3DWFA

Crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
271
Chain Sequence
EKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNVLSNERW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of key hydrophobic surface residues of 11 beta-hydroxysteroid dehydrogenase type 1 increase solubility and monodispersity in a bacterial expression system
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
total genus 101
structure length 271
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dwfA00
1VSUA 4BO9A 4O5OA 1VL6A 3PYMA 3L9WA 4YDRA 1QG6A 1S7CA 3BIOA 1LLUA 1B15A 2EKLA 2FPPA 3OEWA 1NHGA 1LC0A 3ABIA 4IQGA 1U4SA 5COAA 1HT0A 3DAPA 3HDHA 3QLJA 3SBOA 2ZKLA 4FB5A 4M8SA 5GY7A 2EKQA 3H6KA 3E6AA 8LDHA 3G1UA 4EZBA 3ZWAA 1Y8QA 1Q7BA 4R5MA 1CIVA 1GEGA 2RHCA 2Y1DA 3TRIA 3RI3A 3T7CA 4ALMA 3F4LA 4UVHA 2XPCA 3ZU5A 4RVDA 4F6LA 4DPKA 1JKFA 1WDKA 4LK3A 4JIGA 5DBFA 4DMMA 4CV0A 3GT0A 3AUUA 2BFOA 3RD5A 1U3TA 2D3TA 3DHYA 4YT2A 5DBGA 3UH1A 3JYQA 1O9BA 4YJDA 1ZW1A 2VHZA 4I5DA 4Q3BA 1VJTA 5L40A 4UAGA 3JCZA 1LLQA 4TQGA 1R12A 1E77A 1VC2A 2BRUA 4BO7A 1QKIA 4NJMA 3TOZA 1GCOA 2O3JA 1ZVMA 3L6OO 1MGOA 4WGGA 3ZV6A 5THQA 4FFLA 4WOJA 3ZWPA 2BKAA 3AFNA 4R69A 2PD4A 3VPGA 4AJJA 1ZH8A 2ZTLA 3TQHA 2HJSA 1ISJA 3H8VA 4ND5A 4IDBA 4IDEA 3U4HA 3PDUA 3F5QA 3S1LA 1EMDA 5JXWA 4TWRA 4BB6A 1FDUA 3WLFA 1LLDA 2D59A 1IPFA 5ICMA 1MXHA 2C54A 3ZCXA 2W98A 2QX7A 3JQBC 4IXTA 1EQUA 3W4JA 3C85A 2UAGA 1KETA 4TVOA 1ZSVA 3I4CA 3MWEB 4B3IA 3JQ6A 3D7LA 1T26A 3GQVA 3W8FA 1WNTA 1YB4A 3JSAA 4BMNA 1MB4A 1JWBB 1GV1A 3TNLA 4KTTE 3EGOA 4BL5A 5AVOA 3X2FA 1XGKA 4W9NC 2NTVA 3V1TC 2Q1WA 1NNUA 2GDZA 3I9LA 5JYDA 3MTGA 1SNYA 3OFSA 3L4BC 1DIHA 1PGNA 3VH2A 1NFRA 3QJ5A 1D8AA 1K2WA 3MJ4A 1RM4A 1B2LA 2E82A 3UHAA 4BNMA 3MJVA 1ZK4A 5U1PA 2AE1A 4QO8A 3MJEA 3WWZA 3GEDA 3ROMA 1O89A 2IZ1A 3LZ6A 4IMRA 4R5HA 2HLPA 1LDGA 3JQFA 3Q6IA 5I7FA 1ZK3A 3E48A 2Y05A 1J4AA 3GVIA 4HKTA 1XELA 2PKQO 3RFXA 5DCUA 4BNTA 3EDMA 1ENZA 3GY0A 3ZHYA 2EXXA 1U3VA 4B7CA 4GKBA 1T25A 3JQ7A 2G5CA 2A9FA 1EVJA 2AQ8A 2IRWA 2JD1A 3DB2A 3PHLA 4RVSA 1OAAA 1E6UA 2W2KB 1NHWA 1OZAA 1H6CA 1XKQA 4J4TA 4BIIA 4OXYA 4RF5A 2FR1A 1JTVA 4RPGA 3GF4A 3ULKA 1ADCA 4R68A 4RDHA 3ZWBA 3DBLB 4AJ2A 4YAEA 4II2A 2OHXA 5T8KA 4CL3A 4PLHA 5COBA 4Q3CA 4CLRA 3UXYA 3GHHA 3NX4A 4GVXA 3KYCB 1KEPA 4JN6B 4FC6A 4BNNA 4NQZA 1H6DA 3CZRA 4DTIA 3AJRA 3AWDA 3FWZA 1E7QA 2VWQA 3LLVA 4R1UA 4BKRA 4OKIA 3KRTA 4PGFA 3DFZA 3LF1A 2O50A 3S2EA 3ICPA 4DLAA 1Y81A 1VL0A 1ZSNA 2LDBA 3C24A 4IJWA 2GUGA 3GAZA 4CM5A 1A4UA 3RUFA 3S8MA 2HMUA 2GGSA 2P2SA 4RO0A 3GZNB 2HMSA 5G0VA 5B4UA 3CMCO 1LX6A 4P4NA 4E2XA 2WD8A 3VH1A 4Y8VA 1PL6A 3FRJA 4CM4B 4CM9A 1GDHA 3ST7A 3UICA 3GNQA 4CV2A 5KTKA 3EMKA 1DPGA 3D1LA 4FDAA 1PEDA 5U9CA 5F1PA 4GX5A 3JQ8A 3LVFO 4KUGA 1KY5A 1QYCA 4BS9A 3DZFA 3HE3A 1ADFA 2ZIZA 4R4JA 4O6VA 4KDFA 3W8DA 4CUJA 4BVAA 1YOVB 1F8GA 2QG4A 3JQAA 1LI4A 1RM0A 2AE2A 2B36A 2B69A 4A26A 3WNVA 4MVJD 2HUNA 3TZKA 3GK3A 5DULA 3JQGB 1QYWA 5DNAA 1ISMA 1U2GA 4GLLA 3K30A 1EEHA 4IZIA 5HS6A 1DRWA 3IJPA 2VUUA 2YZ7A 4CM8B 4LGVA 3WIDA 4Y98A 2FSVA 3I4FA 4C7JA 1Z45A 5C3MA 4HNHA 5AXCA 2YW9A 1PR9A 4BO4A 1DFGA 2W2LD 1R4NA 5DT9A 4B3HA 2VWHA 1W6UA 3P2YA 2V6BA 2P9CA 4J9VA 5H83A 3KEQA 2DBQA 4RJTA 2X58A 3U62A 4Y6RA 2X5OA 4O0LA 2ZATA 2DM6A 3AUAA 3HDYA 1EDOA 2JD0A 2HU2A 3OJFA 4OGWA 5TLSA 3RJ9A 4DRYA 2Q2VA 4PRKA 4TROA 4YAKA 2PH3A 3SJUA 3WGGA 1V3TA 2HSDA 4AJIA 2ILTA 4EDFA 1EDZA 3GVPA 1OOEA 3KLPX 4L4RA 4NFYA 3TL2A 1LTHR 4NR0A 1OFGA 2EF1A 4XGKA 2XAAA 3DOOA 4MVJH 1C1DA 5KVCA 4PVCA 1B3RA 3DO5A 5TNXA 1H2BA 1DRVA 4B4OA 4J1TA 5T8KC 4NPCA 3HFSA 1QORA 3ONDA 3WGOA 4BV9A 4BNLA 3D4PA 4OM8A 1DSSG 1HLPA 2WTBA 4LMPA 3FNFA 5KOIA 1TLTA 4YPOA 3TZQA 1ADBA 1KEVA 5COQA 1VKNA 4JJFA 5GZ3A 3M2TA 5L3ZA 1I5RA 4D45A 1NBOA 2I65A 2Q45A 3H9QA 4DIBA 1B14A 2G82A 3KV3O 4A10A 1SZJG 3O38A 3TSCA 1UZLA 2O3UA 1K5HA 2QHXA 4UVEA 4L73A 4W4TA 4F6CA 2EGHA 3W1VA 3RBZA 1A27A 4Q3DA 1QRRA 3GEGA 4AJHA 4FR5A 4DGSA 1V3UA 3MJCA 4CLXA 2LDXA 2XOXA 1R4MB 1Q7CA 4GSLA 3RC2A 3ONEA 4WPGA 4GL4A 3TOXA 4DLBA 3VPSA 4NHEA 3TF5A 3OIDA 2J5KA 5IAAA 2Q4BA 1SEVA 3AFMA 4Z0TA 5JCJD 5DF1A 2BH9A 3QP9A 3T7EA 3GFBA 2HAEA 2I9PA 3RUIA 3OA2A 2VUSA 1YRLA 5CEJA 3KYDA 1U1IA 1YJQA 2X0NA 2BI8A 4L4SA 1B26A 2VZ8A 1ZSYA 1K3TA 4NI5A 2BGMA 4ONEA 2BFAA 3H65A 3DZKA 2ZYGA 3ZNNA 3LC1O 4B8ZA 4GVLA 3GZ4A 4PG8A 2G17A 4TKLA 4WCFB 1PZHA 3G1TA 3CUKA 3ZV5A 4URFA 2P5YA 2YV2A 3T4XA 4G5HA 4CLOB 3TFOA 4CMCA 4I5EA 3HADA 3GPDG 1F8FA 1BWSA 3U09A 5LDGA 5ILGA 3NJ8A 1H93A 4JCOA 1X1TA 2H1SA 2IXAA 2DFDA 2F00A 2TMDA 3H9EO 3WGHA 3WGYA 1MG0A 1ID1A 4DBVO 3LDHA 3DWFA 3OHSX 4GGOA 3RVDA 5JNLA 1CJCA 1DDOA 2AG8A 3HZZA 4FFMA 1AGNA 5TS3A 1EVIA 2GNAA 3WG9A 4N5LA 4WECA 4BGVA 3TN7A 3WJ7A 4BO1A 2PZMA 2VTDA 4HNGA 4J3FA 3CSDA 1ZUD1 2GF2A 4UUMA 4HFMA 4PLWA 4CLOA 2QYSA 3GGPA 1IY8A 2HDHA 1H6AA 1U4OA 2Y67A 3ZHXA 3KYCA 1BW9A 3M1LA 5K9ZA 2BHLA 3VZQA 1GPJA 4NMHA 2IZZA 1LDNA 3DZIA 2RHRA 3AOEC 2D0IA 4E2WA 1WAMA 1J0XO 4OSPA 2YQ5A 1AXGA 4RCVA 3UGKA 3FWNA 1NAHA 1FK8A 4PRLA 2OZPA 5IXYA 4GMGA 3QVWA 3FNEA 5C7OO 3RCBA 4PZEA 4Y67A 2WDZA 4RLHA 1J49A 4I08A 3BMQA 2JFGA 4NFHA 3L9XA 1LRLA 1WMAA 1X0XA 2DTXA 4TRJA 1F17A 1E1LA 3ZH2A 3WSVA 3DMTA 5IXSA 3DBRB 4CLEA 1GYPA 1E1KA 1ONOA 1DHTA 5I9MA 3MJSA 1Y7TA 4NJOA 5IJZA 2FP4A 2Q2QA 1NR7A 1X0VA 4J4HA 4WCFA 2YQ4A 4KUHA 1I2CA 3PFWO 4ZJUA 3I9NA 4CMAA 1NQTA 1YQXA 3PXXA 4XIJA 2NU7A 2VOEA 2ZQYA 2ZK7A 3Q11A 1ZO8A 3WOHA 2AEJA 5KCZA 5KVVA 2PGJA 2CNBA 3IMFA 2Z1MA 1J5PA 1E0DA 3ANNA 3BTUA 4R41A 5K6AC 3CIFA 4EBFA 2WE7A 1GU7A 4CM3A 5KJ6A 4BOYA 1NWCA 1UXHA 1CF2O 3WYCA 2YFHA 4B4WA 5FYDA 2V7PA 3FNGA 3ITDA 1SO8A 1YGYA 4KQXA 3ZWMA 5A4DA 2TMGA 1YH3A 1UDAA 2Y0DA 5TC4A 3VZSA 4DIOA 1QYDA 4NK5A 3IAHA 2NU8A 4GH5A 3KUXA 5AXBA 4J7CA 5JSFA 5EJ2A 4JXKA 4DPLA 4DMLA 3A14A 3S55A 4BHTA 4NNJA 3VHRA 1JKIA 4WCFC 1PQWA 2SCUA 3FTPA 3GFGA 4I1IA 3UCFA 4ESOA 4GX1A 1E92A 4OHUA 1DRUA 1V35A 3WIEA 5JMWA 4LSWA 4BNXA 1DB3A 1E3JA 2HCTA 1PJCA 2BFPA 1P1RA 2FOIA 4U0JA 1M6WA 4UEJA 4E12A 1LQUA 1YB5A 2HK8A 5TF4A 3VOSA 3U9LA 2DKNA 1RM3A 5KVQA 3U4DA 1XHLA 4Z3DA 1RYEA 4CLHA 4M55A 1H9AA 2EW8A 1A72A 3JQFC 2CSUA 2WM3A 5F3RA 1NQOA 3G17A 4TZTA 4W99A 1B7GO 2EJVA 1Q2XA 4O59O 2JCXA 3ROQA 4G81A 1FDSA 2VNAA 4OMUA 5ER6A 1NVGA 3I1JA 4B8WA 1C0IA 3DBHB 3OJEA 3OJLA 4QECA 3UVEA 2ZQZA 1NX6A 1CYDA 1U8XX 1HEUA 3JD0A 1M75A 1UZMA 1Z7EA 3U0BA 1YOVA 1YE3A 1HLDA 2PLAA 2C5EA 3PQEA 4OYRA 2B4QA 3PZBA 4BV8A 2HMTA 1GYQA 1O5IA 4YQZA 1I30A 3K92A 4JNKA 3QHAA 4GWGA 4PLGA 3QVTA 2JCVA 1HKUA 5GZ6A 1KC1A 5CDTA 4NBRA 3I6IA 3D0OA 2HK9A 1KVRA 5TJ9A 3WYEA 2J3IA 3C7DB 3GUCA 4E3ZA 3GOHA 5JMPA 5BNFA 5DCYA 1LU9A 2OP1A 2VWGA 5EQDA 4AJ4A 3DONA 1PJTA 4I9UA 4LW8A 3GZNA 2V6GA 3IIEA 1N2SA 3INTA 5JE8A 3B6ZA 1T2CA 2YHUA 4INAA 3GN2A 4E30A 4B3JA 5A03A 1Z74A 4OIMA 2YY7A 2I99A 1LDBA 7MDHA 1HF3A 2O3QA 2NACA 1L7DA 4H7PA 3K2EA 2EW2A 3UN1A 4RZIA 3BA1A 4ND1A 3SVTA 4XX0A 1P3DA 1BG6A 3OF2A 1HWYA 4XIYA 3E03A 2AA3A 1YKFA 3DXFA 2DT5A 5KKCA 4D3SA 3NTRA 1GQ2A 4OO3A 2FR8A 4UUPA 5LDHA 4U5QA 1E5QA 1ADGA 4FFRA 1EVYA 1TA4A 1I01A 3ZWYA 1XU7A 1I3MA 1HL3A 1PWXA 1X7GA 3VPHA 2Q3EA 1DFIA 1R0SA 1U3UA 2CVZA 3K31A 1N7HA 1NVMB 1NTOA 2O4UX 3GVHA 1GTMA 3LT1A 3LT4A 4DQUA 4IXWA 1NM5A 3QWBA 1E6WA 3AM3A 1RJWA 3F6YA 1JN0A 2WMDA 3HSKA 1AN9A 4R51A 3V2HA 5JAIA 1XDWA 1NPTO 1YB1A 4DBZA 1WWKA 1G1AA 2NNLD 1H6BA 3LC2O 3OBBA 1VI2A 4MVJM 4BO2A 4AVYA 3JQAD 4PLCA 1XSEA 3B1KA 2C59A 2NVBA 1PU2A 3QQPA 3HG7A 3BMCA 1LNQA 2WD7B 4DPMA 4PFJA 1NQAO 2HMVA 1EBFA 1B0AA 2OGUA 3RBXA 3C7CB 3HHPA 4LRTB 2AXQA 2V6MA 3R1IA 2AEMA 1TT5A 4E33A 1UXKA 3DOCA 4J4BA 4K28A 5HS4A 2NSDA 2O3RA 5I8ZA 5BNTA 1VJ0A 3E9MA 4QSMA 5B4VA 1E3WB 1YBMA 2VHWA 2Y0EA 1YBAA 3FBTA 3PIIA 5ITVA 4ZD6A 5B12A 2GR9A 3QWHA 2GERA 1W4ZA 3GAFA 3QRWA 4BGUA 1NFQA 1NR1A 4YRBA 1UAYA 2D4AA 2FR0A 4FPXA 5DDIP 1ZXLA 1DC5A 5JDIA 4WEQA 3K2BA 3C8MA 3WX0A 2DAPA 3TL3A 4WLNA 3KTDA 4Y9DA 3I9KA 4LSMA 2C29D 5L53A 3BMNB 3EYWA 1KVTA 2QRLA 1SOVA 1LJ8A 2CMDA 4OH1A 4BKPA 4MO2A 5JO9A 2VQ3A 2X5KO 2O3TA 2RH8A 5A9SB 2UYYA 4D3DA 1NVTA 1ZMOA 2Q4EA 3LK7A 1EK5A 3MCVA 1HYHA 4JK3A 4JX8A 1I36A 1LUAA 4ZQBA 2O7SA 3UFXA 1B3BA 4D3FA 4YR9A 5JBIA 3AM4A 1I10A 3NJ4A 3PWSA 3ZV4A 3ZZNA 5JPIA 3WB9A 2NTNA 3LF2A 4WOKA 4BKQA 2YFQA 2Z5LA 3CKYA 3ANMA 1DIAA 3GGGA 4GI2A 4J0EA 2R00A 4PLFA 4AJ1A 1FF9A 2RBEA 4GQAA 5ENDA 2EP7A 3OECA 3WLEA 3L4SO 1ZBQA 1UP6A 1P45A 3Q1LA 4RV9A 3ZNOA 3BMOB 3NGXA 2W8ZA 4NBUA 5KJFA 3ZU3A 1HZZA 3PYXA 1PSDA 1KVSA 1N5DA 2NVWA 3CXRA 4YT8A 1PJBA 1EE9A 1ZK0A 4BNGA 4GMFA 3AI3A 1D1TA 3PIDA 2AG5A 4YB8A 4M86A 4WLFA 5KJCA 3I83A 1SMKA 3WWYA 4YXFA 5L4SA 4IQ8A 1E7SA 4CMKA 5HWSA 1P1HA 3DHEA 1YBVA 4RLSA 5K0ZA 1LQTA 3HN7A 2Q49A 3PJGA 1T1RA 2HO5A 2JJYA 3GPIA 3KEOA 3WTBA 4DQVA 2UV8A 2VWPA 5BSFA 4P38A 4J1NA 1YL6A 3UOGA 2PGDA 5B37A 3IUPA 4K9DA 5JLAA 3JQBA 5C7IO 4J49A 3LU1A 4L76A 3HQ4O 5F1OA 1LSUA 2JCYA 1T2DA 2EG9A 4MP8A 2B5WA 2DPHA 3AOGA 1UJMA 2VRBA 4KTVE 1QSGA 4WLUA 4WUVA 1MFPA 4CMHA 3WJAA 4NK4A 2GPTA 1NP3A 1EFLA 1E1MA 4FJ1A 4ZRNA 3JQ9C 1LDEA 2WYWA 3BTOA 7ADHA 1RWBA 5DN9A 5T5QA 3IUSA 3NT4A 3KYBA 3UCXA 4E21A 2GN8A 3TWOA 4GWKA 1WLYA 2D5CA 4D0SA 1XLTA 3VPXA 1SC6A 1BHSA 3G3EA 3AOEA 2JHGA 5T6BA 4BUCA 2B37A 2Y1GA 4Q3AA 1NYTA 5EIOA 2V6FA 3K5PA 2POQX 4F46A 1K89A 4YJHB 4MP3A 2J8ZA 4N5MA 4DQXA 2X9GA 4CM8A 3RWBA 2YYYA 5CG2A 5JY1A 3MOIA 2CY0A 1SB8A 4BMSA 1LRJA 3KVOA 4LISA 1PJ3A 4WE3A 4AJLA 1A9ZA 5I7SA 3H7AA 1VE9A 4MIYA 3RU7A 5HTOA 2VOJA 1R66A 2QZZA 3T4EA 4FIZA 3W6UA 3ADPA 4PG7A 1UDCA 2Q1SA 3DFUA 1LSOA 1O8CA 3PGXA 4CQLB 4NDNE 4ALJA 3S2FA 3ZWXA 4E2YA 2O2SA 1B16A 3M2PA 4YAJA 4ZQHA 2B4RO 4YAGA 4EEXA 3ETDA 1P1FA 1ZMTA 3JYOA 4Z3KA 1JLLA 3ENNA 5TRTA 3H2ZA 4R1TA 1GQYA 1PGPA 1HXHA 4LRSB 3B20A 1WZEA 2AQKA 1X7DA 5BSHA 4NBWA 3JQCA 3BMNA 1D7OA 1TI7A 3QIVA 3ZWCA 5A9RA 1R6DA 2DBZA 1C3VA 3KB6A 3O9ZA 1G0OA 1ONPA 4I8XA 4W82A 2NQ8A 3HDJA 4PLVA 3WS7A 4EITA 2ZJ0A 2J5RA 4RZHA 2BGKA 2BI7A 5KJEA 3K8ZA 1PL8A 2AQIA 4J90A 1I2ZA 3PPIA 1BGVA 1YL7A 5BQFA 1HDXA 1ISGA 2OORA 4ZN6A 4QO7A 4A5OA 1PS0A 4RF4A 4A0SA 5JO0A 4PN3A 3OA0A 1AXEA 1GEEA 3G79A 3WFJA 1N9GA 2DU8A 3DTTA 4PCVA 3TPCA 4CLDA 3VKUA 5DZSA 2J3KA 5G0SA 4E2ZA 3EVNA 3VPFA 1VRWA 1ZCJA 4MP6A 3NRCA 1ZKMA 2VRCA 3KSZO 3ZW9A 1DC4A 4AJNA 4XCVA 3MTJA 4CQMB 5KNLA 4OOFA 1SBYA 2NV6A 2GZ1A 3P5SA 4GX0A 1DJQA 3HFGA 2EIHA 1I8TA 3EY4A 3NDJA 5IG2A 5IZCA 5HRUA 3C3XA 4DL9A 3GGOA 3KYDB 4QUKA 2ZCUA 3FF4A 4YJGB 3GN1A 3GVCA 1ZEMA 3KBOA 3DTYA 1T2EA 2JD2A 1ONNA 5TT0A 4HADA 1PJLA 2W2KA 4HX5A 4XKJA 1YDEA 4E32A 3VVCA 1FDWA 3WBFA 2ZB4A 3L77A 2VNSA 4D44A 2DTDA 2WSBA 1CWUA 1PWZA 3GDGA 2VT2A 4RORA 1R4MA 1P44A 4KP7A 2JAHA 3GNTA 3FN4A 1UR5A 1PS9A 3UAGA 1E6EA 1MC5A 1H0KA 3NKLA 1A9YA 2QRJA 1SB9A 3FNHA 3E9QA 4ND3A 1K6IA 4HWKA 4BNUA 4HFRA 3I52A 1LA2A 4IINA 4JP3A 1YS4A 1F06A 4J6FA 2ZTUA 3NT2A 5H81A 5U4QA 2R6JA 2EERA 1ENPA 3W8EA 2IYPA 4A73A 1IHYA 2C0CA 3LT0A 4CR8A 2X86A 4CR7A 1JVSA 3TZHA 1GZ4A 8ADHA 3NTQA 3S2GA 1SEPA 3NT5A 1A7KA 2CD9A 4XB2A 3OIGA 4ZHSA 1L7EA 5A1TA 1M66A 1G6KA 4MVJP 1Y5MA 1E7WA 3PHIA 3D3WA 1XWFA 4FS3A 2A4KA 4RQTA 4YJFB 3EZYA 1P9LA 3DMTC 4IGEA 1I3NA 4YACA 1QXSA 2EP5A 3ZW8A 5I7VA 3JTMA 3UW3A 4NU6A 2ZB7A 3DHNA 1DIRA 5ADHA 2GO1A 1Q7GA 5ES3A 3ETGA 4HUJA 1VL8A 2IZ0A 2E37A 3LSYA 2E4AA 2GRAA 1KVUA 2QYTA 1HTBA 4K1LA 4CMBA 3QW2A 4BMVA 3JD2A 1N1GA 1V6AA 4GKVA 1QP8A 4BNWA 3Q2IA 2IEDA 4II3A 5DP1A 1ZZEA 4QT0A 3C7AA 2PWZA 3BTSA 5F21A 4J7UA 1QR6A 1I3KA 1GFSA 2BD0A 1GZ3A 3RFTA 3ONFA 4FOOA 2WWRA 3Q2KA 2CF6A 5JFOA 1Y9AA 1S6YA 3NV9A 3WGQA 4BQPA 1HE4A 2NTJA 1BXZA 2X9VA 1BXKA 5H82A 4C7KA 4UEOA 4J43A 4DC0A 4TVBA 4MKRA 1LLCA 4RVFA 3O26A 4PZCA 3F47A 1SAYA 3GVXA 3RAJA 2C7GA 4D42A 1HYEA 2YHIB 2X22A 4E5MA 4BNFA 3U4CA 4BO6A 4XD2A 4R9RA 3BZUA 1LDYA 1WMBA 4FFNA 2C82A 5TQVA 3RIHA 3ZN2A 2C7VA 4U7WA 5CDUA 1SCUA 3GC6A 2FY8A 3IL2A 4XR4A 3QSGA 1ZIDA 4BO0A 2J5QA 2JAPA 4TRMA 2PV7A 5ICSA 5DP2A 3E18A 3VVBA 4YYZA 5L51A 5A9TA 3RBVA 1E7YA 2CZCA 4JBIA 4E13A 3PHJA 3CZMA 4XJTA 3N7UA 4L74A 2HKIA 3JQGA 3R6DA 3AI2A 3V5NA 3KSDO 5FF9A 3PP8A 2E48A 1KVQA 3GMDA 2GSDA 3U4IA 4CM1A 4EEZA 1LEHA 1EVZA 1KY4A 1R0KA 3CH6A 5JAQA 2I66A 1XA0A 4IY1A 1X14A 3E5RA 1GR0A 4YT5A 1BW9B 1BXGA 1T2AA 1TEHA 2B35A 2GN6A 4MDHA 3GR6A 1Y5RA 3P2OA 1YL5A 2I5PO 3O4RA 1D3AA 1BVRA 1P74A 2ZB8A 3K6JA 4XYGA 3DEYX 3DOJA 2OOSA 1JQBA 4EJMA 4ILKA 4NIMA 1RPNA 4U6SA 1P1IA 3QWFA 2FZWA 1W0CA 2X9NA 3GMSA 3KXDA 1LBEA 4BB5A 1Y8RB 3ZWVA 5JCXA 1EUZA 1HE3A 4PLZA 4PVDA 3HB4X 5CPBA 4YBZA 3PFFA 3R3JA 1QV7A 1O0SA 1ENYA 4JJGA 1T1SA 3PEFA 1I3LA 4LN1A 3WQSB 3F4BA 3O8QB 1JA9A 2Y68A 3K73O 3OQBA 4RPKA 1U5CA 3GNSA 4M49A 1YDWA 1HE5A 3EHEA 1RM5A 1WXDA 1O95A 2DBRA 3QV1A 4ND2A 1I33A 5MDHA 1PJQA 3PWKA 1JWAB 2FMUA 1JKJA 1VM6A 4J1SA 3HNPA 5KKAA 3ZDFA 4EJ0A 5JAMA 3NDRA 3H4VA 3INRA 3L6EA 2GYYA 1QLHA 3NAQA 1GAEO 1ZEJA 2YDXA 5TT1A 1HDRA 1IUKA 5EPOA 3GG9A 1DFHA 2BGLA 1MXFA 4EGFA 3GHYA 2PY6A 3EZLA 2GZ3A 3H3JA 4RL6A 3ON5A 1C0LA 1Z75A 2NWQA 3U49A 1BMDA 3V2UA 5K6AA 2DFVA 2PH5A 1E1NA 2OXIA 2Z95A 3WR5A 2P4HX 3FHLA 1F12A 3CPSA 3WGZA 4BQRA 5AOVA 4WLEA 4KQWA 4NBVA 4OQZA 1VSVA 4E31A 3B1JA 2CDBA 1IPEA 3AI1A 3R0IA 5HA5A 3ZGYA 1KYQA 3DQPA 2P91A 2GD1O 4U8GA 2EJWA 2BLLA 2QW8A 1BTOA 5T57A 2NADA 3KSUA 2CVQA 1MX3A 3H2SA 3IJRA 1PGOA 5T67A 4BGEA 1UDBA 4J2HA 4EW6A 5EINA 3EAGA 1T24A 5L9AA 4CMJA 2D2IA 1YWGO 4NBTA 2DVMA 4N18A 1UH5A 4B7UA 1LDMA 2X8LA 3AK4A 2CUKA 2QQ5A 1Q0LA 2X0RA 1QV6A 4WNCA 4PG4A 4NFSA 4MVJG 1PIWA 1LXCA 5A04A 3PJFA 3V2GA 9LDBA 1N1EA 4XYMA 4Y6PA 3FI9A 4YWJA 2E6UX 2D1YA 1GUYA 1OBFO 3IP1A 3E1KA 1EBUA 4MPDA 1WDMA 4XR9A 5CG1A 1U2DA 5ER9A 1TVEA 1GADO 3I9OA 4E5KA 1Q0HA 4OOEA 1DXYA 1X1EA 1P0FA 4MVJA 1X13A 1EK6A 2O7QA 3KO8A 4J9UE 1HDZA 3GRKA 4OAQA 5MGBA 3PRJA 3OMLA 3E8XA 1K6JA 4S3MA 4AJPA 1R0LA 1EZ4A 1N8KA 1DC6A 5IDWA 1W73A 4WLOA 4IBOA 4NZ9A 4RPJA 5BR7A 5CEEA 4IM7A 2C5AA 1EFKA 3JV7A 4XGNA 4R3WA 4Q39A 4D79A 1B8VA 1PJSA 2OFPA 1JW9B 1IOLA 1DAPA 1TT7A 4OXNA 3RKUA 3IKTA 1R16A 1C0KA 4ZU3A 4ITUA 4WKGA 1YONA 2PNFA 2Y1OA 5HM8A 1PQPA 4EUEA 1K0UA 1UXGA 1GY8A 5CPFA 3KOUA 4YQYA 1CEQA 2EV9A 4TRNA 4PG6A 5TIIA 5JDCC 5EMHA 3VDRA 4BNZA 1E7RA 1DC3A 3FTNA 4BNYA 3VKVA 3G49A 2ZTMA 4L4XA 4MIEA 5BSEA 5JC8A 3DZGA 3H9JA 3K9QO 4F3YA 3AM5A 4J91A 5C37A 3C1TA 1FDVA 1QLJA 2ET6A 3GDFA 1YO6A 4MVJF 3JQ8B 2PGLA 1ISIA 2O48X 1FDTA 2PZJA 4DYVA 3H5RA 3MEQA 1W8DA 5EESA 1NXQA 2C2XA 1CETA 3DL2A 5A9SA 1C1DB 4IS3A 4RPLA 5KJ1A 1U7TA 4G65A 1PL7A 4K6CA 4BGIA 1EQ2A 1JVBA 4CMIA 1I32A 3H5NA 3H9UA 2E49A 2AEFA 3GUYA 4NU5A 3KHUA 3ASUA 1JAXA 1IL0A 4GGPA 4CUKA 3NUGA 1MP0A 4QX6A 4CODB 1VJ1A 3FPCA 3FD8A 3D64A 3GDOA 3H9GA 1PS8A 4YRAA 1ORRA 4QTZA 3FSRA 4AJEA 4Q9NA 3PJDA 4BNIA 1CQIA 3WMXA 4IDDA 4Z9YA 3UKOA 2QZ9A 2AMFA 4TRRA 3VC7A 2HRZA 3QE3A 4J7XA 3OETA 4Y6SA 1PJ4A 5L7TA 5FI3A 5I8WA 2I3AA 3S2IA 2HK7A 1RKXA 2PKQP 4CLRB 3PDJA 3QY9A 4DUPA 4DWVA 4XQCA 4D7AA 1YQGA 4QFDA 2J3JA 1H9BA 3ROPA 3PHHA 5A02A 4EUHA 4W6ZA 5JYEA 4CM6A 1GCUA 1UP4A 1HSOA 2WD7A 4MVJI 5BSGA 2OL4A 1LSSA 2A35A 4EI2A 2C2YA 3DDNA 3RUEA 6ADHA 2FPGA 5IDYA 1HE2A 1ZK2A 1MV8A 4U6QA 5G0UA 1P1KA 4CV3A 2GASA 4FGWA 5A3JA 1HZJA 3KLMX 1DOHA 2VHVA 3C1AA 4CUZA 3WGIA 2HMWA 2JKVA 4R1NA 4DLLA 2O2YA 3F46A 3ZI0A 3STHA 3NTOA 1J6UA 2XXJA 1GQQA 1XYGA 2B4TO 2P9EA 3ZV3A 4AFNA 3QA9A 4JQCA 5G0TA 1Z6ZA 4YJGA 4IDGA 1CDOA 2OP0A 5IDXA 3SX2A 2H9IA 1GYRA 2VHYA 1DO8A 3JQEA 4YVFA 2NU6A 3QVXA 4O63O 1XQ1A 4P8RA 2GCGA 1V3VA 1E7MA 5JDCA 1IB6A 4B4UA 1XEAA 1NWHA 2IEBA 3FR7A 4CMEC 1C1XB 4RPHA 2DUUA 2Z1NA 1YXMA 3D4OA 1ZXBA 5DOZA 3IKVA 5T64A 1V9LA 4BKOA 2DQ4A 3ZWNA 4DIFA 1E3EA 2VZ0A 1HDCA 3AW9A 1HDYA 2X4GA 4HY3A 4X54A 1U7HA 5IFLA 1BXGB 3BHIA 4I9NA 2Y66A 4R01A 3HUDA 3WMWA 4RVHA 3PWZA 4I5FA 4S1VA 2VUTA 4AICA 4B4VA 1TT5B 1JU9A 3TJRA 3WNQA 5IDQA 1F0YA 5JDIC 1BDMA 4ALNA 1GPDG 2Q2WA 3V1UA 1V8BA 4E6PA 3OSUA 1NASA 4CQMD 1ULUA 1E3IA 3BMCB 2QIOA 4PLYA 4WJZA 5FFFA 4BNJA 2Q50A 3SXPA 5BNIA 2PZLA 3PI7A 5CP8A 5TSDA 2GN9A 4RDIA 3LLSA 3VH4A 2X7HA 5TJHA 4DXHA 5IN5A 4ZVVA 3I9MA 3F1KA 5L95A 1HETA 3HDQA 3TFQA 1X15A 5A05A 5KIAA 1LSJA 5A06A 4MOWA 3VTFA 2P68A 4W7HA 2FHSA 3QVOA 1R37A 1IE3A 1CERA 1GZ6A 3JD3A 4Z9FA 5IN4A 1LRKA 3E5MA 3IC5A 5A5FA 4YA6A 4MIOA 4IDCA 2UUPA 3A4VA 3ENKA 2FPIA 3ICCA 3JD1A 3OIFA 3RROA 4PLTA 3DMYA 3L07A 2VYNA 2PZKA 1HSZA 2IE0A 5JY6A 4WASA 2NUAA 3V8BA 3GRPA 4GAEA 1C0PA 3PYLA 4ALIA 1WP4A 2Y99A 1M67A 4PIVA 4R16A 5G2OA 2VYVD 2ZJ1A 4JGBA 4F45A 3DZBA 4WLVA 3BHJA 2AHRA 3IOYA 1NPDA 2WYVA 2YV3A 3I3OA 1U5AA 4NG5A 3D4NA 4AJOA 1UXJA 1ENOA 3A06A 3PQFA 3TZCA 1N92A 3MJTA 4P22A 1HDOA 3W4KA 4E0BA 1F14A 1QYXA 3A28A 2GN4A 1BRMA 1C14A 2FN7A 1HRDA 3OH8A 4KOAA 3W4IA 2F1KA 4UREA 2Q1TA 4IZHA 3PLNA 1B8PA 2BF7A 3CINA 1WW8A 4HBGA 3NYWA 2DBVO 2Q1UA 1GUZA 2PR2A 4MJLA 1Y6JA 5L4LA 3ZNQA 2GZ2A 4XZ3A 4YJFA 2Y93A 4R1SA 2QRKA 4JJIA 2YV1A 4XQGA 1HYGA 3ZU2A 1ISHA 5G4KA 2Y1EA 1AUPA 5ITWA 3ORFA 3IDSA 4RQUA 4FW8A 2D8AA 1DIGA 2P4QA 4ZA2A 3JQ9A 5FI5A 2H6EA 3OJOA 3LT2A 2PD6A 5KVSA 3PK0A 3IS3A 4AG3A 5J23A 5L45A 4IJUA 4R3NA 3IP3A 3PQDA 4YCAA 2I6TA 2YHIA 2WYUA 4FSHA 3BTVA 4J16A 3JQAB 1R4NB 3DC2A 4CL8A 2J6IA 1PTJA 3F5SA 3UF0A 4WK6A 5F5LA 1PR3A 4IPTA 5G0WA 2WEKA 3OM9A 1ZK1A 1JDJA 3CMMA 1OC2A 1DAOA 3G0OA 3LQFA 1MLDA 3D3EA 3D5QA 2EEZA 1Z73A 2OBYA 2BMAA 2CF5A 1WPQA 4E5YA 1OMOA 4GPD1 1KBZA 1CRWG 3BHMA 4ZQEA 1OI7A 5LC1A 2OO5A 1PZEA 3DAFA 2C07A 4GSKA 4M89A 5AQ1A 3KZVA 4XEHA 4D0RA 1U3WA 2NLOA 3WXBA 4HFNA 4E5PA 3QWIA 1BSVA 2YJZA 3AUTA 2VCYA 1PJ2A 4OSOA 4XA8A 3D3WB 4IS2A 1ARZA 4EUFA 5CDYA 2DC1A 1H5QA 1GUFA 5BT9A 2IXBA 4LCJA 4FCCA 4UVIA 4XQEA 1HDGO 5EQFA 3H5AA 2EGGA 3GH3A 4PZDA 4TZKA 4ALLA 3WYBA 1MC4A 2R00C 4P4LA 3WICA 4DREA 3VAZA 1M76A 1NPYA 1I0ZA 5I7EA 3AY7A 1ZJZA 2ZTVA 2IDZA 2RH4A 4TKMA 1KOLA 4LMRA 4WEOA 3RC7A 4HV4A 5FEUA 3E82A 3I9JA 4CPDA 1ULSA 4DYDA 5AXDA 3AU9A 1FXSA 5L4NA 1P31A 2O3SA 4IUYA 5CAEA 1YVEI 3I5MA 3JQ7B 3PZRA 2DPGA 3LC7O 3WBBA 3NDIA 4IJKA 3ZHZA 4GBJA 3FBGA 4WCDA 5C5IA 2CDCA 2ZYDA 2VHXA 3R3SA 3BYZA 3DBRA 4OL9A 2A94A 1BDBA 1O94A 2PFGA 4KUEA 5DOVA 3HWRA 4YTEA 2HRBA 3FR8A 4G2NA 4OJNA 4E5NA 4QEDA 3P19A 1MFZA 3RU9A 1IZ0A 2WJPA 3DBLA 2J3HA 3AUSA 3ZWOA 3K96A 1O6ZA 3ITKA 1WDLA 2PKRA 4FBGA 5JC1A 4UUOA 4RF3A 4UVGA 1Y1PA 4RGBA 1GD1O 1E3SA 3OJ0A 5EERA 1NQ5A 2BELA 1TB4A 1XR3A 3WGTA 2UDPA 4Q3EA 3VZRA 1PZGA 4MKZA 5JAZA 1H94A 4FC7A 5GZ1A 5ENVA 3FCOA 5CHEA 2BFMA 3TDKA 4XDZA 5DBIA 3W6ZA 3ANLA 3ETEA 3F3SA 2B83A 1DBVO 2OBNA 3CE6A 2Q46A 2X5JO 4A27A 4J1QA 3GLQA 4N54A 3VZPA 1PX0A 4FJ0A 4D41A 2G1UA 3ZWWA 4IIVA 3WTCA 5CDSA 1CQJA 1MUUA 2X23A 3I23A 4YT4A 4NH4A 4XYLA 4LCEA 5AXAA 3SC6A 3MZ0A 1IULA 2C20A 3AY3A 3EVTA 4K26A 4O1MA 4ZQFA 2VN8A 2AQHA 2XF8A 1B8UA 1Y8RA 3SC4A 5THKA 4JP2A 5HBRA 2OUIA 1QMGA 2UVDA 1M6HA 2RAFA 1EUDA 3HN2A 3OP4A 4CMIB 4D46A 2D5AA 2EHDA 3JD4A 1TXGA 4BNHA 4C4OA 5KWEA 3WSWA 2I3GA 3RC9A 1KERA 1P1JA 4FGSA 4I9HA 5I9NA 1SOWA 3ZHBA 4W9NA 1E5LA 2VT3A 2NQTA 4H3VA 2RCYA 4Z9XA 5LCXA 4XB1A 4Z0PA 3NEPX 4M87A 2OMEA 1G0NA 4CMGA 4BNKA 4U0KA 2YDYA 4LVCA 1OC4A 4M1QA 1A71A 3MOGA 1Y9EA 4ND4A 4QQRA 3U3XA 4XJSA 3JYLA 1U8FO 2IYOA 1DLJA 3DBHA 3DZJA 4PG5A 3RFVA 1GV0A 4NJMB 5IZ4A 4GLOA 1XIVA 4HP8A 1P0CA 4EYEA 1UP7A 1PZFA 4LVUA 3L4BA 3SEFA 5I9LA 3DZHA 4FN4A 2EKPA 4B7XA 4BO5A 4IDFA 3MWDB 4CR6A 1FMCA 1A4IA 1UZNA 3FPLA 2EWMA 2GLXA 4FOSA 1H2HA 4KMSA 2HQ1A 4KWHA 4J0FA 4FFOA 3KM0A 3WQQA 2JFHA 3WFIA 4RVUA 1KS9A 3A9WA 3DR3A 3RUCA 3ZNPA 3N58A 3GA0A 2W90A 4DA9A 4MINA 3I6QA 1Y8QB 1VPDA 5F5NA 1IHXA 2I67A 5JS6A 2VZ9A 4CM9D 2V65A 4OQYA 4UUNA 3C1OA 1JAYA 1UUFA 1Q1NA 1VKOA 4UULA 4BO8A 4DVJA 1DLIA 3OEYA 5G4KB 3ROKA 3N74A 2X6TA 3HJAA 3L0DA 2H63A 4XDYA 1KC3A 4TSKA 2H5LA 1ISFA 3WQRA 3V1YA 5EN4A 5CFZA 2XXBA 4Z0HO 2X0IA 4JROA 4CM4A 2DLDA 1ML3A 4IDAA 3CEAA 3VH3A 1VLLA 3RJ5A 3ADOA 1UAGA 4A2CA 1X7HA 4CMEA 6LDHA 2A92A 2ZB3A 4D43A 1R15A 2R2GA 4DC1A 5L7WA 2O4CA 3A1NA 4QFCA 2WE8A 5JW6A 1RYDA 2JFFA 1MA0A 2B0JA 2NU9A 1EE2A 2Q99A 2VYND 5IF3A 3OICA 5CEFA 3RUHA 5EL0A 4R54A 4CJXA 1XCBA 3NGLA 1DIBA 1WZIA 1YJ8A 4J2OA 4P4GA 4XGIA 1P33A 2W2LA 4TMFA 4AJKA 1NFFA 3BAZA 1V0JA 4YRDA 1T4BA 1U28A 1I2BA 2Y1FA 3CTMA 4KWIA 4Z6KA 4ALKA 3VDQA 2IODA 5A5EA 2Y0CA 1K6XA 4HXYA 2JHFA 3BMOA 2X0JA 4JLWA 5TX7A 4JBHA 3BMQB 4FQ8A 4EJ6A 3Q0EA 3QVSA 1Z7BA 2AW5A 5FWNA 4CV1A 3KETA 1YQDA 4KZPA 4OXKA 1KIFA 1XQ6A 2CFCA 4CQMA 2O23A 4N5NA 1A7AA 1GL3A 2PK3A 1AHIA 4JBGA 4BNVA 3COSA 2P9GA 1UXIA 2G0TA 3PHGA 4I5GA 3PVZA 4BO3A 4E4YA 1XG5A 2FWMX 3H3FA 1ZFNA 3TZ6A 1MG5A 2G76A 2VTEA 1WVGA 2DTEA 2FSSA 4B79A 5L7YA 3UCEA 2ZYAA 2B5VA 1Z82A 4HFJA 1M2WA 3JQDA 3RKRA 4ZRMA 2YUTA 1U9JA 4WNIA 1FJHA 1D4FA 3DAGA 1P77A 1C1XA 2NVUA 2RIRA 3VTZA 1PGQA 3F1LA 3QWAA 4N7RA 1EUCA 2CVOA 4AL4A 1E3LA 3O03A 4YEDA 4L75A 3E9NA 1N7GA 4YAIA 1L1FA 2ZCVA 1SPXA 3D5TA 1ZNQO 3SLKA 4PLPA 3RQSA 3F9IA 4IIUA 4ZGWA 4L0QA 3AY6A 1KEUA 2DUWA 3B1FA 1N9GB 2NVUB 3JYPA 3U5TA 2CDAA 3M6IA 4OKNA 3WDSA 1NAIA 2Y1CA 2VYVA 3JYNA 4CM7A 1E3WA 3EW7A 1T4DA 3EC7A 2JL1A 4L9RA 3OQ6A 3INGA 3PTZA 4BKUA 1AHHA 2W4QA 1LC3A 5ILOA 2NM0A 4QXMA 2PA3A 2FRDA 1BVUA 3M1AA 3Q3CA 5TGDA 5JCJA 4FFPA 1IZ9A 2PTGA 1AE1A 4IQ0A 2VRCD 4ROSA 4XWYA 4CQLA 2P5UA 4XQ9A 4MVJE 2UUOA 5F1KA 3RSHA 5B1YA 3BXXA 3RUAA 3X2EA 4M54A 5G4LA 4H15A 5CDGA 3UUWA 3PJEA 4L8VA 2X1HA 4ZICA 3EUWA 3LYLA 1PGJA 3Q9UA 4ZQGA 1DEHA 4Q3NA 4UVDA 4IJVA 2I76A 3IQDB 3Q9NA 4KDEA 5GMOA 4XRGA 4R9SA 3DBVO 3GG2A 3HB5X 4IGFA 4XRRA 2PD3A 3PGJA 5B4TA 4W7IA 1I24A 3RC1A 4A03A 1D1SA 3RASA 1KEWA 4XYEA 3L6DA 4K6FA 4H16A 1A5ZA 4UEKA 5AYVA 5A3VA 1ZJYA 4XYBA 1IYZA 3P7MA 1DHRA 3O8QA 3AU8A 4FD3A 3SLGA 5IZCC 1Q0QA 1T2FA 3OQ1A 4A7PA 3EK2A 3RUDA 3SJ7A 1QYVA 3PLRA 2HJRA 4MKXA 2FZEA 4GX2A 1DJNA 9LDTA 4ID9A 1PQUA 4IMPA 4RF2A 5DCWA 3GEMA 3ZU4A 5C7LO 4RVGA 4FJ2A 3ASVA 1XU9A 3B70A 4YJHA
chains in the Genus database with same CATH superfamily
3GARA 4GOJA 1VSUA 1RWMA 3RC3A 3T7IA 1U04A 1VB5A 1JKMA 2WU4A 4KOEC 3GLUA 4G0VA 3CF0A 3IIMA 1QG6A 4LEIA 2QRQA 1ZD9A 2J07A 3H4TA 3N8DA 2UZ1A 3VR6A 3FVRA 2FPPA 3DWGA 1IATA 1D1PA 1OH8A 3ABIA 4IQGA 1IZ7A 4G25A 3SJBA 4E7PA 3HDHA 1IXYA 2H7XA 5THXA 3KVYA 4M8SA 4LJ5A 5GY7A 1SD1A 2PCJA 3UQZA 3LVBA 2DE0X 3SKYA 5LLDA 2CNDA 3A36A 4TKUA 1Y8QA 5AVJA 3GLIB 1GLNA 1CIVA 5CXUA 4CI9A 4HMQA 1XFDA 2P7HA 5AJZA 2Y1DA 4ARBA 4ALMA 1QFMA 3E3OA 4DR7B 1T9KA 4UVHA 3Q87B 3T5TA 3L8MA 4JB3A 3ZU5A 2XWPA 1NP6A 4EB8A 5F2EA 2JA2A 3HDVA 4UMEA 5LU8A 1PNOA 4I4NA 1SA0A 4JXJA 4LK3A 4MV0A 3E9YA 4NOMA 4CKXA 2PRSA 5DBFA 1IY2A 2GEUA 3EMVA 3GT0A 5IJ9A 5F76A 4G26A 5CUQA 4HLUC 2D3TA 4YT2A 3JATB 3EF0A 2R11A 3R09A 2GXQA 1X1DA 2ZYTX 1MNAA 1QE5A 3FPAA 4I5IA 1O9BA 4YJDA 2OYCA 3D0RA 3BPSA 3BWYA 1VJTA 3LBNA 5A4JA 3MJDA 3ER9A 1R12A 2CMFA 4R83A 1YVRA 4OHMA 5CR9A 3JWHA 1RI3A 5ITZB 4C20A 4CZ2A 4RHFA 1KQGA 2O3JA 3CQ9A 1NUPA 1YUBA 3CW9A 3LXRA 2JHCA 3MPUA 2QX8A 5GONA 2Z5FA 3NTLA 3VYSB 3KE9A 5THQA 2CV2A 2AG0A 5EJ7A 1XZMA 4HDKB 1DS6A 5ALZA 3F98A 4BQEA 1L7PA 1Y3CE 3K72B 4AJJA 2XUZA 3QH4A 4JLAA 1UANA 2BKLA 1KMCA 3LTNC 3A1SA 1M1YB 4ND5A 3N1UA 2Q0HA 3T1VA 2ZT8A 3HC7A 1NW4A 3M33A 2C5LA 1JQ3A 4KE8A 4ND8B 1H1TA 1KMNA 4CCYB 5F7OA 4HH4A 2PMKA 5EIFA 1FDUA 2E18A 4BB6A 2D59A 2WIKA 3F6RA 3HB9A 4S2UA 4Y0AA 4KZKA 1R6TA 4AMUA 1SD5A 1GTZA 1P5JA 2BE7A 2C54A 2C5BA 2VH5R 4PONA 3ZCXA 4CL0A 3ZD7A 1I6WA 1BEEA 1V96A 3JQBC 5DNCA 1P7ZA 1XRJA 1OXKB 1EQUA 4L0DA 3C85A 5SZHB 2BYTA 3DOFA 2RGXA 4D26A 2IS1A 4UPVA 2P4SA 3GEEA 2PQ0A 1Z47A 3IEKA 4ZEMA 3JQ6A 4US2R 1RI5A 1T26A 2DP4E 5IJ0B 5TEVA 3W8FA 2QW1A 2BC9A 2JI9A 1XEWY 4BMNA 4P53A 1ZM9A 5HIMA 5AIAA 1MB4A 4RQBA 1FBTA 2NGRA 1C4KA 3MWGA 4G9BA 5EGNA 3EGOA 3GLTA 2AG1A 4JY7A 1M6NA 2V9PA 2NZ8A 1ZISA 3A2MA 3D3NA 1MABA 3G85A 5JXHA 1NNUA 1U63A 1UCFA 3I9LA 1CY4A 3BG5A 3LW8A 1SNYA 3F67A 1S89A 2XVZA 1ZOSA 3C6YA 4WKBA 1PDVA 2IEAA 4G5SA 1IY9A 1PGNA 1MQSA 1PG0A 1EDDA 1I4DD 1QX4A 2C4HA 2DECA 3B1VA 1C3OA 2A6PA 1TVKB 2ZYHA 3QJ5A 1K2WA 5F1YA 2XMRA 3MBOA 4NOJA 1RM4A 5F73A 1B2LA 2E82A 1ACMA 2XYQA 4URXR 1ZK4A 4UHDA 3AF4A 3KQSA 5U1PA 2GPYA 5BWMA 3G9XA 4U63A 3VC1A 5HEKA 3GEDA 3ROMA 4NENB 2AYYA 4GNKA 1TIKA 4GLJA 4IMRA 4R5HA 4AS3A 1EJ6A 2HLPA 3BD9A 3D4BA 5TVGA 1Z2OX 2Y05A 2YFYA 4HHEA 5JS2A 3UAXA 4HKTA 2Z3WA 1XELA 4ZVTA 2CHEA 4MZDA 3PD1A 4Q34A 1I6LA 1VSQA 1XRSB 2V5AA 4IV8A 1K8RA 2EFHB 4IVPA 4K40A 4RZ3A 5EMKA 4C9BA 5F2NA 3FFWA 3GY0A 2IFTA 2ZIWB 3L7NA 4B7CA 3PHLA 5EOVA 5FOXA 4BY9E 4PFKA 1NMQA 2GEJA 3KJIA 1PUIA 1HG1A 1OZAA 2JI8A 3KV1A 3OFKA 4FINA 4J4TA 2GEDA 3BSYA 2OO3A 2OILA 2OXFA 4MYCA 4OXYA 5KTNA 1KL7A 2WIAA 3GF4A 3U56A 3ULKA 3PXCX 2H9YA 3GBPA 4R2WA 3FLEA 5JEEA 1W49A 2E7ZA 3I32A 4K9LA 1TF5A 3DBLB 4AJ2A 4BQNA 3SSNA 3T4UA 4II2A 4D3ZA 2Z09A 1ZBDA 3VSAA 1FCJA 3A6LA 3DCNA 3DMRA 3PG5A 4PLHA 1U8ZA 5COBA 1RHUA 4Q3KA 1K2VN 4GVXA 4NAUA 4RJKA 4FC6A 4BNNA 1H6DA 3KT6A 3EYAA 2I7XA 1MEJA 4FFVA 5CDFE 2ZR9A 2VWQA 3IKMB 4MRMB 2Z2IA 4BKRA 3JQRA 2QMOA 3LF1A 5HZGA 3L6CA 1Q2UA 1Y81A 1NRJB 1L9XA 3OBIA 5AWFC 2J09A 3I58A 2RHDA 3IMCA 3IE1A 3M9XA 1UJ4A 2VSYA 4LRYA 1RD4A 1A4UA 4ZYYA 1CVLA 4EPXA 2Q5LA 1VL1A 1UIRA 4ZI2A 1HMYA 5BPFA 3N5KA 2EJTA 4C43A 4B73A 1WULS 4HH1A 3GZNB 3JVIA 5TEWA 3B6JA 5LZ8A 3DUWA 5B4UA 1KZ6A 1WKBA 3CMCO 3P20A 4BX3A 1X9IA 4CG0A 2C04A 4K9PA 5FWYA 5HCIA 2O8DB 4Y8VA 3UWKA 1GDHA 4DCGA 2GRJA 2PSHA 4P08A 1R2QA 5KTKA 4IO0A 5LVAA 2BDTA 4HQFA 4RD2A 2FRXA 2C3PA 4I1PA 4DV7B 1WHSB 1X92A 4GX5A 3BX1A 5F4BA 3VVLA 1V26A 2FX5A 1GNTA 2PSFA 4Q82A 2ZBPA 3HE3A 2ZIZA 4KDFA 1OWOA 2PT6A 3MS2A 3RRXA 3ZS8A 2V4MA 5KSPA 2GM9A 2JS7A 4CE6A 1RAEA 3BM5A 1II8A 1U90A 2GAJA 1VE6A 3QK7A 4GE3A 1ICIA 4UNQA 3T3HA 1LI4A 5SICE 1GKKA 2B69A 1RYHA 4A26A 4UFPA 4F91B 1JG4A 4BFTA 1KAEA 2PMFA 3AUKA 4N3NA 3NIGB 1UWLA 2LR0A 3B2NA 3FYCA 3RGWS 1SBIA 2HSJA 3HNRA 3M6LA 3WMRA 5HKKA 1L8QA 5DNAA 1T3LA 2I1QA 2FH5B 4O4HB 2F17A 3IIIA 3T1QA 2Q8PA 4IZ6A 4ZZ2A 2ZAOA 2HSZA 3HB7A 5EZYF 4EBBA 2PMDA 3KL2A 2WNSA 4GZLA 4Z7JA 1FS5A 1T5OA 2B3TA 1E4OA 2BHTA 4FLFA 4C7JA 3G2KA 4RA9A 2XT0A 5AXCA 5HF6A 3EDQA 1PR9A 2ZRIA 2ZVQX 5PNTA 4NU0A 4KBFA 1CZHA 3UMBA 1UQRA 2RHWA 4DA8A 4QGFA 5LNK6 1QFSA 2W2LD 3HJNA 4NEQA 5DT9A 3AILA 1W6UA 4IF6A 4L7VA 5AKXA 2CZGA 2EQBA 1T0UA 2ODQA 3FSGD 1JEAA 2P9CA 1C4XA 3P9QA 4W7SA 3P26A 4RJTA 5JJCA 5K7SA 1M72A 2AG6A 1WUHS 3DMNA 4Y6RA 2AF3C 1EDEA 1VI5A 2HWWA 1TQ8A 3IVMA 4GLFA 2DM6A 1U11A 3ZHRA 2H7YA 5A62A 3IQXA 3HCFA 4FSXA 4OGWA 5TLSA 3BSWA 4TROA 5E3JA 3SJUA 3WGGA 3EIFA 5TQ2B 4C3ZA 4P80A 4TTQA 4EDFA 4HN4B 1FDRA 1GDTA 2BMJA 3V7FA 1LTHR 4QASA 2QKYA 3UXHA 5DX0A 3DOOA 1WHSA 4JI2B 4PVCA 5TNXA 2HWUA 1P6XA 3ZKWB 3KC2A 2JBWA 4UASA 1CP3A 2FPWA 3CV3A 4TM7A 1XL1A 2QJRA 3WGOA 1ND5A 1CY2A 5D86A 4KQ6A 1HLPA 4LMPA 4OM8A 3UJDA 5I9IA 4XEUA 3DVRX 1KEVA 5COQA 2PMEA 1XK6A 1FRFS 1L6RA 3VR4H 2Q6OA 2I65A 5FTJA 5J40A 1F8XA 3DVLA 4K9OA 5KTOA 2CWWA 2O1EA 4YP9A 3TSCA 1UZLA 4ZOQI 4JI4B 3ZGLA 3H04A 1K5HA 1XOIA 2QHXA 4FNMA 1XQWA 2JFUA 3TNFA 5J2UF 5F9FA 3ACBA 4L73A 3A7DA 1VYUA 4F6CA 2PGAA 3M4XA 4GOMD 3CCBA 1EAMA 1P4AA 1A27A 3A05A 5EZ5A 1EA7A 1ZOOA 4FR5A 3R3XA 1RVDA 3VHLB 1V3UA 3P27A 4CLXA 3Q3GE 1R4MB 3RC2A 3HYSA 2IV7A 2ONJA 1JR4A 1L5OA 2HADA 3OZCA 5A1JA 4UMFA 2R7NA 5AHRA 2BWJA 1WV0A 4P58A 4P9NA 3EOAI 3CM0A 1U8AA 3MCZA 4E2FA 2BCJQ 1JP7A 3E70C 2GPJA 1W4LA 2CLIB 4FMPA 4HGRA 2I9PA 2WFLA 3H0EA 3O7WA 4CIVA 4UFNA 1PE0A 5CXSA 5E8RA 1M33A 3Q72A 3LP8A 1N0IA 3FHCB 3HVKA 1C30B 2HCFA 1EKXA 3D7NA 3K1ZA 2A9PA 2NPIA 3OD1A 5EXXA 3VAAA 2BGMA 2C77A 2ZRFA 2G9VA 2ZP1A 2ZYGA 1OYWA 3OOHA 3VC2A 3G0DA 1Y4ZA 4ZZ0A 1Z5NA 3L7YA 3RE1A 3PRHA 2OFXA 3V48A 1G98A 2G17A 4PICA 5DHRA 4KV7A 4WCFB 4UOEA 3QENA 5LP6A 1JH8A 3GJ8A 3Q85A 1EB9A 2QMHA 3AF0A 1KSGA 2DSTA 3H8JA 4MW1A 2JGNA 3UGJA 3P1JA 2MHCA 2PBFA 1TTQB 1BMFD 2AJCA 2C1XA 2CFIA 1BU8A 2YV2A 2IHUA 3AXTA 2ATVA 4G5HA 4S35A 4D1YA 3TFOA 3BOSA 2MSNA 3HADA 3ELBA 2JAWA 3GPDG 4QGGA 1F8FA 3CLVA 3GDWA 1WMDA 3ZDCA 5LDGA 1BS1A 2MINA 2WF6A 3CRMA 3NVDA 4MPJA 1KMIY 4RD6A 1IUOA 1X1TA 3M34A 2H1SA 3JRWA 3QU4A 2TMDA 5AVKA 1WRBA 1MG0A 3EGXA 3WGYA 4DBVO 3T1YB 1RCUA 1TAHA 4GGOA 5HBGA 3W9BA 3PKZA 4NDAA 4MQEB 4MHTA 2ON6A 2AOUA 4QYIA 2H4YA 1CR0A 5TS3A 2GNAA 3B7WA 5BVHA 4FCVA 1YF3A 2BONA 1GGHA 2TSYB 1WG8A 1XAHA 1PTKA 2GF2A 3H8SA 3ACDA 5G3YA 4LY3A 2PMCA 2QYSA 4F56A 2O05A 2HDHA 3ECCA 3I5YA 4UZSA 4D9IA 4A15A 2LVBA 2QXYA 1U4OA 2Y67A 3BB1A 1Z4PX 4U39A 2C9OA 5JISA 3U3DA 2C7PA 1TD9A 2QTWB 4W5JA 3FYSA 3L7LA 4NMHA 4CVNA 4IVRA 1QGYA 1J0XO 4OP2A 4RJIA 4F7WA 3UGKA 1AG9A 3FWNA 4Z7NB 2OZPA 1T9GR 3QVWA 3BWXA 4HG2A 3RCBA 3SZLA 2WDZA 1I5OA 3DCJA 4KXVA 4RLHA 3WKBA 4BTVA 4I08A 4DHWA 2JAQA 3O6VA 4XVCA 4L50A 1WNFA 2QT9A 1FY2A 3FPEA 5A7GA 10MHA 1WCIA 4F3RA 1XZEA 3R5JA 3W5CA 3LP6A 3CLUD 1BC5A 1LRLA 1HQDA 2DTXA 4LWQA 2OE2A 3GZTB 1OZFA 2H8KA 5JT1A 1KDVA 3VU0A 1E0AA 2W58A 3DBRB 2GO7A 5I9MA 1E1KA 4JX9A 4EHJA 1M1YE 4KQ9A 4F2WA 3NOOA 4AURA 1GTRA 2Q3LA 1CDDA 3LL4A 3ODPA 3TD9A 3FGOA 4J4HA 1FUYB 3QJGA 3W2HA 13PKA 3LUGA 5C8YB 1I2CA 3I9NA 1DRKA 2GN2A 2P1DA 4ZU1X 1NQTA 1EEXB 2V98A 4EECA 4COOA 2HFKA 5HIKA 1BS9A 1EWTA 3I2GA 3ONNA 4R2LA 1RRFA 5KVVA 3ESXA 5EUQB 5AVXA 5JQWA 2CNBA 1Y63A 3L7MA 2WUEA 1J5PA 2B94A 3NHZA 3ANNA 1KIMA 4JLPA 3TG8A 1ZA1A 1TYAE 1FU8A 4R2IA 5ALHA 1V11A 1S5PA 3OJXA 4EBFA 1VPLA 4UHFA 4BRUA 2VQEB 3R3UA 1JR3A 2WABA 5AJHA 1EGHA 2YHSA 2VJDA 1IZYA 2F4NA 3B9BA 3QXGA 2GPBA 1Q21A 3RB8A 4WERA 5JSHA 3EZXA 3HY6A 1FNSA 1RBZA 1UPBA 4NX2A 4LXTA 5A4DA 3ZKWA 1IM8A 2ZUWA 1UDAA 2YWBA 5LL6P 3DLAA 4KGVA 1DE0A 4MLZA 1KP2A 2C7QA 2JFZA 1QYDA 5FA8A 3CXUA 3IAHA 4NYJQ 5HZMA 2V9CA 4QL3A 2YZGA 3SHOA 1C8BA 4Y1RA 4AKSA 4CQNA 4DR5B 2I2FA 3OE7A 2LCQA 2C4VA 2I3BA 3DDZX 5H3CA 2WUVA 3RR2A 2W2XA 4WWHA 5K0CA 1JKIA 5D3ZA 1JHQA 1R64A 2V7XA 4KG7A 3KFLA 2SCUA 2FEPA 2JH3A 3EZ6A 5EQJB 4C0JA 3FX2A 4OVKA 5AIBA 1R9NA 2BJHA 1E92A 1G9XA 1VXRA 3G13A 2NUTA 1EWKA 3TI7A 5JMWA 1N0HA 1ILWA 1OXTA 4LSWA 5DJ5A 5IKXA 1DB3A 1E3JA 2B1QA 1P1RA 4ZV4A 1M6WA 2DOKA 1OXVA 4HAXA 1KE1A 4E12A 2JFPA 4DSUA 5TF4A 2HBYA 1B43A 4YRMA 2QBYB 4U4AA 1RM3A 5HCUA 3AF2A 4PW0A 4FYPA 3N2ZB 5KVQA 4BU1A 2CHGA 4Z3DA 4FM9A 2X4LA 3HJHA 1RYEA 1LS1A 4CLHA 2YWFA 3KDPA 2WM3A 4EMTA 1NQOA 1P7YA 2P1ZA 2VRNA 4TZTA 3DS8A 4LF4B 4LZAA 2EJVA 4O4HA 5HFAA 1Q2XA 1QAOA 1T2UA 5J1TB 5EKDA 1N33B 3J7TA 4G81A 4HS4A 4OMUA 1QB7A 4GVPA 4ZODA 1NVGA 4QOGA 1O6FA 2JEYA 5CT6A 1CYDA 3MT0A 3VJKA 2C7OA 3T35A 2J0VA 1RWWA 2W6NA 4LE0A 1M75A 1K8QA 2DR0A 4P5PA 4KRYA 2ZRHA 3PKJA 1Z28A 5A0FA 4YO7A 4CU5A 4DLTA 3BWVA 4OMDA 1QGAA 2ASEA 2B4QA 5ALKA 5KYUB 2JJ2D 4IDQA 2RJ3A 4XD7A 5KIAA 1XN1A 2HMTA 1J8DA 1O5IA 2V54A 3AGPA 3GFRA 3ZE7A 1I30A 3F7TA 1POWA 4ISCA 4PYNA 1NJ8A 1TM7E 2JCVA 1BN7A 4NYMR 3AR5A 5GZ6A 3ZYZA 1E3TA 1K7SN 1ZVQA 1ECLA 3C5VA 5DW0A 2JCSA 4NBRA 4ZHQA 1TMKA 3D0OA 1AQ6A 1KVRA 3L41A 4WXEA 4BZXA 1LZLA 4XUCA 3WYEA 3QVVA 1Q74A 3GUCA 1GU0A 4EY4A 5BNFA 5FAKA 2WHEA 3RHSA 5EQDA 2Z8XA 4ZO6A 5K0LA 1AO3A 3GZNA 3P9IA 2V6GA 3UUFA 1N2SA 1SXQA 1KMHA 2YHUA 4IWYA 4INAA 3LPMA 3HKBB 1A8QA 1U2QA 2DJ5A 1Z74A 3QELA 4IEIA 1EX6A 1YB6A 2IU0A 3TLBA 3KQTA 5A03A 1YTUA 1G2QA 1DUVG 3KQWA 2BEWA 2O1SA 7MDHA 1KBQA 1L7DA 1UBCA 4H7PA 3ADKA 3ZJUA 1JUDA 2EW2A 3UN1A 2YICA 1ZM3A 4C5AA 2MYTA 4CCWA 3FB1A 1BG6A 1OXMA 1X2EA 3FDXA 5E6SA 5FRDA 2P11A 1YKFA 3IXLA 4IRUB 3OQJA 5CB0A 5KKCA 2CNOA 2V5UA 2ZAGA 2FR8A 2XKAA 4U9HS 4UUPA 4U5QA 4FWIB 4U2FA 2ILVA 1K75A 2GILA 4FFRA 4X62B 1YZKA 1XU7A 1I3MA 3D7RA 1G8FA 1RS0A 1T1IA 3ILYA 4I4TB 2MDTA 2ZDGA 2C99A 3HB0A 2OCDA 4OHVA 2FLWA 2EYUA 4XTRA 2PPLA 2YJTD 3BK1A 3AR4A 1EUCB 3A3YA 3EULA 4GGMX 1EX1A 4X95A 2YNMA 3N39C 4PQRA 3FOCA 4DQUA 1SKAA 2ID8A 1N2JA 2WVGA 4L72A 3VR6H 1GHTA 2QQ0A 1RJWA 3JAKB 3JVUA 4MRVA 4QHYA 4CF5A 1KI6A 1T0PA 3VRHA 3I62A 3G23A 1OAKA 4IHKA 1CY8A 4Z0NA 1JG3A 2YCLA 5E6RA 4WBSA 4R51A 2IUSA 1O94D 3FGNA 3V2HA 5KDLA 5T3UA 2HRRA 1XDWA 2FUNB 3U1VA 3S3TA 5GIOE 5ESWA 1G1AA 2NNLD 2VXBA 3KXIA 1S2GA 3HZOA 3OBBA 1M8PA 4GDMA 4MVJM 4RZSA 4ZYZA 3WRXC 1A96A 1PWEA 2C78A 2J41A 1DDGA 2LW7A 1NVWQ 2JDIA 1JEYA 3GJSA 1HRKA 2WD7B 3H5IA 3MC1A 1BYIA 2IV2X 2XZPA 2JARA 4PFJA 1YR6A 5ALQA 1EBFA 3UWSA 3H1EA 4M99A 3RFFA 2GPWA 2MJLA 3RBXA 3U9TA 1JF8A 2BFDA 3JZDA 3HHPA 4W8GA 1IAQA 4ZZ3A 2AXQA 2AEMA 3HCOA 4N12A 4BFLA 4GQBA 3BBPA 2BH2A 1IQPA 3MELA 4UNRA 1UXKA 1QU2A 5K3AA 1QTNA 3ADCA 4QLBA 4IH1A 5C52B 1NUUA 3E8MA 5AI8A 5AJVB 5BNTA 1A5TA 2WILA 3E9MA 5C4MA 2Q5IA 2X19A 1E3WB 1E60A 1RPAA 1SUEA 1YBMA 3RSGA 3BZBA 3PIIA 2LGJA 3FBTA 3KKKA 1BFDA 1KDZA 1JU3A 1MPXA 1CEXA 1B8NA 4OQXA 1A2KC 3O8OA 3JR7A 3QM1A 3QRWA 2J9YB 4N82A 5BQ5A 4BGUA 1KDPA 4YRBA 1KK2A 2WZQA 5GAJA 4FPXA 2BZ1A 2C92A 2OD9A 5DDIP 3M6WA 3ISJA 1M2FA 3C97A 3LKBA 3NWJA 2H29A 4WD3A 1AD2A 4WEQA 1GG5A 2YXDA 4MQBA 5E9QA 4D9KA 4FS8A 2ZI4A 1Z4IA 2DAPA 3UMSA 3TL3A 1VIAA 1NYRA 2B9EA 5CX1B 3C45A 1JIUA 4PHFA 3RDPA 1G3RA 4LSMA 3LRTA 3SXJA 1P73A 2QRLA 2LP4Y 1SOVA 3ND8A 1QRUA 3G2OA 3L1VA 2Q0QA 4MO2A 2VQ3A 4F38A 3QFFA 2YYSA 4QPJC 4YLGA 3KAQA 4EGCB 1U2RA 3F3KA 1AQLA 3ZJVA 4JYPA 4JU8A 1MQ9A 1WR8A 2A0YA 1Z36A 2QTVA 5GONF 4BJ6A 5D3MB 2ST1A 3Q8WA 3K4HA 5EJ4A 1OFHA 1K7FB 4JJEA 1A9SA 1JPVA 1MB9A 2P9FA 3PNMA 4G67A 3ZV4A 2F1JA 4DCSA 4FWTA 1ZYUA 1QVVA 4G0OA 4RY0A 3UENA 3RAGA 3WB9A 3FTDA 4D25A 1WETA 4YP1A 1DUSA 1U0BB 4YUXA 3KCNA 2YFQA 3CKYA 2B20A 4YDHB 2R0QC 1DIAA 1PL0A 3SM3A 4AROA 4KXMA 1OX5A 4AZ3B 1RQRA 1D6SA 1IMOA 1A95A 3HLTA 3NCTA 2HJHA 1M54A 2EP7A 3BSFA 4GQAA 1WBBA 3SIWA 1ZBQA 1UP6A 3W3AH 4BX8A 1DKLA 2JBHA 5NULA 3IULA 3NGXA 2W8ZA 2WSSA 3FFAA 2ZSBA 3L0OA 1F2VA 4TMVA 1HZZA 1KVSA 1AKNA 2NVWA 4CTMA 4EZEA 3FE2A 1D04A 2JGLA 3ILXA 1EE9A 4Q7JB 1U7DA 3RVBA 4BNGA 3QJYA 1L0BA 4GMFA 1G55A 1R8XA 4MYTA 5DIFA 1G4AE 1QS0A 1WO8A 2ACVA 2HLDD 2QVZX 3L5OA 4YGYA 2AN9A 4WLFA 4YFYA 5BSRA 3HU5A 3R7FA 3G5MA 2JLWA 4DQ0A 4C0XA 4RKFA 3LOPA 5B7QA 4IQ8A 6PFKA 4OI4A 1P1HA 3DHEA 2VRWA 1FW6A 5K0ZA 4YP6A 4JB0A 1T1RA 2HO5A 1R6XA 1DG3A 2JJYA 4GZ5A 4LY9A 3YASA 4D8YA 7AT1A 3F74A 4I50F 4ZREA 3O82A 3OY7A 3VJLA 3GLIA 2CMHA 1FFYA 1T5BA 4DQVA 5K3FA 3T5AA 3MSCA 4QJ5A 1N5LA 1X3SA 3LKDA 4DM3A 1G9SA 4IIFA 4WZAB 6NULA 1V45E 1J9EA 1JR6A 3NB0A 1GWNA 4GZMA 1PAUA 4RPCA 2BTQB 3S5JA 4J49A 1F4VA 4ASUA 1J2RA 4MRNA 2RG1A 1DIOB 2VDMB 3CJTA 1KFEB 4UUBA 2EG9A 2GAIA 2GXAA 2ZG6A 4EVIA 2WHYA 3AOGA 4K6HA 4CN8A 4EH1A 3L7BA 1MEOA 4LDQA 2H2FA 1VLMA 5FP0A 1B42A 1MORA 4RSMA 5HDQA 3JZFA 1VCHA 4A6DA 1Y6GA 4GC9A 3LY8A 1YHZA 3M6AA 1E9AA 1KK3A 4N6NA 2ZDQA 3ZV7A 2FE4A 3BVPA 4LPKA 2BHSA 3QKSB 1WM1A 4ZRNA 1RWPA 1W581 3IQZA 3JQ9C 3I6MA 2ANBA 2WYWA 1TU4A 1UT6A 2XNHA 4IF4A 3K0KA 2BFWA 5DN9A 2GKOA 4PQEA 1RQLA 3OQVA 1QF9A 3IUSA 4H7DA 5HF5A 3QU7A 4ZDJA 3HJGA 4D0SA 1IH8A 1NOIA 1G21E 2QTMA 3B51X 5K8JB 4JJ7A 1PT5A 1SC6A 3DEAA 3AOEA 5DE3A 3UBTA 4BUCA 3OO0A 1ZD4A 3U80A 3KB1A 1NKTA 1K7CA 4Q3AA 2XMSA 4WFJA 2FWNA 2X7JA 2V6FA 2ZYIA 3SG0A 3K5PA 2FSVC 5JWOA 3P9YA 4PSAA 4J3NA 1ULTA 4HWGA 5EJ5A 1M9NA 4DQKA 1F60A 4DQXA 1M8FA 3Q10A 2F43B 5JY1A 3KUKA 3ZJTA 4EF6A 5KQPA 3RJZA 4BMSA 2BEKA 3KVOA 5B6PA 3N2GA 3KT3A 1Y48E 3GZJA 2ZZNA 1I6KA 1CEEA 4MIYA 1VLVA 1C5KA 2Q1YA 2Y76A 1R66A 4OQEA 1L5ZA 1UDCA 2Q1SA 3G8BA 3DFUA 1LSOA 2VPIA 4MUGA 4BLSA 2YVQA 3OZXA 2OCGA 2AYXA 3DMDA 3FCYA 3H11A 4PZ9A 4CFSA 1Y1SA 3PGXA 3EIEA 4U9UA 1TCUA 3ZHOA 4ZI7B 3BCUA 4NDNE 4F9EA 3NHFA 4L57A 3T1OA 3ZWXA 4E2YA 3M2PA 2YVUA 4B7ZA 2I4TA 4LQCA 2P9YA 4ZQHA 3SIPA 2ZJFA 3WL4A 1ODJA 3L7KA 2V03A 2I3ZA 3GPBA 4LFBB 3F6BX 3KD2A 4RANA 4F46A 3VU9B 4ZFNA 2AC4A 5TRTA 3JZIA 4V0LA 2H48A 5BSTA 3D6VA 3GPLA 1D0IA 3C3EA 1DV1A 1FMJA 4KMMA 5KQGA 4C21A 1WZEA 2VQDA 5EIAA 5ARDA 5BSHA 2NMVA 4NBWA 1J2TA 1MC8A 1O77A 3JQCA 1TI7A 4RELA 2CBZA 2FHPA 3ZWCA 5A9RA 1R6DA 2DBZA 3O9ZA 4OTZA 1ODFA 3G9QA 4X1KA 1G0OA 1ONPA 1P0QA 4I8XA 2NQ8A 1BZYA 4PLVA 4N41A 1PW7A 2CCJA 4D8VA 4DMHA 4RZHA 5IYZF 2BGKA 1H5NA 4ZOLB 5BSUA 2AQIA 3CBQA 4FNOA 2BKUA 4J90A 4N6OA 5YASA 5BQFA 1FS6A 2HWYA 1HDXA 1QRAA 2XUGA 3E8SA 4BVHA 3KKMA 4Z4GA 3N8HA 3OKAA 4RF4A 1FYFA 3AEUB 2XDWA 4MVXA 1K8YB 3G7SA 4PN3A 1TK2A 2GEBA 4IZOA 1AXEA 2FWAA 2QLJA 4EFDA 1V47A 1N9GA 1RMYA 3DTTA 3OLQA 3ZHUA 1VRCA 3H2GA 3VKUA 3OQOA 5DHQA 4E2ZA 5JHGB 5ES4B 3VPFA 1VRWA 4KQ2A 4MP6A 1F0KA 3OEEA 1S2MA 4URHA 3FVVA 3ZW9A 3AEQB 3L8ZA 3PC8A 4AJNA 2WQ6A 1CLUA 5HM6A 5J4HA 3ZEAA 4MIKA 3GLVA 2R48A 5EXDA 2EIHA 2XV1A 3LX6A 3NDJA 4IL5A 1JL3A 1GPAA 3BREA 2PRJA 2C31A 3DULA 3EIHA 4Y2SA 5HRUA 3KYDB 2P6RA 4QUKA 3GN1A 3KBOA 3R9XB 1Z8DA 1ONNA 2NOAA 1ZIOA 1PJLA 2WG0A 2OV8A 4E32A 1YDEA 4M53A 4E5VA 5BRJA 1F2UA 2FNAA 6YASA 5LFAA 2QT0A 2VT2A 3CG4A 4QE3A 5EJ8A 5KOHA 3U16A 2QX9A 2XE8A 4P4UA 3VR4D 4WGFA 3GNTA 1E6EA 4UD6A 5EHIA 3RFUA 2OWEA 4ND3A 2Z2XA 1SU8A 3P96A 2UZAA 4BNUA 4EO4A 4RULA 3HA3A 3FUVA 4B2YA 4BEJA 4PO3X 2BFCA 5FA5A 5G53C 4JP3A 1YS4A 2NO7A 5FTNA 4TMZA 3NT2A 5U4QA 4LHVA 2R6JA 3PITA 4DSAA 4I1VA 4DWJA 1ENPA 4O2LA 4D9BA 4C6TA 3K09A 1CUGA 1L5VA 4JUAA 1P4SA 2AKEA 3TZHA 1GZ4A 2ZIAA 4YJ2B 2G28A 1TO6A 3NT5A 4U00A 2B2NA 3HZHA 3BORA 5EI5A 1HFWA 4Q18A 5A1TA 2DR3A 3PQ3A 4ZAXA 4RCZA 1E7WA 1DTWB 1JHAA 2GJAA 2AFHE 3BCSA 3EZYA 1P9LA 1QWOA 3DMTC 3DL4A 3DYBA 4GP7A 3ZBQA 1VLHA 2HPAA 3SNKA 1QXSA 3RSLA 2A78A 1DMRA 3ZW8A 5I7VA 2BY4A 3THSA 3UW3A 5KEIA 3P9ZA 4XSVA 3A9CA 2AOXA 3A4NA 3A9RA 5ADHA 2JI4A 2IU3A 1U5BB 1ZNYA 3MAGA 2IZ0A 2JDID 1WU7A 3AHHA 3SZOA 3DBOB 1TEZA 1UPFA 3E9ZA 3A31A 4CMBA 3ABZA 3UBMA 1A9OA 4GKVA 3EX7C 5LYJA 3HEMA 3Q2IA 1XZFA 2IEDA 5DGTA 3WIBA 1SQSA 4WN9B 1WJGA 3RHFA 2POCA 1J0BA 1I9GA 4URUR 5FUQA 3ZHQA 3Q40A 1CY1A 3E2IA 3KZKA 3UJ8A 2PUEA 3EF3A 3QPDA 1NJGA 1QR6A 1MO3A 1E9EA 1GFSA 1XA3A 3IT2A 3LAWA 1WXWA 3RFTA 4LJ7A 1EGVB 1V1JA 4JENA 4FOOA 3Q2KA 3VI4B 5K0EA 3B7PA 4MGHA 5IS2A 2DZDA 4KGZA 5HF8A 4LPSA 3WGQA 2V7TA 4OQQA 4BQPA 5IULC 5JXIA 1QIHA 4B2PA 3L06A 2F2TA 2QN8A 1G8GA 1R0RE 2OQIA 3IV6A 4YJ2A 2D5BA 3BBLA 4DABA 2OKGA 1WMEA 3IX7A 1JPNA 4FXPA 3GEIA 2R6CA 4RVFA 1WSAA 3O94A 4M9SA 2NV2B 4QXPA 1W94A 1ZH0A 1US8B 2C7GA 1U3GA 2VJMA 3FNRA 4I4LA 2DPMA 4JI5B 4D42A 4DDKA 2ZUEA 4AKHA 2X22A 4DDTA 3NLLA 4AO8A 2P5SA 3BFJA 2A86A 3RS9A 3C43A 4R9RA 2XE4A 2NU7B 1DGQA 4U7HA 1LDYA 3EXFA 3AUJB 2C82A 5BYJA 1J25A 2VF4X 4EK9A 2C7VA 5AKIA 1XMOB 5IU6A 3EHDA 3GC6A 5KX5B 1KPHA 3IL2A 1PR0A 3CUTA 4QBGB 2J6CA 1GSIA 1VBNA 3T7KA 4ND7A 1UJBA 1W2HA 4G0ZA 4TRMA 1W52X 4LXUA 2VQSA 2REXB 5FWXB 4FFDA 3M3DA 1SVNA 4HPWA 4YYZA 1E7YA 1WOMA 4PNEA 2I6XA 4XVUA 3JU3A 3KFXA 2NVOA 2O2GA 1XDSA 3R6DA 2V3WA 1VE1A 2PX2A 3Q0IA 3S1AB 5FF9A 1SCKA 4JBNA 5BWBA 1I94B 3IR5A 5K8UA 3KHKA 1U3FA 1CUXA 1ZJ6A 2XE7A 1L5GB 4CM1A 2JBAB 4C88A 1CP2A 1R0KA 1VHJA 2PU7A 3A4IA 2IGBA 3CH6A 5EE9A 4JOQA 5JAQA 2Z04A 1XA0A 3LYUA 4RK4A 5CLIA 1X14A 1CY0A 1T4CA 2YXPX 4YT5A 5K2MA 1BW9B 1CSEE 5FI1B 4JT8A 3AERA 3IP8A 3OD5A 2J3LA 1DBIA 1HM5A 4R7TA 5HYVA 4B9AA 3V1NA 4TLBA 2ZSJA 1D3AA 3ZTTA 4QXOA 1RRKA 4JLVA 1FTQA 1N2OA 3PFHA 3K6JA 1YK0A 4BWVA 3B6KA 1L5HB 2FRVA 3EAQA 1ORVA 3FMVA 4D9HA 4ILKA 1DC7A 4J76A 4DRXB 3QWFA 2FZWA 2H1IA 4XWGA 1Q6YA 1OAOC 4HDAA 2BL4A 5B3AA 2I80A 3FAKA 5AM3A 2L42A 2F59A 3DSRA 1PQ4A 3R3JA 3DCIA 3FTEA 1FSSA 1O0SA 1QV9A 5H1YA 1FVXA 3FUWA 3O2SB 1DCKA 2JHAA 3OP1A 1TQ6A 4JJGA 1OILA 5BNWA 2QQEA 1N36B 4W1RA 2IYTA 3EZ2A 2RCNA 1JA9A 2IOFA 2Q5JA 2Y68A 3N75A 4TQUS 4ZVSA 3RFCA 5LPNA 2JRCA 1C7QA 2H0RA 1I6MA 3A6JA 1QX3A 3OZEA 4IWNA 1JTFA 3R6GA 4L51A 1QJCA 1T6BY 2HTFA 1XNRB 1WXDA 4P2BA 2FB9A 2DCMA 3BS4A 5CTJA 2MMCA 5ITSA 2JFNA 1IVNA 3KZNA 1D2CA 1JXOA 1N6HA 2IUYA 3ZDFA 4JGIA 2VF8A 4JOBA 2QP3A 3DFFA 3G9UA 4UEQA 3OSZA 2RAVA 3CUSA 3L6EA 1DRJA 2IIBA 4OQLA 4Q66C 1GAEO 1UC9A 3LIPA 1IBKB 4JR1A 1R6AA 3MMSA 3A58B 4BXOA 4BBJA 4HDSA 4WOPA 4KO8A 2WPNA 2G1PA 4UU7A 3AHEA 1IUKA 3DEFA 4HB4A 3ZLTA 4XVQA 1E6CA 1LPPA 1MIOB 5HZHA 4OHOA 3OPYI 5CM2Z 4RDXA 3AHGA 4BXOB 2FPXA 1Z75A 3ILSA 3U49A 4ZZIA 2AX4A 2P3OA 4V0ME 2PH5A 1E1NA 1JG1A 1E59A 1QMPA 3C48A 4M22A 1AQUA 3LQ4A 1QNFA 1RCFA 5HW0A 4NBVA 3ESBA 2VC2B 3KZCA 1LVHA 1M6YA 1KPGA 2NUPB 4H4CA 2QZSA 1YZLA 2GK6A 1GARA 1IPEA 1WPXA 2Q7XA 3DAYA 3AI1A 3DQPA 4U8GA 2P91A 2GD1O 2BLLA 4N3GA 4MR8A 5IM4F 2H9AA 2WSYB 4XWWA 1BTOA 3RT9A 5BOSB 4M0UA 4DVGA 4ZAWA 5ELMA 2WJYA 2Q5QA 4UTZA 3ED1A 4MMYB 5FBHA 1NURA 1PGOA 5T67A 1CJTC 2QUHA 4J2HA 2Q62A 3C3DA 1YQ9A 4YP0A 4BX9A 1T24A 1YS9A 4AKTA 2WT4A 3ZBTA 4QOJA 5CJPA 1X80B 4E3WA 5KDDA 1G8SA 5KUTA 2DVMA 2NU6B 3CKMA 1GXSA 5K3DA 3V4VB 4CKCA 4BQIA 3AK4A 2WC1A 1V1MB 5P21A 1Q0LA 3R5FA 2XIJA 2WTEA 1W2WB 2AMLA 2JCGA 2JGDA 3CVJA 2Z0MA 3ETNA 3FDIA 4IDPA 521PA 1RE0A 4ML3A 5IKPA 1G20E 4MVJG 4MROA 3U7QB 2O59A 1PIWA 1LXCA 3NBMA 4EVQA 2XB9A 2WZBA 2QAIA 1UM9A 4RTKA 1KOJA 2GK7A 2PUTA 1UMBB 4OF4A 3CPEA 3RUPA 1GUYA 2YWJA 2L82A 3TSZA 5CA1B 4KX3A 1IK6A 1Z8HA 3M5PA 3NBAA 4CFZA 4XR9A 5CG1A 1R5BA 5KNCA 3G02A 5A6SB 4FEEA 3TIVA 5B5SA 2QB5A 1BH6A 5JSQA 1RDFA 1G6HA 3DEZA 4MUXA 3HVJA 4DY4A 4FKZA 1T6ZA 1DXYA 1R9JA 1DEOA 1Z2NX 2OPBA 4D8TA 2AUNA 2TRSB 1EK6A 4A36A 3NOVA 2QUBA 2QN9A 3PWTA 3I04M 2PXXA 3OMLA 3E8XA 3SFVA 2NXEA 1R0LA 2YUIA 3N6XA 2G9RA 3DYIA 3WV4A 4WK2B 2G77B 3MD0A 2PH1A 1E98A 4IBOA 3QG1A 2DFNA 4NZ9A 4OJTA 1HG0A 2R96A 4LKOA 4RPJA 3TIFA 5CEEA 4YASA 2V0GA 1LQ2A 3WMFA 4TWZA 4R3WA 1ZPDA 4XGNA 4D79A 1PJSA 1W96A 3CF4A 1DAPA 4DOMA 3PNBA 3REFA 1TT7A 4LOLA 1WY5A 2C94A 4ITUA 2Y1OA 4FDVA 4JYBA 1RJDA 6AT1A 4K2HA 3HKEB 4EUEA 4RMNA 1K0UA 1QG0A 1UXGA 4YN3A 5CNKA 4L08A 1E1CA 5CPFA 5AHKA 1XYVA 1ZGBA 3L18A 5ICFA 1HFKA 2VP4A 1LJLA 1G3MA 1DOAA 2ACEA 2EV9A 1J5EB 2OBBA 3F6EX 1WQ3A 5JSZB 2FQQA 4MUYA 1EH5A 5TIIA 1URPA 4ID3A 4LSGA 3GWGA 4Q9AA 5FCDA 1O8BA 3E0XA 4IKEA 3EQ6A 2OHOA 2YW2A 4BNZA 2VJOA 4ZCIA 3TCNA 4P7KA 2IYZA 1P7VA 4KH0A 2FN3A