3DWFA

Crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
271
Chain Sequence
EKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNVLSNERW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
publication title Mutations of key hydrophobic surface residues of 11 beta-hydroxysteroid dehydrogenase type 1 increase solubility and monodispersity in a bacterial expression system
pubmed doi rcsb
source organism Cavia porcellus
total genus 101
structure length 271
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dwfA00
4CV2A 1DB3A 2D8AA 3QSGA 4Q9NA 2NLOA 3D4PA 1SB8A 3ZNPA 5KNLA 2ZB7A 2WSBA 1R0SA 3ZHBA 3EYWA 2JD0A 5KIAA 2VHVA 4HFNA 4WEOA 5JW6A 4AJHA 5A3JA 1R66A 1EK5A 4BOYA 3OA2A 2W2LA 4KDEA 3ZV5A 2GO1A 3WYEA 3GHYA 3INTA 3L6DA 4CLXA 2YV2A 2NUAA 2Y66A 1Y1PA 2CDAA 3RUIA 4QSMA 3C7DB 3UFXA 1KVTA 2ZJ1A 3K73O 4YT4A 1EEHA 1NYTA 3DDNA 2NTNA 3V2UA 3UVEA 1HLPA 3F1LA 3Q9UA 4LN1A 4XJTA 5KJCA 1YL7A 3HUDA 3C7CB 4ROSA 3OMLA 3I9JA 2P91A 1T2AA 3BTSA 1QV7A 1HSZA 2GPTA 3BMQA 3ORFA 1YH3A 3H9QA 2HMTA 3LC2O 4ALLA 4LMPA 1LRLA 4IDAA 2HK7A 4RQUA 1G1AA 2X9NA 4J2HA 4D41A 3FCOA 4BKQA 4O59O 1C1DA 2D4AA 4C4OA 2I76A 3JV7A 1V9LA 2EKQA 3ABIA 1GD1O 3LLSA 1DRWA 5L3ZA 2WYVA 3AJRA 5TQVA 4EITA 4BMSA 3GA0A 3BA1A 2VHWA 5C3MA 1LU9A 1G0NA 2O3JA 3NGXA 5DZSA 1NWHA 1UDBA 1HDCA 5LCXA 3WBFA 1ISIA 1M2WA 3TF5A 1Y8RB 4TRJA 5AXAA 1BG6A 3OFSA 2DBZA 4FFOA 2IXBA 3RFXA 2QRJA 1I8TA 4XWYA 4MP8A 4MVJF 1KEPA 6ADHA 1HDRA 1R4MB 2EHDA 1X0XA 1N9GB 2BGLA 2A35A 3JQBA 3KZVA 3O38A 3K6JA 4ONEA 3RC9A 3DMTC 2AQ8A 3UF0A 2VOJA 4CUJA 1JTVA 4CM5A 2Y05A 3CEAA 2TMDA 5F3RA 5BR7A 2EEZA 4CQMA 2XXBA 3JQ8B 3UAGA 4Z3KA 2YHIA 4MVJH 3JQFA 1P45A 3R1IA 1BVUA 2OL4A 4FGSA 4EJ6A 4XRGA 3QE3A 3I52A 3OICA 4EGFA 3I1JA 4DYDA 3MWDB 3C1TA 2Q2WA 3UW3A 1UXKA 2O48X 3WIEA 1R0LA 4CQLB 9LDTA 3KYCB 3MJEA 2VRCD 2PV7A 4FN4A 3PIDA 4U0KA 2V6MA 1T4DA 3NJ8A 1LC0A 1P0CA 1VL8A 1XIVA 4WUVA 4MVJP 2I3AA 4WCFA 1SPXA 3H5RA 2ZIZA 1DC5A 4D42A 2VWHA 4CLHA 4IZHA 3DXFA 4YA6A 1A4IA 4OSPA 5JXWA 3AUAA 4URFA 3HFGA 3RFTA 4CM4A 1GDHA 3QHAA 1PJ4A 3VHRA 4H15A 1KERA 3BYZA 2Y1GA 4DQVA 5L45A 4OYRA 1ISJA 4AG3A 4MVJE 2VT3A 3WJAA 1ADBA 3S1LA 1JVBA 1ULUA 2AG5A 2C07A 1AHIA 1PWXA 5TX7A 2O4CA 3ZV6A 3E18A 3GT0A 1A7AA 1ZK1A 4FD3A 4GLLA 5TT0A 2PZMA 4WLVA 4YAGA 4U6QA 4WPGA 1JKJA 4E33A 3FSRA 3IIEA 4WLNA 3V2GA 3CPSA 1HRDA 1TXGA 2BELA 1X0VA 4WLEA 1ID1A 5AYVA 4CLDA 5G0TA 3H3JA 4M8SA 1YOVA 5BQFA 3A28A 1KBZA 1RM0A 3ENKA 3INGA 4MVJA 3TJRA 1T4BA 4BNZA 4BNLA 1U3VA 1E1MA 3FN4A 4GH5A 4RVDA 4BKRA 1GPDG 4F45A 1HDYA 1VKNA 3GH3A 4GL4A 3GPIA 3JSAA 4LW8A 2X8LA 1JDJA 1O0SA 1BTOA 3KXDA 4HXYA 2B37A 2JHGA 4EEZA 1T26A 4CMAA 1K5HA 1PQPA 3K96A 1GZ3A 2V6FA 3NDIA 5C37A 3VH2A 3TZCA 3PGJA 5KCZA 5JO9A 4LSWA 5I7SA 1KETA 1ZCJA 4DL9A 1JA9A 1NPDA 3UHAA 4F46A 2HK8A 3G3EA 4IDEA 2JD1A 1YB1A 1TB4A 5TLSA 1NQTA 4NDNE 2OHXA 5TS3A 5F5NA 4ALNA 3C7AA 5K6AA 3FNFA 3LLVA 3O8QA 4MVJM 4DMMA 4DPKA 1I10A 2AMFA 2OUIA 4L76A 5TJ9A 1X1TA 2EG9A 3W8DA 1U7TA 1G6KA 1W8DA 3ETDA 4J4HA 1ADGA 2GN6A 3GAZA 3WWZA 5COQA 4HADA 1IHYA 4AVYA 5DP1A 4BNVA 5KJ1A 4BNGA 2GGSA 3PP8A 4C7JA 2IXAA 3D3WB 5CDUA 2FHSA 4XZ3A 3FD8A 4J1QA 4J1SA 5I7VA 5JS6A 4FGWA 2QW8A 2UUOA 3ICCA 4RDHA 4KOAA 1Z7BA 2C20A 3PFWO 1YONA 3U49A 1PEDA 2RHCA 2X22A 5G0VA 3IOYA 5COBA 1HDOA 1A5ZA 2C0CA 2NVBA 3CZMA 2HSDA 3GLQA 3ZU4A 2YW9A 2VYVA 4GWKA 4J9UE 3VZRA 3RJ9A 4BNYA 4UUNA 1E7WA 4L73A 3RVDA 4UVDA 3PEFA 5C7LO 5DBIA 2BFOA 3G79A 4GKVA 4FOOA 4E2WA 3IUPA 5TNXA 1PJ3A 3HADA 3OQBA 3DR3A 3PWZA 3WJ7A 5A3VA 3KEQA 1F12A 1YB4A 5KKCA 2EKLA 1SOVA 1EFKA 3LT0A 1HSOA 3ZWMA 1ZSYA 2C59A 3L4SO 1NFQA 4P8RA 2ZB8A 3V2HA 3ZWNA 4Y6PA 4BO8A 4E31A 2FOIA 1CF2O 2PR2A 3WDSA 3EK2A 4NJMA 3D3EA 1LX6A 4CMBA 2IZZA 1LDNA 1P44A 1PTJA 4RV9A 3VPSA 2D5CA 5JPIA 1VE9A 3E9QA 2X1HA 4JP2A 3TPCA 1Y5RA 3V1TC 2J6IA 4YYZA 3AFMA 1UXGA 2PY6A 3IP1A 4E2XA 4EJMA 5JAIA 4L4XA 3TZKA 2CSUA 4IDFA 1LLCA 1YJQA 3MJVA 4RVGA 4FOSA 3A9WA 1O95A 4OOFA 3QWHA 4F6LA 5JSFA 3JYNA 3M1LA 5L40A 3BMQB 4NU5A 3WTCA 1B8VA 4AJEA 4HKTA 4QTZA 2NVUA 4KUGA 3TN7A 4LRSB 4R69A 4YR9A 2O23A 4XB1A 1WMBA 3LSYA 3ST7A 1XGKA 1PZHA 4UUPA 1ISGA 2DPHA 1D1SA 1DBVO 1C1DB 2JAHA 3AI3A 4IQ8A 1LC3A 3G49A 4KMSA 3FWNA 1VJ1A 1LDMA 2G17A 4ZGWA 1DC4A 3ZZNA 4ZRMA 3PRJA 3GHHA 1QKIA 3BTVA 3DO5A 2VZ8A 3E5RA 3HQ4O 3MTGA 4GVLA 2Y0DA 3PLNA 1Q7GA 2NADA 2GDZA 4IIUA 5FFFA 3VVBA 5G2OA 5FWNA 1GV0A 1R6DA 1JAYA 1W73A 2NQTA 1PGQA 4RPLA 4I5FA 4KWHA 5EESA 3D0OA 3BAZA 3TNLA 3KSDO 4IDGA 3RIHA 3F6YA 1MFPA 3KUXA 3MJTA 3MWEB 3ADPA 1J4AA 4IDBA 4RDIA 2AQIA 1DSSG 1ENZA 5I8ZA 4UEJA 4G65A 3P7MA 1E3WA 5MDHA 2HRBA 3IKVA 3Q11A 3HHPA 3ITKA 2RH4A 2JFFA 1CRWG 1U5CA 1CIVA 5CG1A 3SEFA 1V6AA 1W6UA 3ITDA 2ET6A 1VL6A 1ML3A 4ND4A 2FR8A 2JFHA 4CQMB 1MC5A 2YHIB 5B37A 2VNAA 5KVQA 1U7HA 4IGFA 3WSVA 4R16A 3JYLA 4RPKA 2HJSA 3WGHA 2OBYA 4ZQFA 5B4VA 1ZXLA 3JQEA 2FR0A 4XIYA 4YWJA 3VPFA 4EUHA 3UCXA 1DFGA 1LSJA 4JN6B 2NTJA 1E92A 4MP6A 4ID9A 4KTVE 4IINA 3K5PA 4WCFB 3F3SA 2VZ9A 3B1KA 3GNSA 4D43A 3NGLA 4LGVA 2NVWA 3ZN2A 1FXSA 1TT5A 4CMHA 1JVSA 3B6ZA 1B3RA 3GEDA 4EW6A 1SCUA 1DJNA 3N74A 1WAMA 3GC6A 1JKIA 4CM4B 2O7QA 4A26A 1T2CA 3WICA 1GUZA 1EDZA 4B7UA 4BIIA 2NU9A 4ALKA 1DRUA 2LDXA 1H6DA 2XF8A 4Y98A 1UR5A 1UAYA 4IPTA 4NBTA 3JYQA 1NAHA 1EUCA 1X13A 2YUTA 4L0QA 4RF4A 5EINA 3RI3A 4EBFA 3BMOA 1TT7A 3S2IA 1BXKA 1U28A 4CL8A 1PJSA 2LDBA 3AK4A 3QVTA 1NFRA 3DFZA 4BO4A 5A9SA 1K89A 2VUSA 4DMLA 1UH5A 3ZWCA 3IJPA 1YOVB 1HZJA 3I23A 2I3GA 1E1KA 1NPYA 4WE3A 2Q1TA 3HZZA 4PG7A 4DIBA 1GFSA 4L4SA 4IJWA 4X54A 3OF2A 4FB5A 1LXCA 1UJMA 4HWKA 4NBRA 3HB5X 1DC6A 3WGQA 3E9MA 3DBLA 1P9LA 4HNGA 3PZRA 4RVSA 3GY0A 4P4LA 3KVOA 5ENDA 4BO7A 3JQCA 2VT2A 1WDMA 2X0IA 5CEFA 4R01A 2Q1UA 2GF2A 2O3SA 3ICPA 1CQJA 5IN4A 5H81A 3LQFA 1V3VA 4HFJA 1WDLA 5HBRA 3DTTA 4BNMA 4BO3A 1X7GA 2EIHA 2HMVA 1BDMA 1DO8A 3HFSA 3I9MA 2HKIA 4I8XA 3QA9A 4Q39A 3WIDA 1PGOA 2H5LA 4ZD6A 1LQTA 4TKLA 4UVIA 2DLDA 2HRZA 3O8QB 4OHUA 3ENNA 3LT4A 2Q46A 1RWBA 4MIEA 1TA4A 4NK4A 1LLQA 4RLHA 3KSUA 3RD5A 3AY6A 5DF1A 2BGKA 1ZFNA 1LLUA 1QSGA 2OMEA 4R54A 1LJ8A 2PA3A 3UCEA 3PXXA 3LT2A 1O6ZA 1KEVA 1H93A 2E6UX 1H6BA 3OQ1A 4R9RA 2R00A 5LDGA 2WMDA 4BHTA 1PGNA 1QRRA 2W90A 1EBFA 4MVJG 4W4TA 2DT5A 3QY9A 3ZV3A 4BNUA 2C7GA 2OORA 1PJTA 1IOLA 4RF5A 4R41A 2H9IA 1P74A 2EJVA 1Q1NA 3X2FA 4BL5A 3EGOA 3E8XA 1B8UA 1F8FA 4BO0A 1FDUA 3H2SA 3QVOA 3PI7A 1VLLA 1GUFA 1ZSNA 4H7PA 4R4JA 1DDOA 1NR7A 2Q4BA 3UICA 3MJSA 2J5RA 4XQEA 4NJOA 1QG6A 3HJAA 3KETA 3E1KA 1ZIDA 1HE5A 2AEJA 3I4CA 1LDGA 2D2IA 1RM5A 4WGGA 5A04A 1KYQA 3EZYA 3PYMA 1PZFA 3TZHA 5G0WA 1DIGA 2WJPA 1QR6A 1EFLA 2FY8A 3PPIA 3INRA 3DHEA 1BGVA 4O6VA 2FRDA 1U3UA 4ZA2A 3D64A 4TZTA 3JYPA 5B4TA 4RF3A 2X0NA 3W4JA 3C24A 2Q49A 2UVDA 1PJ2A 2YJZA 3IDSA 2FMUA 4IDCA 3L4BC 4RGBA 3GRKA 2UAGA 1ONPA 3W4IA 3W4KA 3GFBA 5LDHA 1U9JA 1AXEA 4NJMB 3Q2IA 2ZK7A 2VHYA 2QQ5A 3MOGA 4RCVA 1DPGA 2G76A 3DMYA 3GQVA 3ZU3A 1FJHA 1R37A 4TKMA 4I08A 3KO8A 1D4FA 2JCVA 4E6PA 3OA0A 4ILKA 1I32A 4GGPA 3V5NA 3G1TA 4JROA 5JLAA 3WQRA 3WWYA 2Q4EA 4ZQHA 2A92A 3L77A 1HT0A 1IPEA 1U3WA 4PLTA 2PZJA 1IE3A 5DNAA 1CQIA 2B4RO 3H2ZA 2NVUB 5AXCA 4XQCA 1H6AA 5U4QA 4BV9A 2FWMX 2HAEA 3JD0A 8LDHA 1X7DA 4XGKA 4CLOA 1I3LA 4NQZA 3OJFA 1RKXA 4IZIA 4RPJA 2ZB4A 1O89A 4ND3A 2V6BA 3VAZA 1U2GA 2HMUA 2DBQA 1NASA 3OEWA 4UVHA 5BNIA 1MXFA 4R51A 3X2EA 3DAPA 2ZCUA 3KEOA 2ZTVA 2VHZA 5CFZA 3WB9A 2YHUA 4G81A 4GSKA 4BMVA 1I5RA 3DMTA 3RWBA 1SBYA 3VC7A 4ZU3A 1ENOA 1U4SA 3HDJA 2IYOA 4I5DA 5A5EA 2EV9A 3C1AA 1LBEA 1T25A 1XA0A 3QWAA 4U6SA 5BSEA 4WECA 1E3WB 5CDGA 2ZQZA 5IZ4A 1XU7A 4CM8A 3ZH2A 5ES3A 3HN7A 5JMWA 1YGYA 5L53A 5JC1A 2B4TO 3DZKA 3TL2A 3I9OA 4AJIA 1N7HA 3M1AA 3NT4A 5JDCC 3FI9A 3S2FA 3ZWXA 1H9AA 3I5MA 4J9VA 4AJJA 3SJUA 3QLJA 2NU6A 3WYCA 5IXSA 5B1YA 4K1LA 2ZCVA 2IEDA 1I01A 2IZ0A 1VKOA 1FDTA 3PVZA 4DYVA 5GZ1A 4BNHA 1ZBQA 3SBOA 1B7GO 3K31A 3TL3A 3IMFA 3AUSA 2IODA 4B8ZA 4IXWA 1HDXA 3CINA 3JQDA 1KVSA 4W82A 2VYND 2NTVA 3PQDA 4CM9A 1TT5B 1CETA 4CMEC 3U5TA 3TOZA 4BO9A 1L7EA 3LF1A 5DCYA 4BMNA 5JO0A 4TVBA 1ADCA 2BD0A 3FPLA 3A4VA 1WWKA 1BVRA 2BKAA 3P5SA 3P2OA 2B83A 2O3RA 2VQ3A 2YFQA 3W8EA 2BMAA 3SX2A 1ENYA 2NU7A 1E6WA 3AU9A 2EF1A 2QIOA 5FI3A 4WLFA 1FK8A 4N54A 4YJHA 3HSKA 3DL2A 3Q0EA 3BMOB 2O4UX 4P22A 4A0SA 1PGJA 1U2DA 4TROA 1DIAA 4Y8VA 4J0EA 4A10A 2DBVO 5A9SB 2O3QA 1JN0A 4RL6A 3ZV4A 1ZVMA 3K2BA 4EEXA 4MPDA 2A9FA 4U0JA 4CMGA 2PFGA 3DEYX 3GOHA 2CNBA 3Q2KA 3V1UA 1ZJYA 2DUUA 1Q7BA 4XDZA 4XQ9A 1I36A 1DIBA 4R68A 1YJ8A 4DIFA 2Q50A 4E21A 4C7KA 1F8GA 1OAAA 2BFAA 4N18A 5F1KA 1L7DA 4D3SA 4G5HA 1NM5A 4A27A 3U3XA 2GD1O 3DBLB 4TQGA 1BRMA 2X0JA 2TMGA 3FNEA 3GPDG 2FSSA 3F9IA 2ZYDA 3Q3CA 1E7MA 5HM8A 1PJLA 5LC1A 5G4KA 5J23A 1ISMA 5TJHA 3HG7A 1ZK3A 3PZBA 2GZ2A 4FW8A 5L7YA 1ZH8A 4IS3A 4AJNA 1F14A 4NBUA 4QT0A 2Q1SA 4WOKA 1ULSA 3QWBA 4WLOA 4B4OA 3IKTA 1I0ZA 1R15A 5L9AA 3VOSA 1IHXA 4JBGA 2YQ4A 4ND5A 1WZEA 3GGPA 4QEDA 4IJUA 1N8KA 1C3VA 4OKNA 4Y9DA 1QP8A 4PLYA 3RCBA 2VYNA 3JYOA 3OIGA 1DJQA 1HE4A 3PHLA 3ZWWA 5L4NA 4OKIA 1PZGA 2GASA 1XG5A 4RVFA 4YQYA 1GCOA 4CM3A 4FJ0A 5A9RA 5IXYA 1PL7A 4FSHA 4NBWA 2YDXA 3PQEA 1GUYA 4TRNA 1IY8A 4M89A 3S55A 1MP0A 1GZ4A 4YJFA 3W1VA 7ADHA 1WP4A 1RYEA 1H0KA 1C14A 2CVZA 3NTRA 4Q3BA 5DT9A 5G4LA 4ITUA 1NVTA 1SZJG 1O9BA 4NIMA 2VNSA 4DQUA 2F1KA 5DBFA 4Z9FA 3AOEC 4IXTA 2B0JA 2PH5A 4XYGA 4E5PA 3FR8A 5GZ6A 5JCJD 2VN8A 1WNTA 1T2EA 3GG2A 4Z3DA 3WOHA 5L51A 4MVJI 4XYEA 3ZWPA 4GI2A 2V7PA 5ICSA 4UUOA 4YXFA 4XGIA 1XLTA 1AGNA 1EQ2A 1D1TA 2C2YA 2OP0A 4QECA 3TWOA 4TZKA 2FZEA 1JLLA 2B35A 4L74A 4IJVA 4JIGA 3TZQA 4CLEA 3LU1A 2HDHA 2CF5A 3OIFA 3MJ4A 2JHFA 3DC2A 3DWFA 3L6EA 3OJEA 3VH3A 4S3MA 1P31A 1EE2A 4EZBA 4FC7A 4RVHA 1K6JA 4DPMA 4AJKA 2CMDA 2GCGA 4YVFA 1B2LA 2E48A 2HQ1A 2J8ZA 2P68A 4CV3A 3VH1A 4YQZA 4M55A 4F3YA 2BGMA 1D8AA 3U4CA 3OP4A 2RH8A 1YDEA 1HKUA 4CLRA 3M2TA 2E37A 1N92A 1EQUA 2ZKLA 4GMGA 5B4UA 4N7RA 4JJIA 2DVMA 3ZDFA 2DU8A 1BSVA 1MC4A 3GEMA 2AW5A 3UN1A 2I5PO 2RAFA 1NPTO 5CPFA 5F1OA 2Q45A 1XWFA 3GAFA 3CZRA 4CLOB 1PQUA 1KC3A 1EE9A 4EDFA 3Q1LA 2SCUA 1PIWA 4NH4A 1ZMOA 2O50A 6LDHA 2FSVA 1YXMA 2VRCA 3RJ5A 1W4ZA 1M6WA 2ZYGA 1PL8A 1QXSA 2Z5LA 1EK6A 2EP5A 4CV0A 2O2YA 4PLCA 3VTFA 1I2CA 4II2A 4TVOA 4PG5A 4RPHA 3RUFA 4CJXA 1Y6JA 3O9ZA 3GNQA 5IN5A 3JQAD 3KRTA 1H9BA 4CR6A 1B14A 3DHYA 1E6EA 4YTEA 1Y5MA 2OZPA 5A06A 4XR4A 1NWCA 3SC6A 1PWZA 4CM8B 3L07A 3KLMX 4PLVA 5AQ1A 3VZSA 4NFHA 5IFLA 2PD6A 1LLDA 3CSDA 4AICA 1D3AA 2WWRA 2DFDA 3A1NA 4OM8A 1CJCA 3SLKA 2E4AA 3H9EO 4MKZA 3SXPA 4JJFA 4WNCA 1IYZA 2P9CA 4BNWA 2VRBA 1ADFA 1YBMA 3H6KA 4J0FA 3CKYA 5A5FA 5DOZA 2GSDA 3RU9A 5JDIC 1A7KA 4KWIA 3MZ0A 4R9SA 4Z0PA 4QXMA 5TGDA 1SO8A 3NV9A 4H16A 3MJCA 3ON5A 5A1TA 1SOWA 1ZNQO 3VZPA 1SC6A 3PGXA 1Z45A 3OETA 4HUJA 4XYLA 1N2SA 1RJWA 2CVOA 5BT9A 4Q3AA 3OH8A 2OO5A 4W7IA 3NKLA 3NEPX 2WYWA 5ITWA 3OEYA 3GZNA 4ZN6A 4UVEA 4RPGA 2JCXA 5TRTA 3SJ7A 2PH3A 2WE8A 3DB2A 1QLHA 1KIFA 1XEAA 3F46A 3ETEA 4BB5A 4ZRNA 1K6XA 4YJHB 3ZWYA 1LRKA 4MJLA 3PJEA 4S1VA 4BQRA 4K6FA 1VC2A 1DLIA 4AJPA 1E3EA 3I9NA 1V3UA 4IY1A 3EC7A 4DBZA 1E5QA 2PZKA 2P4QA 2X7HA 3COSA 1S7CA 3R6DA 5KKAA 3RC2A 4DREA 1YL6A 3U0BA 3PLRA 1Y81A 2VWGA 2X5OA 1YQXA 3BZUA 3RSHA 2FPIA 1HE3A 1Y9EA 4XX0A 2YQ5A 4M86A 4BNKA 4IDDA 4MP3A 4DA9A 2HO5A 3SC4A 3KSZO 1D7OA 1TVEA 1N1GA 4NFSA 3WLEA 1Z73A 4E0BA 4FBGA 3LDHA 3V1YA 4ALJA 3ZNQA 1GZ6A 3PJGA 1V35A 1BXZA 3JQ7A 3UXYA 4GMFA 4J4BA 4XEHA 2CUKA 3PHGA 4BKPA 2NACA 5DP2A 4MIOA 4MIYA 5G4KB 1NXQA 3IAHA 4FFNA 3SLGA 3LC7O 1ZKMA 1H2HA 3DBRA 4K9DA 1LI4A 1B0AA 2POQX 3O03A 4FR5A 1O94A 3D1LA 5CHEA 1ARZA 4HNHA 1OI7A 4P4NA 3DOCA 4HY3A 2J3HA 2DTXA 4WJZA 3W8FA 2AQHA 3H65A 3SVTA 1R16A 3L0DA 3TQHA 3ZU5A 1C0PA 4WCDA 1GCUA 1CWUA 1QORA 3GDGA 1EBUA 3VPGA 3CXRA 3GVXA 4N5LA 5KJFA 3NRCA 3PDUA 2J3KA 2WE7A 1BMDA 3ZWBA 4DPLA 5GY7A 3VDQA 4E2YA 3R3SA 3DONA 3ZWVA 3I9LA 4W99A 3RASA 5FI5A 4YJFB 4A03A 4B4WA 3ANMA 3HWRA 3TSCA 5IZCC 2Y67A 4F6CA 1E1NA 3FBGA 4MDHA 1WXDA 5JAZA 1P0FA 3NX4A 2BI8A 3DOOA 2EGGA 5JY1A 4FDAA 1DAOA 5AVOA 3MCVA 3N58A 4DTIA 3RUAA 4XB2A 2AQKA 5EPOA 3FRJA 2HJRA 4LRTB 1LDYA 2RBEA 4RORA 3L4BA 2X9VA 4NNJA 4J7UA 4TMFA 5L4SA 2IEBA 3BIOA 4K28A 1OC4A 3WTBA 1T2FA 3L6OO 3VKUA 1FF9A 3DAFA 2O3TA 3I4FA 4IM7A 4J16A 1B3BA 4L75A 1C0IA 4INAA 3PDJA 4NMHA 4Z0TA 2AXQA 1LDEA 2UUPA 3AUUA 4Z9YA 3S2GA 3ZHYA 4Q3DA 2DFVA 4GPD1 1MX3A 1ZK2A 4MKRA 2Q99A 1PSDA 4CMIA 3GZ4A 2RCYA 2C82A 4M49A 1UP7A 2D0IA 4UAGA 4CM1A 1P1HA 3EDMA 4E5KA 5ITVA 1E5LA 4BNFA 4BV8A 3ULKA 1PZEA 3D5TA 5EQFA 3TFQA 2AHRA 2BFPA 4XGNA 2OXIA 3WS7A 2G0TA 3RBXA 4CMKA 4IQ0A 4CLRB 4DLLA 1MLDA 3AI2A 4L4RA 3AOGA 2PD4A 1XDWA 4YB8A 4I9HA 2Y0CA 1UXHA 5KOIA 1PJQA 4GWGA 4U7WA 1Z82A 2QZ9A 4YJDA 4E3ZA 1NTOA 3FF4A 4DUPA 4JCOA 4JP3A 4PLZA 4YPOA 4XR9A 2D59A 4FIZA 4GBJA 1XSEA 1VL0A 2DTDA 2F00A 3K8ZA 3ZHXA 1M6HA 3GUYA 5CDTA 5JBIA 2OP1A 5T8KC 5T64A 4BKOA 5A05A 4NK5A 4D45A 4DVJA 1UP4A 4BB6A 5EN4A 4BS9A 2CVQA 4KP7A 4BNXA 2QHXA 3QVSA 1EVIA 1X1EA 3WXBA 2PD3A 1OBFO 3DZGA 5C7IO 5ILGA 5JDCA 1R4NA 2Y1FA 3B70A 1F17A 2YY7A 3AY7A 4E5MA 4FC6A 2P2SA 3K30A 4NHEA 4FJ1A 1WZIA 4FQ8A 4D44A 1UP6A 5HTOA 3ZW8A 3ZNNA 1GQ2A 3RU7A 1HLDA 1YBAA 2GLXA 4QX6A 2PGLA 4AJLA 4OMUA 3WQSB 1K6IA 1IZ9A 2XXJA 3H4VA 2IDZA 1JW9B 3CMCO 4LCJA 4EJ0A 2JD2A 3WGOA 2EERA 2Q1WA 1I3NA 2WD8A 4G2NA 3ANLA 1H94A 3QRWA 1YS4A 2QX7A 4CMEA 1JWBB 3D7LA 1HYHA 1EUDA 4QO8A 5EERA 1AN9A 3ZGYA 3DZHA 1SEPA 2W8ZA 1QMGA 2HK9A 2WEKA 2A4KA 3FHLA 1QLJA 4A2CA 3BHIA 4DWVA 3NJ4A 3QW2A 2EP7A 4KQXA 1H5QA 2YYYA 2FP4A 2DC1A 3AU8A 1PJCA 2AE1A 4O0LA 4DIOA 3GZNB 4LISA 3VKVA 3NTQA 4BO2A 2G5CA 1PR9A 1M66A 4R5MA 4FFMA 4OAQA 1E3IA 4EUEA 1NVGA 1KY4A 1P1KA 2PKQO 3GN2A 3H5AA 1KS9A 2PGJA 4J6FA 3JCZA 3VVCA 1K0UA 3RUEA 3DOJA 3M2PA 4NU6A 1E1LA 5I9MA 1ORRA 4KZPA 2I6TA 5ER6A 3LC1O 4XQGA 4B4VA 1NQOA 1LNQA 1XYGA 4L9RA 2B69A 3GN1A 5DBGA 3BHMA 4W9NC 1EMDA 5F21A 1DC3A 3KOUA 5IF3A 2PLAA 3WFJA 2R2GA 3HB4X 3OBBA 4YRBA 4XKJA 4EI2A 4KDFA 1LUAA 2Y0EA 5GZ3A 4IIVA 3L9XA 4R5HA 3UGKA 2PGDA 1EUZA 4BKUA 2Y99A 2VCYA 3PYLA 2I9PA 5COAA 1LSSA 2H6EA 1M67A 5EIOA 4IMRA 5JFOA 3JQ7B 4WNIA 2GYYA 1NP3A 3HDHA 2ZYAA 1SEVA 2X86A 3EHEA 2O7SA 5DCUA 2W2LD 3QVWA 4K6CA 1SB9A 3QJ5A 1EVYA 5HWSA 3JQ9C 1EDOA 1FMCA 2H63A 2P5UA 4OXYA 2ZTLA 3FNGA 2ZQYA 1HE2A 2D5AA 3DBRB 3P2YA 1BW9A 1I24A 5G0UA 3RBVA 4AJ1A 1KVQA 5A02A 1VSUA 1R12A 1ZUD1 3RUDA 1CDOA 4E12A 1L1FA 3LVFO 1VI2A 3Q9NA 3UCFA 1HL3A 1TI7A 3WMXA 4PG8A 3K9QO 2E49A 2NWQA 4YAJA 3GDFA 1ZSVA 3GGOA 1P3DA 2P9EA 1I2ZA 4MO2A 4YT2A 1HETA 2J3JA 5F1PA 3OIDA 3RC1A 5KWEA 3WGIA 4E4YA 5IDYA 3ZNOA 4N5MA 4E32A 3MOIA 1HWYA 3AOEA 2OGUA 5EJ2A 1UZMA 4FCCA 5FF9A 3NT2A 3RKUA 4AJ4A 2J3IA 2BH9A 2UV8A 3D5QA 3I6IA 3WR5A 2EJWA 1YVEI 3BTUA 3JD2A 3GFGA 4JXKA 4LVUA 3OHSX 4A5OA 2OFPA 2DAPA 3LT1A 1P1FA 2EW2A 4B79A 4JBIA 2VUUA 2NNLD 4I5EA 4I5GA 3WGGA 4CPDA 2HMSA 1CEQA 3E48A 3R3JA 4J43A 3WLFA 1Z7EA 3H5NA 1N7GA 3U09A 3AW9A 4PVCA 1LA2A 1PX0A 5CG2A 2W2KA 4PZEA 2X5JO 4YRAA 3OECA 2C7VA 4HFMA 4OXNA 1DLJA 1U1IA 4PN3A 4ZJUA 3P19A 3GVHA 1F0YA 2R6JA 4TRRA 1PS9A 1MV8A 4JK3A 4D46A 4E5NA 5A03A 1J5PA 3RC7A 2JAPA 2EW8A 2PKRA 3DHNA 2NV6A 3KYBA 1E7SA 5JE8A 2X6TA 3EVTA 1YQGA 3JQ6A 4I9NA 4CMIB 4CQMD 4HV4A 1W0CA 1UZLA 1E7RA 1B26A 1S6YA 4OO3A 3JD3A 1KEUA 1ONNA 2B5WA 3QV1A 1O8CA 4UEKA 4DQXA 2B4QA 4PLFA 1JAXA 4J90A 1WLYA 2OBNA 1IUKA 1DEHA 3K92A 1T24A 3O26A 3WGTA 5MGBA 2EGHA 4KUEA 1ENPA 2Y1CA 3ZWAA 1T2DA 5IDWA 3NDJA 1NBOA 1KVRA 4NFYA 4NZ9A 2D1YA 4IBOA 4CUZA 1AHHA 2AEMA 3HDYA 4UVGA 1MA0A 1CYDA 1J6UA 3OJ0A 2JL1A 2Z95A 4LVCA 2YDYA 5L7TA 1X14A 1XELA 7MDHA 1HF3A 2CZCA 1I3MA 5IAAA 1CERA 3CTMA 4GGOA 1XHLA 5U1PA 4OXKA 1UXJA 2WYUA 3RUCA 1QYXA 2OOSA 4DXHA 3TDKA 1YDWA 3KV3O 4JLWA 3U4IA 5JY6A 3EY4A 3NYWA 1EVJA 1PS0A 5JCXA 4EYEA 4IJKA 3UH1A 3WX0A 5IDXA 4NBVA 5KVSA 3KYDA 2FZWA 3E03A 4J4TA 2YZ7A 1BDBA 2C5AA 3FWZA 1Q7CA 1MG5A 2O3UA 1R4NB 4HBGA 5CEEA 5JYDA 2JFGA 4ZHSA 2PK3A 2ZJ0A 4MVJD 4GKBA 4E5YA 4CR7A 5I7EA 1LEHA 4I9UA 4XRRA 1E3LA 5JDIA 5T57A 4DLBA 4U5QA 3F5SA 3VZQA 4PVDA 4Z6KA 5CP8A 2I67A 3F4BA 1YKFA 1PR3A 3C8MA 2X5KO 1E3SA 4TWRA 5T67A 1A72A 4UULA 1KC1A 1ZMTA 3CMMA 3DAGA 3VTZA 3PIIA 3ONDA 1GQYA 1P1IA 4PG4A 1GYRA 3QQPA 3WNQA 1NQ5A 1Z6ZA 2I65A 1GR0A 4M87A 3GF4A 3IC5A 4ZVVA 2ILTA 4II3A 4LMRA 5EMHA 3WMWA 2QG4A 1DXYA 3JTMA 3H9JA 1NFFA 1PS8A 3ROMA 4TSKA 4NG5A 5GMOA 1ZK0A 5G0SA 3GG9A 4NI5A 1NAIA 4FS3A 3Q6IA 1LDBA 5K9ZA 1I3KA 2O2SA 1SAYA 1FDSA 4NPCA 3WG9A 4OIMA 4RJTA 1PL6A 2VUTA 4XD2A 4J49A 5DN9A 1QYVA 4WEQA 4K26A 3UKOA 5I8WA 4Q3EA 1Y8QA 3K2EA 2AG8A 1H6CA 5AXDA 4QQRA 1C0KA 1C1XA 1HYEA 2YV3A 3U9LA 1FDVA 3A06A 3H7AA 2EXXA 3IUSA 1MB4A 4A7PA 4OOEA 1EVZA 1R0KA 4QO7A 4GX0A 4YDRA 2VYVD 1YQDA 4DBVO 4J2OA 3DBHA 1WDKA 4J7CA 4BO5A 3PHIA 3GEGA 2BI7A 4B8WA 4R1NA 1E6UA 1ZEMA 3FBTA 4BO1A 1HXHA 2BFMA 3DZBA 4KTTE 3VPXA 1DAPA 1MG0A 5L7WA 1O5IA 3DBVO 2IZ1A 4UREA 4PLGA 1OOEA 4CMJA 1HTBA 1NNUA 3CE6A 3AI1A 1JKFA 3JQGA 2VOEA 3KTDA 2GN4A 3R0IA 3KB6A 3ROPA 4DRYA 1A4UA 2H1SA 2CY0A 4OJNA 1VJ0A 2NQ8A 1OZAA 3CIFA 4FFPA 5H82A 4D3FA 4XDYA 1BW9B 2IRWA 4BNIA 3KHUA 3RKRA 2FN7A 2VHXA 5JCJA 1ZJZA 1DFHA 4GX2A 4CR8A 3LYLA 3AM3A 1FDWA 5BNFA 3VPHA 4OGWA 4Z9XA 4XIJA 3WGZA 4CODB 3WFIA 3FNHA 1T1SA 5IZCA 2GERA 1GQQA 2AA3A 4GSLA 2CDBA 1HDZA 4R1TA 3PHHA 4ZICA 3BMCA 3GMDA 9LDBA 4XYBA 1AE1A 1HDGO 4CM7A 1DFIA 2X4GA 4PZDA 2CDCA 3D4NA 3V8BA 3F1KA 4FJ2A 3ZU2A 3H9UA 1GTMA 2JKVA 2GZ3A 2P9GA 5JYEA 4AFNA 1Y9AA 3LZ6A 4GLOA 5TC4A 4ALIA 3JQBC 3DZIA 2QYTA 4YAIA 1U4OA 4JJGA 5CPBA 1P33A 2ZTMA 1GYPA 3RAJA 2Q2VA 2BLLA 4L8VA 1BXGA 1F06A 1ONOA 3JQFC 5A4DA 3GGGA 4OQZA 1U5AA 1P77A 5EL0A 3MTJA 5DDIP 1NQAO 3QVXA 3E5MA 5L4LA 2A94A 3I83A 1A27A 4J1TA 3TZ6A 2W2KB 3C85A 4BO6A 2X23A 4M54A 2PWZA 2FPGA 3FTNA 4GVXA 2BF7A 3QWFA 4WCFC 4BGVA 5T6BA 1MFZA 3UOGA 3OJOA 3TOXA 8ADHA 5EQDA 1SMKA 2DPGA 1K2WA 4P4GA 1T1RA 2Y93A 2UDPA 3NT5A 1QYWA 1Q0LA 3RBZA 4E30A 4QUKA 5IG2A 1GY8A 1OC2A 1RM4A 4YAEA 2WD7A 5FYDA 5BSGA 1WPQA 4DLAA 3B1JA 1UDCA 3JQAA 4BUCA 1IB6A 2VZ0A 1E0DA 1GEGA 3BMNA 4PLHA 3WBBA 4E2ZA 1DHTA 2Q2QA 3CH6A 4I1IA 5JMPA 5DOVA 2W4QA 4MKXA 1ZW1A 4LSMA 2WTBA 3WYBA 3I3OA 1H2BA 1U8XX 1NX6A 1GEEA 3ASUA 5JAMA 1M76A 2QRKA 1VPDA 3ROKA 4ZQEA 3ZCXA 3KLPX 1Q2XA 1AXGA 4O1MA 5T8KA 2BRUA 5ADHA 3GVCA 3PK0A 2DKNA 3IL2A 4FPXA 4OH1A 1V0JA 2DUWA 1XR3A 3T7CA 1YRLA 2X0RA 1DRVA 1GV1A 4R3NA 2C2XA 4XYMA 3T7EA 4GX1A 1I33A 3BHJA 2NU8A 3GDOA 3PTZA 5AXBA 1GU7A 3ASVA 4Y6RA 3KYDB 1OFGA 1TLTA 4AJOA 1MXHA 4HP8A 4OL9A 2DQ4A 3TFOA 2GR9A 4PIVA 1LSOA 2JCYA 4BNTA 1Y7TA 3FPCA 3OSUA 1BHSA 4ND2A 4YJGA 3AY3A 2VTEA 1A9ZA 3AUTA 4R3WA 2Z1NA 4QFCA 1E77A 4OSOA 3WSWA 1IL0A 1KVUA 4RO0A 5JAQA 5K6AC 4H3VA 4BNJA 1WVGA 2X58A 4ESOA 2B5VA 3AM5A 3B20A 1YB5A 1U3TA 4B7CA 3S8MA 1J0XO 4IMPA 1MGOA 3B1FA 5CEJA 2QZZA 5A9TA 1MUUA 3ONEA 4AL4A 5ER9A 4JQCA 4TRMA 3AM4A 3ZHZA 2AE2A 1NVMB 3O4RA 1JU9A 4B3IA 2J5KA 3EUWA 5C7OO 4WOJA 1GADO 3GVPA 4Y6SA 1NHGA 2PTGA 3E9NA 2RHRA 4P38A 5DULA 1GYQA 1RM3A 4D3DA 3BTOA 1PU2A 3AWDA 4PLPA 3AFNA 1XKQA 4O63O 4B3JA 3OJLA 4RZHA 3QP9A 1P1JA 3RUHA 1RYDA 1UZNA 1LRJA 3WNVA 5H83A 3ZWOA 5FEUA 2B36A 3HE3A 3OM9A 1A9YA 3ANNA 1RPNA 4WLUA 4IS2A 4JX8A 1PJBA 2CFCA 2Y1OA 3PJDA 3GVIA 5HRUA 4W9NA 1EZ4A 1ISFA 4HFRA 2DBRA 4PFJA 3G0OA 2HCTA 3C1OA 3EW7A 1Y8QB 2HUNA 4JNKA 5I7FA 1C1XB 4IGEA 2VWQA 2C5EA 3H8VA 2VWPA 4J7XA 1Z74A 5KVVA 2E82A 5IJZA 3DZFA 4ND1A 3EVNA 3D4OA 4BGIA 1E7YA 3C3XA 4KQWA 4PRLA 4MOWA 3CUKA 4PRKA 4Z0HO 4BNNA 3IJRA 1E7QA 5AOVA 5CDSA 3DBHB 4IUYA 2HLPA 1VM6A 1KOLA 2CF6A 1VJTA 3JQ9A 4W6ZA 3DQPA 4J3FA 5KTKA 2P4HX 5HS4A 5U9CA 1A71A 3U4HA 4W7HA 3NDRA 1I30A 1VRWA 2BHLA 3OQ6A 3STHA 2IE0A 1K3TA 3EZLA 5HA5A 2W98A 4DGSA 3JQGB 5BSHA 4O5OA 4D0RA 3VH4A 4UEOA 3WGYA 2PKQP 3T4XA 4J91A 2UYYA 1P1RA 3PWSA 3ROQA 3A14A 1B8PA 1X7HA 1IPFA 1OMOA 3I6QA 1YE3A 1U8FO 2AEFA 2G82A 5T5QA 2X9GA 3RQSA 1YO6A 3GUCA 4CMCA 1I2BA 2C54A 3EAGA 4ZQGA 3N7UA 4YCAA 3E82A 4GX5A 5TIIA 1Y8RA 1Z75A 3G17A 4PG6A 2P5YA 3NAQA 4JBHA 5F5LA 4HX5A 4FFLA 2GUGA 3F5QA 5CAEA 3ADOA 3PYXA 4Y67A 2J5QA 2FR1A 5I9NA 2WM3A 4JGBA 5I9LA 1Q0QA 1PGPA 2GN9A 1R4MA 5K0ZA 3BMCB 1N9GA 1C0LA 4ZQBA 4YAKA 2Y1EA 2ZATA 5BSFA 4LCEA 4A73A 1GPJA 2IYPA 4M1QA 2V6GA 1E3JA 1AUPA 2JJYA 2GN8A 4BQPA 4WKGA 3JQ8A 5L95A 3KBOA 5ENVA 4MINA 3MEQA 4RQTA 1DIHA 1KY5A 2RIRA 4CUKA 5CDYA 1TEHA 4XCVA 3H9GA 3TRIA 3NUGA 4WK6A 1WMAA 4B4UA 4CQLA 2ZB3A 4QFDA 3KYCA 1HYGA 1SNYA 4UUMA 2EKPA 1XQ6A 4B3HA 3QWIA 3QIVA 1VSVA 3ONFA 4GQAA 4FFRA 2WDZA 5ILOA 2GZ1A 3T4EA 1BXGB 1JQBA 1GAEO 3EMKA 5ICMA 1G0OA 4KUHA 2EWMA 1LQUA 3IP3A 3IQDB 2PNFA 1B16A 4YT5A 2YFHA 3VDRA 3W6ZA 1QYCA 2GNAA 4BVAA 1UDAA 4XA8A 4D0SA 5JC8A 1YWGO 2DM6A 1IZ0A 1N5DA 3PWKA 4E13A 5B12A 2CD9A 1NR1A 3ZI0A 3DZJA 1GL3A 3M6IA 3GR6A 4B7XA 1IULA 3KM0A 1ZXBA 1B15A 2XAAA 3WQQA 4GAEA 2QYSA 1XQ1A 2WD7B 5TF4A 1YBVA 2VTDA 5THKA 5IDQA 2PZLA 3JQAB 3HN2A 3PJFA 1UAGA 1JWAB 3FTPA 3PQFA 3BMNB 1QV6A 4CV1A 1DHRA 2QRLA 3HNPA 3ZW9A 1X15A 4YT8A 5THQA 2Q3EA 2Y1DA 3E6AA 4RVUA 4D79A 2ZTUA 1HZZA 4Q3CA 4D7AA 5KJ6A 3ETGA 3GK3A 3GNTA 1ZK4A 4NR0A 4RLSA 4CM9D 1KEWA 1HEUA 4IQGA 5BNTA 2GRAA 2I99A 3JD4A 3JD1A 4PLWA 3GRPA 4R1UA 3U62A 4DC1A 1PQWA 1QYDA 3G1UA 1LSUA 5KVCA 1LTHR 3IS3A 1M75A 2FPPA 4PCVA 4OQYA 2NM0A 4N5NA 1J49A 3S2EA 3LK7A 2XOXA 4WASA 1V3TA 3PHJA 4YEDA 2I66A 1WW8A 5JNLA 1UUFA 2DTEA 2Y68A 1Q0HA 3FR7A 4EUFA 4Q3NA 1V8BA 4AJ2A 3L9WA 2NSDA 3DFUA 2HMWA 3NTOA 1DIRA 1DOHA 4ALMA 2D3TA 2Z1MA 1ZZEA 4YRDA 4YJGB 1N1EA 1UXIA 4YBZA 1XU9A 4DC0A 1ISHA 2YV1A 4PGFA 4PZCA 3D3WA 5TT1A 4RF2A 3PFFA 5TSDA 5KJEA 3W6UA 3HDQA 4XJSA 2V65A 4U8GA 4J1NA 1ZEJA 4LK3A 2XPCA 4CL3A 3GMSA 2C29D 3H3FA 4BGEA 4RZIA 4BGUA 3U4DA 5DCWA 3RFVA 3F4LA 2HU2A 1BWSA 2G1UA 1ZO8A 2R00C 3I9KA 4YACA 1YL5A 3F47A 5HS6A 5C5IA 3DTYA 3UUWA 4CM6A 3BXXA 1XCBA 3LF2A 1NHWA 4R1SA 3RROA
chains in the Genus database with same CATH superfamily
1NQUA 2WJ6A 3EBPA 3LOPA 3N8KA 1MNAA 1Z25A 2IOQA 2WABA 4Q9NA 4Y0NA 3ZZ0A 1RQNA 3D4PA 1K92A 1SU4A 3BEOA 4S12A 4CYMA 1G16A 2EYUA 2XB4A 3DG9A 4P5PA 2WSBA 2CL0X 1EG7A 3ZHBA 3ZD6A 3LQ2A 4HFNA 5JW6A 2CGEA 3PGKA 2MYPA 1P7VA 2C2ZA 4E15A 3T7IA 4JUDX 1RWKA 2GO1A 2UZ1B 3B51X 3EXFB 4FFBA 1M2VB 4AG5A 4CLXA 2FFHA 3KOMA 5CDHA 3OQHA 3H7IA 4EB6A 1Y1PA 2PLNA 1V25A 2IC5A 4GO1A 4P93A 3D7NA 3UFXA 4EYQA 1QG0A 1CEEA 1RBMA 2L69A 4NTZA 2ZJ1A 1QCYA 3FHJA 2JHAA 2QL6A 1Z7WA 1JL3A 1YRYE 2ZRIA 4N5DA 1U98A 4OGKA 5KTTA 1XROA 3V2UA 3QPDA 1FLAA 3UVEA 3F1LA 3GJRA 4BRUA 4LN1A 4XJTA 4C0JA 4L6AA 3Q10A 3HUDA 4EGJA 2OZLA 3QSYA 5K8JB 1XTVA 3QXXA 3S28A 2C04A 1SXIA 2VDOB 3QVKA 4R8KA 3MOSA 1JQLB 3I9JA 3Q8WA 1KOJA 4DDHA 1T8RA 5CBKA 1CEYA 2ZWOA 1QV7A 3QM1A 2AG6A 5FBQB 1QB8A 3ELBA 4K9RA 3OQOA 1FQJA 1G20E 2XQVA 2G07A 2QX6A 4CKBB 5F2NA 5B2ZA 3MCZA 4MQEA 1IQUA 3BK7A 4QBFA 1LRLA 2GTPA 2SECE 3VOTA 4RQUA 2WTNA 2QKYA 3EH1A 4LXHA 1L7QA 4H3KB 4QRDA 3S1AB 1DE0A 3KQYA 1XC7A 4D41A 4LE1A 3I6YA 4JHLA 4PHCA 2BR5A 1UBMS 3W8NA 3JV7A 1V9LA 4LHSA 1A4XA 2WD9A 3AT1A 4N7MA 4HDAA 1GD1O 3JAWA 5D51S 3DPIA 5FR1A 3LXRA 1M72A 5JXJA 5KAMA 1I7DA 5L3ZA 4EMTA 2RAVA 4F2GA 2UKDA 3AJRA 3P45A 1I7NA 2IP2A 2XEDA 5BY2A 4D81A 4JEHA 1IUPA 2VHWA 5C3MA 4BAZA 1CJKC 4UBIA 3MQ4A 1TFUA 5DT2A 10MHA 1M2WA 3A9VA 4DSZA 3MPUA 5LUAA 1H85A 3IBYA 4UC0A 4UPEA 1PUIA 2EFCB 4ZZ2A 1QP4A 1T0IA 1LBQA 2QRJA 2C8LA 1NW6A 2Q5OA 1GDDA 1RTKA 4ZVQA 3RJZA 6ADHA 1YTLA 2HQOA 5HRCA 2Z57A 2VNKA 4OB7A 1KK3A 3QH4A 3SZ3A 3M3PA 3DLIA 4REQB 3G89A 3KZVA 4C2UA 1N0UA 3OY7A 4IUDS 1ILEA 2AQ8A 1JR2A 3IOCA 1FTGA 4Q6BA 4RD0A 5E95A 1JTVA 4DDWA 5ICCA 5KTRA 1CY6A 1JFRA 1WPRA 3CEAA 3DUFB 4UAVA 5K1ZA 5IVKA 1N2GA 4CQMA 4R2IA 3VI4B 4Z3KA 3CR7A 2OLEA 3SYKA 5IANA 2CYAA 2GLTA 3CZQA 5GVRA 4AQYB 1U63A 1P45A 1UWLA 2YMMA 3BILA 1BVUA 2OL4A 1ZBDA 3IP7A 1CR0A 3NUQA 3QE3A 3R1IA 4FGSA 3B9PA 4EJ6A 1ZN2A 2UUBB 2XSZA 2ZETA 4OBXA 1SUIA 4C7MA 1VYVA 3ZG6A 4DYDA 4Y6LA 4D92A 1GZ7A 3FGOA 4HTFB 2V6IA 3QE0A 2ZM5A 3NHFA 2PV7A 4B3MB 4Y2YA 5DTEA 2V6MA 4EPWA 1FYVA 3NJ8A 2WV9A 5EUQB 5BYKA 4R2HA 3H5RA 1G4HA 2ZIZA 3PQ2A 1Z15A 2XZTA 1W34A 4OJKA 1VLZA 4QUJA 4D8UA 1FS6A 3BE6A 4HS4A 3WLOA 5KAPA 2BBWA 2B99A 3AIMA 3SIPA 5SZKB 3WLLA 2YWCA 4XOIA 1V6CA 5EIBC 1XHEA 5HQ3B 2WIJA 4QXQA 3RFTA 5JFGA 1C3JA 5BW5A 3BF8A 4MVWA 1HMPA 2G6TA 1U9ZA 4M7WA 5EWLA 4E09A 3EXHB 2IU3A 1ISJA 3H4TA 1TZMA 3CRW1 1DKRA 2IPAB 1NVVQ 3B6IA 5FPPA 1S3SA 3QTBA 1Y6RA 2GAFA 2QENA 1PWXA 1I2DA 3GFVA 5M3BA 3M1YA 5FORA 4BBJA 4N03A 3T12A 1UBHS 2CZQA 2O4CA 5TX7A 4CKWA 4O4JB 5KQLA 1XD9A 3GT0A 4QDKA 1A7AA 5JD4A 4GLLA 1YFKA 1NC3A 4LG1A 1SZCA 3UWSA 2IOFK 1PEKE 5IYZB 16PKA 4YAGA 2ZYSA 4QGAA 5L8VA 2FF7A 5CNMA 4WPGA 5BXQC 4WLNA 3IIEA 4P2BA 3TEFA 3HVIA 2FWAA 4NV0A 4M2LA 1R9GA 2BELA 2V7QA 2G6BA 1WU7A 4B6QA 3SHWA 4UUBA 2P8SA 1U3VA 1GPDG 3LRTA 4X90A 5FA6A 2GILA 4GL4A 4N1AA 1RJFA 3GPIA 1CUZA 3JSAA 1Z2AA 1UIRA 5D3KA 1JDJA 1O0SA 2HIGA 1BTOA 2X6RA 3BX1A 4Y2VA 1TOAA 1B1CA 1Q14A 3MHTA 4DMHA 3ZJTA 1USVA 2VP6A 1FFDA 4QYXA 5C37A 2V6FA 3DNMA 1A04A 3VH2A 3E9DA 3P0HA 3WYDA 4BJ3A 3TZCA 2H07A 3PGJA 4LNUA 5JO9A 3VXKA 5JCPA 2ZYHA 3RH0A 5I7SA 2JFYA 2VQSA 4YS6A 3L8GA 4MGKR 4OL0A 4X24A 1KDTA 1UMKA 1P7ZA 1NUQA 4OXQA 3DCYA 2I4TA 1QS0B 2H18A 1MRNA 1WSWA 4MZXA 5C31A 1U11A 5C0OE 5TLSA 2EEPA 4LZJA 4RMNA 1MA3A 3EXG1 1LPMA 3C7AA 5CH3A 3C98A 5EZSA 1ZISA 4ALNA 4ZJPA 3NOQA 3LLVA 1W1WA 1XJ5A 3ENQA 2AMFA 4L76A 2HYDA 5CDFA 5TJ9A 3TD9A 4GKKB 3THXB 1W8DA 1QAQA 1SJ9A 3MGCA 3BSSA 6NULA 4J07A 1LB1B 1E6LA 3TNDA 4HUTA 5COQA 3TSOA 4AVYA 4QOSA 5C8YB 5KJ1A 5HHTA 4BNGA 4EMBA 3DGEC 5GJVC 4F84A 1D9XA 3CPEA 2IXAA 3BRSA 3D3WB 3NUZA 5IM4A 3H83A 4G5OA 4MUGA 1E1CB 1G4AE 4H7JA 4J1SA 4RXUA 2NVOA 5I7VA 5JS6A 2QW8A 3QNMA 4Q3LA 2UUOA 3ICCA 4Y7CA 5EWLB 5BWOA 2J67A 1Q0ZA 1USWA 1Z7BA 4K6GA 5KSYA 4XSGA 2BFFB 2VJDA 2IH2A 3VKHA 1ECFA 4ZEXA 1FTQA 3KD2A 3NVKI 5CLIA 4ZMRA 4CU5A 1VPWA 4FZ5A 2C0CA 1P2GA 2NVBA 4D9CA 1PZNA 5LP6C 1AKTA 3MMPA 3ZJVA 2Q5JA 1NXPA 1ZYUA 3BCUA 3GYBA 1FFGA 3D2LA 4Q00A 3RIMA 5EMJA 3WRXC 4GWKA 2Z2JA 1Z83A 4WERA 3SJCA 1JMVA 2P9TA 2ZWAA 3JATA 3LRPA 3UYLA 4BNYA 4CKCB 1E7WA 4L73A 3PEFA 2NU6B 1O94D 2V7XA 4DLKA 3I2HA 5EAIA 2AGVA 1SRRA 1R8XA 2EQBA 2OCAA 4E2WA 4LF7B 3E8SA 5TNXA 3OQBA 3HKEB 4Y2UA 3MPOA 3RFUA 2MWMA 2CLDX 3QE4A 2IP4A 2EVWX 3A8TA 2H7VA 5KKCA 2O2ZA 4FR2A 3ZXUB 2E1PA 2P2LA 3WDMA 2VDKB 3EQ2A 1G5QA 1WXGA 4TLCA 4BWVA 4TMKA 1SIUA 4RTJA 4EG0A 1HSOA 4B80A 1EP3B 5JI2E 4BLVA 4B4KA 2C59A 3L4SO 5JXHA 3U61B 1JFFB 4P8RA 2HD4A 1AUVA 1FP6A 3VR2A 2FOIA 2K6GA 4GECA 2QLTA 2PR2A 3AYZB 3PX3A 1CHNA 1ZJ6A 2SKEA 4N4AA 4X8HA 3RDPA 2C98A 1QDLB 3EK2A 2WKRA 4KK3A 1LX6A 4KLRA 2P8JA 4K7JA 4RK0A 1P44A 1PTJA 2DFPA 3VPSA 2D5CA 1J2UA 2DUNA 3TPCA 3E9QA 3KCQA 3MWGA 1EXWA 4JP2A 4OJQA 4DIDA 1TUIA 3QF7A 4FW9A 2J32A 2PY6A 1E2JA 2R1ZA 3H4IA 1BMTA 1C7IA 2IZ6A 1N78A 4IDFA 3KJZA 4AMZA 1CP3A 4ARSA 1B6GA 3MJVA 2JEOA 4RVGA 4E94A 3KXLA 1V7ZA 4H1UA 3A3NA 3I9V6 4F6LA 2QN8A 5JSFA 4OKSA 2AJCA 2ORVA 5EXTA 5J58A 3BMQB 2BFDA 3VJKA 2KWIA 2VSFA 1KSGA 4LX0A 4HZGA 3AR4A 3CBQA 2Z9BA 1JBQA 3B82A 4P81A 1WMBA 5HVNA 3HGMA 3OC6A 2GFIA 2V96A 1B23P 1XGKA 3HKDA 3S5JA 3D8NA 1ISGA 2VP0A 1YIDA 2X8AA 3U4MA 4LSZA 4HVTA 4QDUA 2JAHA 1IXKA 4IQ8A 1U04A 2AN1A 2B8TA 5K09A 2RHDA 4IJMA 3HRKA 3JVEA 1TTHA 2G17A 3ZZNA 3KQPA 3T9CA 3WLPA 1PLKA 1OXUA 1DKOA 2D1SA 2QY9A 4ZV9A 1ZI6A 4QREA 3E5RA 1PD0A 1C0EA 2CZGA 2HDNB 3BH0A 3PLNA 2V54A 4LHVA 3VI3B 1Q7GA 4LDRA 1G20B 2GDZA 4RLFA 1IH8A 3VVBA 4ASUD 1L7XA 2X8JA 4U5XA 5EMNA 3C41J 1JAYA 3D1JA 2JJQA 2EW1A 2NQTA 2FMHA 4E5SA 4UBJA 3FB1A 3SQOA 1CY1A 2ZXUA 4I1YA 3KSDO 4D96A 2XDQB 2BKLA 3AVQA 4LGMA 4G5GA 1RACA 1J4AA 1JFLA 3KB2A 3MIIA 3PUJA 1XTQA 1C4KA 2AQIA 3SSNA 4DJAA 2WU0A 3T52A 4RVCA 4TXHA 3HYTA 2IYVA 2V7TA 4I81A 4H6WA 3REFA 1FVHA 3WGNA 4U2DA 4HSEA 1B73A 3HHPA 3OBIA 1ZIYA 2C2OA 4NPAA 4MLCA 4D98A 4EB0A 6REQA 1FP4A 3UAOA 3TIIA 1UK7A 1W6UA 2W22A 5ALTA 4FWTA 1DUVG 4WV3A 5BR1A 2IS1A 3PDWA 3QMWA 1Q1AA 3WB1A 1E2FA 1G42A 2C94A 3A26A 2YHIB 1TM1E 2AYYA 2WJWA 5H02A 4DG5A 4IGFA 1H1TA 1HFKA 1VL5A 4PC7A 4FLFA 1SVNA 3DWEX 1GJRA 3IX7A 1CUEA 1KZ7B 3GJ8A 4TWAA 5BQPA 1RQLA 5JJBA 3ZUGA 1O77A 1XP5A 2YZMA 1VYUA 2ZE6A 3P4UA 4YWJA 4R1OA 3JQRA 3SX4A 3UCXA 1DFGA 4N0MA 4EUHA 3U56A 3DAHA 4DNOA 1EU1A 1MO6A 4KTVE 5ERXA 3QXSA 5EZYA 3RHFA 5EUMA 1XK7A 2EOAA 1P91A 2IYEA 1IM8A 1YS1X 1QH9A 3F3SA 3GNSA 1XUOA 2VZ9A 4D43A 4LGVA 4LTDA 2FQWA 2VKQA 4WMLA 4ZT5A 1R6BX 3PS9A 1Z56C 2ODPA 3DNFA 4QGSA 3KQUA 2RBGA 2R9VA 3MM4A 1JVSA 1I1NA 3B6ZA 3WMEA 4X63A 4EPVA 4FKBA 4QPCA 4EW6A 1DTEA 3N74A 2OD9A 3GC6A 1DTWB 2O7QA 2E55A 1T2CA 1QQ6A 1GUZA 2PU7A 3DP7A 4JJ7A 3T95A 3ZS9A 4DAOA 1BDHA 1J06A 3UAXA 2NU9A 2O6LA 5CLQA 1ZD8A 5J2TF 1GGEA 3NVDA 2HRRA 2ACEA 4AKTA 1MOQA 4IPTA 1UAYA 1O4WA 3JRNA 1X13A 1EUCA 1L6IA 3BCRA 2WF5A 2OO5C 1QYRA 1OFIA 2WRZA 4C0QC 3HEMA 4PE5B 1EXDA 5JS7A 1ZWLA 2H1IA 4Q7EA 4RD6A 4DY4A 1JXQA 2C97A 3N07A 2LCIA 5AKEA 1BXKA 1U28A 3OX3A 1PJSA 3FMIA 2LDBA 3P2KA 1TCVA 3QLEA 3AK4A 4UNPA 3S2ZA 4X61A 1NXTA 1SHJA 2B94A 2KYRA 2TMKA 2VUSA 3FDJA 5F7JA 3T3MB 3V9PA 3ZWCA 3OO1A 3KKEA 1J20A 3BFVA 4DNPA 1HZJA 2KQUA 4MLPA 3I23A 2I3GA 1E1KA 4IG9A 5IHPA 1BX0A 1GPBA 1KJZA 1T29A 4CKBA 5IUKC 1NRJB 1P4HA 2F4NA 3HACA 4NF2A 5IWCA 3HZZA 3PD0A 3ZJ5A 2CKDA 5I7UA 1IVSA 4YMVA 2P5SA 3K94A 4FNOA 1VRVA 1UXOA 4L5BA 1D4AA 4L4SA 5EWMB 4G37A 5LR6A 1YZQA 4FB5A 1IBLB 1KYWA 3CUEF 3NH9A 3CT4A 3WRYC 2VXOA 3HB5X 1XZJA 2JK1A 2FWBA 4RNCA 2Q1YA 2Q6TA 3LPAA 2FRVA 2GO7A 5HZMA 3USES 2VT2A 1WDMA 2X0IA 5FHRA 4R01A 5AW8A 4FZVA 4KPFC 3Q4GA 1L6RA 1Q50A 5HBRA 4BNMA 2AJLI 3DTTA 2XUAA 4BO3A 2EIHA 5IBQA 4R7TA 1CZUA 1OKKD 3CLTD 2NSJA 3V4PB 1FDOA 3V1MA 3VTAA 2JVKA 4MHOA 4XFKA 1DO8A 3H86A 3HFSA 2HKIA 3I9MA 1BEUB 2P3OA 3HXLA 3OE4A 1PGOA 2H5LA 3QA9A 1LQTA 3EZGA 1I4TD 4TKLA 2VPPA 3T7KA 2IKQA 3ENNA 1BS2A 4TMWA 1BVYF 3F5DA 5DYGA 3HB9A 2C2BA 3EE6A 3OZAA 1PN3A 3IBSA 4QGHA 2E5FA 1KKMA 1CRQA 2QR5A 2WICA 4F04A 4AS1A 3AY6A 1QIDA 3V7UA 2Q4OA 1ZFNA 1LLUA 1QSGA 2UZ0A 2WQZA 4PX5A 4AB1A 5C51B 2JAXA 3MYRA 3LT2A 1O6ZA 1RZRD 1O94C 3HBNA 2JFUA 2PMBA 4LQDA 1IBRA 3OQ1A 4FYXA 4WBSA 1UPUA 5JHGB 1J2EA 4KXYA 1QRUA 4ENQA 3EVZA 1EBFA 4KXNA 4MVJG 1GN9A 2DT5A 4QQNA 1MIOA 4W4TA 2FW6A 1PJTA 1EJ0A 1GL7A 5BSTA 4C6RA 1IOLA 4RF5A 4WQMA 4LYJA 5EA2A 1R74A 4HPJB 3VO1A 2PX8A 2R8XA 4CIYA 3SVZA 3VV3A 3JR7A 4PNZA 3MF4A 1XEFA 3RARA 3WVNA 1NP7A 4YMSA 4H60A 5EIFA 3K9WA 1BQ4A 3LV8A 2HOQA 4R4JA 1K98A 5DGCA 4BLPA 2Q4BA 4C76A 2IU4A 1UJ4A 3IV7A 4PYRA 3RNOA 5E3JA 5CVVA 1MAHA 2RG7A 4NJOA 3RS4A 3E1KA 2A5FA 4QXAA 2NXCA 5F7OA 1DT5A 1VIYA 2WOJA 4EW3A 1P4SA 2HA2A 3EZYA 2BIFA 1PZFA 1QIMA 4ZPXA 4F86A 1VFPA 4JX9A 1DIGA 3QVVA 5ARDA 4DQ0A 1QR6A 4MGIR 3PPIA 2DWUA 5EXXA 3INRA 3K0FA 4O6VA 2AR9A 1SKMA 1VSTA 1SD5A 3FPHA 2X1MA 4C87A 4OIFA 4GYYA 4MCHA 1IJBA 2H4WA 2ZXFA 1L8XA 4MYSA 4CF5A 2RAUA 4O25A 3W4JA 5B4TA 4G0PA 2UVDA 5AJVB 1Y1QA 4O4JA 2YJZA 3CFYA 4PICA 3GRKA 4QPJC 1ONPA 3PUXA 4H31A 3GFBA 3W4IA 3KVYA 2WU8A 2XE7A 4ZZ0A 4NJMB 3DL0A 5TPWA 4HJXA 3F7MA 4MI9A 4XVHA 1QO0A 2VHYA 2QM3A 2VJCA 1E2DA 3JAKB 4K9LA 5F77A 2D4HA 5KX5F 2Y1LA 3OQIA 2GD6A 4GZMA 2GNPA 3VNAA 4D0LB 5AUQA 2YWDA 3GQVA 1FJHA 1VA4A 4XD7D 4OQFA 2MR5A 3OLWA 4C89A 1PG0A 1ZMRA 3OA0A 3NWPA 5CVJA 5DK4A 1PO7A 3FMGA 2XWQA 3CH7A 4FQ5A 2A1TR 2FWPA 3MVEA 3R0VA 5C34B 1T6XA 4R1QA 4HF7A 4LXQA 3FYUC 1N8NA 4PLTA 4BZWA 5CCXA 1WA5A 3ZK9A 3WAJA 2HZ7A 2PXHA 2PZJA 1IE3A 3B6EA 4MTLA 2MSEB 3LDGA 1BX1A 1RJDA 4QOFA 5DNAA 3V46A 4EFLA 5FOTA 3F73A 4ZHQA 4IRXA 4JKIA 4GRAA 4RXTA 4BV9A 3QTLA 4EB8A 2FWMX 2HAEA 3FUUA 4DBLE 1I80A 1TK9A 1ZH4A 3Q7QA 2FG5A 1CHDA 4OYLA 4CCWA 2QK4A 4ZO8A 3K32A 2QD3A 4ND3A 1AO3A 2ZSUA 5HR5A 5CH8A 2NTEA 2V6BA 4F21A 5JYBA 1U2GA 2HMUA 3ADDA 3OEWA 3TLMA 1TLLA 4PZAA 3ML1A 4KHPB 1DQRA 1ZU4A 3DAPA 4KK4A 1JDPA 1PR4A 1QH0A 4ARIA 5CFZA 3X1ZA 4G81A 1WCIB 3FMVA 4X6XA 1NZFA 1YSCA 3VC7A 1YASA 2XB9A 2FFJA 2NSHA 4UZFA 4EPXA 3OZBA 4DJTA 2IYOA 1TECE 4I5DA 1IN8A 2EV9A 3I5AA 1EB9A 3C1AA 4KW7A 3FIJA 3IT1A 2ZZKA 5L3VA 1RWQA 1LNSA 1SULA 1TLFA 2FAXA 3CGGA 3PDIB 4RU1A 4ZP1A 5FAKA 2Z6QA 1KR5A 4DM7A 4FQ7A 3AW8A 3KT0A 1CUDA 5CDGA 1Z0JA 1EX9A 1JJAA 4OHPA 3ZH2A 1WJGA 1V5EA 5FQNA 1YGYA 1DEOA 1E2HA 4BBPA 4Z3OA 2V4UA 2QPAA 3KPUA 1N7HA 1KSJA 2KSQA 2BOVA 2C4HA 3M1AA 2ZEJA 3Q7RA 3FI9A 5CTJA 4ZXPA 1TJ5A 2M6RA 1O57A 3FB4A 4MQ6A 1BO6A 3S2FA 3ZWXA 3C2QA 4F5WA 4FXOA 2GRJA 5I4BA 4QTTB 5FUVA 2H92A 3SMVA 2NU6A 5BSWA 3FUWA 5ARCA 4F8YA 2XD9A 3KZCA 3B6MA 2L42A 3FUVA 4K1LA 4JVOA 4O08A 2FG6C 2IZ0A 1RQRA 2GK6A 5GZ1A 2P4EA 1Y3DE 5KYVA 1YQUA 2P2YA 4BNHA 2ZZMA 3KZMA 3MCTA 4JOSA 1L4MA 2EP8A 3NHLA 2OWEA 3AUSA 1XLVA 3GLFA 1IXSB 4IXWA 3JQDA 5DYIA 3TB4A 4J0JA 3WIOA 4TX1A 1RC8A 2CNKA 1XJ0A 4AY2A 1GZ5A 1WLSA 5K0SA 2OGTA 4CMEC 3U5TA 3M89A 5CJ2A 4RHXA 3VM6A 3FTDA 1G8YA 3Q5EA 4IAOA 4TVBA 2BD0A 1BD3A 1LH0A 1WWKA 4YRGA 2QTGA 2FFQA 2QN2A 2O3RA 3IAAA 3P2OA 2Q7DA 1W7AA 4QM6A 1DO0A 1YA6A 3P9SA 2I54A 3T4UA 3H2YA 2C7BA 3W2GA 4M8NE 5KUTA 1V41E 4WLFA 4BQSA 5JNVA 1MJNA 2OCLA 4RK5A 4YJHA 3VZCA 4CDRA 4BNDA 5KKNB 3M6UA 3BMOB 1P6UA 4A0SA 1N8SA 1G8AA 1AGYA 1SVSA 2ZIXA 1N3BA 3MIZA 3O2QB 3GFRA 1SH7A 1LJUA 4TROA 4WY5A 1GL6A 4EA6A 3FWYA 4OAOA 1UKAA 1X9HA 2VO1A 4F4DA 4B3GA 1IONA 2JASA 1UFKA 1UOEA 4LQ4A 4A10A 4BLSA 1IOVA 1RKVA 2DBVO 1Y7HA 5A9SB 3ZV4A 1N2CE 2PA0A 3A7EA 4TKUB 3K2BA 4WFQA 3CLTC 5C1IA 1DZ3A 4F4UA 2Q41A 5CA1A 4N12A 3IIIA 3LIPA 1OSNA 4U0JA 2CW5A 3DEYX 1SVOA 1NONA 3Q2KA 4I50F 1U4NA 5D6NA 1RPTA 3V1UA 4A5SA 3I32A 4DMRA 4R68A 5FAXA 4Q1VA 1M5UA 3GJXC 3BFKA 2EQ5A 1KQPA 1F8GA 1OAAA 1ST3A 2BFAA 2C1ZA 3R41A 1PFQA 4HDCA 5JMTA 4AQ7A 2OM2A 4NENB 1LI7A 4RNDB 1F1JA 1MQAA 1LI5A 1NM5A 1JJIA 2B8NA 4G5HA 3U3XA 4E22A 3DBLB 3FOZA 4F7WA 2GHIA 2OLKA 1NRWA 5NULA 4G5YA 1ZJ4A 1FNNA 2CFOA 1XTJA 4TV9F 2WFAA 3WKEA 3EODA 3T35A 1AQYA 5JJLA 1KI2A 3W5CA 5G4KA 2OAQ1 3MGGA 4ZMBA 3CLRD 5TJHA 1R8QA 1ZD2P 5FUYA 4ECEA 3N7AA 3PIRA 1KAHA 1K0FA 1WNFA 1ZH8A 2C5BA 2DWOA 3GJSA 5JG7A 1AQLA 4LXTA 1DWOA 1F14A 3ADCA 3EQZA 2SKCA 4B44A 3OKAA 4R71A 5ILQA 1YU9A 4WLOA 5HCNA 2D2FA 4H27A 4LNHA 4QTUB 5B7PA 3T3EA 5L9AA 1HM5A 3COZA 3VOSA 1IHXA 4JBGA 4DADA 2YQ4A 3C5EA 4NYIQ 5LPNA 4DV7B 1TM4E 1WZEA 1Z29A 2P9YA 3D7SA 3GGPA 2RFLA 4ND5A 1C3VA 4AJ9A 4G0YA 5JDCC 2WWYA 1ZCBA 3YASA 3B13B 3C48A 2Q3MA 3OIGA 2E3JA 3PE4A 2QN9A 4OHWA 1EFAA 1DJQA 1HE4A 3K1AB 3L0YA 3ZWWA 4OKIA 2GASA 4YQYA 4B35A 2C7PA 2O54A 1I7QB 5J2TB 1GQOA 2VAPA 2J09A 1NBEA 5FOVA 3MGBA 1T9CA 2BVNA 2G9NA 4YXWA 1F2UB 2HRQA 3T54A 4M89A 3JXEA 1GZ4A 2AUMA 4EA7A 7REQB 1ACLA 3FHCB 5LBTA 3NTRA 2XZDA 3WV4A 2HDWA 2YXEA 1R27A 3GLKA 4EY5A 4DSOA 4NDZA 2AFIA 1FTYA 3IAEA 1T8YA 2JGKA 4ITUA 2LE0A 1OXTA 3K7EA 2HV9A 2ZW9A 3ORQA 2VNSA 5CX1A 3TEMA 1RJGA 1U1GA 2IYXA 3W0LB 1HK7A 1LF0A 5DBFA 2Q3DA 3UV7A 5I7WA 3OU6A 4XYGA 1F9EA 2ZYIA 1BMQA 1WNTA 4YP7A 3WHPA 4E7PA 1XV5A 3HNOA 4OV6B 4MVJI 1LPPA 4XYEA 4NZYA 4PZ0A 5ICSA 4YXFA 4I0WB 1FJXA 3ORSA 4XWKA 5FLXA 1ONSA 2WM9B 4XW2A 2UXBB 1AGNA 4MMYB 1D1TA 4MR8A 3VSCA 1C9MA 3KVNA 4QECA 1S01A 2GN1A 3R20A 4INOA 2OENG 4MYCA 3TWOA 3H17A 4XLLA 1JLLA 4DCTA 4IJVA 3TZQA 3EOBI 2GJSA 2GQ0A 3RW9A 3SOPA 3SHFA 2RI1A 3EDCA 1W0JA 3R0JA 5F33A 1XMOB 1TIBA 2WLSA 2ZYWX 4RYLA 5GV8A 3L6EA 3OJEA 2JH9A 1VP9A 2QJRA 3DM9B 4JR1A 1RXIA 2GTHA 3Q5GA 4R7ZA 4S3MA 4MDFA 2BZSA 4AZ0A 4EZBA 1SXJE 1WE2A 3OO0A 3CZCA 3F98A 4RJIA 3SG0A 1K6JA 4DPMA 2REQA 2CMDA 2GCGA 4BLWA 3NO4A 2CNDA 1YQWA 3DMGA 1YZGA 3VR6A 1JH9A 3IMCA 1P2BA 1HQYE 1RLUA 1PX2A 3AESA 3DE0X 1XAGA 1A4RA 4M55A 4F3YA 4CIAA 2BGMA 4HQ0A 4F9EA 1D8AA 4B45A 4DY6A 4O4LF 4LV5B 5GADl 4OHKA 1N92A 3ELUA 4Z7OB 3GLIA 2WVGA 5CDFE 1XCMA 2VXYA 4N7RA 2VDPB 2DVMA 4N48A 2GJAA 4EG1A 1BSVA 4BEJA 3UN1A 1ORVA 3O4FA 3A4LA 3P9XA 3CUSA 3PQ5A 1T9ZA 4OFWA 2I3ZA 5IFKA 5FR2A 2CVFA 1SVUA 2AF3C 1UKYA 3HJUA 2YNMA 1AGPA 3PF8A 1J0AA 2I6GA 2J1LA 2JGIA 2NZ2A 4CW7A 2WHXA 2RGAA 2FX5A 2QX4A 3KAPA 1W2GA 1ECLA 1E4EA 1PIWA 1O97D 1ZMOA 3S5UA 2GHTA 2PO5A 2ZBPA 5LZ9A 2FSVA 4YY3B 2VRCA 3LO8A 4RVNA 4Z8YA 4MLDA 3SR0A 4C9BA 2F2TA 3OAAD 1QXSA 2MIIA 2AUTA 3DTVB 4V3CA 1R9JA 4DCPA 4X71A 4KRYA 2OC9A 3VTFA 2J30A 1Y6QA 2XUPA 4II2A 4TVOA 4XGQA 5BSRA 4CJXA 3S81A 3U1BA 2RHTA 4KZKA 1H1LB 3L5OA 1SQ5A 5JTUA 3HJFA 1XQYA 1JLSA 2HMYB 4MI6A 4DCVA 3S0JA 3FYCA 1OZGA 3NU1A 4QPNA 4YTEA 2OZPA 1L8OA 2BP7B 2I4LA 2OMKA 4QXRA 2O52A 3D0RA 3VYSB 5HKLA 3KLMX 3Q9SA 2XQFA 4PLVA 3VZSA 4NFHA 2QV7A 3V1KA 5A5GA 1P0QA 4OM8A 2JAOA 2WFMA 1MJ5A 2EZ9A 2ZRFA 1XVTA 4JJFA 1IYZA 3R5SA 2E89A 4GP9A 1DAGA 5JJ5A 5KX5B 1RYHA 3U19A 1YBMA 5DNEA 3MS2A 3HY3A 3CKYA 1K1EA 3G59A 3JQQA 4JJAA 4QQFA 4GPZA 4M4SA 3TPFA 5JDIC 4P7KA 1GGFA 2BTEA 4KWIA 5DASA 1ABEA 4MWZA 4D1YA 4QXMA 3NV9A 4H16A 1Z22A 5DO9A 3DYBA 3LOQA 3AXTA 4CHGA 5A1TA 3BJIC 4GVPA 1SOWA 4OLJA 2C4VA 3FM9A 1XVVA 3HKCB 5LWHA 3S8EA 3LBNA 3PGXA 4PQGA 1Z45A 3V6MA 2GAAA 3A1DA 3RTCA 1VCNA 4L07A 3UO8B 4A1FA 1RJWA 2CVOA 3OJWA 2XIQA 1J9ZA 4W7IA 4LZOA 5D3MA 4JXJA 1UBKS 4LOHA 5ITWA 1U2TA 3KTOA 2OZKA 3CB4A 4HNUA 1TZKA 4LC9A 2ECPA 4JMPA 3L5KA 2RGEA 1XEAA 2CCGA 4HDRB 3W04A 2Y9PB 4G89A 4OGFA 4HUQA 4M98A 4RCYA 4B6GA 4PYJA 4IMIB 2W6IA 3C3BA 1H05A 3O8DA 4AY3A 5IHXA 3TM4A 3H11A 4DMGA 2WF9A 2XUIA 3PJEA 1RZUA 4G09A 1VC2A 2QRVA 4K6FA 3RYHA 4CEJB 4GXTA 3NG1A 1RAEA 4NXMB 2QVYX 1V3UA 5CVEA 1G63A 4DBZA 4CG3A 2P4QA 3CZ5A 1S7CA 3NKFA 2DBYA 3CLRC 3LX5A 4BTLA 5FLYA 4FUQA 4KIJA 1Y81A 3QI2A 1N0WA 3BZUA 2IPLA 4UHFA 3EYAA 1WXIA 3WKAA 3D4IA 3ILSA 1E2IA 1AB5A 2PN1A 4IZOA 4QARA 2XNJA 3DE6X 4HATA 4HN2A 4YI5A 3UKDA 4CRWB 1T91A 3KSZO 3FPAA 1N1GA 1H2FA 4C20A 5FFNA 1NVKA 4UM8B 1GNRA 3LVRE 3V1YA 4ALJA 2YCBA 4CKXA 1GZ6A 2QN3A 3PJGA 3JQ7A 1BXZA 1NN5A 2TECE 2Y6VA 3FAKA 3N0RA 2IDJA 1QBGA 3TI9A 2Z2ZA 3TLGA 1M2JA 1N2CB 1XFDA 3L01A 4C3OB 4DWWA 1E3MA 5DP2A 1SCNE 1YU6A 1H69A 3EZ9A 3OEHD 1VHQA 2CUZA 5TVKA 1OXVA 4FFNA 2C2HA 2V1UA 4UBKA 4H7KA 3DBRA 4K9DA 2QSZA 4OY3A 5KU1A 4IW3B 2X2EA 2XRMA 3O03A 4KXUA 3H0CA 4FR5A 1KI9A 4ZQCB 3RSQA 5CHEA 2NYRA 1KDRA 1WCV1 5FNZA 4HNHA 7ABPA 1IUNA 1M7BA 1AV7A 2FCRA 3E3MA 2IYYA 3LWNA 1NI4A 5EUCA 1ZUNB 4H7FA 1PR2A 4ER6A 1P1BA 2J3HA 4WJZA 3K6SA 3NHUA 1PNVA 2AQHA 1CUGA 5TGTA 3SVTA 1GG2A 4B3FX 2PSDA 1PSZA 3TQHA 3WADA 4GOMD 3ZU5A 4B1FA 4M1YA 3I01M 2WT4A 2G04A 1CWUA 2HCJB 1QORA 4N41A 1YAJA 2ZM6B 4BFLA 4OSEA 3GVXA 4N5LA 1KFEB 1PWYE 2AX4A 5FULA 2J3KA 1Z12A 2WWGA 2WE7A 1BMDA 3ZCTA 3NWBA 4DPLA 1R7RA 1QHIA 4MB2A 4A8TA 1L7VC 2BUAA 3PPXA 4YWHA 4MWEA 4BZPA 1CSEE 2JATA 4QUDA 4KFTA 5I47A 2RH5A 1B00A 3HWRA 4I6JA 3ESAA 3TSCA 4CDGA 1F0KA 1Z38A 3VR3A 4JVNA 3V1NA 4FONA 1R88A 3IEMA 1NOKA 1Z6TA 1WXDA 4MIKA 4RABA 3RVMA 1F8UA 2EGGA 4YX9A 5BNZA 2XMSA 2C9DA 2FEMA 4NKRA 3PNKA 1DAOA 4C0AC 3E58A 3N58A 3RUAA 3NZEA 3SNKA 5FUXA 4FLEA 1MO4A 4I50B 1EINA 3RBAA 1DC8A 2HJRA 4RORA 1GLNA 5M04A 4HZUA 1GAXA 3L4BA 1T8TA 2P2CA 3HZRA 1F4VA 3IBFA 1TYCA 2FSPA 3M0EA 3P4XA 4RQAA 4LGYA 1CW2B 2A1UA 2W6JD 4J7UA 5L4SA 2IEBA 1HPLA 4HD8A 2OHJA 1Q11A 4D97A 1RZ3A 3WTBA 3SSAA 1U6IA 2UZAA 4RZQA 1XD2B 3T3PB 1G6HA 1FF9A 2V74B 4YP5A 4B2IA 3GFFA 4B2YA 4GOKA 4TV9B 3I12A 4IM7A 4L75A 4ZT4A 3F49S 1QLWA 1ZR4A 1CVRA 1EGQA 3PDJA 3R4CA 3I92A 1DCTA 3R7DA 4BDTA 3HRIA 3KLOA 3SWWA 4LTMA 3MBIA 4Q4HA 1LDEA 2IBMA 3E23A 1J1UA 3AUUA 1N6LA 4GYWA 3W5IA 3WISA 1FLVA 3EA4A 3IQWA 3ZHYA 4ARZB 4D74A 4K81B 2CLHB 5L6MB 5KPJA 1P81A 4YV0A 4RS3A 5K3FA 3GZ4A 1IIBA 2XE4A 4J1TC 3M70A 5A5VA 3GFQA 5TEWA 3IMEA 3FZNA 3BS4A 5JLJA 1G18A 1I7SB 3O1IC 1O97C 1OLXB 2PT9A 4B6RA 1P1HA 3R77A 2IELA 1JTFA 3L7AA 3WY9A 1E5LA 4BV8A 1NATA 1KNXA 3UMBA 4MMXB 4XGNA 2W2QA 3F71A 2OXIA 1TZCA 1M5RA 4DLLA 1H2YA 2KLBA 4BBAA 4QELA 2ECOA 3ND7A 4UOEA 5F3DA 3CX7A 4L4RA 3AOGA 1SXJB 1U7XA 4C6TA 4DG9A 3B8EA 1XDWA 2OEPA 3GRAA 4GXNA 2O2GA 4QOJA 4UNQA 3D6NB 1OX5A 4ENVA 3TTSA 2FFBA 5KOIA 1EVLA 4X41A 4PXAA 3THSA 1Z82A 5AOAA 1R5OA 4Z4EA 2JRCA 1NTOA 2P3SA 1XOIA 2PEYA 4JCOA 2AKEA 1V16B 1Z3CA 4PCLA 3RHZA 1OIWA 3ANTA 3ABOB 4O0MA 4PLZA 2GBFA 2D59A 2D6FA 5ALNA 1X7YB 2JJ8A 3ZC3A 1VL0A 1Z5GA 2VXCA 3K8ZA 1N6HA 2HPAA 2V9ZA 3L0CA 4M9QA 4KLCA 4N0QA 1W36D 2VQ6A 3I53A 2HGSA 4D45A 2O8FB 1HH4A 3C7KA 1UP4A 2ZWVA 5DISB 4BS9A 5EN4A 4U2EA 4WXPA 3K1AA 1SC1A 1X1EA 1DQNA 4IHKA 1E2PA 1NYLA 3KKNA 2Q5IA 3W78A 5IABA 1XXHA 1I0LA 1H2RS 1AMNA 1MX1A 4OEHA 3B70A 5ECDA 3R7SA 4DSNA 1UINA 3TQQA 4IQFA 4NHEA 4IWNA 2CHFA 2G70A 3UC5A 8ABPA 1R8JA 2NPOA 3G8YA 2OV6A 3NHBA 4Q7JB 1NLMA 1VZ3A 1GQ2A 3ZNNA 3GJYA 4QX6A 3FUTA 4AJLA 4OMUA 4R3UC 1Z62A 2XXJA 4Z4IA 3R76A 1GCAA 4KI0A 4GW3A 4PPQA 3P97A 4U3JB 4RHUA 2PX6A 4LCJA 2OPBA 5JARA 3BJZA 4TN5A 2V7WA 1L1QA 1I3NA 2IUSA 3M83A 1SHZA 3OFND 1QZUA 4TLAA 2UYGA 3VDXA 5BV7A 1TADA 3WGGA 1ACMA 2HF2A 3D7LA 3H2BA 1HYHA 4YGYA 1EUDA 4EAAA 4HRAA 5EERA 4MVCA 5BN3A 3ZGYA 4JVLA 5JOQA 1QJ4A 3EIFA 1N2BA 4O4LB 3OFVA 4EAQA 2XUQA 5JNUA 3X1JA 2HSZA 3BHIA 4XUDA 1L5LA 1SXGA 2FZCA 3FCEA 3DW1X 2EP7A 3W90A 3CJTA 5KTOA 4KQXA 4UCQA 2YYYA 4HEHA 3UXMA 1PJCA 5HF5A 1IDOA 1KMNA 4LISA 3NVAA 3VKVA 3ZGVA 2JKZA 3NTQA 2IVFA 3AZOA 2Z08A 4PM4A 1K9SA 4BO2A 2ZR0A 2G5CA 4IP0A 3HJTA 4R5MA 1IATA 1NUUA 2C31A 1IMOA 1XAJA 1KY4A 3HSSA 3JALB 1P1KA 2PKQO 3N2ZB 3H5AA 5B5SA 2G5TA 1KO5A 2A9RA 4BVEA 1K0UA 1Q57A 2XIJA 3M2PA 5FDFA 3ESCA 2ZS7A 3DKKA 4KFCA 2HZBA 1L4NA 4PZUA 4G0OA 1T1GA 4DXAA 5DW0A 4HB4A 3HVHA 5B6PA 1Y98A 1TFRA 3GJ0A 1F0NA 2DWQA 5MFPA 2NUPA 2FYTA 4MWCA 2ZE5A 3B78A 4OB6A 1IY0A 2LVBA 3P2EA 4YIHA 1MJGM 1EX6A 2FPIB 3DXZA 2QY6A 5IULC 1ZUWA 4YRBA 3EGWA 3P9IA 3ZDXB 3IDFA 1WPGA 2NOAA 2VJNA 3UXHA 5AHRA 3D8BA 3F7TA 4IIVA 3L9XA 2PRZA 1N33B 5KO2A 1E58A 3QG1A 3WO0A 1T3HA 1JRLA 1PHRA 4BB9A 2GEVA 5BP7A 2DPLA 4IMRA