1KSHA

Complex of arl2 and pde delta, crystal form 2 (native)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
164
Chain Sequence
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arf-like protein 2
publication title The complex of Arl2-GTP and PDE delta: from structure to function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
total genus 59
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kshA00
4RZUA 4C2TA 4FXPA 2IS2A 3L82B 3ZS9A 3M0EA 4US2R 4E22A 3K0EA 4EKDA 3AKCA 3CR8A 2J7KA 4URXR 1N5LA 3ADBA 1ONBA 2Z4RA 1W0JD 5FOTA 4CZ2A 2Y8EA 1S96A 3CX7A 5CB6A 5JCPA 1AS0A 4LV6A 5EJEA 1TEVA 1CP2A 3ND9A 1VHTA 3RS2A 4JJKA 4G5SA 1IJFA 5M04A 5EUMA 4DIEA 1U9IC 4O0MA 5JJKA 3RWOA 3RANA 1FNNA 2WJVA 4MDEA 3WHKA 1AZTA 1N6RA 2WOOA 4KXFB 4RD4A 2J5XA 2WVJA 4TLCA 5FI0B 2E87A 3T1VA 1NBMA 2YWGA 4L9WA 3LD9A 1IBRA 4BFWA 3VTKA 1XMJA 4QM6A 1XXHB 1SVWA 1G20E 1BMFD 3M1IA 1W48A 3CKLA 3PUXA 2GJSA 4WOPA 3W3ZB 2FEOA 3QEOA 1KNQA 2GJ8A 1P73A 3AVWA 2AK3A 3IHWA 4M53A 2ZROA 4Q01A 3T61A 3X1YA 1T8UA 5HCIA 4A2PA 5JWRA 1YR7A 4TN1A 1W47A 3W6OA 5L3QA 4I1UA 3D7MA 4EAQA 3RRYA 2WWYA 2BOVA 4QBGB 1G16A 1C1YA 4Q00A 2CNWD 1OKKA 4QOSA 5AUQA 1W7AA 2ZSAA 1NG1A 1XU4A 2ANCA 4EQ6A 1SXJB 3IBYA 4TMXA 4QC2A 3FDIA 3B60A 4DCVA 2PJRA 4CGZA 1PVOA 1MRSA 2ZU0C 1DG3A 2D74A 1OJLA 4IDQA 1II8A 2KWIA 3U3RA 3K0AB 2H1LA 4U5XA 4O2RA 1GVNB 1P2SA 2ATVA 2FPKA 3IO3A 3KDSE 1KDTA 1E79A 3KKPA 4RFSB 1HE8B 4TSFA 4RD2A 4TWZA 2OHFA 5BYJA 2OESA 1EFRD 4NYJQ 1NN0A 3GEIA 1DAIA 5AJVB 3IIJA 3AVXA 2F1JA 2OAP1 1I4DD 1OV4A 1KAGA 3LBHA 3HR7A 3AVTA 1T3SA 3MGCA 3BAFA 3ZD6A 1F6BA 4EPYA 1KDPA 3AB3A 3TUJC 2VHJA 2YJTD 3B2EA 3KXIA 2GBLA 2BJWA 4PO8A 1RJ9A 4A6XA 3FPAA 2AK2A 3VFDA 1Z6GA 4HB2A 1HY3A 2GWHA 3PEYA 3ZD7A 4Q4AA 5K8TA 3DEFA 4LJYA 4LZZA 1GNRA 4WAUA 2YNMA 3ICQB 5DE3A 3BJIC 3CNNA 4WZBE 2HCJB 1E9BA 2F7SA 3TRFA 4PPNA 4PHFA 2ERXA 4UNSA 5DO9A 4EPXA 3BGWA 5C1BA 2W0SA 5KDDA 2JAQA 3T34A 5FOSA 3VR6A 1ZIPA 4HLUC 1DAKA 1YZKA 3C4JA 1N25A 3MD0A 3QKRA 3FMPB 3AP3A 3WXMA 3NXSA 4WXRA 4DVGA 4LBVA 1NLYA 4GSYA 4QJ5A 2LKCA 3U7HB 1W2GA 1T9HA 2GNOA 3KJEA 3OEEA 3QVUA 4G3XA 4RFVA 2X2EA 4OI1A 2QRZA 3NDPA 4OJKA 2H7VA 1G7RA 1X6VA 1I4LD 4M9QA 2A3RA 4JBXA 2IXGA 4P0TA 3TLXA 2WJJA 2J0UA 2RKOA 2ZJ8A 4NU0A 2C2HA 3CRMA 1OFHA 1R0YA 1BKDR 3AQ4A 4ZCLA 1Q1BA 1HUQA 3ZQ6A 4CRWB 2CK3D 2ZITA 4DBLC 2C96A 3QKUA 1R0XA 4MGZR 1Q1EA 1NVVQ 4D80A 1E2GA 4TQ9A 2W6ID 1DG1G 3RHFA 2J7PA 2I1QA 3KTAB 4EFLA 3B9QA 1IN4A 4V0MA 4PSAA 1YR9A 4RZ3A 2GZDA 2FFHA 1QBKC 2QT0A 4NE2A 5EZ5A 4FWTA 3AKYA 4R71A 4D4JA 1WA5A 1HV8A 3A8TA 3LRPA 2JDIA 1FMLA 3VX3A 4S35A 4QGFA 4Q4JA 4O2LA 4AD8A 3I61A 1WP9A 3QOFA 4K81B 3A58B 4RKFA 4DHEA 2FA9A 1NMZA 3BBPA 2ZYVX 2H16A 2FE4A 2HDNB 2JJ2A 3H86A 4W5JA 3K0CA 2CCKA 3VKWA 4GP7A 1ZNXA 4MITA 2YC2C 3KKNA 1CKEA 1VIYA 2RHDA 3WBKA 1P60A 3N2IA 2BVNA 2XOKD 4HZIA 2OAQ1 4OYHA 5FTMA 4BFUA 3BS4A 1JR3E 4PQFA 4KITB 2CXXA 5SZIA 3LQRA 5DI3B 2OO7A 1EWRA 1QHHB 5G53C 2EFGA 3GLIB 1Z0JA 4TL8A 4Q1AA 2WMNB 1A2BA 2WBLC 3HYTA 4IVPA 2F1RA 4CF7A 3NHAA 3AVYA 4HAVA 2QL6A 3KJHA 4MRVA 4Q9KA 1TQ6A 1TQ2A 5KSYA 3AKEA 3Q7PA 4MRRA 2CVHA 4HZUB 1ZMXA 1TU3A 4JKYA 1XXHA 221PA 2EWWA 2MSEB 4NCIA 3FKSA 3KQHA 3OFND 2CVFA 4JLOA 1Z6XA 2ZS7A 1IAQA 3CPJB 2ODEA 5A0FA 2ODWA 2DWQA 1VG8A 3BFKA 2G88A 3MWKA 3AVPA 3PXGA 3GLGB 3C15C 5J4KA 1MH1A 1N5KA 4Y0AA 1U0LA 3IUYA 3LFUA 4Y0VA 2V7QA 4KVGA 1E2JA 3C14C 3Q9LA 1JXMA 4QHYA 4EPWA 3I62A 4K46A 4GOXA 5ANRB 4AG6A 3K9NA 1T91A 5AUPB 2WWFA 1SXJA 2OCBA 3M4YA 1A5TA 3WRYC 2C78A 3GLHB 3RWMB 1ZC3A 4OK3A 3SQXA 3KFXA 4FMDB 4G5GA 1S9HA 1OFTA 2JLXA 2DFKB 3RS7A 1UBEA 2TMKA 1G4AE 3EIQA 4HAWA 3LV8A 3W3AA 4D81A 2ZETA 3W34A 4Q9HA 4EPRA 3R8FA 3IPYA 4C2UA 4OK6A 1I2DA 5F2EA 2RGGA 1Z6AA 3TKLA 2OBNA 3NTUA 4F92B 1GRNA 2ZRCA 4RFSA 1ZM3A 2V1XA 1NMYA 3ND8A 4P4UA 2J41A 4GMDA 5E4FA 3QXSA 3FOZA 2G0TA 2Z0MA 3KX2A 1DE0A 2BBWA 4MYCA 3MFYA 2GEVA 3HR8A 4D0LB 2FV8A 1Z8FA 2AXNA 2IYZA 3HWSA 3RLFA 3C8UA 2IHBA 2B21A 3VQTA 1Z2AA 4O3MA 3CRQA 5J40A 1PZNA 4M1YA 1CF4A 4B74A 4F91B 1S2MA 3VHXA 4W5HA 4Q9LA 5GJCA 3EA0A 3KXLA 1V43A 2VIIA 2NQ2C 2FWRA 1R6BX 5BQ5A 5L3SB 4KFSA 4LHZA 4RSGA 1OH8A 2IEZA 4QM7A 1E2HA 1RW4A 3UWKA 1T5IA 3GJXC 5JRZA 4DCNA 5JEEA 1VTKA 3BB1A 1ZUHA 1ZIOA 2V8OA 3GEEA 3K70D 2GEUA 4M1MA 2W6JA 2VYFA 1ZUIA 1RE0A 1TPZA 1E96A 3Q5DA 5F3WB 3PUYA 2R6FA 2ZEJA 2ZSBA 1RRCA 1MRNA 2FSGA 1H8HD 2Q6TA 5CK4A 4DSNA 1CJKC 3U60B 2ZPTX 1M1YE 1SULA 2V6JA 5EE0A 1ODFA 2IYVA 1JALA 4TL9A 2IUSA 1TADA 4BWYA 4Q1BA 2VH5R 1VG9B 3BORA 1XD8A 2JGNA 4RD0A 5K8LA 2B7CA 4MGKR 4DXAA 2JLQA 3RS0A 3UMFA 4A2WA 4PC6A 1Q57A 1P3JA 2PL3A 4Q4HB 1KO5A 4IJMA 4EJSB 3SYNA 2FGJA 3L0IB 4B71A 4D4MA 4HDOB 2YYZA 1KI3A 3L8ZA 3CX8A 4PZZA 2UZIR 2HYIC 3K09C 3K53A 1KTVA 1XMVA 1US8B 1VMAA 3IIMA 4NPHA 2VHTA 3MJRA 4GOKA 5AUNB 3KTAA 1KJWA 3AF0A 3I4LA 3RABA 1OSNA 3QEJA 4P31A 3ZDQA 2UZ3A 3R9WA 2QAGB 3B1VA 2DPXA 1R5BA 3SBEA 1BOFA 3QF7A 3W5JA 3VKGA 2P5SA 2QI9C 4Z54A 4BGDA 3BH0A 4M1SA 5EZ6B 4IRUB 5CLLA 2ZANA 3TAUA 2YKGA 4OHVA 5KSPA 1LY1A 4DEYA 2FFBA 1EG7A 1XZPA 5EXXA 1ZM2A 1P5ZB 4KODA 1W1WA 2J0VA 4NYMR 3UG7A 5F98A 4L9SA 5FTLA 5TARA 2KI5A 1JNYA 1G21E 3K0FB 4FMBB 2J59A 3J81k 3VR1A 3THYA 4UNPA 1TUEA 3FE2A 2FH5B 3BH6A 1W36C 1RFLA 2WM9B 3DOFA 1BH2A 1M8PA 2WJGA 3QXJA 1Z6TA 3EWAA 4R2IA 1G8HA 4RVCA 5FBQB 3O8RA 5DI3A 4MGYR 3TW8B 2ZSDA 3GJ0A 421PA 2W2VA 4ASUD 1FP7A 1QHHA 4XH9B 2ZI4A 4B6FA 4AIIA 4ZIRB 3GLIA 4LHWA 1HYQA 4M8NE 4MUBA 2VP0A 3AUXA 2ZR0A 3CNLA 3C5CA 4NYIQ 1OFIA 5KSZA 3TBKA 4GZLA 1IN5A 4FD2A 2VPPA 1G3RA 621PA 4M2LA 1W44A 1H65A 3D3QA 4X8HA 4HATA 4A0FA 1GTVA 5JHGB 1XJCA 6Q21A 4KYUA 3UPUA 1X3SA 5B30A 1KAOA 4I1VA 2PEYA 3C16C 3TQFA 1XEWY 2D62A 2IXEA 3LQQA 4TQUS 5J5CA 2R9VA 2RB4A 2VL7A 4P33A 4URWR 1HTWA 1JJ7A 3TSZA 2OBMA 1V5WA 3B1ZA 3NBXX 4D6PA 2OILA 2OUKA 1UBFA 3GLGA 1G3QA 3MAAC 1Z28A 4ACBA 1XMSA 3AVOA 4LYAA 4AKIA 1ZP6A 3DM5A 1YR6A 5BYKA 4FMDF 3PEUA 1NRJB 4G01B 2QM7A 1A1VA 4B2IA 1VDZA 1Z2CA 2HCBA 1FUKA 1Z5ZA 5J4LA 2WPDA 1YRAA 2WWHA 3GLHA 1NJGA 1NIPA 3CRW1 5EE3A 4NP6A 4P4SB 2GZAA 3X1DA 2D7CA 3KQKA 2BIFA 1Z6YA 5F9HA 1CJTC 3NC1C 1KSGA 3UG6A 2RMKA 5AJZA 5DN6D 1G41A 3A37A 3R9IA 4R9UC 4BFSA 1M6NA 4F93B 3MMPA 3R9XA 4TLAA 1IN6A 4C0QC 4XD7A 2WTUA 4LDJA 1AS3A 2VO1A 5D3QA 3KB1A 2GVDC 4XWOA 2HJGA 3REFA 2QPTA 4I4LA 4BLQA 4A15A 3TVTA 1FPMA 1RIFA 4GOJA 4DLWA 2IHYA 4F38A 5J47A 3ZQJA 3NKVA 4DLRA 1IJEA 4C4PA 3CBQA 2CDNA 3PR1A 4Z8YA 3TVDA 1UBGA 4PHHA 3ZVRA 4KBGA 1KJYA 2N1BA 3CONA 1EESA 1U90A 1GL7A 1G291 2W58A 5JS7A 2AKAB 4YC7A 4RCYA 5KOYA 2QPOA 4Q66C 4L16A 1GNPA 2QSYA 4LC0A 2B7BA 2IWHA 2Z6VA 1NLFA 1YKSA 2K5UA 3K9GA 4JSYA 1NVWQ 4B2LA 2QGZA 3ADCA 2PCLA 1M74A 3ADDA 2ZRJA 4YXWD 3CH5A 4BFVA 2J87A 1P7CA 3ZIAD 1G5RA 2WHXA 5JI3E 4GNKA 3FWYA 3RSLA 4L4UA 3AP1A 3TW4A 1QVAA 1CBUA 1Z0FA 4JT4A 2O8FB 5E7MA 1IN8A 1E1QA 4KFTA 3B8HA 3HPRA 1ZM7A 4IOJA 3SEAA 1QHSA 1QHNA 3EZ7A 4TZ0A 3KKQA 4GL2A 4BLPA 4Q4HA 1ZRHA 5TV2A 3ADKA 4JBWA 5FPYA 4EJSA 4U02A 1FQJA 2CL7X 5FUXA 1PUIA 4IOKA 4PC3A 2AN9A 2X19A 2OCYC 3Q8XB 5GJWC 2DFNA 4BEJA 5GVSA 2BEJA 3EC2A 4W7SA 2J46A 1US8A 3EC1A 2QMHA 4B35A 2Q0HA 2AWOA 1QF9A 2PCJA 5TY0A 1IN7A 1X1RA 2ZJ2A 2O5VA 5C2JB 2VSFA 2QAGA 3PEWA 3K0CC 2Q21A 4C0BA 3U6BA 1YHNA 4QHTA 4NMMA 2QBYB 2I1VB 2IEYA 2X1VA 2FMXA 3TUIC 2FG5A 3FYHA 3OIWA 4LCBA 4OHXA 2IYUA 2ZYTX 1F2UB 1E94E 4B3DA 4AG5A 1G19A 4HUQB 1ZAKA 4YMVA 5LBIA 1NL3A 1KI4A 2EFDB 3OAAA 4A8JB 5HR5A 1GDDA 2KJQA 1CTQA 5F9FA 1WF3A 3KKMA 1WE2A 2ZYWX 4EPVA 1LF5A 3K0FA 2CLDX 2NPIA 5FI1B 2ONKA 4AKGA 2REBA 1FUUA 5JJLA 2ZRPA 1AM4D 3DL0A 4NYJR 1DAHA 1OT3A 1KI9A 2QN6A 5HPYB 3CLVA 5DSZA 4OL0A 2G83A 2Z83A 4ZIRA 2A2ZA 3PUZA 1FX0A 3B85A 1LW7A 1HEIA 1KSHA 2XSZD 4ESVA 4BFYA 2QPAA 3B13B 2WZQA 1ZM4A 3TR0A 2ONJA 5AK0A 2ZJOA 2JCSA 2C03A 1KOFA 3KJGA 5AJYA 3CH4B 2WV9A 2IUUA 4CIDA 2GCPA 3P26A 1ZU5A 4LSGA 5K8IA 1KYIA 1W4RA 3Q3JB 1ANKA 1GKIA 2QTFA 1VCIA 1UDWA 3I8SA 4FWIB 4LPKA 4QFMA 4ZPXA 5EE9A 4XOIA 4BLOA 2XXAB 3MSXA 2OCAA 4TT3D 1D2MA 1FP6A 5J4VA 1AK2A 1SXJC 2WWGA 5AJWA 5K8UA 1FTNA 2R65A 2REOA 2WJYA 1EX6A 4Q02A 1U99A 4LJ7A 1KMQA 2EVWX 8OHMA 2G1JA 1FNMA 1TTTA 4R2HA 1MABB 4JS0A 3AF3A 4BZPA 3JVVA 1WQ1R 2YVUA 4DIDA 3TNFA 4PQRA 5AUOB 4DUGA 4PHGA 5FTKA 4ZDWA 2I4IA 4TYNA 1Z07A 3UMRA 4BRWA 1YZUA 2ZJYA 4QGHA 4TMTA 3E2IA 1NVXQ 4P4SA 4XWKA 3BOSA 3OE7D 2PH1A 3T15A 1G8FA 1LNZA 1P6XA 2W2XA 1Z08A 2VHQA 5DI9A 1XTIA 5HCNA 2VF7A 4MKIA 3R8CA 1KZGB 3WNBA 2IWRA 3I1FA 2G0NA 4I1SA 4UXJA 4GDFA 3PV0A 1DAEA 1E6CA 2DWPA 2XNSA 3PFIA 1X8LA 4JLJA 4MQBA 5LB2A 3EIEA 2WICA 3OIVA 3Q5EA 4UNQA 4XSHA 3W5IA 1Y3AA 3PUWA 2B92A 3A6PC 4Q1FA 3WP1B 3GLFB 2BDTA 3ZZUA 1B0UA 4BFZA 4KLZA 4M22A 1E9AA 2WIBA 2ZE8A 1NLZA 3THXB 4L15A 1OXTA 4NBSA 1S1CA 1FW6A 1GFIA 3QI2A 4OHWA 5LB4A 5CITA 2YWEA 4MKFA 1XFAA 1GRRA 3DOEA 3JZMA 4A9AA 3TMKA 1W0KD 1X8JA 4M1OA 4Q7LA 1GZSA 821PA 4TYQA 4LPSA 1R2QA 5GJBA 1E98A 1VPLA 2NO7A 2ZE5A 2GKSA 1E69A 1OHHA 4JJZA 5AJXA 4Z1MD 2FN4A 2PJZA 3SN6A 2A5YB 1XB2A 2EYQA 1DARA 1KI2A 3KKOA 3B82A 2O8DB 1XTRA 2CJWB 3ZIAA 1TEXA 1Q21A 1XEWX 1COWA 1XP8A 5FUYA 3EPJA 2IYQA 2C95A 1CJUC 1W5TA 3T12A 5C46F 2OCPA 2O8FA 1OB5A 2NG1A 2P0EA 5BN5A 1E0SA 3SJBA 3T1QA 1N0UA 1HE1C 3N70A 4ILEA 2PMDA 5J4YA 1J99A 3CZPA 3P4XA 3E5HA 2F6RA 5FBVB 4Q7MB 3AVVA 3RDPA 3EZ2A 3NC0C 3BB3A 5HKKA 2Z5FA 5LD2B 3SQWA 3GJ5A 1H8ED 4KU4A 5H1YA 2R6AA 3FGNA 3BXZA 1G8PA 4HYYA 4NH0A 2FZ4A 3FKQA 1XJ0A 2XTZA 5IK2D 1YJ5A 1Z0IA 4JMPA 2BMEA 4M9XA 5FPKA 3HYRA 2ZUCA 2IUTA 2OXCA 4B3GA 4A6PA 3CWZA 2QG6A 3QKSB 1LS1A 4TLDA 1S8FA 5KPDA 1D6JA 2GRJA 1FQKA 4HDCA 5EQTA 1DOAA 5JSZB 1P2TA 4XVUA 2QBYA 1NIJA 3ASYA 2WKPA 1G17A 1P62B 5G3ZA 1Q3HA 2G9NA 2WKQA 4FW9A 3V4RA 2P6UA 4HUQA 4TYWA 1QHYA 2SHKA 4EPTA 4LJ4A 4L5BA 3U44B 2KE5A 2JJ1D 4QXAA 4OJQA 2BM1A 2HLDA 2XGJA 2H8KA 1JJVA 3G82C 2JLZA 1T3HA 1K5GA 1SKYE 3MWLA 3AF2A 1DAMA 4OHYA 3CNOA 5C4GB 4P32A 4WZAE 4B2PA 3CB4A 2C77A 4F4IA 1GL6A 4P4TA 1MV5A 2HYDA 5FPSA 4B47A 4Q4LA 3RAPR 4Q1CA 2R6CA 3HU1A 3KL4A 1AA9A 1KGDA 4LBYA 2QMOA 2VHUA 2OFOA 1ESNA 1FFHA 3HJNA 4II7A 3PIRA 2VSOA 4B73A 1O3YA 3VKHA 2PT7A 2XNDD 4DLUA 4TZ6A 3DPUA 2EFCB 4WBSA 3K1JA 1AKYA 4JVSB 1JB1A 3T5DA 1AJEA 1P9NA 2BMJA 2OV2A 3QIAA 1TQDA 2WIAA 5CK5A 4DLSA 2IS6A 2EFEB 2XXAA 1N6KA 5FUVA 2LCFA 1IONA 1GKUB 2ZIAA 4X8LA 2N46A 5IHPA 2WWIA 1NKSA 1W0JA 2GK6A 5KYKA 1LV7A 4M21A 1CRQA 3ZH9B 3KZ1E 4CT4B 1NY5A 3QNUA 5DYGA 1MABA 2WOJA 5EXTA 2ZTSA 4V0KA 2CHGA 3CZQA 1CR2A 3EXAA 1XCGB 3KXKA 5DNYB 2BWJA 3TSOA 4BE7B 1R8QA 2ZI9A 3CW2A 3RC3A 3QBVA 1EFHA 1L7VC 2A9KA 1BIFA 2IYSA 4C0JA 2DBYA 1ZYUA 4DDTA 4RZ2A 3OEHD 1ZVQA 4QNMA 5AR1A 3O8BA 4NHOA 3A4LA 3K0SA 1IXSB 1E2PA 4RJLA 3WYAA 3UXMA 4RD3A 3PENA 2WSSD 3UATA 2OE2A 2QP9X 3DO6A 4BRUA 2IYXA 1BYIA 5B57C 2ANBA 1TAGA 3SU8A 1BMFA 1RRGA 3IQWA 2ZS9A 4C3ZA 4BLTA 2W0MA 2AFHE 3B9PA 1T4GA 5JWOA 3RNLA 3T1OA 3GJ4A 1HT2E 2PT5A 4HDQB 2IF0A 3GLFA 2Q3HA 2RGCA 3DZDA 3WNCA 4A36A 4FINA 4A2QA 3BFXA 4KCGA 2CNWA 4KFRA 1XDBA 2B6HA 3THXA 1PV4A 2OXRA 5EP4A 2FEMA 4BFTA 5G40A 4E03A 2WKRA 5EP2A 4J0QA 2FF7A 2J3EA 2NPFA 3U3KA 3K0AA 3RRZA 4MRPA 1NJFA 4PFSA 4X8OA 2EU8A 2NO1A 2Q9AA 2PZGA 2MMGA 1NVUQ 1R10A 1LFDB 1JAIA 2GCOB 3DM9B 1SVOA 2A78A 4HAZA 2XZOA 3LVQE 4KVAA 2KBFA 3EPKA 3RRNA 3CR7A 1KO8A 5DHFA 1XPRA 3KFVA 1TQ4A 3U6KA 4YMSA 2O8DA 4JSTA 2CJWA 1ZNYA 2Q3FA 1EFRA 1A82A 4EJSC 1GL9B 3VMFA 1GOTA 2F1IA 2QP4A 3GCGA 2CE2X 2X2FA 1ZNWA 4NYIR 3EA5A 1G1MA 2RGNA 2QY9A 3RSOA 4N1AA 4PAOA 2MSDB 2QTHA 4DRZA 3LNCA 4QBHA 2XJ9A 3TE6A 1T6NA 5B58C 4FMCB 1W49A 1XTQA 3D8BA 4TMVA 4KAXA 1KK1A 2QAGC 3EWSA 3X2SA 3CX6A 2CL6X 1TF5A 4PX9A 5FL7D 4YQFA 3IHLA 1KDOA 1SVMA 4IVQA 1KY2A 3TAHA 5CDFE 4UXIA 4ZO4A 1CULC 3NWJA 3NH6A 4GI7A 4Q18A 3K70B 2VP2A 1WBBA 1JR3D 3QKSA 2VA8A 3BH7A 1DO2A 2J45A 4KYIB 4B32A 2OG2A 2VQSA 1NF3A 5SZJA 1OH7A 5JSZA 1CJVC 4WVFA 2AKYA 2H5EA 4PC7A 1VYUA 1ZM9A 1P61B 1U8ZA 4CEJB 4UNNA 3OF5A 5E7JA 5TB5A 5FH9A 1Z3IX 1JECA 5E3HA 4JLKA 1OXSC 1PLKA 4R7ZA 3U44A 4UJ3A 2ZRDA 2C9OA 3HU3A 1YR8A 4LYFA 4A0HA 4UNRA 3RS3A 1KSFX 3I92A 4LI0A 2QTVB 4PTLA 2WJHA 3VNUA 4HI0E 1E2FA 4JBYA 2CK3A 3MWJA 2GXQA 1MR3F 3KJIA 2XTMA 3AVQA 2O0HA 2H92A 4GT1A 4IW3B 2CE7A 4C7OB 1EWQA 3GJ8A 4NCNA 1NBME 5KNBA 4C0AC 2W6IA 1L4UA 1BS1A 4DC9A 4URZR 1ZCAA 1TX4B 1RVDA 4V0OA 1JEEA 3GQBA 2EYUA 1Q44A 1GRQA 1FTSA 2V55B 4N3NA 4KSBA 2P2LA 3SE0A 2D06A 1GKYA 1PJRA 2V3CC 2IXFA 3PCRB 3NH9A 3TIFA 3TJZA 2JIZD 2YZ2A 4DSUA 4JYBA 4HAUA 4E5UA 2GCNA 2FJUA 1RC8A 1KK0A 2RGEA 1ZD8A 5JFGA 2QP3A 2DHRA 2ZRFA 2CCGA 3SNHA 3UANA 3LBNA 1F60A 4B43A 1KO1A 2YV5A 3QF4B 4I81A 3DMDA 2XOKA 4KV9A 1ZW6A 4MKHA 1ZCBA 1OPXA 2AX4A 3U4QB 1JPJA 3MRSA 2OFWA 4YDHB 4B75A 4BZXA 1E1RD 1F3OA 1HH4A 2YWFA 4LYJA 5CJ2A 3Q85A 4IEEA 3WMFA 4Q47A 1EGAA 2N42A 1II9A 3QE0A 4OHZA 2AD1A 1G3MA 1QVRA 3SFVA 2ERYA 4BFXA 4HB0A 1M34E 4HZUA 2RH5A 2HV8A 3IO5A 4JYCA 1G8GA 5DHAA 4DDVA 3FMFA 1Q0UA 3DMNA 4U7DA 2R6GA 4YONB 3OFNA 3ZVMA 4XJXA 2IS4A 4ACAA 1AKEA 3BWDD 4RCZA 2QROA 4MYUA 1KI7A 3VR2A 3VHLB 1VIAA 1Q3TA 3F0TA 3B1YA 2YHSA 4BASA 1PUJA 2ZI6A 4JLAA 5FOWA 2FX3A 1T0HB 3LLMA 3WRXC 4ZCMA 1P75A 1QHXA 2NIPA 2FFAA 4JVMA 2W83A 2XAUA 1XTKA 1VYVA 3ETLA 4ZV4A 4IEIA 4TTQA 4D2IA 3G5UA 1XEFA 2CHVA 1AQUA 3IPXA 1U2RA 1G7TA 1LTQA 3FHCB 3LW8A 1ZU4A 2KB0A 4N0DA 4KSCA 1DPFA 5L8VA 1N5IA 2GZHA 2HUPA 3G0HA 1IY1A 2GCOA 4LHXA 2BMDA 1G64A 1E9FA 1YZLA 3DHWC 4PAQA 2B8WA 2XX3A 1E2IA 1JAHA 1GWNA 1M7HA 1TNDA 4FN5A 2BCJQ 4QNRA 4V0NA 3W9YA 2E1RA 4ABYA 2ODNA 1U8AA 1DBSA 1ELOA 3PVSA 1Z0KA 2C9YA 3IIKA 2BHRA 3X1XA 1W36D 5A4JA 2NO6A 4GP6A 4V03A 1NBMD 2X77A 4UKDA 2RGAA 2ZRKA 1RRPA 2FSIA 4LBWA 4D0GA 3AVUA 1ZINA 3D6TB 5CM9C 4M1TA 3U7GA 4FMCF 3F3YA 4JLMA 3M6AA 1Z0DA 5B64A 1R8SA 4DEXA 3C5HA 1Z63A 1KO7A 1AS2A 2PEZA 1HT1E 4CEIB 4BQSA 3L0OA 4PZLA 3V00A 2KSQA 2V54A 3SDZA 2QMUA 5FPHA 2HT6A 5L3SA 1HQYE 1NMXA 3H1TA 4V0ME 5IRCD 4D0NA 1EXMA 1YRBA 4WW0A 5EXSA 3NBZC 2ZE7A 1GITA 1Z47A 1KKMA 1IM2A 3U3MA 1E0KA 1JBKA 2ZRAA 1N0VC 1OKKD 3I73A 2L0XA 3MWYW 3O47A 4C0LA 4U00A 1TMKA 2GHIA 4LJ6A 4IXMA 1E9CA 4A0GA 1UF9A 5CIWA 1FOEB 4V0LA 3AF4A 2ZRLA 1DEKA 2ZVQX 4TL6A 1H8HA 3V9PA 4B6EA 4DZZA 1W4BA 2RHMA 1E0JA 4AKEA 5DYIA 2CCJA 3NHBA 4CEJA 1YZGA 4HLDA 2WWXA 3QPVA 1G3IA 1QHGA 2QAJA 1E79D 1WDTA 3AH8A 5JMTA 2UKDA 2PZEA 4TSFD 3SYKA 1X1SA 2ZM5A 5EE1A 1BO6A 2REXB 1UEJA 4WXPA 3RS5A 2HEIA 4PSKA 2XZPA 3FMIA 5HZHA 1SVSA 5JEDA 3A4NA 5TXGA 2ZS8A 5A5GA 1UJ2A 1Q1ZA 3NG1A 4C7OA 4JKIA 2O52A 3FTQA 4HAXA 4MYTA 4A0RA 4MH0R 4ZDJA 3H84A 3GFTA 1IXRC 2D4HA 4YDSA 3KB2A 3WHLA 4B48A 2IX3A 5HE8A 1R5NA 1MOZA 4PSVA 1AGPA 3I5YA 4TMZA 1XXHE 2FNAA 3WYFA 1U81A 1W5SA 3AP2A 2A5DA 4DWJA 2XEXA 4KLNA 1XMIA 4M1KA 5C4MA 4R98A 4L8GA 1DADA 2AWNA 4N0EA 1NSFA 4NCJA 3I5XA 1UM8A 2NGRA 1IQPA 4AYTA 1G6OA 1OLOA 2IBMA 5FBRB 4YLGA 1JQLB 3P32A 4D4KA 1ZD9A 4DLTA 2GETA 3KQNA 1TL7C 5CJPA 4IDHA 1E32A 3VR5A 1DAGA 3IKJA 4NCHA 4KBFA 2AL7A 3LWNA 1L2TA 2ZJ5A 2QRNA 1KK2A 1SXJE 3QF4A 3W90A 4NL4H 3K9HA 3OEED 3T35A 3U4QA 1N2CE 5JHHB 3CPHA 4URYR 3WYGA 2VLIA 5EP1A 4DSOA 1E99A 2GEDA 3LXRA 2ORVA 4YMTA 1KIMA 1IY2A 2QNRA 2GK7A 4ASUA 3ASZA 5H68A 1IY0A 4B76A 4CT5A 4LJAA 2RGDA 1KI6B 1Q20A 3OIUA 2JASA 4Q03A 5EUQB 4HAYA 4OBEA 3DDCA 1NNEA 1F48A 1UEIA 1Z06A 2NO9A 2ZQ5A 1N6OA 4RD6A 2ORIA 3B5JA 1G5TA 1M2OB 3UMSA 2FOLA 2J7PD 2NO0A 1I4TD 1VKJA 1P2UA 4TQAA 2JLUA 4Q7JB 4B3FX 5TVKA 3EASA 2ZRBA 4S2EA 3AF1A 3K9LA 1J7KA 1XEXB 1VG1A 5CLQA 5GJVC 3W8RA 3THWB 2JDID 1OYWA 121PA 1XRJA 3CF0A 2ODBA 521PA 4ZI3A 4DB4A 4GMXA 4KO8A 1E9RA 1SHZA 2J0QA 4DCUA 2ZAOA 5LDDC 2BBOA 1GIAA 4LX0A 3CM0A 1FL9A 3DVLA 1E4VA 1U8YA 2A5JA 3TK1A 1OH6A 1AGRA 3PITA 1G3UA 2OM2A 4ZI2A 5HZKA 1OYYA 4QJ4A 3SR0A 3WNDA 4POAA 3R7WB 4MUAA 4RZXA 3RYTC 2RGNC 4K8OA 5DN6A 4DT1B 1NVVR 4M4SA 5E95A 4G0NA 4JT2A 1E9EA 3TQCA 1SKQA 4Z51A 4ZDIA 3JVUA 4AC9A 1U94A 1UKZA 1MO6A 3WP0A 3LO5A 3H0KA 1M7GA 1XPUA 1R0WA 5LD2C 3U7FB 5G3YA 4A82A 3VU9B 5EXPA 3TGPA 1F2TB 3U5ZB 4NTZA 3EPLA 3FFBA 3FKSD 4ITRC 1SVLA 2CMKA 1JQJC 3BC1A 4CEIA 3KQUA 2ZRIA 1KDRA 4HEJA 3QENA 5TMPA 3CUEF 1XD9A 2JA1A 2H17A 5IDVA 1PLJA 3EAQA 2A7QA 1YU9A 3T1TA 1KMHB 1E4YA 1OE0A 3E1SA 1W2HA 4DKXA 3VAAA 2B8TA 2V7QD 1CR1A 5CYPA 5HE9A 5JECA 1GNQA 2RGXA 3DKVA 2GF9A 3S1AB 4JL6A 4LBZA 2OEPA 1KKLA 3AKDA 2PLRA 1R5OA 4IDOA 3QKTA 1SXJD 1VCMA 4YXWA 4XSGA 5TDHA 2VRWA 4D26A 2QSZA 4BEBA 3EPHA 3E70C 2AHOA 2QMEA 4UQOA 1VHLA 2DYKA 1DO0A 2VP9A 4WZ6A 1RRFA 3U3OA 2ZRGA 1SGWA 4E09A 5BXQC 4TMKA 4IFBA 1DTSA 3IILA 2WWWA 4QBIA 4DSTA 2NMVA 2FU5C 4PR0A 2LKDA 1JEDA 3Q7QA 1XNJA 3T5GA 1S0UA 3FVQA 3I72A 1A7JA 3FHOA 1WXQA 5FBLB 2J1LA 4PPGA 3GLIE 1PLLA 1N6LA 4CEHB 3U7EB 3B7GA 5LPNA 4ON9A 4KHZA 2CLSA 2ZSFA 1C4OA 5L3VA 5GADl 3QXXA 3ZZTA 4IOMA 2FGKA 1ESMA 2RAPA 1NN3A 3UKDA 1CS4C 3QQ5A 3QXCA 4TLEA 3TH5A 2E9SA 1U0HC 2FSFA 2ZR7A 3HP1A 3LXXA 1OIVA 4JVNA 2PX3A 3ZZ0A 5J4HA 2ZE6A 2IW3A 5FL3A 3FHTA 3CRVA 3SHWA 4DDWA 1CXZA 3VR4A 4FIDA 4M1WA 1EFCA 3I8XA 1W46A 3PEVA 2VF8A 4QHSA 3A1TA 4C0HA 1CR0A 4Q1EA 3MCAA 3GPLA 1F2UA 1QRAA 4Q7KA 3GLGE 4H1VA 3CF6R 1MT0A 2BEKA 2W6JD 3BE4A 5G41A 4A8JA 4LHVA 4AWXA 4D25A 2ZRNA 3AM1A 1XD2B 1KI8A 4MKGA 1TU4A 3EG5A 1SHKA 4FCWA 1OIWA 2ZI5A 1HA3A 2OLJA 3FFAA 3QVVA 3LX8A 3U3JA 4V02A 2F1HA 3GLHE 1EK0A 4IKEA 1MO3A 3GFPA 3HU2A 4URUR 2GJ9A 2XZLA 1OW3B 3SYLA 1OIXA 4PO9A 2PBRA 1B23P 1GAJA 1N6NA 1SQ5A 2H18A 4NCKA 5H70A 2C99A 1Z29A 2NTYC 2XSZA 1KI6A 2P67A 3GD7A 4XWAA 4RD1A 4JZKA 2EQBA 3BERA 3QG1A 3HDTA 1AZSC 4XTCS 3W6PA 2GJAA 4QRHA 3UIEA 4UJ5A 4UXHA 5FFMA 1VCOA 2Z43A 1KNXA 4FI3C 2OBLA 3BFVA 2O8EB 4DJTA 2BKEA 2HF8A 1D2NA 2Q3MA 4US1R 3NEJA 2XB2A 1RKBA 5EP3A 4TT3A 3UK6A 1J2JA 4LC1A 1CIPA 2GF0A 1XEXA 3KUCA 3N2EA 3EZFA 1WBDA 4LUCA 4AK9A 3THWA 4IHQA 2P5TB 4EFNA 4LGMA 3AGPA 2HXSA 2ZRHA 3WY9A 5JBQA 3LDAA 1E2DA 2GXAA 2C5LA 4E07A 2HF9A 3B1WA 2ATXA 3BK7A 1E2NA 2QGNA 3EZ6A 4LWZA 4YMWA 4PPQA 3PJRA 2WAYA 4AY2A 2AR7A 2A5GA 1U0JA 2ZU6A 4Q5IA 2PMKA 3PQCA 4US0R 1ZC4A 3CPEA 1KZ7B 4TTPA 2BC9A 1ETUA 1FMJA 1XJQA 2QU8A 2VP5A 4RKEA 3ZGXA 1QG2A 4H9GA 4AYWA 2JLYA 4CVNA 3QSYA 3THYB 2IS1A 1NG9A 3O8CA 1J70A 2AXPA 2I3BA 3IQXA 3OE7A 4MGIR 2EW1A 3R7WA 3A1VA 1SVIA 2IYTA 1LF0A 1WMSA 1GSIA 2C8VA 2UVQA 3H2YA 5EE5B 4TTRA 5JI2E 4TYYA 3QBTA 4GPTA 2P6RA 4HLCA 4DT1A 1JR6A 4CDGA 5DGXA 1P72A 2ZUDA 1E9SA 3LY5A 2XB4A 2ORWA 2ZXUA 2F9LA 4ESHA 1UKYA 2EWVA 3U61B 2J0SA 2G6BA 1XPOA 1XTJA 1ZD1A 1G7CA 3THOA 3A1SA 2O8BB 4WIAA 1G6HA 3B78A 5FOVA 1G4UR 5KDOA 3ICEA 3VU9A 2BCGY 2PZFA 3CF2A 4A1FA 4ZCIA 5KNDA 1F2TA 3EARA 1E9DA 4MDFA 1T0JB 1YE8A 1JXOA 3BIFA 3PUVA 4JLBA 4OQXA 3IBGA 2ZJBA 3CO5A 3F5FA 2GXSA 3K70C 2IA5A 1UKVY 5BN4A 4IVRA 1KO4A 1E2QA 3WBJA 4ARZB 3MJHA 5FTNA 1E2KA 1KMHA 1W0KA 4BLSA 3A1UA 1JPNA 1OXUA 2OFXA 2QQ0A 3SS8A 5L3RA 3ZYCA 3S1AA 3SJCA 2Q9CA 3GFOA 5CM8B 1W4CA 2IYWA 1XF9A 5GVRA 4Z1MA 4QJ3A 2ZRMA 1XTSA 2WPDD 3QXHA 5DH9A 2BBSA 1SKYB 721PA 1WB9A 2YOGA 1DS6A 2C9CA 2OT3B 3X1ZA 3TUZC 1RPZA 1NI3A 1F5NA 3L2OB 3DKPA 1G7SA 3F8TA 3BD9A 1R7RA 4QGAA 3KUDA 1LS6A 2AD5A 1FZQA 4TMWA 4ZKEA 4B33A 3HPQA 1HQCA 1IHUA 2O0KA 3QPUA 5IT5A 1U9IA 2ZI3A 3V4FA 3NIBA 2XJ4A 1KSJA 1CJMA 4XD7D 4Q1DA 2F3RA 1W4AA 4HB3A 2GXUA 2XTNA 2JLWA 1CEEA 4CEHA 3EX7C 2ZR9A 1S3SA 4DB2A 1T8TA 3SJAA 1H8EA 5P21A 3Q72A 4B3BA 3GJ3A 2BMFA 3W8NA 3OZXA 5IK2A 4DDUA 3EZ9A 1DVRA 1QDEA 4YMUA 1GILA 5FOUA 3NVAA 4PQYA 1UBCA 1E3MA 2C98A 4XIGS 1ZUNB 4KJZA 4G5QA 1RYFA 4A92A 2OLKA 4M0LA 4OKSA 1IOZA 2JATA 3AEZA 4C30A 1GUAA 2DR3A 1NKTA 5SZHB 2V6IA 3D31A 2JLRA 2P3SA 3ZJYA 1WRBA 4M9ZA 4JLDA 4PC1A 2GAAA 4LRWA 1I2MA 1XD2A 2RGBA 4MA4A 1XWIA 3SFZA 4H1UA 2FDCA 5DLQC 5KUTA 2WJIA 2JJ1A 5E7IA 3B6EA 4CYMA 4HLQB 4DCTA 1OH5A 3MLEA 1P2VA 4G1UC 1OFUX 3LLUA 4C0KA 1KHTA 3NDBB 4EUNA 3I32A 4LJ5A 3X1WA 1E1QD 3QJYA 1K6MA 1MO4A 2D7DA 1C9KA 2IT1A 1Q12A 2R62A 3LAWA 4LK2A 4OI0A 2QORA 1LB1B 4IDPA 4PHTA 2NZ8A 4FCTA 2IYLD 5ELXA 1G9XA 3QPWA 2DFTA 2IF2A 4B3XA 4Q21A 1E2MA 2QZ4A 4Q48A 4ERNA 4RY2A 1UPTA 4BPBA 4JLPA 2QQEA 5SZKB 2C04A 1CU1A 2R8RA 4DLYA 2WAXA 5BWMA 2F43B 2GVZC 1SZPA 4WA7A 3L0SA 3LVRE 3OESA 1D8TA 1N6PA 1Z0AA 2ZAMA 4B3CA 2XNDA 2QE7D 2R44A 4XTRA 3WMEA 1WCV1 2RCNA 1S3GA 1UADA 2V4ZA 4W5WA 2MMCA 1XX6A 5D3MB 2O8EA 3NBFA 2IK8A 4D4LA 1S9DA 3MUFA 2F9MA 1VCNA 2QENA 2G77B 3P27A 2F55A 1UFQA 1Z22A 1TF2A 2YOHA 4I1OA 2CBZA 3CIOA 1YQTA 5JWHA 2QEQA 1T5LA 3A36A 4MRNA 4OQLA 5FBWB 2O8CB 4HSEA 1X86B 1AQYA 2J9RA 1K8RA 2G3YA 4NKRA 5BW8A 4HLUA 5DIFA 3OAAD 2FSHA 3L8YA 4HUTA 4MRSA 5KU1A 2DB3A 4IXNA 2F3TA 4JLNA 2CLCX 5CB8A 5CYOA 4NDZA 1HURA 4TYPA 1NY6A 2A30A 1P4SA 3OEHA 4LYHA 1S4QA 2ASEA 1ZNZA 2QUZA 1X8KA 1K5DA 2ZREA 4P3YA 5CIQA 1CRPA 2FPLA 2IL1A 4JLVA 2WSSA 3W6NA 4BLRA 2ZJAA 1R0ZA 3A1WA 4I99A 3IEVA 1L4YA 2G1KA 1FX0B 2HXYA 1O87A 1XZQA 2HJVA 3DZ8A 3H4MA 4Q9IA 4EFMA 5B2ZA 4W9MC 5BN3A 1RYHA 2CEAA 1XCMA 1YZNA 4URVR 2O8BA 2YWHA 2GDJA 1BYUA 1VYTA 5UKDA 5FPTA 1DAFA 1KK3A 1OF1A 1A2KC 4AURA 3ZLJA 1ZBDA 5HTKA 5KTYA 2H57A 1D5CA 2YINC 1II0A 4NZYA 5AWFC 4C0SA 1QHIA 4ARZA 4LY6A 3C7KA 2BKUA 2DWOA 2Z4SA 1E0AA 2VSXA 1VG0B 4BZQA 4F4JA 4AKHA 2PX0A 5KHOC 5JCZA 1A4RA 4TL7A 3EIHA 1OXVA 1Q1QA 2OSBA 1DELA 2A5FA 5JJIA 5KNCA 5FUWA 4DUGD 4PPFA 3KQLA 1Z83A 3LX5A 4Q19A 5JZVA 2O0JA 2CHQA 2DFLA 4G5RA 4PO1A 3GMTA 1MKYA 5JS8A 4LOAA 2W00A 3P4YA 3JZAA 5C18A 1W36B 2JLVA 4EIWA 3MG9A 3C41J 4QKQA 2FFQA 1G5PA 4DLXA 5IF9A 4GFDA 2VBCA 2XITA 4OK5A 4PZYA 4LHYA 3VR3A 3I3SR 2JLSA 1VECA 1TUIA 3LA6A 2PLFA 4HB4A 4EDHA 2HT1A 1E2LA 2QM8A 2AFIE 4ZKDA 1EFTA 2GESA 2GTPA 4QBFA 2GBLC 4OQFA 4XVQA 4JIMA 1J8MF 1N3BA 3TR5A 3L43A 2V9PA 4C9BA 1YZTA 2ZSEA 2FZLA 5FL7A 1SVKA 5L3QB 2R2AA 2IYYA 4MYHA 3VX4A 1OXXK 3U2QA 2D2EA 1TF7A 2VEDA 4NONA 2BM0A 1S1MA 3SC3A 4A8JC 4EQ6B 4LJ9A 1E2EA 1U98A 3SHFA 1JR3A 1D9XA 2KBEA 3AGQA 4PXAA 3SJZA 1UKEA 1YZQA 4LJ8A 3VNVA 4XVRA 2JJ8A 1II8B 4PC2A 4CW7A 1Q22A 2OZEA 3OHMA 1KI1A 4O25A 2MSCB 1NSTA 3UWOA 2D2FA 2DCUA 3TSWA 1OHHD 4NYMQ 1J8YF 3ONWA 2YOFA 4BUJA 1Y63A 1D9ZA 3AUYA 1P9WA 1UAAA 1KJZA 2ZVPX 3LBIA 1CLUA 2ZYUX 3QUSA 2VP6A 4OI4A 1QZXA 4PAMA 5H8WA 3QG5A 1GP2A 1COWD 3REGA 3R20A 4X8MA 1YVDA 2VHCA 5KO2A 3SZRA 4JVLA 3RVBA 2W2TA 3ZVNA 3P1JA 1T3LA 5DISB 5FTJA 4IDNA 1QG4A 1RJ9B 4A4DA 2GILA 4DLVA 2BBTA 3LH5A 1P9RA 3EW9A 3B1XA 4Q4AB 5HKKD 3AV0B 2DY1A 1NN5A 2ECKA 1AN0A 5FOXA 2F43A 4IFEA 4Q9JA 4AI6A 4DCSA 2D3WA 1JI0A 4QG7A 4FCVA 4F4CA 2JIZA 2QE7A 3ECCA 2QT1A 5D3MA 1G18A 4JL5A 4B34A 4QGGA 3QKRB 3BRWD 1GM5A 3K8YA 5FR1A 4GRAA 5FR2A 3GLFE 1MO5A 3ZS8A 2VTKA 4LV5B 2P6NA 2NOAA 3N5CA 4Z8XA 1CR4A 2ZJZA 2IC5A 2CL0X 3RRMA 2BV3A 2O8CA 3GP8A 2IYRA 1KY3A 1XBTA 2WSMA 3SBDA 1GG2A 2EFHB 1D2EA 4BECA 2ZI7A 1AIPA 3FMOB 4QL3A 2QA5A 3LW7A 1NN1A 2J0UB 1E1RA 3T06B 5JLJA 2YC4C 3SI7A 2FPMA 4LV8B 5JRJA 2WMOB 3IGFA 2HLDD 2NZJA 5KPJA 1R4AA 2P65A 3GJ7A 4ZDKA 2GAOA 1M7BA 2Q9BA 1N0WA 4AYXA 1LVGA 1RZ3A 2GA8A 3P20A 4F7WA 4GBMA 2V1UA 4M9SA 4IOLA 3CWQA 1EFUA 3NEYA 5KSOA 3WMGA 3BB4A 3PG5A 2BJVA 2JEOA 1UDXA 1IXZA 1XCPA 1N6IA 1N6HA 3L0PA 3RS4A 3NBYC 2VP4A 3FB4A 2ZUBA 5KDLA 1J90A 1NP6A 4GZMA 4KI0A 1L8QA 3A4MA 3RC8A 4KFUA 3IDQA 2R6DA 5CDFA 3QY0A 3IEUA 1G8YA 4G5OA 3O8DA 1N5JA 3K09A 3OIYA 4DLZA 1ZJ6A 3GEHA 4OQNA 4D82A 2LWIA 4PANA 4OQMA 3GJ6A 3SOPA 4Q4JB 3CRRA 1OB2A 1EX7A 2GJKA 4JL8A 2X8AA 4B44A 4TLBA 3ZVLA 4OI2A 2JJ2D
chains in the Genus database with same CATH superfamily
2PT9A 3EIWA 3TZHA 3V8NA 2VTBB 4OMCA 2Y68A 4C5CA 1Y8RA 2L82A 4IQ8A 2O2SA 2IY8A 4KQ1A 3K0EA 2EX0A 2LW7A 3AKCA 4A5SA 3E9YA 1LKZA 2BZGA 2WHPA 5DGDA 1LSJA 3ADBA 4MW1A 2Z4RA 3S2IA 4QTUB 4AUMA 3HVIA 1PR2A 3GNTA 4FYKA 3DOCA 3HKDA 3G5TA 1PT7A 5AKXA 3CX7A 4C03A 5CB6A 2CC2A 4LV6A 2DTEA 5EJEA 3JD1A 3ND9A 1MZPA 1VHTA 1MC5A 3IHTA 2K6GA 4M86A 3RS2A 3S3TA 2W6MA 3KELA 3WL4A 4IR7A 1C3JA 4ZT3A 3RWOA 4RQBA 3WHKA 1AZTA 1N6RA 4KXFB 4RAOA 2J5XA 2WVJA 4UTVA 2C00A 1AUOA 5FLXA 2C8KA 1A8UA 1BW9B 2LV8A 5EZYF 4P92A 5HBRA 2IUEA 1JHQA 3RVOA 1N4AA 1Q0QA 3DDSA 4X00A 4YMGA 1NXPA 4HVTA 3RKRA 1SCDA 2JHAA 4WUTA 2FQ1A 3JQ9C 3VTKA 1EE2A 1G5QA 2VVTA 1TUBA 2XWQA 2Z2XA 2KW5A 3PGMA 3PXBA 5FB3A 1N2GA 1SU6A 4QM6A 2NXEA 1SVWA 3NYQA 1BMFD 3M1IA 5D87A 1SUSA 4FEGA 4WOPA 3AEUB 3KD3A 4Y2JA 4MMYB 1CVRA 2FEOA 1YS2X 1PBTA 3QEOA 2JRCA 2WTAA 4XYGA 4PLHA 1T5DX 1YJ8A 1JIXA 2R7MA 2FUNB 3CUWA 4F8EA 1AX9A 5CW1A 2RI6A 3BE5A 4Q01A 4JT9A 3F71A 1ZICA 1LDYA 2YYSA 5JWRA 1LLFA 4PZ0A 4YV7A 2W5UA 4QPCA 5GTDA 3MWFA 3O8NA 4PYOA 3COWA 4PGFA 3TDNA 2WWYA 3CXUA 1G16A 1C1YA 3QWIA 2CNWD 3N2KB 4ZANA 2TS1A 4QOSA 2P2GA 1YVEI 2AQHA 2WINI 3M6UA 1W7AA 2IYNA 2ANCA 5LU9A 3IBYA 3JQGB 1M1XB 1NQUA 4M88A 3PDHA 1LBEA 3VUFA 2DEUA 1YIOA 5KJCA 2A67A 1TLLA 5E6RA 1MX1A 1NMQA 4KR0A 1KFKB 4KQGA 2DUJA 3EZNA 2KWIA 4PU0A 1PL6A 4IKOA 3RFTA 1E6LA 3K0AB 3TGWA 2H1LA 1C9EA 3TTYA 2BGMA 4ZZ0A 5FEUA 2BDUA 1C9YA 3BF8A 3E3NA 3ZY4A 3TN7A 2F1KA 4ZJYA 1A8QA 3IO3A 2NXWA 3AUTA 2ZLBA 1KDTA 3HCCA 4MVCA 3JAWA 1NVKA 3KKPA 2G5GX 2YWDA 4NFLA 4TSFA 2V59A 3HFJA 1AC5A 1WHTB 4ZVOA 2OHFA 1IPEA 3P5BA 4HYQA 2OESA 2QN2A 4C2BA 4M89A 3GEIA 4NYJQ 4XARA 5FT9A 2DQZA 4BS9A 5K6AA 1ORVA 3AVXA 2F1JA 2IYOA 4XFDA 1OV4A 1OXKB 3TD6A 5SYMA 2YIMA 5IUNC 3TX6A 3AVTA 2VJAA 3BAFA 4EB0A 3ZD6A 4KZPA 3R2JA 1C0PA 1K98A 4NLLA 3VSDA 4IIJF 2VHJA 2JCXA 3KXIA 1FP4A 1KQPA 1RJ9A 2AK2A 3R7AA 1UBMS 3U16A 3GO4A 1JMKC 4EARA 1FB5A 2QUHA 3PEYA 3QPAA 1G5IA 2B1JA 4NZOA 2E4VA 4PLZA 3C7CB 2A5LA 2VUSA 2Z2JA 4LZZA 1K7CA 1TZ2A 4QUJA 5JAUA 1Q6ZA 3BJIC 3CNNA 4I50B 4YP6A 3NPMA 4HX5A 3N9IA 2F7SA 4X64B 5JPDA 1TKBA 4PPNA 1JEYB 4EJFA 1OWPA 2A9JA 2IHUA 2ZUUA 5C1BA 3TECE 2EKDA 3ZZ1A 4A23A 4Y9TA 1A71A 2W8ZA 2O6HA 1DAKA 1WUTA 3MD0A 1N25A 2LXNA 3FMPB 4RC9A 4UC0A 3TOCA 2ADFA 1KJNA 1PQPA 3AJEA 3IOMA 3PNBA 5BR4A 4LBVA 2H1FA 3REQA 1A5BB 3DL2A 4FFSA 3B48A 4HO1X 5GV7A 4Z3DA 3TCNA 4AZ3B 1H2WA 1WMAA 2H4FA 3C8MA 3DB1A 4YUYA 1D2GA 1T9HA 2QRHA 5DNEA 3ZWQA 4A26A 5EJGA 4Z3KA 2D8MA 2QRZA 3G3EA 4RHYA 1X6VA 3UB2A 2ZJ7A 4XYEA 1ZQ9A 4HF7A 4JBXA 3AEKB 4MQEA 3FOBA 1FVOA 2G67A 1P1BA 1BZYA 2LCQA 3ZWVA 1JE1A 4C7BA 3MCTA 2IYFA 3BMOB 3ND5A 3ZVKA 2PUEA 3AQ4A 3D8HA 3B3FA 3CX4A 4RHTA 4CMCA 3D59A 3U1BA 4TWAA 4DBLC 4BCCA 2C96A 3IODA 4Y9UA 3JX9A 3QKUA 4HDSA 4KV7A 1M0EA 3L7JA 1AV7A 1NVVQ 5A3QA 3EFOB 2NSJA 1D3AA 1GNSA 3UCXA 4D80A 5KNBD 4I46A 1GPKA 4IO0A 1DG1G 2GTHA 1U2ZA 1BE8A 5E3JA 3I6QA 3HUDA 4ZK6A 3EIOA 5DM60 1LJLA 3B9QA 3L77A 1IN4A 4TYMA 1WW2A 1ETHA 1TYAE 2NLOA 1YR9A 4O3FA 5E1BA 4YAUA 1SXPA 4RK5A 1EP1B 1R18A 2HHAA 3BCUA 1BFUA 2X7JA 3OF3A 3OMLA 2WD8A 4AT1A 3A8TA 1P8AA 3I37X 1FMLA 2Q29A 2JLAA 1U7PA 1Y42X 3NASA 4QGFA 2OCXA 5AIAA 4YR7A 1FSZA 5K20A 1XTBA 3QOFA 1Z3CA 3A58B 4FLMA 4K81B 1K9SA 4DHEA 3L9XA 2FA9A 1WCYA 3JQPA 3BBPA 2VTBA 2AR9A 2EBFX 2FE4A 2HDNB 2IIVA 2JJ2A 3HNRA 2EJUA 5IDYA 1B73A 3U4AA 4EKNB 3VKWA 5C5IA 1NJ6A 1ZNXA 3PHJA 4EP1A 4DMKA 1UKCA 5I4IA 2WIFA 4QZVA 4D3XA 2JD1A 4OYHA 1WKCA 3QLTA 4FFBB 4BFUA 1SH7A 4K3UA 2V7GA 4K7JA 4UW9A 5TQ0A 4NMXB 5ED0A 3G9UA 4IIFA 3Q3HA 4AXXA 2IZ5A 1GR0A 2Q7OE 2CFIA 2YWJA 3V2IA 3JPWA 5CBKA 3GLIB 3WLEA 2W2OA 4TL8A 3G9XA 3LP5A 3HYTA 2VT6A 3X1KA 2L69A 1IOWA 3AFMA 1IZZA 4DQUA 4ENUA 3HKCB 1ZGAA 1EP3B 3UJCA 1XE3A 2DQSA 2PUGA 3GJZA 4LIPD 2QL6A 5LNK6 1BW9A 1ZWLA 2OGZA 1BGVA 1SC3A 2B4AA 4XDZA 4EG5A 2QX7A 1TIPA 4NOJA 3NJ4A 3ONDA 1CZOA 1VI6A 4MRRA 5FYDA 1WSWA 3IQFA 3KOUA 3UXYA 1DLJA 2EWWA 4FHFA 4NCIA 3KQHA 3HJRA 4I2VA 2WLSA 2CVFA 2NP7A 3AEUA 4RVOA 1QOZA 3CPJB 3ZDXB 1ZAYA 3A06A 3RBXA 3BFKA 1JR2A 3MWKA 1MOQA 1CF9A 4D41A 4IJVA 2AJBA 3FCUB 3LFUA 1SUCA 3C1AA 4Y0VA 5CW2A 2V7QA 3F1KA 3W7AA 4CNQA 2IUYA 4URHA 1PFVA 1U3DA 1G6KA 2NXNA 3HN7A 4TLLB 2Q3EA 4ZAXA 5H02A 3RVDA 3N2KA 1PK9A 3LZDA 2NSLA 4BNLA 4AG6A 3RSZA 1IJBA 3K9NA 2YYAA 3DOOA 4G0OA 1GL3A 1I1OA 2FN7A 2FZ5A 3IQIX 3JQGA 3RC7A 3RWMB 1ZC3A 4RDIA 1AKQA 2WUDA 1B6TA 3KLOA 2VQDA 4G5GA 4WZAB 2HU2A 1H94A 1LPOA 3R3WA 4K6CA 1E0DA 1NURA 3RS7A 1UBEA 3M5CA 3D7RA 3EIQA 3EPRA 2YN0A 1MEOA 3R8FA 4D81A 2XUAA 3R4CA 4P81A 4RLFA 3W34A 1JX6A 2JARA 5ER9A 2JGDB 4FNGA 4JV5B 3JWIA 3TJRA 3W5AA 4FZRA 2RGGA 3ZBQA 4OX9B 4L6IA 3NTUA 4DR2B 4QLOA 1EA7A 1RMYA 1XA0A 4KDFA 3DT9A 2FYTA 2DU8A 1WHTA 1OBOA 3ND8A 4PE5B 2J41A 2NX2A 4FVTA 3UVEA 2A0WA 2VS1A 3PX2A 3U7IA 2Q2VA 2AJDA 4LQLA 2XMCA 2IPOA 4M7OA 2FV8A 3CSSA 2AXNA 1DWUA 3NALA 2JG3A 1D07A 2IUFA 5EHIA 3C97A 3VQTA 5IUJC 1NUTA 3OFKA 2HCRA 2VZ8A 4O3MA 3CRQA 5J40A 1X13A 3FXAA 3R3JA 3U4DA 2BTEA 4M1YA 4HH1A 4NSNA 4LFAB 3UBTA 1GGKA 1KE1A 3FLEA 3W2EA 1P0FA 3EA0A 5J5VA 1V43A 4ZPJA 3GFGA 2ZAGA 4IF6A 5AW4A 3TM5A 2FZVA 1R6BX 1YMVA 3JU3A 5EPEA 4BKMA 4I50A 4KFSA 3DAHA 3K4PA 1E2HA 1JEYA 2OK7A 3ACDA 3DCNA 3P9ZA 4JI1B 1R0LA 2QXUA 4BJ6A 2VC2B 4QU5A 1D6SA 2GEUA 4DLAA 2W6JA 1RE0A 3Q5DA 3RARA 5KCMA 4BNWA 5F3WB 2YMMA 2Y3IA 4MICA 4XUGB 1FFYA 4NBUA 1ONSA 1R3DA 1SULA 1HLFA 2VNIA 4GVPA 2IYVA 3D54D 1N8TA 4JLSA 4CLDA 1WY7A 2IUSA 3HB1A 4OQPA 4K87A 3DBIA 2JGNA 1FXWF 5K8LA 4DXAA 3Q41A 3UMFA 3RS0A 3AEKA 4UZEA 4D9FA 2NSDA 1D2RA 3KSMA 4PC6A 4C1NA 1P3JA 2DRIA 3P97A 3IUBA 3DZIA 4JC0A 2IU6A 1BE0A 1GTL1 3BMOA 4IJMA 2GGSA 4EJSB 5DBOA 3SYNA 5B2EA 2FGJA 2PLAA 3KDPA 3L0IB 4IDBA 3U13A 4F9GA 4OBXA 4AP9A 4JJEA 2KX7A 4DUZB 3L8ZA 2D0OB 4ZD6A 4OHCA 4YI3A 2E7ZA 3K53A 3EFOA 1XZBA 2PUBA 1XMVA 1I5EA 1UQRA 3KVNA 5DTMA 1P9OA 4R1MA 3STWA 5T5QA 5K6TA 4GOKA 4FR2A 3E7XA 3PB3A 3RABA 3RV4A 4I4TF 3TXAA 2FZCA 3QEJA 3FKJA 4P31A 3R9WA 3PX7A 1JKIA 5BRAA 1A2QA 3GN1A 5AH0A 2C2ZA 3V34A 5DOVA 4A8HA 3OECA 1P91A 1YS9A 1A77A 5LOVF 5AK6A 4R6WA 4HQLA 1BOFA 1ZSVA 2LCIA 4XQEA 3JZDA 4Z54A 3IUPA 3W7BA 4HK4A 2CEKA 4RF4A 3D7NA 1J33A 3SZGA 1LFAA 1QHEA 1RAEA 3Q7EA 3EQ9A 3HI6A 1NT4A 1PT6A 2IXAA 1EG7A 3CZCA 4ZZ1A 3KXDA 4HV4A 1H2EA 2J0VA 2DT8A 4BQIA 5CDGA 1NOJA 5C8YF 2AQIA 2XUZA 5TARA 2KI5A 5FTLA 1B3RA 1L7QA 2PKCA 2J59A 1Z8HA 1D7AA 3H6GA 4Y6RA 4UNPA 3VR1A 1G59A 1YIDA 2FH5B 3BH6A 4QDXA 3VYTB 4FFBA 1W36C 3DOFA 2W2LD 2WM9B 2WJGA 4EVRA 2NUBA 5FBQB 1B4DA 3O8RA 1JZQA 4HXEB 4MUFA 3GJ0A 421PA 3OPQA 1FP7A 2H4ZA 2C94A 4ZIRB 3GLIA 1BHSA 5AXAA 1HYQA 1T34A 4MP8A 1JMYA 2VP0A 2XBUA 1N2ZA 3NWEA 4MW2A 3ROKA 3HKCA 4BJ3A 1JG2A 1D0VA 3CNLA 4C20A 3I4FA 3R6DA 4CKYA 4J0FA 3BICA 3NWOA 4FU0A 4MUXA 5T6BA 1QRSA 1Z82A 1ISSA 4FD2A 4P4LA 4F1WA 2ZDGA 5AM1A 3L0ZA 4B8YA 1NQOA 3D3QA 3H7IA 4NOKA 4L6CA 4GXTA 1GTVA 5AKYA 2TYSB 2IU0A 3ROEA 1L6RA 4CG1A 3ABQB 6Q21A 3UPUA 3RADC 5B30A 4D9GA 5JROA 3H5WA 4HXYA 4GEGA 1PHPA 3TQFA 4BPRA 2D62A 2IXEA 3HY6A 3QZUA 3LPCA 3SQOA 4AP6A 4DPLA 2R9VA 1HTWA 3SIPA 4Z4QA 2OBMA 3B1ZA 2QIOA 2OILA 1DINA 4M9CA 5F4BA 4W6QA 5BW4A 4QUIA 1O94C 5DBIA 3DM5A 3ORYA 1YR6A 1YQGA 3KPUA 1DT3A 1NRJB 3N8NA 4G01B 5JD6A 3TCXB 1BWQA 4B2IA 3A2KA 1YONA 1RJEA 3JZFA 2I8LA 4BX2A 4ZXPA 1SA0B 1WXDA 3MOSA 2WYVA 3PVCA 4OB8A 2P90A 3EFBA 2PZJA 1N3IA 1NIPA 3CRW1 4Z4EA 4WZAA 3ICOA 1XVVA 2P27A 4NP6A 3JR3A 3U80A 2NO4A 4TVSA 3HJFA 1KFCB 2B94A 1D1SA 1GZ5A 2B69A 4DWWA 3QYJA 5D7BA 3R3HA 4P54A 3W77A 3O74A 2OV3A 4HX2A 5K0JA 5K3CA 1JJFA 3R9IA 4F93B 1M6NA 3IE1A 1R37A 5ISMA 3R5FA 2QL9A 4YN3A 3T0FA 2WTUA 2YJNA 3HN6A 3K2BA 1SCUB 4KPEC 3S2EA 3KB1A 2QJRA 3CKMA 3DBOB 4JB8A 5T8KA 3BF7A 3REFA 2VRCD 3ENVA 3ZHTA 5BV0A 4RLQA 3TVTA 4CQLB 1JYEA 3IAS1 1RIFA 2JH8A 3NHMA 4GOJA 1QG0A 2IHYA 4F38A 4NOLA 1X9HA 3ZQJA 4E5DA 4DC1A 4Q82A 4C4PA 5IANA 2O5RA 1Z0SA 2CDNA 4Y2HA 1F7VA 2ZVDA 4YCJA 2ID4A 3TVDA 2JFPA 2DXIA 1UBGA 1UWVA 4PHHA 4AU1A 3ZVRA 4PLFA 3H5LA 1YKGA 1KBZA 1KJYA 2UYOA 5CRIA 1QFSA 5TC4A 3VO8A 3RSQA 1EESA 1JHAA 3HU5A 1U90A 3PKJA 4GI2A 4L5AA 2PU7A 4M76B 3VOTA 3QBJA 1ZGHA 4L8FA 4RS4A 1WTAA 2XUKA 4L16A 1GNPA 5TGZA 4LC0A 3K6KA 3GYGA 3EYWA 3LGAA 3ROMA 3ZNNA 3H6HA 4B2LA 4PIMA 5M5BA 1I4EB 1PWYE 2PCLA 1SELA 2X9NA 4Z3OA 5LQNA 2ZRJA 3SC4A 2ZT5A 3CH5A 1I1NA 4R2LA 4K5QA 1P7CA 1RTKA 3ZIAD 1L4MA 1G5RA 3DOHA 4R0MA 4FSHA 3ZLBA 5I7FA 1CUFA 1YBHA 3RSLA 4AJPA 3EWNA 2I6QA 1TT5B 4L4UA 2GLUA 4MPTA 5EJ2A 1BS9A 3PWKA 4A6EA 1ISPA 2Z08A 2R97A 1QVAA 4JT4A 2O8FB 3O75A 4GPIB 4X63A 1R6TA 5TRTA 2GSDA 4F4UA 5JDIA 5CYGA 1PQ4A 1HI9A 1ZM7A 2QM3A 1NXVA 3HLTA 5CPFA 3EZ7A 1PGJA 3KKQA 4GL2A 3RBVA 1ZRHA 4N5HX 5TV2A 3VISA 5P8WA 4EJSA 3NHWA 3KUUA 4WBXC 3EULA 1N2IA 1QFYA 1FQJA 4J0EA 1YQWA 5FUXA 1PUIA 1MVOA 4PC3A 1QF6A 3GT0A 2C7VA 1M8FA 2VRBA 3ZZNA 5F9MA 3EC2A 1V41E 4TRMA 2RB5A 4X3OA 3FPCA 4NH4A 2QMHA 3LUPA 4B35A 3C3DA 3N8DA 1C41A 4QPPA 5JSFA 4BMPB 3OUUA 3O73A 2O7VA 4DCCA 4DM4A 4K9LA 1IN7A 2ZJ2A 4Y30A 3UH0A 1M75A 5EKUA 2V7WA 4ZMSA 1EJ6A 2VSFA 3JPYA 4XTRA 3IDFA 3VC7A 2AMVA 3K0CC 4XM1A 5EFOA 2JPDA 1W5AA 2X1VA 3ABOB 3NHJA 4KXYA 1T13A 5BSTA 4NWIA 3R76A 2FG5A 3TQTA 2AVNA 3MT0A 4LHSA 3BWEA 3S5UA 2D5BA 1G19A 2BFOA 1W581 4HUQB 4R8KA 4IIDA 1ES9A 3WMWA 4UBOA 4AB1A 4YMVA 2EFDB 3OAAA 1C50A 1VHJA 3FSRA 4EYOA 3RUCA 1OFUA 1WF3A 3KKMA 3OPVA 1JYFA 4MRAA 2ARKA 3E61A 3T1YB 1LBQA 2ZTUA 3FRIA 3IIEA 3PI6A 4MUGA 1TT7A 4ZU3A 3UOAB 5LMNB 2I9PA 1HOTA 2NPIA 2IIQA 2RJ3A 2YQZA 4JIGA 2REBA 3O26A 4JXKA 1SZCA 5CNMA 4HP8A 1OLXA 5B36A 4NYJR 4B4WA 1IAVA 4XCQA 4P22A 3GVXA 2I7DA 1HNZB 3ZHZA 4OL0A 4K9KA 1QV7A 1ZHHA 2Z95A 4ZIRA 4LEIA 2OFPA 4QPJC 5L95A 4RF5A 1HEIA 1KSHA 4UULA 4AICA 1IUOA 1WD5A 4C08A 3OQ6A 4X62B 3WNQA 4KB5A 3D64A 1D4OA 1KZ6A 1FDTA 2WZQA 4BX8A 4QRIA 1T3TA 3ABZA 4UTXA 4K9DA 3MJEA 5AJYA 4LCEA 2WV9A 3NT5A 2ETVA 3K6RA 4EW1A 3IHKA 3N2YA 3PR3A 1E7SA 2DPGA 3V7WA 2BFFB 2QBYB 4KR2A 4BO3A 4NBWA 2AMLA 3EHDA 2FG6C 2JA2A 1VCIA 4AN4A 3IRVA 1D09A 3I8SA 4FWIB 4JGBA 1X7YA 4KTTE 4LPKA 5H0IA 2E1PA 4PCVA 4AN1A 2XXAB 4E12A 3ETDA 3UWPA 3ET5A 3I45A 5I8WA 5J4VA 2R5WA 1AK2A 3NNNA 4TXJA 3X1JA 3JQDA 2E49A 1DKOA 4KXVA 4QBKA 2REOA 2WJYA 3OLZA 4MWEA 4IX9A 4F2GA 1U99A 4LJ7A 2CD9A 2UZ0A 3H5TA 4O6VA 4HPXB 4D3FA 3RBZA 4EJMA 3HJGA 4NJOA 3JY6A 4N9WA 4R2HA 1H4VB 3R7DA 1UPUA 1L7OA 3GPCA 2WFZA 5GONF 1KWGA 2K2WA 4EY5A 3TNFA 1ZJ5A 1SKUA 4NQZA 5AI0A 5AUOB 5HYVA 1F0PA 1ZY2A 2C61A 2HLNA 4WXYB 4BZWA 2HSDA 3PA6A 4TYNA 2QZPA 2HWWA 1NATA 2XF8A 3UMRA 1NQTA 2JC3A 1KZHA 2ES4A 3VZQA 4BRWA 5K0FA 3KV3O 1HQKA 3F3KA 3UF0A 1NSYA 1PYDA 1SCKA 1PW7A 3QHAA 5I4KA 4P38A 5ICMA 5IKXA 1BVHA 1Q7RA 2FK8A 4MV7A 1QNFA 5DI9A 2J4DA 2W2XA 1Z08A 4GSKA 1RQ7A 4LMPA 4RJKA 3A1NA 1AHNA 3GT3A 4ZT5A 3KETA 1GEEA 2QRMA 5FV4A 1Q0TA 1L4HA 2IBTA 1GSHA 3RTAA 2G0NA 2IE8A 2IOYA 3AMVA 4UXJA 1MVLA 1BX0A 1RABA 5IN5A 1CD5A 1SCUA 1NJ5A 3AETB 1EQAA 1DAEA 4OYRA 1E6CA 1KAHA 3II6X 3PL1A 3NRBA 3GEGA 3GVIA 1JDBC 1YL5A 2WICA 3QVJA 4MJLA 2R8BA 3GV0A 3OIVA 3RUFA 3I8OA 2J0EA 4CQLA 1AMOA 1Y3AA 2F17A 1CQZA 2B92A 2OO3A 5AKZA 2F8MA 5ALNA 3A31A 5KVAA 3NR2A 2R7KA 3X43A 4D8XA 4ED9A 4IIXA 1B0UA 3BUSA 2WU4A 2X42A 1GA6A 1W25A 4OHFA 1YA8A 4OAPA 2WIBA 2ZE8A 4TV8A 2GBGA 3A1DA 3C6BA 3RU9A 5EA2A 2NPOA 3KPYA 3HNPA 4JP8A 1JIQA 2H2FA 3D7SA 3L93A 5AW9A 1I6MA 3BWVA 5AK3A 3S8EA 1OILA 1Z25A 2PFSA 3ASVA 4Q7LA 1GZSA 2B36A 2Y27A 4B79A 1IIRA 1I24A 3B1JA 1R5JA 3C5EA 4LPSA 5B3AA 3S2FA 821PA 4ETWA 3HRHA 1W5FA 4JX9A 5F1OA 5B1YA 1M8JA 1QIJA 4UQPA 4D3SA 1OHHA 1RQ2A 4X41A 3D6HA 3QUQA 4HMOA 2GSWA 3D3JA 2A5YB 3W7VA 5BVHB 3A04A 3T52A 3LNTA 1YFLA 3QYAA 1VSUA 3DWIA 1KI2A 3KKOA 4KGVA 5KMGB 3FTFA 1JWLA 2O8DB 3S8MA 1E7RA 5HUQA 1Q21A 1XEWX 4GG1A 2EXXA 2NVOA 1TT5A 4R9SA 2QU7A 3OA0A 4ODIA 5TMBA 2BEWB 2C95A 4BJ5A 3GLSA 5C8ZA 2R66A 1DSSG 4J4BA 2O8FA 2P2NA 3D6JA 5T3UA 2I3ZA 2HRBA 2Q5FA 2WG0A 5DEOA 1E0SA 1SMKA 3SJBA 1N0UA 4YR9A 4YT4A 3ZDDA 2PMCA 2PMDA 3CZPA 3PDWA 3E5HA 4OU4A 1Y3HA 4MEJA 3TX2A 3X3HA 1YQQA 1EIZA 3AXSA 1ISIA 5FBVB 1U1DA 1SN7A 2HQBA 3M82A 1QFZA 4HDAA 1BVYF 2FW7A 4J0IA 4Q7MB 3V42A 3ZNPA 3BB3A 5B2FA 2YN4A 5JMOA 2J31A 2YXPX 4RPIA 2G7ZA 5EHZA 3SQWA 1YI8A 1PGPA 3H1BA 3CLUC 3PZRA 3QV2A 2R6AA 4LSWA 4MUEA 3I9MA 5H1YA 4N82A 1G8PA 4HYYA 4DBLE 1SU7A 4MVWA 3WAJA 4R2JA 1JILA 5ILQA 1YJ5A 2PKWA 4GU5A 2ATEA 3WMXA 3CKYA 4J91A 1OASA 4QUGA 4OG2A 3BRWA 2PG3A 3SXPA 5AVJA 2YJ3A 2BELA 1VMEA 5EY5B 4BKRA 1D6JA 3STXA 1O6BA 3FYTA 4ND3A 1FQKA 2IFTA 1VZ2A 4EGSA 5BQ3A 3QFFA 5IKOA 3ASYA 4MZDA 4WA8A 2WTMA 1VKZA 2H1OA 2PZKA 2WKPA 4JU9A 1N32B 2FPUA 1P62B 2N47A 1KVQA 1UWCA 2IXBA 1Q3HA 4I3GA 4YTEA 4MW0A 4DUYB 4FW9A 4HUQA 3UN1A 1QHYA 1VIMA 3JYPA 5JAZA 1R9GA 1UPFA 4C5AA 4KRGA 4DA7A 1LLQA 5LFAA 4IGAA 2YWBA 3IR7A 4DIUA 2OYSA 2WT9A 4KBYA 3KUXA 1PR3A 1SOAA 4FS3A 4OJQA 3ZXXA 4D45A 1WETA 2BM1A 2XGJA 3MCUA 2ZT8A 2H8KA 3Q3EA 4Q39A 1JJVA 2A9FA 2FW0A 2GZ2A 2YZMA 3KUKA 1K5GA 4FGKA 3IUSA 3D8SA 5D5PA 4R8SA 4DIMA 5DF1A 4ZYWA 3LLVA 3T5PA 2A33A 3CNOA 1T8SA 1YD7A 4K9PA 4WZAE 2UUPA 2O57A 5BUZA 3S5JA 3GARA 4G86A 4JCOA 2QUJA 4BNMA 3TLMA 1GL6A 4KK4A 1FW8A 4OQDA 1H2ZA 4B47A 3RAPR 4PZUA 4JI0B 1M76A 3PGVA 2VKQA 3KL4A 5B6PA 1JU4A 2H11A 2NZWA 3FDZB 2ZIEA 1NWCA 4REQB 2BFAA 5EI5A 3K8QA 3FWNA 3WIVA 4F85A 1N1DA 1ESNA 4I1RA 5C7YA 3Q1LA 5AHWA 3VA7A 3FR8A 2BFFA 2XNDD 4DLUA 3A6JA 5EESA 3CUVA 4WBSA 3K1JA 3KG2A 4TZ6A 3V8QA 1P9NA 3MB8A 3QFTA 3QIAA 2JNWA 1TQDA 4AN0A 5CK5A 2HHHB 1EFPB 2X8WA 4FTWA 2XXAA 1MPTA 3RC1A 1K66A 3R3UA 1WVMA 4KACA 1SQGA 3HG7A 1NW6A 3ZIUA 1LV7A 1A9PA 2AI1A 5FA6A 1XKTA 5H80A 4DIFA 4F5DA 5AJUA 3LWDA 3KZ1E 4P98A 5CLHA 1NY5A 1GPMA 3N2GB 4JCCA 4KQWA 4ZOQI 2O3SA 1QFXA 6GPBA 5GGYA 3N2ZB 4PFJA 4ROSA 4LRTB 2ZTSA 4V0KA 2MU1A 3MHTA 4KAFA 1LSUA 3NHKA 3ESBA 3KXKA 1J20A 2BWJA 2VK2A 3F8SA 3OCVA 4I66A 4I55F 1XVTA 1XZGA 2GKOA 4JSRA 3QBVA 1X7WB 2X58A 1SPXA 3RC3A 2QR2A 3ZY3A 4C01A 4GYYA 2IYSA 2DBYA 1ZYUA 1VL1A 4DDTA 1MEEA 3OEHD 1OQAA 3WLKX 4BBJA 1Z5UA 1GAQA 1AHPA 4CTMA 1HLPA 1PTJC 2GPAA 3SQMA 4K1LA 2IELA 4K3VA 4O4HB 3UXMA 3ZHRA 1DDIA 1LPSA 5DNCA 2JKYA 1GPNA 5FULA 4Z2YA 4UEJA 2RE8A 3ZDZB 3LRTA 2ANBA 2FMKA 4BCBA 5FWXB 1BMFA 1KS2A 1PK8A 3P9XA 3AETA 3BE8A 4JR1A 3DPSA 4R5MA 4Q9DA 3CVYA 3LL4A 2DHCA 2W0MA 3OTHA 3DLHA 4MR8B 4GX2A 5JWOA 1A04A 3FPJA 3MLBA 4FHZA 3RNLA 3DUWA 5JNUA 3DCJA 3GJ4A 3EGOA 4ZEMA 4DR1B 2PT5A 2R4QA 2ZUWA 4GZ5A 3DZDA 4TSRA 3E9QA 2VT2A 2D54A 4ZVNA 4EEKA 2G70A 2M6RA 2VWGA 3ZWAA 2VATA 3BFXA 5C4IA 2CNWA 4O59O 2B6HA 3LWBA 2G1PA 2OY0A 4S04A 3JQ8B 1QP7A 2ZJ3A 1UP4A 2TRSB 1C7JA 1W5BA 4PVCA 4OHMA 2XCRB 3VZSA 5C32A 1UBSB 1HTBA 1ORWA 4H3KB 1SG0A 2QD2A 2NPFA 3IOYA 3DZFA 3KAQA 5CVDA 4HH0A 3DMTA 4HQ0A 2ZVJA 2VZ9A 1PKEA 1ZA2A 5K8CA 4ENRA 2EU8A 3J7AC 3TYXA 3DM9B 5BUQA 1Y4AE 3GT4A 1SVOA 4HAZA 1DUIA 1S3FA 4KVAA 1VIVA 2KBFA 3EPKA 3RRNA 4MV8A 1WXHA 4ZOLB 2D4AA 2MJLA 3MGKA 2UUBB 5BVHA 4YI5A 4F04A 1FTGA 4YMSA 5LNK1 3U6KA 1EVEA 5TF4A 3WLTA 1QQ7A 5KMGA 3Q1KA 2O8DA 4CF5A 4J6EA 4DQVA 5CURA 3BJRA 2B34A 1HDYA 1A82A 3BMXA 5FORA 1BWPA 5DRYA 2BEWA 2K2QB 2F1IA 2QP4A 1A9XB 2CNBA 2V58A 2Y0DA 2GZ3A 3TTUA 4U0JA 3AXTA 1ZNWA 2VT7A 3EA5A 4J3FA 5G0VA 4F2PA 2LVBA 4NR0A 3RSOA 2F90A 3EY9A 2MSDB 2QTHA 3FUVA 1PZMA 4FOOA 4PAOA 3V2HA 4DRZA 1C7FA 2DPMA 1XNGA 4B6FA 1HDEA 3UHPA 2C7GA 3QVXA 5D01A 2XLCA 1Y1RA 3W1WA 3GK3A 4UTZA 3TMAA 2QAGC 2EDAA 3RIXA 2GUWA 3PNQA 3CX6A 3X2SA 4A16A 1JEJA 1E7YA 1DCTA 2CL6X 4G4SP 3F46A 4MUYA 1UT8A 4XJTA 4IXDA 3IHLA 1OU4A 1SVMA 4YQFA 5LP1A 5ABPA 5IWCA 1KY2A 3RS8A 5L51A 4UXIA 4U3JB 3OSZA 5KNDH 3RTBA 1WDMA 4Q18A 3ICVA 4F56A 5FA5A 1W85B 2F67A 5AI4A 4DV3B 1BXZA 4KYIB 1NF3A 2B2NA 1K8YB 5SZJA 2IV7A 2Q3DA 1CJVC 3ITNA 5JYBA 1S4MA 4WVFA 2CUTA 2OV1A 2WVHA 1UOEA 2H5EA 5E2AA 3ZHCA 1HEUA 1JSZA 1CB7A 3W4KA 4HS4A 1P61B 1V4VA 4G63A 4ROTA 1KE2A 2E55A 4UNNA 3WLQA 4HEHA 1UFRA 1BNCA 5DKFA 5CB0A 4IICA 4JLKA 3WGTA 2ONYA 4KWHA 1R6XA 6YASA 4R7ZA 4JJ7A 4XEHA 2CMGA 1R88A 2VXBA 3HU3A 1P9LA 3EUEA 4G9GA 4LYFA 1DV2A 4UNRA 2OVBA 4G1CA 3RS3A 3I92A 3Q2KA 4LI0A 3T3MB 2QTVB 2DECA 2HV9A 4IXWA 4NBVA 2WJHA 2XVXA 4HI0E 4PTLA 3VNUA 4JBYA 1XL0A 3BEDA 2XTMA 4BRZA 2O0HA 5L7TA 1NM5C 1XZAA 1EWQA 2XUJA 1PZGA 1UIRA 4JB0A 5EKDA 5KOJB 5KNBA 1QAOA 3V97A 1X2EA 3EMBA 4W82A 4AS1A 1JP7A 4ALNA 4DRYA 4GIBA 4URZR 3ER8A 1RVDA 2AMYA 1FSSA 3RASA 3FDZA 2V8BA 1Q44A 2A8YA 2TMGA 2V55B 4R40A 3DBHB 4REQA 4J49A 4DYHA 1AA6A 5KJEA 2P2LA 3PGJA 1T9AA 1OAOC 3L92A 2NTVA 4WZZA 2FEWB 2XZDA 3RKSA 2F62A 1TJ3A 3ANXA 1UXHA 2W2NA 2GWRA 3NH9A 4TXMA 3TJZA 4NG4A 4DA9A 1RC8A 3LUKA 2XYHA 3LFHA 1SCAA 1KK0A 1EFPA 2ZB8A 1ZBQA 3KHSA 3S4YA 3EPJA 4GI1A 4BX0A 2QP3A 5AOBA 3UANA 3SNHA 1AXRA 4DS3A 1F60A 1YOBA 2JI7A 1ECCA 2AV6A 3LCVB 3NAMA 4OA8A 1K68A 2R48A 3UHOA 2P9YA 3VI3B 2AX3A 4IDFA 3Q11A 1ZW6A 4H7FA 2AX4A 4HFNA 3VKUA 3WNVA 3N2GA 3TEJA 9ATCA 3U4QB 1GA1A 4EX6A 1YQUA 2NQ8A 3CQ9A 3LUBA 4B75A 2PUAA 2XV1A 1TLTA 2ADMA 4LYJA 5A3RA 3CZ4A 3Q85A 2KMLA 2MYPA 3O4FA 3WMFA 2I33A 1X7WA 5DGCA 5K3BA 4I0WB 1OI4A 1PJBA 1II9A 2VWQA 2PUDA 3HKBB 1NDQA 3JVEA 1QVRA 4PV7A 2ERYA 4BFXA 4E7OA 1CP3A 2VTDA 4HB0A 2HF2A 4O4HA 3I34X 1XU9A 1BDMA 1Z4JA 2IZ1A 3IUJA 2HV8A 3WLFA 3OZAA 3PU6A 5HDQA 1JKMA 2M1XA 4ZHSA 3FUWA 4HWKA 3VPHA 1OBHA 2H2IA 5DHAA 4DNXA 1VKHA 1Q0UA 1JLRA 1PR0A 2XQGA 4RZQA 3OM8A 4RU1A 4MLDA 3RIEA 4FI3F 3ZVMA 5BY2A 3HCFA 3UC5A 3UWMA 2C8JA 1SJ9A 4IVNA 1M1NA 3OPMA 4MR8A 1KI7A 3FB1A 3N3AC 1IATA 5EJ5A 2Q46A 1Q3TA 4B6RA 1OTYA 5EIEA 4O4JF 4ZJPA 5D2CA 3DEAA 1TCCA 3DJFA 4ID3A 1ICIA 1R0SA 3LLMA 3AG5A 3PXXA 5JQGF 4KQMA 1GSAA 2VXYA 1UDAA 3CUSA 4EI7A 5A5VA 5JARA 5CCBA 4RVUA 4JVMA 1M1YB 3QEKA 3JQ8A 4HG2A 1PGQA 4TTQA 1ZJ4A 2GARA 3GCZA 1ZXBA 2P75A 2VDUE 1XEFA 2ZDQA 5IJZA 4QYIB 4RX1A 3AWIA 4UDXX 1U2RA 3FVWA 1G7TA 4FR0A 3AR6A 3LW8A 3QX9A 3RJ5A 3ZU4A 4LF7B 2KB0A 4KSCA 2YL2A 4D9NA 4RESA 4CFSA 1AKNA 1WU7A 2HK8A 5JD5A 2ZBRA 2PKYX 2HUPA 3G0HA 1IY1A 2G17A 1C0EA 2JCBA 3EFEA 3S99A 1O8BA 2XX3A 4V0NA 1E2IA 1M7HA 1TNDA 2H06A 4ZOLA 5KNLA 1NVGA 1U8AA 2AGVA 4AO7A 1ORIA 1DBSA 1ELOA 2OCKA 1Z0KA 3PVSA 5GOTA 5IARA 5A4JA 3O93A 4KH0A 4H0NA 1UOPA 1O2DA 2DX7A 3ODGA 3WLSA 4V03A 3RE1A 2C0PA 2J3QA 4UKDA 1BOOA 4LBWA 1A9XA 1JIVA 3FMGA 2OWDA 5ARCA 1PUXA 2G71A