3DWFA

Crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
271
Chain Sequence
EKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNVLSNERW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of key hydrophobic surface residues of 11 beta-hydroxysteroid dehydrogenase type 1 increase solubility and monodispersity in a bacterial expression system
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
total genus 101
structure length 271
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dwfA00
3JQ6A 3PYXA 1JKFA 2O4CA 4RZHA 1NVMB 1C1XA 2ZJ1A 1FDWA 2E48A 4IDGA 1EFLA 1MA0A 3FWNA 3LF2A 4JBHA 3GAZA 1PZGA 3FCOA 4AICA 4W6ZA 4MVJM 2GLXA 4BGVA 1EK5A 3GDOA 3TL3A 4BV8A 4ND4A 1EQ2A 1ISFA 1DRWA 1O9BA 3INTA 3JQBC 1QYXA 3OETA 1H2HA 3BMOA 1U3UA 4HUJA 2FPPA 1KC3A 4OH1A 1NQ5A 1XLTA 3AY7A 3HN2A 4NJMB 1IZ9A 2X0JA 5IDQA 1NPYA 4P4GA 4U6QA 5EPOA 4BNVA 1KEVA 4DC1A 5JCXA 1Y6JA 2V6FA 3E5RA 4J3FA 1ZSYA 2BFOA 1ZW1A 4FJ0A 2ZCVA 5AQ1A 3U3XA 2CFCA 4A10A 4XQGA 3U0BA 4E5NA 4D3DA 5TJ9A 3LZ6A 4MIOA 4MOWA 1R16A 1YWGO 2Q1UA 4LVUA 4L4SA 1SPXA 3I9OA 1SB8A 4OSPA 1YXMA 3W6ZA 1UZLA 3IP3A 2E4AA 1DIAA 1N92A 1E1MA 1UH5A 2P9GA 2OORA 3NAQA 1K5HA 5DP2A 4ND3A 4YDRA 5G4KB 3L07A 1PJQA 4DMLA 2FOIA 3D5QA 4QQRA 1BSVA 2ZB3A 3U4IA 4KZPA 1HYGA 3EAGA 4FCCA 4DTIA 4BNGA 3FNHA 1GV0A 3NTRA 3TF5A 4XRGA 2FR0A 4F45A 3LU1A 3VZPA 4EBFA 1NR7A 3UCEA 3ANNA 4OGWA 4CQLA 3EMKA 5AXDA 1LSUA 1U4OA 4ESOA 1SAYA 3FSRA 2CSUA 2OGUA 2Y1DA 1DIGA 5COQA 3RUCA 1NPTO 1LDBA 3AI3A 1YE3A 3Q1LA 2DBVO 4ITUA 2HK7A 5L45A 1T2FA 4NR0A 1WNTA 3WGHA 4AJ2A 2OO5A 5CAEA 3N74A 1DIRA 3PJEA 3WDSA 4PVDA 3JQGB 1DSSG 2D59A 2GYYA 5I7FA 5U9CA 1H2BA 1ISGA 3BYZA 4JGBA 2X23A 1KS9A 1LJ8A 4JBIA 4BO9A 3RKUA 2NTNA 4OXNA 4BNIA 3RC7A 1EE2A 3GEGA 3H8VA 3QP9A 3JQAA 4UVDA 4YXFA 4NBVA 1PL6A 2NQ8A 1QP8A 2PGDA 4XGNA 3ON5A 3WBFA 1PJTA 3KYCA 4OSOA 5U1PA 5T6BA 2HJSA 3ZU3A 4F6LA 2C59A 3CZMA 3RASA 4HFNA 4FSHA 1QLJA 4PG4A 5FI3A 1XQ1A 4LMRA 3NJ8A 1XYGA 3S2IA 2JFGA 3EW7A 2CNBA 5JAZA 4IBOA 4OL9A 4DL9A 5JSFA 3GMDA 5EL0A 2JFHA 4WOKA 4J43A 2Y68A 3H5AA 4W4TA 5GY7A 5BNIA 3AI1A 3HWRA 1E6EA 1MC4A 2WJPA 1ZK1A 3RAJA 1E7WA 2BH9A 5AXCA 1EBFA 3OF2A 1C1XB 1GR0A 2GUGA 4YCAA 5JAIA 5L7WA 3DBHA 3Q9NA 5THQA 1RWBA 3C8MA 1YQDA 2GRAA 2H9IA 2VT3A 1V6AA 3K92A 3V2UA 2WEKA 3K96A 4NJOA 1I8TA 3U9LA 1IHXA 2X86A 2O7QA 3ETEA 5EQDA 4Q3CA 2QZ9A 1TVEA 4BO8A 1TI7A 1ZO8A 1QRRA 4NIMA 5KJEA 3ZWBA 4CL8A 1UXKA 1DB3A 1QKIA 4L4RA 4W7HA 2DBZA 3HG7A 2VHWA 2QRKA 1UZNA 1YL5A 1ZJYA 3AI2A 2O2YA 3UUWA 4CR6A 4NBWA 4BO1A 4CMEC 5CDUA 3E03A 1A7AA 3QE3A 1F17A 1LRJA 1NBOA 4CLHA 3T4EA 3ZV3A 1ARZA 1WP4A 5EN4A 4EGFA 1GUZA 3B70A 1RJWA 3F6YA 1D3AA 5GZ3A 3WYEA 3DTTA 3JQAD 1U4SA 3Q6IA 3D1LA 1B15A 3TZQA 2LDXA 1Z6ZA 1GU7A 2QW8A 4BO6A 3KM0A 3KOUA 3RUAA 5KCZA 3F46A 3BMCB 4YVFA 1I30A 4HXYA 4YACA 3GY0A 3RQSA 1CJCA 3VKUA 4IJWA 5COAA 3RVDA 3RJ9A 3M2TA 4M87A 4Z9XA 3DBRA 3TOZA 2ZYGA 4EEZA 1PGQA 3TZKA 1T2DA 1WZIA 4J0FA 3KEQA 2GR9A 2H5LA 2GCGA 4PLFA 1NVTA 2FPIA 1T4DA 1O89A 3SC4A 4BNFA 5EJ2A 4J2HA 4PVCA 1YJQA 1E3EA 3DBHB 3NEPX 1BVUA 4R9SA 1O95A 1XSEA 4URFA 3TNLA 4A03A 4DREA 1ADBA 3FTPA 1K6JA 4BO7A 3H9UA 1FDVA 1VL0A 2QRJA 7ADHA 4AG3A 4FFOA 2JD0A 2PK3A 3E1KA 4IJVA 4WGGA 3CE6A 3OIFA 2DUWA 3FI9A 4HP8A 5G4LA 4XZ3A 1HXHA 4YRBA 1DO8A 3PJDA 2EKQA 2QYTA 4IDDA 5EMHA 2OFPA 3IJPA 4CM9D 4TRNA 1CEQA 3VDRA 1E7SA 2BGKA 3JD1A 4BVAA 1DBVO 1WDMA 2IDZA 4K9DA 3RC9A 5JE8A 4ZICA 3PLNA 3GRPA 1F0YA 4IPTA 5DF1A 5GMOA 1KY5A 2J5RA 2DTXA 4WCFC 4ND1A 1P45A 4TWRA 4H15A 3QA9A 4MVJH 4XJTA 3TN7A 5T64A 1NHGA 2VYNA 4IUYA 4XJSA 4GKBA 3HFGA 4A73A 4TROA 4OKIA 1UXIA 3I6IA 4RDIA 3RUEA 4MP8A 5JY6A 3INGA 4ZN6A 4I5EA 4OAQA 2O3JA 1MG5A 3K5PA 4NBUA 1D1SA 3E9NA 1IY8A 4TMFA 4U7WA 3CUKA 4ZGWA 4U6SA 1NAHA 1NHWA 4CM9A 4A26A 4O63O 1YH3A 1O8CA 3FNEA 3PJFA 1J0XO 4MKXA 5GZ1A 4BMSA 3RIHA 4RZIA 3T7EA 4E21A 4B7XA 5HTOA 3AY6A 2P68A 1Y9EA 4WECA 1I3MA 3LT1A 4WOJA 1HZJA 3A14A 1B8PA 2VUUA 3I9MA 2VZ8A 3PHHA 4YQZA 3LLSA 5EQFA 1I2BA 2FMUA 4YWJA 3WLEA 2PTGA 4KUEA 5CHEA 4BNLA 3HB5X 4PLWA 3EVNA 3GGOA 1JVBA 2VRCA 3P2OA 5H82A 2EGHA 4OJNA 4DPKA 1VLLA 2B37A 1NFFA 5DBIA 2R00C 3F9IA 3N58A 1VL6A 3G3EA 1NWHA 3VH3A 3JQFC 4YAIA 2X4GA 1T24A 2DUUA 4I5DA 2ZB7A 3PDJA 5CPBA 1PQUA 2DBQA 3HADA 3NGXA 4GKVA 4L75A 2VYVD 3LSYA 2ZKLA 3W6UA 1AHHA 2EJWA 2VUTA 1VRWA 1YGYA 4FFPA 1KVSA 1M75A 1T2EA 2P4HX 3HQ4O 4FFLA 4BNUA 3FNGA 3AFNA 4UEJA 1EVIA 1FJHA 2G17A 2OL4A 2CF5A 1G0OA 2JD1A 3PRJA 3VVCA 1UZMA 4K26A 4UUMA 5A5EA 4FFNA 5BSFA 2XAAA 3QVXA 4J0EA 4GX0A 2FSSA 4AJIA 3AJRA 4YEDA 4Z0TA 3JD0A 4B4UA 3I3OA 5COBA 4ZQEA 5FF9A 3DMYA 2R2GA 1Y8RB 2H6EA 4QO8A 1FMCA 2PGLA 3PGXA 1UXHA 2I3AA 3NV9A 2X9NA 3KO8A 3AUSA 3G1TA 3BHJA 4RLSA 3S1LA 2RCYA 1PEDA 1PZEA 2YHUA 3O8QB 3TFQA 3OECA 4A5OA 4CL3A 4R69A 4II3A 1R0SA 4PGFA 4XYEA 4IDFA 4LRSB 1N5DA 4FDAA 5JDCC 3DOCA 1PU2A 3I83A 5I7VA 3ZU4A 3H9QA 4ZD6A 3W1VA 5ER9A 1MC5A 4NG5A 4HKTA 4J2OA 2B35A 1JU9A 4BMVA 3PXXA 1XU7A 4FGSA 1CETA 1NASA 2PR2A 1RM5A 2UV8A 1EDOA 4ALMA 4CM8A 2PFGA 1LX6A 3W8FA 3G79A 4HBGA 5JYEA 4KDFA 4RF4A 2PNFA 3ZWNA 1Y8QA 4JJIA 1Z73A 4LSWA 4FW8A 3NT2A 4BB5A 2FHSA 2O2SA 1H9BA 5JDCA 3P19A 4ND5A 3G0OA 3VH1A 1E7QA 2DVMA 3E5MA 4Y6SA 3NYWA 2E37A 3U4HA 3WIDA 5DOVA 2Y1CA 3GA0A 2PKQO 4XD2A 4RL6A 1BMDA 3PHLA 4B3HA 5A9TA 4IJUA 1B3BA 2GN6A 2AEMA 4HFJA 4TZKA 4GGOA 3WJAA 2Z95A 3D64A 2P2SA 3WSWA 3UGKA 3PI7A 1LDMA 2WWRA 2ZB8A 2V6BA 2IXBA 1LI4A 5JAQA 2AEJA 3DL2A 5IDXA 4XIJA 1PX0A 3MJSA 4YAKA 5IDWA 2PD3A 1JWAB 2GPTA 3OA0A 3OH8A 3KBOA 5J23A 4FC6A 2VHZA 2IRWA 4GH5A 3OQ1A 1E3WA 3H9JA 3ZWPA 3DXFA 4Y6PA 2Y05A 3ASVA 3GGPA 5TRTA 3ZWVA 1EDZA 4PG8A 3VZRA 1X1TA 2JHFA 2GZ3A 3RCBA 5H81A 1HZZA 4UVGA 1JKJA 1MP0A 2W98A 3I52A 4TSKA 5BSHA 3EDMA 2Q2QA 3Q0EA 5CDYA 1VSUA 3BA1A 5AXBA 1SEVA 2R6JA 1MFZA 4DQXA 5L51A 2JAPA 4MDHA 3W8DA 5F1KA 2NVUB 2VNAA 4AL4A 4F6CA 4CMIB 2WMDA 2A92A 2ET6A 2NACA 1SCUA 4CM8B 1NP3A 3OQ6A 1L7DA 3Q9UA 2D3TA 2JL1A 5JBIA 1R4NB 3PPIA 4MP3A 1ZUD1 4F3YA 3W4IA 4CLOA 3L6EA 3MCVA 3F4BA 3VPGA 1ML3A 3H9EO 3M1AA 1UP6A 5B37A 4EJ6A 5AVOA 5IXSA 1X0VA 1XQ6A 4RVSA 4BO4A 1GPJA 1PR9A 4GGPA 2NU8A 3JD4A 4MO2A 2XPCA 4YTEA 4N7RA 2C0CA 1KIFA 1HDXA 4RVFA 4IMPA 5JO9A 4INAA 6LDHA 5KKAA 4YJGB 2HSDA 2VHVA 1S6YA 2JD2A 3K73O 1A7KA 1U3WA 1I36A 4B3IA 1A4UA 1KVRA 3V1TC 4JIGA 4XKJA 4BGIA 3H6KA 2WM3A 4WCFB 3V1YA 1BGVA 4BUCA 5JCJD 1I33A 3UOGA 3LT2A 1HLPA 4BKPA 4QECA 1GZ6A 5F5LA 2CVZA 1C0KA 2VT2A 4TVBA 3WQRA 4Y98A 2HUNA 3WBBA 3GGGA 1H6BA 4BNTA 4BHTA 3GEMA 1E5LA 3RUIA 3RC1A 1NFQA 1HDYA 5JO0A 4CQMB 4K1LA 4IIVA 5JYDA 4CUKA 4P4NA 4IS2A 1ZKMA 2NSDA 3ONDA 3DFUA 1B14A 1NQTA 3KXDA 3IJRA 5B4TA 3ZZNA 3ZHYA 3AW9A 3VH2A 1E7MA 5DCYA 4JLWA 1W8DA 4U0JA 4Q3AA 3VZSA 1O94A 2B4QA 2X7HA 3ORFA 4OM8A 1KC1A 3LC1O 4AJNA 1P0CA 5KVSA 4NK4A 1C0IA 3QJ5A 1TT5A 4IDEA 4IGEA 4WLNA 4RVUA 3E9QA 1D4FA 1UP7A 2ZTUA 4ALNA 1DC6A 1ZJZA 3D3WA 3FBGA 3B1KA 1C14A 3H5NA 1U28A 3VPSA 4AJEA 4DPLA 9LDBA 3WLFA 3O38A 1YKFA 2WDZA 4GAEA 3IUPA 3OSUA 1NAIA 4UAGA 5T67A 3R6DA 4BNJA 1M2WA 1XKQA 4Y9DA 1ZZEA 1HEUA 1C3VA 2CDAA 1F8FA 3UXYA 6ADHA 1CWUA 1VC2A 4J4HA 5DP1A 4EI2A 2QRLA 1QXSA 5BT9A 1EEHA 2BGLA 4RO0A 3AOEA 1XDWA 5C5IA 1B26A 3M1LA 4HWKA 4RVDA 2UUPA 4GX5A 1CERA 3O9ZA 5F3RA 3LT0A 2X0IA 1J5PA 4UVEA 3UAGA 4AJKA 2GZ1A 2ZQZA 5A9SA 4HV4A 3DR3A 2V6GA 1JLLA 1LU9A 1BWSA 3CSDA 3H65A 4D7AA 5KVQA 5I7EA 5IF3A 2P5YA 1GAEO 2NUAA 5JDIC 1R0KA 2AXQA 5HS6A 1U5CA 2X5OA 1HE4A 3AOGA 3PYMA 4FJ2A 3MEQA 4WUVA 3RJ5A 3TZCA 1QYVA 1SEPA 2YHIB 4U5QA 3L0DA 3VC7A 1R6DA 2AG5A 4AJ4A 2GD1O 4GWGA 4OOFA 4FFMA 3DBVO 2P9CA 4WE3A 4CLOB 3QSGA 2RHRA 3UKOA 4TQGA 4LGVA 3EZLA 4DQUA 3HDQA 3RBXA 4DA9A 4A0SA 1ZXLA 1I5RA 3H3JA 2HMVA 1JTVA 4MVJA 1XHLA 4AJPA 2JKVA 1Z75A 1DRUA 1ZXBA 3MWEB 2EJVA 2NV6A 1E3IA 2BFPA 4PG7A 3FTNA 4IM7A 3ICCA 1LEHA 2OP0A 4QEDA 1VJ0A 3WXBA 3ZNNA 4BOYA 2RHCA 4R1TA 2W2LA 4ROSA 4XCVA 3SLKA 4E5YA 1VJ1A 1BW9A 4GVLA 1GL3A 1GTMA 4B4WA 3Q2KA 3AM5A 1ISMA 5A3VA 3M2PA 3KLPX 1IL0A 4FOOA 4I9UA 3JQDA 5IN4A 4DC0A 4MVJD 2EP7A 4QXMA 4LVCA 3FPLA 1F12A 5KIAA 2CD9A 1H0KA 2JJYA 4B8ZA 3A1NA 2EIHA 2Q45A 5IJZA 1PWZA 4XYGA 5DDIP 4IIUA 4FFRA 3RU7A 4YB8A 1P3DA 3AY3A 1KEPA 4BO3A 1JKIA 1NNUA 3AM3A 1GADO 4PLCA 1ZFNA 3WWYA 3ZW8A 4NNJA 4EDFA 4CMCA 4KUGA 3U62A 1RM4A 3GVCA 5FFFA 2JCVA 4XX0A 1Q2XA 2CDBA 3INRA 4E6PA 1O6ZA 2ZTMA 4L73A 4JK3A 3W4JA 1YVEI 3I1JA 1U8FO 3O03A 3ROPA 1PL8A 1JVSA 3FN4A 5F5NA 2VHYA 1UJMA 3GH3A 4EZBA 3ZV5A 1LC3A 2Q99A 4RJTA 3W4KA 1CF2O 2VQ3A 4HY3A 1B2LA 2SCUA 3A06A 3E18A 3FF4A 1M76A 2HQ1A 4MVJG 3TZ6A 3I23A 4LCEA 4XGIA 4J4TA 3AWDA 3UCFA 3SC6A 1WZEA 5ENDA 2G0TA 4NU6A 4CV2A 3ITDA 4BGEA 3U09A 1QORA 3JTMA 3KVOA 3G49A 4H3VA 3VTZA 3L4BC 3GVXA 1K3TA 3EHEA 4YJFB 3AOEC 3UF0A 2BFMA 3JCZA 3NKLA 3AUUA 3A9WA 1AGNA 4XRRA 4EUHA 5I9NA 1SC6A 1AN9A 3WYBA 3BAZA 2OZPA 1XEAA 4BO0A 3ZNOA 1P1RA 4IZHA 2O3TA 3HSKA 4WKGA 3EUWA 3GN2A 4GI2A 4IGFA 4CQLB 1DIHA 1GZ4A 4GSKA 3D4PA 2W8ZA 3F5SA 3VDQA 4YR9A 1H5QA 4W9NC 1GEGA 3QWIA 3OJEA 1MB4A 3CKYA 4RPGA 1I10A 3E8XA 3NGLA 4R51A 4WCDA 1ISJA 2BF7A 4G5HA 5JMPA 4W9NA 3EGOA 2QYSA 4WLOA 2HK8A 3ONEA 4ALIA 3WOHA 3DC2A 3MJEA 2BI7A 1ZMOA 2I99A 1O5IA 4J91A 4GLLA 3DZKA 5TX7A 3ZHZA 2HK9A 4R54A 3U5TA 4D3FA 1U9JA 4RV9A 3PIIA 3H2ZA 3MOGA 4PLZA 4UUOA 4PLVA 1XIVA 4J9VA 2ZCUA 1HDCA 3QWAA 4BKQA 5JNLA 3GVIA 2AEFA 3VAZA 1GZ3A 4LMPA 4YT4A 4HNHA 1ADGA 4KWHA 1GD1O 3H2SA 3WGIA 1LDYA 1LQTA 4GLOA 4PIVA 2JFFA 1EK6A 4G81A 3JYNA 1KEWA 3E9MA 3QY9A 1MLDA 1U7TA 1R12A 4CM5A 3H4VA 2BRUA 4O5OA 1HSZA 4W7IA 1H6AA 2IYPA 1H6DA 3DAFA 3OEYA 1W73A 3I9KA 1N7GA 5A02A 5DBFA 1Q7CA 1KVUA 2E6UX 3OBBA 2DC1A 1Q0LA 4E5PA 3H3FA 5CEEA 4D0SA 4R9RA 4WNIA 4RDHA 1DEHA 1TEHA 1V3VA 4Q3DA 3Q3CA 4XA8A 3BMQB 4RGBA 4ILKA 2G5CA 4E30A 1MGOA 1YDEA 1HLDA 2PA3A 4WJZA 5F21A 2FR1A 3ABIA 4L8VA 3BHMA 3DZJA 3S2FA 2PKQP 1P1JA 3PZRA 1U1IA 3ANLA 4R5HA 3PGJA 1LRLA 4N5LA 2FP4A 2I76A 4CV0A 4E2ZA 3PZBA 3WSVA 1U3TA 3WGYA 3MJ4A 2QHXA 3WGOA 2DLDA 2Y1GA 5LDHA 1NYTA 4CLEA 3RSHA 4XQEA 1TA4A 2P91A 3RU9A 3PWSA 2VN8A 5JPIA 5KNLA 3IC5A 3R3SA 1LRKA 1HSOA 5A06A 3E48A 3NDIA 4KQWA 1B7GO 4L4XA 1C1DB 3RFXA 3SEFA 2DTDA 5THKA 2DQ4A 4PN3A 2YJZA 2CF6A 3GMSA 3S55A 3JSAA 5A5FA 2X22A 1OAAA 3Q11A 3ZV4A 5TQVA 1N9GA 1ZEJA 3WGGA 2B4TO 2PKRA 4ZJUA 2J3IA 4FPXA 3NRCA 2E82A 3KYDB 4DPMA 4AJ1A 1M6HA 4J7XA 4R1NA 5KJ6A 4C7KA 4WEOA 5MDHA 4FC7A 2XXJA 1PR3A 4XIYA 5JMWA 1WWKA 4XB1A 2Q50A 3GZNA 1HE2A 4D42A 1I32A 3KETA 1T2CA 5FYDA 4OYRA 1N2SA 2WD8A 3JQGA 3ZN2A 5TT0A 1NM5A 2FRDA 1R37A 3FRJA 4IDCA 3V2GA 2ZB4A 2HKIA 8ADHA 2DM6A 4J4BA 3C1TA 5A05A 3N7UA 2PZMA 2YQ5A 2IZZA 4AJHA 1WAMA 2GSDA 4R3NA 5B12A 1JQBA 2Q1TA 4NDNE 1E77A 4RPLA 4HX5A 1OC2A 2NLOA 3D4NA 4KUHA 4KDEA 4EITA 1T4BA 1UXJA 3L4SO 2R00A 2D4AA 4N5NA 3ENNA 3Q2IA 5C7IO 3DQPA 1DJNA 1I2CA 1XG5A 5DN9A 1LDNA 3ZHXA 3DZFA 4BNNA 2C07A 1QR6A 3QV1A 3K9QO 3LC2O 4NJMA 5CDSA 1SNYA 3JD3A 1YO6A 3KLMX 4MPDA 2O50A 1VM6A 4IZIA 2YFHA 1OC4A 4MIYA 3TFOA 1T1SA 1LDEA 3LK7A 5JC1A 1GUYA 3ANMA 2DFVA 4CLDA 3X2EA 3ZNQA 2B69A 2BHLA 3FWZA 2JAHA 5EERA 3STHA 5HS4A 1SO8A 4NHEA 4E5KA 3ONFA 1OFGA 2UYYA 2YQ4A 3W8EA 4Y6RA 1ULUA 4CM7A 3TOXA 3EK2A 2E49A 3WG9A 4DQVA 1ENOA 2Y93A 1G0NA 3WTCA 4GL4A 4NZ9A 5L4SA 4BMNA 3I9JA 2YV3A 1QV7A 3I4FA 3QVSA 5G0WA 1IHYA 5KJ1A 3WS7A 4R68A 4CV1A 2RIRA 1CQJA 1OOEA 3GRKA 1FDUA 3ZWOA 2NVBA 1ONOA 1LXCA 5I7SA 4BNXA 1F06A 3L77A 4IDAA 4CODB 3ZDFA 4DIOA 3BTUA 4D3SA 1I24A 4U0KA 1E3WB 2A35A 1YL7A 5KVVA 3D3WB 2D5CA 1B8VA 2XXBA 2CVOA 3BMNB 5KOIA 2HCTA 4X54A 4BNKA 4NFSA 2DAPA 3UFXA 5EINA 3OIDA 2ZIZA 1ADCA 1ZSNA 3K8ZA 3L9WA 3WGQA 2HRZA 1A5ZA 3JQAB 4NQZA 2C7GA 3RC2A 4ZHSA 4Z9FA 3P7MA 4MKRA 3IKVA 3DZBA 2WYVA 2NVUA 4LK3A 1R15A 4XDYA 3BIOA 3HZZA 2G1UA 5HA5A 1BTOA 2NQTA 4NBRA 4E3ZA 3PHIA 4ONEA 1EUCA 1KETA 2DPHA 2WE7A 3B1JA 1EUZA 1ISHA 3JQ9A 4IXWA 4BS9A 1VE9A 3HE3A 4BQPA 4B79A 3DHYA 4YAGA 4R4JA 4QFCA 4M55A 1HF3A 4XQ9A 2VZ0A 2YUTA 4M1QA 2ZJ0A 2Q3EA 2TMGA 5TIIA 2AE1A 4WK6A 1DRVA 1Z45A 2B0JA 3S8MA 1U2GA 3QWFA 3VOSA 1P9LA 5JXWA 1PL7A 2I9PA 2NVWA 1BRMA 3DMTA 4OHUA 2Z1NA 4ZU3A 1QYCA 3DMTC 3VH4A 4CMEA 2Y0CA 1YBMA 2AW5A 1HKUA 3WX0A 1Z74A 3GOHA 5CFZA 5DOZA 1Z7BA 2X1HA 3GR6A 3O26A 5LDGA 4YJGA 3TL2A 2VYVA 1GQQA 4RLHA 3IQDB 5TJHA 1YDWA 3ZU2A 2EHDA 4KOAA 4M86A 3NDJA 4MVJI 1JN0A 1BXZA 1GCUA 1ZVMA 3MJVA 3TDKA 3BTSA 5IFLA 1IUKA 1WDKA 1BXGB 1LDGA 4KMSA 4I9NA 3C7DB 3GAFA 1WW8A 4TKMA 5JS6A 4OXYA 5TSDA 5A1TA 4UVHA 4R16A 5G2OA 4MVJF 2EW2A 1Y9AA 4XWYA 1E6WA 3PQEA 3H7AA 5DCUA 4QFDA 2CZCA 1UAYA 2CVQA 3WWZA 3EC7A 2Q4BA 1IE3A 1JA9A 4DIFA 3PWZA 2RH4A 3OJOA 3ADOA 3SJ7A 3KYDA 3DBRB 2ZQYA 1DAPA 4YQYA 2H63A 4LSMA 1I01A 3UN1A 3O4RA 2X6TA 5I9LA 1F14A 2C54A 3GDFA 1PJCA 2FR8A 1X0XA 4OOEA 1OI7A 2C2XA 1VI2A 1I3LA 4HADA 1ADFA 3WNVA 3GUCA 4MVJE 3OJLA 3S2GA 1ZBQA 9LDTA 1PJ3A 4YJFA 1HDGO 2Z1MA 4TRJA 1HYHA 4M89A 3JQ7B 1ENPA 3RUFA 1EMDA 1NQAO 5FWNA 3GEDA 2AMFA 5MGBA 3VKVA 3FHLA 1AHIA 4BO2A 1B8UA 5ILGA 5CG1A 1KERA 4D43A 5A4DA 1UR5A 2EEZA 4BIIA 4MP6A 4GQAA 3WICA 3VPHA 3U49A 4GPD1 4Z9YA 1D8AA 1DOHA 1A72A 3BHIA 4PRKA 2BD0A 2IEDA 1NVGA 2D1YA 4CQMA 4N18A 4P38A 1Y81A 1K6IA 2W4QA 2BLLA 4E2WA 1B0AA 2GNAA 1HDZA 4RCVA 2O7SA 1XCBA 1NQOA 1M6WA 1P1IA 2O23A 1KVQA 1V3TA 2VRCD 3NTQA 1MV8A 3PFWO 4YRDA 2NWQA 1FDSA 3OJ0A 4L74A 3QWHA 1E1KA 1AE1A 2Q46A 1QG6A 1IOLA 4B4OA 3LC7O 1W0CA 1ZK0A 1Q7BA 4Q39A 3NDRA 3SVTA 5ILOA 1I2ZA 3GG9A 2Q4EA 4JQCA 1AXEA 1GQ2A 2NM0A 3PDUA 3RUHA 3CMCO 5F1PA 3IIEA 1PIWA 2DT5A 1A9ZA 2RBEA 4RF3A 4Q3EA 5F1OA 5CP8A 3BMOB 4HFRA 1WLYA 4JBGA 4KP7A 4PLTA 3ETGA 5JCJA 4XYBA 3OQBA 3TPCA 4E13A 3TJRA 1E3JA 1P1FA 1W4ZA 3ICPA 4WLEA 1F8GA 2WSBA 4J1NA 5T8KA 2LDBA 4J1TA 1Y8QB 5TF4A 3OIGA 1SOWA 4YPOA 1TLTA 4M49A 3EVTA 1MFPA 3GZNB 5B1YA 4YT5A 1PGOA 4PG5A 3WNQA 4DRYA 2P4QA 5L4LA 1N7HA 1P0FA 1T2AA 2O3RA 3K2BA 1EVZA 2ZATA 3JQBA 3UICA 3MWDB 2I5PO 2OHXA 1B16A 1DPGA 1DXYA 2EW8A 4GWKA 5G0VA 2B4RO 3CINA 3HFSA 1MX3A 5TC4A 2V65A 5ADHA 2VNSA 5H83A 4P8RA 2FN7A 1R0LA 4Q3BA 4Y8VA 3C3XA 4DGSA 3ZV6A 3DZGA 4P22A 3I9LA 5TNXA 4PZEA 3OP4A 3ROKA 1DDOA 2J5KA 3ZWCA 3GNTA 3JYLA 3KHUA 1FXSA 5U4QA 4DLLA 2X58A 4XR9A 4DXHA 1PQPA 2Z5LA 2IYOA 3G1UA 3V5NA 2VTEA 3ITKA 3LVFO 5G4KA 2O48X 1M67A 2EXXA 3DHNA 4O1MA 2GN8A 1EE9A 1JWBB 5JY1A 3BZUA 4UREA 3WIEA 1GUFA 4ID9A 3AFMA 1LUAA 5DNAA 1CYDA 2VWHA 2GN9A 2H1SA 3NX4A 1V3UA 1UP4A 2Y0DA 3OM9A 5B4UA 4EJMA 1B3RA 4XEHA 3GLQA 1LQUA 1H94A 2B5WA 2Y67A 1YOVA 3B1FA 5L40A 1PJ4A 2DTEA 1P1KA 1WVGA 1LA2A 3C1OA 3WR5A 1ULSA 1BG6A 5BNTA 1RM3A 2PH5A 1Y5MA 1HETA 3KSDO 4NH4A 4R5MA 2OXIA 4GBJA 4DWVA 3T4XA 3IDSA 1ENZA 2PZJA 2ZYDA 1ONNA 2PWZA 2RAFA 4PZCA 1E1LA 2VWGA 3WMWA 1E6UA 4B4VA 5HBRA 5EESA 4Z3KA 3QLJA 2VZ9A 4LRTB 1VKNA 3OEWA 4CQMD 4GX1A 4CPDA 4FQ8A 2J6IA 3PQDA 5L95A 2IZ1A 4XYLA 4EJ0A 2YHIA 1XU9A 4R3WA 4A2CA 3PK0A 2PLAA 4CMAA 2HDHA 1X7GA 1QV6A 5C37A 4E2YA 3GQVA 4IY1A 1NWCA 2O4UX 5BNFA 4DIBA 1P74A 4DLBA 2I6TA 4K6CA 1BXKA 5I8WA 5B4VA 1EZ4A 3D0OA 1RM0A 2HMTA 4Q3NA 1M66A 5IZCC 1T25A 2WYUA 1LSSA 4H7PA 2EERA 4BKUA 1V9LA 3K6JA 2C5AA 4IS3A 5HRUA 2FSVA 2OBNA 4I1IA 4MVJP 2IODA 1LSOA 4WEQA 1CQIA 1SB9A 1UDAA 5L53A 3ULKA 2OUIA 2QX7A 5TT1A 3C1AA 3DEYX 4E33A 2J3HA 1ZSVA 3AU9A 4C7JA 5G0SA 2YV1A 2C29D 3BMQA 1PGPA 3LF1A 2C5EA 1BXGA 3MJCA 1ZH8A 1J6UA 4JCOA 5T8KC 3VPFA 2V7PA 3ZCXA 2JCYA 3L4BA 3G17A 4K6FA 2ZTLA 4ZQBA 1X7HA 1HDRA 3WGZA 1C1DA 4Z6KA 3B6ZA 2AG8A 3GNQA 5A04A 4Q9NA 3TQHA 4G65A 3R3JA 4DVJA 4CMBA 1PJLA 4F46A 3OMLA 4B7UA 1C0LA 5DBGA 3D7LA 3OHSX 4CM1A 2PH3A 2WE8A 5BSEA 2D2IA 1P1HA 2AHRA 4R01A 4WLFA 4YAJA 4XR4A 3C7CB 1IPFA 2J3JA 3LLVA 3C85A 3E6AA 4II2A 2DFDA 4WLVA 3GN1A 3QHAA 4NFYA 3ST7A 4PFJA 2A9FA 2BELA 3ZWAA 4E4YA 1TXGA 2HMWA 3EZYA 2AE2A 4BNZA 1LSJA 2VRBA 3LT4A 1HE3A 4MIEA 4ZA2A 1ZCJA 2YFQA 1N8KA 2QIOA 3KZVA 1H9AA 4BNYA 1Y7TA 4B7CA 5KKCA 2QQ5A 4JXKA 1HL3A 4YJHA 2PD4A 3DBLA 1DHTA 1P44A 3GPDG 5IXYA 2FWMX 4DMMA 4DUPA 1PJBA 1YONA 2C20A 1R4MB 4Z0HO 2Y99A 4YT2A 3GDGA 1QYDA 5IN5A 3RI3A 1PS8A 3QW2A 2O3QA 1W6UA 2NTJA 4CM6A 1E92A 2C7VA 2DPGA 1ORRA 1MUUA 3AUAA 3JQCA 4I5GA 4CM4A 3MTGA 1U2DA 2A94A 3GNSA 4CM4B 4D45A 4DBVO 5C3MA 3JQ7A 1LLCA 2X9VA 2VYND 1GEEA 3IP1A 4DLAA 1RYDA 4D41A 3MZ0A 4UUNA 5K9ZA 4L0QA 1X7DA 2X0NA 3T7CA 3WYCA 3AUTA 1J4AA 4TVOA 3V2HA 2W2KA 4NFHA 4Z0PA 3ZWWA 3BTOA 4CR7A 2EG9A 5I8ZA 3MTJA 3KYCB 4DBZA 2HJRA 3CMMA 3F4LA 2VOJA 3VTFA 3X2FA 3DTYA 3PVZA 4W82A 3FR7A 3IMFA 1RPNA 4OQZA 4R41A 2I66A 4NK5A 4DYDA 1GPDG 1MXFA 2I67A 4R1UA 3HHPA 2J3KA 4K28A 4QX6A 4ZQFA 3TRIA 3DFZA 3UW3A 3WMXA 3JQFA 4BNWA 2O3SA 3RFTA 1XWFA 4KTVE 4OXKA 5HWSA 1NX6A 4J16A 4YYZA 1PTJA 3S2EA 4GX2A 2CUKA 7MDHA 1YB5A 4PLYA 3AK4A 2PD6A 2OOSA 3LYLA 1HE5A 4PLPA 4EUEA 1KBZA 4IJKA 4PRLA 1YS4A 4QT0A 4FR5A 5JDIA 3NUGA 3F1KA 1DLJA 3JQEA 4KTTE 1XELA 1H93A 4BL5A 1PJ2A 4XYMA 3FBTA 5BR7A 3OICA 3JD2A 4FBGA 4LCJA 2YYYA 3RROA 4E0BA 4ALLA 1P33A 2FZWA 3DOJA 3TWOA 2HLPA 4D79A 5DZSA 4WLUA 2P5UA 2ZK7A 1A4IA 1QLHA 1LLDA 1V8BA 2X9GA 1KY4A 4LW8A 3AU8A 1BHSA 3VPXA 1PSDA 3UVEA 2VWQA 3MOIA 2C2YA 4NU5A 3I6QA 3ZI0A 3SBOA 4J1QA 3HDHA 4R1SA 2BFAA 4WNCA 4AJLA 3JQ9C 1YQXA 3PFFA 1Z82A 1SZJG 3IL2A 4CM3A 1JAYA 3NT4A 1KOLA 3I9NA 2Y1EA 4FS3A 3HB4X 3UH1A 1PGJA 3GG2A 2X5JO 4RORA 1GY8A 2W2KB 4G2NA 4FN4A 3V1UA 2YY7A 1PQWA 1IPEA 2YDXA 4JJFA 3F1LA 3GHYA 5L7YA 1GQYA 3OA2A 2AQKA 2PZLA 2IXAA 4H16A 2GGSA 4OQYA 2J8ZA 4BO5A 1DFIA 1OMOA 1ZMTA 4IDBA 2Y66A 3ASUA 4RPHA 4JX8A 3DDNA 1YRLA 3P2YA 1WXDA 2VHXA 3HJAA 1JDJA 1N9GB 1X14A 2RH8A 4FJ1A 5L9AA 1DJQA 2V6MA 2WD7B 1VPDA 1ZK4A 2HAEA 5JLAA 1ZK2A 2GDZA 2GERA 4OKNA 4CJXA 4E2XA 1YB4A 2EWMA 1WDLA 1T26A 3GFBA 4JROA 4UEKA 4IQ8A 1G1AA 5IG2A 4EEXA 5ITVA 5CPFA 3KV3O 3D3EA 3PYLA 4AFNA 4J1SA 4GMGA 3QIVA 2JCXA 3BTVA 2BGMA 4FOSA 1NR1A 5EIOA 1KVTA 5ES3A 1GYQA 2IE0A 4BNHA 1VJTA 4CR8A 3PEFA 4TZTA 1FK8A 4JJGA 3DAPA 2I65A 3DO5A 3KB6A 4QUKA 2VOEA 3OFSA 4I5FA 4UULA 3JV7A 4P4LA 1N1GA 2DBRA 3ETDA 4MJLA 3RWBA 2OP1A 4YA6A 2EP5A 4XB2A 5CDTA 2F00A 1QSGA 3OJFA 1DLIA 4BB6A 4IXTA 2FPGA 1LBEA 1NPDA 2J5QA 1I0ZA 4BQRA 3DOOA 3TSCA 3I4CA 4W99A 5K6AC 2B5VA 3DZIA 3UHAA 8LDHA 4ZVVA 3F3SA 4J90A 2TMDA 1DC5A 5KWEA 3FD8A 3QVTA 4WASA 1DIBA 3PP8A 3R0IA 3K31A 2PV7A 5ER6A 2BI8A 1YBVA 3ZU5A 1VKOA 5JFOA 4J9UE 3C7AA 4LISA 1L1FA 5ITWA 3HUDA 2W2LD 4FIZA 4MKZA 4BV9A 3GPIA 1CDOA 2DU8A 4GSLA 4CLRA 3RFVA 3PIDA 5ENVA 2PZKA 4CUZA 1SMKA 1K2WA 2UUOA 3CEAA 4N54A 1FDTA 1X15A 1JAXA 2AQIA 5AOVA 1DAOA 1HDOA 1V0JA 2OMEA 3L6DA 4TRMA 1LLUA 4YJDA 2VWPA 3QVWA 4D0RA 4BKRA 2ILTA 3P5SA 1BDMA 3QWBA 4S1VA 1DC4A 1DC3A 1S7CA 4RVHA 1HYEA 1ZEMA 1H6CA 4RF2A 1TT5B 2CY0A 4GVXA 3PJGA 1CRWG 1K6XA 5A3JA 5AXAA 2EV9A 4E32A 2YDYA 4C4OA 1OBFO 2XOXA 3L6OO 4IQGA 2UDPA 1BDBA 4NI5A 1HRDA 5IZCA 3R1IA 2AQHA 3D5TA 1YQGA 3COSA 4CMJA 1SOVA 5K0ZA 5K6AA 4JNKA 4O0LA 2G76A 3ZNPA 3A4VA 1A9YA 4PG6A 4CUJA 1HT0A 2IZ0A 1A27A 4IINA 4PZDA 3DZHA 5IZ4A 4ZQGA 1IZ0A 1Z7EA 4FD3A 1BW9B 1EVYA 4YJHB 3PTZA 3WQSB 3GZ4A 3CPSA 2FY8A 4TKLA 3V8BA 5A9SB 2PGJA 1E7YA 3LQFA 3WGTA 3GUYA 1E0DA 2B83A 4O59O 3KRTA 5L7TA 2XF8A 3KEOA 4PLHA 1J49A 2FZEA 5I9MA 3U4CA 3MJTA 1LNQA 1VSVA 2X8LA 1EQUA 4CMGA 1OZAA 1NFRA 1PZHA 1EBUA 2GN4A 3AM4A 2QZZA 4CV3A 2NU7A 5C7OO 1BVRA 4AJJA 4NPCA 5L4NA 1PS9A 3ZWYA 1EUDA 4MINA 3K30A 4DYVA 5IDYA 3TZHA 2EGGA 2YW9A 4E5MA 2C82A 3BMNA 4HFMA 1PWXA 4A27A 3D4OA 1T1RA 3HN7A 3U4DA 5JC8A 4D44A 2D0IA 4UUPA 2D8AA 1ONPA 2ZYAA 5L3ZA 2HRBA 4FB5A 3ZW9A 5BQFA 1Q0QA 2NNLD 3DHEA 1WMBA 3ZH2A 1E1NA 4ZRNA 3RBVA 3FPCA 3JQ8A 4NBTA 3ZWMA 1ZIDA 4AVYA 2HMUA 4GMFA 2WTBA 2Q1SA 4UEOA 2HU2A 2NTVA 1P77A 4I8XA 4Y67A 3PHGA 1PGNA 1A71A 1GYRA 5A9RA 1Y1PA 4BKOA 3VZQA 2G82A 1MXHA 2YV2A 4NMHA 4UVIA 3KSZO 1KEUA 5FEUA 4L76A 4HNGA 4OIMA 5IAAA 4J7UA 3A28A 3ROMA 1R4MA 3GVPA 3H5RA 1HTBA 1V35A 1Q0HA 1X13A 3GFGA 3ZGYA 1VL8A 4D46A 5DT9A 1YJ8A 3F47A 1AXGA 1LLQA 2EKLA 2Y0EA 2OBYA 3PLRA 1XA0A 3BMCA 4B3JA 3WTBA 5CEFA 3IKTA 3B20A 2Q49A 3EY4A 3GT0A 4QO7A 4KQXA 5DULA 3WQQA 2PY6A 4J49A 5KVCA 1C0PA 1CIVA 1LTHR 1QMGA 4YRAA 4U8GA 4XQCA 1ENYA 2I3GA 3HDYA 4PCVA 3DAGA 4ZRMA 2CMDA 3FR8A 2F1KA 3IUSA 4JN6B 4XDZA 2Q1WA 3RKRA 1O0SA 1RKXA 4BNMA 5FI5A 3K2EA 1PS0A 2AQ8A 1JW9B 2GASA 4ND2A 3C24A 2D5AA 5TGDA 1Q1NA 1N1EA 1AUPA 1QYWA 1ZK3A 3RD5A 4B8WA 3I5MA 1XR3A 1DHRA 5CEJA 3IOYA 4M54A 3DONA 1YB1A 3PQFA 4OMUA 2O3UA 3CZRA 3WFJA 2NU6A 3NTOA 3ZWXA 2QG4A 3KYBA 4RVGA 2GO1A 1WPQA 1R4NA 4CMHA 3KSUA 1NXQA 4JP2A 1Y8RA 3FNFA 4ALJA 2HMSA 3JYOA 4FGWA 3GC6A 1U3VA 3HNPA 1E5QA 4EYEA 1E7RA 1D7OA 2EKPA 3PHJA 4J7CA 1UDCA 1YBAA 4OO3A 5CG2A 4YT8A 4S3MA 5C7LO 3ZHBA 4WCFA 2X0RA 1ZNQO 4E31A 5JAMA 4QTZA 1K0UA 1SBYA 2BMAA 4XGKA 3VHRA 3DB2A 4YAEA 3NT5A 3CXRA 1XGKA 2Y1FA 5AYVA 3JQ8B 5KJFA 3IAHA 4YBZA 3H9GA 1X1EA 3QQPA 3DWFA 3HDJA 2NU9A 1FF9A 1E3LA 3L9XA 2Q2VA 3RBZA 5ICMA 3IS3A 3SLGA 1NTOA 3ENKA 5DCWA 1MG0A 4ALKA 2NADA 3F5QA 1GCOA 3GF4A 4Z3DA 1ID1A 1K89A 5G0TA 1Y5RA 4IMRA 5GZ6A 3RUDA 3QRWA 1PJSA 4O6VA 3JYQA 1D1TA 2B36A 3GVHA 3CTMA 1UDBA 1IYZA 1IB6A 5G0UA 5TLSA 1DFGA 2W90A 2GZ2A 5HM8A 2X5KO 4RQUA 1UUFA 1R66A 4IQ0A 4RQTA 2VCYA 4CMIA 3NJ4A 3PWKA 1UXGA 5BSGA 3ADPA 2IEBA 4I08A 4RF5A 4N5MA 5T5QA 3DBLB 3CH6A 4CLXA 3KTDA 5TS3A 5ICSA 3KUXA 1GDHA 3VVBA 4CLRB 4RPJA 1LC0A 2GF2A 4E12A 2EF1A 3SX2A 2POQX 3CIFA 4AJOA 4J6FA 1EVJA 4JP3A 1G6KA 4EUFA 2AA3A 2WD7A 3E82A 5LCXA 1U5AA 3QVOA 2Q2WA 2P9EA 1WMAA 3LDHA 1HWYA 4PLGA 4RPKA 4CMKA 2VUSA 1GV1A 1GYPA 2UAGA 4WPGA 3GK3A 2ZTVA 3EYWA 3ROQA 4EW6A 1ISIA 4BGUA 1KYQA 5CDGA 1E3SA 2VTDA 2CDCA 1I3KA 3WJ7A 2HO5A 1IULA 1TB4A 1TT7A 3SJUA 5A03A 5LC1A 1YOVB 2JHGA 3BXXA 3GHHA 1L7EA 1U7HA 4QSMA 3M6IA 1U8XX 3O8QA 1EFKA 2DKNA 4A7PA 4M8SA 3WFIA 1RYEA 2UVDA 1GFSA 2A4KA 3UCXA 2BKAA 1P31A 4KWIA 4TRRA 1Q7GA 2YZ7A 4ZQHA 1DFHA 5T57A 4I9HA 3SXPA 2Y1OA 3WB9A 1PZFA 4L9RA 5KJCA 1YL6A 1UAGA 5JW6A 5KTKA 4LN1A 2WYWA 1I3NA 3JYPA
chains in the Genus database with same CATH superfamily
2D1RA 1JKFA 1KZ6A 2O4CA 1GCAA 2RHHA 3H13A 4LTMA 2GEUA 4LJKA 1JXOA 1G41A 5H68A 4ZI5A 1C1XA 4XVHA 1N0VC 3HBNA 1D5CA 1FDWA 1FSZA 1SU6A 1TQDA 1RT9A 1ESCA 2ETVA 4WNAB 3UMSA 4AWBA 2Z3WA 5JD6A 2GK3A 1XZGA 1WL8A 4JBHA 3GAZA 1PZGA 3GJ4A 1WB6A 2HNKA 4IGAA 4AZ3B 3EZ9A 8OHMA 1UC8A 3DKIA 1JKJB 3DTNA 3FCUB 1DRKA 5FXMA 5EJ6A 5L3SB 3AL2A 4YCJA 4WXPA 1SVNA 3D4LA 1W6RA 1J70A 4GRIA 3WNZA 4LOJA 2PUTA 1QYXA 2NZJA 2ZVJA 1U3UA 3HACA 3X3HA 4EYKA 4PONA 5EJ4A 1KC3A 3HDTA 1PR0A 3H83A 1RJFA 1ZI9A 2WWGA 3AY7A 4MRMB 1Z22A 2W6ID 3N5KA 4G67A 5IMBA 2YYSA 3TD9A 2QZJA 5EGNA 3RS8A 4KOEC 2LP4Y 3LPNA 2FLVA 4KC0A 1J2UA 3NALA 4U6QA 5LB4A 2YN0A 1GSOA 4BNVA 4MCJA 5JCXA 4D0GA 4ATNA 1SKMA 2PUCA 1GA4A 1VHJA 5I5GA 3OD1A 2B7CA 1MO4A 3FCSB 2JATA 2XMRA 6GPBA 2CFCA 4AO6A 1TO1E 3OEHA 2AMYA 5DLPA 3VR3A 3L8FA 4POOA 3ZVRA 5KX5A 3O47A 3LZ6A 4MIOA 4MOWA 5LZ8A 4Q19A 3W5SA 3GP8A 3CF4G 4LVUA 4RA9A 3PGA1 1FLNA 1CLUA 1ZKDA 2JLCA 2WIGA 1A96A 1NXXA 4MAAA 4UE3S 1OXKB 4MUXA 1IXYA 5FA8A 4TXNA 1A9PA 1DAEA 1R6AA 1IATA 1N92A 2IJGX 2O57A 4IFBA 5DXAA 4N5IX 4QGHA 1E1MA 3DXZA 5AW4A 3QEKA 4KNWA 4JDPA 2OORA 2X77A 4UHFA 4KKXB 1AGYA 1QG2A 3CJRA 4Q01A 1DAFA 3QBEA 4DOMA 1T2NA 1Z26A 4BCDA 3BB3A 2H16A 2COKA 1Y3CE 3H04A 4QAQA 3HYNA 4YJ2B 3SAJA 2HEIA 3LM8A 2BE7A 3GD7A 3QBJA 2D74A 3EB9A 1BSVA 3KU4A 3DV0A 2XDYA 3BBPA 4N7JA 3D7MA 4I6GA 2VK2A 4DTIA 1XD2A 2Q5LA 4BNGA 2PWYA 1GV0A 5KKNB 1IZZA 1ZD2P 3REFA 3VZPA 2RC5A 5EJ9A 1NR7A 1VI5A 3EMKA 1MENA 5A3QA 4DABA 5I3CA 2B98A 4JBWA 1ZLYA 3GZJA 1T8UA 1DIGA 2Y1DA 4Y9RA 5EOVA 1L8XA 3W77A 1FUEA 1LDBA 2ZZKA 2J0QA 2JGDB 3UHFA 2I4TA 4X7BA 3QEJA 4KMMA 1IY1A 3RABA 4F3CA 2HW8A 1QCDA 5LR6A 3NBQA 5IMSA 2OO5A 5AW9A 4KNYA 1X1DA 2XCQA 1OH7A 3WDSA 4PVDA 2ZREA 4DV3B 4K0RA 3JQGB 2ZYHA 2R11A 1JMKC 1Z8HA 1JX6A 2DPMA 2LBPA 2GYYA 5EMKA 1KSGA 1RXYA 2DH5A 3MGCA 3NWEA 3Q0TA 3H87A 5U9CA 2A2ZA 1ISGA 3BYZA 1QP4A 2X23A 2AC7A 5DBOA 1KS9A 1LJ8A 3D2AA 1FP6A 1X6VA 5E8RA 2NTNA 4OXNA 2C3PA 3AZPA 1JJAA 3GEGA 5IRCD 1VPVA 2DWPA 3JQAA 3E7FA 5K0LA 1PL6A 1CFZA 2PM8A 3LH5A 2PGDA 1Z5OA 3ON5A 3UQZA 4A15A 4OSOA 3NU1A 3OLWA 5T6BA 2C59A 2ZKIA 3IV9A 3OF5A 3DTVB 2YZGA 5FV4A 4HX9A 4WADA 2J09A 3QFTA 1QYRA 4OXXA 1X7XA 4RTQA 2H1LA 4BBAA 5FI3A 4K6GA 3DE0X 1IBSA 4JOCA 2P2GA 3ECSA 3IVGA 5A7GA 3S2IA 4EMBA 3DSRA 4O02B 2CNBA 2ZAYA 1Z7WA 2YJ4A 3KFVA 4IBOA 4M0UA 2AFVA 5JSFA 2VBIA 3IBSA 2C58A 2JFHA 1GZVA 3FPAA 3IB6A 5BNIA 5GY7A 3ZX4A 2W8BB 3HKDB 3IV6A 3AI1A 3NHJA 3AVYA 3U44B 1ZK1A 1AX9A 2QN7A 3RAJA 1O0BA 1EBFA 2QUZA 1H65A 1C1XB 2B1JA 3HZHA 4RJ2A 5JAIA 4G5OA 5JTTA 1L9XA 3Q9NA 5L7WA 1XJQA 2YC2C 1A98A 1RWBA 2AJBA 1YQDA 3GLRA 4LXGA 1XZDA 2AG0A 2VQ6A 2ORED 4V0KA 421PA 2C5GA 2BSQA 3RUPA 4PQGA 3U9LA 3ISTA 4L07A 1V8DA 2O7QA 5TE9A 1TVEA 3B51X 3FSJX 2OYRA 4IMJB 2OHOA 2EYQA 1QGUB 4FGKA 1QRRA 3DYVA 3ZWBA 1FFXA 4CL8A 3MG9A 2MCFA 2ZWVA 1IDN1 3H0EA 2WHXA 3K1AA 4LJLA 3JAMA 3ESXA 5JTUA 2PH1A 4W7HA 1QO9A 1RHMA 2DBZA 2DQYA 3ESAA 4FXOA 1E4EA 1ELOA 1PLKA 2O5EA 3UW1A 1V5IA 1I6WA 3DEAA 3MLAA 1SBHA 2QP9X 4WNYA 4ERNA 4MJ3A 2PEYA 3CKKA 4CR6A 4NBWA 4CMEC 4ETNA 2IHVA 1C8LA 2KMLA 3E03A 4HGQA 4OFZA 5BO5A 1ZL0A 2L69A 5P21A 1F17A 1GITA 2OZKA 2Q9BA 3X43A 5K99A 3I64A 3AY0A 1T4GA 1JQKA 3ASZA 3EGWA 2FLKA 3KJXA 1RYBA 2OHJA 1WP4A 9GPBA 4ETIA 2BMEA 1USVA 1U0EA 5FTJA 1BWQA 1DTEA 1RJWA 4E5SA 4CKCA 1WHTA 5J4LA 3M3DA 3BJEA 1AGXA 5TQ2A 1A77A 1TQ2A 2IGTA 2Y2VA 3PX2A 4MQ5A 2H1WA 5E9QA 1L5GB 3WYEA 2WVJA 3OBIA 4QOGA 2DPLA 1G21B 2H4YA 1PZNA 1XZJA 3D1LA 1F8YA 2XNCA 3LOQA 4GMDA 5LKRA 4DA0A 2YWXA 1Z6ZA 2PSHA 2QW8A 4K6OA 5F33A 2XLBA 3QIAA 2NU8B 4BO6A 4IVRA 4X6LA 4UTNA 3BMCB 2GAIA 4CT4B 1I30A 4OBEA 3NNDA 3RQSA 1U2RA 1CJCA 3G82C 1FDIA 1VKRA 4N41A 3COPA 3IIKA 3M2TA 2XBUA 4WKPA 2O8DB 2M98A 3DBRA 2C4VA 3NFRA 1PGQA 4FYHA 3TOZA 5E7IA 2V45A 3MWFA 2WJJA 1A2OA 2VDRB 3SVLA 4C30A 3LBAA 3FVQA 2GR9A 4G5XA 4PLFA 4LZJA 4AICA 2G9ZA 3JRXA 3S7ZA 2Q9AA 1ZCAA 4RTOA 5KMGA 5JFTA 1VSTA 4QG7A 3W5BA 4QBIA 3HBLA 1DBIA 2IA5A 2RAVA 4OAOA 4RSMA 2KS6A 5TGTA 4DMHA 4EFDA 2UZ4A 2KM1A 4FXPA 1TMOA 1S4QA 3BPSA 4K6MA 1KYXA 3VO8A 1X87A 4FSDA 3ESQA 2QRJA 1FDRA 4FFOA 4TYMA 1G18A 4RFVA 3E1KA 4IJVA 3TW8A 2BJVA 1H5UA 4HP8A 5G4LA 3PITA 4F96A 4XZ3A 1HXHA 1DO8A 5F98A 4DR4B 4C87A 4CM9D 4CTNA 2HPVA 4NE9A 2FPLA 4MHTA 1Z5UA 1IEXA 2NYVA 3PNLA 3UGQA 3HCWA 2FF7A 3DOHA 2OAP1 5ELMA 1RC0A 2B8TA 4ZICA 2CMHA 4WZBB 2OO7A 4B34A 3H2BA 4OX9Y 1ZESA 1KY5A 1A8PA 4X45A 2ZITA 4TLLB 3SF8B 2GM4A 4H15A 3N75A 4MVJH 3TN7A 2WYIA 4FNMA 4NYMR 4U63A 4YP1A 4IUYA 4US2R 3FVTA 4Q7QA 1D0VA 1UXIA 3RUEA 4EPRA 2JZCA 2AKYA 4MP8A 4UUBA 4QZVA 5JY6A 3TMAA 4UDYX 2G40A 1KH3A 4KXWA 1CG6A 4O5AA 2CCGA 3O82A 3E9NA 4CF6A 4JLKA 2VTKA 1FRQA 1NAHA 1HTTA 5FOQA 4ZT6A 3N2GB 1YH3A 1VB3A 2NN3C 3CF6R 5F4BA 5FOXA 2BISA 4E07A 1D2CA 5DTIA 5HCUA 1UJCA 3KELA 121PA 3T7EA 4QOIA 3O92A 3ZS9A 1Y9EA 3CWCA 3D0QA 2AWNA 5EWLB 1Z63A 3ETLA 1EFTA 4WOJA 1KEEA 2P1ZA 1KFCB 1B8PA 1TVCA 1D0IA 4CHTA 4ESEA 2NW6A 4P32A 4YQZA 5FV7A 2GX6A 1Z68A 3ME5A 3NHWA 2P65A 2V58A 2FPMA 4MS3A 1KR5A 1E1QD 2HMYB 2RKBA 5CHEA 4HDRA 4PLWA 1A4XA 3GGOA 4PHFA 1C1YA 3VYSB 2DHRA 2CXPA 2Z3ZA 2ZSIA 3KXLA 4RESA 5GWXA 2EGHA 4R81A 4BWYA 3LXUX 1GTRA 3DLBA 1I4OA 2B37A 1N6LA 2ZS7A 2CNNA 1NFFA 3EG9A 4Q4HB 3K9FC 3SXJA 3OIWA 2W2VA 1U2GC 3OLZA 4L5AA 5BOSB 2W2MA 3P71T 5DRYA 3W5IA 2J32A 4XSHA 2ZB7A 1C2YA 2B94A 2NOAA 3L8HA 5BPHA 1SXJA 5IEJA 3D31A 4GKVA 4JLNA 5IKMA 2L82A 4KGVA 2PSEA 2PHZA 3JALB 1OZGA 5B1EA 2H1RA 4AZ0A 3W6UA 4X1OA 4QREA 5I9SA 2BFCB 1NQUA 2ZIAA 3N8HA 4BB0A 4RIFA 4OHFA 3HQ4O 4F2GA 1YFLA 5L3SA 4J16C 2XYHA 3DMGA 3IODA 4ICIA 4JQYA 1CUVA 1USKA 1EVIA 1E2EA 2DH6A 4Q9JA 4QDKA 4GRAA 1A2BA 4OB6A 4PGAA 3V8RA 3TIGA 2JD1A 1T3ZA 4ZU1X 3HYCA 2AF3C 1UZMA 1PR1A 2X8AA 3CZ4A 4PWYA 1TZKA 3IQFA 4YECA 5BSFA 3G8DA 3MUEA 4L4UA 2H18A 2I1WA 3TSZA 4CKXA 4LDNA 3AF3A 4M36A 2FSSA 5ALJA 3EXHC 5IJAA 2YWCA 4IZ6A 4OI0A 2PL9A 3LUJA 3IJEB 4MQFA 3BQ9A 1X3SA 2D5LA 2XZTA 4Z0TA 4TKUA 2UVPB 5COBA 1FRVA 2WMYA 1MOPA 3MPUA 3NVKI 2R2GA 3L7BA 4QNMA 1Y8RB 3BJMA 4QO8A 2PGLA 4BBJA 3ICEA 5CMLA 5I51A 2XSZA 1Y3AA 1HFJA 3TZBA 1D7AA 3NV9A 2X9NA 3FYCA 4II7A 1VKJA 1UPFA 3G1TA 5EE1A 5GONB 4RLSA 4DXDA 3S1LA 3H2HA 4P08A 1M2VA 2KBEA 1PEDA 2YHUA 2HJ9A 3DCNA 3O8QB 4QYIA 3AG6A 4XJXA 3S44A 1TCCA 3OECA 4JD5A 4A5OA 3KPJA 4O2BF 5EFZA 3P5BA 1X7XB 3BAFA 3Q9SA 3A9SA 3I83A 4FDAA 5ALSA 4O8CA 5I7VA 4RK4A 1N2IA 2B2CA 2WKPA 4YP9A 4AP6A 3B1WA 3PEVA 3PRYA 3QVVA 1M34B 3N3BC 1S02A 3W1VA 5ER9A 2DLCX 4HKTA 5KWSA 4FCVA 5BUCA 4ZOLA 4GUAA 4X3OA 1TU4A 3I01A 1U8UA 3PXXA 1MJNA 1XU7A 4FGSA 3IXMA 4CM8A 3UZUA 4P53A 1LX6A 1XTRA 1YI0A 4MQFB 3TLJA 1CCWA 1Y8QA 3FDZA 3OOSA 4LSWA 3FWKA 4BB5A 4Q66C 4HRXA 4KACA 3NBAA 4Q16A 5E8JA 1NJ1A 3P19A 4V0LA 5BWCA 4N49A 3NPAA 4ND5A 2DVMA 2PA0A 1RQ7A 3GH1A 2MWMA 3STVA 3H4IA 2ZVPX 1QH1A 1VFNA 5DOVA 4WK4B 2WI8A 4XD2A 1SOAA 1NVDA 2PKQO 2ATIA 3Q10A 5EHQA 4BMPB 9ABPA 5DWDA 1B3BA 4W5RA 4TZKA 3WJ1A 1O5OA 1QAQA 3S1AB 1YF3A 4XWGA 3EYAA 4QRIA 5FNVA 4XOUA 4JUIA 4UDNA 1YDFA 2EFHB 4GGOA 5EMLA 3MHPA 1FNBA 3PI7A 3X2SA 4X1KB 3JY6A 1LDMA 3DDUA 4FTWA 2NPFA 3PJRA 3I04M 2VJPA 1VYUA 1Z4MA 3EXHA 4JBLA 3DL2A 1XDGA 1F3OA 1U6JA 4XIJA 3DEJA 1BD4A 4Q4AB 1AH2A 1ZCFA 2HHHB 4FUTA 1QX3A 4O2LA 1FP1D 3AINA 1JWAB 3TM4A 3PSHA 3H18A 4NY1A 4OHCA 4FC6A 5CBPB 1KYWA 1JNXX 1ZJ5A 3OQ1A 2O2JA 3VJKA 4JBYA 4ZVKA 4AZTA 2ZTSA 1VZ3A 3GRFA 4RACA 3ASVA 5TRTA 3R75A 4K81B 1XEFA 2HJVA 3U3ZA 1K8RA 3WWDA 3RB8A 3AFOA 2JHFA 4C6TB 5JD5A 4RETA 3R4CA 4E5DA 1OI3A 4L27A 2WIAA 2C83A 3OKCA 1MNQA 2GVNA 4A8TA 5E38A 4NHOA 2WAMA 3EGDA 2W98A 2E4UA 1W0KA 1PJRA 4M6WB 4UM8B 4ZYVA 3EDMA 3H97A 3QI7A 4W6QA 3UJBA 3B7PA 1JFVA 3P9ZA 5F2OA 3AZQA 5CDYA 2G72A 1HURA 2PPVA 1JHQA 1MFZA 3EDQA 4XAQA 2JAPA 3F2IA 1SVOA 2AOTB 2ZZMA 4YRZA 5KX5F 7MHTA 1D1PA 4AL4A 1H1LB 4F6CA 3CVJA 3O1HB 3S81A 2NACA 2ET6A 2EW1A 3DMPA 3ZE8A 3HLYA 1LPOA 4N3AA 2FW8A 3FI0A 2YJ5A 1D6SA 2C5HA 3ZCTA 3ELYA 5JBIA 1R4NB 3HCRA 3PPIA 4MEAA 4MP3A 3WI7A 2V7VA 5DSXA 5C0OE 1FU4A 4F8EA 4KV9A 4UQPA 4EY5A 4BGDA 1J0BA 3MOSA 2E4YA 1ML3A 4PSDA 5CNMA 5BWOA 1CF4A 2I1LA 2IEIA 4QJ4A 3WP0A 1J21A 4DWJA 2XXAA 2FMFA 2NMVA 1PR9A 4WESB 3C4JA 4MO2A 4YLYA 2C0CA 3PKZA 3Q40A 4RGQA 5DTRA 4RVFA 2XB2A 2Q5IA 1HDEA 2YW2A 5FBLB 1AN0A 3MHTA 2WV9A 4YJGB 1GG8A 3F67A 1D4OA 2VHVA 4KXFB 2RGEA 4QPDA 4CKCB 3U61B 4MGHA 1YJBA 3A11A 2WLSA 4HNQA 4OBBA 5LD2C 3DA8A 2I6SA 5F12A 5B55A 2IHBA 2NP7A 3C45A 1KVRA 1KDVA 3G9UA 3W3AH 4HEA6 4LBYA 1NKTA 2NZ2A 2WM3A 3H6KA 5IANA 3V1YA 1TZCA 3O5AA 2QR3A 2GCIA 4EJ6A 1IQ0A 3UOGA 4OGFA 3FSGA 1HLPA 4B6OA 3GP5A 2DFTA 4JLSA 5IKXA 3ROZA 1GZ6A 3TX6A 3OE7A 3JQQA 2PX2A 2CVZA 2Q3MA 3M0EA 4RFSA 4K9KA 3WBBA 1U2PA 2Z9CA 5AWFC 3ODGA 3UWDA 2ZM5A 4BNTA 4BHTA 1U0RA 2J1LA 3VNSA 1Q0TA 2QT0A 2YOGA 3B2EA 3VYUB 4JQSA 1XK6A 4TN1A 2AC4A 1RIFA 1DOZA 2WF9A 1SUAA 4IIVA 4K1LA 5HXAA 1V5GA 1IM2A 2QU7A 3BG5A 4QQ8A 4D6PA 1ZKMA 2NSDA 2ZR9A 1MB0A 1S0UA 2JVKA 5C2JB 1B14A 2GKGA 2OM2A 1EFVA 3V8VA 4GR4A 3ZZNA 5AI9A 1JV2B 3AW9A 3ZTYA 2HXGA 4IDPA 5DCYA 4U0JA 3O90A 4L5BA 5AW8A 4KPGA 3UJCA 4Q3AA 2ZYVX 4NCXA 4BJ1A 1M2JA 1CUBA 3PBKA 3HDGA 3CT4A 1KOGA 1O94A 4AJNA 2X7HA 3K4QA 4L0CA 4RTMA 1BJRE 3EISA 1MIHA 4MDYA 13PKA 2QI9F 3A6EA 3TRDA 2CVHA 3ZDYB 1PV4A 3V8MA 2F1HA 2ZIVB 4UCFA 5C5CA 1R27A 3N7AA 4RVUA 3E9QA 1R18A 1M1YA 3FCXA 4G0QA 5C51B 4GL2A 3E7DA 1JZSA 1SN7A 2IUTA 2PL1A 3B1KA 2AL7A 3H5NA 3IP6A 3ZEIA 1FRZA 4AJEA 3WLFA 4NYIQ 3LGSA 3LBHA 1YKFA 4LSGA 3TQQA 1P5RA 1I2AA 4GAEA 1T8RA 4X6UA 5T67A 2FSFA 1Y6GA 4H77A 1Y4DE 1ZZEA 2PLNA 1BYUA 2YH2A 1C3VA 2WJ3A 4JLVA 4E2FA 3QLVC 1AD2A 3PL1A 1F8FA 4LXXA 3UXYA 1B74A 1CWUA 3UY4A 1WDTA 3NOQA 3IEVA 1EBBA 4HRAA 2FJ0A 3LDGA 5DP1A 5AK3A 1A04A 1K6MA 2EFGA 2HK6A 4LEIA 1VBMA 1QXSA 1V37A 3L6CA 4OQDA 1XCGB 5BT9A 2BGLA 2RGRA 2Q5EA 4DMCA 2XUOA 1N33B 1QO7A 3M70A 4FNAA 5C5IA 4LECA 1B26A 2A67A 3PGVA 2O1EA 3NQ41 1KSJA 3NBXX 4KLNA 1NN3A 4QTUB 5DU2A 1W94A 4GX5A 4BCCA 4I55B 2PFSA 5F3RA 2NZVG 2IYEA 2VSNA 2ZS8A 3DV2A 4AJKA 1ZA1A 2SKEA 2X2OA 3VNVA 4F04A 3ZE0B 1UEXC 3T1QA 1R9JA 3DVLA 4EB6A 4YONB 4KFUA 1LU9A 1BWSA 3CSDA 5E1MA 1CR1A 5B1HA 5KNCD 5I7EA 2PWBA 1K68A 1KDRA 4WSOA 2P2YA 5F3DA 1G8PA 2AXQA 2CJWB 2H54A 3R0JA 4FYKA 3PDIB 3PYMA 2VUIB 4FDUA 2J0UB 1JDTA 2YHIB 3VC7A 2V8OA 4Q12A 3W1EA 4AJ4A 3PGLA 3IDFA 4LVOA 1KIMA 1X7WB 2HN9A 3MLBA 1ETUA 1NC3A 1JEYA 1ZD5A 3DBVO 1WMFA 3SZ3A 2P9CA 1PYGA 2E18A 1O58A 4RZSA 3TPZA 4ZHQA 1W36D 3QSGA 4RC9A 2OT3B 1HOTA 5KREA 2NIPA 2JANA 3HBAA 5D3MB 3HDQA 3EY9A 2HSEA 2RJNA 4QHSA 4P4SA 1ZXLA 1MPTA 3TQFA 3F6EX 4D4LA 4DA9A 1R2QA 3WGNA 3PEWA 2HMVA 1JTVA 2HNBA 3KKLA 5CDFA 3RVQA 1G9SA 4A1OA 4AJPA 2QTBA 2HTFA 1IIRA 4Y2JA 1D2GA 1K8YB 3QUBA 3FUUA 1HE8B 1TEVA 2NXCA 3O73A 1NF8A 5HNKA 2BVNA 1PFGA 3QXXA 1VJ0A 4OREX 5DN6A 3CVXA 4L2IA 1OKKD 2W2LA 3ND5A 2OD7A 1Z83A 3SYLA 2BFBB 2IXGA 4KSCA 3SLKA 4E5YA 5K5EA 2PUGA 3DM5A 3HXPA 4GVLA 1BA3A 4LNUA 4OQ4A 2MSLA 5CCBA 4MDFA 3GLUA 3M2PA 1IL0A 5B6JA 4FOOA 5LPNA 5FPTA 1AURA 1XN4A 3KQOA 3LPAA 3ER9A 4DRXB 1MDBA 2EP7A 2LWIA 5E7MA 5IC4A 1F5NA 2G28A 3EA4A 3EGXB 1M5RA 1SULA 1ORWA 2IS1A 3E9CA 2GBGA 2NSYA 3E1GA 5DHAA 3K9WA 2RHGB 4PZLA 5DWQA 3ZGNA 3T3DA 2Q45A 3A1NA 3QPDA 1PWZA 5CT8A 1U2QA 3LDFA 3D3JA 5TMPA 4FFRA 3ZY4A 3S5UA 5DM4A 4YB8A 5EJAA 4C2BA 4D4IA 3M4ZA 1M74A 1G1MA 5CH5A 1KHTA 1W4CA 3H75A 5I7HA 4AMYA 1KJJA 1NNUA 2BE9A 2HJWA 4C6RA 1C9YA 1E3QA 4Q4JB 1P7YA 4BV3A 2C42A 4PLCA 1KO4A 3ZW8A 5K01A 1EX7A 1FW6A 3F74A 1CUIA 1G8JA 1XLVA 3OD5A 3OMWA 1HT3A 1R6TA 1XMVA 1Q2XA 5E6SB 2XITA 4E08A 5JNWA 2VDWB 3HCBA 2KBFA 3OOJA 2Q0XA 4DLZA 1O6ZA 3TOCA 3ZHTA 2P0AA 4BU0A 1U8FO 3O03A 2BGGA 2Q3BA 2EGUA 2ZRLA 4KNVA 4F06A 1Y0BA 3K70D 4JNCA 5GONA 1PWYE 2IS6A 4Z0NA 2PKWA 1ZJWA 3FN4A 5EG5A 3X1KA 3UV7A 1DWQA 2VHYA 1UJMA 2X19A 1DTWA 2QLLA 3CQ9A 4EZBA 4HYQA 4RJTA 2DFKB 1CF2O 3B6JA 1WXGA 2VQ3A 1WD5A 3PUVA 2XZOA 1B2LA 1GNLA 1PTKA 3E18A 1NBHA 1WF6A 2HQ1A 1W8IA 3OX1A 1CDDA 1E9BA 3C7TA 3IE2A 3SDSA 5JARA 3DE7X 3A6GA 4RKFA 1PUJA 1PCXA 3OSZA 4ZI3A 2ZPUA 4KQ9A 1DQSA 2P9YA 2G0TA 5ENDA 4CV2A 3M4YA 3AFHA 2FX3A 1JR3A 4LJ7A 3I01M 1Z2PX 3VTZA 1I6KA 3QYFA 3DWEX 4MUNA 1YV9A 2GOYA 3V33A 3JYHA 3OU6A 3V9AA 1QRUA 1S3IA 5I9NA 4PYMA 1AGNA 3DCJA 2QAGB 3L7AA 4HAYA 1AN9A 3GPCA 1JLMA 1FP7A 3RLFA 3T1VA 3WYBA 4RVCA 2BZGA 2JVIA 2YJ6A 2FETA 1ZVKA 2OZPA 1LNZA 1MB9A 1RJGA 1NJFA 1P1RA 1Y33E 4TXHA 3ZNOA 4IZHA 4CF4A 2EC5A 2P3QA 2WT9A 3KHSA 4DSAA 3A3YA 3GN2A 3HA7A 1CR2A 3ML1A 4GI2A 2PFKA 4WQMA 3RIEA 4LQDA 4CQLB 3WNDA 2O8FB 1DX9A 5AUPB 4ML3A 4JC4A 1RZRD 3RYCB 1T8WA 4EFLA 3STUA 2ZS9A 4Q6BA 1GEGA 2HDWA 1P7WA 5CGZA 4RPGA 5FTKA 1GNQA 3MD0A 1F8UA 4R51A 4WCDA 1IAQA 5IX8A 3EGOA 1IUOA 5DI3A 4KO3S 2N47A 5E2BA 2XT6A 3TMYA 2IYSA 4R8MA 4WLOA 1K92A 2YBDA 5DM2A 5BRAA 5MFPA 4G84A 4GBMA 3QLVA 3EZFA 3WOHA 3G2LA 1L5QA 1G5PA 3GBPA 3KOOA 4BEJA 2OKGA 4ENVA 4AZSA 4BN5A 5KTTA 1NNEA 2I99A 1KOJA 2WV7A 4GLLA 5BW8A 3ZHZA 5ECYA 1G7CA 3U5TA 1LFAA 1N2GA 3AHHA 4QNRA 1EG7A 2YZMA 3CNHA 1ZJ6A 3NVDA 4RV9A 1MRSA 3OG9A 3H2ZA 4UAVA 5IS2A 4TKZA 1DI0A 5E1BA 4QYSA 1HDCA 3QWAA 3OCZA 3VAZA 1GAWA 4C2TA 1EWYA 1E3TA 1ADGA 1YQTA 2VCHA 3CSSA 4LV6A 2CJYA 2VNJA 2G3YA 3OQOA 2BBSA 3I09A 5G02A 5HZGA 1O7JA 4UTXA 3RT9A 1HGXA 1BEUB 2VL7A 1ECCA 3AF6A 3MW8A 4M8IA 2O8CB 4YAOA 3U4GA 2JFFA 3KQPA 5IT9A 3UMMA 3E9MA 3CNNA 2AK3A 3K6RA 4WN9A 4FOLA 3L4KA 3R3ZA 1B1CA 1U7TA 1C7EA 2FK7A 3G59A 4EHKA 1OLXB 1BS1A 2VBCA 5HPYB 2QKYA 4ENPA 2CJPA 4OQNA 2VT7A 3ZHRA 2YHAA 3CLUD 3C98A 3M6LA 2ZE8A 4RV4A 2HQOA 2PGAA 1XPJA 3RTGA 3S2SA 1H6DA 5EIBD 5EIWA 5LZ7A 3WAJA 3LUBA 3HEMA 3OEYA 1W73A 3FE2A 2QY9A 4FOTA 4EO7A 5A02A 1YA6A 4I4NA 4UHCA 1F8XA 2BZ1A 4NATA 5ALMA 3H3FA 5CEEA 5FTLA 5FUBA 2PBRA 2YZKA 2FRXA 2WUGA 4RDHA 3A6ZA 1NOJA 1PQ4A 4G0XA 4UM7A 5CVTA 1EJBA 1N6KA 2H06A 1O6CA 2O2XA 3HCFA 3VXKA 1QIIA 4ILKA 4Q7JB 5EWLA 4E30A 5CBKA 5JBNA 1YDEA 3QF4B 1IWOA 5D6OA 1T1EA 4C9BA 4YRRA 2ZT8A 2BSAA 4WT7A 1QOZA 3E58A 4L8VA 3BHMA 1CQWA 1XXHE 3Q85A 2PKQP 4PM4A 1P1JA 4TV8B 3S2FA 3R4VA 4DCCA 5KX5B 4OD0A 2FWNA 4Q21A 1RWWA 3ANLA 4E2ZA 3PGJA 1LRLA 2C5SA 3IQZA 4WJLA 3BF8A 4ZAXA 1U3TA 1T8TA 1CQXA 5IABA 2YN4A 2QHXA 4CG0A 1MV5A 4TLMB 2Y1GA 3VU1A 3UJ6A 4CEJB 4FMPA 4F38A 1W52X 1NYTA 2B8EA 2O2DA 3RSHA 4G5GA 4CLEA 4EY7A 2AD5A 2P11A 4G24A 2ZAOA 5FI0B 2NZ8A 4EKYA 1WXIA 2OV6A 3DLCA 5KNLA 3B12A 2NXNA 1LRKA 1HSOA 2OBFA 1NZFA 3A36A 3E48A 3GT4A 3QVLA 1BVHA 4Q1CA 4L4XA 5K3FB 3RFXA 3QUSA 2J9YB 2IHJA 2XWSA 4IKEA 4RNDB 2AUTA 3KV1A 3GMSA 3A1SA 3LLMA 2CJWA 2HFJA 2OHHA 3KB8A 3CX3A 1Z06A 2X22A 1OVMA 3CGWA 3VNAA 2Z6VA 4BTVA 1ZVQA 2BM8A 4CWAA 2BHRA 2C9CA 4ZJUA 4EB8A 2WZCA 2ZI3A 4LXHA 3SS7X 3NRCA 2FVYA 2E82A 3UQYS 4HQ6A 4DPMA 4DLTA 5J2TA 3VU0A 2A88A 5DVZA 5AK5A 3VU8A 5JMWA 1G55A 1T91A 1WWKA 1Y42X 4M0LA 1U0TA 3O4HA 4NMLA 4CCWA 3AR4A 4D42A 5KDOA 1JA1A 1TKBA 3K6KA 4AAYA 4GG1A 5EKSA 4HGNA 2WUFA 4EY8A 2LGJA 2LKDA 2XADA 3MWLA 4PTLA 4RMHA 1CS0B 1GSIA 1Z2NX 4KQ2A 1XMIA 2IXEA 3HYSA 2OLEA 5TT0A 5EMMA 5D2CA 3DMRA 3QX8A 2FRDA 3RG2A 3E2MA 3LUDA 1C5KA 1GRVA 3DDWA 4MPTA 4EDHA 4G0UA 3TUIC 2VRWA 3BRCA 4EPXA 4YIHA 4DKJA 4KWTA 3PXEA 4C05A 2WTMA 3EEBA 4Y2UA 1QZZA 4YIKA 1UMBB 3P9CA 1U1EA 2IBSA 3SG0A 1SC3A 3LP6A 2IHKA 3R20A 1L5KA 4OKSA 2NLOA 5ESDA 5HIMA 8ATCA 2F3RA 3H6HA 4LGCA 3COZA 4YAWA 1T4BA 4LQCA 5D5QA 4OLBA 3BC1A 1CJUC 3VJRA 1ODSA 2WSMA 3Q2IA 3R3YA 4R6WA 1BAPA 2O8NA 1PLLA 1XG5A 2EF0A 3PEUA 2ATXA 4I5IA 3ZHXA 5HZKA 5J2TB 1G3MA 2ZWMA 3TAXA 5IJ9B 3L7NA 4S1OA 5FR2A 2ILVA 3K9QO 2Q7DA 2BP7A 3BWBA 4DJEC 4QVIA 2QV7A 1BZYA 4YCMA 2F1OA 4C4RA 4ZJPA 2ZR8A 4MPDA 4LOIA 2NO5A 4FDLA 1VM6A 1TECE 2YFHA 4N8SA 3F5MA 1QANA 3OZVA 4ZI7A 3KL4A 4B6PA 1T1SA 3NG1A 3VO9A 1KO8A 2NZXA 2SECE 3WKBA 3G2NA 3LY9A 2DFVA 1SWWA 2JAHA 2WFLA 4MUEA 1K9VF 1W4BA 5EERA 2Z2IA 4MRVA 1RLUA 2GM9A 2QJWA 3HWX1 3ONFA 1OFGA 2HD4A 2HLNA 2G1JA 3CG0A 1GN8A 5AM5A 2YQ4A 4D02A 5BV1A 4JLUA 4OQFA 2ZP1A 5T3YA 3W8EA 1HA3A 1E2DA 3NHZA 5DSZA 1GGHA 4ZDKA 2HWWA 5B58C 3Q3HA 3GFSA 1WXXA 1CU1A 4J29A 1YC5A 4DQVA 2Y93A 3TAUA 3ZJTA 4GYYA 4ZXPA 3WWCA 5AK4A 1FDOA 2YV3A 3MRTA 5I45A 1QV7A 2X9QA 5CJPA 4HDKA 1FFEA 2FMTA 1RI3A 4CV1A 4Z9BA 3TH5A 2XB8A 1K3UB 1NI4B 4G1EB 1O6BA 1EP1B 1UBSB 4F5WA 4FZ5A 2POCA 1T29A 3B1VA 5BRJA 5I7SA 1VLZA 2X8BA 4FGZA 1ESEA 1XA3A 3IELA 1F06A 2INGX 2QW1A 4RGVA 4B47A 2OGZA 4US0R 1KJQA 1J2TA 2IUUA 1I24A 2YZ2A 2QTHA 4Y2PA 3GFPA 2A35A 1K8XB 1D8TA 3BORA 2D5CA 4GFDA 1G4HA 4MQEB 1CIPA 3DR5A 2JAUA 3C3AA 4I14A 4QHTA 4B2PA 3AL0C 4X54A 3FMIA 2COEA 2DAPA 3PXCX 2ZIZA 1JEJA 1N34B 1J0CA 5BV0A 1GTJ1 4W5JA 1ZSNA 3L9WA 3WGQA 5IKPA 1IY0A 3JQAB 3CVOA 4NEQA 4PNHA 1ODLA 5KNDH 4Z9FA 5BW5A 3P7MA 1QOQB 3NH9A 1GL9B 2ACVA 4OP2A 3RRNA 1NJSA 4FMDB 3PFNA 2QLBA 1DKNA 4L8FA 3OLXA 4CQNA 1AT1A 5CXSA 2AOTA 1R15A 1NG1A 3GLHE 4GMHA 4KXYA 4TOIA 1P2GA 4GOKA 4Q82A 5LQUA 1MN6A 3AKCA 4WL0A 4N6NA 5HA5A 3WZMA 1BTOA 5FWAA 4IKOA 4KIFA 2HSZA 1ZGBA 4ZREA 1T6NA 5FWXA 4BCBA 1ISSA 1Z4JA 3EWIA 4W5OA 2XUZA 3KLOA 3B1JA 1GPWB 1P8AA 4XD7A 4Z1MD 2R7KA 1RLMA 2PRZA 3HE3A 3IQGX 3THOA 3I1FA 4AKEA 2D54A 3DHYA 4DLYA 4YAGA 3PX7A 3FWHA 1G5FA 1BHJA 2DMRA 4H6WA 4XQ9A 3FOEC 2VZ0A 2QTNA 2YUTA 4G1MB 4M1QA 2ZRGA 1XZBA 4D4GA 2PU5A 1VDZA 2AE1A 1JYEA 4WK6A 4F92B 3FYDA 4UNIA 1A8SA 2B0JA 1U2GA 3QWFA 3E3AA 1KYVA 5C1DA 1GPNA 4RH1A 3RADC 3IVXA 1HY3A 5AI8A 3A9CA 1ZXXA 2JRCA 5DNUA 2R3SA 2AW5A 4QJBA 4ZARA 4LF6B 2PS9A 4UTOA 1XTPA 5HE9A 1IHOA 1UBUS 3UJ7A 5JNSA 1CB7A 1X1SA 3HBFA 1ZOIA 4UMEA 2YS7A 4PIPA 4U02A 5ARCA 5EZYB 1H8HD 1VJGA 2X1HA 4ARAA 1NY5A 3PQ7A 1V25A 1YASA 2VYVA 3I8XA 2LIVA 4D9KA 5TJHA 3RH0A 3UYLA 4ZOBA 3BFJA 1S1CA 4KOAA 4M86A 4DHEA 3ZLJA 1JJFA 3NDJA 2O6HA 4Q37A 1JILA 1GCUA 1ZVMA 2YN2A 2ID8A 1W9HA 5CLJA 1BXGB 4WOCA 2J5XA 1BXRA 3RHTA 3HO6A 4BFCA 4D9BA 5GQSA 3KPVA 5JS6A 5ALKA 1QH9A 4R16A 1VB5A 2OCDA 4IIYA 3WADA 1N0IA 1OZHA 2AYYA 3EBOA 1VIAA 3KDSE 3QXSA 4RM2A 4RUKA 4XWYA 1E6WA 1YTLA 3H7AA 4X00A 4DIDA 1CY6A 3C48A 1GOTA 3B82A 3DTVD 3L06A 1MW8X 2I4OA 2CZCA 2PT6A 2UYQA 5E0KB 4CTOA 1W48A 3IE1A 3DP7A 3L1KA 3W5HA 1AQJA 2YWHA 1I1HA 3I0NA 1TK2A 4C4ZA 5E7QA 4HG2A 5IM4A 1EG2A 1Y1QA 4WJKB 4GZ6A 4G0MA 3PWZA 3I5XA 4EENA 4JEHA 1IBMB 2FEMA 4TMXA 1P7VA 3VR2D 2DUMA 4YQYA 2R6GA 3HCNA 3TE6A 2VS1A 2E1PA 1W59A 3KT3A 3RV3A 3VU3A 4R84A 3Q88A 3HCCA 4YQFA 1PJCA 3U4QA 3MA0A 1O4VA 4OP3A 3AKDA 1KY2A 2FKAA 3I3SR 3KUUA 4HADA 1BEEA 2PUDA 2Z2XA 5HUJA 4RHFA 4AN0A 3AEUB 3S2ZA 2QJOA 5A6SB 4MVJE 3K5IA 1R74A 2PMFA 1FMFA 5D3ZA 5G40A 3M83A 4HNRA 4KIGA 2XA9A 2QN8A 4NZYA 2C7RA 1R3DA 4JGGA 1XRSB 3RUFA 2WA2A 1S96A 1ZNWA 1NQAO 4OEHA 3A3OA 1L6RA 5IWCA 4IG9A 1MHPA 2AMFA 3DAHA 3T7KA 3VR0A 2DFLA 1FLVA 1R6BX 2SBTA 5DYGA 1AHIA 2JHCA 2P9BA 4KW7A 2XTJA 3AR3A 2HADA 4ZQCB 1DQNA 1XVVA 4FMCB 5ILGA 4JI3B 3VPDA 2ZRDA 4D43A 4WKBA 3KB2A 4BZZA 1TZBA 1L9KA 1SHKA 4OI1A 1RKVA 4WA8A 4Q47A 1KQGA 4GQAA 4PGGA 3MRVA 4ZI2A 3OE7D 5AJXA 3TSWA 3BWXA 4WDRA 2GPBA 1A72A 2D00A 4TT3D 3LHIA 2BD0A 4AKSA 1WS6A 2MYNA 3SIRA 1HEYA 4IDNA 5EHNA 3TUZC 3HRIA 4P38A 1NBME 4QELA 3M5WA 1K6IA 3IV7A 4E2WA 1U8ZA 1VIYA 3VYTB 1HDZA 2XNKA 3PKIA 4FK8A 2X6RA 4FFDA 4B6GA 1DWPA 3AILA 4FQ5A 3MTBA 4EH1A 4PNPA 3N87A 2OHGA 2OE2A 4IIGA 3EMVA 2C95A 2W9XA 3OQIA 1MV8A 2DY1A 3EQ9A 1RRFA 2CXTA 3FPEA 4L74A 1FDSA 3OJ0A 1U4NA 1ZP6A 4C5AA 3FYUA 1V2HE 5DTQA 4JT9A 3BSWA 3KK0A 1SUCA 3V7YA 3QPAA 1QG6A 1IOLA 4J7AA 3LC7O 4KLCA 4NPAA 1W0CA 4MV0A 4Q39A 3LLCA 4DZZA 1FUKA 4YWHA 1NNI1 4FNGA 1AXEA 2IPAB 3JASB 1GGJA 5BT8A 1UEJA 4QYMA 2BDTA 2BKXA 1NBMA 1DQRA 2D5BA 3LUGA 3ZLBA 4JAVC 4JFRA 2Q3CA 821PA 1UBCA 1ZYUA 3AKEA 5CT6A 2Y1LA 5CP8A 3BMOB 5EZSA 5AUQA 4R2HA 4R2IA 1OV4A 3BCRA 6REQB 3FB4A 1C7JA 1WLYA 3UANA 1IQRA 3FAKA 4J0CA 4ENSA 4BEWA