3DWFA

Crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
271
Chain Sequence
b'EKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNVLSNERW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
publication title Mutations of key hydrophobic surface residues of 11 beta-hydroxysteroid dehydrogenase type 1 increase solubility and monodispersity in a bacterial expression system
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase
total genus 101
structure length 271
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dwfA00
4JK3A 5FFFA 4NFSA 1FDUA 3QA9A 4UAGA 3JQBA 1HDCA 1XA0A 5LDHA 2AEFA 3GAZA 5COBA 4E5YA 1K6XA 4WOJA 3NDRA 1D1SA 1PQPA 2OZPA 2O3RA 3K2EA 4K1LA 3EY4A 2UVDA 3LQFA 1H9AA 4DUPA 4NJMB 1JQBA 3FWZA 2JJYA 2CVQA 4R3WA 1NHGA 4PZDA 4BNFA 2YFQA 4FDAA 3ZHZA 3GRKA 1C1DA 3F9IA 4UVHA 4XYMA 4UREA 4AJEA 3BHIA 4D0RA 4DXHA 4C4OA 3U4HA 3W1VA 4NBRA 1PZHA 4PG7A 1JLLA 4YACA 4IY1A 3AWDA 2NUAA 3EYWA 1O5IA 1P77A 4E2WA 3ZV6A 4ZN6A 1H6CA 3OSUA 3BHMA 3Q9NA 4DYDA 5K6AA 1NVMB 4WLNA 3EDMA 2G17A 3AUSA 2IRWA 2JKVA 2O3JA 4GVLA 1E7QA 4E4YA 2H63A 1HF3A 2NU9A 3HJAA 1HZJA 2VZ9A 3PWKA 4NR0A 4GX5A 2OMEA 2RHCA 3GGGA 3KYCA 5JMWA 1KVSA 4JGBA 4DPMA 1ZBQA 5CHEA 1X0VA 3H65A 2CVZA 3R6DA 5A3VA 2C07A 4XKJA 4NHEA 3V2UA 3L9XA 4ITUA 4JLWA 3INTA 1IPFA 4I5FA 3S8MA 4GMGA 5DOVA 1JKIA 1R4MA 3CPSA 3B1FA 4H3VA 5CDUA 2O7QA 2Y1DA 3GHYA 4AJIA 1Q0LA 3M6IA 1NWCA 1YDWA 1E1KA 4OM8A 4JBGA 2BLLA 3UXYA 3QVTA 4I08A 4R41A 2WJPA 2ZB4A 3EZYA 5G0SA 4D43A 2PKRA 4JN6B 1K2WA 4BGEA 1SOWA 3PQFA 2ZQYA 1KIFA 2Y0DA 3DZHA 3SLGA 4HNGA 3B20A 1V6AA 3LZ6A 2W2KB 3ZU5A 4YQYA 4CUJA 3ASVA 3PWSA 3ITDA 1C1DB 1ZVMA 1XWFA 2EHDA 4E0BA 4YAGA 3RROA 1KS9A 4ILKA 1QP8A 4A5OA 1GZ4A 4PG8A 4FOSA 5CPBA 5KJEA 3D7LA 3RWBA 1JWAB 3FNEA 4BNJA 1HE2A 1T1RA 2O3SA 3GVHA 4GKVA 3DHYA 4Z3KA 1RM4A 4QO8A 2FN7A 3KBOA 3RFVA 5IN5A 4J7XA 4RGBA 1XDWA 2P5YA 4A7PA 1ZK1A 4CM8A 4B4VA 3GPDG 3K2BA 4Q3CA 2QRLA 3LT0A 3SLKA 2YV2A 2OOSA 5C5IA 1GADO 1LSSA 5G0TA 1NFRA 2JAPA 2PGLA 4M49A 5HBRA 4BIIA 4BGVA 2X8LA 3KYCB 1N8KA 1ONOA 2PH5A 4HADA 2HSDA 3AUTA 5A5FA 3IP1A 3DZGA 1VKOA 5CEEA 2BD0A 3WS7A 4BMVA 1O6ZA 3BMQA 3WMXA 5CPFA 3QY9A 3RIHA 4LVUA 3VOSA 1GYQA 1E3JA 2J3KA 4JJFA 1PL6A 3N7UA 3IS3A 3M2PA 2I3AA 1HEUA 3TZQA 3T7EA 2EKLA 4OHUA 4CQLB 4CM9D 3ZV4A 5B37A 2PFGA 1EVJA 4S1VA 1R0KA 4GLLA 4BO7A 5CEFA 3O4RA 4IXWA 4BL5A 2ET6A 1ISGA 5F1PA 1NR1A 2BF7A 1Q2XA 4NPCA 1B14A 4CPDA 2FOIA 2Q2QA 4NK4A 5GZ6A 5IG2A 1PJBA 2VT2A 2EIHA 3LF1A 3I6QA 4YJGA 3HWRA 2GERA 3CXRA 4R1SA 1N1GA 4FR5A 4DLBA 4F6LA 1BVUA 3JD4A 4NNJA 5KJFA 1ID1A 2Y1FA 3L07A 4BNLA 4XGIA 2IYOA 3MJ4A 1PJCA 5CAEA 4XYEA 1B15A 2DBQA 3CINA 4JXKA 5DOZA 5U1PA 1QR6A 5MGBA 1I3LA 1YQXA 5LDGA 3LT2A 2DBZA 4RDIA 4GQAA 1VSVA 2AE1A 4ALKA 4ZQEA 3QWHA 4KZPA 4U6QA 2QRKA 3VKVA 4A26A 4XQCA 1DXYA 4AL4A 1F0YA 4IDDA 2NVUA 3QQPA 1U2DA 4PN3A 4IDEA 4IJKA 4WEOA 4LVCA 1C14A 1R4NA 2CSUA 4JNKA 4KUEA 4LW8A 2CUKA 4DIBA 3ZU3A 1QLHA 3LK7A 4DWVA 2X22A 4BNWA 4PLVA 2R6JA 3CUKA 4S3MA 1WDKA 4N7RA 4BNUA 4D7AA 3JQGB 1LSUA 3BMQB 4LMRA 2J5QA 3WGQA 2SCUA 2Y05A 2AEJA 2Q1SA 3PJDA 4Y8VA 4E33A 1CDOA 2ZTUA 3WNVA 3DMTC 1WWKA 3RUIA 3PYLA 1XKQA 4CR8A 3FD8A 1ADCA 5JDCC 2G0TA 1GZ3A 3JQ9C 3LSYA 4J1QA 3GMSA 4WLOA 3WIDA 2IZ1A 2WE8A 3JTMA 5JCJD 1Q7GA 1LRKA 1YVEI 3GVXA 3TQHA 4CJXA 4NFYA 1EK6A 1ZEJA 1J4AA 4RF5A 5DCUA 4H7PA 2W98A 2Z1NA 3H7AA 4CLDA 1PL7A 1DFHA 5T64A 4Q3AA 4BQRA 4OSPA 1E77A 1E6EA 5A1TA 1E5QA 4IDGA 3Q6IA 1CF2O 3ZHXA 1NQOA 3G0OA 4FFPA 3A28A 2WM3A 1Y9EA 1JA9A 1ZK0A 3E5MA 3H9JA 1WW8A 2EP7A 3MJSA 3BHJA 1TEHA 5DT9A 1PGJA 1LI4A 4JROA 3VHRA 3GFBA 5JSFA 1U1IA 4ID9A 1K6IA 1A4IA 2DAPA 2DBVO 1V8BA 2HRZA 3X2FA 2VWHA 1T2CA 4IDBA 3E1KA 4K6FA 2NVUB 1UAGA 4M89A 3ZNOA 4YT5A 1U3WA 1E7WA 2Z1MA 2CDCA 3EZLA 4E5KA 1GZ6A 2HMVA 4Q9NA 1R4NB 1T4DA 2YJZA 1VL0A 3HDHA 1XIVA 3C85A 1WXDA 1MUUA 4D42A 1L1FA 1JTVA 1VSUA 5L3ZA 4CM4A 3TDKA 3GDFA 1YL7A 3Q2KA 5AVOA 1B3RA 1VKNA 3A14A 1WPQA 2X5OA 1P9LA 2CDBA 3R3SA 1UJMA 4IDCA 5BT9A 3IC5A 1U28A 1DJNA 2ZB3A 1KY5A 4LISA 1XR3A 4GX0A 4G5HA 1M75A 4FFMA 4AJ1A 1QKIA 1UP4A 4FN4A 3PHLA 1LUAA 3ZHYA 2GO1A 2X6TA 1P1HA 3FBGA 1FDVA 1M76A 3RBXA 3CZMA 3GUYA 5COQA 1TLTA 3G1UA 4DVJA 2ZCVA 2EKPA 4XYBA 2GZ1A 3QSGA 1ULSA 3AOGA 3KEOA 4DLLA 1P1JA 2DPHA 2P2SA 4LGVA 3T4XA 1DO8A 4A10A 3GN2A 4LMPA 3I9LA 2GRAA 4B4OA 3PJGA 1MFPA 1BW9B 5AXAA 5ENDA 4DREA 5DP2A 2I3GA 2I65A 1X13A 5TF4A 2EG9A 1KVUA 5I8ZA 4EUEA 1GV0A 1XELA 3RAJA 1YBMA 1LNQA 4FQ8A 3NDJA 4A73A 2C59A 4BKQA 1G0NA 2OP1A 4JQCA 5KCZA 2YYYA 4EGFA 4BO8A 4CM6A 4WKGA 4KOAA 4IGFA 2GGSA 3OHSX 1B16A 4GX1A 2C82A 4R4JA 4YTEA 4CLEA 4RF3A 3IIEA 4L73A 3RJ9A 3PQDA 3QV1A 1ZFNA 4CM9A 2J3JA 4CM4B 1JW9B 1LSOA 1ZKMA 4WPGA 4DGSA 3SEFA 1S6YA 4C7KA 5IZCA 2VUSA 3SC6A 1JKJA 4WE3A 5DNAA 5ENVA 4ALJA 1M67A 1T26A 2OL4A 2X4GA 1NM5A 5ITVA 4CMJA 1B0AA 2YHUA 4CL8A 4DPLA 3AI1A 2CF5A 4RL6A 4XGKA 5A4DA 3AI2A 2OORA 2XOXA 2BKAA 4ND4A 4QFDA 1AUPA 2PKQO 1BWSA 4CLOB 3Q2IA 2VWGA 3E9QA 1D1TA 1N7HA 3KYDA 5JE8A 2PR2A 1CERA 5BNFA 4J43A 4KDEA 4NQZA 3IL2A 4Q3NA 3HNPA 3OJ0A 2X23A 3FCOA 1WVGA 3VC7A 1Q7BA 2PLAA 3VVBA 1N9GA 1Z73A 4QT0A 2Z95A 2FPGA 3ETEA 2WD8A 2D1YA 2GSDA 2O3UA 1DB3A 2I9PA 5G0WA 5BNTA 1LA2A 3W6ZA 3G49A 2R2GA 3JD2A 5EIOA 2HLPA 3GFGA 3FNFA 2C7GA 2OO5A 4XCVA 1BXGA 4PLWA 4EEZA 2HU2A 2IZ0A 1VI2A 2PWZA 3S55A 5G4KB 2X0JA 4DQXA 1LX6A 3RBVA 3WYCA 4IDFA 4CMKA 1SBYA 4BNYA 3GPIA 3DOOA 3KOUA 4CQMD 3L4BC 2BELA 2DT5A 3OMLA 1GCOA 1NWHA 3OF2A 1DIBA 3W8EA 3NRCA 5AQ1A 5ITWA 4J49A 3OQ6A 1PJLA 4QEDA 5A05A 1YBVA 1CQIA 3Q3CA 5K6AC 4L76A 2F00A 3ZN2A 2VRCD 2D59A 4J91A 1UUFA 4IQ0A 4MVJH 3QP9A 1F8FA 1E3IA 4BO0A 4BNXA 3ZDFA 4KUHA 3AY3A 3B6ZA 1WMBA 3GNSA 4G81A 2VHXA 3S2FA 4XQEA 1H93A 3BTVA 4BGUA 1ADFA 2NM0A 1UZLA 4WGGA 1JWBB 2X0IA 3KYDB 1EEHA 3D3EA 1A7AA 4IZIA 3NYWA 1P33A 4BKUA 4RPKA 3NTOA 4LRSB 1VJ0A 4P4GA 3N74A 3R3JA 4YJDA 3NV9A 4E2YA 5IN4A 1G6KA 1L7EA 4GLOA 1P74A 1R12A 1VJ1A 1V0JA 3BA1A 3DZBA 2PZMA 3GQVA 1P0CA 1H0KA 2FZWA 3DMTA 3MCVA 4ZRNA 5GMOA 3AFNA 5I9MA 4YPOA 1C0KA 2GDZA 4HNHA 1E3LA 1QYDA 2D5AA 4WCFC 3Q9UA 4AJOA 2DM6A 3TL3A 3JQ9A 2O2SA 1U9JA 4BNZA 3H4VA 3LVFO 1F17A 4GBJA 1ISHA 3LYLA 4R54A 3ROMA 4KWIA 1GYRA 3C24A 3TJRA 2AQ8A 2ZYDA 4PLYA 1DLJA 4XDZA 3PGJA 4YJFA 3WYBA 3U09A 4XIJA 1KVRA 1HE4A 1PIWA 1Y1PA 5JAZA 4HX5A 4J16A 3ZWNA 5IFLA 1SC6A 1M2WA 1C0PA 2IEBA 5L7WA 3VTFA 4YJHA 4B7XA 3UVEA 3RKUA 2A9FA 3WFJA 2VHYA 3E82A 5A06A 3OIFA 1IE3A 4CMAA 1UP7A 3HUDA 3QWAA 1Y5RA 5TQVA 5TJ9A 3U49A 1GQYA 1K6JA 3DBRB 3TZKA 1SCUA 4HKTA 2OBYA 4OSOA 3ABIA 3E03A 4TMFA 3V1YA 4DRYA 2FRDA 2JD2A 3PZBA 1ENPA 3COSA 4EJ0A 1X7DA 1HTBA 1NQ5A 9LDTA 4YEDA 3WGZA 4CMBA 3KETA 4ZICA 2ZJ0A 1I01A 1QLJA 4CV0A 3CEAA 3OA2A 1ZUD1 1I32A 3WQSB 1UXHA 2VNSA 3I6IA 3UCXA 1GAEO 1CEQA 4ZRMA 5FWNA 4B4UA 4JP3A 4R16A 2LDBA 4E5NA 1PQUA 1VL8A 3IDSA 3WFIA 2P9GA 3MOIA 4BOYA 3JYQA 2FP4A 3BMNA 4QTZA 3WDSA 5KNLA 4FJ0A 4FW8A 2DQ4A 3E18A 3W4KA 4G65A 1FK8A 2G76A 1U7TA 2WYUA 1ZSVA 1TT5A 4YAEA 3IJPA 3WGGA 3IUSA 4QO7A 4RDHA 3GHHA 2AEMA 2GR9A 4UUNA 1VE9A 3NT2A 4ZQGA 3QWBA 4R5MA 1O89A 1R0SA 5L95A 1VJTA 1O0SA 4MKZA 2W8ZA 2C7VA 4U5QA 4YJHB 3OJFA 1EBUA 1KOLA 1SMKA 4NBUA 3P7MA 2ZCUA 4L8VA 2HCTA 2O50A 4GGPA 4PLZA 1DHTA 4D45A 1EUCA 3SJ7A 1T2EA 2BH9A 3DHNA 1MG0A 4O59O 3HB4X 4FPXA 1I2ZA 5EL0A 4PG4A 1YKFA 3PLRA 4CMIB 4DYVA 5KJ6A 1GPJA 1PWXA 4ND2A 2NTJA 1ZJYA 2GZ3A 1WZEA 2AQHA 2AG8A 1NR7A 1LSJA 5EJ2A 3WGOA 1YXMA 5JO0A 2NSDA 4PLHA 5BSHA 2HUNA 5IXYA 1EQ2A 3ZW9A 5A03A 1FDSA 2VHVA 3AY6A 3DAPA 3LDHA 4MVJE 1BXZA 3GA0A 4E30A 5DBGA 4RPLA 5LC1A 3HG7A 3C1TA 1JDJA 1EUDA 5A02A 1B7GO 4MIEA 3S1LA 4RF4A 4CQMA 4FGSA 3EW7A 1Y8RB 1YOVB 3U4CA 1TT5B 1V35A 2HMTA 3CTMA 4IGEA 3G3EA 4UUOA 1Y5MA 3U4IA 4G2NA 3R1IA 1PTJA 2VRCA 1BTOA 1MFZA 3H5RA 4HFNA 2O4UX 3GOHA 2X86A 4HBGA 4CODB 4E21A 1HT0A 3KYBA 3WSWA 3WQQA 4RQUA 2A94A 3ZWPA 4PZEA 5TJHA 4LK3A 1R16A 3G17A 3MJVA 3OH8A 1HSOA 1V3UA 5CEJA 5FEUA 1PEDA 2Q2VA 1W6UA 1ZXLA 5THQA 2B36A 2W2KA 4Z0PA 1KVTA 5IDWA 3KO8A 1ISJA 3HB5X 4R1NA 3A4VA 4GMFA 8LDHA 1NFQA 5L7TA 1ULUA 2EGHA 3L4BA 1YQDA 5T67A 5L40A 3PPIA 3MJCA 1SEVA 2RAFA 3ULKA 3O26A 5T8KA 2V7PA 4WLUA 3MZ0A 2Y68A 3W6UA 4FGWA 2B4TO 1D3AA 2NQ8A 1LC3A 5C7OO 4MVJP 4HFRA 1R37A 1GV1A 1QSGA 4TWRA 3GEGA 1H2BA 2FWMX 4P38A 1ISMA 2TMDA 1PGNA 4QXMA 4EJ6A 1A9YA 1Y7TA 1I5RA 1GCUA 4OGWA 1YRLA 3A9WA 3F4LA 1BHSA 4L4SA 4XA8A 2ZTLA 1M6HA 4WK6A 3KXDA 4BKRA 5DDIP 4E32A 2EW2A 2CVOA 3BXXA 2AXQA 3SBOA 1WNTA 4CQMB 2Q1UA 3ZWBA 5K9ZA 3D4PA 1PZFA 4NJOA 5F21A 2NU6A 2I5PO 1XCBA 3HFGA 4ZGWA 2Y1CA 2ZB7A 1PZEA 1R66A 2E37A 3AI3A 1YBAA 4JX8A 3RC7A 2VUUA 2AMFA 2DTDA 3DZFA 2Y93A 1CWUA 5A9RA 2DTEA 4WCFA 4CQLA 1H6BA 3F5QA 1TA4A 1P3DA 3ZU2A 3RC1A 4GWKA 3I9KA 2CD9A 3IJRA 2NLOA 1ZIDA 2QIOA 2ZKLA 3PVZA 4OOEA 4Y9DA 4M55A 3DO5A 1RKXA 3M1LA 4K6CA 4MKXA 2P5UA 1KEWA 4NU5A 1KY4A 1F12A 3GG2A 3AM4A 1J5PA 1NQTA 3RUAA 3PJFA 1G0OA 1DIHA 3ZNQA 3C1AA 3GNTA 3ZGYA 1N2SA 1HYEA 5IZCC 2NVBA 1T25A 3KB6A 5B12A 5KVSA 2NWQA 4ALLA 3VPXA 1HDXA 3OBBA 4X54A 3ON5A 2QHXA 3UCFA 3PYMA 3INGA 3W4IA 1E3SA 3NEPX 4HWKA 3KV3O 1EK5A 3HFSA 1NFFA 1ZXBA 4XJSA 3V5NA 3QIVA 4TKMA 2X58A 4U0JA 3HN7A 5IDXA 1ISFA 1TXGA 5J23A 1DIGA 3VDRA 2VHWA 1PJ3A 3JQGA 3DWFA 2D8AA 5KKAA 3I23A 4UUMA 3UW3A 3CKYA 2PD3A 2V6GA 1E7SA 4B8WA 2JHGA 3WTCA 3UH1A 1OBFO 5I9LA 1ZNQO 5DBFA 3DOCA 4BVAA 2Q99A 4C7JA 2VNAA 4IBOA 3U3XA 4WCFB 4XJTA 1EQUA 4J3FA 1B2LA 1DDOA 4B7CA 1PJSA 1VC2A 1NVTA 4CLHA 3NDIA 3FNHA 1GD1O 4KQWA 3G79A 2Q2WA 2W90A 5TS3A 4XGNA 1MX3A 1UXGA 2AQKA 5DN9A 4CUKA 5U9CA 4GI2A 5JBIA 4WCDA 4XD2A 3C8MA 4NZ9A 1QYVA 1VLLA 5LCXA 3DBLB 3M2TA 3PFFA 4CMEC 2GN9A 1Q0HA 3ZI0A 1IY8A 2DFDA 3DEYX 3WR5A 5DULA 4BO4A 1E7RA 3O38A 5DCYA 1E92A 2X5JO 2EEZA 4MPDA 3JQAD 3DDNA 5G4LA 3S2GA 4FFOA 3L4SO 4J1TA 2I99A 2VWQA 2UDPA 3UOGA 1CETA 3EHEA 2O4CA 1PX0A 2NNLD 3U62A 2Q49A 3I3OA 4GKBA 4NBWA 3V8BA 1Z82A 3GZNB 1DPGA 1N7GA 1HWYA 1VM6A 2CNBA 1CQJA 3I9OA 4B8ZA 4E2ZA 2D5CA 3UUWA 2VYND 5BSEA 3FHLA 1ONNA 1R6DA 3GH3A 4Q3EA 5JPIA 4IM7A 5KVQA 5TGDA 3WOHA 4CUZA 3K8ZA 3BIOA 3GG9A 4U6SA 3HDQA 1EE2A 3AY7A 1I2BA 2AHRA 1HSZA 2B83A 2G1UA 3HDJA 4P4LA 2Z5LA 3KSUA 2Y66A 4QSMA 4PLGA 5AXDA 3H3JA 2IE0A 5F5NA 4WJZA 1ZSYA 3WQRA 3F3SA 4FJ2A 3D5QA 3V2GA 2DLDA 4EW6A 3IUPA 4L74A 1MG5A 3GGPA 1E0DA 2PKQP 1EVIA 3WWZA 4YA6A 3LF2A 1LQTA 1U3UA 5F3RA 5CG1A 2X5KO 3AM5A 4PRKA 1JVBA 4RORA 3P2YA 2C0CA 2YZ7A 3DXFA 3U4DA 1NP3A 5I7VA 1IZ9A 3CMMA 3MWDB 4OQYA 4RPJA 1IL0A 5KJ1A 4J2HA 2NACA 4CL3A 2J5RA 5KKCA 3OIGA 1U3TA 2QW8A 3W8DA 2GN6A 3DL2A 4RVHA 3I5MA 4MIYA 1MB4A 1NAHA 3T4EA 3FTPA 3PIIA 1OC2A 4BNHA 3TF5A 4NDNE 1BW9A 1HYHA 4EUHA 2FY8A 4HFJA 3OP4A 2YQ4A 5F1OA 3GEMA 3H2SA 3K96A 3QW2A 2FSVA 3JQEA 4BO5A 3EVNA 4PIVA 4MVJI 3DTTA 1ZSNA 4I8XA 5MDHA 4PLTA 2BRUA 4D3DA 4XX0A 2ZATA 5C7IO 4BO9A 5EINA 3WXBA 2IEDA 2PZJA 1PWZA 1ADBA 2HKIA 3AOEC 5B4UA 2V6FA 4OIMA 3RASA 4BUCA 4W7HA 3BZUA 1YJQA 3I9MA 1H5QA 3CIFA 5DF1A 1Y6JA 2Y67A 4XEHA 4YBZA 3PLNA 3ZWAA 2VUTA 2YDYA 4YRDA 3QVWA 5H83A 3S2IA 5KTKA 2W2LD 4PLFA 3WLFA 1HDZA 5IAAA 1T1SA 2I76A 3GAFA 5GY7A 5JYDA 4KTTE 3VZSA 3TN7A 2Q4EA 2PZKA 3ICCA 4WNIA 2BI7A 2PGDA 3PHHA 1HXHA 4E3ZA 1Q0QA 1K0UA 1DC5A 4CLOA 4AJPA 4FFLA 3FR8A 3ONEA 1NBOA 1A71A 4Z9YA 2A92A 4BO3A 4DBZA 3QE3A 2A35A 4JJGA 4HUJA 4AJ4A 1HYGA 4QFCA 4CLRA 3FWNA 2X7HA 1P1IA 5CDSA 2DUWA 2VHZA 3GDOA 3UGKA 4RO0A 3JQ7A 1O95A 2NV6A 3WICA 1DIRA 3GRPA 4AJJA 4W82A 1DBVO 2V6MA 1LDMA 2O48X 5IF3A 1MA0A 1GL3A 1B3BA 3F47A 4RCVA 3WWYA 1AXGA 3DBHB 4Z3DA 4W9NC 5HM8A 4XIYA 3O8QA 2C5EA 5KJCA 3G1TA 4NG5A 1AE1A 4CM5A 1VPDA 2VRBA 2YFHA 1XEAA 5KWEA 3PDUA 4DQVA 3KHUA 1ZK2A 2DU8A 3ZWVA 2NU7A 4IUYA 3AU8A 5G4KA 5AYVA 3NAQA 2GF2A 1QYWA 2BFOA 3IKTA 3QWFA 3MTGA 2PY6A 3WYEA 1J6UA 3NJ4A 4GSKA 4DMMA 1KVQA 3FI9A 3K9QO 4ZQHA 1LDEA 3C1OA 4BNNA 4NH4A 4PG5A 3RU9A 3E9MA 3ZWMA 1CRWG 2GLXA 4XRRA 3PI7A 4BS9A 2BFAA 2CF6A 3C7DB 3ROQA 4GAEA 1XSEA 1NTOA 2QZ9A 3ADOA 3E5RA 1KEVA 1SPXA 3WGIA 3JQAA 4JJIA 2C2YA 5GZ3A 1ADGA 2CZCA 3VPHA 2D0IA 3NGXA 4CLRB 5B1YA 2E82A 1GY8A 1YQGA 2D4AA 5EERA 3JQ7B 5JMPA 3IOYA 1GQQA 2FR0A 4YAKA 2X9NA 1Z6ZA 2GYYA 1TT7A 2EF1A 3WX0A 1LLCA 2VYNA 1GUYA 2FR8A 2W4QA 4Z9FA 4D3SA 1X7HA 3O8QB 1C0IA 1PGPA 4TVOA 4YT2A 3F1KA 1AN9A 4QX6A 2VWPA 3CE6A 4UEKA 2WDZA 6ADHA 4TKLA 2BI8A 3PYXA 4P4NA 4KUGA 3PZRA 4RVDA 1P45A 2WYWA 1I10A 3PHJA 1I3KA 2H9IA 3OETA 5ER6A 4CMEA 2JCXA 5KVVA 4BB5A 4B79A 3X2EA 1PZGA 2HK9A 2Y0CA 2JL1A 3KEQA 2F1KA 1HETA 4RV9A 4FFRA 2JHFA 1EFKA 1W8DA 4U0KA 1HDOA 3RJ5A 3ZU4A 4O0LA 3UHAA 5T8KC 1WMAA 4K28A 1HE3A 4UVDA 5C37A 3BMCA 1YB4A 1K3TA 4WEQA 1IHXA 5FI5A 3TZHA 1K5HA 5G0VA 3DBRA 2Q4BA 2B4RO 3FF4A 2HMSA 1OZAA 1NPYA 4RZIA 2QQ5A 3QLJA 4HY3A 5HTOA 4P8RA 4AVYA 2J5KA 3RC2A 3B1JA 3HN2A 4RLHA 2NVWA 3ZH2A 3IMFA 3JQAB 4CV1A 1NASA 3K92A 5EPOA 2DFVA 1OOEA 1LLQA 5CG2A 1E3WA 1HZZA 4BNIA 1WAMA 2WYVA 4J0EA 3GVIA 4WECA 2P91A 2D3TA 1YO6A 2PZLA 3Q11A 4NBTA 5I7FA 3VH2A 3E48A 4FS3A 1KC1A 4AJKA 5G0UA 1YH3A 3NGLA 4AICA 3BYZA 5F5LA 1TVEA 2HAEA 1I33A 3PIDA 4MINA 1AGNA 4XDYA 3U0BA 7MDHA 2W2LA 2HQ1A 2NQTA 3TL2A 2PH3A 1ZCJA 1O8CA 1RWBA 4QQRA 1HL3A 3EMKA 4Y67A 3H9UA 4J7CA 2HO5A 5JLAA 3RUCA 3GNQA 3OA0A 1JU9A 3RCBA 2YY7A 3DOJA 4U7WA 3QVXA 3K30A 2BGMA 3KUXA 3BMCB 1S7CA 4J90A 4CM7A 3WTBA 9LDBA 4EZBA 4BHTA 3ENNA 1I0ZA 2JCYA 3VZQA 3BTSA 3EVTA 4BB6A 1LJ8A 4CMIA 4ZQBA 3ZNNA 3RBZA 3WB9A 2XXJA 4M8SA 3AOEA 3EAGA 4PVDA 1IPEA 4DIFA 2POQX 5A9TA 4B3JA 3JQCA 5T57A 4M54A 2IXAA 4FSHA 4PGFA 4BO6A 4DPKA 2CDAA 4I5GA 4O63O 3L9WA 4Z0TA 5JO9A 2YHIB 1E3WB 2UUOA 4BKPA 1X1TA 2NTVA 3C7AA 2UYYA 3RKRA 5IDYA 1XHLA 4ND5A 4Q3DA 4BMSA 1XQ6A 4E12A 1UDAA 3HHPA 4HFMA 4XYLA 3PJEA 5EMHA 4TRNA 1PJTA 4U8GA 4XYGA 3RFTA 3VH3A 1Y8RA 4FB5A 1YOVA 2Q45A 4NMHA 3SC4A 4I5EA 3ROKA 4E13A 5F1KA 4WUVA 1JVSA 3VAZA 1ZZEA 1KETA 1WDMA 3PHIA 1Z7BA 3ZWOA 1Z75A 3ZZNA 4ZD6A 5JS6A 1MXHA 4J1SA 3ONDA 2RH8A 5JDIC 2Q3EA 1KEPA 1SB8A 3OJOA 4W9NA 1RPNA 4Z0HO 1VL6A 1T2AA 5IJZA 5L4SA 1E1MA 5TLSA 1X0XA 2PGJA 1UDCA 2AA3A 4FFNA 4L4RA 3OQ1A 2ZTMA 3WGTA 3M1AA 4BNGA 3AK4A 4WLVA 1LRJA 1DIAA 1PQWA 4J9VA 2C54A 4NK5A 4TRRA 3ZCXA 1QYXA 4K26A 4IIUA 3H2ZA 2WEKA 4YQZA 3KRTA 3VPFA 1UAYA 1W73A 4DL9A 2AW5A 4NI5A 4BNVA 3GVCA 4FC6A 1QV6A 3ICPA 1MC5A 3BTOA 3H9QA 1LBEA 4ALIA 3QHAA 1H2HA 1P0FA 3KM0A 2B35A 2EW8A 4MVJG 5ER9A 2WMDA 3OQBA 1I8TA 3P19A 3VPGA 1QRRA 4FJ1A 4J9UE 4D41A 1PJ4A 1GQ2A 4OQZA 1QXSA 3AW9A 4YRAA 3P5SA 4Y6SA 2WSBA 3ZNPA 2D2IA 3JD1A 2JFHA 3JYPA 4RPGA 4TVBA 5COAA 3RD5A 4CM3A 3DFZA 3OEWA 3GN1A 1BRMA 4MP6A 1WP4A 1CJCA 2H1SA 4KDFA 2X9GA 5C3MA 4CV3A 2PD6A 3D1LA 4ZHSA 1U8XX 1SO8A 1U8FO 3W8FA 1U2GA 4KQXA 3HQ4O 3PEFA 1LXCA 2RCYA 2YW9A 1L7DA 3K5PA 3TWOA 1HDYA 5L53A 2Q46A 4R1TA 3C7CB 1XLTA 1WLYA 4MKRA 3RQSA 4J4TA 3TOXA 4IS3A 3CZRA 2GN8A 4CMGA 1BMDA 2B4QA 3VVCA 4IIVA 4DTIA 1P1RA 4XZ3A 1RM5A 5JC1A 4PCVA 1ZK3A 1ORRA 1C3VA 3FSRA 2FR1A 4ESOA 2EGGA 4RF2A 2PV7A 2O3QA 1XU7A 4R9SA 2Q50A 2GD1O 3TOZA 4B4WA 3WJAA 2EKQA 2GASA 2J3HA 3WIEA 5TC4A 1FDWA 2CMDA 3FBTA 4IJWA 1Y8QA 4YT4A 4FOOA 1IULA 4RVFA 1BDMA 1ENYA 4OMUA 3UAGA 4PLPA 1RJWA 4RVGA 2DPGA 4WOKA 4DBVO 3GT0A 1DEHA 1HLPA 3OJEA 4FCCA 5JAMA 2GUGA 1B26A 1F14A 5JYEA 3V1UA 4GVXA 1HLDA 2YDXA 3DHEA 4I9UA 4YCAA 1Q7CA 3RUHA 2VN8A 4BKOA 3ETGA 4CMHA 1EZ4A 4N5NA 1YWGO 3WMWA 2VZ0A 1EDOA 4GL4A 1JKFA 1A9ZA 2EP5A 2VTEA 4ND3A 4XR9A 2B37A 3U5TA 1X1EA 1DAOA 4O1MA 3ZWXA 4AJHA 5CDYA 2VTDA 4UEJA 2WD7A 2YUTA 4EUFA 3GR6A 4ALNA 5BSFA 2J8ZA 1PJ2A 1UXIA 4Y6RA 1M6WA 4Z9XA 3PK0A 4FBGA 1GFSA 2YQ5A 3K73O 3EGOA 1MV8A 1IYZA 4M86A 3BAZA 1FXSA 1B8PA 1I36A 3S2EA 3PHGA 5ADHA 3INRA 4F45A 1P1KA 4D46A 4DIOA 2X1HA 3AFMA 3H8VA 3MJEA 4H15A 4KTVE 1ZEMA 2HJSA 2WWRA 4IS2A 3ZWCA 2Y0EA 1HDRA 3JQFC 1XU9A 3GDGA 4BNMA 5TSDA 1KEUA 3DBLA 4J2OA 4RZHA 4BQPA 4Q39A 5EESA 4E31A 1M66A 1Y8QB 1YDEA 1E7MA 4XB1A 1LRLA 4JBHA 5HS6A 4IPTA 3FPCA 1KYQA 3NTQA 1U3VA 3OICA 2OFPA 1FF9A 3Q1LA 5AXBA 1A4UA 4OKIA 4K9DA 3GZNA 2X0NA 4ZQFA 1PR9A 1E6UA 1GR0A 5GZ1A 3IKVA 1JN0A 4TRMA 1BDBA 5JW6A 1P31A 3JQ6A 4W4TA 5TRTA 2OP0A 1ENZA 2CY0A 1H6AA 3MWEB 4IMRA 2NADA 2VOJA 1MGOA 3LU1A 4BV8A 2DTXA 2UUPA 1SZJG 2QX7A 2WD7B 4XRGA 2JAHA 4L9RA 3PXXA 1HDGO 4TSKA 3DR3A 3EK2A 4II3A 4DMLA 3HE3A 3ROPA 3EC7A 2DVMA 2HDHA 3ZWWA 5IDQA 3K31A 1J0XO 4M87A 2HK7A 1UP6A 3DMYA 4IJVA 2FSSA 1DRUA 1BGVA 2OBNA 4ZA2A 3VH4A 1YB5A 1N92A 4WNCA 3W4JA 5KOIA 3F5SA 1PGQA 1DLIA 5JY1A 2RBEA 1F8GA 3WLEA 4LSMA 1IB6A 3L6OO 1R4MB 4I1IA 4DA9A 1NAIA 1HKUA 2FPPA 1ZJZA 1WZIA 3H6KA 3NUGA 5I7EA 1GUFA 4IQGA 1YS4A 1KBZA 3RFXA 4RVSA 4YR9A 2JD1A 5JDIA 3VH1A 3DONA 3P2OA 1D8AA 6LDHA 1ZMTA 3R0IA 4MIOA 3EUWA 5BR7A 2X0RA 3JSAA 1Z7EA 4ROSA 2H6EA 5AOVA 1QORA 3DFUA 4AFNA 1J49A 3ANNA 1O9BA 3QVOA 1ML3A 3PQEA 5JCXA 3TFQA 4LSWA 3I4FA 2ZTVA 1DRVA 5DZSA 4CMCA 2QZZA 1N5DA 4EEXA 3OFSA 1SNYA 3TNLA 1PJQA 2PD4A 3B70A 4E6PA 3ANLA 1RYDA 4GH5A 5HWSA 3FNGA 1ZO8A 2I66A 2DBRA 3PFWO 2UV8A 1OAAA 4CM8B 2JCVA 1PGOA 3N58A 1I3NA 4F6CA 2GZ2A 5B4TA 4MVJD 1PR3A 1DRWA 3QJ5A 4IXTA 3VZRA 4CLXA 4F3YA 1PS9A 4TRJA 2PA3A 4JIGA 4J6FA 4UULA 4YB8A 1PS8A 3D4OA 1SB9A 5BSGA 4N54A 2JFFA 3ZWYA 4BGIA 3B1KA 3LLVA 1GUZA 1SEPA 3BMOA 1IOLA 3KLMX 4FC7A 3CH6A 4QECA 3NJ8A 1YGYA 1Z45A 5L45A 3F46A 2VZ8A 2BHLA 4MDHA 3DZJA 4HP8A 4IQ8A 3PRJA 4MP3A 4OH1A 5H82A 4XB2A 1NX6A 3DBHA 5ICSA 1DJQA 3K6JA 2RHRA 1ZMOA 1NYTA 2VYVD 4IJUA 3RUFA 3NT4A 3RSHA 4UUPA 4R69A 3I83A 2B5WA 5TNXA 5ILGA 1O94A 5FYDA 3ASUA 4YJGB 5CP8A 3SJUA 1HE5A 3HADA 1LU9A 4IDAA 4UVIA 4JBIA 1KERA 1I2CA 5HRUA 4N5LA 4OL9A 5FI3A 3UF0A 1R15A 3VKUA 3HZZA 1CIVA 5T5QA 2IDZA 3JQ8A 3TFOA 3DQPA 3QRWA 3ZW8A 3MTJA 3E6AA 4IINA 2C2XA 3C3XA 3GEDA 3H5NA 1YB1A 5L51A 2Y99A 3KSDO 2DUUA 3IP3A 1OI7A 4GGOA 4W7IA 1BXKA 1DC3A 1BSVA 1EE9A 4MVJM 4EYEA 1XQ1A 1DHRA 5DP1A 1IZ0A 1ARZA 1ISIA 4EI2A 1H94A 4GWGA 4OKNA 4UVEA 4MOWA 3O9ZA 2ZYAA 4ONEA 3PP8A 1UH5A 2ZYGA 2X9VA 3F4BA 3V1TC 5THKA 4YWJA 3BMOB 4ZJUA 3LLSA 1AHHA 3H3FA 4L0QA 5K0ZA 3OEYA 5L9AA 2VT3A 1GEGA 2FZEA 2R00C 5C7LO 2C20A 4LCJA 4YYZA 2ILTA 2ZQZA 4YAJA 1IHYA 4J7UA 4D79A 8ADHA 5DBIA 4BNTA 3ADPA 4AJ2A 2Y1GA 3ONFA 3RUDA 1OMOA 3ZV3A 4N18A 5A5EA 4D0SA 1GPDG 4DC1A 2P4QA 4LCEA 3LT1A 1GYPA 1UDBA 4J1NA 1NVGA 4D44A 1B8VA 2DKNA 4PLCA 2HJRA 4WLFA 3WBBA 2OUIA 3JQFA 2OHXA 3VZPA 2O3TA 4O5OA 4HV4A 1QYCA 1D7OA 4MJLA 1ZK4A 1MC4A 4RQTA 4D3FA 3GLQA 4HXYA 3JQ8B 4YVFA 4OXYA 1BVRA 1WDLA 3HSKA 3VTZA 1Y9AA 2JFGA 2EWMA 2BGKA 2O23A 3DZKA 1GDHA 1P44A 2H5LA 3AM3A 1EFLA 3I1JA 3JQDA 3NKLA 3V2HA 3L6DA 4BMNA 1EBFA 3FPLA 1QMGA 5A3JA 3FR7A 4I5DA 4URFA 2V65A 2Y1EA 5HS4A 1VRWA 2AE2A 1LDYA 2YV1A 1MLDA 4PFJA 1NXQA 2BFPA 1MP0A 3F6YA 3I9JA 1I3MA 1V3TA 1X7GA 1U5AA 4OYRA 1GTMA 4ND1A 2E4AA 2JD0A 4TQGA 1DC6A 4AJNA 5DCWA 3NT5A 3OECA 4PG6A 4INAA 1UXJA 1NPDA 1LDNA 2O7SA 3VPSA 2VQ3A 1BG6A 3JYNA 1F06A 4LRTB 4XQGA 3UN1A 5I9NA 2NU8A 1Z74A 3D5TA 4E5PA 4MVJF 2EXXA 3MJTA 4F46A 2QYSA 4L4XA 1QV7A 4ZU3A 5TX7A 1EUZA 3JD3A 2I67A 1X14A 1YL5A 4EJMA 2P4HX 1U7HA 4WLEA 3SX2A 4XWYA 1AHIA 2ZK7A 3JYLA 5A9SA 5CDTA 2PK3A 1JAXA 3JV7A 3OJLA 4UVGA 3STHA 3SVTA 4MVJA 3GC6A 5B4VA 2Y1OA 5EQDA 1C1XA 5FF9A 1UZNA 3OM9A 2HK8A 4NIMA 1LLUA 3TZ6A 4UEOA 1ZH8A 3JQBC 5KVCA 4RVUA 5JAIA 1DSSG 3ETDA 4W6ZA 1EMDA 3CMCO 3LC7O 1I24A 4OO3A 4OXKA 3MEQA 3RC9A 4IZHA 1YE3A 5EN4A 3DAFA 1B8UA 1D4FA 5L7YA 1T2DA 2G82A 1X15A 2XPCA 4O6VA 3RU7A 1W4ZA 2XAAA 5TT1A 4CV2A 4XQ9A 3MOGA 5CDGA 2E6UX 3L77A 4CR6A 3BTUA 4R1UA 3DTYA 4BO1A 1K89A 2HMWA 1LLDA 2O2YA 5JAQA 2BMAA 3FRJA 4M1QA 5T6BA 4Y6PA 2VYVA 2IODA 5JCJA 1P1FA 2EERA 2HRBA 3A1NA 2YHIA 3WGYA 1A27A 4BV9A 4YT8A 3DZIA 3WBFA 4ALMA 3JYOA 3D0OA 1XGKA 5KIAA 1LTHR 2B0JA 4W99A 3KSZO 1JAYA 1ENOA 1YL6A 4E2XA 4PRLA 1GEEA 1EVYA 2P9EA 4KWHA 5AXCA 1UZMA 1TI7A 3IQDB 2QG4A 1DC4A 4L75A 4NBVA 3VDQA 1LDBA 4OAQA 3RI3A 3TRIA 3QWIA 2C29D 3SXPA 3FN4A 1DFGA 1H9BA 2WE7A 5ES3A 3HDYA 3TZCA 3PDJA 4BO2A 2YV3A 1E6WA 1E1NA 5A9SB 1Q1NA 2QYTA 1CYDA 1T24A 1UXKA 1XYGA 3DC2A 3D4NA 3KVOA 4Y98A 3GK3A 4TZTA 1T2FA 2B69A 3GZ4A 1C1XB 1N9GB 3AU9A 4OJNA 5G2OA 5JDCA 2J6IA 1C0LA 4EBFA 4R5HA 4A03A 5H81A 5CFZA 3NTRA 4B3HA 4MO2A 4PVCA 3A06A 2GPTA 4GSLA 4BNKA 2OXIA 4WASA 4CM1A 1BXGB 4RLSA 1G1AA 2ZB8A 5U4QA 1A72A 1UR5A 3PTZA 2I6TA 4RPHA 2QRJA 2UAGA 2CFCA 5I8WA 4DLAA 3KTDA 2E49A 4FD3A 4R68A 1SOVA 3AUAA 2C5AA 4EDFA 1KC3A 5A04A 3ITKA 5L4NA 4A27A 5TT0A 5L4LA 3WJ7A 4J4BA 2VCYA 3F1LA 1R0LA 4Q3BA 3D3WA 4AJLA 3GY0A 1LQUA 1FJHA 2EJVA 4RJTA 4GX2A 5TIIA 1DFIA 1PU2A 7ADHA 2EJWA 3PWZA 4IMPA 4N5MA 2GCGA 1DOHA 4TZKA 2EV9A 4P22A 1MXFA 2V6BA 1YONA 1E3EA 1FDTA 1V3VA 2PTGA 1RM3A 4DQUA 1NPTO 2WTBA 4PZCA 4A0SA 1OC4A 4I9HA 5IZ4A 3JCZA 3E9NA 3UICA 3H9GA 3TSCA 1QG6A 3DAGA 4R9RA 2OGUA 5JXWA 3IAHA 5BNIA 5HA5A 2R00A 2FHSA 2IZZA 4MP8A 2B5VA 3E8XA 3ZHBA 1LC0A 3WGHA 3GGOA 1T4BA 4Z6KA 2DC1A 4KMSA 2RIRA 1PS0A 5EQFA 3UKOA 4B7UA 4R3NA 1Y81A 3I4CA 5JC8A 3CSDA 3WG9A 1PL8A 2AG5A 2J3IA 5BQFA 2P9CA 1PSDA 4I9NA 3U9LA 3PGXA 2IXBA 1HRDA 2XXBA 3I52A 3UFXA 4B3IA 1TB4A 3L0DA 1RM0A 4YJFB 1ZW1A 4AG3A 4FIZA 2LDXA 4TROA 1EVZA 1GU7A 2A4KA 2BFMA 2VOEA 2ZJ1A 2RH4A 1NQAO 3WSVA 1U4SA 4R51A 4YAIA 1A7KA 2Q1WA 4JCOA 2FMUA 4OOFA 5ILOA 4CR7A 1XG5A 2NTNA 2P68A 4NU6A 3LC2O 4QUKA 5IXSA 3H9EO 3DB2A 5JNLA 3GF4A 4YDRA 1A5ZA 4LN1A 4E5MA 4NJMA 3T7CA 3D3WB 3GUCA 5JY6A 4GPD1 4NFHA 4YRBA 3WNQA 1ONPA 2XF8A 3ANMA 1RYEA 3I9NA 3TPCA 1DAPA 3LC1O 4YXFA 3H5AA 2AQIA 3LT4A 5JFOA 3DBVO 1E1LA 1N1EA 2ZIZA 4A2CA 2FPIA 1NHWA 1LEHA 1OFGA 3AUUA 4ZVVA 1FMCA 4OXNA 4EITA 2HMUA 4H16A 3AJRA 3GMDA 2TMGA 1E7YA 3L6EA 1H6DA 3O03A 1V9LA 4KP7A 3FTNA 3GVPA 2E48A 4J4HA 4II2A 3KLPX 5ICMA 2GNAA 3BMNB 2G5CA 3Q0EA 1U4OA 3JD0A 3KZVA 1SAYA 2PNFA 2GN4A 3ENKA 4J0FA 5I7SA 3NX4A 1E5LA 1I30A 4DC0A 1LDGA 4JP2A 1W0CA 1YJ8A 3OIDA 3QVSA 4R01A 3RVDA 3UCEA 3ZV5A 1AXEA 1U5CA 3ST7A 3ORFA 2BGLA 4XR4A 2IYPA 1IUKA 1EDZA 1NNUA 3D64A 3RUEA 2Q1TA
chains in the Genus database with same CATH superfamily
3SBEA 3WAGA 3NH6A 1Z2EA 1WHTB 4EMTA 2IQIA 4L95C 5IM5A 1U9CA 3LP8A 3QA9A 3QU9A 2J6HA 3PVCA 3I1IA 3JQBA 4HEQA 5GP1A 4M9RA 3GAZA 3O74A 5COBA 5EP3A 1FS4A 3T1OA 5IC5A 3WWOA 4YWHA 5EJ6A 1D1SA 1ZGJA 2XUQA 3D0RA 1RRVA 3LBNA 5ERXA 1WVIA 3IX7A 4K1LA 2ZJ4A 4MR8A 4P35A 1D2AA 3K0KA 3LQFA 4CIAA 4JBWA 3T3NA 3KKQA 3MMNA 1JQBA 3NWPA 5BN1A 1ZR4A 2CVQA 4W5HA 3TEFA 1QVRA 5IT4A 2YFQA 3BSFA 5IKMA 1TUIA 3GRKA 2YWDA 5JPDA 3UXMA 3BIXA 5A2GA 2W6PA 3ZHTA 4P54A 1O97D 4NOJA 4NCBA 1YRBA 3HYSA 4XYMA 3VSEA 3Q8LA 1XQXA 2W0MA 1JVNA 4ITRC 1RZUA 4RHEA 4UREA 5F78A 4E5SA 1S7GA 1LJUA 3RPEA 1G66A 2X1MA 4RYLA 4K6MA 2FPIB 3UK1A 4P2BA 3V7WA 1JLLA 3UC9A 3X0DA 2X2PA 1T8SA 2GKGA 3EYWA 3ZV6A 4ZN6A 1Z26A 3OSUA 3UHJA 1I1QB 3EDYA 4EUKA 3DKIA 5HKOA 3S40A 2G17A 2QR3A 3EG9A 3PXBA 2HWKA 1BA2A 2JKVA 4KGXA 1TD1A 5FOUA 4FHZA 2H63A 3DO8A 3FDXA 4JJ4A 2BJVA 3TEJA 5KOJB 2P6PA 3A70A 5AM5A 4PINA 3EN0A 3U37A 4DPMA 1XRPA 4LJ5A 5CHEA 4LOHA 3DMFA 3E0QA 3BWVA 1DG1G 2C07A 3FPSA 3M5WA 1G5QA 3DL0A 3P8ZA 1F2VA 1O4VA 2JGNA 2A5DA 4HQ6A 3KUCA 1CZLA 2JGJA 3VX3A 5B6PA 4Z51A 2P6OA 3UOWA 2H4WA 1IPFA 2AXNA 4FEGA 4B9AA 3R3ZA 1DXQA 2ORIA 1L5WA 4GMGA 4P80A 1R4MA 3B1FA 5A4IS 3PUVA 4Q93A 4LRQA 4W5OA 3V33A 1IIBA 3GHYA 3EXFA 1L7BA 2WKPA 1L4GA 1Q0LA 1R6BX 3M6IA 4AJIA 8ATCA 2Y6UA 3BBPA 3UXYA 1JG6A 1E99A 1U8UA 1VOTA 2ZB4A 1L7OA 4LPKA 4JN6B 2GNPA 4F3TA 1SOWA 1N8SA 3PQFA 3DZHA 3JXEA 4UASA 3MTQA 2OAQ1 1QQ6A 3B5JA 4QE3A 4BTLA 1Y6RA 2HD4A 2V98A 2CLFB 3LZ6A 1UFVA 4CUJA 1L5YA 3FJ1A 1JZSA 3FWPA 3HCNA 3OD1A 1C1DB 1XWFA 3G8BA 2C1EA 1QP8A 2G6BA 1GZ4A 4ILKA 4PG8A 3A6ZA 4DT1B 4Z53A 3ZIAA 3OIWA 1DKNA 1LBTA 2WHPA 3BD9A 3FNEA 4YV2A 4BNJA 4A16A 1T1RA 2O3SA 4H7KA 1UPCA 3DG9A 4OJKA 5K0FA 3DHYA 1QG0A 2BYTA 5K3EA 5BWLA 5ALOA 3DCJA 5AJXA 2OHOA 4J7XA 4U3JA 3WLJA 1U5BB 3NASA 2NUAB 5G40A 2O5EA 5D85A 1II0A 1GNLA 3HBJA 4HH4A 1U2RA 5EWJA 5FTJA 3RODA 5ILQA 2I9KA 1WL8A 1X1RA 3L7DA 2AVNA 3EXHA 5FI0B 5C5IA 3KKEA 5EEHA 1C9DB 5G0TA 2IS4A 4OUKX 3PCXA 2A9KA 4OJQA 2O2GA 1A8HA 4TMKA 4F86A 4ENWA 2AX4A 3VPDA 4ZGBA 1S2DA 2PH5A 2QUHA 1QK4A 1RHKA 2HSDA 1OASA 3ZXSA 1V45E 1U8ZA 2WINI 1AMOA 3EAQA 1V96A 3MS2A 1GG2A 3GZTB 1MX1A 1SD5A 1F8YA 3WS7A 5KTNA 2PJZA 2VHJA 3BMQA 2J85A 1PDWA 3CEMA 4BVKA 2VP6A 4MGIR 4F9TA 3VOSA 1GYQA 2ADOA 1E3JA 3ZK8A 4R8VA 3OQPA 4F6RA 3ML1A 3JATB 2YOGA 5LOVF 3IS3A 4OI0A 1G4HA 1J2JA 2EKLA 3OY7A 4Z1MD 1U6KA 2VA9A 4OHUA 1IEQA 2X76A 4LBZA 2PFGA 3ONNA 2VJYA 3W2HA 4EFLA 5CEFA 5D51S 4BL5A 1ISGA 5F51A 2BF7A 4NPCA 3DLAA 1XZPA 3GI1A 4K6HA 5E9AA 4AC9A 4EHKA 3DLHA 2FOIA 1GRCA 2Q2QA 2R6ZA 5D1NA 1IHOA 1RQXA 2VT2A 2EIHA 2ERXA 2OV8A 2WSMA 1EDBA 2P1ZA 3I6QA 3LF1A 1UWVA 2GERA 4JI3B 4ZCTA 3LGXA 3WGJA 2C9DA 2GX6A 4DWOA 2V7QA 3I0ZA 5FFNA 4F6LA 821PA 3JD4A 4L6IA 1ID1A 1XN4A 3L07A 4KBGA 4JUBA 2OKCA 2QA5A 2R1TA 3I6ZA 3IIIA 4TXMA 2IYOA 5DSTA 3MJ4A 3H2GA 3WB0A 1B15A 3K1AA 4OH7A 5ANRB 1KS2A 5U1PA 1QR6A 3GFTA 1GGFA 2YS7A 2XYHA 3L06A 5EHGA 1HNXB 5E9QA 3RTEA 2W70A 2YASA 1M2GA 2AE1A 1JDVA 1FW8A 3DV0B 4QFMA 2QRKA 4RW0A 1YR9A 2UYQA 1DXYA 2P3OA 3CF6R 1F0YA 4JC5A 2IHTA 5FO0A 4AL4A 3OCCA 4D3YA 2B99A 2WMNB 4Q4AB 4IDEA 4B5LA 1KOGA 1H0RA 1E4EA 3H2HA 5BO5A 3BH0A 5CFQA 3RSGA 2R7KA 3DOUA 2QT0A 4LW8A 1R4NA 1JG4A 2XD9A 4JNKA 3ESAA 3ICEA 1QONA 4HQ0A 2HWYA 4Q1EA 1S02A 3Q85A 4PLVA 5JHHB 3P1JA 1Y80A 3CVVA 5AM3A 1NURA 3JQGB 4IIGA 1ZVJA 4MW7A 4AK9A 3KALA 2Q5QA 3WGQA 2J48A 5G41A 2R11A 1JR3E 4WXRA 1YA4A 2Y05A 3WAKA 2ZTUA 2BMVA 2VK8A 1OROA 2A3NA 2O0LA 3H4TA 4GHWA 3GOQA 1T9AA 1ZI9A 1FMFA 3DZ8A 4ZALA 1GZ3A 3FPJA 4J1QA 3IRUA 4PZUA 4JA2A 4B43A 5K0JA 5JCJD 2AD5A 4UAUA 3NHRA 3M70A 5ED0A 5CVUA 2OXTA 1FFAA 1TW2A 2J5XA 3B6IA 1CRZA 3HV2A 2K5UA 4YUYA 2WTMA 3E9RA 2ZSJA 3H7AA 3QKTA 3R76A 3CJRA 5GJWC 2VKQA 4F7DA 3L01A 1E1YA 1YJXA 4UNSA 4OBXA 3C7KA 3LD9A 5A1TA 5BR4A 2VQDA 1NBMA 1NQOA 3DUFB 3Q7QA 4FFPA 3A28A 3PNBA 3I2GA 1ZK0A 4A8TA 4WFIA 2DPMA 3DCNA 5B3JC 4KRXA 3PA6A 2C5SA 3BHJA 1YS2X 2FE4A 3A0UA 1LI4A 2GZAA 3HMQA 3GFBA 2WY2D 5IAKA 3VHLB 4V1CA 4ID9A 1TC1A 5A62A 3PENA 4MK4A 5CCXA 2YWEA 3OO0A 4YP7A 3RE1A 4KO3S 2VJAA 2HT6A 2WHXA 3TBKA 4DUGA 2I7DA 1ZQ9A 3VDXA 5I5EA 4LZZA 1FLNA 4Q9HA 1E7WA 2NSLA 2CDCA 1V25A 1Q20A 3A6LA 1J24A 1UZAA 1VL0A 1HOXA 1O54A 5DX8A 2R3SA 3SSMA 5KX5B 3RYFA 3W3AA 1B6GA 4TWIA 2FRDC 4JU9A 4AUEA 1MUUA 5JI3E 1IZ7A 2V3VA 3DOIA 5HIAA 1PUIA 1VSUA 2O8CA 2DPXA 1XRSB 3GDFA 5FPSA 8GPBA 5JADA 1C8BA 2FX3A 2R6CA 4HL6A 1FQJA 5AVOA 3NAMA 3W9SA 1QFXA 2OAP1 1B4DA 2B6NA 5CA1B 2SCUB 1S01A 1UJMA 3WOVA 4RXTA 2XMCA 5C52B 1DJNA 4GPAA 5HQTA 1AQYA 3FSEA 1YK0A 2ZB3A 3I09A 1SCDA 1VTKA 4Q3OA 2XNDA 4YASA 3RNLA 1XR3A 5FA6A 1BXRA 2ZRLA 4L7VA 3KCNA 2WUVA 4G5HA 2F64A 3PHLA 1TU3A 2N46A 2QN8A 2Z04A 1F1JA 4QUBA 3SM9A 1P1HA 1N5KA 3ZHYA 4DOMA 3PJRA 4UQPA 4XB6B 5HUJA 4O1IA 3EUAA 2R0QC 2HTFA 2P62A 3RGGA 2FSGA 1PV4A 2VJBA 2ZCVA 3CX4A 1F4VA 1TZMA 2GZ1A 3QSGA 1CUDA 1SPBS 2ON6A 3TR5A 4UBOA 4DLLA 2CFIA 1ZH0A 1QVWA 2P2SA 3TRFA 3T4XA 1DO8A 1TGYA 2QMOA 1BKSB 1L6RA 4JAVC 4B2YA 3WHKA 1FUKA 5AJZA 3DKVA 3I53A 4D96A 1PJRA 5EE3A 1EX1A 3SYLA 2FSUA 3C16C 3NHJA 5LD2C 4MRNA 2BTOA 1FFWA 2RMKA 4L9AA 2XE8A 5HIIA 3QXCA 1PDVA 1TJ4A 2WBLC 2WA2A 5CDFA 4MAAA 4C4YA 4ZCSA 3SQOA 1A2BA 2XY4A 1TF7A 1XELA 5AVUA 3PEWA 2RHBA 1L4UA 1URPA 3ILYA 2WTUA 1RP1A 5CCBA 3SN6A 1LNQA 1HDEA 3AIKA 3EMVA 3E2PA 3NDJA 4FQ8A 1E8NA 3SR3A 3WKCA 4BEWA 5IRCD 1RZRA 4JQCA 5TMDA 4MGKR 1XRNA 1JYFA 5FNVB 4EGFA 4ETIA 4RPIA 4BO8A 2CNWA 4EHDA 4YP6A 4R4JA 1JEYA 4YTEA 1NIJA 4R0VA 4YMSA 3IIEA 1KI8A 2OAGA 3PQDA 3E84A 3F6EX 4CM9A 4CM4B 3CCFA 3BGOS 1R0WA 3JR7A 4ZI7F 1EP1B 4JLMA 5LLTA 1E89A 5IZCA 2M98A 2VUSA 3I1FA 1JKJA 2Q8QA 1YBHA 5HGXA 4ALJA 3KDAA 3PFHA 1N3BA 5CTJA 4BTVA 4B6RA 1JEJA 4KYIB 3BK7A 4M22A 1B0AA 4YIKA 3ZVRA 2D3WA 4CL8A 5KNBH 2GCPA 3AI1A 4QVIA 3A2NA 4B82A 3RSZA 3EPLA 2HYIC 1QF7A 3FHCB 2FUG1 2VAVA 3OD5A 4MB0A 5FDFA 2YUIA 4F3NA 4ZI7A 4HDKB 5F4ZA 3UMMA 3E9QA 5AK0A 3INNA 3IHKA 1KE2A 4GNKA 1CERA 2PKEA 1M0TA 3KJGA 4NYMR 5IJ0A 3LUFA 3SS7X 3ZR4B 4J43A 2CNDA 4KDEA 3RRFA 4ANFA 4YRMA 1DAMA 3L7IA 3DAYA 4YCLA 3IAS6 4MRSA 4DIEA 4B6OA 2UYCA 3BB3A 4K81B 4M7OA 5JNTA 3FCOA 3NYIA 9ATCA 1IEXA 3LIPA 3HJHA 5C8DA 5JQGB 1WKBA 2PLAA 3SMVA 1P4GA 1W2GA 4QOIA 2G9ZA 2Z95A 2FPGA 3ETEA 1W59A 1XNHA 3K4HA 4HVAA 2IELA 3RHFA 1P8JA 4MWEA 5JS7A 2CLEB 2OCGA 4L9SA 1T8PA 5G0WA 1A3CA 1LCIA 1YVUA 1WXIA 3T9BA 1PLJA 3G49A 3HYLA 4YMLA 4BJHB 1DUSA 2R2GA 5EIOA 5IBRA 2ODBA 1NNI1 3GFGA 1FP7A 2B8TA 3AO0B 3MT7A 4O2AB 4WBXC 4XWTA 4EGQA 1WMEA 5DTRA 4BE4A 4DWVA 2XNHA 1T5DX 2GXQA 3KD2A 2IYFA 4EEZA 2AKYA 4HVTA 1N3YA 2IU3A 1TJ5A 2NU7B 3FYUA 1CY2A 2ZYHA 3S55A 3HXOA 4MHTA 1E1QA 3BWEA 1BOOA 3TJMA 4AKGA 5FBRB 1F9EA 1GGKA 3WYCA 4CMKA 1M34A 1E9RA 4AY6A 2BEUA 3KOUA 4GMKA 1U7XA 3AR5A 3ZQUA 4HLUC 2BELA 2J87A 4L3OA 1N6PA 4N3AA 3VBEA 1NWHA 1YHZA 1E64A 3W8EA 3O2SB 3RF6A 2ZAYA 4J49A 4JH0A 3JWJA 4GGMX 1Y34E 4QEDA 5IVPA 4N7BA 4C03A 3TLJA 3ZN2A 5JPCA 2VRCD 1V6CA 2HBZA 4J91A 2XQJA 2W22A 4IQ0A 5LA6F 4O4IB 3QP9A 4K9KA 4AZTA 4BO0A 3R4CA 5BQOA 1SXJA 2HMAA 2K4MA 1NIPA 1U31A 1UC8A 4QU9A 4LNUB 6PFKA 1T5IA 3KD3A 5AKHA 2NM0A 1T1JA 1UZLA 4WGGA 4WJKB 3SQNA 1JWBB 3FZEA 5ALIA 2O7VA 2FB9A 3KZOA 2Z4RA 1M1NA 3OPVA 1YIDA 2BHRA 2JRCA 3PQ2A 2WU4A 1VJ0A 4IZIA 2V74B 1IUOA 1Z0FA 3N74A 3R3JA 4M8KA 2P1DA 4X7BA 3UMRA 4AB1A 5BV7A 1SQ5A 3P96A 5IN4A 4A1FA 2YCLA 3SLRA 5C8YB 2VNHA 1W25A 2PZMA 3KCQA 4MQ4A 2PRYA 3BN3A 4ZRNA 4A6XA 4OATA 3ZD7A 1P7VA 2W0SA 4N0MA 2HNAA 4BQQA 4OBWA 4MJ7A 1TYCA 4YPOA 3OZVA 1KO4A 4HNHA 4MX8A 4A8JB 1YDHA 1JG1A 3VR4H 5DYYA 4AJOA 3JQ9A 2O2SA 4ZPJA 5KDLA 5HIMA 1SVLA 2Q7OE 1JIQA 3H4VA 3T1NA 3MA0A 2B8JA 1SVKA 2Z09A 5H0IA 5SZJA 5IULC 3LP5A 3LYLA 4OMDA 4F4JA 4R54A 4EA6A 2DLNA 1F5SA 5FTMA 7REQB 1IWPB 1OZGA 2HWXA 2C3OA 3LWDA 4KIJA 4YP0A 3I6MA 1AUVA 3VDMA 3WYBA 2PIAA 1ZJWA 1KVRA 1PIWA 1Y1PA 2X77A 3OAAD 1E1RD 3N59A 4GPZA 3TKYA 2RH5A 3T5BA 1NG1A 3PSHA 4JLAA 1HPLA 1M2WA 1C0PA 2W48A 4RS4A 5DN6D 2FOLA 1KXJA 4P34A 5L7WA 3LC0A 4UM8B 2Y1LA 5EA2A 3MUOA 3MJDA 4FFWA 4W1RA 4BLTA 3P71T 4AKIA 2YR0A 2Q0XA 3GLFE 4CNBA 4LHWA 5EMKA 1NUTA 3G9QA 1J99A 5KSYA 3F9CA 1NUAA 5CFNA 1Z0KA 1YOBA 3E0XA 4GP7A 4RTQA 1MRNA 2GO7A 3ASZA 2AC2A 2IFTA 2M6SA 2V7VA 5LDDC 3EYAA 2XLBA 4LNAA 4O8ZA 1GTG1 3E03A 2ZLBA 3AEKA 4AY5A 1E5TA 4TMFA 4MUGA 5TDHA 4JQZA 3V1YA 4DRYA 4K7JA 1L8XA 3GIDA 5KEIA 3KQUA 4DADA 1AC5A 2LGJA 3KQOA 3AHEA 3AJ9A 1ZVQA 3DT9A 4YEDA 2CZGA 3HXPA 2Q3MA 1T0PA 1AA6A 1ZUNA 3WLNA 3KETA 2ZJ0A 1I01A 3U44A 3W4KA 4CV0A 3Q3JB 1GNVA 1ZUD1 2ZE8A 1CY6A 1KJYA 3UCXA 1MO6A 3ZIAD 4AYWA 3G2QA 2LDBA 2QZPA 1C2TA 1R8XA 1RT9A 3SE0A 3MOIA 1XZ8A 3GEIA 4BOYA 2YVQA 2LZ0A 2O2IA 3K1ZA 3WDSA 3L43A 4BZXA 1K86A 4FW8A 2QRVA 3DEFA 3OSZA 2J6BA 3H75A 2DQ4A 3NFYA 2IITA 1YNOA 4ZAYA 1XBTA 1EXWA 2JARA 1T0JB 2GMWA 4JQOA 1J06A 4CWAA 1FJXA 2H57A 2BR3A 4ZDIA 3WGGA 1G5IA 3PD7A 3IUSA 2RHMA 1GZUA 4P93A 4IH1A 2W2MA 4P36A 1ZJ6A 1BGXT 4NH0A 2HV8A 3AHCA 4FEAA 3NT2A 5EJ5A 4GE0A 1EPUA 2VS1A 1Z08A 1YHYA 3WMRA 5L95A 5E7QA 1IBKB 1WHTA 4GECA 4P33A 1G291 3OJFA 1EBUA 2GK3A 4UUAA 1L2TA 3AGQA 4YJHB 1JF8A 1J2EA 1JPNA 2HHCA 5E4YA 5AD1A 2BDEA 3R9XA 1VQ1A 2VDNB 1JT2A 1UK8A 4L8VA 4RGQA 2O50A 4A36A 5HHTA 2VPQA 4JYPA 4OQPA 5EXTA 3SQXA 2O5CA 1RRFA 1MG0A 1X19A 1XEXA 4PHHA 5IT5A 3JZMA 1IUNA 3HB4X 1S2MA 5GVSA 1XP8A 4BN4A 2FMKA 3IMGA 4HB4A 3WNBA 3CLSD 1U7WA 2QVBA 4QPDA 3UJ8A 4ZDKA 5HJ5A 2DLCX 3PHCA 1EVEA 4PZAA 2ZXEA 4BWYA 3MWGA 4LV6A 2GZ3A 3ACBA 1WZEA 3MD9A 4RJ2A 4Y3UA 3TLCA 4BRUA 1NR7A 4D74A 4F0JA 4X84A 4PV7A 4S1WA 4MS3B 5EJ2A 2YIMA 1YXMA 3VYWA 2PZBA 2BUAA 2NSDA 2GYUA 3NWEA 4ILEA 2VDVE 4ZANA 2OSVA 5JO0A 4RENA 4E51A 4PYJA 1JNXX 3SDZA 1OZ0A 2VHVA 1BQ3A 3LDHA 1L7VC 3KOOA 2XLCA 1EK1A 5AHRA 4MEBA 3HUFA 4CU5A 1TUGA 5G3ZA 1W4RA 3FBWA 2CYBA 4QXOA 5H3LA 9MHTA 4CDRA 3D6HA 1Y82A 1B7GO 1P8AA 1UDXA 3ER6A 1T0BA 4E14A 4HTFA 1R0YA 4RF4A 1VL5A 2YNMA 4I1VA 4FGSA 5AHKA 4DANA 4EWLA 1Y8RB 3HCOA 1FZTA 3HRKA 1YOVB 4FE4A 2XDAA 4W8GA 1EZZA 2QRHA 1TT5B 4DMGA 1V35A 4WQMA 2REOA 2G9RA 5LQCA 3CTMA 2WDPA 3FWYA 3G3EA 3VR5H 1Z56C 3U4IA 3R1IA 3QPVA 2ZBEA 4MRMB 4NEHB 1PKXA 2QMYA 4HFNA 4ZVTA 3TLGA 3P0JA 2QLLA 3GROA 4HBGA 5CNMA 3VTAA 3BB1A 4A9AA 2WF9A 4M0PA 4DCCA 5AVSA 3WSWA 4J0JA 4KN5A 1BYIA 3MERA 4R0NA 2WMOB 4TSFD 1ES9A 4ZT6A 2O07A 1JA1A 3OH8A 4JMLA 5AHXA 4K0KB 1V3UA 2I2AA 4BB6A 5CEJA 3PX3A 1NXPA 2LRHA 1T4CA 2Q2VA 3M6WA 4OQNA 5THQA 1RQRA 5FV7A 2DECA 1GTZA 5EY5B 1CG6A 3KO8A 1ISJA 3AESA 4JT4A 1J2TA 2OCPA 8LDHA 1E9FA 1GTL1 3C6XA 1NFQA 5KNDH 3C6MA 5L40A 3UAWA 4FOLA 4U39A 1SEVA 3ULKA 4BMPB 1PFUA 3IDOA 2UVPB 3RS3A 5K0GA 1CZHA 3RANA 3AVUA 1XZFA 1GRNA 1A95A 1H69A 3MRTA 4FGWA 1SFRA 2B4TO 2RKBA 2WIKA 4G01B 5C7OO 1L5QA 2QW0X 1L3CA 1R37A 4HFRA 2QJRA 4TWRA 2AC7A 4KVFA 4J07A 3GEGA 2AUNA 1H2BA 1NBMD 1HTTA 1YQEA 3GCXA 1UIMA 1U28C 1Z35A 2X0KA 1PGNA 2C2MA 3MNFA 4QXMA 4RZ2A 3RFFA 1I5RA 1ZKDA 4ZI5A 1JB1A 2PYDA 1WUJS 3LWNA 1E2HA 3N75A 4HDAA 4ZCIA 1BHSA 2ZTLA 5ECDA 5AUOB 2IYLD 3KXDA 4BKRA 2EW2A 3SBOA 2AXQA 1Q44A 4D5GA 4K8OA 3ZWBA 1BN7A 1HQKA 3D4PA 1QTRA 2WG1A 2DE0X 1T8YA 3F73A 1XCBA 3T5CA 5ADVA 1R66A 5FT9A 5J9FA 4UM9D 4I50A 1QZ3A 1SBTA 2VQ6A 3JATA 3IAXA 1OIWA 4O4LB 3T12A 2E87A 3ZQJA 1XMQB 2XB6A 2Y93A 1CWUA 4MAFA 2NZXA 5A9RA 4P7FA 2J3EA 2DTEA 4WCFA 2EDAA 1WO8A 3F3KA 3A3OA 4QPCA 1LBHA 4LHXA 3L46A 3UZUA 2QTVA 3ZU2A 4ZYYA 1CDEA 3I9KA 1ECLA 5CVEA 4N8EA 3PKIA 2QUBA 3W79A 4E4TA 3NTVA 3MBOA 3QVLA 4H4CA 5AICA 1Y3AA 5D3ZA 3KIPA 5TE9A 1POWA 4MUHA 4RAOA 1J8FA 1LY1A 1SUWA 1FXWF 2J9XB 2OPBA 3M1LA 3RIXA 3D6AA 1KY4A 1F12A 4RHYA 3GG2A 3AM4A 4PE5B 3W1WA 4AIIA 1J5PA 1L8AA 1NQTA 5LWHA 5LVAA 5BQPA 5DM60 3CLHA 4BVLA 1NMZA 5BMVB 1Z4KA 1W581 1G0OA 4RMNA 3EF1A 1ZCAA 1LH0A 2Q9BA 2R85A 3ZDYB 5BWMA 1WA5A 2WWYA 1B43A 1Z8NA 1HYEA 2RAUA 3I76A 3AR8A 3KK0A 2QN7A 2PCLA 1A69A 2IX9A 1QFYA 4Y2UA 2JFZA 4ALLA 4J29A 4X54A 2R1ZA 1FXWA 4Q4AA 4M0FA 2ZUBA 3H1EA 3INGA 1Z3CA 3NEPX 5IVDA 2XWJI 3KV3O 1EK5A 2NXNA 3IEUA 4JQYA 5CXSA 2B92A 4HNSA 5E1MA 5GV8A 4P0TA 3I30X 4U0JA 5IDXA 3M9XA 3PA8A 2A59A 4DFDA 1TXGA 3PNOA 1DIGA 4RTNA 2HDWA 1ACMA 2VHWA 1OZHA 3S6JA 3JQGA 2C5LA 1ZM7A 4GQIA 3T0IA 1YB7A 1U04A 3UXEA 4QM6A 3UW3A 1XVUA 4PHGA 4HN9A 2CXXA 2VG8A 4OBEA 5LNK1 5IAOA 2D7DA 1VPVA 2P90A 2BAGA 1A88A 1OBFO 1OWMA 3WMFA 2R8ZA 5DBFA 2AFHB 1SCIA 2QT9A 5GAJA 4ESEA 1ZOSA 3CYFA 3VNSA 5JLJA 1EQUA 4J3FA 2HCRA 3O90A 2ETXA 4DE5A 1TAGA 1Y89A 1Z07A 1EE1A 1V39A 2HCBA 1HFEL 3CKKA 4IFIA 4B6EA 1NVTA 2IUFA 4RH3A 4CLHA 5IUJC 3LQYA 5J59A 1Z22A 3FNHA 2XZTA 3F90A 3G79A 1Y7PA 4A0QA 2ZRKA 5TS3A 1ONBA 4PX5A 5DN9A 4CUKA 2W6JA 1R27A 2LUOA 2YN4A 2WWFA 2WHYA 3E9ZA 1LQ2A 3PQ8A 4NU8X 3R74A 3H83A 5FWXA 4O29A 1JILA 4XD2A 1XL0A 1QYVA 2XITA 2ZOSA 5LCXA 3DBLB 3M2TA 3DSRA 4BLSA 1U98A 2GN9A 4CMEC 2PLRA 1GL9B 1XZAA 1T9CA 1JHXA 2V4MA 4AO7A 3DUFA 4N5DA 2PT7A 4FHDA 5ALZA 3FHOA 3WC4A 1RRPA 3OKAA 5KX5F 3RWMB 3FYHA 2X5JO 3OOHA 4HJRA 3UENA 3H2BA 4NJEB 2AFVA 3NANA 4G1BA 3ZBUA 4RNDB 5DIFA 3UOGA 2N0SA 2IXFA 1C7RA 1CETA 1COZA 2O4CA 3U62A 3ZY6A 1T5HX 5BSVA 5AWFC 4QTXA 1WSDA 1JG7A 1Z82A 3GZNB 5CW1A 3V8BA 5CA1F 4RA9A 4Y2YA 3UUWA 3AH8A 3FCAA 1VLZA 2H4JA 2JJ1D 3FHLA 3AW8A 5BSEA 4Q3EA 5TMPA 4IM7A 5TGDA 4DWJA 5KX5A 3PNKA 4DVGA 2JBAB 3BIOA 3GG9A 3K8ZA 3IV7A 5JMTA 4F38A 3QU4A 5FTLA 1J5EB 1I2BA 2AHRA 3NNNA 1RVV1 4UBLA 2G1UA 2BHTA 3UYKA 3LGAA 1YIAA 3ELDA 4ETNA 2Y66A 3AVWA 4DDMA 4GRAA 4OI4A 1CUWA 5AXDA 3H3JA 521PA 4Z99A 1FP1D 3FH0A 3VV2A 3W5JA 4DEVA 2PMEA 4WJZA 3EIXA 1DDIA 2GM4A 3F3SA 1G98A 3FG9A 5K8CA 3ECAA 3TFWA 3ZKAA 2FW9A 4M1OA 4L74A 1PHRA 4E7OA 1T5SA 5K6TA 4GKKB 3GGPA 1H8HD 1E0DA 3E53A 1XC7A 2BI4A 2JIQA 2PKQP 3EQ9A 4KWCA 4ZREA 1KQOA 1RI4A 4PYQA 3G2PA 4RJJA 5F3RA 3GMIA 3I8XA 1GG5A 1CSEE 2X5KO 4E3WA 2ZR7A 4WBSA 5DIZA 3AVVA 1WZNA 1AF7A 1N5RA 3N2KA 5I7VA 4RTMA 1DUVG 3TOCA 3MWDB 4MWDA 2PSJA 5KKCA 3CH4B 3ICWA 2BBWA 1G8GA 1QCYA 3OIGA 1BE8A 1Y7HA 4G0MA 4HV4A 3RHZA 2WIJA 5DTJA 4XWWA 2ZJ2A 3I5MA 1VZ2A 1MB4A 1J2RA 2CEAA 3FTPA 1FVFA 1V8FA 3DR5A 3VUFA 4MA0A 5FNVF 1C4WA 2GVZC 3EQZA 3TDMA 3FMIA 4C2UA 1R4ZA 1NUHA 1XWIA 4EUHA 4RDXA 1A9RA 4RTRA 3ESZA 1KFKB 2POCA 3OP4A 4ZMSA 4Q16A 3LDAA 3U60B 1ZU4A 3H2SA 3C6BA 3K6SB 2BFCA 3EHDA 4ETWA 5DB4A 2FEMA 3EEYA 4PIVA 1XXHB 2FVXA 4ZWNA 4F84A 3DTTA 1ZSNA 3I9V6 1Y0BA 3MAGA 3RS4A 3WJ2A 3KPUA 1J33A 1QQ5A 3P9IA 4AN1A 3U40A 5FNVA 1N9KA 2A3RA 4V38A 4ASUA 2W6NA 4BJ3A 4BO9A 1R64A 1QNLA 2PZJA 1PWZA 2CLDX 2JLRA 4G1UC 3AOEC 2I2BA 1IVNA 3NOVA 4OIMA 1NI5A 3EGVA 3RASA 4BUCA 5H1YA 2CV2A 2XTJA 3BZUA 3ZCRA 1H5QA 3G88A 3QF4B 1JFLA 4AUMA 5EIWA 2X13A 2L82A 3TVTA 4EW2A 3JVVA 2CN1A 3V80A 1SXHA 3BFJA 1E9VA 7GPBA 2F55A 3H6HA 3G2JA 3O3CA 3LH5A 4R2KA 3WLFA 3A6GA 5HKKA 5A3QA 5GY7A 1KU0A 2PCJA 1A9PA 1CRQA 2GT1A 3ICCA 3E3OA 1XZEA 1UK6A 2PGDA 1S8NA 1XKXA 3O2JA 4OHPA 1HXHA 5AKIA 3HRHA 3TM4A 4B3TB 4E3ZA 2O7NA 3MBIA 1YACA 4TGLA 4YRRA 4HDKA 3VSCA 3ONEA 4KGVA 1NBOA 1XTPA 2WWIA 4GQBA 4Z9YA 3FVTA 3L0PA 2BGGA 3WLAA 4OB8A 3GGDA 4AJ4A 4C78A 4DA7A 1BS1A 4QFCA 4O2AF 2Q4OA 1UMKA 3CT6A 2CXTA 1E3TA 2H5IA 3P4XA 5ECGC 3B1YA 1WXQA 3GDOA 2ADFA 3F2VA 1LPPA 4QRDA 4RCZA 3VPBA 1WETA 4KFRA 2GHQA 4WZAA 2DBYA 1DIRA 2BEKA 3GRPA 3WICA 4DCPA 4JI2B 3TLYA 4UM5A 1IJBA 1LFAA 2XUPA 2H1OA 2GAAA 4HDRA 1FNNA 4HAOA 3E9DA 1BDHA 4WN9A 1BX1A 5BWBA 5HM8A 1FS6A 3KEGA 3NDPA 3PC2A 5E8JA 1ZYUA 3VGJA 4F9GA 3U48A 3CIOA 3THXB 3WNCA 1VPDA 3RSSA 4O2AA 1TEXA 2YFHA 1C2YA 2ZJ7A 4UMDA 1L4NA 4CEHA 5GIOE 3QX9A 2P9HA 2GJ4A 2JFUA 4LOKA 2DU8A 1QVAA 3AXSA 3ZWVA 3DFFA 2NU7A 3LO8A 4IUYA 3AU8A 3L1VA 4OLJA 4O4IF 4JLDA 4QD3A 5AYVA 4ZEWA 4EGCB 4UM9B 1P2TA 1S3IA 2ZDQA 4JL5A 2FH5B 4MDEA 1QYWA 3WYEA 2PY6A 2WZCA 3NJ4A 4DDUA 3FAZA 5CJJA 1Z4QA 1KVQA 4E46A 2FN3A 2IPNA 1LNZA 2KW5A 1Z18A 4BNNA 4I1YA 1V47A 2ZBQA 3O8DA 1QX4A 4KSBA 4IIYA 2J3LA 4Y7DA 2JVKA 3RU9A 1UOEA 3E9MA 2C4NA 1RQNA 5SY9A 2PQ6A 2VJMB 1CRWG 3EDRA 3GELA 2HBRA 2PWAA 3STYA 3PI7A 5IABA 3TM5A 3VNAA 4O4IA 1HT1E 2BFAA 3X44A 5C8YF 1W5AA 3C7DB 2O1SA 3EXG1 4K0RA 1DDGA 2LCIA 4OK3A 2QXUA 3MUFA 1XMJA 1UDWA 4GAEA 1ZICA 1XSEA 2QZ9A 3F5FA 4XDHA 3ADOA 3T41A 4DSOA 4DDTA 5DNYB 4YV7A 4FR0A 4URHA 5IF9A 2J4CA 4HGQA 3WZMA 3NHUA 5IP5A 2ZZNA 5I4CA 3SNKA 1P29A 1ATZA 4DLKA 2FZGA 2VYQA 1U9YA 1BAPA 3NGXA 5JAPA 1U2GC 1XK6A 3MFQA 5C8YA 3TAXA 4FCWA 2C9YA 3QUQA 2PUTA 3H8SA 4KQ9A 5DISB 3DQZA 4YAKA 3K2IA 3CZAA 3MJHA 5JQWA 2X9NA 3AR3A 5BQ5A 1Z6ZA 2G70A 4ZOCA 1K06A 2EF1A 5IEBA 2C4HA 3O83A 4A8JA 4ZEMA 1KI6B 1LFDB 1TQ6A 4Z9FA 3CR7A 4PCLA 4D3SA 3HGTA 4NCXA 3TTSA 4Y6OA 1MHTA 1PGPA 5TXGA 1RI3A 2ZBGA 2VWPA 2GD2A 6ADHA 4X91A 3PXGA 1B1AA 3ZDAA 1YUNA 1R6TA 2BI8A 3D5EA 3L8ZA 4RBNA 4UU0A 2JLYA 4TMZA 2VVTA 4CKCB 1I3KA 2DULA 3AC0A 3PNMA 2XR1A 2F9FA 5ER6A 2JCXA 3U4MA 1P9WA 1M54A 2ZT8A 4BB5A 3DVLA 4CQJA 1KI7A 2QTHA 4B79A 1CLEA 2F1KA 3U9SA 4FFRA 4XUCA 4U0KA 2G1KA 2J09A 1XQ9A 1RAFA 5A5DA 2NPIA 1KDVA 3ZJTA 1WMAA 2NO0A 3LJKA 2EBHX 4YCDA 4EOGA 4YX9A 2PT9A 3BMCA 3E05A 1OLXB 2O2ZA 1ZOIA 1XTTA 1K5HA 4L5JA 1QIMA 5G0VA 3FRHA 1N25A 2YWBA 4JB0A 4QUEA 1MVNA 1H4QA 3JQPA 1UIRA 2HMSA 3BF7A 1OZAA 2QN2A 1QBGA 1SURA 3DC7A 3IUEA 3OKFA 4OYLA 3TR0A 3QOFA 4AYTA 5HTOA 4QLAA 4KPYA 4AVYA 5JJLA 4DQKA 2JI9A 2FTKE 5IT9A 4OB7A 3ZH2A 4JJ6A 4CV1A 5EPOA 3K92A 2DFVA 4KVAA 5AKYA 4YGXB 3TOSA 3BDIA 5CG2A 4GUDA 4L7QA 1E3WA 4OB6A 5EHNA 4BNIA 2Q0SA 1TO1E 1G2IA 1YC2A 2AJLI 3OOWA 1YCFA 1XLWA 4ZZIA 2OCKA 1UMDA 3ZE2B 4CG1A 4DLZA 5DNUA 2PS1A 2G1PA 3PQ4A 4XI9A 4NBTA 4MJXA 1IUPA 3HM9A 3ZVNA 4KRFA 2ZRNA 3E48A 2ZS7A 4LZPA 3NW9A 2D6FA 5B1DA 3KZ1E 1KC1A 1SUPA 1WD5A 1WX1A 3A58B 3DLPX 1ILWA 1AHNA 1N3LA 3R7SA 4R40A 2WIGA 5JS8A 3NGLA 1W36D 4EO4A 3N0TA 3NIBA 5F33A 4HF7A 1I33A 2ZANA 3KKKA 1JDPA 4XDYA 4ZDWA 3ZUGA 2E89A 2ALJA 4LXIA 3IULA 1AO0A 2PH3A 4XPIB 3VNQA 4C0XA 3LY7A 3TTTA 2BM1A 3QEKA 5DYNA 3H87A 1V37A 3K0EA 3OMXA 3W9YA 4F60A 2B4AA 3E5HA 4J7CA 4Q7QA 3N0RA 3ORHA 1DJPA 2GJKA 4YS6A 5AW1A 2A5FA 2BJWA 2VTKA 3BUSA 5ALTA 5ALDA 2LR0A 1RWPA 3WB2A 1NSTA 2ANBA 2BGMA 1RAEA 1E59A 2I62A 3K30A 4OYHA 4QASA 2BR4A 5ALFA 4EB3A 4C0HA 5EWMA 1VBMA 5AJHA 5B1HA 2R4UA 3FB4A 3WTBA 3T34A 4C20A 9LDBA 4KL8S 4BHTA 1I0ZA 4G8DA 1I7LA 4ZCLA 1FJGB 1K63A 1LJ8A 4ZQBA 3RWOA 5C18A 5KU7A 1VPWA 2XXJA 5ALNA 3EIFA 3PL5A 4OIFA 2XMQA 2HMYB 2HBYA 5A9TA 1H05A 3R20A 4K9RA 2XB8A 2IXDA 4FVTA 3QBEA 2CDAA 1TVKB 1HORA 3OU2A 1Q22A 1PE0A 2WSSA 4G5GA 4HEHA 2XB9A 4U7TB 2YHIB 3FPBA 4RY8A 3OE5A 5AKEA 4FR2A 5J2TB 2EP8A 1GGHA 1VG1A 3A4IA 2UUOA 4OL0A 3ZHRA 2C61A 2P67A 2W6OA 3QVGA 2Y3IA 2X7JA 3G2LA 3UGQA 2X2OA 3L18A 3VKFA 2J31A 2ZW9A 2D4HA 2XRYA 3I5UA 4B80A 2X3UA 2D1FA 2W2VA 2WFMA 1NOKA 1IY9A 2ZAIA 4OCZA 3HHPA 5IVKA 1EBBA 1NVVQ 4AX4A 3EFOB 1BRTA 2ZJAA 1PJTA 3N2ZB 4RV4A 1Z7YA 2VDWB 4U8GA 4LF7B 2C78A 1H3NA 2RDMA 3A1VA 4KU4A 3VH3A 3ZX4A 3ZCTA 1Y8RA 3L40A 3OTWA 5LP6B 1H2FA 1YOVA 5IM4A 4QDKA 4I5EA 4RABA 3ROKA 4KN8A 5K1ZA 1CZUA 1ECCA 1HLFA 1ODKA 1K3UB 4FGLA 4LYGA 2A9RA 2WSYB 5F1KA 3VAZA 4DCOA 4HK4A 4D9GA 4GEGA 4MRMA 4NOLA 4PYKA 5IKPA 3R8XA 1YI0A 3L7YA 4ZTBA 2J30A 5KDOA 2PUBA 3JTEA 1K7YA 1PJ8A 2M9MA 2P75A 4BUJA 1TM3E 3KZXA 3OE7D 2DHEA 3LBYA 4ZV4A 2JBHA 3BZWA 2DQYA 2WAAA 5J2UB 5BWNA 3EGXB 1IZZA 4N0PA 2JANA 2QQFA 5JNRA 1JA0A 3AUFA 3PUKA 1KZ7B 3HEMA 1TMGE 4ZT3A 3R0ZA 1I13A 3EZ6A 1KF0A 1T2AA 2RBKA 4I3HA 1UBFA 4WOCA 1E1MA 1J56A 1OU4A 3J81A 4FFNA 4NCJA 2DCMA 5AW3A 1W85B 2IWRA 2A5YB 2HHJA 3WGTA 3SD7A 4WBNB 1MO5A 2GJSA 1SK8A 2IP1A 2J6CA 2P2CA 3ZDEA 1LRJA 4BNGA 1PQWA 4DRXB 4XWKA 3NALA 2AI2A 4UW9A 2WEKA 2C42A 2VF2A 2RI1A 4OMCA 3Q1KA 4HEA1 1UAYA 4FGJA 4NI5A 1GPBA 1L7QA 4LDAA 3GVCA 4ARIA 3KQKA 3V6MA 3WI7A 2QBYB 3H9QA 1PEAA 2UVPA 3ASYA 2J33A 2W2OA 1OFUX 4ALIA 3BOSA 3QHAA 4R1LA 4BZZA 1ODSA