3DWFA

Crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
271
Chain Sequence
EKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNVLSNERW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
publication title Mutations of key hydrophobic surface residues of 11 beta-hydroxysteroid dehydrogenase type 1 increase solubility and monodispersity in a bacterial expression system
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase
total genus 101
structure length 271
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dwfA00
3Q2KA 1P1KA 3D4OA 3BTUA 3WS7A 1ZK4A 3FNHA 4II2A 1O9BA 2D4AA 4PLFA 4UEJA 4WKGA 5A9SA 3BMCA 1VL6A 2JFFA 5TSDA 5ENDA 3WYEA 3I4CA 3GPIA 4WUVA 1E5QA 4E5PA 5C7OO 1U3WA 1FDSA 1PS9A 5I7SA 1CQJA 1G1AA 4DC1A 5I9NA 2EKLA 3KLMX 1NWCA 2AQIA 4O5OA 4KQWA 5A1TA 4BKQA 2QRKA 3EDMA 4BNMA 5IZ4A 1V3TA 3VAZA 1RM5A 2ZIZA 3O26A 4F46A 4RF4A 1YQGA 2CVOA 1T4BA 3ZWMA 4BNFA 4XDYA 3JQ8A 5KKCA 4BO7A 4PZEA 1IHYA 1N1GA 2FZWA 3ZWOA 1V8BA 3ZU3A 3UCFA 3BHMA 4BNYA 1EQ2A 4Q3DA 3RQSA 2C0CA 2PGDA 2ZYDA 4ROSA 5L7WA 2JAHA 4U6SA 1VJ0A 4J9UE 1ADGA 1Z7BA 3C7CB 4IZIA 3O8QB 5J23A 3JD3A 1EDOA 4JLWA 3GUYA 1Z7EA 2AQKA 4DQVA 5AYVA 4MVJG 1V3UA 1ZH8A 1PL8A 3ITKA 3V1YA 4P4LA 1NFFA 8ADHA 3MJVA 5DULA 4LISA 2Y0CA 2DVMA 2HCTA 3HUDA 2UUPA 4I1IA 4OH1A 1LDGA 3ETGA 7MDHA 1GDHA 2CFCA 4J3FA 2FY8A 4XB1A 4FCCA 5I7FA 1KBZA 2C5AA 4PLPA 2HMVA 1GV0A 4J6FA 4RZIA 1A7KA 3GR6A 5JC8A 1ADBA 1WLYA 3UAGA 2GZ1A 2YV2A 3HN7A 2QZ9A 4PFJA 3RU7A 2VRCA 2BGKA 2Y1EA 1MX3A 2EV9A 2NADA 2P4QA 5HA5A 4EYEA 3UFXA 4EUFA 4LGVA 5BR7A 3EUWA 4NR0A 3WTCA 4ND2A 4KUHA 1GFSA 2AA3A 2EIHA 3AI3A 4A27A 3K8ZA 4JJIA 4OGWA 5IAAA 4XJTA 3QVXA 2VWHA 3JQBC 5GZ6A 3UOGA 4G5HA 1ONPA 4IGEA 3CZMA 3KUXA 4RPKA 3WWZA 1TLTA 9LDBA 1PQPA 5MGBA 4MIOA 3PJFA 4RF5A 4RPHA 4XGKA 1LSUA 2DKNA 2O3UA 1NNUA 1PJLA 3PP8A 1GR0A 1YKFA 1EFKA 4FJ2A 4WPGA 4BNNA 4BMSA 4IPTA 1CJCA 2EKPA 3D3WB 3VDQA 2B37A 8LDHA 4BKOA 4PLWA 4XQGA 2G5CA 2ZB7A 1WZEA 1XGKA 3KYBA 4MJLA 5TF4A 4HX5A 4UEKA 4HKTA 2QX7A 2DBRA 1XQ1A 2NSDA 4ZN6A 5EIOA 1H2BA 1ZSYA 4XQEA 2YFQA 1HWYA 1UDAA 1Y6JA 2W2KB 3E5RA 3RUAA 1F06A 3G0OA 4WCFB 4YTEA 5DCWA 3WJAA 4ZJUA 1LU9A 2AE2A 1AGNA 4BIIA 1S7CA 3BMQA 1H6DA 4BNIA 3M2PA 1DC3A 1PZHA 3UGKA 2RHCA 5JY1A 2CUKA 2B4TO 1E3WA 1X1EA 5ICSA 2I9PA 1IZ0A 3JYLA 2D59A 3H9QA 4RPGA 2J6IA 3I9LA 1P1IA 1BTOA 2O4CA 4RDIA 5ICMA 5KJCA 3PVZA 1UP6A 3KLPX 1QYCA 1XWFA 3EMKA 1K6IA 1EE9A 1FDWA 3STHA 3ZV4A 4AFNA 4J90A 3F5SA 5LCXA 1X1TA 3NT5A 4ZD6A 1PWZA 1PQUA 5BNFA 1DDOA 1N2SA 4J4BA 2PD6A 3MWDB 5U9CA 2BRUA 5JAZA 3ONEA 1HSOA 1IY8A 1UP4A 1RM0A 1UUFA 4W4TA 4H7PA 3GRKA 1ZJYA 2GPTA 2SCUA 3TL2A 2Y1FA 2PKRA 3BMOB 3PHGA 4YJGA 3HFSA 3ZHXA 4CMGA 4DA9A 5C7IO 5C7LO 2BFPA 1BG6A 2J8ZA 4CR6A 3RBVA 4JK3A 3E18A 2WD7A 4XYLA 2B5WA 2YDXA 4NFHA 5I8WA 1B26A 5IF3A 3DB2A 1XCBA 2GERA 2Q1UA 4D41A 4LMPA 3W8DA 5DBGA 3T7CA 5KKAA 4Q3NA 3PZBA 2VRCD 1R12A 2VZ0A 3ZH2A 1YBAA 3DTTA 3KSZO 4D3SA 1GUZA 4BKPA 4YYZA 3W8FA 1GEEA 3GN1A 4G65A 2IRWA 2Q1TA 1YBVA 3UF0A 3U09A 2CMDA 2EKQA 4FBGA 3L6DA 4U0JA 3VTZA 2G1UA 3OQ1A 5EQDA 5JMWA 3D5QA 4CMAA 4Q3AA 3RC2A 2EGHA 4IMPA 4CLEA 1HSZA 2J3HA 1Y81A 3CTMA 1HYHA 2J5KA 4DRYA 3C1AA 4NU5A 1S6YA 3HDJA 1MV8A 3E48A 1A5ZA 1GL3A 3NUGA 1P3DA 4DREA 4IDDA 2I6TA 4YQYA 3R3SA 5JDCA 2RCYA 4JIGA 2IXBA 3QVOA 4RVDA 2PGLA 4FIZA 4GMFA 4B4VA 4ALLA 4YJFA 1QRRA 4CJXA 2B5VA 1GYPA 4YAKA 3WQRA 5DP1A 1DXYA 1LNQA 3KB6A 1DHTA 1RKXA 1WNTA 4PLTA 3K96A 5A9TA 4BO3A 5EERA 3E82A 5JO0A 5CEFA 2NACA 4FGSA 2NVUA 4J7XA 1GYQA 2QYTA 1XKQA 5L7YA 4AJOA 4Q9NA 2O3RA 2J5RA 3KTDA 2DPHA 1EFLA 1T2EA 3ICCA 5COAA 3LT4A 3FN4A 5A02A 5JYEA 3GHYA 3U9LA 1H5QA 1P31A 3FR7A 5T64A 4D42A 5CG1A 5I7VA 2PV7A 1DRWA 1QV7A 3SX2A 3WNQA 1UAGA 3JQ8B 4R69A 3SJUA 1K6XA 3WWYA 4BGUA 4DYDA 1EUCA 1BSVA 3EVNA 1ZK1A 4NDNE 1UDBA 4HBGA 2HK9A 3MEQA 2NV6A 1SEVA 3U4HA 3T4EA 3QSGA 3DZFA 4AJJA 1B8UA 4YVFA 4R9RA 5B4VA 2YUTA 3LF1A 1ZEJA 1KC1A 3VPFA 3B20A 1PJ2A 4GI2A 3DDNA 1UDCA 4RCVA 1U3TA 5L4SA 1I3MA 2NTJA 3TJRA 3PI7A 3I5MA 1E6UA 4Y67A 5F3RA 3WIEA 5KWEA 1QYXA 4CLRB 4DWVA 3OICA 3QHAA 2VYVA 1YVEI 1RYDA 1XU9A 4NK5A 2O2YA 5ES3A 3TQHA 3TFQA 4E33A 1V3VA 3NDRA 1VL0A 2JCVA 1UXIA 5JW6A 1IHXA 2A35A 3ZWXA 2OHXA 2VNAA 2JAPA 3MOGA 4JBGA 1Z82A 3JQGB 4U5QA 1HRDA 3FNEA 1XA0A 1NP3A 3WB9A 4WOKA 2WDZA 2WD8A 3V1UA 5BSGA 3FR8A 3AOGA 1P45A 3F9IA 2CY0A 2E49A 1XIVA 3K9QO 3PJGA 3ZHZA 3GNQA 4DBZA 5L51A 4CL3A 2X1HA 5BSFA 3TL3A 4CV0A 1E1MA 5A5FA 4OIMA 1O5IA 3DMYA 1PU2A 2GZ3A 4JBIA 4XZ3A 4EJMA 1UP7A 4LVCA 2ZQZA 1WPQA 1UH5A 2IXAA 3ZCXA 4BNGA 4BQRA 3JTMA 3JQ9A 3DBRB 2HMSA 3AOEA 2HMWA 1LC0A 4W7HA 4KQXA 3RROA 4RVUA 4YT4A 4PZDA 3WGQA 4R68A 3GAZA 4M87A 3ROMA 4BO6A 4J7CA 1VKNA 3NEPX 3UKOA 5G0UA 3RFTA 1DIBA 1ONNA 1UJMA 3KEQA 4ND4A 5LDGA 5BNTA 2QRLA 5DNAA 2C54A 2GSDA 2POQX 4WEQA 3H9JA 4W6ZA 2NU7A 4I5GA 1NAIA 3P5SA 3DONA 1JVBA 1X14A 1K5HA 5DBIA 3VOSA 4DTIA 5JYDA 1EK5A 2JJYA 2DUWA 4YA6A 4R1SA 3QW2A 4ID9A 4XCVA 3LZ6A 2GRAA 1GAEO 2ZTMA 4OKNA 1ZSNA 2A4KA 3NTQA 1LLDA 1ZVMA 2WE8A 4L8VA 4OHUA 5CDSA 1X13A 4KUEA 5JMPA 1M6WA 3F4BA 4FJ1A 4LN1A 4L9RA 2PA3A 5H83A 4NBTA 1H6BA 2BMAA 1OC4A 4OSOA 2OL4A 4IY1A 3VZPA 3LVFO 1DOHA 3HQ4O 3ZV6A 1XLTA 1WZIA 3C3XA 4CV3A 2CDBA 1UZLA 1E3SA 5JDIA 2V6FA 3K6JA 3DR3A 3UCEA 3GMDA 2PZKA 3PHJA 2GN6A 2Q2VA 2IEBA 2O7QA 3PQDA 3PYXA 4BNVA 4PLGA 1QKIA 5C3MA 3NKLA 1NYTA 2D5CA 3CIFA 4PCVA 3SC6A 2V6BA 3W4IA 3V2UA 3VTFA 5CAEA 3GVHA 4TZTA 1U8XX 4I5EA 4TRJA 4QEDA 1PJSA 4AJHA 1PTJA 3I1JA 1HL3A 2VYVD 3G1UA 3RKUA 2D5AA 3RJ5A 4B4WA 3B1FA 2WD7B 3PEFA 4RZHA 4GKVA 4B4OA 1N7HA 1YGYA 3E8XA 4HFMA 3PZRA 4QO7A 5TC4A 1OAAA 4MVJE 3GEGA 3OH8A 4AJNA 1I2BA 2P2SA 3F4LA 4QSMA 1DRUA 3C8MA 4FD3A 4OL9A 4GSKA 3VZSA 3JQ7B 2DTDA 2VYNA 1I10A 3QVSA 3PDUA 4ND3A 1BXGA 2XXBA 3LSYA 3WSVA 2ZATA 3CEAA 4O6VA 4ND1A 2F00A 1QLJA 1IOLA 1E6WA 3D3WA 3D4PA 3DFUA 3PWSA 3IIEA 4HWKA 4K9DA 4II3A 3WGGA 4ALIA 2D2IA 4A0SA 4E2YA 3LLVA 1G6KA 1SOVA 5L3ZA 4BS9A 4W7IA 3HG7A 5H81A 4KDFA 4GX2A 3QQPA 2W2KA 1MFZA 1MA0A 3JQCA 5TGDA 3ZHBA 5L9AA 1LA2A 4WCFA 3DL2A 3AUAA 2O3QA 3BHJA 4AJEA 1U2DA 2E82A 3CUKA 2IDZA 4O63O 4YJFB 1ZIDA 4BO0A 2W90A 2X5OA 3DZIA 1Z74A 5K6AC 1MC4A 4FFMA 4A26A 3RC9A 4NI5A 3FPCA 4DQXA 2NU8A 1T2AA 3P2OA 3WGYA 1KETA 2D1YA 3AY7A 3JQAB 2P9GA 3TDKA 4HNHA 1N1EA 5B4UA 3IUSA 4L0QA 2VUUA 1DPGA 2PH5A 4BV9A 2AXQA 5A9RA 5AQ1A 1P33A 5JDCC 9LDTA 4BKRA 1T24A 4ND5A 2EP5A 4O1MA 1DLJA 4W99A 3G3EA 4UVEA 4PVCA 1NR7A 2HDHA 3OEYA 3HFGA 2ZCUA 4MVJM 2V7PA 5FI3A 4AVYA 4JGBA 1DLIA 5IJZA 1WMAA 1NPYA 1HE3A 1R0SA 5L4NA 3DO5A 3U49A 1M66A 1NPDA 3H6KA 3ASUA 3L6OO 4FJ0A 3ZNPA 1PS8A 5IDWA 1IYZA 1E1LA 3ANNA 3U62A 5L7TA 4OMUA 5LC1A 2PD4A 4P8RA 2J3IA 5JAQA 4QTZA 3HJAA 2YFHA 4PLHA 3HSKA 4XQ9A 4BO1A 4DPMA 1I2ZA 7ADHA 4J1QA 4GSLA 4BNJA 4HADA 4DMLA 2YHIB 3SXPA 1Y1PA 1ORRA 1PJQA 3DOJA 3AUUA 3C7DB 4R3NA 1SO8A 3Q0EA 3DHNA 3FWZA 3H9GA 1KVTA 4ZQFA 2C5EA 1E7YA 1B14A 2I66A 4MPDA 3A14A 4H3VA 4KOAA 4D3FA 5DBFA 3KVOA 4UREA 3W4JA 3WX0A 2JFHA 3SEFA 1SC6A 4PGFA 3P19A 3NT2A 3GF4A 1T4DA 4XEHA 2V6GA 5THQA 4E6PA 2HSDA 2VYND 4AJIA 1KY4A 1TT5B 4TRRA 4CMEC 1LDBA 1V9LA 3BAZA 1W8DA 3DOCA 4JBHA 1R0LA 5ITWA 3LDHA 2ZB4A 1Y9AA 4J1TA 1C0IA 2ZK7A 1ENPA 1KIFA 3LU1A 1R66A 4TVBA 4RJTA 3QP9A 1EVYA 2EJWA 3HWRA 2H63A 1BW9A 3E9MA 4HFJA 3RC1A 1E7QA 4J2HA 1V35A 2TMGA 3H5AA 3PPIA 1KS9A 4DIOA 4I5DA 4TVOA 2FMUA 5JPIA 3AI2A 1MUUA 4C7KA 4P38A 4E2WA 2ZQYA 3DAPA 3F46A 1FXSA 3PQFA 5BSEA 2YHUA 3ONDA 4PG7A 4RQTA 4BB6A 1H2HA 3IUPA 3ONFA 4CL8A 1WMBA 1Q0QA 3OF2A 4KDEA 4MKZA 1LQTA 3U4IA 4PLZA 4E21A 3PJDA 2OUIA 4B8ZA 3GPDG 1IPEA 4BGEA 4I08A 4A7PA 2GO1A 5TX7A 4RVGA 1LXCA 2FPIA 2QW8A 5GY7A 3FHLA 3H5NA 4OQYA 2OZPA 1M2WA 3P7MA 3HDHA 3TN7A 2O48X 4P4GA 4CM1A 2HLPA 2UYYA 1SBYA 4EW6A 3WMWA 1HLPA 2H5LA 3I4FA 2DU8A 1YB5A 4JNKA 4WLFA 4N5NA 5COBA 3RUDA 1OMOA 3PIIA 4I5FA 4K1LA 4DBVO 3L4SO 1Q2XA 2WJPA 4FB5A 2GR9A 1PJTA 3U0BA 4URFA 2ZTLA 2BI7A 3V2HA 1I33A 1K3TA 3DMTA 3S2IA 5AXDA 1P1RA 3A4VA 5CHEA 5EQFA 3S55A 3JD1A 4CLRA 2P91A 4QO8A 4CM5A 4IXTA 3JQDA 3ZWNA 2WMDA 4CQLB 2VUTA 4CPDA 1E3IA 2Y68A 1B3RA 2GDZA 1HEUA 1QMGA 2H1SA 1HE5A 3GDOA 4LSMA 3JQGA 3LLSA 3KBOA 3FWNA 4DIBA 2X8LA 3ZWYA 3ADOA 4D46A 4E4YA 5TT1A 3OIFA 5KJ6A 3KETA 1W4ZA 3E9QA 1I3NA 2C82A 1CRWG 4DMMA 3B6ZA 5F5LA 4C4OA 4WJZA 3B70A 2FSVA 4IGFA 5DT9A 1DBVO 2YQ4A 1PGQA 2PZJA 4I9UA 4AJ1A 3WGOA 5TT0A 4J16A 2I76A 2AHRA 3C1TA 4ZU3A 1ADFA 4BL5A 1ZEMA 4GAEA 4H16A 2J3KA 4WNCA 1MB4A 3EZYA 5DOVA 2IZ0A 5DZSA 3OMLA 1BXGB 1DIGA 3MJTA 2A9FA 4ZQHA 3DBRA 4X54A 2CNBA 3PIDA 5C37A 1D1TA 1K0UA 1XDWA 3ANLA 4YEDA 3NRCA 1YB4A 3H5RA 3WFIA 1B15A 1PGOA 2BFAA 4EJ0A 4IBOA 3AW9A 4BQPA 2I65A 5G0VA 1VL8A 3BA1A 4ALKA 3E03A 4LCEA 3K5PA 5B12A 1HKUA 1T2CA 5EINA 5B37A 3RU9A 1ZMTA 3I3OA 1B8PA 3CKYA 1HDYA 3ULKA 1J4AA 3NGXA 4L73A 3KM0A 4D44A 5G4KB 3WNVA 1IPFA 1T1SA 4E13A 3TNLA 1JN0A 4M55A 5KNLA 3AM4A 1T2DA 5JNLA 3G79A 3GEMA 2EJVA 2VUSA 4XR4A 3GFGA 1ISGA 2DLDA 1M6HA 1BMDA 4BNTA 1GCOA 1ENZA 4Q3EA 1P74A 2AQHA 5EL0A 2WYUA 4AJ4A 1UXHA 2PZLA 3QJ5A 4AJPA 1NQTA 3ETDA 2AG8A 1M75A 3UW3A 3CPSA 3JQEA 1DJQA 2YYYA 3N74A 4A10A 1LDNA 4QUKA 4NU6A 2E48A 3TPCA 3WTBA 1LQUA 1C14A 2P5UA 4JQCA 4PVDA 3ZHYA 1VJTA 2D3TA 1HZZA 4RPJA 3TZ6A 4YR9A 2VOJA 5KVSA 4NJMA 1JWAB 4IJWA 5G2OA 4CUKA 3E5MA 3QLJA 1PJCA 2EHDA 2G0TA 4IDEA 4BB5A 1ULUA 3RBXA 4JP3A 1GY8A 1FDUA 1MLDA 4OXYA 4J4TA 3ZU5A 2R6JA 4CMKA 2YDYA 3S8MA 2C20A 1KVSA 2BFMA 3UCXA 4LVUA 4ZQGA 3R6DA 1T2FA 5GZ3A 3CE6A 1NXQA 3JQFA 3SBOA 1B0AA 2NNLD 4NNJA 1ZSVA 1U5CA 1DJNA 1J49A 4J0FA 1M76A 1W73A 4YDRA 5KJ1A 2X5KO 4LCJA 1BXZA 2E4AA 1QV6A 3C1OA 2I5PO 1IUKA 3GRPA 4L4XA 3EVTA 4RLHA 2VWGA 1V0JA 1ULSA 4ZRNA 3AFMA 4BNKA 4WK6A 3PWKA 3RIHA 3JQ7A 4RLSA 1I2CA 1U4OA 3D3EA 3A9WA 3NJ8A 3FPLA 4Q39A 1GZ3A 3HADA 1H6CA 3HB4X 5BSHA 5TS3A 1Y7TA 1Y9EA 2CZCA 1RPNA 3AU9A 4KTVE 4WLNA 3I9MA 4TMFA 3WLFA 1O0SA 5FEUA 3E1KA 3IAHA 5TQVA 3GGGA 1R4NB 2WSBA 4BNHA 1U2GA 4HXYA 2AEJA 4W9NA 1FF9A 1SCUA 1A4UA 3TZCA 2ZB8A 3NJ4A 4BO8A 3AUTA 3H9UA 1R15A 1KVQA 1KEPA 2HQ1A 4KMSA 4UUOA 3VKUA 1NVMB 3OM9A 4FC7A 4YRDA 2WWRA 1F17A 1LJ8A 4IQGA 1BW9B 4HNGA 3PDJA 3VDRA 3K30A 3GEDA 1LRJA 2PD3A 3JCZA 4GH5A 3UH1A 3IJRA 4Z9YA 3ZU4A 4JN6B 3GG2A 5LDHA 1BXKA 1NHWA 2V6MA 4RPLA 5IN5A 1GV1A 1HDGO 1WW8A 2EGGA 1LDEA 3JQAA 3Q11A 2Q50A 2ZB3A 3QWFA 5HM8A 1A7AA 3UICA 1BGVA 3L4BC 5CPFA 1PZGA 3T7EA 1YL6A 1SB9A 2Q2QA 4CUZA 5CDUA 1QR6A 2P9CA 4J2OA 1I0ZA 1CETA 4IDCA 3ZWVA 1GPDG 1A71A 1JTVA 2I3AA 1ARZA 4I9NA 4K28A 3INTA 1YRLA 2P5YA 1HDCA 3TZKA 2FPGA 1F12A 3LC2O 1B8VA 3IOYA 3SC4A 4WCDA 4D43A 5GMOA 1N9GA 3MJEA 4QFDA 3W6ZA 4JCOA 5K9ZA 3RUEA 3RJ9A 3IP1A 1H0KA 1NAHA 1YJQA 1PGNA 1SEPA 2X0NA 4R51A 3CSDA 5EN4A 1GQYA 2ZKLA 1X15A 3KSUA 1LX6A 3PWZA 4FOOA 3AFNA 5JAIA 4J9VA 4YT8A 1VLLA 2VZ8A 2YHIA 3JYOA 4UAGA 1YQDA 1RM3A 1GU7A 3EY4A 2DBQA 5IZCA 5JAMA 1PL6A 4BGVA 4GGPA 3OJFA 4QECA 1ZKMA 2DFDA 5JO9A 2C29D 2Z5LA 3F1KA 1ID1A 1Q0HA 3ICPA 4E12A 2LDBA 1IB6A 4Q3BA 4Z0TA 2B35A 1HE4A 1TXGA 3ZWBA 2JD2A 3EK2A 1YO6A 1HETA 4GVLA 6ADHA 4E31A 4EI2A 3GVIA 5ADHA 3JV7A 2JD1A 4N5MA 5EPOA 2Q1SA 4CUJA 3KHUA 4MKRA 2I99A 4CM6A 3DMTC 3WICA 2ZCVA 1UXKA 1EUZA 4NBWA 3F47A 2GF2A 3CMCO 3V2GA 3ZN2A 1TT5A 5G4LA 3EZLA 5HBRA 5KVVA 3QY9A 4IUYA 4B8WA 4IDAA 1C0LA 1RJWA 4D45A 4B7UA 2PFGA 2YY7A 1WDMA 1ZK3A 2W98A 1YQXA 4UUPA 3GH3A 5HS6A 3TFOA 4QXMA 3I9NA 5FF9A 2FR8A 3ZZNA 3FI9A 1ZMOA 4CLXA 2TMDA 3H4VA 1EBUA 1KYQA 3S2FA 1DC5A 4IDBA 4BGIA 2GUGA 1LEHA 2DTXA 1LRKA 4OYRA 3EGOA 3O9ZA 1Q7BA 3WG9A 2X0IA 4YT5A 2JHGA 4EZBA 1JLLA 3FD8A 1J5PA 3I23A 4ZVVA 6LDHA 1YJ8A 4F6LA 2NU9A 1PWXA 2W2LA 3VPGA 2CF6A 1WP4A 3LQFA 1GQQA 2H9IA 2Q45A 1FK8A 4OXNA 2X9GA 4LMRA 4JP2A 3FBGA 3DAGA 1LBEA 2BELA 2W4QA 1XG5A 1V6AA 3F5QA 1UXGA 3OFSA 3VHRA 2FRDA 3JQAD 2YW9A 3HZZA 2DT5A 3JD4A 1NQOA 4AJLA 4RQUA 4XGNA 4Y8VA 1R16A 5CEEA 5MDHA 4E5KA 4OOEA 2G17A 3QIVA 2BGLA 3R3JA 4N7RA 5T57A 4ALNA 1DB3A 3WR5A 1C1DB 3Q1LA 4FFPA 5A3JA 1YWGO 4YRBA 1IZ9A 5JCXA 5DCYA 1Z75A 3Q6IA 2BI8A 3ZW9A 2Y1CA 3WMXA 2ZJ1A 4B79A 3PYLA 1L7EA 3L07A 1AN9A 3NYWA 1CERA 2YJZA 1AXEA 4LRTB 4YJDA 3BZUA 3WDSA 1ZBQA 3PGXA 4XR9A 3DFZA 3ZNOA 1J6UA 2PZMA 4CMCA 4UVGA 3GVXA 5JS6A 4R5HA 4IQ0A 3FTNA 3NGLA 4NHEA 4ALJA 2NWQA 4NJMB 4AG3A 1AXGA 5CDYA 5K0ZA 1LDYA 2JCYA 4F6CA 1HDOA 1NHGA 4GWKA 4JXKA 4CQLA 1GYRA 4G2NA 1EUDA 1LI4A 3K31A 3M6IA 3HHPA 1QLHA 3ENNA 1E7MA 3ADPA 3GT0A 1MFPA 2BLLA 2Y93A 2FOIA 5JBIA 2XOXA 4K6FA 4HFRA 5JSFA 4MOWA 2UAGA 4PLVA 3GGOA 3O4RA 4MVJH 4OKIA 5U4QA 4XDZA 4DLLA 1MC5A 3HE3A 4ZQBA 4BMVA 4S1VA 2C2XA 4TWRA 1QG6A 1ONOA 4CMBA 2WYVA 3GVCA 1WDKA 2VRBA 4L75A 4GBJA 1E3JA 1WDLA 3C7AA 3H3JA 4EJ6A 5DF1A 5CEJA 2HJRA 2HRBA 4WE3A 2VNSA 3AY3A 3H7AA 3JQ6A 2IE0A 1E0DA 3AUSA 4U7WA 4NK4A 2O3TA 1E3LA 4CM8B 1VI2A 3WYCA 1YONA 5G0TA 4Z3DA 3WBBA 1E3EA 3JQFC 3WGTA 1GEGA 1Q0LA 1TB4A 2HRZA 1C1XA 2PR2A 3PXXA 4MVJP 5HRUA 3DEYX 4BNUA 4MP8A 3ORFA 1EEHA 4D79A 3GA0A 1TA4A 1ZJZA 1GADO 4ZHSA 4FFNA 5HS4A 2NM0A 2EW8A 2Q3EA 5L95A 5ILGA 1ZO8A 4QFCA 2JL1A 4MKXA 5G4KA 3LF2A 4MIEA 4N5LA 4A5OA 2Q2WA 1F14A 2PKQP 2R2GA 2X0RA 1BDMA 1J0XO 4QQRA 4R16A 3MOIA 2C7VA 1NVTA 2W2LD 1GZ6A 4YAGA 3WQQA 3PGJA 2GYYA 1W6UA 4JJFA 4E2ZA 3IQDB 5KCZA 3FF4A 5TIIA 2Y67A 1H9BA 5L40A 4HY3A 4GX5A 1D7OA 3QE3A 2B0JA 2JFGA 4FFRA 2HK7A 4Q3CA 4NBUA 4EEZA 3GY0A 1I01A 2ILTA 3HN2A 4BNWA 1Y5MA 3GDGA 4WEOA 3BTSA 3I9JA 3X2FA 1LLUA 1NQAO 1X7HA 1P1HA 1KERA 5IN4A 2LDXA 3WQSB 1FMCA 5CDTA 2VHXA 3RFXA 3OECA 1E6EA 4M89A 1N9GB 2IYOA 2Y99A 3ZW8A 1HE2A 2OFPA 4ZA2A 1Q7CA 2EXXA 3LT0A 1LLQA 4GL4A 4GMGA 4M86A 4IJKA 3IKTA 1Z6ZA 1VM6A 3E9NA 1A9ZA 1NFQA 3HDQA 4UVIA 5ITVA 4NQZA 4U0KA 4WLEA 1N7GA 3TOXA 4B3JA 2BD0A 2GN4A 4R3WA 4WECA 1U3VA 1ENYA 2GN8A 3K2BA 2V65A 1PX0A 2OP0A 1VRWA 1EK6A 2DBZA 1OFGA 1GD1O 3L0DA 1I24A 2Z1NA 2Y0EA 2VZ9A 4NFSA 3ASVA 4CMHA 5TJ9A 1B16A 1KC3A 3H9EO 3NT4A 1PJBA 4JJGA 1FDVA 1F8FA 3INGA 3UXYA 1BVUA 1EZ4A 4OM8A 1OC2A 2QRJA 2IYPA 3ZU2A 3LYLA 4BMNA 5JY6A 1ZZEA 4XYBA 3ZWWA 4HV4A 1EQUA 3QWBA 1OBFO 2GLXA 3KXDA 1R4NA 2GN9A 4MVJF 2JD0A 4M8SA 1YL7A 4EBFA 4OAQA 3GNTA 1C0KA 1L7DA 3GK3A 2I67A 3IS3A 3TWOA 2ZYAA 3FSRA 3H3FA 2Q49A 3KYCB 1I36A 4Y98A 2Q1WA 3U5TA 4Y9DA 5TJHA 4Z9FA 3ZDFA 4IMRA 4XWYA 3ZNQA 1G0NA 2X22A 2DUUA 1UZMA 3RC7A 1JVSA 4RVHA 1I3KA 1NPTO 3F6YA 1QXSA 4KWIA 2B83A 4DPLA 4Z0HO 1R37A 3DBLA 4Z6KA 4S3MA 4DXHA 1JKFA 4FOSA 2BFOA 4L4SA 1CDOA 1Y8RB 2PKQO 3PHIA 4IDGA 2WM3A 2HKIA 4GX1A 1DIAA 1O89A 2C7GA 3VPXA 2FN7A 1ISMA 3VH3A 3WOHA 1AHIA 2E6UX 3AM3A 3BMNB 4Z3KA 2OO5A 4YRAA 5A03A 3B1JA 4CR7A 1T1RA 1E77A 1PS0A 2Z95A 4OSPA 4XYMA 2CVQA 1VKOA 4FGWA 4Z0PA 1DAPA 2HAEA 4CM3A 3ANMA 4DGSA 2GGSA 3HDYA 1E5LA 1BWSA 1DFIA 3JQ9C 5KTKA 3AOEC 3Q3CA 3IJPA 2R00A 3GQVA 3INRA 4PRLA 3ST7A 2OORA 1H6AA 4BO2A 2YQ5A 2X23A 1OI7A 1ZXLA 4A03A 4UVHA 3O03A 3GMSA 1ZK0A 3LC7O 1BHSA 3PLNA 3W1VA 2DM6A 1H93A 4E5MA 5I7EA 2HO5A 2O3SA 2PWZA 5COQA 4E32A 3FNFA 1OOEA 1BVRA 1HDZA 4MVJA 4OJNA 2AEMA 3P2YA 1CWUA 1YDWA 3AU8A 1QORA 2EP7A 4BO9A 2Q46A 3JD0A 3WGIA 3S2GA 4L4RA 4IJUA 5F21A 3EYWA 4PLCA 2C07A 1IL0A 2ZJ0A 5JC1A 4MINA 3MJSA 4FC6A 2P4HX 4NPCA 1PSDA 4KP7A 4ONEA 1W0CA 3OBBA 5BQFA 5EESA 3H2SA 2GASA 4NIMA 4BVAA 1I3LA 2NVWA 2FSSA 3GZNB 2CVZA 4OOFA 4EUHA 1ISIA 3MJCA 4NBRA 2Y66A 4ZGWA 4R1TA 1U1IA 5EJ2A 3L9XA 4QX6A 1PZFA 3ZI0A 5JDIC 2Y1GA 3MWEB 4GVXA 1LTHR 4GPD1 1B7GO 2F1KA 4WLVA 3WBFA 3S1LA 4CLHA 4OQZA 3ON5A 4HFNA 1ISHA 1EVJA 1IULA 1U9JA 2PLAA 4CR8A 5G0WA 3H2ZA 1U4SA 1XSEA 4YB8A 2O50A 2CD9A 4NMHA 3DZHA 2RIRA 1LSSA 3AJRA 3IDSA 1AHHA 4PLYA 1LLCA 2WE7A 4IDFA 4CM4B 4IZHA 5JXWA 3GGPA 3SVTA 3NDJA 2QQ5A 4KWHA 2E37A 2CDCA 3ZNNA 4HP8A 1C1XB 3OHSX 3MJ4A 4MDHA 3OQ6A 5CP8A 4E3ZA 1HT0A 2NQTA 4TRMA 2VHZA 1RM4A 3TRIA 2HMUA 4TZKA 1ZFNA 5IDYA 2AG5A 2B4QA 5F5NA 5G0SA 3RBZA 4FDAA 3WXBA 2QG4A 1X7GA 4CMJA 4DPKA 4XJSA 3ROKA 1P77A 4EGFA 4TKLA 3UN1A 2Z1MA 3A1NA 1MP0A 5CDGA 3SLKA 3VVCA 4DUPA 1HYGA 2DAPA 4YAEA 1K89A 3ROPA 3VZQA 1DRVA 1NX6A 3EC7A 4WLUA 5BNIA 2FPPA 4E30A 1ZCJA 3VH2A 1A9YA 3DZGA 4GGOA 2EEZA 3MZ0A 1C1DA 3OP4A 3OIDA 1D3AA 1XELA 4TRNA 4DIFA 2AW5A 1DC6A 1D4FA 5T8KA 4B3HA 5A3VA 4CM9A 2EW2A 4EEXA 2BGMA 3L9WA 3DC2A 3MTJA 4RDHA 1PIWA 3UVEA 3VC7A 4WCFC 2GNAA 1U5AA 3DBHB 1MXFA 1Y8QB 5HWSA 2UVDA 4U8GA 2Y1OA 3Q2IA 2O7SA 4DVJA 1KVUA 1MG5A 4MVJD 1D1SA 4P4NA 3R1IA 2X58A 4BHTA 3RWBA 1X0VA 3CH6A 2IODA 4RVSA 3KSDO 4XIJA 3IP3A 5H82A 1NM5A 3TSCA 3ENKA 5L53A 2VWQA 2PY6A 3PQEA 1GTMA 1X7DA 3G49A 2AE1A 2PGJA 4HUJA 4YXFA 5CG2A 1R0KA 1N92A 1WWKA 1P0FA 4BNZA 4INAA 3DBVO 1R4MB 3CXRA 4FS3A 3ZWPA 1DSSG 3PLRA 3RUFA 4LRSB 4W82A 4WNIA 3N58A 4J91A 4CLOA 2EG9A 3GG9A 3OA0A 3FCOA 2D0IA 4M54A 1B3BA 3VZRA 5FWNA 2VTEA 4AJ2A 4N18A 4YJHB 3VH1A 1JAYA 3TZQA 3ZV5A 5KJEA 4M49A 3LT2A 4FPXA 3VVBA 5AXCA 4IIVA 4CM8A 2O3JA 2A92A 3PK0A 1XHLA 1GZ4A 2VN8A 1XYGA 1QYVA 3JYNA 2IZ1A 3DHEA 2J3JA 4EUEA 3DZJA 4CMIA 3OQBA 3AK4A 2VT2A 3B1KA 1KEUA 2O23A 3KV3O 3KYDB 3NTRA 3NV9A 4KTTE 4WOJA 4CODB 1YOVB 1P1FA 2WYWA 4G81A 1GUYA 4A73A 3ETEA 2XF8A 2NLOA 2BF7A 3JD2A 4UVDA 2FHSA 2UV8A 3QWAA 4B7CA 5JCJA 4AICA 4XYEA 1WVGA 4ZRMA 1PR9A 4BO5A 5K6AA 1HDXA 1EBFA 3GUCA 2OGUA 4O59O 1MXHA 1JAXA 2IZZA 1NASA 1YE3A 2FR1A 2Y05A 5KVQA 5ENVA 5IXSA 5A05A 3PFWO 3K92A 3DBLB 5F1PA 3MCVA 3NAQA 4D0SA 4BNXA 3QVTA 4IQ8A 4GWGA 4YCAA 4JX8A 4A2CA 3OJ0A 3G1TA 3RKRA 1JW9B 1UZNA 2HUNA 1QP8A 3FBTA 3A28A 3QRWA 3I6QA 2DFVA 3F1LA 1PZEA 4TSKA 3RUIA 2D8AA 3ABIA 3D1LA 3GN2A 1DFHA 5FI5A 1D8AA 1VSVA 3WYBA 1CIVA 4GLOA 4F3YA 3VKVA 4D3DA 5DOZA 1BRMA 2NU6A 1EE2A 4R9SA 4XB2A 1JKJA 2FWMX 5IDXA 1JA9A 3KOUA 1I32A 4MIYA 1KOLA 1NVGA 5A9SB 4RO0A 4CM9D 1LUAA 3BMCB 4XD2A 4BNLA 3PYMA 2HK8A 3SJ7A 2EF1A 2HU2A 1UXJA 3OEWA 3BIOA 4FFLA 1HDRA 2VHYA 3PRJA 5KOIA 3LT1A 2X7HA 1YBMA 4P22A 4FQ8A 2Q4EA 3KO8A 4UEOA 3HNPA 2A94A 2WEKA 5DP2A 3RI3A 3PHLA 1C0PA 5AOVA 2X86A 1NBOA 1B2LA 1DC4A 1Q1NA 5T6BA 3IL2A 4ZICA 3OJOA 1QYDA 4ALMA 3A06A 4DC0A 1KVRA 1LSOA 1E7WA 2R00C 1OZAA 5KVCA 4CV1A 3Q9NA 1DHRA 4IJVA 3DAFA 5ER9A 1VE9A 3EW7A 1LRLA 2RHRA 3CZRA 2RH4A 4E5NA 1KY5A 3L6EA 3L77A 3D7LA 4YAJA 4AJKA 3V5NA 2ZTVA 4Y6PA 1ML3A 4ILKA 1RYEA 1ADCA 3GOHA 2H6EA 3G17A 4ESOA 2DC1A 3ZV3A 2NTNA 4E0BA 3U4CA 2UDPA 3DHYA 5JFOA 4CMEA 2VTDA 3TF5A 3GLQA 4E2XA 3UUWA 2PTGA 1JDJA 4J1SA 1FJHA 4PRKA 4CQMA 4PIVA 3RAJA 1YS4A 2YZ7A 3RUHA 4DYVA 5CFZA 1HTBA 4EITA 3KYCA 5KIAA 4NBVA 4NZ9A 4RORA 4BV8A 3GZ4A 1MGOA 4MP3A 2VOEA 3OSUA 1PQWA 3M1AA 4GKBA 4J43A 5BT9A 2PNFA 4JROA 3KZVA 4MO2A 1ISFA 1NR1A 3D4NA 4MVJI 4PN3A 5JCJD 1N8KA 4C7JA 3R0IA 4AL4A 1L1FA 3OA2A 2J5QA 2AEFA 1HYEA 1Y8RA 4Y6SA 1I8TA 1Y5RA 4QT0A 5FYDA 3WGZA 4XQCA 3VH4A 2C2YA 1U7TA 3DZKA 4IS3A 4NFYA 3WLEA 3BMNA 1SNYA 5A5EA 2RAFA 1EVIA 3C85A 3ZGYA 3DWFA 1ZW1A 3MTGA 1KEWA 1HZJA 1WXDA 1DEHA 2CDAA 5GZ1A 3OIGA 4XGIA 4R1NA 1A4IA 3RD5A 1U3UA 3GFBA 4WASA 3H8VA 3X2EA 4LW8A 2OP1A 4XA8A 1NFRA 3IKVA 2XAAA 3PHHA 3F3SA 4K26A 2ZTUA 5AXBA 3ROQA 5F1OA 3JSAA 3OJLA 4FFOA 2I3GA 1YXMA 4DLBA 3BHIA 2OMEA 1GQ2A 2VT3A 2W8ZA 5DCUA 3WIDA 5L4LA 2NTVA 4I8XA 4E5YA 3RCBA 3I83A 4IIUA 4PG6A 4WLOA 3BMQB 1E1KA 1DAOA 1PGJA 4YBZA 3GVPA 4RL6A 1Z73A 4BUCA 4H15A 1DIHA 5EMHA 1JQBA 1N5DA 3VPSA 2P68A 1O94A 1H94A 1E3WB 2GZ2A 1SAYA 5DN9A 5TRTA 2B4RO 4CLDA 1K6JA 1LSJA 1DO8A 5T5QA 2AQ8A 4D7AA 3RFVA 5U1PA 1P0CA 5AVOA 2VWPA 3I6IA 1K2WA 5ILOA 2X9VA 3EAGA 3U4DA 3O8QA 4N54A 3WGHA 4D0RA 1PL7A 3KRTA 1SZJG 5T8KC 2Q99A 2RH8A 2NVBA 3RASA 1GCUA 2Y0DA 3GZNA 4FSHA 4FW8A 4R54A 1QYWA 4LK3A 4ITUA 3AI1A 1VPDA 3ZWAA 1E92A 1TI7A 2OOSA 3W6UA 3WSWA 3K73O 3D5TA 3QWIA 1X0XA 3V1TC 4UUNA 4R41A 5THKA 3JQBA 2AMFA 3JYPA 4CLOB 4PG4A 1NWHA 1PJ3A 2C59A 4O0LA 4NG5A 2OXIA 1EMDA 4RVFA 1VJ1A 4WGGA 4XKJA 1SPXA 2QIOA 1XR3A 1UAYA 4YJGB 5ER6A 3M1LA 3ITDA 4IXWA 3OETA 1DIRA 3IMFA 4M1QA 5A04A 3D0OA 1EDZA 3SLGA 3T4XA 1CQIA 4XYGA 4CM4A 1P1JA 1FDTA 3DXFA 5AXAA 4CQMD 4J7UA 1R6DA 2QHXA 3FRJA 4NJOA 1M67A 4CMIB 2QZZA 3LK7A 2B36A 2BH9A 1JU9A 4BKUA 5TLSA 1JKIA 1ZK2A 2PK3A 2YV1A 4L74A 1CEQA 2HJSA 1A72A 4XRGA 2B69A 4CV2A 2OBNA 3NTOA 5IFLA 3RSHA 4R1UA 1DFGA 3JYQA 2X9NA 1TEHA 2O4UX 3TOZA 2X4GA 5C5IA 4YWJA 5FFFA 1NTOA 2VCYA 2BKAA 3WJ7A 3W8EA 4B4UA 1U28A 1HLDA 1T26A 1C3VA 1GPJA 5B1YA 1NQ5A 5TNXA 1CYDA 1H9AA 1G0OA 3DZBA 1PJ4A 1YDEA 1EVZA 4PZCA 4KUGA 4YPOA 2NUAA 2CSUA 4EDFA 1XEAA 1QSGA 1O8CA 1TVEA 1ZUD1 3I52A 4R5MA 3DOOA 3BXXA 3I9KA 1RWBA 5I8ZA 4YACA 3GHHA 3LC1O 4W9NC 4XRRA 1IE3A 3BTOA 3K2EA 3NX4A 2O2SA 3QVWA 3NDIA 2PH3A 1AE1A 4UUMA 5L45A 2GCGA 5JE8A 4RF3A 1YH3A 5I9LA 2VHWA 1PEDA 4XIYA 1I30A 3QWHA 3GAFA 4TQGA 1AUPA 3M2TA 3PTZA 4IS2A 4R01A 1BDBA 5KJFA 3DBHA 2P9EA 1Y8QA 1XQ6A 4B3IA 4YT2A 1I5RA 2YV3A 2ET6A 1F0YA 2DTEA 2DBVO 4GX0A 3IC5A 5B4TA 2XXJA 1SOWA 4PG5A 1SB8A 2NVUB 4ZQEA 1JWBB 5HTOA 3QV1A 1ISJA 3O38A 4TKMA 3UHAA 4DL9A 4NH4A 3Q9UA 2WTBA 2VHVA 4TROA 4BO4A 4GLLA 2EWMA 3PJEA 3QA9A 4FN4A 1Q7GA 3BTVA 2Q4BA 4F45A 2JKVA 3CMMA 2G76A 4B7XA 4YAIA 1F8GA 2NQ8A 2X0JA 4RV9A 3VPHA 1VC2A 2EERA 4K6CA 1R4MA 3TZHA 3N7UA 5A4DA 2DQ4A 4XX0A 4PG8A 4FR5A 1CF2O 1HF3A 5JLAA 2ZYGA 3ZWCA 1PGPA 3EHEA 5A06A 5T67A 3HB5X 4LSWA 2FZEA 2RBEA 4YJHA 3BMOA 4U6QA 3DTYA 4J49A 1Z45A 2HMTA 5DDIP 1PR3A 5IXYA 3AM5A 1XU7A 3U3XA 4IINA 2FP4A 3AWDA 4DLAA 2UUOA 1GUFA 1SMKA 2CF5A 2GD1O 2IEDA 3BYZA 4I9HA 1P44A 2FR0A 3D64A 3KYDA 3C24A 4Z9XA 3GNSA 4GQAA 1ENOA 3W4KA 4IM7A 4Y6RA 4L76A 1YOVA 5F1KA 1HXHA 1LC3A 4MP6A 4CQMB 4YQZA 3S2EA 1UR5A 4OO3A 3GDFA 5CPBA 5IZCC 2JHFA 1KEVA 1LDMA 1E7SA 3AY6A 3WFJA 3FNGA 4J0EA 3GC6A 3PFFA 3FTPA 1A27A 4RF2A 2OBYA 1ZXBA 3V8BA 4BOYA 2VQ3A 5IDQA 4UULA 1P9LA 1YB1A 4KZPA 4DQUA 1MG0A 1ZNQO 1U7HA 5I9MA 3H65A 5IG2A 1U8FO 2Y1DA 4J4HA 3RVDA 2X5JO 3CINA 1TT7A 3L4BA 2X6TA 2XPCA 2JCXA 1O95A 1T25A 3E6AA 4RGBA 1E7RA 4OXKA 1WAMA 3COSA 4R4JA 4CM7A 3DQPA 1O6ZA 2QYSA 3RUCA 1YL5A 2BHLA 2G82A 1VSUA 1E1NA 3I9OA 2DPGA 4J1NA 3KEOA 3OJEA
chains in the Genus database with same CATH superfamily
3HC7A 3Q2KA 1EJBA 4YCSA 2FR8C 4ZEMA 5I6DA 2F3QA 1T5HX 1ZK4A 4LXXA 3T3IA 1N2ZA 3E84A 5A9SA 4PCUA 3ETCA 2JFFA 3QBVA 4H4EA 2PPLA 3WYEA 2DFTA 3CKMA 5FV4A 3GPIA 3OPQA 5JD4A 4I4TA 4E5PA 1U3WA 1W52X 2PBLA 3H16A 1PS9A 1QF7A 1J1ZA 2OEPA 5JCOA 1DBIA 3UHPA 1JHOA 1ZW6A 1JIVA 3BE5A 4GVPA 2X13A 3LY5A 3CX3A 3NHUA 1VA4A 3AI7A 3KLMX 4S1TA 2O8FB 3DZDA 1TF7A 3AEYA 3EDMA 4C20A 1BC5A 1H2XA 1JQ3A 1RM5A 4KGVA 4JLVA 1DGQA 5KNCH 2RGYA 3HDVA 4YIKA 1JSRA 2CVOA 4BNFA 1HH4A 4XDYA 1SBQA 5KYXA 4UTXA 1VHDA 4AT1A 1I0LA 2WSIA 4PZEA 2YYSA 4M8KA 2FZWA 1ML4A 2FRDC 4OK3A 2I2FA 5EZYB 5EP3A 4MDFA 5EFZA 1AZSC 3BHMA 2VP3A 1Y1QA 4EA9A 1CRQA 3EGIA 4Q3DA 3DDHA 5ALJA 3U7FB 2PGDA 2IBMA 3KJHA 2GCOB 2JAHA 2WRZA 3BD7A 3OZBA 2IUEA 4JUAA 4X92A 2Q5CA 4J0HA 4C5BA 3JD3A 5I48A 1DBRA 4MX8A 1TAQA 3GUYA 4DQVA 3U37A 2A7QA 1IM5A 2V5AA 4MVJG 1ZH8A 3ND5A 4BY9E 4CCYB 1VPWA 2Y76A 1A8HA 1FSGA 1NFFA 2PIAA 8ADHA 2OR3A 3A1FA 4KGZA 5JSQA 1ZUNB 3IV9A 3LBYA 4A0RA 2H92A 4OH1A 5FA8A 1LDGA 4N9WA 2MSNA 1OFVA 2OCLA 3MUFA 3RYIA 5HRAA 4Y2GA 4J3FA 3K0CA 5LL6P 2AN1A 4KB5A 1EBBA 1Z6AA 2DR3A 1V5FA 3ENQA 2W42A 2XMCA 4Z4CA 4FCCA 3RIMA 5I7FA 3KOMA 1HY3A 3KQSA 1MA3A 5IUNC 1CFJA 3GR6A 4QUJA 3CCBA 2IX3A 1FNMA 2ZJ8A 2ANBA 1CUJA 3UAGA 1OROA 2VK2A 3HU3A 3SC2A 2J0QA 3V55A 1H3NA 1OBHA 2JLAA 4AZ0B 4RFSB 5HKLA 5JRJA 4PFJA 3GFTA 3RU7A 1Y98A 1QAQA 5AW5A 3W3AH 4B81A 2EV9A 4EYEA 1N32B 3KL4A 4HTFA 1AM4D 16PKA 4EUFA 4JLBA 3HV2A 3QFHA 3O1HB 5BRNA 5BR7A 2R6FA 4AY2A 4G5FA 4ZDIA 4GRDA 4G36A 4KO2S 4DWWA 4NJEA 1ZU5A 3PFNA 1NQXA 2HT1A 4ZV7A 4D2IA 1AGYA 5G1PA 2VWHA 3SK0A 1A50B 2GEDA 3PL5A 1RKVA 4M1EA 1JLSA 4D8VA 1KZ9A 2YFYA 4QC2A 4EY8A 9LDBA 3W04A 4XGKA 3HL0A 1EFKA 1MCZA 3BIJA 4AS1A 4QZVA 5F64A 4BMSA 4DIMA 3OSZA 4EA8A 3RS8A 4EG4A 4GR5A 1LZLA 4OHKA 3VDQA 4LVNA 5EQTA 4LDZA 3KPVA 1FJ2A 4MPTA 2B9VA 1JZSA 2EARA 1J70A 3AX6A 4MJLA 2QE7D 3QHPA 4UASA 3FZEA 4UEKA 5TF4A 1OB2A 4FZ5A 4JGGA 2NSDA 2PBRA 4YR7A 3ISVA 2Q29A 5EIOA 4ZN6A 2ZIXA 3V8RA 2XUOA 3VSDA 4D5GA 3N28A 1UDAA 3QI7A 3E5RA 3KZNA 1TK9A 2NT4A 4L02A 3P45A 4LDPA 3WJAA 4JJKA 4ZJUA 3FRIA 1RHJA 4TX1A 1QZXA 1AGNA 4BIIA 1H6DA 1PZHA 1Y4UA 2B6HA 1IOZA 3H1TA 4RY2A 2FMHA 3E15A 1DWQA 2PZFA 2HOQA 5JY1A 4MUBA 5LQRA 2IS2A 1Z38A 1G6OA 3DSRA 1MJ5A 5D84A 3RS4A 2ROQA 1OGIA 4IUDS 3QENA 3EPHA 3E7WA 5CGQB 5FV7A 2B4TO 5CT8A 4KPYA 4QGBA 4D6PA 2I9PA 4URXR 1TM3E 1BEZA 3JYLA 8ATCA 4RPGA 5BWNA 5C1BA 2ZFUA 3D8BA 1J8VA 4PCLA 3GLKA 5I9LA 1W2GA 1ID8A 4LYYA 1XLWA 1Y1KE 4KQ9A 3LLUA 1NBAA 3J7AC 5I7RA 3IDQA 1J2UA 4XDHA 3A70A 3D5EA 2BEUB 3OQHA 4LHYA 3KVRA 4MWOA 4L9WA 1NRWA 2J33A 3R0XA 3NVAA 3LBFA 5LCXA 4AFNA 3OCCA 4ZD6A 4A0FA 3VRHA 1PWZA 1BS2A 2ONKA 5IS2A 2IZ7A 3R6TA 4G8CA 1N2SA 4PY2A 2YN2A 3NV7A 1ATZA 3IT1A 1TYZA 1S2GA 4KJXA 1IY8A 4Q34A 4QHTA 3CN9A 1UUFA 1FDIA 2IF2A 4EX6A 3TJZA 1KY3A 2P2GA 1M2VB 5EJ8A 1ZJYA 3TL2A 3ZEIA 1QB8A 3TXXA 4HAVA 3IAUA 1RZRD 3V8MA 3K6SA 1KR2A 1OI2A 3I5YA 3T95A 3HFSA 3GGJA 2DY0A 2JC3A 3M83A 5C7LO 4Q21A 3DXZA 3WP0A 3RBVA 3KPYA 4JK3A 4OVKA 4WJKB 3E18A 5GJWC 4UNPA 5I8WA 4NFHA 2G9NA 3V4FA 1AGPA 3BF8A 4BX3A 3AIOA 1Q7EA 1XCBA 3RJMA 4W1QA 5EA2A 2QTVB 2IPXA 4FFDA 5ED0A 3LUPA 5GWXA 4Q3NA 3HCAA 3NXKA 1JPJA 2VRCD 1N5JA 1ULHA 4P3XA 2DUMA 1R12A 1TLLA 2AF4C 2VZ0A 1OX4A 1KXJA 3A6DA 3SHVA 1RFLA 1B6TA 1P60A 1VLQA 2VDWA 3QV2A 4YYZA 4EHLA 1K63A 3W8FA 3GN1A 2GAIA 3M49A 1U0HC 2Q1TA 1PK7A 3UF0A 4H4CA 5EGNA 2CMDA 3WWDA 2EKQA 5JS7A 5DWQA 4U0JA 2WIKA 2EGUA 5KHOC 1IBRA 2TMKA 1KAQA 5LBIA 4B3BA 2Q8NA 4GW3A 1FJXA 3SIWA 1FVOA 2XTZA 2P7HA 4MRAA 4CMAA 4FE7A 1V11B 3ACDA 1CRPA 4WFIA 4CLEA 5JADA 1ODFA 2R85A 1JGTA 3TZEA 3CTMA 2YWFA 4A0HA 3H13A 2J5KA 2PSSA 1YRBA 3C1AA 3KQMA 3WIBA 2P9HA 3U44A 4AWXA 3CU5A 2GNPA 2HQSA 3T61A 3E48A 5JBNA 1GL3A 3QE2A 2ERCA 3GYGA 1PCXA 4YQYA 2I6TA 1L4GA 3R3SA 5JDCA 1BWPA 2NZXA 2RCYA 1RFGE 3MTBA 4JIGA 4RTOA 5AVVA 4ACAA 2HSEA 4GMFA 1IQUA 4ALLA 2ZR9A 1QRRA 2J0VA 4FUTA 1GYPA 3M6UA 3KEGA 1ZRMA 5DP1A 2BFDA 2YICA 3L6RA 4GPBA 1DXYA 4I9GA 3ZY6A 1QRUA 1DHTA 1WNTA 3JWJA 3P2MA 1W0KA 2PZAA 2CJYA 1VE5A 3W1EA 3UMFA 3K9LA 1G7SA 4U9HS 2QD1A 4BRZA 1WHSA 2NSHA 3OZEA 2X0KA 1FNNA 3H11A 3VZCA 4ESVA 4JYMA 3ETJA 2QPTA 2QYTA 1JQDA 1Z56C 2WSSA 2ZAGA 4I4TB 4BDSA 3EFHA 4M1KA 2J5RA 1W48A 3LP8A 4MV3A 3ZQ4A 1HMPA 2Q3DA 3ICCA 4J0KA 4MAFA 4CFYA 2G36A 4V38A 1X19A 1TIKA 3THYA 4UCWA 3FN4A 3G0DA 5A02A 3U9LA 2GAOA 5CG1A 1P31A 5K0EA 1U1FA 3COJA 5I7VA 1D5CA 1Y3IA 4TQUS 2XUAA 4XASA 5FPYA 1OUMA 4UMDA 2PSJA 4DYDA 3DZ8A 2HPZA 1EUCA 3LCJA 4FZRA 2I2AA 1C7EA 5E7IA 2IK8A 4MEBA 4NMXB 2QM8A 3HNOA 3VNVA 1F0PA 5E1OA 4OQDA 2DG2A 4B33A 2HXGA 5GAJA 4PIMA 2VYFA 3FVWA 3HJGA 1Y3CE 3DCYA 5BV7A 1SUIA 5EPEA 5JCOC 1QDUA 1UDCA 1WMEA 3EDRA 4ES6A 5KQGA 1KIAA 1NV8A 3L0CA 4G85A 5F3WB 1W4RA 4NOJA 2QN2A 2FSGA 5CLJA 3ZBUA 1I3MA 4DADA 3W79A 3I5MA 2AOVA 5F3RA 3KU4A 1QYXA 2C9CA 3DM5A 4KKVA 5L6MB 4DV0B 4BBAA 1B1CA 1WUJS 4DUGA 3EHDA 2VYVA 1YVEI 2RB5A 1WPRA 2P4UA 2G70A 5HF5A 2IGTA 3H1GA 4TM7A 2FN4A 3BGIA 1KY2A 5AW7A 1G20A 4EFKA 5GIOE 2GEJA 2VAXA 3KKMA 4Y9TA 2OD2A 4UQOA 5BVHA 2XWBF 2A35A 3ZWXA 2B1RA 2OHXA 1XKLA 3MOGA 4TS3A 3VR4H 3JQGB 4U5QA 4NAUA 5SZIA 2ZANA 1XA0A 3MELA 2C5HA 4WOKA 1JUDA 4AZVA 2OXCA 2WD8A 2WDZA 3V1UA 3ZQKA 4Q02A 4ZAFA 2CY0A 4UFNA 3ER9A 3X44A 3ZHZA 2WYOA 4JP8A 1RJEA 3AV0B 2WAXA 4MZXA 1ZZGA 2FZVA 1IY1A 4FDVA 4PIPA 2B8EA 4YCLA 2G67A 2H7YA 4HH0A 1GKKA 5FPQA 2X1HA 4YP9A 3IVCA 3TL3A 1VGVA 2VL7A 3L93A 3DW3X 1LX7A 1O5IA 1U9IC 4OJMX 3TIGA 4YQFA 3G9UA 1N3IA 2GZ3A 4LDJA 1FFXB 4ZYTA 3VNBA 3EZNA 4JBIA 4XZ3A 3V3TA 3HBFA 1A88A 4YMVA 3DNFA 4L57A 4EB6B 2J45A 2CXOA 4KIGA 5LLDA 1WPQA 4BZWA 3PE4A 1YRWA 1W44A 3FCXA 3EEYA 5FQNA 4F1WA 3CLSD 2G9UA 5IT0A 3PT5A 1EFCA 2I55A 2LRHA 4DBLC 1HA3A 3HCOA 3JTMA 2I3ZA 2HMWA 1LC0A 1V16B 4QE3A 2BZ1A 2ZZNA 2WQ7A 4M87A 3V7NA 5D5PA 4BO6A 4QVIA 1NLUA 3ORSA 3IBFA 3ZVNA 4KNYA 1AX9A 4UBIA 3W5SA 1VKNA 3NEPX 2FMIA 3UKOA 3OT5A 1JAIA 3IE2A 3IGFA 5E0OA 3WE7A 1C9KA 2X3YA 3CJQA 4J2TA 4I50B 5KNCD 5EOVA 5IM4F 3K32A 2OGWA 3PQCA 3BL5A 2ZIXB 4LHWA 2QRLA 4MRMA 2GSDA 2MTBA 4MV0A 5E4TA 1GTVA 3WRXC 4CWAA 4DOMA 4DMUB 5E8JA 3ODGA 4X8OA 2PQ6A 2Y1KA 3P5SA 3ZYZA 1NOIA 1D9ZA 5AWFC 1G2OA 2J0UB 1T3SA 5ERYA 4EY4A 5JYDA 1V7QA 1OHHD 4LJ6A 1DO0A 5FBRB 2JJYA 4X7PA 2DUWA 3L4EA 2W6CX 4KPFC 3QW2A 1C30B 2DPMA 2QD4A 2GRAA 4MWCA 4UMFA 5AVSA 3UJNA 2CNLA 4OKNA 3UB4A 3AR5A 1LLDA 1L8AA 1ZVMA 3DCNA 3HVUA 4OHUA 4WX2B 5E9WA 1TF2A 4MLCA 3JWPA 4LSGA 4KEAA 3UV3A 4AROA 5HQ3A 1NI3A 4FJ1A 2IIPA 1TYBE 2C61A 1GL6A 3R9IA 1UPAA 5H83A 1OFUX 2HWYA 3ESXA 2BMAA 4HXGA 1RPTA 4C04A 3VZPA 3P9PA 1DOHA 3F6CA 1SVMA 3TLEA 3K9GA 1G41A 3QMWA 3AW8A 5CX1A 3PSHA 2XUJA 1RADA 5K3EA 4GSYA 1Q21A 1E3SA 2NO6A 2ONZA 2OZEA 2VAWA 3PNBA 4P3NA 4RYDA 3KZOA 3SD7A 3HLYA 1U8AA 3A1VA 3EQ2A 3JVIA 1BDJA 3PHJA 3EBOA 5BNZA 2Q2VA 3GJRA 2QLNA 2O7QA 3L7MA 3GLUA 3VV3A 1BFDA 5C4GB 3RE1A 1COWA 1GPUA 4BMOB 5CCXA 1H65A 1JEDA 3W3AD 1QKIA 2FJPA 3ZK7A 3BWEA 4V1CI 3MRSA 1JU4A 3CIFA 4PCVA 3URKA 2GX6A 2XYGA 3PENA 5LQJA 1GPKA 3GT4A 3ENZA 4JBYA 4KK4A 3PEEA 5KTOA 4YP6A 1QO9A 3L5OA 4XWOA 1PTJA 4FYMA 3FB4A 4GBGA 3E4DA 1P0PA 1XB2A 3FLAA 2REBA 3QXCA 2CKDA 3B1FA 1SXJD 2L19A 5IM4A 4L0MA 4V0SA 3HKBA 2XBUA 1Y5IA 4DV6B 2QTTA 1BGXT 2OXFA 1VE3A 3O4FA 1WG8A 1DARA 1J8MF 3JPYA 2QENA 3I2GA 2HBZA 3KHKA 1G7CA 1N7HA 4QQ8A 1R64A 2WG2A 5TC4A 4JL8A 4WBNA 1ZNYA 4FHZA 2QGNA 3BRWA 1I2BA 1X80A 4JI0B 4H7IA 3O2NA 1EGQA 4OL9A 5T3UA 2VRNA 3U7HB 3VZSA 2VDWB 4M8NE 5M34A 3UMYA 2QN6A 1XCLA 3HVRA 1I10A 1ZCFA 4JZKA 1QFZA 2DZDA 5K1ZA 4K6GA 1F1BA 3EA5A 2P0AA 2QORA 1BXGA 4NF2A 1F3LA 1ZX1A 2XXBA 1AO3A 4HDNB 4K0KB 1JF8A 2CEAA 2C3UA 4O6VA 2PJDA 1RQLA 3M6LA 4ND1A 4Q1DA 2D2VA 2F00A 3MWKA 1E6WA 4LNUA 5EJAA 1QDLB 5BW8A 3IIEA 3QTTA 4OMDA 5AMXA 2OQ2A 4OP2A 4GEGA 5AKLA 4BFLA 1TUBA 1CZOA 1Z0FA 3JR3A 1KE2A 1OAOA 1V1RA 2D2IA 5EMJA 1EX7A 9ABPA 1E1DA 1J0CA 1D2RA 3D3QA 2MMGA 5L3ZA 3U44B 3ILXA 2QJTA 4LQCA 2DPXA 2G08A 3PRHA 2ZWAA 4Y2XA 3CNEA 2VXBA 2UZ3A 3AEUB 2B8NA 2COUA 1IUNA 2W2KA 1MFZA 3I39X 3QQPA 1OU0A 4INPA 4L5BA 4RGQA 3ZHBA 1BZYA 1E8MA 1U81A 4IW3B 4REOA 3ZI4A 2O3QA 1U2DA 4LY6A 5BW4A 3T34A 3M7IA 4QA9A 4OLJA 1J33A 2AUTA 4PN7A 1K6MA 4XWWA 3EW9A 1XLUA 1VL5A 2DH6A 3PUJA 1Z74A 3QFSA 3AGPA 5E8RA 4BASA 3PXBA 3VO1A 4BE9A 3ZDDA 3ZKWA 4DBLE 5C18A 1G8KA 4DQXA 4GZ5A 5B5SA 4QATA 2PUEA 1T2AA 3H11B 2DRIA 5KOHB 2QE6A 1C29B 3KZKA 4HNHA 5KQSA 2J87A 3IUSA 3KBBA 4ZT6A 1Z7YA 3P8ZA 4PWYA 4QDXA 4BV9A 1FBTA 2PH5A 4NEGA 1K7XB 1QIDA 2AXQA 1DDGA 1JHDA 1DG9A 1P33A 1O4VA 4YJ3F 2X42A 5JDCC 3JZDA 4AIRA 2WWFA 4PO9A 4BKRA 4NATA 4B6QA 2EP5A 2VBGA 1FNCA 4KXMA 4HXFB 5F7JA 3KQHA 2Z5FA 3G9TA 2FSIA 1DLJA 1Z2NX 3L0OA 4COOA 3CUUA 1EUCB 3L7DA 4UVEA 1NR7A 2FP3A 4K1XA 5AUOB 2XWPA 1G8HA 4TSRA 3HFGA 3J7TA 4MVJM 5FI3A 2FPGB 4U2FA 4JGBA 1DLIA 4WK2B 5IJZA 5CB4F 2PRSA 1NPYA 2H2WA 4UCFA 5DM60 1FSPA 2GYWA 4ZVLA 2P2YA 4RK7A 1L7MA 2IYSA 3PI6A 1L6IA 2PSFA 3V4SA 1IYZA 1JYSA 4OQFA 3ANNA 2BR5A 3UOAB 3U62A 1A98A 5LC1A 4C78A 5JAQA 2J3IA 1W5FA 4YP7A 1XFAA 3M6WA 1QKKA 3BHNA 3LQYA 4XQ9A 2YWEA 4HNQA 1QOQB 3A6LA 4BO1A 3KVYA 3PCXA 3AP2A 1KAHA 4HADA 4U00A 5AVTA 5IT4A 1L1EA 5KX5F 1Y1PA 1H8HD 2CD7A 3DMFA 3DOJA 5ALZA 1X1QA 3OURA 4L95C 5IKEA 1X87A 3PL1A 4Q1FA 1XVIA 2CWWA 3C7DB 4N0EA 5F2KA 5KDOA 5AQEA 3LW8A 4ZC1A 5LP6F 1G20B 3RW9A 3D8TA 2H8KA 3Q0EA 2Z58A 4WESA 3LKBA 3LUBA 2AMJA 3IQXA 2CLFB 2C5EA 1RCTE 2P1ZA 1RQPA 1UK8A 2GZSA 1SUBA 1C8VB 3OZFA 2OYSA 3E2IA 3SEFA 3HU5A 1SC6A 1GWNA 3DXXA 5H7XA 3DBOB 1M33A 1T4DA 5A06A 1UMBA 2V6GA 4R3UC 2Q2OA 1DS6A 3Q4GA 4JBNA 3I2YX 4E6PA 1QHHA 4NBNA 3FWHA 5LUAA 1XALA 4M37A 1QHXA 3FCEA 3QW4B 4NG4A 1OFHA 3OE7A 3GJ5A 1KY4A 1AUOA 2GM5A 4YCMA 4NMMA 1KK0A 4YJ3A 4WFKA 1LDBA 1UOPA 4E5VA 4RVCA 3V33A 5DXFA 4BLVA 1N3YA 1RPJA 1JEOA 4ZPXA 1VIVA 1W8DA 3IQFA 4JBHA 1VG1A 1P0MA 2NZYA 2CYCA 1QJ4A 3FROA 5ITWA 1M1ZA 4ASUA 1V8FA 1WLSA 2JFZA 1K8YB 2E1PA 2I54A 2OGSA 3H5TA 2R1VA 4J1TA 1R66A 5F2EA 3U4GA 3VFDA 5K8LA 1Q1EA 3HWRA 4KREA 3A9TA 3LCVB 4R83A 3E9MA 3RLIA 3TAUA 4Q9DA 5ERXA 3H3XA 3MSCA 3CYFA 4MUEA 2TMGA 4R2LA 2AR0A 3L7AA 3PPIA 4JOBA 4DA6A 2AOXA 1UKEA 4Q05A 2FMUA 3Q8KA 4EHDA 4E2WA 5EKUA 4C7KA 4P38A 2A86A 2BMVA 3DAPA 3F46A 1FXSA 5TMDA 3EXIA 3ONDA 4PG7A 1JHAA 4FNMA 1H2HA 1KK2A 3IUPA 4KN9S 1QFJA 3ONFA 4KN5A 4NXNB 3AKYA 1KJQA 4KDEA 4R1OA 5F35A 5HKKD 5HPYB 2UU9B 1XCPA 1FP4A 3PJDA 4JJ4A 4YV1A 3GPDG 2OECA 1S9DA 4P7JA 5T7BA 1QFSA 4NV0A 3FMIA 1Z12A 1QO7A 1UBOS 1EWTA 1WXIA 3S2ZA 2XRYA 1RVV1 5LP6A 5J43A 3IQIX 1JV2B 3UC9A 4A6DA 4YP5A 3FMGA 3GCZA 3VC3A 1CJBA 2JJ1A 2QW8A 2GILA 3AXSA 4P5DA 3TRDA 4DC9A 1M2WA 2V4MA 3P7MA 4Q4AA 3TN7A 4ZZIA 4O25A 3PRYA 2CC2A 4UEWA 4P4GA 3SQOA 1PJZA 3F71A 4RWEA 3TEJA 4EW6A 5HQ3B 1MO3A 3T1QA 3TW8B 3GXBA 5IRCD 1ZL0A 5L6LB 1ISSA 3F6PA 5JFTA 1URPA 3MBIA 3PIIA 4MW4A 4PYMA 4MGZR 1X8KA 2BFWA 1AKUA 1VHJA 1EH5A 2CYBA 3GFSA 1X1BA 2ORVA 3DBIA 4Q9KA 3QU4A 4KU4A 2VPZA 3V2HA 1I33A 5KYKA 3VR4D 1M2HA 4U7PB 1P1RA 4C0AC 2R7KA 3A4VA 2AZTA 1BAPA 1MB3A 4GPAA 4CLRA 2GBPA 2P91A 2ZVQX 5DYWA 1YIAA 2IYYA 1Q77A 3JQDA 3H7IA 3S1AB 3ZWNA 3A10A 3BD6A 4MWTA 5EMNA 3PUKA 1C81A 2VUTA 3ZJYA 2H5JA 5DH9A 2FRVA 4NABA 3AY0A 1Y63A 4XCQA 3C3DA 1HEUA 5CU7A 1JXOA 3VNSA 3QE9Y 2G09A 4LSMA 3A3YA 2KE5A 3LLSA 3R7SA 1RRFA 1U5BB 2G72A 1QX4A 3B60A 2X8LA 3KG2A 3LUJA 3NHPA 1NVKA 3O0DA 3ZWYA 3FLBA 3L6BA 4GOMD 1H2AS 5TT1A 1PT5A 3CQ9A 4A16A 3K0AB 2CZQA 4LDAA 2G5TA 1CUEA 2IYEA 3JAKB 5TPZA 2D1QA 2C82A 1CRWG 4RANA 2PT7A 1GN8A 4HPWA 2XB4A 4ABYA 3GLSA 4KIJA 3U3DA 5LYJF 3P1JA 1LWNA 1O6BA 3B7GA 4DNFA 2OBFA 1W2WB 4IGFA 3RRXA 1SZPA 4I9UA 2PZJA 3PEUA 3EXHB 4OMCA 4XAQA 5EMKA 3IYLW 4A8PA 1ECLA 3T1VA 4J16A 2AI3A 4Y9UA 4XPIA 1T5IA 3SYLA 4DDWA 1AQJA 4OXXA 1DKMA 1S8FA 2AHRA 3C87A 1SUSA 2CLIB 3LCUA 1OTXA 1PT8A 1ADFA 2JH9A 3WWEA 1ZEMA 3GPCA 2CWDA 4NCIA 4GAEA 1JDPA 3UAOA 4R2JA 4ZJPA 1JXAA 1YBFA 3BH6A 4O2AB 1M2NA 1PTJC 4H1UA 2OHJA 4X7MA 1BXGB 1DKLA 5CK4A 1QS0B 1VFPA 1B6GA 2CNBA 3R5SA 1CCWA 2O5VA 3UMGA 2PYDA 5JNVA 1ULAA 1EUYA 4F5WA 5BYKA 3ILSA 1E2QA 3NRCA 1J23A 1GAJA 2WF6A 4GPTA 3CLUC 3HMKA 1V4VA 4LQLA 2XF2A 3EF0A 5TXGA 2BVNA 2P2LA 3AW9A 3MJDA 4JCCA 4FILA 1S7GA 4M9ZA 4BQPA 4GI1A 1YSCA 2WY2D 1R0YA 3TPFA 1NBIA 3E03A 3HJHA 4UQPA 9MHTA 1R7RA 3SGLA 2WJVA 1OSNA 3GZJA 3K5PA 3UHOA 1EZ1A 4UU0A 5AR1A 4KO3S 4OA5A 4R40A 1HKUA 1T2CA 5EINA 5IBRA 4YUVA 3RU9A 3B3JA 3SJAA 3ZHCA 4QM6A 1B8PA 4JENA 1HDYA 4G41A 3NHKA 3R7DA 4I4CA 3ZXSA 4OEHA 2I4OA 3IQEA 3WNVA 1XDBA 1U28C 2X2FA 3E5NA 3OT1A 1K75A 2ZB2A 5B53A 3CIOA 3RGWS 4BMPB 1JN0A 1Y0BA 4JEIA 3Q3JB 4MV6A 1KI3A 5B7NA 5JNSA 5JNLA 1GT91 1TQHA 4XR4A 3K2IA 3IV7A 3KJIA 3JZIA 3IAS1 3ZKWB 1BMDA 2GBLA 1G8JA 3GGCA 4RK5A 5BOSB 4NCAA 1GCOA 5AD1A 5JECA 2I03A 1EFHA 2AQHA 2V6IA 4QRIA 2WYUA 5HDBB 1OAOC 1GG9A 2HHCA 4CDRA 3C6XA 3IIMA 3LQ1A 4CKEB 5ETJA 2VT6A 3A2NA 3CLTC 2AG8A 4UDXX 5FULA 3UJCA 5LN1A 3CPSA 4O8CA 5IUKC 1QVVA 3E4CA 4UU8A 5J5AA 3DG9A 2E7ZA 4A10A 4QUKA 3UYKA 3WLOA 1HNXB 1AY0A 1DTWA 4NU6A 1EJ0A 1RVDA 4PXSA 3TPCA 3AF5A 1EDDA 2ODTX 1VJTA 1QO0D 3TZ6A 2VOJA 5I7AA 2C00A 3SAJA 4V03A 4CUKA 3S68A 1F8UA 5HIJA 3BE6A 2CXTA 3RPEA 1SG0A 4GP7A 1PJCA 1X1RA 1XOIA 1Z6XA 2VG8A 2G0TA 4IDEA 4BB5A 2V55B 3RBXA 2A9QA 2IPMA 4LC9A 4GFDA 4JP3A 4IWXA 2OCBA 1Z4NA 4UZFA 2IBTA 4OXYA 5DN6D 1UMDB 2UYOA 3FPSA 4J4TA 3WC4A 4CMKA 5JOQA 1F6DA 3HCRA 3GIWA 2HGSA 3AZOA 3PC7A 2ODNA 4TLMB 4R98A 2X7JA 3ICWA 3V46A 3ZDYB 4M7PA 1FLNA 3CE6A 5DK6A 4U2EA 3SBOA 3RJTA 1N0WA 2IYWA 3DL4A 1U6JA 4YFYA 2IY8A 5DHSA 4E1VA 5BQXA 1ZSVA 2JFVA 2HA5A 3MGCA 4K3VA 2YNMC 4NS1A 1OLSA 4Q9LA 2JB9A 1M76A 3NM4A 5HM6A 2YXPX 3SS8A 2B8TA 2WPNA 4LCJA 2F7SA 1VSQA 4LNHA 1T9GS 4PPYA 3ICOA 3EVTA 1YK0A 4TXHA 4DDUA 3VC2A 3EULA 2VWGA 2ETVA 2Q62A 1OI4A 4XIIA 3UIEA 2JDIA 4FOLA 4H7FA 1U80A 3PWKA 4YAUA 3GLGE 1XF9A 4JU8A 1I2CA 1WMSA 3NJ8A 3A9WA 2V1XA 5EUMA 3FPLA 4BCDA 3TIXB 1XYVA 1Z28A 3ELUA 3DOUA 1G3QA 2PLWA 2XAUA 3TMAA 1H6CA 2IS6A 3HB4X 2NSYA 4KWEA 3ZLBA 1Y9EA 2CZCA 1DJOA 2VXYA 4EATA 1E8DA 1MU0A 3AU9A 4KTVE 1UMBB 4WLNA 4DNPA 9ATCA 1GG5A 3DE7X 3OZCA 4OQNA 1U2GA 2AEJA 4I3HA 1FF9A 3RYCA 1JEEA 3CF0A 3TZCA 2ZB8A 5EJ6A 1RBMA 2DJ5A 2MSDB 4BO8A 2P9BA 4QLOA 3JYHA 3AUTA 2DYKA 3ZY5A 5KINB 1FQJA 3QOFA 5HRCA 1P6QA 2VBIA 2WUDA 4BECA 2R1VB 3OM9A 5HJ5A 3GAMA 1DKRA 3VOBA 5D1HA 1F17A 2DOKA 1LJ8A 3NH6A 4D3XA 4JYZA 4KGXA 1CUUA 2BPOA 5CB4B 4A23A 3C7KA 2GJ9A 1ZH0A 4EHIA 2ZWOA 4D82A 1ZRSA 2WFLA 3G2LA 1ECBA 1XXHE 3GEDA 3N75A 3JCZA 3R8XA 4BMCA 3ET4A 1EFVB 4I1RA 1GGVA 3LKVA 3R5JA 1H8ED 2WUWE 1KEEA 4YJ2F 2G0AA 3BE8A 3QELA 5IN5A 1TD1A 3GV0A 2AXPA 4FMDB 5CUQA 3JQRA 3ZLUA 1L4UA 1OIXA 5AT1A 2EGGA 4CIDA 2HK6A 3L8DA 2DULA 3KXPA 2ZKIA 2BE9A 3CUSA 2H7XA 3CISA 3MWLA 4GXNA 5HM8A 1R6TA 1JDVA 3DOFA 4BLQA 1PEAA 1BGVA 2EQAA 4EB8A 4LF6B 1DCTA 5KX5B 4NESA 2XUPA 2YUIA 1HEIA 1BE1A 1YL6A 4J1TC 4KGDA 5INTA 2Q2QA 1VBKA 2ZYSA 4CUZA 1T6XA 4PW0A 1NDUA 3NOQA 5LFAA 5LP6B 3MMSA 3PITA 2Q3FA 4LYEA 2R6HA 1UANA 1IJFA 4C0SA 1A71A 2VK4A 4Q01A 2I6SA 3KTFA 4D8XA 1ARZA 1N7JA 4XI9A 2RAUA 2P5YA 1HDCA 1TD9A 3AJDA 3TZKA 1E1CA 1NUTA 4U7JA 1Z26A 2XVMA 1FXWF 4LWPA 1KH1A 1UPXA 3LPDA 4EG3A 3NAGA 3A2KA 4L0DA 2H0AA 4O4JF 2G3YA 3DJFA 3ZHQA 3FYUB 3MJEA 5ALGA 5FPSA 1C3LA 1Z5GA 3W6ZA 3A4TA 4JCOA 4ARSA 4LRUA 3LY9A 4AZWA 2EZ8A 1QQ7A 2G25A 1OH6A 1YT5A 1NAHA 5JS8A 3CG4A 3ANXA 2PX0A 4YAWA 3TTYA 5LNK1 1PGNA 5EN4A 2VTVA 1GQYA 4FOOA 5CCBA 1TC2A 3KCNA 1GTL1 4IKOA 6YASA 5A0TA 2YHIA 2HF8A 3M5DA 4UAGA 5KYVA 2PWAA 1JBEA 3QEMB 3G7UA 3PQ8A 1GU7A 4WK0B 4IX1A 2O7RA 1R0WA 3GB9A 4S24A 1PL6A 5JAMA 3OJFA 3FH0A 4QECA 2AMYA 1ZKMA 3AG5A 4EJSA 2Z5LA 3IB3A 1ID1A 5KB3A 2XNKA 2ZBGA 1EA5A 1HURA 4HEA1 4MK4A 5K0SA 2RBGA 1HE4A 3NM5A 3IDFA 1TXGA 4UC0A 4JJ7A 3EK2A 1YO6A 4J76A 3NALA 1KI1A 5ADHA 5L3QB 1WCXA 3JV7A 5H16A 4F6RB 2J30A 4D9NA 1ZD3A 3KJQA 4B43A 4M83A 4XJVA 3CCCA 5DLQC 3U9TA 1IB0A 2BDTA 1UJCA 1UXKA 2C3OA 1VGRA 1J7KA 2JAQA 3F47A 4RTLA 4XWKA 1BFKA 1YD7A 1CIJA 2E3JA 2GF2A 2JF0A 3ZN2A 4EG0A 5G4LA 4O4LA 3Q7RA 1CQWA 3QY9A 3HXKA 4IUYA 4DLWA 1NKVA 1GG2A 4D45A 4B7UA 2UUBB 4NARA 3EPKA 1X7YA 2DQYA 2KBFA 1E61A 2W98A 1RZRA 3R09A 4U63A 2FRXA 3RIGA 3TFOA 2ACWA 3ESZA 1OT5A 4GPIB 4QXMA 1QBKC 1WA5A 2C2GA 1FXWA 3AUJB 3LK6A 1E1YA 1R6BX 3F5DA 3FI9A 3CT6A 2EFCB 4O4JA 4D6YA 1ZUIA 4CLXA 2TMDA 3H4VA 1Y42X 3OPYA 4YFVA 3S2FA 1DC5A 3VTKA 1O1YA 3W5HA 4AQDA 4DDMA 1EM6A 1LEHA 1FRNA 2DTXA 2QD2A 3AKDA 4OYRA 2VPTA 3EGOA 3FFBA 1GPNA 3O9ZA 1X74A 4A1FA 2CNKA 3OBIA 1JQ5A 4YT5A 2ZBQA 4YMTA 3AHCA 1P61B 5CR9A 3ZGOA 3OOJA 2BEJA 4J16C 4ZVVA 1LNSA 1XJ5A 1J25A 4FS8A 4WBSA 1YFJA 1PWXA 2HRDA 2CL0X 5AUQA 1WP4A 3H87A 3IUMA 2V9PA 3H2KA 3MQFA 4UNIA 3OZAA 2VUHB 2QAGB 4JP2A 1QVRA 1SK8A 3DAGA 1ECCA 5IXJA 3OT1B 2F4VB 2AXEA 2C9BA 3K1TA 3O3CA 2IPOA 1FBNA 1AN0A 3ITEA 3JQAD 3TRHA 2YW9A 3HZZA 2DT5A 1W7AA 5KU7A 3C7TA 4LMBA 1NQOA 3DHVA 1W94A 3CUWA 4HAOA 4UPVA 4XGNA 5JVDA 1MB0A 5MDHA 2MYUA 1Z8FA 4JWKA 1EEXB 3SCZA 4DKXA 4M9QA 4WXMA 4RMJA 3DHWC 3WR5A 1T6YA 2I87A 3H5OA 4CYMA 3FI0A 2PRYA 4EPYA 1KDRA 4HDRA 2ZRAA 3ZW9A 3ZUPA 5LYJB 1GZVA 4D4MA 2OTCA 4B79A 1SVWA 3VZBA 4G8BA 3NYWA 1CERA 1AXEA 1A8IA 3BZUA 4US1R 821PA 3PGXA 3C6ZA 5IWCA 3K1YA 4DG9A 1J6UA 3O2JA 1GM5A 1JKMA 2KBEA 1I6KA 3OIUA 2FH5B 3GVXA 4PE5B 3EC2A 4R5HA 3WWPA 2IVZA 4ALJA 3PNYA 1Y6ZA 2AN9A 2NWQA 3A1CA 3MINA 4HB3A 4BRSA 2KJQA 1KMIY 1PK8A 4M8LA 1CZKA 2UYGA 1NHGA 1P5ZB 4GWKA 3NNDA 4ILEA 2QYHA 1GYRA 4G2NA 1EUDA 2WFMA 2GBLC 5JD6A 2MSWA 1ZJ4A 1JZTA 2PL1A 3QLUC 1RWQA 3ENNA 1P9NA 4AU1A 2PMBA 2BM9A 2IUTA 3P0JA 2Y93A 1ZMXA 3ZLTA 2CKMA 4UHHA 1IVSA 2XOXA 3LNTA 1JEQA 5H3CA 3BRSA 1LBTA 4HFRA 5JSFA 4FX5A 4MOWA 4MVJH 3FETA 3SYKA 3R6WA 3RWOA 5ARBA 2ABWA 4ZAYA 4ZQBA 1J0DA 4F3RA 1YZFA 3IAFA 3CSUA 3V7FA 1QG6A 1YNOA 4PC3A 1OLSB 4ZOCA 3H18A 2IEIA 3PC2A 4RZXA 3ONNA 4E46A 1B0ZA 1SUCA 5K0GA 4L75A 4ZQIA 3OEHD 3D4LA 4KLNA 3B51X 2EDAA 3REQB 3UXMA 3H3JA 3C7AA 1HE8B 4UKDA 3WQHA 1H3EA 4U3JA 3E9DA 2HRBA 3AY3A 2RJNA 1N0HA 4C7XA 2JAWA 3DQQA 3IAM1 3CZQA 4UDNA 4XH9B 5ALHA 3TQOA 3UATA 1DAGA 2ZCJA 1KJ8A 7GPBA 4Y0VA 2GD0A 1V48A 3VYUB 1W29A 2Q7XA 3EIUA 6NULA 4AF7A 2PUBA 4GE0A 2HH9A 1AV7A 5G0TA 3ZZ1A 4ER3A 4JI4B 2A5YB 3P2JA 4X20B 4YUYA 1QCYA 1JQLB 1KZHA 3WGTA 3AL0C 4MA5A 1GVHA 1XT6A 2HFKA 1Q0LA 5ITZB 3HN6A 2NUPA 4UMVA 3Q7TA 2XDQA 5DT2A 1XZGA 3VI4B 5AM2A 3DEYX 3UANA 2A0YA 3QA3E 4YGXB 1BMTA 4ZHSA 1H4SA 3DT6A 2WKSA 4YPFA 1NW5A 3DD1A 3QVGA 4YCBA 4DTCA 2JFNA 5ILGA 1ZO8A 5C53B 2FG6C 1ISPA 2JL1A 1BX1A 2QTAA 3MUOA 4KVAA 4N5LA 3AVWA 1TA0A 4F38A 2Q2WA 2WLSA 3AR3A 1KKLA 4FFSA 2PKQP 4FWIB 1J0XO 4G0OA 2VJDA 2WFLB 1NVTA 2P6UA 4TXJA 1QH0A 4AB1A 4CT4B 4U2BA 5JNUA 3EE6A 3SZOA 4RTMA 4DAEA 2CNWA 1G3UA 2AN5A 4MCIA 4JYPA 3UYLA 1KEEB 2XITA 3I76A 4WIAA 1U2GC 3NC1C 2OV8A 4LXQA 1SOUA 1SUAA 3QELB 4W5RA 2Q7OE 1L4NA 1XC7A 4YMIA 3TSWA 4HDMB 2I1WA 3GFRA 5ALUA 1AMUA 4P7BA 1MIOB 1D04A 1XEFA 4RJIA 5DHQA 2H31A 3T9CA 4BVGA 4C0LA 3V4OA 4AF8A 5L40A 5TIIA 4C3VA 5M29A 5JRDS 3OTOB 3C0KA 3MB8A 4HWTA 4OH7A 3T3OA 4C0QC 1JHXA 4QPCA 3NVDA 1YKSA 3ZXYA 3RVSA 1OZHA 2JFGA 521PA 3DJYA 3EF3A 3VXKA 1KEKA 4N3AA 2NU6B 4NBUA 3UWDA 5D7NA 1CUSA 1C50A 1I01A 2ECOA 2XQKA 4ZVPA 1IJEA 1Y5MA 2A7XA 2ZE5A 4IH1A 4KVGA 3BQMB 2C99A 4RD1A 4WEOA 1O58A 2CXNA 3CNLA 3G88A 1LLUA 1QIHA 2WMNB 1NQAO 4X7BA 3SZRA 2ZU0C 1B76A 1NJ2A 1SUWA 3FXAA 2FXIA 2HNAA 2LDXA 3WQSB 4CBVA 3GJ0A 1DJMA 3TAHA 2O1EA 2ZBPA 4KAJA 1Y8CA 5IJ9A 5BWLA 3C3MA 3VOAA 1PE0A 2Y99A 2IYOA 2ZS8A 1E1QA 3ZVLA 3ZW8A 1EWVA 2OFPA 3HU2A 4DDVA 4ZDJA 5B58C 1VPEA 3ABOB 4S1PA 4RZ3A 3IERA 4OI2A 1RWXA 1OA0A 2BFBA 4GL4A 1JA0A 1U6IA 4GMGA 4XE5A 4BFWA 4DSZA 1KQ3A 4R0MA 4Q4DA 3IKTA 4ZVKA 5B7QA 3F78A 1VM6A 3HDQA 2AYXA 4B85A 4LV6A