1KSHA

Complex of arl2 and pde delta, crystal form 2 (native)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
164
Chain Sequence
b'RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arf-like protein 2
publication title The complex of Arl2-GTP and PDE delta: from structure to function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
total genus 59
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kshA00
4M1YA 4P4TA 3LNCA 3SC3A 3LW7A 3W6OA 2OO7A 4K81B 5FPSA 1NRJB 4FWIB 2NZJA 2ZVQX 2RGNC 3AUYA 2AXPA 2WM9B 4U5XA 3C41J 4URWR 2QPAA 1AS0A 2ZPTX 4I99A 4KFRA 4PANA 1AQUA 2AK2A 1E1QD 4Z1MD 1NSFA 2WWWA 5AWFC 1GAJA 3RS5A 5J47A 4QGGA 2ZM5A 3FTQA 4P4UA 1ZU5A 3DEFA 1UDWA 1XU4A 1SXJE 3BXZA 1P62B 2ZRBA 4XSHA 2ZE6A 2ZAMA 3UANA 1G8PA 3W8RA 5KPDA 3L43A 5LD2C 4NCJA 4M4SA 2QA5A 1X8JA 2ONKA 1S4QA 5TY0A 4G3XA 1WCV1 1P73A 4UNPA 5CB8A 1QDEA 4GZMA 4OQLA 3L8YA 1YE8A 4RCZA 1MO6A 1M7HA 2A7QA 2OHFA 4E03A 2OCAA 3SJCA 4UXIA 3SHFA 4R98A 1G64A 1P2TA 2NO7A 1KDTA 4HZUB 2F1JA 4N1AA 3IO5A 3RWMB 5IK2D 3B82A 5HKKD 2V7QD 1HT2E 2YC2C 2JA1A 3M6AA 3VR2A 1EFCA 2VBCA 3QKSB 2ZSAA 3RWOA 4D25A 1E3MA 1E2PA 3LBNA 5FI1B 3PUYA 1SVSA 3GEIA 4PZYA 4C30A 1LFDB 2IYUA 2ZJYA 1BIFA 3A4LA 3NBFA 5IF9A 3B6EA 1RE0A 1OLOA 2C9CA 2P2LA 4Q1FA 4F92B 4HZUA 3G82C 4CDGA 1LV7A 4FMDB 1SVKA 3U5ZB 1CR1A 3WMFA 3U6KA 1YZNA 3OFND 3K9HA 3VU9B 2JGNA 3X1YA 1T3LA 3GJXC 2FSIA 3W3ZB 1ETUA 4Q5IA 2EW1A 2ZS8A 3OIUA 1PLJA 4A1FA 1LF0A 1MO5A 1G9XA 1UDXA 2FPLA 3ADCA 4GMDA 1NNEA 1KO1A 2WV9A 2V55B 1DS6A 1VG8A 4EPRA 3U44B 2IF2A 3T1VA 5L3SB 1CP2A 4M2LA 4JSTA 2XNSA 3VU9A 4DCNA 1FQJA 4NU0A 3KQNA 1KI8A 1JB1A 1TADA 5FR1A 3CPHA 2YOGA 4Q7JB 2O52A 2BV3A 4M1OA 1Q1ZA 1P2VA 1Z6AA 2JJ1D 3U44A 3AV0B 2I1VB 2WJHA 1OFUX 5L3SA 1OH5A 3OESA 4PC6A 3M4YA 2ZXUA 1NBME 1F2TB 1VHLA 2JIZD 4HZIA 1DEKA 2KB0A 4TQUS 2XNDA 2FWRA 2XAUA 4OL0A 4WAUA 1OPXA 2ZU6A 1G8FA 2RGXA 3IQXA 3W9YA 3THYB 2NMVA 2C95A 2EFHB 4UNSA 3KXIA 2FE4A 1VG1A 4ARZA 1YRAA 2P6UA 2CEAA 1AKYA 1ZM3A 1F2TA 1YZLA 1US8A 3I4LA 5F98A 4JBXA 1A1VA 4L15A 4C0BA 4PO8A 1DELA 4U7DA 4NYJR 1DAKA 1OSNA 1GKIA 2FX3A 3F3YA 3THYA 2RMKA 1EWRA 2ZETA 2QE7D 1G3QA 3HU2A 4RFSB 3V00A 3VKWA 5BN5A 4Q9IA 3SQWA 1GRRA 1UJ2A 4LK2A 4A4DA 1NG1A 1A82A 2FMXA 4LJAA 1Q1QA 3VKGA 2I4IA 1W5TA 3BRWD 1Z08A 3VR3A 2W83A 1E1QA 1XCMA 2H16A 3U60B 1D5CA 3L82B 4XWKA 4RFSA 4D0NA 1G3RA 3FYHA 4Q21A 5E7MA 2QPOA 1P61B 2NG1A 5GJVC 1HURA 2F7SA 2UKDA 3RNLA 3KFVA 5EZ6B 2IS6A 2IS2A 1AZSC 1E1RD 4ILEA 3QVUA 1IOZA 1HH4A 4IHQA 2XSZD 4NKRA 2GBLC 2V6JA 4HAXA 3FFBA 1OW3B 5AUPB 1ZW6A 4G5SA 4WIAA 1G1MA 3EZFA 2GF0A 2Z4SA 4OQMA 2ODWA 1OXVA 2A30A 5B2ZA 5IK2A 5HKKA 1JALA 1M74A 4NCNA 4IEEA 4BUJA 4I81A 2F43B 2H1LA 2J9RA 1H65A 2WBLC 2WMOB 3B1ZA 5BN3A 1AGRA 4EFMA 2O8EB 1R5BA 2VF8A 2YKGA 2HYDA 2A5DA 4E22A 3BFKA 5H8WA 1DBSA 1EFRD 1XTIA 1GL9B 3FFAA 4R2HA 4ZKDA 3DZDA 5FTLA 1ZIPA 1RJ9A 1TQ4A 1TQDA 1R6BX 4Q7KA 5JRJA 1MABA 4B43A 4GPTA 3OFNA 5CDFA 3UG6A 2O8EA 4HLUA 1N5KA 1II8A 2WJGA 1LS1A 2AX4A 2YHSA 3L2OB 3BD9A 2GA8A 4RD4A 1W4RA 2QG6A 2JEOA 1KK2A 1MKYA 2W58A 4KFUA 5HE9A 4RFVA 1IJFA 1E79D 3ZJYA 3QJYA 2O8BB 1VYTA 1KJWA 1H8HD 2FZ4A 4URXR 2ZI3A 1P2UA 5FOWA 3X1DA 2QQ0A 4M1TA 4Q4AB 1I4DD 2FFBA 2PH1A 3P27A 3BB3A 5TB5A 1S2MA 2B7BA 3KKQA 2VO1A 1QG4A 5SZIA 4A0GA 4EPVA 3OIVA 3CR7A 4B74A 3I72A 4RSGA 1JBKA 5JFGA 3KTAB 3E5HA 3M1IA 3P1JA 4B2PA 3EPLA 2O8BA 2JJ1A 1VHTA 1MT0A 3OEEA 4V0NA 2RKOA 4Q4AA 4XJXA 3TSWA 2ZRCA 3EX7C 2JIZA 2VTKA 1U2RA 2UVQA 3KB2A 2ZI7A 4AYWA 1IY1A 4LPKA 2K5UA 2QTHA 4MH0R 2O8DB 3CZPA 2J87A 3KTAA 3D8BA 3PITA 4PZLA 1V5WA 1VCNA 2XXAA 4BLTA 2BJWA 2VHUA 1ZC3A 4TL8A 5EXSA 1GITA 2CJWA 1TEVA 1P75A 5AJVB 2BBOA 4DSTA 1VCIA 1E9DA 3CW2A 3WNDA 2O8DA 4CRWB 1I2DA 3QOFA 3F8TA 4XWAA 1FMLA 3N2EA 1G8GA 1JXOA 2BJVA 2F9LA 4OJKA 1KNQA 2AK3A 2H7VA 1MRNA 3B2EA 4GOXA 2P6RA 3VR5A 1J90A 2ZR9A 1OF1A 1JAHA 2DHRA 4B44A 1NL3A 2AXNA 2R6GA 3CUEF 3MSXA 1M6NA 4HAYA 2YINC 4JS0A 2H57A 1U0HC 3W6PA 1OFTA 4G5OA 3Q7QA 1XBTA 1CLUA 4QKQA 3AVQA 4LGMA 4LOAA 1CEEA 2J5XA 1PZNA 2FU5C 4GOKA 3MCAA 5HE8A 4TMKA 2GCOB 4TMTA 4A8JC 4OHXA 1U0JA 1OXSC 2ZS9A 3IILA 2OESA 1NSTA 1JQJC 4AC9A 3SFZA 2CE7A 3CIOA 3I8SA 5EJEA 2XSZA 1LTQA 4W5HA 2GKSA 1VCOA 3PV0A 2FZLA 3CWZA 1BOFA 4LJ5A 2LWIA 5SZKB 1SHKA 4TYPA 2GEDA 3PXGA 1YR9A 1AN0A 2NPFA 5HTKA 1G5PA 2GJSA 3LA6A 1U0LA 3LLMA 3NH6A 5FOXA 2IYQA 1SXJD 1TF5A 4UNRA 4JYBA 4A6PA 2WTUA 2VP6A 4Y0AA 3T15A 3LXRA 2ZRIA 3D3QA 4CW7A 4W9MC 2W2XA 3L0PA 5BQ5A 2ZJBA 4MRRA 4DDVA 1Q12A 4BFXA 1AS2A 1JR3D 2W00A 4C0SA 1KZGB 2HJGA 3CRVA 3BFVA 3NXSA 4WXPA 2AN9A 2FSHA 1E99A 1NIJA 3IKJA 3M0EA 2DFNA 1TU4A 4B34A 1UBGA 3BE4A 2JLVA 3P26A 3UG7A 1CIPA 4D4JA 5D3MA 1HUQA 1KJZA 1X1SA 2QP3A 3DMDA 1HQYE 4I1UA 1EWQA 1E79A 5FTJA 2QGZA 1G21E 1H8HA 3DDCA 4DLVA 2G1KA 1TUEA 4NYIR 1CJVC 2V8OA 4WZ6A 1E0JA 3IHLA 2HF8A 3DPUA 4DRZA 1K5DA 4PPQA 5AJYA 1HTWA 2QP4A 5LB2A 5EP1A 3K53A 2IUTA 1X1RA 2ZS7A 4NL4H 3VHXA 4LWZA 1T9HA 1OIXA 2R2AA 1COWD 1JNYA 1WRBA 5KDOA 4L9SA 2H92A 4IDHA 4XTRA 4DZZA 3D31A 3RHFA 4GI7A 1WXQA 3NHBA 1W1WA 3VMFA 4ZDKA 2OSBA 2V3CC 5EXTA 4LBVA 521PA 3ZS9A 1ZUIA 4AYXA 5B57C 1ELOA 2WKQA 4B2LA 3SI7A 5EUMA 2IS4A 1YJ5A 1KDRA 4NHOA 4N3NA 2WWFA 1GOTA 1F2UA 4BLSA 4A2WA 2NPIA 2A5YB 2JATA 2YZ2A 1KI6B 5C2JB 1W36C 1KMQA 3VKHA 4OI4A 1KY3A 4OQNA 4POAA 5FPKA 1Q21A 4PPFA 5TDHA 1NY6A 2EWVA 1E9EA 1Z0KA 3THOA 1EFHA 2C98A 2GRJA 3IIKA 3RS7A 2HV8A 2FGKA 4M9QA 1CJUC 4FD2A 2NGRA 5AR1A 2ZJ2A 2R44A 1DAFA 3WP1B 1G291 5DLQC 1E0KA 4QBIA 3L8ZA 1GL7A 2YV5A 3TE6A 1T8UA 2RB4A 4XWOA 1AZTA 1ZM4A 1WE2A 3FPAA 2WMNB 1LS6A 3CRRA 4D0GA 3T06B 3SJAA 4NDZA 2XX3A 4DWJA 3RRYA 1QBKC 1RRFA 3QENA 1G19A 1NI3A 2IYWA 3WBJA 2WSSD 5LPNA 2WVJA 3JZMA 3MUFA 2N46A 4WOPA 3QE0A 4FCWA 3GFTA 2FFHA 3C15C 2DFTA 4CT4B 2MMGA 2XEXA 4UQOA 1OE0A 3AKDA 1OXUA 1P2SA 3ONWA 4BFSA 1XEXB 4MITA 1J8YF 3VR4A 1UF9A 2OT3B 3AVOA 1XB2A 4B2IA 1PLLA 1RVDA 2FEOA 5BXQC 3KKOA 2VYFA 1F3OA 3KUCA 1NLZA 1OH8A 1RRGA 1Z6XA 4KO8A 3GLHB 3QUSA 4LPSA 1Q20A 4CGZA 4LJ4A 1G4AE 1JPJA 2XOKD 3T34A 1SXJA 3K09C 1F5NA 3WHLA 2PZEA 1MOZA 4ZIRB 1JJVA 1VPLA 4K8OA 1XPOA 3TUZC 1LW7A 2HEIA 1DO0A 3N70A 4B35A 3H84A 1W4AA 3GLHA 1JR3A 3KKMA 3AP3A 4YMWA 2ZJ8A 1ESMA 4ZIRA 5KSZA 3UWKA 4B33A 2G0NA 1SVOA 1UPTA 3CF0A 2YWHA 4QJ5A 2JJ2D 2VHTA 1YR8A 4LJ8A 4WBSA 3H86A 1ZNWA 4GSYA 1S1MA 2R6DA 4AIIA 2R65A 3RS3A 4RCYA 4F7WA 5AJZA 2QBYB 2VEDA 1P9NA 5JRZA 2AD5A 1NP6A 1R4AA 1GKUB 2GILA 1DTSA 3I32A 4Q4HB 1KO4A 1LVGA 1XTJA 4M21A 2C9OA 2RGAA 1DG3A 3X1ZA 1XD2B 2QT0A 3GJ8A 1W5SA 2NZ8A 2EFCB 1AJEA 2F9MA 2PL3A 4Q4LA 5JJLA 2MSCB 3BFXA 1JPNA 2VP0A 3CLVA 1H8ED 3R7WB 2SHKA 3N5CA 3UPUA 4Q4HA 2GK7A 2BMFA 3BC1A 2QMHA 2YC4C 1J8MF 2ZJAA 1XD2A 5FPYA 1X86B 1KIMA 2ZU0C 3IEUA 4TLCA 3F5FA 3WYGA 4DIDA 5B64A 2QSYA 5JS7A 5K8IA 2QNRA 3K70B 2NO1A 1K8RA 2HDNB 3NEYA 1E2NA 2X2FA 3B1VA 2QAGC 4EFNA 1T4GA 3L0SA 2CVHA 1IN8A 5EP2A 4OQXA 4URVR 3NH9A 2AD1A 3TW4A 1F60A 4B3DA 1J70A 2WJYA 4QNMA 4XTCS 1CULC 1SHZA 2N1BA 1TMKA 3U7EB 2BMDA 4JVMA 2TMKA 3KB1A 2ZE7A 1SVLA 2B92A 5FOTA 2Z5FA 2CVFA 2PEYA 4G5QA 1GUAA 3U7FB 2GVDC 3RRNA 2UZ3A 4NE2A 1NVVR 2V1XA 1Z6YA 1E2IA 3F0TA 3SHWA 3ZVNA 1NMZA 4BZPA 2V9PA 1D8TA 2GCNA 4V0ME 3ZZUA 1ONBA 3IUYA 4LUCA 4A92A 1CS4C 4US2R 1E6CA 5FBQB 4F4JA 1R8QA 2GJKA 1B23P 1DPFA 1S8FA 5L3VA 1M8PA 4MYHA 3PG5A 3FE2A 3PVSA 4O0MA 1KI1A 3A58B 3KJEA 4L4UA 3RANA 2WSSA 1FX0B 1J99A 5EE1A 5KSPA 5L8VA 1UKZA 3B9PA 3QXHA 4D80A 4TL7A 3CNLA 3SBDA 4DCVA 3Q85A 4IEIA 3CX6A 1G20E 3QBVA 5G41A 4I4LA 2RCNA 3WYFA 4N0EA 1LNZA 2X1VA 4JLOA 1N6KA 4DLXA 2KJQA 4JBYA 4GRAA 1J2JA 3AVPA 3EC2A 3GEEA 5EE3A 5G53C 5DISB 1XPUA 4W5JA 3TNFA 3AGQA 2C8VA 1KMHB 2DWOA 2J0QA 2XOKA 5BYJA 2DB3A 4HUTA 2KE5A 3EPJA 3UIEA 4I1OA 4DCSA 2P67A 2GZDA 4LDJA 5CJPA 4Q1AA 3N2IA 1WA5A 4KYUA 1OKKD 2GCPA 4PC1A 1AK2A 5KTYA 2BBSA 2F1IA 2C5LA 3CZQA 1KY2A 1KMHA 4B3XA 2RHMA 1Z06A 5TVKA 2ZQ5A 4EUNA 4Z8XA 1GTVA 4P33A 4PC2A 3LQRA 2P3SA 3DKVA 2E1RA 2QEQA 5JI3E 5EZ5A 3T12A 4LJ6A 4GMXA 4D81A 2J46A 2VSOA 1FP7A 4PSKA 1G8HA 1E9SA 1II0A 2X2EA 4BE7B 2IWHA 2NIPA 2OCYC 1KI4A 5CM8B 3GJ0A 2EFGA 4RZ3A 4ZDJA 4J0QA 4MKFA 2P5TB 2LCFA 3EC1A 1OHHD 2PLRA 3KX2A 4M8NE 5LDDC 3GLGB 4EJSC 5JCPA 2YOHA 2L0XA 2RGEA 1N5LA 3EZ9A 3KKNA 4M9SA 5G3YA 4BFWA 4R7ZA 2W0SA 3QEJA 1XWIA 2BMEA 3AKCA 2CMKA 4EPTA 1H8EA 1BYUA 1CR0A 1N6RA 3GLGA 1W48A 2J7PA 2GJ8A 2XZPA 2ZIAA 1X3SA 2ZI4A 4GZLA 4BPBA 4BFVA 1ZJ6A 1FW6A 2D2FA 2O0KA 1XX6A 3CR8A 4LX0A 1P3JA 3VR1A 2D4HA 3NBZC 4KLZA 2IUUA 2YNMA 5F9HA 5CJ2A 1U90A 2ZYUX 4Q9JA 1TF2A 4HSEA 5KNCA 4QHTA 1Y63A 4C0JA 1Z22A 1X8LA 4O2RA 4CF7A 1N5JA 3A1UA 3AVXA 1YR6A 3V4FA 4QHSA 4KVGA 4NYJQ 1ZAKA 1TPZA 5FBRB 4QJ3A 1IAQA 4HYYA 1U8ZA 2VSFA 1WMSA 3PIRA 2R6AA 4RD3A 5LB4A 3W5JA 3BS4A 1KO8A 3U2QA 4PAOA 3ZIAD 3VNUA 1R2QA 1C4OA 3BWDD 2ZR7A 1L4YA 4AYTA 2IBMA 4BFUA 4P32A 2EYUA 2C2HA 4DLTA 5J5CA 1D9XA 4JVSB 3VX3A 4BEBA 4KBGA 3GFPA 2HLDD 4B6FA 3FKQA 1TX4B 2RGCA 3B78A 4HATA 2BBTA 4D4MA 1EG7A 3E70C 1N5IA 4LHXA 1NN1A 4LCBA 1SVWA 4AKIA 3H4MA 1OFHA 3GPLA 1EFTA 4CEHA 1LF5A 1GIAA 4QBHA 3HU1A 4DBLC 3VHLB 2PCLA 4A9AA 1BYIA 5JMTA 2CLDX 4ZKEA 2B8WA 4FN5A 5FR2A 3WMEA 4EQ6A 2ZUCA 4WZBE 1RYFA 3IO3A 3MWKA 1G6HA 1N0UA 1DVRA 4F4IA 1V43A 5J4LA 1E2QA 3AM1A 3MG9A 2WKPA 4TL6A 1ZCAA 4LHWA 1BMFD 2H8KA 4YQFA 2R9VA 2IW3A 1IY2A 2PLFA 1E9CA 4TSFD 3ZGXA 2D06A 5KYKA 4IVRA 2WWHA 2IYSA 4M53A 3KQUA 1OKKA 2BC9A 3O8RA 1JECA 2F6RA 2LKDA 3I61A 4HB2A 2OZEA 4CEIA 4URUR 4JLMA 4ARZB 4F38A 4DLWA 1M7BA 2IL1A 1US8B 1S3GA 4Q1CA 1OB5A 2WOJA 1E4VA 1R8SA 4HLQB 5DE3A 3EZ2A 1U81A 2Q9CA 2CCGA 4Q48A 1PJRA 2X77A 1CXZA 1P5ZB 5FUWA 3CPEA 1E0SA 4LV5B 2XTMA 3RS4A 2IK8A 1E2LA 4LJ7A 1ZNXA 3TSOA 4DB4A 4HAVA 1CJMA 1DAHA 4G0NA 5FUXA 3IIMA 2CBZA 4C0LA 1R0XA 1E2HA 2PJRA 4BRUA 2V6IA 3BB4A 5IHPA 3A1VA 1DAEA 2W6ID 5EE5B 3AP1A 3QXJA 2DYKA 3AF0A 2QGNA 3ZZTA 3WRYC 1KSJA 3PUWA 3QXXA 1U9IA 1YVDA 1ZNYA 3IPXA 4LY6A 3K8YA 1Y3AA 4Z1MA 3WY9A 1XJQA 4LJYA 3B1WA 3OAAD 3E2IA 3U3KA 2RAPA 4IKEA 2R6FA 3EZ7A 3X1XA 5KU1A 1AS3A 2HYIC 1FUUA 3ZQJA 1KK3A 1VECA 3I1FA 2O8FA 5HPYB 3UXMA 3MD0A 3C16C 2GJ9A 3OZXA 3X1WA 1LB1B 1QHHB 4JL8A 4US0R 5BWMA 1RYHA 2IYVA 4HLCA 5KPJA 5EXXA 1W0JD 4UXJA 1KKLA 1J7KA 4KV9A 1R0YA 5C4GB 4GL2A 5E4FA 4QNRA 2I3BA 4M1WA 3ZIAA 2IXFA 4QL3A 3PUVA 2MMCA 1RJ9B 4ESHA 2OXRA 1XMVA 2V7QA 1QHHA 1MABB 2QSZA 3IGFA 4TZ0A 1KSHA 2O0HA 2ZRNA 3P4XA 1PUJA 1II8B 2HLDA 3ZVMA 3V4RA 5FI0B 1YZUA 2NO9A 2BDTA 3NHAA 2EVWX 2JLUA 2PEZA 3GLIA 2WWIA 3LY5A 3ND8A 3AF3A 1XMJA 2VP4A 4C9BA 3QPWA 4JT2A 1KHTA 4JKIA 1Z0FA 2GWHA 1JQLB 5EP4A 4MDFA 1Q57A 1MO4A 2JDID 2VA8A 1Z6TA 1P9RA 3H0KA 2IYLD 2WAYA 3Q9LA 4A2PA 2P5SA 1BMFA 1E98A 1TEXA 3GJ6A 4II7A 1DARA 2EQBA 2PMKA 1A4RA 4PC3A 4TSFA 4ZPXA 5EE9A 1B0UA 3CH4B 3HR7A 2ZRMA 3GLFB 1HYQA 4A82A 1T3HA 2C78A 4BLRA 2DPXA 2UZIR 3EW9A 4JVNA 1U8YA 4FINA 4KVAA 5CIWA 2XXAB 1XXHA 2DY1A 3AKYA 5AUOB 2QAJA 2VH5R 2G1JA 1E2KA 1DO2A 2FPMA 3CF2A 3O8BA 3ICQB 1ZRHA 2CJWB 2B8TA 2X8AA 1QHSA 2VP9A 1QF9A 2VP5A 5G40A 3GLFA 2VLIA 2GESA 5JEEA 4NMMA 2NO0A 1L4UA 1QG2A 1SKYB 4B73A 3D6TB 2DWPA 3DOEA 1U8AA 4RKFA 3SZRA 1UEJA 2BCJQ 4M9XA 3VX4A 3KQLA 1T8TA 3SYLA 1ZBDA 3LV8A 4NYIQ 1HQCA 1E4YA 2EU8A 4TT3D 1AIPA 2PX0A 3I62A 3B9QA 5J4KA 2X19A 4TLDA 1U99A 4DEXA 3IPYA 5GVSA 4Q9KA 5AJWA 2OLKA 2REXB 5EP3A 5GJWC 1OT3A 2OCBA 2QE7A 3CM0A 3PCRB 1GNRA 4YLGA 4IFBA 4P4SB 3S1AB 5KNBA 2RHDA 2W6IA 3KDSE 2Z4RA 2OAP1 4FWTA 5FBLB 1ZMXA 4WXRA 3ZZ0A 4BLOA 3NKVA 3B5JA 3NIBA 4UJ3A 4BGDA 2N42A 1FQKA 4RD0A 2QUZA 2PMDA 4YDSA 2ZRFA 2IEZA 4JZKA 4P4SA 2DWQA 3EPHA 3LLUA 4TMWA 3S1AA 3WYAA 3E1SA 4HI0E 1CTQA 2WKRA 2OFWA 1HA3A 2AFIE 4JLDA 2J45A 3HR8A 3ZQ6A 3IHWA 4P31A 2PX3A 1E1RA 1R10A 4RKEA 1G3IA 1RZ3A 3RAPR 2YJTD 1I2MA 1FNMA 3KJIA 4MUBA 3B1YA 4S35A 1UKVY 1Z6GA 1SULA 3NG1A 1ESNA 5KDDA 1S1CA 3TGPA 1W44A 1YRBA 2FG5A 4MRSA 2IYYA 1A2BA 4EKDA 4QFMA 5H68A 3EWSA 1FFHA 3PEUA 2DR3A 3CKLA 1NVUQ 3T61A 1P60A 1GNPA 4Z51A 4G1UC 3SNHA 1EFRA 5D3MB 4L5BA 421PA 4D2IA 1TQ2A 4TWZA 2V4ZA 1CR2A 3RDPA 2FOLA 4LRWA 3MWJA 3AF4A 2EFEB 4JLAA 2JLRA 2PBRA 2NTYC 2VSXA 4R9UC 1BS1A 2WPDD 1ZD1A 2Q9AA 4UJ5A 4KCGA 3FDIA 721PA 3T1OA 4IDPA 2P6NA 1YZTA 2EFDB 4MRPA 2JDIA 2D74A 3ZYCA 3W34A 3R9IA 1OXTA 3I92A 3HPQA 3BAFA 3FOZA 4XIGS 3K70C 1JEEA 2O5VA 2GK6A 2Z0MA 1G4UR 4WVFA 2ZYTX 2DFLA 4DCUA 2ERYA 3C5CA 4LSGA 2GZHA 1N6IA 3EIHA 1Q22A 2GXUA 4LYHA 1NN0A 3RSOA 1KSGA 5JEDA 3TJZA 4HEJA 1X6VA 4QGHA 4CT5A 4BRWA 1MH1A 4B3BA 1DAIA 2OILA 1IXSB 4DLZA 1F2UB 1Z0IA 2G6BA 2QZ4A 4D82A 2ZRPA 4NTZA 1DE0A 2O0JA 3LVRE 1N2CE 1OYWA 1SVMA 2GBLA 3UMSA 4G5GA 1VCMA 2Q21A 1YKSA 3SBEA 1Z29A 2AKYA 3DHWC 4HUQB 1XPRA 4OJQA 4A0FA 2AHOA 1G7RA 3RRZA 1KKMA 5FBVB 2IYTA 1L7VC 2G77B 3ZD7A 4HDCA 2WICA 4FCTA 4IJMA 1ODFA 1P72A 3FB4A 4TT3A 2CHGA 1ZNZA 2OBLA 3AH8A 4YMUA 4AD8A 3PENA 4HB3A 2A5FA 4HUQA 4PAQA 1IN7A 4XVRA 4M1MA 4OHVA 1NBMD 1ZD9A 1E9FA 3PQCA 5DN6D 3QEOA 3KZ1E 4KHZA 2ZI9A 5LBIA 4JMPA 3SYKA 4H1UA 4NP6A 3I73A 1GG2A 1JAIA 2GXSA 2GXQA 1AKEA 1R0WA 3U3MA 1XJ0A 1JR6A 4IW3B 4OKSA 3ZVLA 3ADBA 4M9ZA 4K46A 3ZDQA 1VDZA 621PA 1DADA 1W47A 4PHHA 1UKEA 4ZCIA 4FMCF 2ANCA 2YOFA 5HR5A 2VHCA 3O8DA 5CDFE 1P7CA 2JLQA 2OAQ1 4XH9B 3GJ5A 3GCGA 1UKYA 4V0KA 1SXJB 3JVVA 1FTSA 2IUSA 2FSGA 3O47A 1E9AA 5G3ZA 5BYKA 1WF3A 1NN3A 2WWGA 1DOAA 4DDUA 2ZROA 2GHIA 5CLLA 4PSAA 5FPHA 2W6JD 3QPUA 2ZSDA 1NVVQ 5DIFA 3Q72A 1ZU4A 4DLRA 2JASA 5JZVA 2IYZA 3BORA 1IONA 2PCJA 2PZFA 3C14C 5CK4A 4KJZA 3ZLJA 1IN6A 1DAMA 1KZ7B 5CITA 1NY5A 1XEWX 5FL7D 5J40A 3BIFA 1W36D 1JJ7A 1AM4D 1Q1BA 2ZVPX 5JCZA 1XTRA 2ZRHA 4MYTA 4W5WA 2QORA 4JLBA 4BASA 2WPDA 1IQPA 3NBYC 2HJVA 3K0EA 5DNYB 4C2TA 1ZUNB 3CX8A 2GEUA 1O87A 1CR4A 2YWEA 4PR0A 2WHXA 4Q19A 4KSCA 3RS2A 3TUIC 1ZM9A 2CCJA 3J81k 3CF6R 5JHGB 4A0RA 2EWWA 4A0HA 2Z83A 4YDHB 3ZVRA 1NVWQ 4PQYA 4DDTA 2ZRJA 4ZI2A 4ON9A 4JL5A 3KQHA 4TYWA 1AQYA 4Q18A 3QPVA 3UK6A 4LYFA 4IXNA 4H1VA 3Q5DA 1UBCA 4RZUA 2DCUA 1KDOA 4HAUA 3DKPA 3RYTC 4DJTA 1GFIA 1FMJA 1CF4A 4Z8YA 1E9RA 2BKEA 2YWGA 2WIBA 1COWA 4JJKA 2H5EA 2Q3HA 4A8JA 4IFEA 1T0JB 1KAOA 4C3ZA 1KOFA 5E7IA 1XFAA 1W0KD 1M2OB 4KI0A 1C1YA 5CIQA 4B76A 2J0SA 4QM7A 2CLCX 1ZUHA 2XJ9A 1HT1E 3D7MA 2ZRDA 1KNXA 3FVQA 1BKDR 2RGBA 3MMPA 5E7JA 2CDNA 3H1TA 3SOPA 4EAQA 4JT4A 1ZCBA 2ERXA 3KUDA 3OF5A 4DHEA 3V9PA 1KDPA 4JIMA 2ORIA 5CYOA 2QI9C 2ZRLA 2ZYVX 2B21A 4OHWA 3U7GA 1N0WA 4Q7MB 2ZSFA 3K0CA 4HDOB 4DCTA 1L8QA 2Z6VA 4KXFB 2Z43A 4HB4A 3MAAC 1NLYA 3WNCA 1E2JA 3TQCA 1CJKC 3MFYA 4E09A 1GL6A 1VYUA 2KBFA 3A4MA 2J1LA 3GD7A 5JS8A 1XP8A 5F2EA 3QXSA 3NDBB 1NBMA 3GEHA 2I1QA 5JBQA 3A1SA 2ZSEA 4ZO4A 2WAXA 3B13B 3CO5A 2V54A 1XDBA 2C96A 3ZS8A 4V0OA 5J4HA 3SE0A 2CE2X 3TMKA 3QVVA 2FSFA 3B1XA 2XITA 2WJVA 4PHGA 1YU9A 3ECCA 4N0DA 2IXEA 2PT5A 2QMUA 2GAAA 4D4LA 2XZLA 1NKSA 5FUVA 1TU3A 1KK0A 2GJAA 2HCJB 3Q7PA 4QBGB 3VQTA 5IT5A 3UATA 1DG1G 1IJEA 2QQEA 4QGAA 1T5LA 1XCGB 3B85A 5JHHB 2A3RA 3VTKA 1ZIOA 4TQ9A 3C7KA 3KKPA 2JAQA 1A2KC 4G01B 1N3BA 3WXMA 3KXKA 2ZJ5A 3UKDA 4DDWA 5FFMA 2ZANA 2W6JA 3GJ4A 1IXRC 4NCHA 1T0HB 3HP1A 1WB9A 1OIVA 2V1UA 5CK5A 1HE1C 2F3RA 4ZCLA 4JJZA 3AUXA 1Z0DA 2F1RA 1QHGA 3BBPA 3TR5A 1KK1A 4IVQA 5JWHA 4DC9A 1OJLA 3QXCA 4TTQA 3EIQA 5TXGA 2BKUA 2P65A 4PHFA 2FPKA 5JSZA 4MYUA 4LBYA 2QMOA 3LAWA 2JLZA 2ECKA 5TARA 1GSIA 1XMSA 4TYNA 4Q9HA 2J3EA 1XTQA 1E2DA 2ZRAA 1FNNA 3GJ3A 4XVQA 2ONJA 3TW8B 2JJ2A 5TMPA 2A5GA 3TIFA 3SFVA 4B32A 3LVQE 3GFOA 3U3RA 1OIWA 4D4KA 1CU1A 4XOIA 3U3OA 5FBWB 4UNNA 5C1BA 2D62A 4QJ4A 4RZXA 4JYCA 5CB6A 1KI2A 4C7OA 5AUQA 4FXPA 2B6HA 3EZ6A 4DSNA 4OK3A 2BEJA 5K8TA 4ACAA 1IY0A 4P0TA 4Q47A 3AGPA 2VIIA 4GP7A 3QF4A 4NYMR 3TUJC 1ZINA 2BCGY 4C0KA 1Q3HA 1KYIA 2A2ZA 5JWRA 1W0KA 3U61B 3QSYA 3K0FB 5H1YA 8OHMA 3LH5A 2HUPA 4QHYA 1Z07A 2C9YA 5L3RA 3MWYW 4L16A 4X8MA 1NMYA 2NO6A 4HLUC 1DAGA 2GZAA 3C8UA 4LC1A 1Z28A 1XNJA 3LDAA 3SU8A 2CNWD 2KBEA 4LYAA 1VIYA 4AY2A 2HCBA 3EXAA 3K0FA 3R8CA 3K09A 1GKYA 1FL9A 1RC8A 2QPTA 2P0EA 4Q1BA 2ZUDA 3BH7A 5DI9A 3DZ8A 2REOA 2VHJA 4C0HA 2YVUA 4MQBA 4R2IA 5HCNA 1P9WA 1IN4A 2IEYA 4BEJA 5DHAA 4M1KA 2IXGA 4US1R 2CL0X 4QM6A 5HZHA 1N6HA 2G88A 4FIDA 3JZAA 4CEHB 2XJ4A 1N6NA 2VHQA 2VF7A 4PFSA 2IHYA 5A5GA 4DSOA 3GLHE 1Z2CA 1JR3E 4EPWA 2ZEJA 4TYQA 4EQ6B 3MGCA 3THWB 1M1YE 2ZI5A 4BECA 2WWYA 2FFAA 5FL3A 2QN6A 3DOFA 1OYYA 1KGDA 3R20A 1PV4A 2J0VA 1KSFX 2NQ2C 4F93B 5FTKA 3KQKA 2XB4A 5FPTA 1E9BA 2HXSA 3TRFA 2IX3A 2Q9BA 1XZQA 3VR6A 4ZCMA 3A6PC 3U6BA 2BOVA 2ZI6A 1R7RA 4YMSA 1XEFA 4OK6A 1SVIA 4YONB 2J7KA 2JCSA 5CM9C 3OE7D 4XSGA 4TMXA 2QAGB 4CEIB 4MUAA 4KLNA 4PC7A 3RS0A 3SS8A 1IBRA 4KFTA 1VYVA 2CLSA 3ETLA 4B6EA 1O3YA 3NWJA 1EFUA 1VG0B 4NCKA 1YZKA 3HPRA 2Q3FA 3QKSA 2GXAA 2JLWA 1Z83A 1UEIA 3AEZA 4JKYA 4A2QA 1CJTC 4HLDA 2BEKA 2GTPA 3AB3A 4IOLA 1XMIA 3FKSD 2PT7A 2ZJZA 4YXWD 1S3SA 2QAGA 1OH6A 4Y0VA 1G7SA 1ZM7A 3X2SA 4I1VA 5IDVA 3KL4A 4A6XA 2DFKB 1Z0AA 3OHMA 1SQ5A 1UADA 4PO1A 3I8XA 4BZQA 2FA9A 3QQ5A 1EXMA 1XRJA 3T5GA 4B3FX 3IBYA 1SKQA 4MKHA 4X8LA 1QHXA 5DO9A 3G0HA 1XD8A 4Q01A 5H70A 4DKXA 6Q21A 2XTZA 1R0ZA 4NONA 4HAWA 2OE2A 4PQRA 1AGPA 2KSQA 3OEED 2HT1A 1OHHA 5DSZA 2ZSBA 2ZYWX 3NVAA 4JVLA 3ZD6A 4NPHA 5FUYA 2OBMA 3SN6A 2VRWA 2FV8A 3QG5A 1WBDA 3BH0A 1TUIA 1QZXA 3REGA 4IVPA 1NIPA 2QT1A 3HYTA 4DUGD 1ZP6A 3CBQA 3LWNA 1G3UA 4B75A 2ZTSA 3BOSA 1GWNA 4DSUA 1KO5A 1PVOA 3NBXX 3L0IB 4OBEA 3RC3A 4Q7LA 2Q3MA 1OXXK 2CNWA 1UM8A 3WP0A 4BLQA 3QG1A 4IDNA 1E0AA 4WA7A 3EG5A 3NC1C 1KI9A 4NZYA 5B30A 4OYHA 4DB2A 4ZDWA 3PEVA 5EXPA 4QBFA 4Q66C 2ZUBA 3FHCB 2ZITA 2BM1A 3LW8A 4NH0A 1G5RA 1FUKA 1NF3A 4M1SA 4GBMA 4RZ2A 4BLPA 3GLIB 2JLXA 1OB2A 5SZHB 1FPMA 1NG9A 2J41A 3BB1A 1P4SA 4TMVA 4EJSB 3K9NA 5M04A 3BH6A 3GJ7A 4LBZA 2IS1A 4OQFA 821PA 4MGKR 2PJZA 1RKBA 1YHNA 3G5UA 1Z3IX 1WP9A 5E3HA 2AR7A 2FH5B 1WDTA 3RSLA 2ODEA 3ADKA 3K9LA 4PZZA 4DLSA 1P6XA 2Q6TA 3TKLA 2ODBA 4EJSA 5HCIA 1E2EA 2WJJA 4AWXA 3QIAA 5FOUA 4MGIR 2FFQA 4FMDF 1KI3A 3FHOA 2Y8EA 4YMVA 1XXHB 1VG9B 4JBWA 4URZR 3OE7A 5LD2B 2RGNA 4E5UA 3AVVA 1T6NA 4Z54A 4FI3C 2ORVA 2XB2A 3WMGA 2W0MA 4PQFA 3LRPA 2GF9A 2AWNA 4JLNA 1JEDA 2D7DA 3SJBA 2F43A 4AURA 5EUQB 3FWYA 5KO2A 2OUKA 2OG2A 2IC5A 2QM8A 3ASZA 4F91B 3HDTA 3FKSA 1CRQA 4FW9A 4YXWA 3T1QA 5FH9A 1KTVA 1G7TA 3GLGE 1QRAA 3THXB 2F55A 3WNBA 1Z5ZA 1Q44A 2VL7A 2HXYA 1N25A 2QRNA 4TLAA 5GVRA 1OV4A 3T1TA 3LBIA 1S0UA 2B7CA 3PEWA 3P20A 1VIAA 4E07A 3QNUA 3ASYA 4PO9A 2G83A 1K5GA 2C03A 1I4TD 2VPPA 1W2HA 3QY0A 4M22A 3RABA 1BH2A 3A37A 3U7HB 3THXA 4R71A 4PSVA 2CXXA 4KSBA 3AVWA 2OFXA 3HU3A 5EE0A 3TVTA 3B7GA 4LHVA 1N0VC 5K8UA 3PJRA 3TK1A 3LBHA 3OIWA 3TBKA 4BWYA 1E2FA 1SXJC 2G9NA 4YMTA 1FP6A 3W3AA 2WJIA 3FMPB 1NJGA 3GQBA 4UKDA 5C4MA 5GADl 1D2MA 4MA4A 4B3GA 5A0FA 3TR0A 2FJUA 3WBKA 4ERNA 1ANKA 1T5IA 5KSOA 1M7GA 2F3TA 4DUGA 3IQWA 2MSDB 1GRQA 1QHNA 2GAOA 2WZQA 1UBFA 3OAAA 3AKEA 1XZPA 4XD7D 3PEYA 3PUXA 1EESA 1YZGA 2Q0HA 4TN1A 2QL6A 4TYYA 5AJXA 1IM2A 1ZC4A 1PUIA 3Q3JB 2GNOA 2CK3D 3NTUA 4PPNA 3EAQA 5F3WB 3CPJB 1UAAA 2AFHE 3CONA 4MGYR 1MO3A 4DLUA 1GDDA 4FMCB 4AK9A 5ELXA 2JJ8A 3SR0A 1M34E 3REFA 3K0AB 2ZR0A 1W0JA 3DO6A 4BFTA 4B71A 4LJ9A 4ACBA 4KU4A 5SZJA 3UMFA 3SDZA 2QTFA 1FZQA 4Q9LA 3TLXA 5K8LA 3HWSA 5IRCD 1T91A 3UWOA 3K0AA 3EARA 1XTKA 2A5JA 1E69A 2AL7A 2BVNA 3WRXC 2GVZC 4KITB 4D26A 1GNQA 4MDEA 5AUNB 3ICEA 4GT1A 1G7CA 2CCKA 3MRSA 4CEJB 2GCOA 3R9WA 1UBEA 1YZQA 4IRUB 4OK5A 3SJZA 2HT6A 4Q1DA 1XTSA 4ABYA 3K0SA 2R8RA 3K0CC 4OI1A 1E32A 1FTNA 4B48A 2CL7X 2BIFA 4W7SA 2H18A 1TAGA 1NN5A 3LX8A 4LV8B 4V0MA 2JLYA 2EYQA 4CEJA 1GRNA 1KI7A 2NOAA 4V03A 2OXCA 3AQ4A 3CRMA 3PUZA 4AG5A 2R62A 1RPZA 2ATXA 4HB0A 4UNQA 4GDFA 3TAUA 4C4PA 1QHIA 4KAXA 1S9DA 1VMAA 4QGFA 4DLYA 1XD9A 2QMEA 4IDQA 4LYJA 4Q4JB 2C99A 4LHZA 4GOJA 1LY1A 3I5XA 4B47A 3TAHA 4ZV4A 2ASEA 3PFIA 4HAZA 3DMNA 1R5NA 2D2EA 5EQTA 4H9GA 3FHTA 2MSEB 3DM5A 5DGXA 4PTLA 3KJHA 2PZGA 3O8CA 3THWA 2CHVA 4OI0A 3AVYA 2QTVB 4WZAE 2BM0A 3A8TA 3UMRA 1Q3TA 1W4CA 5ANRB 4L8GA 4Q4JA 3TSZA 3MWLA 1EX6A 3RLFA 2D7CA 4QC2A 4AKHA 1G16A 3ND9A 3HJNA 4IXMA 2W2TA 3U3JA 1HE8B 2RH5A 3GMTA 4CVNA 2FNAA 4KBFA 5KHOC 3I5YA 3B60A 4ZI3A 1G18A 1W46A 1G5TA 1II9A 3QF7A 5GJBA 3VNVA 2IWRA 4JLJA 3I3SR 2WSMA 2O8CB 4S2EA 5AK0A 2IYRA 1W4BA 3T35A 5J4VA 1NLFA 2ZRGA 1D2EA 4ITRC 5CYPA 1TL7C 1XCPA 2ORWA 4TLEA 2QY9A 1N6OA 2FN4A 3VAAA 4IOJA 2ZRKA 4LZZA 5DYGA 2BBWA 2FF7A 1WQ1R 3C5HA 3CWQA 4EDHA 3ADDA 3AVUA 4MRVA 4XD7A 4QG7A 3SQXA 4RD6A 4KFSA 5JLJA 3AVTA 3MJRA 3TH5A 2O8CA 1G8YA 1QHYA 4OHZA 3GLIE 2FDCA 2RGDA 1Z0JA 3SYNA 4P3YA 2BHRA 3AF2A 3K70D 1D6JA 4ASUD 4TMZA 1OH7A 2CK3A 1C9KA 1KI6A 5FOSA 1NVXQ 1TNDA 3QKRB 1OFIA 2ZAOA 1GP2A 3LD9A 5FOVA 4RD1A 1N6PA 5FTMA 1JXMA 3JVUA 3VFDA 4TZ6A 5KUTA 1MV5A 4C0QC 1IN5A 3R8FA 2GDJA 1HEIA 4HDQB 2VP2A 1QVAA 3QKRA 2XGJA 4TTPA 1TF7A 3KJGA 1G3MA 4RY2A 4MYCA 4URYR 2OM2A 1WBBA 4DEYA 4OI2A 1XXHE 3K1JA 5B58C 4GP6A 1CRPA 3OIYA 1ZM2A 4PXAA 3ZH9B 4D0LB 2XZOA 2O8FB 2ZREA 5D3QA 5J4YA 4JL6A 2C77A 4CYMA 3KXLA 2QU8A 3GLFE 1GILA 2WWXA 3BK7A 4NCIA 4L9WA 2F1HA 4O25A 2ZE8A 1A7JA 2OEPA 4RD2A 1G6OA 5GJCA 121PA 3T5DA 2W2VA 1NMXA 4MKIA 1XEXA 1IXZA 4JLVA 1SZPA 1Q0UA 4AKGA 1QVRA 1W2GA 2CL6X 1SGWA 2AKAB 4X8HA 4FCVA 1KJYA 4LC0A 2IYXA 4RVCA 1E94E 3W90A 4A8JB 3AP2A 5KNDA 2RGGA 4JLPA 3L0OA 1AA9A 2QP9X 2E87A 4LHYA 1F6BA 1SKYE 2R6CA 1A5TA 4RJLA 3AF1A 2OLJA 1MR3F 2REBA 3BGWA 1E2MA 3A36A 3IEVA 5HZKA 3CH5A 3A1TA 2HF9A 4LBWA 1PLKA 2CHQA 3FMOB 3NC0C 2J59A 1W7AA 2A78A 3CB4A 3OEHD 5JJIA 4C0AC 3CNOA 3W5IA 4F4CA 3IIJA 4IDOA 5TV2A 3RVBA 5L3QB 2YYZA 3DM9B 2ODNA 4TLBA 4ZDIA 4G5RA 4Q02A 1EX7A 1G17A 2IHBA 5DI3B 1K6MA 3WHKA 221PA 1MRSA 3U4QB 2YWFA 4KYIB 1Z47A 4O2LA 1JI0A 1NJFA 1Z8FA 2C04A 1VTKA 3IBGA 5L3QA 1TQ6A 2QBYA 1R5OA 2OBNA 1HY3A 4ESVA 5E95A 2ZE5A 3DL0A 1ZVQA 4DT1B 4MGZR 3LQQA 3LX5A 5DI3A 1EK0A 5BW8A 4EPXA 3A1WA 3U4QA 5DHFA 2IF0A 1RFLA 2J7PD 3TVDA 4NYMQ 4PAMA 1EGAA 3LXXA 1E96A 4M0LA 5A4JA 2BMJA 1XJCA 3PR1A 4PPGA 4Q1EA 5DN6A 4EFLA 1L2TA 4Q03A 3QKTA 3FMIA 4AKEA 4QOSA 4PHTA 3CNNA 3P4YA 1ZD8A 4DT1A 4A36A 1Z2AA 3R7WA 3EA0A 3FMFA 1S9HA 4IOMA 1VKJA 4BZXA 5BN4A 4U02A 4DXAA 5FTNA 3HYRA 4LV6A 2D3WA 3CRW1 3Q8XB 1CKEA 5UKDA 3MLEA 5KOYA 1RIFA 4DIEA 2ZJOA 5KSYA 1G41A 4AI6A 4ASUA 1GM5A 1RW4A 4AG6A 3B8HA 4LI0A 4D6PA 4XVUA 2QRZA 4JLKA 2E9SA 5C46F 2XTNA 1F48A 2OV2A 3Q5EA 5F9FA 3EWAA 4B3CA 4OHYA 3LFUA 4U00A 5KDLA 3QKUA 3K9GA 4BQSA 4QXAA 1W36B 2WOOA 5CLQA 1ZYUA 1CBUA 5JSZB 2AWOA 1Q1EA 1N6LA 1NKTA 5C18A 3EIEA 4Q00A 4TQAA 5DH9A 3QBTA 5JWOA 4NBSA 4QRHA 5JJKA 2ANBA 4CIDA 3GP8A 3RC8A 5P21A 2DBYA 3C4JA 3NEJA 5FL7A 2LKCA 1U9IC 2OCPA 2JLSA 1YR7A 1FOEB 1D2NA 3CRQA 2VQSA 2QM7A 3KFXA 4KODA 1TTTA 1FX0A 3A4NA 4GFDA 2GEVA 4EIWA 3R9XA 2G3YA 2IA5A 4C7OB 1D9ZA 3SEAA 4BFYA 1W49A 4MRNA 4EPYA 4UXHA 4C2UA 4YC7A 1U94A 1Z63A 2KI5A 3MJHA 4V02A 3TQFA 3W6NA 3QF4B 2A9KA 2BWJA 1UFQA 1IHUA 5JI2E 3BERA 3BJIC 5JECA 3EPKA 1U98A 2GETA 3H2YA 1XF9A 4TL9A 1RRPA 2IT1A 5DYIA 3EA5A 4TTRA 3RRMA 4BFZA 2ATVA 4A15A 1XEWY 2XNDD 2KWIA 1YQTA 2OFOA 2FGJA 3LO5A 3OEHA 1E2GA 2J0UB 2WIAA 1T3SA 4X8OA 3W8NA 1KAGA 4I1SA 4DVGA 2H17A 1GZSA 4V0LA 4GNKA 4CZ2A 4MKGA 1RRCA 3DVLA 3EASA 3IDQA 3NDPA 3P32A 2QROA 3QI2A 2QENA 2G0TA 1GVNB 3FGNA 4O3MA 1S96A 3CX7A 4JSYA 1BO6A 2FEMA 4IOKA 1HV8A 1KO7A 2J0UA 4PX9A 1I4LD 4WW0A 4FMBB 1X8KA
chains in the Genus database with same CATH superfamily
2IXAA 2IGTA 4P4TA 4HNAB 1AKUA 3LW7A 3DCIA 2OO7A 4RDIA 4Q9AA 1TJ4A 1ZIDA 3EAGA 3L7LA 3DQQA 1U7OA 2ACVA 3C39A 5ALEA 1CS0A 1CG6A 3AUYA 3D6AA 3EVAA 3QLJA 1I6KA 3TTYA 1HYBA 3LUKA 4URWR 2QPAA 1T4CA 1TT5B 3KEOA 4I99A 4TKVB 1RWXA 2VYVA 3PZBA 4G5XA 4ZD6A 3D3WB 3HM9A 4HNRA 1E1QD 2QLNA 4FR2A 5CA0A 3G0CA 4YUXA 1GAJA 4EFDA 1JU9A 2I6TA 4BVFA 1UDWA 3GYGA 1P1BA 1SXJE 3BXZA 3CG0A 3LGAA 2ZRBA 3PC8C 1N36B 5KNDH 3UANA 2DR0A 5JPIA 1NR1A 1G8PA 3C5VA 5JFTA 1JA1A 3L43A 4NCJA 4M4SA 2NSHA 3IJEB 5KPDA 2EFJA 1X8JA 4J4TA 1DFGA 5CH8A 4JUCA 4M0PA 2X2PA 3A9TA 3CZ9A 1LUAA 4G3XA 4UNPA 5TY0A 4B1FA 2W2OA 3A6DA 4B7ZA 4BO2A 3OJOA 4GZMA 4L78A 1YA4A 1R88A 1XVTA 2D5AA 4PFKA 4QUKA 3CMMA 1YE8A 1M7HA 2XUHA 5EJ5A 3ELBA 2GERA 1YRQA 3K73O 3PHJA 4FEEA 4UXIA 1L8AA 4K87A 1IZ7A 3ZWMA 5IC4A 4PIMA 5EJMA 4X85A 3MINA 2NO7A 2HBYA 2G9VA 3R5KA 4HZUB 4BPRA 3G1TA 4YP7A 2F1JA 2LV8A 2ZB4A 3A25A 4YMIA 4WBNA 3NLLA 2V7QD 3ZQ4A 1TTHA 2JA1A 2WIFA 5K1ZA 3H16A 4RTSA 3QKSB 2ZSAA 1O2DA 1WXIA 3RWOA 4EI2A 1IPHA 1PU2A 1E2PA 3FPKA 1G6KA 3KWLA 1SVSA 5FI1B 3ZYZA 4DNPA 1YOVB 2VRBA 5AKEA 2G4CA 3UH0A 4PX2A 3U4MA 2F2TA 2O05A 3RC9A 1J33A 2DQ4A 2NXEA 4O4JB 3R74A 1RE0A 1XTBA 3WYDA 1LRKA 2OHVA 2CVOA 4A16A 5CA1A 4XAQA 1O96A 2JFUA 2XNCA 4CDGA 1LV7A 1VJDA 4XIFA 4Q3OA 3U5ZB 1Z16A 3BREA 3NTRA 4LX8A 2TYSB 1YZNA 1E3TA 3VU9B 2BMWA 2AFIA 2JGNA 4N7MA 1T3LA 3C1UA 5K3BA 4RJIA 3X1YA 2I3DA 4WA8A 1IAVA 5F73A 1ETUA 2HBQA 1BXKA 1OAOA 3JW8A 2JBWA 1TM1E 5FJIA 3LC2O 4A1FA 4FJ2A 1DJPA 1UDXA 1P5HA 3MELA 3U9SA 3ZWPA 2C3YA 3OIDA 4JA0A 3PF9A 4OY3A 3ADCA 4UEOA 1TVCA 4AO8A 1DS6A 4RM3A 3HDJA 2PT6A 5B6PA 1QR6A 5L3SB 4NMHA 3I04A 1HWYA 1W88B 3LTEA 3OC0A 4DCNA 3M33A 4JLWA 1NQUA 2UZ4A 4I3HA 1TADA 1KJ9A 2YWXA 1L7AA 3CPHA 1NWHA 4I55A 3CHYA 3TKAA 5J1TB 3M2TA 4M1OA 1P2VA 1Z6AA 3DE5X 4IZIA 5DK4A 2GZRA 2I1VB 5ALHA 2WJHA 1OFUX 4QVIA 4ZHSA 5LFAA 1T1RA 3X1KA 2ZXUA 3WDSA 3RSFA 1DEKA 4P0PB 1WXEA 2XNDA 2YMMA 2D0DA 4BQPA 4WAUA 1OPXA 1ZZGA 1NKVA 2YFHA 2RGXA 3PQEA 4IMRA 1NSYA 3ZY2A 8AT1A 1ZD5A 2PPLA 4YRNA 2C95A 4U9IS 5T5QA 3UJ9A 3AIMA 2C57A 4UNSA 1YH3A 2FE4A 4W9NC 3GCDA 5LLTA 2D0PB 2PKXA 3DUWA 1YRAA 4CCSA 4EEZA 3ETEA 4YXFA 4JIGA 1US8A 1VRWA 2G09A 4W99A 5F98A 4L0QA 1GQYA 3BFPA 5CX4A 2Q0QA 4Z6KA 2WT4A 3DEIA 4N3GA 2ZB2A 4PO8A 1DELA 4YREA 4EVQA 3DJYA 3CUTA 4NYJR 1DAKA 1K08A 1OSNA 1PHRA 4QSMA 4BQQA 5JARA 3C8DA 4YDRA 5IXYA 3HU2A 2VYCA 3A7DA 4RFSB 3L07A 4IV8A 5CPFA 3V00A 4A8TA 4QXPA 5BN5A 3F7MA 4C4XA 3TTWA 2J3LA 1CEQA 2WTEA 1RXYA 1WSBA 3K20A 4LK2A 4A4DA 2VTVA 1RI3A 5I3CA 4KGDA 3RV3A 5DF1A 1TYDE 3UPTA 1Q1QA 3FZEA 4QU9A 1W5TA 2CFIA 4LZWA 3QU9A 1CNMA 1Z08A 3PGLA 3KSZO 3K6SA 3WTBA 2H16A 3P2EA 4UVIA 1FSPA 3L82B 1QTRA 2XUFA 4WBNF 2I80A 3ZHCA 5E7MA 2I3AA 4IJKA 2E21A 2QPOA 3E0XA 1T2EA 1P61B 2QTMA 2R6ZA 2XMBA 4K2AA 4JY7A 4AX4A 1DJMA 3RNLA 2C7BA 3UICA 1E1RD 1UC8A 1X0VA 1IOZA 1BE1A 1H05A 1H94A 4K1LA 3ZW9A 4IHQA 1EVKA 1MQAA 1WHTB 2C9BA 1QYVA 2GBLC 2NAFA 5CA1F 2H1VA 2BGNA 1P7PA 4U2KA 1OW3B 2X86A 3IEPA 3PL5A 2X42A 1G1MA 1EHCA 4WX2B 2VK1A 3GQVA 2V74B 3OJEA 5G0UA 2ODWA 1JHAA 1PTJC 3BRCA 2JKZA 1CRZA 5B2ZA 2O2GA 5HKKA 3SNKA 5D1HA 4GXNA 5A5FA 4IEEA 3K4QA 1JNXX 2JHPA 2NV2B 1KYZA 2J9RA 3B1ZA 3K7EA 5BN3A 3ZTYA 3CUYA 1Y4AE 5K0SA 1KC3A 4GSKA 4PCUA 2OQVA 2A5DA 3H2GA 4D9EA 4NS1A 5H9VA 1DBSA 1EFRD 1JXAA 1GPYA 1QV7A 3OUUA 4J16C 3TSAA 3DZDA 1UXJA 4EKGA 2F67A 2GX6A 1AK1A 3L93A 4MV4A 3CT4A 3OTIA 3V34A 2FDRA 2X15A 4KKVA 2H1OA 4YAWA 3TM5A 3R3ZA 5CDFA 3C8HA 3A28A 1MJNA 10MHA 4YGYA 3SZMA 4L76A 2V5UA 2WDZA 2YHSA 3T9EA 1NTRA 1LVUA 1XAHA 2GA8A 2O8NA 5DTRA 5MN6A 5JCJA 4D99A 1XXLA 1L3BA 1L8LA 5KTRA 2O59A 2JEOA 3HB1A 2C5SA 3A1FA 3FETA 2NQTA 4R8SA 3QJYA 3BZUA 2LUOA 1VYTA 2FCRA 1KJWA 3IH5A 1KDYA 1ZHHA 2GBGA 1PZXA 1T9DA 3X1DA 3UMMA 3PYLA 2VHVA 1I4DD 1TJPB 2GAJA 1MQ8B 3PJFA 2AJCA 3BB3A 3NAGA 2C5GA 3DEAA 5TMBA 5SZIA 4EPVA 2X0RA 3CR7A 4B74A 5HZGA 3ZHVA 3FYUC 5B7PA 3M1IA 4B2PA 4Q15A 1NLUA 2JJ1A 2PT9A 2ZPAA 1I3CA 3EQ6A 1XZFA 5A03A 1T3TA 4V0NA 3HXPA 4J7UA 5C81A 2RKOA 3SJUA 3VOSA 1C8BA 2RHHA 5F5NA 4XJXA 1HO3A 1MC1A 3S28A 2C4VA 1NDHA 1GZDA 2VTKA 1V26A 3N0TA 3OETA 3G3EA 3KB2A 1H2WA 2QX9A 5KZMB 3OQNA 4ZYLA 1MORA 1UZNA 4MH0R 2Z6AA 1JTVA 1K5HA 3CZPA 3GBPA 1Y8AA 2J87A 3KTAA 1E62A 4F0JA 2WPNA 2ID7A 3IOCA 1JHZA 1GD1O 3EOBI 3WO1A 4K9PA 3DHVA 3GVXA 4MQUA 1UK9A 4B6JA 5I7HA 1ZC3A 4TV8B 4DSAA 5EXSA 4W5NA 3WAKA 3TB6A 2PWZA 4JI8B 3UA4A 2JANA 1VCIA 4YBRA 3DC7A 3WNDA 1RXVA 2O8DA 3FYDA 1I2DA 3P9YA 3QOFA 1QYXA 3BMQA 2GM4A 2WZCA 1FMLA 1D03A 2EQAA 3NFYA 1X2EA 2HTFA 1I1QB 2NN3C 4Z4EA 4GX2A 1KNQA 4G0PA 1CWUA 1H2YA 4GOXA 5HJEA 2ZR9A 1OF1A 3G8YA 2DHRA 1YS4A 4F2PA 2AXNA 5EIBD 2BZ1A 3CX4A 1M6NA 4W1SA 4OXYA 2II6A 4JS0A 2GO1A 3NT4A 2Q4DA 3BMOA 3CNHA 4MWCA 3Q7QA 4B9AA 3AMVA 1SUCA 3JAWB 1MB4A 3BRWA 1CLUA 3EZXA 3AVQA 3FROA 4LOAA 4F2DA 3LCMA 4RZIA 3F2VA 4S1VA 2JFGA 3BJMA 4FWBA 5HE8A 3MOIA 3Q10A 4U3JB 4AMYA 1K68A 2FUCA 1P18A 1OXSC 3IILA 3QYFA 1ZA1A 5M3BA 2W2KB 1JQJC 2E3JA 1R0SA 3BWMA 5TC4A 3SFZA 3UWPA 1DHRA 3IJ5A 3KAQA 4FR0A 3H4VA 2FK8A 3F9IA 1XZGA 3DDHA 5EJEA 4KPEC 4W5HA 5CB4B 3OZWA 1JFFA 5CXXA 2GMWA 5TIIA 1ISMA 1B14A 2QKYA 1DRKA 3TPCA 5BWLA 3R77A 4ZTZB 1OC4A 4QULA 3D59A 1HFKA 2BGRA 2QL7A 3EE6A 4GO1A 5DXFA 2J5RA 5T4BA 1AN0A 2PYZA 1M2GA 5EJAA 4LNAA 2NPFA 3WJ7A 4MLZA 5THQA 4EL0A 1QE0A 3LCUA 1HBJA 4ALJA 5GGYA 1N4AA 1ONSA 4JGBA 5FUBA 2W2NA 4C3OB 2BEWB 2MYPA 1JEOA 2WTUA 4N6OA 2JJQA 3P94A 4CW7A 2HDHA 5BQ5A 2ZJBA 2ZYGA 2REQA 3NUZA 1KARA 3LUCA 3L7CA 4GPZA 1ST2A 1HFJA 3N8NA 4MW0A 3UYLA 1JSXA 4BFXA 4ZRNA 3TQTA 1FNBA 3CRVA 3NXSA 2JHCA 2ZRQA 3U9LA 4C5CA 4K0KB 3D9QX 4LQ4A 3RBXA 4ZU3A 2XT0A 3UB2A 1NIJA 4MZXA 1JZSA 2P0YA 5KJ1A 2J3DA 4MRAA 1TU4A 1UJCA 1TMYA 3AK4A 2Z57A 3C8MA 3GOHA 3SZUA 3SLRA 3ZU3A 5K0BA 1GXSB 3OH8A 3P26A 4M55A 5AKIA 1HUQA 1Q7RA 3Q6MA 4R1QA 5IC5A 1EGHA 1KJZA 2QP3A 2XRMA 3RSQA 5HTOA 1HQYE 1YONA 2ZTUA 4PCAA 5EPUA 1B6GA 4BU0A 5CLFA 1N2XA 3RWBA 2P1ZA 4WCVA 3F98A 1G21E 1H8HA 4FFVA 3FSGA 3LM8A 3WGJA 2G1KA 2PGIA 4FBLA 4ZC8A 3UCFA 1MG5A 3IQZA 3A4IA 4K05A 4OQYA 4HH3C 1PFQA 2G82A 4G36A 1TKCA 4K03A 4XASA 4Y6PA 4DLLA 4Z3OA 3L7OA 5F77A 1HNNA 3OZUA 2NYAA 2PSHA 1EUDB 5CT9A 1XNRB 2DGDA 4W5QA 1U8CB 4EYOA 4HEHA 3SF8A 1WRBA 4WY5A 3QLVC 5F2OA 1UODA 2HA3A 1CUFA 5HJ7A 3T7KA 1T4MA 5T3UA 5LJLA 4GI7A 4R5HA 3NHBA 3NVDA 4EP1A 5CAEA 4RXTA 1X7ZA 4CR6A 3HY6A 4BVKA 2OSBA 3EUAA 3CVOA 2WV7A 3X43A 1AKTA 5EXTA 4ZT7A 1XDSA 4HQLA 1U8XX 3TL2A 4J2HA 4LSZA 4ZAXA 5AJTA 4X90A 5ICMA 2IS4A 4PE5B 1QYIA 3KZKA 2GA9A 1GOTA 1F2UA 1T2CA 1M5TA 1GVHA 3NUGA 3R0XA 4MUGA 1KI6B 3OTQA 1LA2A 2JIPA 2XZTA 3D8TA 3H99A 3IV7A 4ITUA 1AB5A 1SBCA 4OI4A 5JSUA 4QODA 1F4LA 4POAA 1ZN7A 2RG7A 5A3QA 1OC2A 2OLEA 4R0MA 1E9EA 4HJRA 2X3UA 1DKMA 3MT0A 4P92A 3FWKA 1GPKA 2Q2QA 4G9BA 4CQNA 1H4SA 4M9QA 1AHIA 1UXGA 3SEQA 4FD2A 1KU0A 4OP3A 3SSMA 2R44A 1I14A 1U3DA 2AN3A 3PP8A 4ZQGA 1IULA 1R5JA 2E55A 3KOWA 4P82A 1UH5A 3VDXA 2C0QA 2WI8A 3GDGA 3SC2A 1U04A 2RB4A 4QTYA 3HXQA 5DM4A 4DE5A 1NRWA 5FORA 2P9YA 1K06A 3FPAA 4YAFA 4B31A 7YASA 1Q19A 2XT9A 3SQNA 4Y2YA 5FX2A 2DUNA 4K6KA 3QYJA 2XX3A 1R4MB 3EDCA 3RRYA 3CKYA 4PV7A 3QENA 3R41A 3ZLBA 3G85A 4ZJYA 1JLRA 1U7DA 3O4FA 3T7SA 4BP9A 2WVJA 3JZMA 3ORSA 3MUFA 1NMEA 1Y5MA 2HPVA 3O8OB 3D3NA 4WOPA 3TECE 1BVHA 4G97A 4H7KA 1H9CA 2XIJA 1U2SA 1BU8A 2FFJA 2HWXA 2QQFA 2G4VA 3WLNA 1T9GS 1UF9A 2OT3B 2X1MA 3MEQA 3N7TA 1UK6A 4XA8A 4KIUA 3KKOA 5F1KA 1FFDA 3E15A 1BRMA 3RIGA 5IWCA 5CVUA 1NLZA 5D3KA 2V4UA 3QUSA 4XIJA 4GEKA 5TGZA 2HDOA 2XOKD 3BG5A 1SXJA 5JAOA 1F5NA 1LBTA 2IPOA 3ND7A 1JJVA 1XNGA 2K2QB 3IJRA 4R3NA 3UN1A 4DF3A 4BVHA 2OPBA 2WSYB 2A1IA 1X80B 2CJYA 1JUDA 2HLHA 2A0WA 2WE7A 4JITA 1W4AA 1E61A 3HMKA 5H3LA 1ISSA 2WTXA 1XQ1A 4YWJA 3KKMA 4ZWNA 1M1YA 1W87A 4WFQA 2P9ZA 2RHTA 3UWKA 3WL5A 4B33A 1YI0A 3G9XA 1SVOA 4RE5A 1A8IA 2RI1A 5ED4A 1PWZA 3BHIA 4ZGWA 4DNXA 1CEXA 1XLTA 1Q1AA 3LKDA 3HCFA 4O4IB 3JY6A 1ZNWA 4GSYA 4YI5A 4RSHA 5BNFA 4AIIA 4F7WA 2PRZA 2QBYB 4LQDA 1U80A 3AONB 2OV3A 1P9NA 1D0SA 1WZCA 2V7GA 3DVQX 3LIIA 5JRZA 2AD5A 3TVYA 2JGRA 1A95A 3ZXUB 1QFXA 1F3LA 1GKUB 1JYEA 2WYIA 2FOXA 3G2KA 1KO4A 3KQWA 4V0QA 4DPMA 3G5TA 1EGVB 4WCFB 3RE1A 3RKUA 4BIMA 1DAOA 1XD2B 2UUCB 3PFWO 4G5FA 4JBIA 2HBZA 1H9AA 2EFCB 3TZCA 5L4LA 1F51E 3D7SA 3MCUA 1E1CB 2MSCB 2X4IA 2PX4A 3BFXA 5DPMA 1S02A 4OMDA 5CFMA 1B00A 4IUBS 1EG2A 2L42A 1RLJA 4IIYA 4NNOA 4PGFA 1J06A 3R7WB 4BX0A 3KT8A 3DXZA 4D9GA 3OPMA 3BC1A 1J0EA 4FI3F 4KGZA 2HHCA 3OZRA 4J0EA 2WFZA 3KKKA 3A6LA 2XIQA 1TFUA 4TLCA 5IAGA 2C2KA 2EX4A 2AW3A 3CFYA 2BHNA 4IKOA 5JS7A 4IUDS 1D2CA 1ADYA 1RWQA 2PXAA 2QNRA 4RF2A 2A7XA 5C8YB 3K70B 3EDQA 3R3VA 4BO7A 2YNMD 3F47A 3REOA 1K8RA 5H02A 3IS3A 1WY7A 5KNCD 4B3IA 4ZYYA 3S81A 3R0VA 2QAGC 4EFNA 2D54A 3NBAA 3NH9A 3TW4A 3W8FA 4PVDA 2JI4A 1SJ9A 3ACDA 1BDHA 1QGDA 2AN1A 2WJYA 4OV6B 3WQRA 1TAQA 2BMDA 1P74A 2NSLA 2QSJA 2ZE7A 3KB1A 5JMWA 1C7FA 2EBFX 3AESB 3ZTWA 7MHTA 1LJLA 1GUAA 1P7WA 3U3XA 9LDTA 5HOEA 1TA9A 1C3LA 1JEAA 5DSXA 4REQA 4B5LA 5HJ2A 1Q74A 2IEIA 3DLHA 4QELA 3SHWA 4CLEA 1JI3A 3USCS 1BXGA 2HK8A 2Y0DA 3O9MA 3IUYA 4FR5A 5DWDA 4HFMA 3DV9A 1PR6A 5DNEA 1E6CA 2UVPA 3MWEA 3VO8A 2HF7A 4F4JA 1RHRA 2GJKA 1B23P 2GTIA 5FYDA 3RJZA 1DPFA 3F5MA 3J81A 1GA4A 3KP1A 1YCHA 4MYHA 2ZAYA 3FE2A 3GGPA 3PG5A 4O0MA 1KI1A 3MSCA 2WSSA 4R8MA 3CURA 4FB5A 2ZIXA 1UKZA 3R9XB 1TD9A 2GN2A 3KO8A 3BJRA 1P1FA 3CNLA 1DINA 4YP1A 4EHKA 5FQNA 1DXQA 1OA0A 3QBVA 5G41A 2RB5A 4EB6A 3TZEA 2NU8A 2J9GA 3ZUPA 1PL6A 2BKXA 2D3TA 2R1UA 3KALA 1AGYA 1MJGM 4HFJA 4YLEA 1RKUA 1WW2A 2IVZA 3ABIA 4IZHA 1J2JA 3DZBA 3TF5A 5G53C 2X8LA 3F6PA 5J63A 1XPUA 5FOQA 3BRSA 3JSXA 5COBA 4X5OA 3TNFA 3C3EA 5IX8A 3II6X 1KY5A 3WGQA 1KEPA 2O7RA 4BQEA 3KVNA 1T0BA 3NANA 3UIEA 5TRTA 3ILXA 1Q1GA 5CJPA 4ZVTA 5FPQA 4Q1AA 2FY8A 5B1SA 3N2IA 1X2BA 4N40A 3E82A 3PWKA 3N05A 3ORHA 3CJRA 3VR0A 2OQIA 5KYUB 1ACJA 2DP4E 2IZOA 3KSDO 1KMHA 4B3XA 1KFKB 1M0TA 2RHMA 5HIMA 2PQ6A 4IJVA 4EUSA 5B4VA 5E3JA 2CZCA 3PFNA 4GLOA 1RWKA 3VUEA 3I28A 4HDKA 4P33A 3MTGA 3RAGA 4XDZA 5BV8A 1T6BY 1ZDMA 3GG9A 4PC2A 3W5SA 3WFJA 2P3SA 5JI3E 2E1RA 3N9IA 3T12A 4LJ6A 1REQA 1U28A 5IJ0B 3GARA 3ZI4A 3W9SA 2X2EA 4HDSB 4NPCA 4EJ6A 2V7PA 1C1DB 1BJKA 1WTAA 4NXMB 1KI4A 1U9YA 3SKVA 2ATCA 2EFGA 2ORYA 2VUSA 2AN5A 1YAJA 3TRDA 2QM3A 2LCFA 3MTQA 1QG6A 4XM2A 2EIHA 3TW8A 3ZGLA 3PQ7A 2HU5A 4O02B 5LDDC 2E48A 4UDOA 3DEYX 5KU7A 4B3JA 3SSOA 3FG9A 3QFCA 1VHQA 2ZT6A 3SZGA 4M9SA 1ORHA 3Q88A 5CP8A 3VR4H 1XLUA 3DULA 3SYTA 2W0SA 1YS6A 1R6DA 1WZUA 2BMEA 4NZ9A 1ZEMA 3KR2A 2QAIA 3CV3A 5AK5A 3QOYA 4AF6A 4GDMA 1W48A 2J7PA 4GZLA 2ZIAA 2IIVA 5KYYB 4L3OA 4BPBA 4IUCS 3VISA 1QGED 1CY8A 2HWYA 4KW7A 4LYYA 1QQAA 5A9TA 1UDBA 1Z0UA 1WABA 1LDYA 1GGKA 3AR3A 3NGMA 4LX0A 2D4HA 4G81A 3ET4A 1UAYA 1J23A 3GNQA 2JAXA 4MS1A 5CJ2A 2QYTA 5FB3A 4Q9JA 1K7YA 1TF2A 3IDZA 4HSEA 4I8IA 2XXBA 4QHTA 4F56A 1Y63A 1I0LA 1Z4IA 3A6GA 4MROA 4TLMB 1EFVA 3WK8A 1P6UA 4C0JA 1T10A 1X8LA 5FWYB 2ASVA 4CF7A 2D6FA 2I55A 4ES6A 4FJ0A 1KVSA 4FVTA 1IYZA 4QHSA 4UE6A 4NYJQ 2IOQA 1WKCA 1TPZA 3OJCA 5K2MA 4C03A 1IAQA 1UP6A 2PS0A 1U8ZA 4HYYA 1JF8A 4LN1A 3RYFB 1WMSA 3PIRA 1KVTA 1FVFA 2R6AA 1FSSA 2D2XA 3OBIA 4HF7A 4RD3A 3SX0A 3X1JA 3O73A 2PX2A 3PRJA 1KO8A 1PTKA 2BKLA 3A04A 3Q2IA 4NEQA 4GLBA 1FLAA 2H2GA 4DQKA 4TLLB 4BEWA 4UFNA 4AYTA 4P32A 3ZKWB 1OREA 1NBWB 2EYUA 6GPBA 4RAQA 4UCXA 1J8QA 4M6WB 4JVSB 3GAMA 4AJEA 4GF5A 4KBGA 2ZP1A 2ZUVA 4L4YA 3ISVA 3GFPA 2HLDD 2JZNA 4M49A 4RLQA 5CTJA 5G1PA 3FKQA 4IQ4A 1TX4B 2OUIA 3VSEA 4P58A 3S2ZA 1EG7A 2ZSHA 2ZOSA 5CFOA 2X0FA 3WBFA 4I9GA 4AKIA 1VZ2A 2QZ9A 1LKZA 3L6DA 5CLIA 1L5HA 3GD5A 3K8ZA 5BYBA 2FZKA 3X2EA 2QQ5A 2O1WA 3K2EA 1HNZB 4IP0A 3GV0A 1EFTA 3FAKA 1YU6A 3WKBA 2WZBA 2M1ZA 2QB5A 2PCLA 3FRJA 1BYIA 3RVKA 5HUHA 5JMTA 2AFHA 1RXUA 2C7VA 2CLDX 4OB7A 2B8WA 3M6MD 4FN5A 3WMEA 5IG2A 4OFXA 3U48A 3OU2A 3THWA 2NTNA 3DAFA 3EUFA 5LQJA 3GMDA 1SBQA 3LG2A 2WJ3A 1X13A 3UFBA 2FQXA 4YRZA 4TL6A 3URMA 4Y2XA 5DWVA 3HFJA 1BMFD 1PJZA 2L69A 2IW3A 1XNQB 1NYQA 3QMVA 1UKAA 2A9JA 4TVOA 3QNWA 4OBWA 5IDYA 3ZGXA 3ABQB 3GLTA 2OA0A 3I2GA 4PVCA 5M34A 3RYCB 3JQ8A 2Z9DA 4B6QA 4IVRA 5I4BA 1HEYA 2PZMA 2A1TR 2E82A 4KK3A 5D87A 4DYVA 3Q11A 1GGMA 3VVMA 3ZW7A 1NOKA 2VHZA 3OE5A 3QMPA 5EIAA 4D42A 3U7JA 1F8XA 2XNJA 4URUR 4Z0NA 5HF8A 4URHA 4AJHA 4ARZB 2CNLA 5ICEA 3FMVA 2XMZA 1T0UA 1XKTA 2BJHA 3TLBA 4BP3A 4C4RA 5C8ZA 2WOJA 2C1EA 3NCTA 1NW5A 1K6IA 3FUWA 1U81A 3LRXA 4DSZA 2Y6UA 1U4OA 2WWVD 4LE2A 2DR2A 4IS3A 1ZH6A 3D64A 1CK4A 4KQCA 1C30B 3HFGA 4ND7A 2WF7A 5J23A 2JCYA 3BSYA 1R8JA 5TR9A 1Q1NA 3P71T 3EXEB 4HAVA 3F6BX 2QN8A 4R7GA 1BA3A 2O4CA 4NZZA 4E32A 4OUDA 3HUEA 1D2HA 4ZO9A 3FPBA 3O82A 3VZCA 3JVEA 1GSOA 1QQ7A 2NAPA 1XYVA 1QIEA 1SVNA 3HS3A 3USES 2FYTA 3I3OA 4RE6A 3RTGA 1I1NA 5IHPA 4YP0A 2Q3JA 3GMSA 4AS3A 1WETA 2GJ4A 1FYVA 3T7AA 3ZGOA 2VUHB 3QXJA 1GPWB 3MXTA 4ND8B 1VPTA 3QXGA 3QX7A 2IOHA 3JQAB 3QXXA 4GMFA 1Y3AA 1ZVKA 1QGUA 1D0VA 1GLNA 1L1QA 1NC3A 3E4DA 1TO6A 3U3KA 3VH2A 1VGQA 3GVCA 4IKEA 2EBWA 2R6FA 1TJ5A 4LDZA 1QM5A 2XKAA 4LC9A 3NNNA 3OLCX 4RZQA 3NATA 4C5BA 1VL5A 3ZY5A 1FUUA 2BI8A 5J58A 2CDRA 2O06A 1VECA 3LQFA 3URKA 2I2WA 5FO1A 1SUAA 3I8OA 4ZVUA 4FUQA 2GASA 1MJ5A 1LB1B 3HSKA 1X19A 4GXQA 5IC6A 1ZWKA 1TJNA 2IYVA 4HLCA 1IOWA 5BWBA 5I47A 2HJWA 2YJ4A 3QTTA 5ENZA 5KPJA 1MOSA 5EXXA 3FVTA 1EU1A 1OBHA 4G84A 5DP2A 4CT5A 1PQYA 4Y9RA 1NOIA 2Z3VA 3JQGA 5BXYA 4EECA 5AM1A 2PKRA 3F90A 1IATA 5D85A 1RJ9B 2FPUA 4YX9A 2OXRA 2V7QA 3FFXA 1NVAA 4JHXA 1AZWA 1EZZA 2HMYB 1KSHA 3A4YA 3ENVA 3GNTA 3KEMA 2Q4TA 3L4SO 5EMMA 1AUOA 1ZVJA 2QWXA 2Y4NA 3VBCA 4F9TA 3H8JA 4ZICA 1HORA 1II8B 4YRQA 2WM8A 3CINA 3ZVMA 1U3CA 3V4RA 5FI0B 4CKXA 1Y6FA 3KPYA 2KM1A 3WKDA 5IFKA 2JZOA 1KH3A 2BDTA 1KJJA 1P29A 5LQCA 1SA0A 1E5TA 2RHBA 1MF7A 3B51X 5TF4A 2X0DA 4CN8A 2WWIA 3AEKB 5TVGA 1B43A 4J6FA 2AA3A 2UUBB 3QPWA 4FYJA 3K32A 2IYFA 1Z0FA 2QTLA 3BD6A 1JQLB 3CSDA 3UXEA 2C2OA 4X20B 1AE1A 4CQMD 1M1ZA 4P1ZA 5BMVA 1V7CA 2XCIA 2ZJ7A 5F12A 5HRCA 5KCZA 1BCSA 2YYAA 3H0KA 3Q1LA 5E1DA 5DW3A 1GARA 2E1PA 2P2NA 1Z6PA 3ZWNA 3OZCA 1JKXA 4UEKA 3Q9LA 4DMMA 1DARA 2EQBA 4U7PB 1CY7A 3KB6A 4TSFA 4ZPXA 3VPBA 1NGSA 1S89A 3HR7A 2OHXA 2ZRMA 3CEPB 2VPXA 4JVNA 1RT9A 1I33A 1UEXC 1LC3A 3TAXA 3W5VA 4GZ6A 4LOIA 4YV0A 1PGPA 3C3XA 2PKQO 3UB3A 3JWPA 4EG0A 1XXHA 2DY1A 4LVUA 1CQJB 3CQ9A 1G38A 2KYRA 2OGUA 4OHBA 2ZIUB 3ZCXA 3DE2X 2FPMA 3O8BA 1NXTA 3H97A 4KP7A 1Q91A 1TO1E 3T5BA 3D54D 5IVIA 1QHFA 5F9MA 3INYA 3HSYA 2F17A 4HS4A 1ZX1A 3E7XA 4RQBA 2Y0PA 3AHCA 4EY8A 1FYWA 5JEEA 2YH2A 4ZRMA 3GCXA 2F3PA 2JGDB 1GUYA 2ZIFA 3DOEA 1Q50A 3JQ7B 2R85A 5L45A 4KWHA 3E3AA 1UEJA 4WZZA 4NBUA 3KQLA 4R1NA 1T8TA 3SYLA 3LV8A 1XTVA 4PCVA 3I5MA 2JFHA 3DVAA 1NYTA 3HQ4O 4MK4A 1NXQA 4MPTA 2PX0A 1EA7A 4D44A 4P3XA 4BMZA 2X19A 3HGQA 1U99A 3S7TA 3V2UA 4FFSA 4JSRA 5ESDA 4AJ4A 5JXWA 1NX6A 2V96A 5KKAA 3H11B 4E5NA 3AEQA 2OHIA 1WCXA 5EP3A 1HEUA 4Z0HO 1J24A 3CM0A 3PCRB 1HOTA 1GNRA 1O8CA 1XRNA 3KZCA 3CZ5A 3NYWA 4FHDA 5SY4A 2LNDA 1QSGA 2W6IA 2CFRA 3BMNB 2BZGA 3KDSE 2OAP1 5DCWA 4KO3S 3UKJA 3GP3A 3P9XA 2I71A 3FNHA 3PR3A 3B5JA 3U7QB 1D4AA 3WSVA 4HQFA 1DKPA 5BSEA 3UW1A 3GA5A 4RD0A 1LW6E 3I1JA 3WLHA 3V1KA 1P3Y1 4MB0A 4MUFA 3C5EA 4BQNA 4JZKA 4CMJA 4P4SA 4K6GA 1IZYA 3EPHA 3L8CA 1XLTC 3LLUA 4H7FA 3EIXA 3LTNC 3ABRB 4B79A 3D8NA 2ZZMA 1KP2A 1CTQA 1SOUA 3S29A 2PX6A 4OBBA 2SNIE 4TS4A 1VYHA 2FP4A 2PX3A 1E1RA 1XRSB 5KOHB 2YJTD 3TL3A 2Y0EA 2VKTA 4HWPA 1FNMA 1XTPA 4S35A 2QXTA 1RRMA 1Z6GA 3DCYA 2A9VA 3NG1A 5KDDA 2CJFA 1THMA 4G67A 1U7TA 2E85A 4BKUA 3LHSA 2DH5A 4BNFA 2H51A 2O14A 4XX0B 2X8JB 3EY9A 4OXIA 4QFMA 4TXNA 4ESOA 1I13A 3LBFA 2B9EA 5H68A 5A62A 5BMVF 3ZNPA 4JP5A 2PN1A 4UVEA 4I6GA 1XC7A 4KE9A 1HPLA 4P4LA 4UQPA 3OZBA 4FUTA 4LXYA 3VNQA 5C9ZA 4CG0A 1W93A 4V0RA 4BDTA 3STHA 1AKMA 1EFRA 4L5BA 4LOJA 4D2IA 1JIQA 1A04A 5EHNA 4ND1A 1F14A 1N57A 1UWCA 2A33A 2FW1A 4JLAA 2FPRA 5LMNB 4R8KA 2NTYC 1GPNA 2VSXA 4FSHA 4U8HA 3O4JA 4ZHQA 3AYXB 5DGDA 2IDJA 1YV9A 1Y80A 5KINB 1NULA 4UJ5A 3NMUF 2PQMA 3PNMA 3T7CA 1NUAA 4HRXA 3EY4A 2EFDB 4B4DA 5DBIA 2QV0A 5MN4A 1N5RA 2JDIA 4KR9A 3PPYA 1W73A 2QLTA 4N6GA 3EIFA 1JLLA 3VHXB 4B6RA 4CWAA 2VQ3A 3HPQA 1NWCA 3JQDA 4G0YA 1BWQA 2DCMA 1CERA 1NJ1A 2QHXA 1G59A 2EZTA 3Q0EA 1RAAA 1TQ8A 1PJLA 2O54A 3IYLW 1MA3A 3NM6B 5IUKC 1SM4A 1V48A 2GXUA 5BVGA 1CQPA 2V8BA 3G2LA 2N9UA 3FNIA 3U4AA 4BWVA 3CUUA 4CETA 1C14A 1PWEA 4MV7A 1NASA 1GO2A 3VH3A 5JEDA 3VJRA 3RS8A 1X6VA 2FKAA 3SQDA 3OLXA 2VJLA 4XDHA 1DAIA 1EB8A 1MD9A 1O6FA 3BXOA 4RACA 5H81A 4D9HA 5HQ3B 4BNYA 1Z0IA 1ZKMA 4D82A 1LNQA 4DC1A 1GQRA 3A3NA 1O95A 5B2FA 1U7UA 3CGWA 1MJFA 5BNIA 4BB9A 1SVMA 4YCJA 5DASA 1E5DA 4UMEA 4R01A 1C4KA 2FG7C 4R9RA 2C7RA 4Z9XA 4GSLA 3EFOB 1W8IA 1I5RA 4WK2B 1XPRA 3ANSA 4X95A 4UQLA 3RRZA 4ND5A 2IYTA 5C5DA 2YFQA 3ZD7A 4RZHA 3OJ0A 5B3LA 4G1MB 2X8WA 3OCCA 4D92A 4OJNA 1A7UA 2HMSA 5FIUA 1ZNZA 4O8ZA 4PLHA 3RUEA 5DGTA 3V9AA 5H3HA 4P4NA 4HB3A 1Q0SA 1QC5B 1FFXB 1Q92A 5ECYA 1IN7A 3TOCA 1T25A 3A2LA 4OHVA 1C0LA 1HNXB 3PQCA 5DN6D 2VDWB 4PGAA 1H1TA 2YTZA 2OO5A 5F2NA 3D0OA 2OTCA 2EG5A 5ALJA 4KQ1A 3U3MA 1YKGA 4C20A 3BXFA 3UMYA 4OKSA 3BWXA 1B8NA 3ROXA 1K7SN 4BKMA 2JIMA 1EUZA 3BQNB 4JEHA 3H8SA 4AMZA 1V6AA 3JRNA 4YALA 1VDZA 4ILKA 4BAZA 621PA 1L4MA 1D4ZA 1W47A 2NSJA 4L0MA 2VDNB 4CV0A 4HX2A 4CM6A 4LWPA 3RSGA 1AKVA 4DQUA 1PK7A 1JPUA 1SCNE 2ANCA 4Q3KA 3JQPA 1K5PA 3O8DA 4F1JA 4XH9B 4PLGA 1U28C 2PYIA 1BVRA 5C34B 3HN6A 1GTRA 3UAVA 1FTSA 3A31A 1NW4A 3O47A 5BYKA 2QGFA 3RVPA 1NN3A 2F9FA 3UK1A 5JASA 3B3QA 4K9LA 3OJXA 4ZHQF 2VTBB 1PWYE 1RFGE 3KHTA 4WEOA 3IV6A 5CLLA 1FNCA 2W6JD 3VDMA 2JCBA 2KMLA 1JE0A 3IX7A 1LSSA 4NDAA 4B3TB 4MPDA 5EKDA 1VI6A 4O5AA 3ZCUA 3AF6A 4LDRA 3B7WA 2IYZA 3OSUA 1IONA 2JG3A 5GV8A 1DAMA 1SQ0A 3EXHA 3TFWA 3ZE1B 5IYZA 3FDJA 1V8DA 1GYRA 4JKOA 1ZONA 5FL7D 1A76A 2Q3DA 3AM4A 4XWTA 1JLKA 2PH3A 3BGDA 4PN3A 1X3LA 3C3MA 4FFDA 3W3AH 2ZWPA 5A06A 5IPFA 1OAKA 4EG5A 2AOXA 4DNQA 3QQPA 3UMBA 2O3QA 1XG5A 2X1LA 4JJFA 2P91A 2BFOA 3L7AA 2SICE 3MQFA 4LYGA 4X97A 1DEXA 1IQPA 2X2OA 4YJ3F 3ESZA 2HJVA 1PFGA 3K0EA 5BQPA 4V1CA 1P8JA 3CX8A 3W9BA 2WHXA 1DOZA 1TAHA 2GEBA 3EF1A 1JIXA 4KSCA 1OBFO 5BUCA 5MN5A 1Q7CA 1AV7A