 4HADA 2WMOB 1TCCA 2ATEA 1K27A 1ENOA 5IVPA 2OAEA 2P6NA 3UMBA 4CTKA 4TT3A 2YY6A 4BQPA 4D80A 3AHIA 4LDZA 3C98A 4NV3A 4RY0A 5JPIA 3A32A 4J16C 5BW6B 3ZD7A 4CI9A 2Q7OE 1QV7A 4UAGA 4F3NA 4X9XA 2BRUC 3VC2A 5EE0A 4TYYA 1KRWA 3L8HA 4C7BA 3CPJB 4W5QA 1Y42X 3QEBZ 2AF3C 2J7KA 3AJEA 3LC2O 4O1IA 4W1PA 5KX5B 1F6DA 1I1HA 4B4OA 4Z1OA 4I5GA 2JIDA 5FL7D 2AR9A 5ES3A 3PL5A 3FB4A 2P30A 4NU6A 3VNBA 1O4WA 4JLDA 4KB5A 1JIUA 1GYPA 1WNFA 1JEEA 2B0CA 2ZIZA 1E7QA 4HPJB 5FNVA 1RWMA 1PJQA 3TW8B 3OQMA 4EB3A 5A3VA 1VQ1A 4QPDA 1ONOA 4C7KA 3IURA 4KAJA 3R7WB 3LPMA 4FYIA 5ITVA 3EAQA 3GB9A 3ED5A 4GI2A 3F67A 2ZTUA 4R8VA 4PZ0A 2DBRA 1N34B 4N76A 1KC3A 1MHPA 3N8KA 3TNJA 5TIIA 3U09A 1XZEA 3SX4A 4BGDA 2FR1A 1C30B 4BLQA 3BGSA 1IDOA 1PNOA 4Q1EA 5B7PA 3KXIA 3U6BA 4H7IA 4K6FA 2R96A 2ECFA 5CG2A 2ZSFA 3FLAA 3GGSA 3VPCA 1N3YA 2QR5A 3UWOA 2OXCA 2R4TA 2VHJA 2Z4TA 2V6FA 2IITA 2RHBA 1BN7A 1ZD2P 3IELA 3ZQ4A 1XTUA 1CHNA 2BMEA 2Y1DA 4EY3A 4OQFA 2C5SA 2N3ZA 2DBVO 3ON5A 3SQLA 1THZA 1TAHA 5L8VA 2GPAA 3Q3JB 2ZJFA 4CLXA 4OFXA 1KI4A 3ZGLA 4LQDA 1QIJA 4LFAB 3V32A 2ZAYA 2B5VA 2WTBA 1QQAA 1FRFS 3ZZTA 1SIWA 1MOSA 3EW9A 4MRAA 4N18A 2RB5A 5ERYA 5EMKA 3QFHA 3W1EA 3UK2A 3O8OA 2CUTA 3SNHA 1PGJA 2P5TB 3SF8B 3NOXA 2FPRA 4WZ6A 2G5TA 1E7WA 3OY7A 1TMYA 1YQXA 4YI5A 1ZEJA 5EZYB 4DGSA 1FS5A 1IHUA 3L0CA 4GOXA 4WK0B 1T1JA 1VI6A 4QTTB 4IKOA 2J30A 2YHAA 1ZS9A 3ZLVA 3O75A 3ZVNA 3DBVO 2R1TB 2VUTA 1CLEA 1DTEA 2HGZA 2XYRA 4DM3A 3X2SA 1QAMA 2GFHA 2X1HA 5DN6D 4PWYA 2HIMA 4C21A 5I6DA 3QPBA 1AMUA 2P1DA 4E5DA 2BBOA 1PF7E 3KL4A 2XCQA 1RTKA 4Y9DA 1PBNA 4Q3AA 3FCUB 3RV4A 2H5JA 3EA5A 1G42A 3RAFC 1Y4SA 1GPDG 2OECA 3VKWA 5LM3A 5I01A 4TLMB 2BHTA 1E1LA 5DTJA 3WGVA 3THYB 1TQDA 4Y1GA 2MR5A 4EEXA 3TQCA 2O8BA 2VAPA 5FD8A 3DYIA 3WLEA 2FPMA 5F33A 4J91A 2VXYA 1A9XA 1ISHA 2N1MA 4RTQA 4JEHA 1EFVA 1UXJA 1C2TA 2OQVA 2V3CC 3TDMA 1Z39A 3LLSA 3FZYA 4MGHA 5A3SA 2JJ1D 3NI2A 5LBUA 1YRBA 3AP2A 4BZZA 3CRMA 1UKBA 2X0KA 4F97A 2QTLA 3P2MA 2QJWA 4DQKA 2EG5A 3HGTA 3HR8A 4FMCB 1NW8A 3ID6C 1ST2A 4QUIA 4HN2A 3BTVA 1E98A 2PU7A 1M7BA 2WNIA 4J9VA 4PLGA 1RI4A 5T5QA 3CZ5A 4GKJB 3MT8A 3WDLA 4JLMA 2PY6A 1DC5A 1U1FA 2HWUA 2PWAA 2YNMC 2B7CA 4G0OA 3SEFA 1QHYA 4JSYA 1JAIA 1IZ7A 3M1AA 2CVOA 1AY0A 2PYIA 4Q37A 4Y2YA 3TEMA 5CYGA 1RRGA 1UBNA 3IAXA 4CUJA 2NSJA 3FGPA 3IB6A 1KJWA 3QNUA 1UKVY 4I1UA 1QCCA 1SELA 1TW3A 3IA2A 4I9FA 2Q4TA 4B73A 4RPGA 5JV5A 1MZPA 2ZJ4A 1AIPA 3HZOA 1T6YA 1Q1BA 2GF0A 3UWDA 2VDKB 2Q5OA 2VHVA 4JWKA 1DEAA 3CEJA 2WIDA 3N0RA 4JP5A 2CJFA 2H0QA 2NZUG 1HE2A 1GAWA 3MS4A 4JOBA 3KUCA 1DJLA 2BJVA 2ZRIA 3LC0A 4E94A 4H16A 2QTBA 3C6BA 1P17A 3GLHA 5TARA 4D0NA 2K87A 1YI8A 2W37A 4W9NC 3TIGA 3DGEC 1TQ6A 4PZZA 4K3VA 3TTUA 1NVAA 5D3MA 4JHXA 5BNZA 1CEEA 3HBJA 1UMBA 3W04A 2JLYA 1DX4A 3IAM1 4GMXA 3LYAA 4OA8A 1A95A 1VYHA 4GL4A 2RKWA 3P32A 1NJSA 2Q6KA 3KKKA 1JEYA 1WL8A 3S5JA 1K98A 1T9GR 2HJ9A 1C8BA 3B1FA 4C29A 2ZETA 1NN5A 3MG9A 5C4GB 2UZAA 2VDJA 3SHOA 4MV4A 2P2YA 4DLTA 2ZQZA 4Y1RA 1Q2XA 2JAHA 1NVEA 1BG6A 4LV8B 4FFVA 5JSQA 3A1FA 3JV7A 3W8EA 5CEJA 4AKIA 2I4IA 2NQ2C 4UKDA 1HDZA 1LPBB 1XTVA 3T9FA 3SXUA 3TX2A 4BFYA 3UBTA 3E4DA 1E18A 4AZTA 5DYYA 1L7BA 3K0BA 5K8JB 1N3BA 9ABPA 2J4FA 1WXGA 4I9UA 3GGCA 4EJ6A 4W6QA 1CIJA 3GLHE 2L82A 2D8MA 2HM7A 4ZAFA 1Y9AA 1X9GA 4ZCQA 1XMQB 1FSSA 1UDRA 2CUKA 4WZBA 4QDOA 1QV9A 5FV4A 2E18A 1A4RA 1RPTA 2D62A 4MKXA 1EXMA 2P9JA 4CXMA 4BQSA 1V5EA 1Q1EA 3PGXA 3TOXA 1QBKC 2Z6QA 4G37A 4ND7A 4TYMA 5FCDA 4FZ3A 2AKYA 1IY9A 2F9MA 2QRZA 3BREA 3ETNA 5EE3A 3QXSA 3U4AA 3E7DA 4OJTA 2EWMA 4MOWA 1MO3A 1H2YA 4R8SA 4CM6A 1J9GA 1FMFA 4KG7A 1DELA 4WL0A 3SSMA 4JL8A 1TLFA 2Q4RA 1FX0B 1OZAA 3TOCA 1RQGA 4E4RA 2G88A 4R6WA 3DDHA 5L53A 1V35A 3WICA 4EHHA 2EBWA 4TWIA 5KNCA 3BFJA 2W6PA 4RPKA 4Z99A 1YC2A 1G1AA 3ZWNA 4RK1A 4S1WA 2I1VB 1O0BA 1C4XA 2UV8A 4EHFA 4QYIA 2ZBUA 1CFZA 2JZCA 3NHAA 4TMFA 5K20A 5KYUB 3JD1A 3C48A 1LX6A 3IVGA 3SBDA 5BUCA 4RGQA 1RBMA 4P9NA 3M1IA 4M7WA 4C4RA 1MCZA 3L0ZA 3ZD8A 2HSDA 3AWDA 2XCSB 3KKQA 1Y3IA 3H9GA 3AO0B 4ESOA 2IUUA 1T5SA 4U7WA 4KR9A 3E0XA 4L0MA 1ILWA 3U4CA 4B3CA 4WZBE 3PNVA 4MJ7A 4TVSA 5E4FA 2LPMA 3WL6A 1XDGA 3OTQA 5I7OA 4L07A 3CF4A 1OWNA 3DO5A 4I4TB 3U80A 4YCSA 5CT9A 1UZMA 4I3GA 4XPZA 4EPYA 5HSGA 4NCIA 3SR0A 2YMQA 3NMUF 3CX8A 1X80A 1CNFA 4DDWA 4EELA 4R5MA 1P74A 3PHBE 4J1TC 2DVMA 5JD6A 5C37A 3D4BA 4I50B 3A3NA 3OCCA 2OBXA 4D6YA 1E8NA 1T4CB 3ZWCA 1IN5A 2XRFA 5JR3A 2L19A 3N0WA 4UOZA 4IGFA 4CRWB 4W5HA 1G6Q1 3UQZA 4C04A 4MYUA 4PWZA 2ZAGA 4NBSA 4A6XA 2VP4A 3TBKA 2VO1A 3EG5A 4WZZA 1QYDA 3PV0A 4ZWNA 3H0CA 3IMGA 1Z6PA 2OV8A 2HBRA 3L6EA 1APBA 3TIFA 2D0OB 1NIPA 3GFSA 1USWA 2XIQA 4A03A 5D2CA 5FTKA 1QUEA 3CC8A 4HH0A 2JJ2D 1S02A 1ZZGA 2WMNB 1EK5A 4TZ6A 2YXPX 1FVHA 1MO2A 2BDEA 1PGOA 4P84A 3HO1A 2E5FA 1MAWA 3JQ7A 3FOEC 1FU8A 2Z3WA 3WRXA 3F0TA 1JIQA 3WRYC 4ZVRA 2XE6A 4PPGA 4CKCB 1Y5NA 2GCPA 4FDVA 1KOFA 3MM4A 1ZD8A 2F90A 3DJYA 4NZ9A 4G1BA 4Q3NA 3WLFA 3VPSA 1EAMA 3BHNA 3NHPA 3R4VA 2UYYA 3DBRB 1V71A 3IQXA 2F1KA 4TVBA 4ZRDA 5KVVA 3EFOB 1MB2A 3EMKA 4DIUA 4DSTA 3R9KA 3CUVA 3IBCA 5E6UA 4MVCA 3A9WA 5H3CA 3ZY5A 3CVJA 2DFDA 3CXRA 5L7YA 1GTL1 2OBMA 5FFNA 1LUAA 1XMVA 3RT1A 3VU9B 5ITSA 2NP7A 1R3DA 3GT7A 3C5VA 5A6VA 3HFRA 4ODIA 3AUSA 3BH6A 2HNKA 5SZIA 4MR7B 2I76A 4K8OA 4WA8A 1CFJA 1IQUA 4B43A 1L5SA 2H8GA 2PKWA 2P2NA 5TB5A 4L72A 3ANXA 3IO3A 4RV9A 4TQAA 4YMGA 5FA5A 1W581 4K40A 4FE3A 4HUQB 3QG1A 4FTWA 4YALA 3SK0A 4Z1MA 5KB3A 3AUKA 4IEEA 8LDHA 3VR4H 2V45A 2GJ4A 3ZVLA 4FDLA 3ZY6A 1ZUNB 4GKVA 4UPDA 4ND4A 3V4FA 2UZ4A 2DTXA 2DWUA 2UDPA 2AFHB 2V0NA 4DA8A 2ZSIA 5FJIA 1NUQA 1T15A 1C0KA 4J0CA 1OFUX 4PVDA 4WN3A 1XL0A 2IQ5A 2VZ0A 4G0QA 4P4TA 4QOEA 3RO7A 1M76A 4UXJA 3RVOA 1IEXA 2PQ2A 3G2MA 3TDNA 4HXGA 4BMOB 4ZOQI 4DG5A 2OQ2A 1NYRA 2Z4RA 2XIJA 3GEPA 3DXYA 4M1KA 1MC5A 2A3NA 4MAMA 1FNSA 3TMKA 4YRKA 4TKVA 4A2CA 2WKRA 1PR9A 2R6ZA 4G25A 1KSGA 1HO3A 4ENTA 4Q4DA 3JX9A 3H16A 5M2QA 1U2PA 1X86B 4DNFA 3SE7A 2FG7C 2HY7A 2XYPA 4B0PA 3H9CA 5BSKA 1A50B 3LPDA 4QU9A 4RKYA 5FULA 2FMUA 5DSZA 4TS9A 1YIOA 3TZLA 1ZCFA 4FIZA 1D2EA 1T91A 5KEIA 2AUMA 3DA8A 1C80A 2WUFA 4K88A 4LE1A 1YH3A 4CG3A 2JFNA 1HLGA 4WA7A 1WAMA 3TQSA 3QGMA 1Q17A 2B61A 4ZT2A 5IAKA 4MUKA 2AEMA 3NGXA 1PDVA 4YI3A 4YQEA 3TBFA 2AXNA 3L7DA 4B2PA 4BFCA 4XQ0A 3ESYA 4MV7A 5IAOA 1W29A 4UVIA 1U0JA 1JLRA 4YAWA 1GP2A 1F1JA 2XUFA 2WMYA 4MEAA 1V1MB 4BMPB 1R0ZA 3FVWA 1J1ZA 1XL1A 3C8HA 5FUBA 3VPXA 4ZGGA 4XWKA 4N41A 1ENYA 1NXXA 4F9GA 1UJCA 2EIXA 4UTRA 1FYWA 3ACDA 4Y2XA 5C7IO 5CDHA 4YJ2A 5DB4A 3UEOA 4LPSA 1Q1NA 5IXYA 4YDQA 5KSWB