1KSHA

Complex of arl2 and pde delta, crystal form 2 (native)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
164
Chain Sequence
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The complex of Arl2-GTP and PDE delta: from structure to function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords arf-like protein 2
total genus 59
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kshA00
3AVOA 4E07A 2GAOA 1GAJA 4B2IA 3E1SA 4B43A 2NMVA 1UFQA 5H1YA 4D0NA 1KI6A 2CCJA 821PA 1KSHA 4Q4JB 3TLXA 4IOLA 5LPNA 3FKSD 2WKRA 2DWQA 2JDIA 2CVFA 4YMSA 2ZU0C 4WAUA 2PCJA 5DN6D 4Q00A 2QAGA 1VHLA 2BKUA 4PX9A 1ESNA 4FCVA 1XPOA 1Z28A 1G9XA 2ZRJA 1G20E 1TNDA 5EE3A 5JHHB 1GITA 1X86B 3L8YA 2Q0HA 2CJWB 4IVPA 1KSJA 5D3MB 4KLZA 1G7SA 1IN8A 3ONWA 4JJKA 4QNRA 1U9IA 3M1IA 4IVRA 2O5VA 2GF0A 2OFOA 1UADA 4PZZA 4HAVA 4NHOA 4D4KA 4JYBA 2C8VA 1A7JA 3SS8A 1DTSA 3KTAB 2BJVA 2X2EA 1ZNYA 4TT3A 5EP1A 4BLPA 3KDSE 4HAZA 2PZGA 2RAPA 4LYHA 2OLKA 4QFMA 2QGZA 5FR2A 4FW9A 5DYGA 4NONA 3GJ4A 4LK2A 4V0ME 1LF5A 5FFMA 2BCJQ 2BMEA 2DPXA 3B1ZA 1A5TA 4OK5A 2NPFA 3TR0A 1E0JA 1Z2CA 4DKXA 2ATVA 4CEHB 1Q3TA 2JIZD 4R71A 2GNOA 3TMKA 3VR1A 4B3FX 3IPYA 2OCPA 3M6AA 5J4LA 4PSKA 1S4QA 1DOAA 2FFQA 4IDPA 1D6JA 4R2IA 2V3CC 2H18A 3AEZA 1XRJA 2ZU6A 4V0MA 3ZD7A 5FOUA 3FYHA 3MFYA 4UKDA 4RZ2A 5CJPA 3VKGA 2PJZA 3AH8A 4PSAA 4R9UC 4W9MC 4UNQA 2F55A 2QAGB 3TIFA 3W34A 2OESA 2OO7A 3WXMA 2YVUA 1W7AA 1W0JA 3B78A 2PZFA 2ANCA 1ESMA 4GZLA 3KXIA 3SNHA 4DLUA 1E79A 2ZJZA 3LQRA 4M22A 2R6FA 2D4HA 1E2LA 4LHYA 4TL9A 1IM2A 1VDZA 4CF7A 4C2UA 2JLXA 2FF7A 4HZUA 2WWGA 1E4YA 2IF0A 3QKSB 4GBMA 4GFDA 4Z1MD 3WNCA 4ARZB 3GQBA 1W5SA 4R98A 3HWSA 1G18A 1OXXK 1ZUNB 2RH5A 2W2VA 1B0UA 3WY9A 1S0UA 1F2UA 1BOFA 1D2MA 4OK6A 3AF3A 3IQXA 2B92A 3PV0A 4TN1A 2BM1A 4TT3D 4EFMA 3CRQA 1J8MF 3V9PA 4TMVA 1QVAA 1P9WA 3N70A 5BYJA 5EP2A 3CX8A 1R8QA 2MSEB 4LV6A 1W1WA 4LHXA 4DLWA 3DMDA 2Q6TA 3IBYA 4QXAA 4RZUA 4I99A 5AR1A 1W36B 4LBZA 5DI3B 2ZJBA 1MR3F 4LC1A 4GL2A 1ELOA 3QG1A 2BEKA 5BN3A 1Z0JA 2ZIAA 3RS0A 5HZHA 3GLIA 3SU8A 1GL9B 2WWFA 4C7OA 4M8NE 4B47A 4JLAA 2KJQA 5JLJA 2CCGA 4PQFA 5BWMA 4G0NA 1NKTA 3QKSA 1KYIA 3BH7A 2J0SA 3GJ5A 3I5XA 3QXSA 1AQYA 1EFHA 2XOKA 3TAHA 5JCZA 4FWTA 5GJWC 3ND9A 5EE0A 1C9KA 4BLOA 5ANRB 1ZVQA 3TRFA 2WKQA 1ZD9A 3FKSA 3NG1A 3FMFA 3KX2A 2JLZA 5FOSA 1KI3A 3FWYA 4DZZA 2A5DA 2WBLC 3AVQA 1JXMA 2D2FA 4G3XA 4X8HA 3TSWA 4QBIA 2AN9A 2J41A 4BLQA 1Z6XA 3Q85A 4C0JA 3U44B 3AVTA 1OH7A 4IDOA 1VECA 2OSBA 1Z6YA 1Z83A 1HE8B 4CDGA 3ZD6A 3BBPA 4RD6A 3AP2A 1EXMA 1XX6A 3QEJA 3U3JA 1HURA 4O3MA 1KO4A 3U4QA 1G5RA 1E1QA 3QJYA 1RRPA 3HJNA 1ZBDA 2YOFA 3RVBA 4XVUA 5AUOB 4HAYA 1CIPA 1KAOA 4D82A 1QZXA 3ZVLA 3ZVRA 3GPLA 3I62A 4JLDA 4AYXA 4PPNA 1W2GA 1KSFX 2NTYC 2WV9A 4IEIA 3LQQA 4HB4A 1T9HA 2PX3A 5FBQB 3AP1A 1AS2A 3HYTA 1MH1A 4TLDA 5EUQB 4US2R 3QG5A 1XZQA 2QROA 3UKDA 1XCPA 1QHNA 4TMZA 1HUQA 4NP6A 4L4UA 5FTNA 3N5CA 4H1UA 2C95A 3AF1A 4B74A 3FHTA 1TF7A 2G88A 2ANBA 3IIMA 2OBNA 1UBGA 2D7CA 3F3YA 1T91A 1AGPA 4HZIA 4OHVA 1CR1A 2FNAA 5L3SB 1E79D 2A5YB 3D7MA 1WB9A 2CEAA 2KSQA 2GBLC 4MKFA 3GFOA 4EIWA 4OHYA 4P4SA 2HT6A 3NH9A 5JI2E 1HH4A 4UXHA 2QBYA 4AKGA 2YOGA 3VTKA 3ZIAA 1D5CA 2ZJYA 1QHHB 1W4AA 1J8YF 3MCAA 1WRBA 4BPBA 1UJ2A 4NYJQ 5CM9C 4OJQA 4DEYA 5JI3E 1JQJC 3B85A 1Z6GA 2QP9X 4MYTA 3U60B 5GADl 3BERA 3A4MA 1JJVA 4ZIRB 1CRQA 1TQ4A 3BD9A 1G8FA 1OFHA 1NBMA 1P2UA 1T6NA 1G3QA 3CH5A 1TU3A 3NKVA 3DEFA 4PAQA 4Y0VA 4ZKDA 4YMWA 4Q9HA 3BH6A 1AJEA 2BVNA 3K8YA 4M9XA 2Y8EA 5LB2A 4GPTA 4LJ8A 4TMWA 4LBWA 5EQTA 1H65A 1QRAA 4C7OB 1EX7A 2GJ9A 5KHOC 4TLAA 5FOWA 3RANA 1G3IA 5CB8A 4Q9IA 1U94A 1NLZA 5JSZA 1YE8A 1H8HA 1G1MA 1U99A 4BZPA 2BBWA 2ZEJA 3THXB 2WOOA 4KFTA 1AQUA 2XNDA 3QQ5A 3RS4A 4DXAA 4DVGA 4KYIB 4U5XA 3VAAA 4PO1A 4Z54A 2VPPA 5DO9A 5TDHA 2G0TA 2HJVA 1Z6AA 4MYCA 4KXFB 2ZJOA 4Z51A 5P21A 1HT1E 4D26A 2W6ID 1XEWX 4FCTA 2W0MA 4PHTA 4TL7A 5FI0B 4I1OA 4BEJA 1CTQA 1L2TA 3C5HA 3S1AA 1E2QA 1E9EA 1YZUA 4HZUB 2P5TB 3EZ7A 1N0VC 5AJVB 3TUIC 1TADA 3PEWA 3U3MA 3EPHA 2H17A 2DCUA 3CX6A 1W36D 1CKEA 4HB2A 1XD2B 1E2PA 1JJ7A 3QBTA 4TYYA 5FTMA 5GJBA 3W3ZB 4F93B 4XH9B 3DKPA 1ZIOA 2R8RA 4POAA 4CEJA 3NBZC 4MGIR 1VG0B 1TMKA 3B1XA 4I4LA 2J59A 4WZBE 2PLRA 3QOFA 1BMFA 1I2MA 5TV2A 1UDXA 4DLRA 3HDTA 2BOVA 3VQTA 4XTCS 2NOAA 4MGYR 5EZ5A 3P26A 2IEYA 2JLQA 2REBA 2VEDA 3OIVA 1JQLB 3O8DA 3EIEA 2QGNA 3BWDD 3OAAA 1D2NA 4B34A 5JS7A 5CIQA 4UJ3A 5JEEA 2ZS7A 2X8AA 2H8KA 2KI5A 1N6LA 3DHWC 5J4KA 5CK5A 2ZS8A 1SVIA 2DYKA 3EAQA 3UG7A 5H68A 2LKDA 3EIHA 4GMXA 1O3YA 2B8WA 3WBKA 4A0RA 4XWOA 3LO5A 3CB4A 5DHAA 3IGFA 4QM7A 1ZNWA 2IHBA 2WJIA 3P4YA 3EA5A 1TUIA 3FMIA 4URYR 3L82B 3BRWD 5BN5A 2WWXA 1UKVY 3BOSA 1IY2A 2WSSD 3KTAA 4OI2A 4IFBA 3GJ6A 1U98A 1XPRA 3AVXA 4PAOA 2QUZA 4LJ7A 3GEHA 1P2TA 3VHLB 2J0UB 1J99A 1LNZA 1RE0A 4Z8XA 4DSTA 3U3OA 1SXJE 1QDEA 3KKOA 2FWRA 1NBME 1E2JA 3AVPA 4F91B 4TLBA 5EXSA 2JJ8A 1N0WA 4II7A 1MRNA 4FI3C 2F43A 1L8QA 3T1VA 1B23P 5G53C 2YWEA 1GWNA 1HEIA 4ABYA 4KVGA 1CEEA 4IEEA 3B1VA 2W2TA 2GXAA 4C30A 3WBJA 3P1JA 4P4UA 1XD8A 4Q48A 1F6BA 1IY0A 5FOXA 4MYUA 3O8CA 2C9CA 4B32A 4BLRA 1W4BA 3CLVA 3TSZA 2WWYA 4RKFA 2ZI7A 2P2LA 3DZDA 3OAAD 1NN0A 1SVMA 3THWA 5FPTA 4Q4HB 2IHYA 2WMNB 3QY0A 3QSYA 2GTPA 3ZVMA 1TQ2A 4GOKA 3PUXA 2D74A 4TZ6A 1MT0A 1D9ZA 3X2SA 2EFCB 2BDTA 3BC1A 2GILA 4C4PA 5CLLA 2CL0X 2GXQA 5L3QA 1GKUB 1MV5A 1US8B 2Q21A 1E2MA 2NO9A 3GLHA 4IXMA 1GNQA 3BE4A 1M7HA 3A58B 1P7CA 3F8TA 4JT2A 3I61A 3CF2A 1US8A 2ZSBA 5SZHB 3ZS9A 2AFHE 3EPLA 5LD2C 4A0GA 4BWYA 4EUNA 2BBTA 1XZPA 3GJXC 1T8UA 3SI7A 1II0A 1W44A 5HKKA 3KQNA 4U7DA 1DAMA 3CPHA 5EXTA 1XWIA 3MG9A 1FL9A 2ZJ5A 3K0FA 2CLSA 2JJ1A 2R62A 4X8MA 1RJ9B 4AYTA 1OT3A 2X2FA 2F3RA 2C03A 3M4YA 5KNBA 2IUUA 3AVVA 1YRBA 1UPTA 3VU9A 4OQMA 1ZYUA 2B8TA 4X8LA 5IHPA 1J90A 3UMSA 4H1VA 2IXFA 5A0FA 1DARA 1PLLA 3QENA 4EPWA 1KI2A 4B3XA 4ESHA 5DI9A 2ZSDA 1TAGA 1KMHB 4NYIR 1II8A 4NCJA 1ZM3A 4P4SB 4A6XA 3KQUA 4NYIQ 1I4DD 2G77B 1KY2A 4Z8YA 3EZ6A 3I4LA 3QPUA 3WHKA 1KI7A 2IF2A 3SQXA 3AVWA 1E1RD 1NY6A 2C96A 2FG5A 3KKNA 5TMPA 1JR3D 2ZPTX 1VHTA 1RJ9A 2BHRA 4DT1B 1VYUA 5KSOA 5KDLA 4URVR 3L0IB 3RWMB 1N6OA 2BMDA 3LWNA 3WMGA 5B57C 1VYTA 1LVGA 3DO6A 4LBVA 4Q4AB 3R8CA 3QKUA 2CL7X 2ZRMA 2H5EA 2N42A 4A4DA 2BC9A 1SKYB 5LDDC 1TEVA 2PX0A 2XZLA 2D2EA 1NMXA 3EA0A 2J7PD 5LD2B 3GJ0A 1A1VA 4LUCA 2VIIA 3TAUA 1UBEA 1CJVC 2PH1A 4M2LA 3CNOA 3KXLA 5AWFC 4JVNA 3SJCA 2I1QA 1Z47A 2W58A 3HP1A 4N0EA 1E0SA 3RS5A 1NN1A 1XB2A 1R10A 4QBGB 1O87A 1KGDA 2IXGA 3T12A 2RGNA 1SVSA 4XSHA 1MABA 3R9WA 5JBQA 4CEIB 2C98A 1SVKA 1ZJ6A 2FEOA 3C16C 2B21A 4PC7A 3TVTA 1KHTA 1NP6A 4IKEA 3SDZA 4FINA 3BIFA 3U7EB 2FSFA 2R6GA 4NL4H 1XP8A 1EFUA 4C0AC 1RVDA 1H8EA 2O0KA 3FE2A 5HZKA 1GILA 3RRYA 1EFTA 1X3SA 2IK8A 1YJ5A 4B6EA 3RLFA 3E5HA 4Q1CA 1MKYA 2ATXA 2BMJA 2EQBA 2JA1A 1KO7A 1P73A 3TUJC 3VHXA 2ZRAA 5FBVB 3C14C 4PO9A 2YWFA 3GD7A 1IQPA 4M1SA 4U02A 1E1QD 2AHOA 3JZAA 4TSFD 5CYOA 1OXUA 3EXAA 4XSGA 1M1YE 2EWWA 3KZ1E 4H9GA 3QXJA 4B3CA 4DIEA 4BASA 5BW8A 1PVOA 1RIFA 4BE7B 4G5QA 2JAQA 2Z5FA 2FOLA 5FBLB 3CH4B 2YOHA 3DM5A 1R5NA 2NO6A 4G5RA 2FA9A 2PL3A 3OESA 2NG1A 5JRJA 3G5UA 1FMJA 2Q3HA 2ZANA 1SHZA 2BKEA 1GM5A 4ZCIA 4L9SA 3ZZ0A 4CW7A 1AKEA 4Q9KA 4EPVA 2WPDD 4KITB 1SGWA 1YR6A 5BYKA 2Z4SA 2V6IA 4QBFA 4P32A 4Q1EA 4D2IA 5J47A 3DPUA 1QG2A 5DHFA 5HPYB 4LJAA 2Z6VA 4XWAA 2P6NA 4DRZA 3AP3A 3WMEA 2CE2X 3AQ4A 4DLYA 1BS1A 3LH5A 5HCIA 4IDQA 3ZH9B 3BK7A 4R2HA 4Q47A 2W83A 4C0HA 1G5PA 2SHKA 3FTQA 4JVSB 1ZRHA 5E4FA 3T15A 4IOMA 1AZSC 3DDCA 4BECA 1VPLA 3LBHA 2WOJA 2XTMA 2BWJA 3RS7A 3I5YA 1AA9A 5C1BA 1G3RA 1BH2A 3CRW1 4G5GA 2G0NA 1KK1A 4KJZA 1P60A 3A1VA 5JFGA 2FX3A 4ZDIA 3FHCB 1ZC3A 1P2VA 3LBIA 1Y63A 3DOFA 3NWJA 4RD4A 1U81A 1E2DA 1NI3A 3CKLA 3PUZA 2NQ2C 121PA 4TMTA 3U2QA 2ZR9A 1LS6A 1JNYA 1VYVA 2CMKA 3ASYA 4OYHA 2JLUA 3SYNA 2J87A 5SZKB 5J40A 1CJTC 2ZJAA 1T0JB 3OZXA 2OT3B 2O8BB 4HDCA 3H0KA 1LW7A 5GJVC 2XSZD 3K0CC 2HCJB 1G64A 3LXRA 3R8FA 3U61B 4GP6A 1SXJB 3IO5A 1CR4A 2WJGA 1UKZA 2HXSA 1NJFA 2JEOA 4JLVA 1E96A 3NBXX 5CIWA 4DJTA 3EARA 4X8OA 1Q1EA 4AG5A 2AKAB 2NGRA 1KNQA 2XAUA 2E9SA 3OHMA 1T0HB 2I1VB 1HQYE 3K53A 1TTTA 4GZMA 1OE0A 1WP9A 1OIXA 4NCIA 4DDVA 2YWGA 4WW0A 4EFLA 1IJEA 4GSYA 5FOVA 4JVLA 3FMPB 2O0HA 1P6XA 2XZOA 1Q44A 4GOJA 1Z22A 5K8UA 4IW3B 3UG6A 4TZ0A 1KI1A 1GVNB 2JIZA 4IOKA 5BXQC 4HDOB 4XD7D 2VYFA 4B73A 1E2KA 2DB3A 2Z83A 1UEIA 3ADKA 2OLJA 1RW4A 4AKEA 4AY2A 2HLDD 2DR3A 4DHEA 1T3HA 3QNUA 4YXWA 4ZDWA 2W0SA 4EDHA 1NSFA 4HLDA 4UNRA 2MSCB 1MO4A 3QPVA 2B7CA 1FQKA 4GT1A 4ZI3A 3EWAA 2YNMA 5KPJA 3FB4A 1CR2A 3SFZA 2IX3A 5H8WA 3QE0A 1YVDA 3EC1A 1EFRA 2HYDA 3IEUA 2VH5R 1JECA 1DAEA 1ZNZA 5JWHA 2ZYUX 5CITA 4LY6A 3K70C 4QL3A 4RJLA 1E9AA 1QF9A 4OJKA 1M8PA 3RS3A 1KDTA 1UBCA 2FFAA 2NO7A 2GA8A 3I92A 2DFLA 4RD2A 4Q1DA 4US0R 4D6PA 4JZKA 2H92A 5HKKD 3KFXA 2P3SA 1FTNA 1JPNA 3MUFA 4NPHA 4WXRA 2TMKA 1YU9A 4E22A 3V4RA 4OQLA 2IS2A 5D3QA 2J0QA 1FUUA 3HR7A 3CR8A 5FPYA 1VG1A 2QL6A 2WJYA 2GKSA 3WP1B 4AYWA 4Q21A 4TYWA 1GKIA 5FPKA 1IN7A 4MRSA 2E87A 5AJYA 2GCOB 4C3ZA 1NL3A 5A4JA 4YQFA 4N1AA 4ERNA 1VCIA 4RVCA 1A2KC 2XX3A 3SFVA 1KI8A 4EJSA 5KPDA 2OFXA 4MDEA 3EZFA 4QHTA 2QY9A 4TMKA 3Q7QA 1KNXA 4WVFA 1GTVA 1YRAA 2A5FA 2ZQ5A 3V4FA 4O2LA 5FH9A 2R6DA 1W2HA 4GRAA 3A8TA 3BB1A 3PXGA 3AUYA 2GK6A 4PXAA 4ARZA 2O8BA 5K8TA 2W6JD 3BXZA 3I8SA 2ZYVX 4EFNA 5FL7D 1SKYE 3UANA 3TQFA 2FPKA 4DUGD 3GLFB 4TYNA 2ZVQX 1XMSA 2V6JA 4GDFA 2WJJA 2WKPA 4C2TA 4TQ9A 5KTYA 4MRNA 1G8GA 1SXJD 1E69A 4RD0A 2QP3A 2HF8A 4B71A 5FL3A 5LBIA 2RGGA 4C0KA 3CO5A 4IHQA 2FMXA 1I2DA 3UMRA 2J9RA 2YYZA 1E3MA 3KJEA 4NCKA 5BN4A 1PLJA 1KI9A 5TVKA 5JZVA 5JJLA 4L8GA 2OUKA 2PMKA 5KU1A 3GLHE 4RZXA 3VU9B 4B2LA 1N2CE 2QPTA 3FMOB 1Z0KA 4L9WA 2VSOA 4Q1BA 3ZZUA 1N6NA 1TQDA 3EZ2A 1S9DA 2RGCA 5KDOA 2VP5A 1N6PA 4URUR 4JBXA 1Z29A 2Z0MA 2IYRA 5JCPA 4S35A 1W4CA 4NE2A 3ZDQA 2HLDA 2P67A 3NXSA 3K0AA 4MUBA 3J81k 2CHVA 4J0QA 4P4TA 4HAWA 1M74A 2YC4C 2CE7A 4JLKA 3B5JA 3U7FB 2R2AA 3CF0A 3CX7A 3KJHA 3SJBA 3U3RA 2H57A 4K46A 3FPAA 2BBOA 1YZGA 3HYRA 4B44A 3T1TA 2ZE5A 1W49A 1A82A 3QXCA 5F3WB 1Z5ZA 4C0SA 3ADCA 1K5GA 4N0DA 1ZU5A 1YZLA 1G6HA 1UKEA 5G3ZA 3OIWA 2KBEA 4XWKA 2QAJA 2A9KA 2XXAB 1CBUA 1E1RA 2ORVA 3ETLA 4JKYA 1ZM4A 4PAMA 2ZRIA 2P5SA 1M7GA 4YDSA 2ZTSA 2AK2A 3SYLA 2PT7A 1IAQA 2GZDA 2IYTA 2V8OA 5HCNA 3TE6A 2CK3A 1K6MA 1MO5A 3CNNA 1N3BA 2WWHA 2QG6A 2QSYA 2RB4A 1KJZA 1Z8FA 3NBYC 4KVAA 4KCGA 1KDPA 1ZD1A 2C9YA 3AB3A 4C0BA 4EKDA 1P4SA 5HE9A 3BB3A 1N5LA 3SE0A 2AX4A 2GXSA 1FOEB 3C15C 4B48A 1E0AA 5B64A 1XJQA 1E4VA 5C4GB 3O47A 4Q03A 4Q01A 2FFBA 1N6HA 1U8YA 2XB4A 4U00A 4Q66C 1W36C 2AD5A 3MD0A 4KHZA 2WJHA 2ZYTX 3RRZA 4DDUA 3Q7PA 3N2EA 4RFSB 3KUDA 4CVNA 4BFSA 1AZTA 2GCNA 4CEHA 3VKHA 1KK3A 5IK2A 2XB2A 4LJYA 3I32A 4TYPA 2AWNA 1R7RA 1G4AE 1R2QA 1X1SA 3QI2A 4R7ZA 2IS4A 4LV5B 3IEVA 1Z63A 2EWVA 4LJ5A 3VR5A 2WPDA 4M9QA 3QBVA 4C9BA 2ZJ2A 2XEXA 4FMBB 2XGJA 2JDID 3GFPA 4NZYA 4ESVA 1S1CA 1SXJC 2B6HA 2F1JA 5IF9A 3TGPA 3D3QA 2ODNA 4ZKEA 2OILA 4ON9A 2GCPA 3W5JA 1U0JA 1E2HA 2R9VA 1Q57A 1FFHA 3CW2A 2P6UA 1N6KA 4ZDKA 2QMEA 3B82A 4DIDA 1CU1A 3RAPR 3SN6A 1ZP6A 4CEJB 1JR6A 1U0HC 4DC9A 1E9CA 2FPLA 4W5HA 2QI9C 1L4YA 3LLMA 3H84A 2IEZA 3CF6R 5AJXA 3W6NA 4BZQA 5C46F 3TK1A 3VKWA 4DCSA 2QE7A 2OAQ1 2WWIA 4AIIA 1VMAA 1JBKA 1F5NA 1E0KA 1MOZA 1R4AA 2JLSA 1ZAKA 3QXHA 1DVRA 1GSIA 2VF8A 1ZM2A 3MRSA 1QHGA 2WSSA 2OE2A 1NIPA 3BAFA 1IBRA 4NCHA 4DBLC 2XXAA 4HYYA 3K70B 4HATA 1X6VA 1JPJA 4HUQB 1FMLA 3GJ7A 3R20A 2WM9B 3ND8A 3P4XA 4BQSA 3VR3A 2FV8A 5TXGA 1R0XA 5JWOA 1T4GA 2QPOA 1XXHB 4MKHA 1IJFA 1KIMA 4AURA 5TARA 3K1JA 3P32A 2VP6A 1YR9A 3LFUA 3CRRA 3QF4B 4QJ4A 1TF2A 1TPZA 2FDCA 1Z06A 2ZROA 1XU4A 2Q3FA 4KFUA 3RDPA 1XCGB 4LX0A 3CWZA 4QGGA 4A0HA 4UQOA 3OFND 2OXRA 3ZYCA 3K9GA 3AM1A 5K8IA 4Q4HA 4TLEA 3NIBA 3VX4A 1DE0A 1RZ3A 1ZU4A 5FR1A 2F9LA 2VLIA 1OB2A 5FOTA 3X1YA 2O8EB 2ZRGA 3LW8A 1KJWA 2WAXA 1JB1A 2IYYA 3QKTA 3DL0A 4M1OA 4MGZR 2IWHA 3KQLA 3ASZA 5G41A 2NZ8A 4ASUA 1BMFD 5FTKA 3P20A 2XZPA 2QAGC 3T06B 4ACBA 1QHSA 2D62A 2RMKA 1OV4A 2XOKD 4CT5A 2CLCX 1I4TD 2O8CB 2IYXA 1IONA 3CPJB 2VHUA 5DYIA 3BS4A 1L7VC 2QA5A 1VCOA 2F9MA 3MWYW 3LAWA 3TW4A 1W47A 3L0PA 5G40A 3SJZA 1G5TA 3UMFA 3GEIA 3PFIA 4URWR 2GAAA 1U9IC 2EYUA 3T34A 2GZAA 1OFTA 3IQWA 4KBFA 4QNMA 521PA 2JJ1D 4JLNA 1NJGA 2HV8A 3WYAA 1JEDA 2OCAA 4EAQA 1J2JA 4K8OA 1WE2A 4HLCA 5DSZA 2GEDA 1CRPA 4P31A 4DB4A 4JL8A 1UKYA 1GG2A 2IYLD 3GLFE 1ZIPA 4Q7LA 1RC8A 3RYTC 2BBSA 2C99A 1Q20A 3PEVA 1ZCBA 4HSEA 4DSOA 1Q1BA 2A78A 2GF9A 2QQEA 2FZ4A 5L3RA 3FKQA 1P5ZB 1KDRA 2FFHA 1T3SA 2DHRA 4V02A 4XD7A 1P72A 1XTRA 2C78A 2HUPA 2QM8A 4GP7A 4KYUA 5AJZA 2ZR0A 2KBFA 4AG6A 1NBMD 1H8HD 4PHHA 2QMUA 4LCBA 2IUTA 3NH6A 1Y3AA 2GZHA 1GZSA 1JXOA 5HR5A 2IA5A 1UM8A 2OBMA 3SYKA 4B75A 4FIDA 5JRZA 5AJWA 3IIJA 4CYMA 3T1QA 3ZIAD 2J7PA 2O8FB 2WWWA 4IFEA 2JCSA 3LV8A 1XEXB 3W3AA 2ZE8A 5GVSA 1OKKD 2F1IA 3TNFA 2O52A 3QUSA 2FGJA 3QXXA 3EASA 4A2PA 4JMPA 3A1SA 1E98A 3IO3A 3H4MA 3FHOA 4TWZA 3CIOA 5L8VA 1OJLA 2GWHA 2OHFA 1ZCAA 5IRCD 4NH0A 2JATA 2CL6X 1M2OB 2QSZA 1YZKA 2I4IA 4RSGA 3THOA 1FNNA 2WJVA 3EW9A 3U6BA 2RGDA 1U90A 3REGA 4E5UA 2AK3A 1WBDA 2GVZC 1AS3A 2GK7A 3EC2A 4LC0A 4EPXA 4Q1FA 4NYJR 4MITA 4UNSA 1ZD8A 2ZVPX 2JGNA 4PZLA 3B1WA 1F2TB 2EVWX 1EX6A 3GLGA 1OFIA 1LB1B 5C18A 1OB5A 4LRWA 4HB3A 1T5IA 3W6OA 4K81B 1IXRC 1MRSA 3X1DA 4IRUB 4QHYA 2UKDA 5F9HA 4O2RA 1E9SA 3RC8A 1SXJA 2RHMA 4JYCA 3BJIC 1G7RA 3LBNA 1MO3A 2V55B 2Q9CA 3CZPA 5CK4A 4N3NA 2CXXA 5JS8A 5EXPA 5J4YA 1U0LA 1ZINA 4BFVA 3R9IA 4E03A 2GESA 2P65A 2K5UA 4I1VA 1T3LA 4BFYA 4FN5A 4JSYA 5FPSA 3A1TA 2IBMA 1FX0A 3G82C 3ECCA 3UK6A 2ZRFA 4Q7KA 1X1RA 2VSXA 2W6JA 4XVRA 4JLJA 3X1WA 1P9RA 3OEHD 1QHIA 1G16A 1EGAA 4KLNA 3OEHA 3W8RA 1OPXA 1YZQA 2CVHA 2J1LA 1TQ6A 3WRXC 1QVRA 1DAIA 5J4VA 3K9LA 2BCGY 3KUCA 2R6AA 2W00A 4BUJA 2XITA 2GRJA 1G21E 1W48A 2J3EA 1WCV1 3E70C 2E1RA 4PPQA 3R9XA 1IXZA 4QKQA 3HPRA 4URXR 1ETUA 2KWIA 3ZGXA 5EE1A 3L2OB 2AL7A 4BLSA 2QMOA 2ZSEA 1CXZA 4TQUS 1DBSA 3MAAC 1UAAA 4ZV4A 3BFVA 3EG5A 1VCMA 3AKYA 2ASEA 3HPQA 5FTJA 2EU8A 1CS4C 3ZZTA 2PT5A 4YC7A 1KK0A 4AK9A 3SHFA 3PUWA 2ZSFA 2MSDB 4BFZA 1RRFA 5HTKA 3L8ZA 2W6IA 3T1OA 1Q12A 4NDZA 2FN4A 5FBWB 3Q5DA 3TVDA 1IHUA 4PPGA 4W5JA 4BGDA 3SQWA 3AF2A 1J70A 3AVYA 1VIYA 1VG9B 2Z4RA 2ZREA 1XXHE 2GCOA 2QRNA 5DLQC 4BLTA 5E7MA 4XOIA 4QJ3A 5M04A 3IIKA 4IVQA 4LPKA 3CPEA 3PIRA 3KKPA 1E2NA 4IJMA 2XJ9A 2V4ZA 1P61B 4RCZA 1G41A 2C9OA 1KTVA 4FMCB 3THYA 3VFDA 4YXWD 3RSLA 3NEYA 4ZO4A 4QOSA 1RKBA 2VP9A 1N6IA 1TX4B 1E2EA 3KB1A 2R44A 2RCNA 3UWKA 1ZM9A 2MMGA 3K0EA 3MJHA 3QVUA 2C2HA 4F4IA 4KV9A 4S2EA 1HYQA 2CNWD 2YKGA 4Q4JA 5AUPB 1XJ0A 2CNWA 4IDNA 2HYIC 3KJIA 4HLUA 1NVWQ 2GJKA 3BORA 1W0JD 1E9DA 3NVAA 4KSBA 1GL6A 1LTQA 4LHZA 5F9FA 2FSGA 3OE7D 4JBWA 1LY1A 3MWKA 4Q02A 1FP6A 3A37A 4IOJA 4LYAA 1PZNA 2WAYA 2ZS9A 2OFWA 2ZE7A 5UKDA 1R0YA 2XSZA 4Q1AA 5KOYA 4PQRA 1P75A 1DADA 3PJRA 3K09C 2DFNA 5BQ5A 1NMZA 2RHDA 4LGMA 5EP3A 2BV3A 3A4NA 3W6PA 2ODWA 1Z3IX 2NO1A 2Q3MA 1NKSA 5SZJA 1FW6A 2IYSA 3PUYA 4BFWA 2ZRHA 3BH0A 4QGFA 4Q9LA 3CUEF 1EWQA 3WP0A 2DY1A 2ZRBA 4URZR 4MA4A 1D2EA 2OBLA 2G9NA 5JSZB 2N46A 3VNUA 1OYWA 3C4JA 4JLBA 4ZI2A 4DSUA 4A36A 1SZPA 3CZQA 1G8HA 2OV2A 4JSTA 5CLQA 4ZCLA 3MSXA 1GOTA 1GRRA 1U8ZA 4LJ4A 4A2QA 2JLWA 1XTSA 1QG4A 2QRZA 4JT4A 5DISB 4TMXA 3TJZA 1DG1G 4BRWA 3ADBA 1NN5A 3QF7A 1EK0A 1ONBA 2ORIA 5F2EA 5CDFA 3TKLA 5KSYA 1Q3HA 4M9SA 1LFDB 5DH9A 1E6CA 1X8LA 2CLDX 4MRPA 5EXXA 4ASUD 4DCVA 4D80A 2YHSA 4G5OA 4A8JB 2BMFA 1D8TA 1Q1QA 3SEAA 2BJWA 5C2JB 1KMHA 1OXVA 3H1TA 4WA7A 3FOZA 3DVLA 1M7BA 4MH0R 1QHHA 1X8JA 5CDFE 2OM2A 4LJ9A 1A4RA 3PCRB 4OI4A 3GP8A 2CK3D 1BYIA 2IYUA 2ZI4A 2GXUA 3EPKA 3PITA 3OE7A 1M34E 1ZW6A 3P27A 4QHSA 1CP2A 2AKYA 2JASA 3VX3A 4B6FA 4CEIA 4M1YA 3X1ZA 3SZRA 3CWQA 3K0FB 3U7GA 2EFEB 4EJSC 2VA8A 1F48A 2CHGA 4ZPXA 4BFUA 2GETA 3SOPA 1SHKA 4MKIA 1JALA 2V54A 4GNKA 2ODEA 1VTKA 1WA5A 2QEQA 4BFXA 2IS1A 4F4JA 2V7QA 4KODA 2G1KA 3ZQ6A 2XNSA 1FUKA 3C7KA 1HY3A 2AR7A 2A3RA 1NVUQ 3LX5A 3MLEA 4L15A 2FZLA 2YZ2A 1KK2A 1DO0A 1KO8A 2ZRCA 2ONJA 4RKEA 4WXPA 5EP4A 1XJCA 1GIAA 2HDNB 3GLIE 1NN3A 1FZQA 4M21A 1QBKC 1JAIA 3PEUA 2CJWA 2OEPA 4DWJA 3I73A 4F4CA 1YR7A 3LY5A 3KQKA 1UBFA 1HA3A 2GVDC 2VHCA 3MWJA 3JVVA 4QM6A 1E32A 2IL1A 1YZNA 2QT0A 3AVUA 4KFSA 1II8B 2ZSAA 4UJ5A 4UNNA 1KAGA 2WTUA 4FMCF 1TUEA 3Q72A 1IN5A 5J5CA 3W90A 2IYWA 1ZMXA 4V0NA 4B35A 3NDBB 4RY2A 5KYKA 4CGZA 1OXSC 2RGEA 1KO5A 1G4UR 3NC1C 4YMUA 5J4HA 2O8EA 1HE1C 4BFTA 3GJ8A 2D06A 3B6EA 3REFA 3A6PC 4LDJA 1EG7A 2RGXA 1FX0B 1LS1A 1DO2A 1SQ5A 3PQCA 4PTLA 4G5SA 2F43B 2F1RA 2J5XA 1G6OA 2VP0A 3IPXA 1T5LA 3GCGA 3MGCA 1NNEA 5FI1B 2QMHA 4AWXA 2QT1A 1OHHA 5A5GA 4D4JA 1G7CA 2ZXUA 2MMCA 5JMTA 2J0UA 4TLCA 3DMNA 5IT5A 1K8RA 2NPIA 1TL7C 3I1FA 4KFRA 4P33A 4PC1A 3B13B 5IDVA 621PA 4D25A 1Z6TA 2FU5C 1OLOA 1GUAA 1ODFA 1DAFA 1V43A 2IWRA 1E2GA 4JBYA 4PHGA 1F2TA 4V0KA 1IN6A 5EE9A 3KQHA 3W5IA 4OI0A 1XXHA 4A9AA 3B60A 3F5FA 4YDHB 4QBHA 1Z0FA 1NVXQ 4FMDF 1XMVA 2OXCA 4US1R 1WQ1R 2HEIA 4EPRA 1KZGB 4ZDJA 1J7KA 3EZ9A 4F7WA 3BFXA 2ERYA 2ZI9A 2REOA 2QORA 3SBEA 3SJAA 1L4UA 3B9PA 1JR3E 3ICQB 1E9RA 3LDAA 1SVOA 3ADDA 4BZXA 1UDWA 1OH8A 2A30A 3KB2A 2DBYA 3RWOA 2JLVA 1PLKA 4JVMA 3R7WB 4KSCA 5AUQA 1CJKC 4QJ5A 4EQ6B 4XJXA 1WXQA 5G3YA 3HR8A 2X1VA 1SKQA 2WIBA 3UWOA 1G3MA 4IDHA 3CONA 3TR5A 2LWIA 1XDBA 2CCKA 5DGXA 2ORWA 3EX7C 1XD2A 1DELA 5FUVA 4DLSA 4OQNA 2CBZA 1GRQA 1XFAA 2KB0A 4LV8B 1ZUHA 4I1SA 4CIDA 4Z1MA 1XD9A 3GLFA 3TQCA 2G83A 3A1UA 4GOXA 1K5DA 4JLPA 2OZEA 3CNLA 1R0ZA 3THYB 2EW1A 4GMDA 4M53A 1AN0A 1C1YA 1P2SA 1EWRA 1OW3B 1S8FA 3K09A 4JL5A 1Z0IA 4KU4A 3LXXA 4RFVA 1JAHA 4YMVA 4D0LB 3DZ8A 3PR1A 3RRMA 4P0TA 4O25A 2J7KA 1F60A 1OKKA 2ZI5A 2GDJA 4TSFA 3LLUA 2IXEA 2VTKA 4B76A 3OEED 1RYFA 3ZLJA 1GKYA 2GHIA 3KL4A 4E09A 3WMFA 3NTUA 3UXMA 3ZVNA 3THXA 2GJSA 3G0HA 1FP7A 4KAXA 3LRPA 3VR2A 5CM8B 1Q1ZA 2J45A 4G1UC 1VKJA 4W7SA 3RS2A 5LB4A 2Z43A 2JLRA 3E2IA 3K9NA 4OK3A 3CM0A 4DCTA 1Q22A 5AK0A 2IYVA 3BGWA 2XTNA 4A1FA 1HTWA 3U4QB 4M1KA 2WHXA 3MMPA 1AGRA 4LZZA 1R0WA 1KJYA 1RPZA 3AKDA 3HU2A 2WVJA 1IXSB 3QVVA 3IHLA 5L3VA 5KSZA 5DNYB 4B2PA 2OCBA 1KKMA 4FCWA 3A4LA 3B7GA 4JJZA 4DLTA 3H86A 2HF9A 1OXTA 2ZRKA 2PBRA 2VSFA 2EFHB 1FPMA 1DAKA 5FL7A 1WMSA 3JZMA 3KKQA 1N6RA 1KKLA 2FGKA 2ZRNA 1OIWA 1XTJA 4FXPA 2WIAA 3LVRE 4YMTA 3AF0A 2F6RA 2L0XA 5CYPA 1R8SA 2DWOA 1LF0A 2H1LA 3IILA 4M1TA 4A8JC 4D4MA 2PEZA 4CRWB 1XPUA 1I4LD 1MABB 4DUGA 5EZ6B 1DPFA 4NMMA 4ILEA 1GRNA 4BEBA 1TF5A 2EFDB 2D3WA 2JJ2D 4Q19A 4OQXA 4A82A 3AV0B 3RNLA 5KNDA 2QTHA 4QG7A 3QF4A 2IYZA 3GLGB 2QM7A 3IDQA 4Q5IA 1LV7A 5JJIA 2GBLA 4HB0A 1XNJA 1PV4A 1G8PA 4D0GA 421PA 1Z08A 5FBRB 1OFUX 4M0LA 4QGHA 2DFTA 1HQCA 2VQSA 1S1MA 2BEJA 2H16A 3C5CA 4RD1A 3U5ZB 3W8NA 4PO8A 2AFIE 2VRWA 3AF4A 4FD2A 4NYMR 3OIUA 4Q4AA 3Q8XB 2QTFA 1NRJB 5IK2D 4AI6A 4FMDB 2OCYC 2ZE6A 4YONB 4QGAA 4PZYA 3FDIA 2C5LA 1KDOA 2XTZA 2G1JA 5KO2A 3TUZC 4OKSA 2AXNA 2RGAA 3SHWA 1BYUA 2PZEA 3CRVA 4C0QC 4D81A 1KOFA 4M1MA 3WHLA 1EFRD 4LHWA 3FVQA 4OL0A 1ANKA 1XMJA 5CB6A 5B58C 3I3SR 3IBGA 4NKRA 4O0MA 1RFLA 3KFVA 4DSNA 2BM0A 1YZTA 5JHGB 2QTVB 2QBYB 3OIYA 2ZRPA 1JEEA 1N0UA 3KXKA 1V5WA 4FWIB 1UEJA 2GEUA 4EQ6A 3ZS8A 2VHTA 4PHFA 3F0TA 2Q9BA 2QE7D 2ZUCA 3OF5A 4I81A 3L0OA 2C04A 5GVRA 2VBCA 4C0LA 2ZRDA 5JWRA 4DLXA 3NBFA 2QENA 4A92A 3GJ3A 3O8RA 3GLIB 5JECA 721PA 1DAGA 2ZI3A 2ZUBA 2WMOB 2O0JA 5KNCA 2GJ8A 3OEEA 1DS6A 3UPUA 2VO1A 1NY5A 5DI3A 3FFBA 4EJSB 1CJUC 4JS0A 1YQTA 2VHQA 3JVUA 4LWZA 2G3YA 4F92B 3AKCA 1W46A 1X8KA 3CRMA 4NBSA 3Q3JB 4YLGA 1ZUIA 3I72A 1YR8A 2FSIA 5DE3A 1GFIA 2WSMA 1W5TA 5AUNB 2PLFA 1OYYA 5L3QB 1COWA 4F38A 1W0KD 1JR3A 3AGQA 2FH5B 2UZ3A 2ZAOA 2FSHA 4WZ6A 4GI7A 1NIJA 3AUXA 5GJCA 3LD9A 2VL7A 4LBYA 4WBSA 2G6BA 3THWB 4ITRC 4PANA 4PQYA 4Q9JA 2XJ4A 4HDQB 2N1BA 2CHQA 1E9FA 1NG1A 3T61A 2NO0A 4OI1A 2HJGA 2ODBA 3M0EA 4MUAA 1G17A 5TB5A 1NSTA 2J46A 4MGKR 3WYFA 3FFAA 4LHVA 5JEDA 4B3DA 5E95A 4JIMA 1N5KA 2ZUDA 2ZRLA 4G01B 2ECKA 2V7QD 1ZC4A 4PFSA 2O8FA 3NHBA 4L5BA 1TEXA 2YV5A 3EIQA 4Q7MB 3DOEA 3ZJYA 3C41J 1Z07A 1VG8A 2C77A 3A1WA 2P0EA 3N2IA 4DCUA 2JLYA 2P6RA 1EESA 4ACAA 4NYMQ 3WNDA 1RYHA 5F98A 3RABA 1NG9A 3L43A 1S9HA 3Q5EA 2AWOA 3T5GA 3VR4A 4LYJA 1A2BA 5E7IA 1VIAA 1N25A 1JI0A 1CULC 2EYQA 5KUTA 4PC6A 3B9QA 3RRNA 2QNRA 2NZJA 3MWLA 2HCBA 3HU3A 1Q0UA 2RKOA 3UIEA 4TL6A 3NHAA 4B33A 1U2RA 4BRUA 4HUQA 2IT1A 4AKHA 3QIAA 1F2UB 4WOPA 3LA6A 3U6KA 2VF7A 2IS6A 1S3SA 4PC3A 1XMIA 2O8DA 4TL8A 4OQFA 3K70D 1GL7A 4DB2A 4DT1A 3GFTA 1G3UA 5D3MA 4A2WA 1IOZA 1CF4A 2FJUA 1CR0A 2IYQA 1OIVA 2ONKA 2PJRA 4V0LA 1WF3A 1Z0AA 3KKMA 2AD1A 3R7WA 4NU0A 4RCYA 1RRCA 1XTIA 4LI0A 3TW8B 2O8CA 1H8ED 4RD3A 3U44A 1Z0DA 1KZ7B 1II9A 2ZI6A 3WRYC 4CT4B 2DFKB 3ICEA 4HAXA 2QU8A 1M6NA 3AGPA 4MDFA 1XEWY 3K0SA 1OH6A 3NC0C 2A5JA 5H70A 3TH5A 4UXJA 1S2MA 1AK2A 1YKSA 1DEKA 1XBTA 1GNPA 3FGNA 1OH5A 1KO1A 3BFKA 3IUYA 1XTQA 4CZ2A 1OF1A 5CJ2A 1BIFA 2WZQA 2B7BA 2GEVA 4PPFA 3S1AB 4HAUA 2HT1A 3VNVA 1KSGA 4HLUC 4DCNA 3D6TB 3D31A 2QPAA 1XF9A 2F3TA 3AKEA 2ZETA 1AIPA 4V0OA 4KBGA 4MYHA 4D4LA 1S96A 3EPJA 1E2FA 5EE5B 1G291 3GEEA 4JKIA 1SVWA 4EPTA 4LSGA 1COWD 1E99A 1PUIA 1EFCA 4HI0E 5FUXA 6Q21A 3DKVA 1SVLA 3UATA 2H7VA 3T35A 4B3GA 1FTSA 4PSVA 5EUMA 3L0SA 4NCNA 3K0CA 4OBEA 2OG2A 4DDWA 1OSNA 3NDPA 4RFSA 4WZAE 4Q7JB 1WDTA 2QN6A 4JLMA 3CBQA 3NEJA 4EPYA 1SULA 2LKCA 3PUVA 4Y0AA 2Q9AA 1XTKA 2NIPA 1GP2A 1W4RA 4LOAA 3BB4A 1G19A 1MO6A 2V1UA 5FTLA 3PENA 4RZ3A 2A5GA 2BIFA 1WBBA 1T8TA 1FNMA 1YHNA 2J0VA 4LPSA 2A2ZA 2R65A 1BKDR 4PR0A 5JJKA 2GJAA 1BO6A 3PEYA 1P3JA 4ZIRA 2ZR7A 1HT2E 4A15A 1NMYA 1FQJA 2I3BA 1NLYA 1R6BX 2F7SA 1KI6B 1XEXA 3SBDA 3U7HB 1DG3A 4LJ6A 1U8AA 4W5WA 4XVQA 1Z2AA 2V1XA 1P9NA 3QEOA 4QC2A 2R6CA 4AKIA 4JLOA 1E9BA 4XTRA 3TSOA 4LYFA 3QKRA 1R5BA 1AS0A 5L3SA 2YC2C 1XCMA 3PVSA 2QZ4A 2DWPA 2F1HA 4TTPA 2A7QA 4OHXA 4WIAA 5ELXA 3RHFA 1PJRA 2UVQA 2ZAMA 3B1YA 221PA 3RSOA 2X19A 3ZQJA 1DAHA 2XNDD 3WNBA 2OAP1 1AM4D 3LX8A 3RC3A 2PMDA 1D9XA 1VCNA 1ZM7A 4AC9A 5B30A 5K8LA 5FUWA 4MQBA 2WICA 4DLVA 1NF3A 5DN6A 3D8BA 3LVQE 2ERXA 4MRVA 1KY3A 1RRGA 2YINC 1QHXA 3T5DA 2X77A 2D7DA 2PCLA 1NVVQ 1QHYA 1W0KA 4B3BA 1NVVR 2KE5A 2JJ2A 5SZIA 2VP2A 3EWSA 3DM9B 5FPHA 2HXYA 1C4OA 2YWHA 3B2EA 2PEYA 1N5IA 1OHHD 3HU1A 3QPWA 4QRHA 5TY0A 3GLGE 4IXNA 1S3GA 2ZYWX 4OHZA 2FE4A 4Q4LA 3OFNA 4AD8A 5C4MA 5E3HA 1KMQA 2RGNC 4DEXA 2ZM5A 8OHMA 1E94E 1XEFA 3CR7A 4V03A 1N5JA 3V00A 3SC3A 2FEMA 2LCFA 3Q9LA 5KDDA 3C8UA 4TYQA 2FPMA 1GDDA 4HEJA 3IHWA 3A36A 4JL6A 4OHWA 5B2ZA 3SR0A 3IKJA 2W2XA 4A8JA 2REXB 4MKGA 4UXIA 1G8YA 4TTRA 4HUTA 4P3YA 4TQAA 3W9YA 4ZCMA 2V9PA 1KI4A 2IC5A 3LW7A 3O8BA 4XIGS 2O8DB 2QP4A 4DDTA 1IY1A 1Q21A 4TTQA 4A6PA 5DIFA 4M9ZA 1CJMA 3U3KA 3TBKA 2IUSA 1ZNXA 1IN4A 2QQ0A 2ZJ8A 3WYGA 4DLZA 1TU4A 1HV8A 3KJGA 4KO8A 5E7JA 4M4SA 3VMFA 1P62B 1R5OA 2IW3A 2RGBA 3MJRA 3VR6A 3X1XA 3LNCA 1UF9A 3GLHB 4HLQB 3B8HA 1NLFA 4M1WA 1F3OA 4KI0A 1GNRA 4NTZA 4Q18A 2VP4A 5FUYA 1CLUA 5EJEA 3K9HA 3H2YA 2AXPA 4I1UA 4L16A 3K0AB 1AKYA 2EFGA 2UZIR 2ZITA 3PG5A 3I8XA 2YJTD 2VHJA 4MRRA 4UNPA 2CDNA 3QKRB 4A0FA 5KSPA 5HE8A 3GMTA 1E2IA 1G7TA 1PUJA 4PC2A
chains in the Genus database with same CATH superfamily
1G59A 1YS1X 1TZBA 2PX2A 3AVOA 2YBDA 1YDEA 2V45A 4GBGA 4B2IA 2EJVA 4B43A 4HEHA 5BV8A 1JIJA 1UFQA 4E21A 2XQKA 4D0NA 5IS2A 1RM0A 1CZNA 3DAYA 3MBIA 1IMJA 4QXRA 4B40A 2CCJA 2GTIA 2QRJA 4IMIB 1MJGM 2WKRA 2WT9A 4XW2A 1DP4A 2IOFA 2ZU0C 3JD2A 4RVDA 4WAUA 2PKQP 1BZYA 5ALWA 5KYUA 2IZ0A 3BIJA 3FVVA 1F8YA 1L5KA 1ZH2A 1VHLA 4KOAA 3DWFA 5BVHA 5T3YA 2QIOA 4KWHA 1E6EA 3T3OA 3LECA 1FSSA 3EH1A 4P3PA 3E3NA 5EE3A 4IWXA 4OKIA 4F9GA 4RTNA 2Q5LA 2VT3A 1OGIA 1LJUA 3QV2A 4JAVC 1IHDA 5BWCA 1KSJA 2KYRA 1G7SA 4NE9A 5C8XA 3AHGA 3IAHA 3JQ8A 4QICA 3S81A 1MA0A 1RP7A 3DCIA 1YRHA 4JJKA 4RYDA 3UV3A 4IVRA 3LGSA 3VH2A 1C7IA 2IZ7A 1UADA 2J5BA 2VUTA 2VYCA 4PZZA 3ZGYA 2RIPA 5JZOA 4RPIA 2FRDC 2C8VA 2IP2A 5TQ2A 4C6TB 3TD6A 5DLPA 1LNSA 1X77A 4ZOAA 4ZEVA 4AZ3B 3IXLA 4G0YA 1TM5E 2X86A 4IY1A 4R8VA 4WFJA 4N54A 3HO1A 4MKXA 1VB5A 1K7CA 2RAPA 4QFMA 3I4FA 4X90A 5EKXA 1C0LA 1ONPA 2QGZA 1RBZA 3DBLA 1W19A 4YJ3B 5FR2A 5J1TB 4BNHA 4I50A 2BCJQ 2DPXA 1PU2A 3B1ZA 2Q1WA 3UJ8A 2FUKA 1Z2CA 1XKXA 2JRLA 1B0AA 1K0UA 1TM2A 2ATVA 4RHEA 5K3AA 4DKXA 4E2ZA 5KTRA 5EPEA 5F3DA 1L4NA 4WK4B 2JIZD 1JQ3A 4B0OA 4E7OA 2GNOA 3DZCA 2MJLA 2X41A 2FWNA 2OCPA 3M6AA 4YJFA 3AESA 1J9ZA 4OQPA 3HDJA 1DOAA 2IPXA 4IDPA 1JHDA 3AEZA 1F8FA 3LWZA 4RJKA 4V0MA 5JG7A 2PKYX 3RIEA 5B12A 4YMGA 4V0SA 1Z37A 1ZWLA 3NJ8A 4TS9A 4O2AA 4B17A 1KYZA 2R5FA 3HKDB 4DLAA 3LFHA 4QBKA 9GPBA 1YRWA 1CW2B 3EFOA 3JWPA 4G0WA 2OESA 2RHRA 4EATA 1C0KA 3ZDFA 1P5RA 2R00C 3PL5A 4M9RA 1Z2PX 3SNHA 2PIAA 2GZ3A 1ES9A 3DT6A 4M22A 5D3KA 2V7BA 10MHA 5DWQA 1AGYA 1VE5A 2D4HA 1BOOA 1E2LA 2Y1LA 2OQ2A 4W5RA 4L6IA 4ND2A 3HVRA 3OZSA 4TL9A 1IM2A 1VDZA 2E37A 5IC6A 1IQUA 4RKWA 1G2OA 2IOHA 2VZ0A 4C2UA 1WXHA 2HBQA 2WWGA 3GP3A 1NNI1 2GZMA 2IF0A 4FGWA 4LVUA 5AHKA 5DHSA 5DT2A 4IJUA 4KRGA 2A9RA 5B2EA 5B1SA 1G18A 2ZWMA 1ZUNB 2AG6A 2RH5A 1B0UA 1SZDA 2W2VA 3DW3X 4XWYA 1S0UA 3IOYA 1D2MA 1T2DA 2YR0A 3L7BA 1PP4A 1RTTA 4X62B 1S8AA 2OY0A 1GADO 3PV0A 4TN1A 4TV8F 2CN1A 2JARA 1Q50A 3DWEX 3CRQA 4CMKA 5IT9A 1OT5A 3FUCA 3QY9A 2LIVA 4FR0A 4HN4B 3SLGA 3MRVA 3IV9A 3K3PA 1E6WA 3IHKA 1R6TA 3N7UA 4DLWA 4C87A 5BSWA 1T4CB 2Y76A 3DHVA 5AR1A 4KQKA 5EHXA 4LC1A 4KQFA 1ELOA 4P0QB 2BEKA 3GMSA 4JEMA 3RPEA 3LUFA 5BN3A 1Z0JA 1KH3A 2ZIAA 4E46A 2EKBA 3RS0A 3NUQA 3GLIA 3GT7A 4Q7QA 1DRKA 2VRBA 2VPZA 3AFNA 3ZWQA 1GAQA 4B47A 4JLAA 2KJQA 2CWDA 2CCGA 4L5AA 2FPGA 4PQFA 5IUNC 1KS9A 1EFPB 3TD9A 3QKSA 5JY1A 3OE5A 2Y4OA 1AQYA 1EFHA 3TAHA 1NJ8A 5JCZA 4FWTA 3CZCA 5J5VA 1Y1LA 1C9KA 2PFKA 1JAXA 3SC4A 3KZKA 4F6RA 4KXQA 4WN9B 1YQQA 3GLUA 5ECWA 4YJDA 3LC1O 4BV9A 3R7DA 3V1LA 3FWYA 4P38A 4Z49A 1MP0A 2JI8A 4LTDA 4UE2A 1FQWA 3QYAA 4WGGA 3HMKA 4QBIA 4I55A 1RZRD 4C0JA 3U44B 2C84A 1OH7A 2CHUA 1CUEA 1QRUA 2D13A 2XQGA 3GA5A 4KXUA 3PNSA 1UDCA 5A5FA 1HE8B 4CDGA 3K7EA 4WNIA 3SD7A 1EXMA 2COEA 1EVKA 2SNIE 1Y4ZA 4XFKA 2Q41A 2VDQB 4C6HA 1A76A 1G5RA 1ZXBA 1E1QA 2IDMA 3SDBA 3QJYA 1POXA 4R83A 4RF3A 2I9KA 4WUVA 4ZT5A 1J8QA 1Q0SA 2VOEA 2VS1A 2WWVD 1C1HA 3RVBA 5LZ7A 4XVUA 4AZSA 1KAOA 4HGNA 4D82A 3I62A 5DXAA 1JDBC 1BVHA 4YAGA 1M33A 4AYXA 4QSHA 1ECLA 1W2GA 3CZRA 3W6ZA 4LMBA 4E12A 4J90A 4IHAA 2VUIB 2PX3A 5AOAA 2AQKA 5LVAA 1AS2A 1MH1A 2OGUA 3I34X 1WJGA 2JKYA 4US2R 2QNBA 1V9SA 2QZSA 2MCFA 4KQXA 2QROA 3K30A 3JY6A 1H9CA 4FHDA 2JI6A 1GZ5A 1XCPA 4OHRA 2P79A 3ETJA 1HUQA 1N1MA 4NP6A 4U7FA 3RV3A 5JO0A 4RIGA 1EUDB 3OU2A 4CKEB 4N3CA 1I6LA 1ZRMA 2BEVB 1DHTA 1TZKA 2ZYIA 4MUMA 5LNK1 3TR6A 3TRJA 4ECAA 5FLXA 1MFZA 3KWLA 3L0ZA 4EL5A 1Z33A 4P7KA 4PCUA 2O7SA 4ZVLA 1RHKA 4IILA 5DF1A 3D7NA 1TF7A 3KEGA 1MXFA 4HZIA 5EI5A 2RFLA 3CSDA 1AGPA 4OHVA 4RK6A 1YA8A 4X97A 1TJ3A 4D4HA 5AW8A 4FIZA 4O4JB 5L3SB 1F0PA 3K2QA 3N74A 1MT3A 4HS4A 2TMGA 2PUFA 2PAAA 2KSQA 2GBLC 4L51A 4O2BA 3WLAA 2Z9DA 2SKDA 4MKFA 5J2TA 3VOBA 1G63A 2VNHA 1JHQA 2Z2ZA 4H4EA 1C41A 3NH9A 3S1LA 4AKGA 3BULA 3VTKA 3D0OA 3PC8C 1QHHB 5IFLA 3NUGA 5HG0A 4BPBA 4ZHQB 2WUGA 2JLAA 2X15A 1XHLA 1Z6GA 2QP9X 4MYTA 2PRYA 4N5LA 5GADl 2C07A 2PRZA 1JJVA 2FSSA 3TB6A 5BSRA 4S05A 3B3GA 1P2UA 1MLDA 1KFJB 4QA9A 3LF2A 3U4GA 5A4FS 4EA8A 4GGPA 4ZKDA 3D6UA 4HWOA 2X4IA 1M0TA 4R40A 2AYXA 1LDGA 2V6MA 1FRNA 3BH6A 5ENVA 4M9XA 4HMQA 3HFJA 1PNRA 3NGMA 3W7VA 3S2FA 3G9ZA 1QRAA 4RIEA 4TLAA 4KBYA 5FOWA 1G3IA 2NT4A 1TA4A 4LSWA 4Q9IA 1JG7A 4IG4A 3VJMA 1NLZA 1UT5A 5EESA 6GPBA 2ZDGA 2JJYA 2DKNA 2UYOA 5ERXA 5IAOA 4WKGA 2EW2A 3E5RA 3T1YB 1M2KA 4PN3A 4HGYA 4KMOA 2WOOA 4KFTA 4KSYA 3LP8A 4EGCB 1E7QA 4HDSA 3RS4A 5CA1A 4N49A 2OLEA 1Z8NA 2PU5A 4I5IA 5DO9A 3TI9A 4I6JA 2G0TA 1RYBA 5AKKA 5CBPB 3OQIB 1T8RA 2ZJOA 3QK7A 2Z09A 1TCCA 1HT1E 5P21A 4W9NA 5CT4A 5HZGA 4RA9B 3Q7SA 1P6QA 2B5OA 3KBOA 1FFYA 3LLSA 3ZTTA 3GJRA 4PHTA 4EYOA 4MP6A 4RZQA 2CHEA 1JIUA 4HWTA 4MUIA 5HDQA 2EEPA 4F56A 1AU9A 3MBKA 3K71B 1L2TA 3C5HA 1E2QA 4UHEA 5C8DA 4HZUB 2P5TB 3EZ7A 4Y1FA 1ODLA 1N0VC 2B1JA 5AJVB 2A33A 2PA0A 5GV8A 5I5GA 1TADA 3ZWOA 1PK9A 4YJHB 2PFSA 5BNTA 6REQA 5K03A 4CUJA 1DQRA 1WR8A 3MAGA 4QXQA 4ND7A 3EPHA 2DCUA 3CX6A 2VZLA 1MX5A 3CHYA 3WS7A 3WGVA 3ZNPA 4D7AA 2H4JA 1E2PA 5LBTA 4DIOA 5ED4A 2ZZNA 3K8OE 1C7QA 3UJ6A 3N6XA 4RADA 3C3EA 3NPMA 3WVNA 4DNPA 4POAA 4IH4A 4HXYA 3Q3CA 2PUDA 2J59A 1AHIA 2PLRA 4KZKA 5TV2A 4O2BB 3DBRB 1UDXA 2X0IA 5K8JB 2IY7A 1QE0A 1BN7A 3P26A 1AO0A 5HTOA 1Z39A 2GPWA 2JLQA 3DV9A 1KYYA 4P82A 1Y8CA 4S12A 3OZIA 3FUTA 1D2NA 1V11B 5JBNA 1OV6A 5K3BA 2ZS7A 4EYEA 5JEEA 1WSWA 2DWUA 4OGLA 5K6RA 2O9JA 3BF7A 5I9TA 2WDPA 1GNSA 2IELA 3L77A 3PQ2A 2GK4A 3EIHA 2QZZA 1AY0A 3N28A 4EOGA 4MB0A 1QQ7A 4RAOA 3CB4A 1J24A 1B93A 3VR3D 4DUPA 2IHBA 4KR0A 1L6IA 5DW0A 3OTIA 4U6NA 3G0GA 2YMLA 5E2AA 5J1SB 3T0GA 3ZI7A 5DMHA 3BG5A 4ITUA 1B43A 3BRWD 4LZWA 4EGFA 4M0UA 5EN4A 5BN5A 1A4IA 5BQFA 1UJ5A 3H8JA 1Z16A 3BOSA 4WSOA 4KWCA 1IY2A 1E0DA 1PFWA 1U0SY 2V9ZA 4IFBA 3HVHA 3I9LA 3RJ9A 3ZBUA 2B5WA 3JWGA 2XT0A 2R8YA 3TOVA 1P2TA 3PQ4A 3DEZA 5ILQA 5EIEA 3U3OA 5JC8A 1QDEA 1B6GA 3HLYA 2PO5A 1D6SA 1OLUB 4EUHA 3U49A 3AEQB 1E2JA 3I5UA 3H5NA 3L4JA 5JLAA 1LUAA 2PXHA 1Z3CA 1PBNA 2OXIA 2H5LA 1JKJB 3D8NA 5BSEA 3MQ4A 3JWJA 1WIWA 4L0MA 3GQVA 3M9XA 5HHTA 2ZOSA 1DC5A 4YXFA 1Z74A 3EMKA 1U7PA 5G53C 4ZT3A 5IUJC 3D6NB 2XE8A 4G56A 4KVGA 3WV5A 2GXAA 4C30A 3WLLA 1XD8A 3P0FA 3OQ6A 1IY0A 4OHCA 4DN6A 3BMOB 4MYUA 2QZ9A 3SNKA 4B32A 2CGEA 4GYWA 4JI5B 1WUHS 1T8SA 4BLRA 5LWHA 5BRAA 1JFVA 2QZPA 2ZI7A 3I9V6 3TEFA 1TKBA 2XZDA 3FIUA 1CX9B 1QCYA 3CMCO 4EI9A 3L4KA 3THWA 1IZ8A 4CIAA 2PS0A 3N2KA 3N3BC 1EVJA 2FPGB 3C3PA 2QRQA 2QD3A 3EWNA 4JUDX 2IEAA 4DC0A 1VIVA 5G0SA 1D9ZA 3C3JA 1Z26A 3IJRA 3UWDA 5IKOA 2XCIA 2GILA 1GGEA 1P7VA 2PKXA 4LWPA 4LCEA 3UKJA 2CL0X 1L5QA 2GXQA 5L3QA 1KZ9A 1OX6A 1US8B 4EY7A 3LT1A 5EUCA 2VNJA 3BWVA 4ZHSA 3IB3A 1Y8ZA 1XK7A 3T3IA 3RADC 1NVFA 3WSVA 1L1EA 1DV2A 1QRSA 1YHYA 2FQYA 1Y80A 1GNQA 3BE4A 1QZUA 2GERA 2NXJA 4ZAYA 2UZ1A 3TZCA 2YMMA 3ABQB 1YC2A 3F8TA 1QS0A 3CF2A 3KPJA 1EA5A 3EPLA 2AFHE 1XSEA 4A0GA 4BWYA 3G0BA 2BBTA 4E88A 1DXHA 1XZPA 4BKPA 3RVLA 3GB9A 3PRYA 3SI7A 1W44A 1A5BB 3KQNA 4MWSA 1LDEA 3R5KA 4PLZA 5K9ZA 1E2BA 1WZ2A 2JGDA 3FTCA 2V5UA 4H6XA 5CT5A 1XWIA 3PC3A 4KW7A 4U7GA 5EXTA 3VI3B 3P9PA 3K0FA 4R1SA 1TXGA 2JJ1A 2R62A 3E1GA 4PG7A 4X8MA 3ZXYA 1OT3A 2X2FA 3FOWA 3PC6A 3B6IA 1TCAA 3M4YA 1NQTA 3ZBPA 4ETNA 5CFOA 5KNBA 3RJTA 2G63A 3G89A 1RSZA 5LA6B 1NZDA 3HLTA 3VU9A 2PUEA 1JFFA 3BIXA 1VL1A 1UZNA 3P9SA 3AR4A 3ODPA 2GEJA 3P2IA 1HRDA 1J90A 2PZJA 3ETNA 3F47A 5JW6A 3N2LA 3DNFA 1S89A 3KNZA 3SC2A 3LZCA 1U8EA 3DDUA 4GO1A 4YWHA 4HV4A 3LY9A 1HDYA 3DR5A 4L9RA 3DKRA 4ESHA 3E8MA 5DI9A 4Y2SA 5DTEA 1L8LA 5NLLA 2ZSDA 1NQVA 1PD0A 2GX6A 4XEHA 2I6UA 4A6XA 3F4KA 1GGHA 1P91A 2WHPA 4D5EA 2DT5A 4EW6A 3W9UA 1VPEA 2UYQA 3C3AA 4Z8YA 4U1RA 1KE1A 1MOPA 3WLKX 1YA4A 3D3WA 2RBGA 2XNKA 1L8OA 2QTZA 1VIDA 2C2OA 4R2JA 5BVGA 4JNCA 1VHTA 4MUFA 2VF4X 4MGHA 3SEFA 1VYUA 1IY8A 4RNDB 1NM5A 1RI1A 1UR5A 3C6QA 3R7BA 4URVR 1N6OA 3DVAA 1LD3A 3D0QA 5BT8A 3JQ6A 5JDCA 5CLFA 5B57C 3BA1A 4KLCA 3R8CA 4KC0A 5LKRA 3S8YA 1H6DA 2Y9MB 4R8MA 3GLTA 3HV0A 2ZZKA 3CTPA 3UOAB 2H5EA 4EJFA 5ARDA 1SKYB 1LJLA 1KYQA 4RULA 4YRLA 5CR9A 2V8BA 1NMXA 1ISGA 2AB0A 3LBYA 2DPYA 2WI8A 5IVIA 3LTNC 2G6TA 2AHRA 3M81A 5LQCA 3GJ0A 5DX1A 4GWLA 3IQZA 4UEWA 1V8BA 4W1PA 1THTA 4UARA 1H23A 1D2AA 1CJVC 1DKLA 2YYAA 3H9JA 2V96A 2YJ5A 2PGIA 1PTJC 1PTKA 5JYBA 3CNOA 2DQKA 3KXLA 3SJCA 4JVNA 3WKAA 5BV1A 3L8GA 4LOKA 1Z47A 3HP1A 4Q4CA 2GR9A 4IIDA 5AVJA 5IBCA 2RGNA 2IOQA 4DNXA 1MABA 1N8TA 5JBQA 4CEIB 1JQ5A 3TX2A 4CLXA 2JIPA 2VDOB 1ZJ6A 4CFYA 2GEKA 3UXHA 1SZJG 4R16A 1KHTA 4XGIA 4OVKA 1H9AA 3SDZA 2BP7A 3WGOA 1JWBB 4FINA 1WEHA 2C8KA 3WGNA 4NL4H 3AMVA 3IUMA 5JD3A 3EY9A 4HTFA 2NU7A 4WI1A 2WUDA 1A88A 5K0EA 4JWKA 3RTAA 1T5BA 4NCBA 4NENA 1X3SA 2IK8A 3AF5A 4IGKA 4PIPA 3TM4A 2QM3A 2V0GA 1C0IA 4CF6A 2C3UA 1IZ9A 2APJA 3CW9A 3E5HA 4Q1CA 1WUIS 2PK3A 2PX4A 5EMMA 1YRYE 2P7HA 1P73A 1FDOA 2GYWA 3K5WA 1RADA 3OT4A 4BP8A 3C14C 4PO9A 4WJKB 1IQPA 1XYGA 3OPNA 4R31A 2AJLI 2QX7A 4TT8A 4U02A 4WPGA 4NI5A 4MINA 4WFQA 3EXAA 2ZTHA 5AI4A 5JZBA 4XSGA 3FPEA 1HEYA 2EWWA 4I6EA 5KTSA 1FDUA 1ZZGA 4B3CA 3FKJA 4BASA 1LTHR 3EDYA 1H0KA 3EXIB 4JOSA 4KNYA 4G81A 4FQ5A 2F4VB 4LZNA 3FDFA 3BA6A 3HWWA 2FOLA 5FBLB 3T9FA 2Q2VA 3CRZA 1R5NA 5JSFA 2KM1A 1CUDA 2Z57A 4G5RA 2GN8A 3CYFA 3WGTA 1I2BA 5T7BA 1YF3A 4RK0A 4M7PA 1M2EA 1USUA 3DEYX 4TRNA 3NIWA 4DMRA 3G5UA 1FMJA 3A26A 1QSGA 1SHZA 1B1AA 3G7UA 3G2KA 1XNHA 2FW1A 1JILA 2OHOA 3G2OA 4L8FA 4L9SA 1KJNA 2GWRA 2OOSA 4EPVA 3GU3A 5KTMA 1OWMA 1SGWA 2FEXA 3KWMA 5HS4A 3HBLA 1GGVA 4KDEA 2W2LD 3H2IA 2YV4A 4QBFA 3AL3A 3X44A 4Q1EA 1DIAA 4Q3BA 3KYDA 3DPUA 2WAAA 5DHFA 5GAJA 3U9LA 1RLTA 2Q8NA 3NVKI 1AK9A 3AP3A 2CE2X 2Y77A 2AI3A 3AQ4A 3PYMA 2PQ6A 5D86A 3R76A 3U4HA 1YOVB 5I6DA 3AEUB 2W83A 1JX6A 4MB6A 1AQ6A 3U62A 2SHKA 1FU4A 4PLFA 5TC4A 4AJOA 1QQTA 5CBKA 4HUJA 5C1OA 3U4MA 4MRAA 5BQOA 3RNOA 3ORSA 1CVIA 3BHIA 3QEBZ 2A84A 3TGLA 4UHJA 3G8YA 1K88A 3AY7A 4AG3A 3CGWA 4BNVA 1JYEA 1HLFA 2P3QA 2WILA 4BECA 1Q84A 4R0MA 3DEJA 1AG9A 4WNAA 1DWPA 1NF2A 3RS7A 5K3EA 2IEDA 5C1BA 1G3RA 2GRAA 4G5GA 2I65A 5DDIP 1B15A 1VZ2A 5JFGA 3WLHA 4RHTA 4ZDIA 4QOHA 1P2VA 2P0AA 5HYVA 4IZOA 1G8AA 3WWDA 1QDUA 1E2DA 1MEJA 1H94A 2I0FA 2VJMB 3DDHA 2BHNA 5C0OE 4BMZA 1KU0A 2WNHA 2ASVA 1S2NA 1TT5B 4TMTA 1GZ7A 3WB0A 2CMKA 4W8OA 5DGCA 4CLOB 3SYNA 2DUMA 2J87A 2OUIA 4LGYA 1DC7A 5ESWA 3MM4A 3NIGB 1A9QA 2FPPA 5DHQA 2OORC 1RXEA 2ZJAA 3RSSA 3UAXA 4ZOLA 2O8BB 4HDCA 1LW7A 2WK1A 5GJVC 2QR3A 1F12A 2P9TA 3JQPA 3LXRA 2PNFA 1CJSA 3HDGA 5J59A 3CF4A 1V35A 2BDUA 4M60A 3S2EA 1U1EA 5LLDA 3IP3A 2HXSA 4A6DA 2JEOA 1T9GR 3NBXX 1A5SB 4JLVA 1VE9A 2Z8YA 3TQTA 2YHIA 1ZIXA 5T5QA 1VSTA 3EARA 1Q1EA 1KIAA 1RQ7A 2WUVA 1W8DA 3ANNA 2AKAB 4HGOA 4EY8A 4JOBA 4O1HA 2XAUA 1AC5A 5ALJA 3V4VB 3PNVA 4FFBA 3JU3A 3FSJX 3K53A 4YO7A 3SZMA 3T4PA 3ZHYA 1EINA 4N39A 1MEOA 2CFOA 1P0IA 4QDJA 1FEZA 4U4AA 4GSYA 5FOVA 4BMVA 4JVLA 3FMPB 4TS1A 3REOA 1PEKE 4R68A 3B6JA 3ZY5A 4BNFA 4IHJF 1H1LA 1XWFA 1Z22A 4GOJA 3WLRA 2XZOA 3WMXA 4F9TA 1EIWA 4IOKA 3UMVA 1UK8A 2DWCA 5BXQC 5BRNA 3EEIA 4IJVA 1W581 3GFQA 4BNIA 5I8WA 2DR3A 5F35A 4D25A 3RUEA 4ZZ3A 1EAMA 3CUYA 4FGZA 4ZDWA 4N12A 4DQVA 4CWAA 4UNRA 4E3WA 5AW6A 4GT1A 3HBFA 5EINA 1TDJA 3JQ7A 1NW7A 2IQ5A 3N8KA 3DYVA 2LCIA 3FB4A 4NF2A 5D84A 2VPQA 4IIJB 1EVQA 2X6RA 1NVEA 2IX3A 3PEFA 4JJFA 4K05A 4NU8X 1YVDA 3IEUA 1EFRA 1NMQA 2HYDA 4DIUA 2Q49A 2QLJA 3VVLA 3T3MB 2VH5R 1JECA 1XMPA 3DPIA 5JH7F 2C7OA 1POWA 2VRCD 3E58A 1U3TA 4LY6A 3SCZA 4ZYLA 1NF8A 4EUKA 3DXXA 4EGAA 4U39A 1UBCA 3E5NA 4AJLA 2NNWB 4QPPA 5EJMA 1HDOA 3PDIB 3KKLA 3LYLA 4JELA 3W5UA 4C3OB 4D6PA 1DJNA 1DJPA 2VNKA 3C8DA 2PXAA 1R37A 4G1FA 1MPXA 3MUFA 1YU9A 4GX0A 4GQBA 1H2FA 3EIFA 4OQLA 5EWMA 3V55A 1WD7A 1Z45A 3ETCA 2J0QA 5IWAB 1IOLA 2CMDA 2PZKA 2ID8A 1EUZA 1N9GB 1NQ5A 2EF0A 2GKSA 2QL6A 2Y3IA 3BRSA 3GZNA 3NXKA 3OZUA 3EN0A 4U3JA 2ZLBA 1C1DA 4A27A 2FJPA 5AJYA 3D54D 4D0RA 1T29A 2CW5A 3IT1A 1MB3A 4NBWA 4Z2AA 3WGZA 3U4AA 2P41A 3B20A 4RVCA 1HT0A 1KI8A 1LBEA 2W2LA 3U4DA 2FG7C 4YV1A 4KOEC 2RBEA 1V16A 2HSDA 3QVJA 2H3EA 3Q9UA 4ZVRA 1ZHOA 1GRCA 2A0XA 1KNXA 1AQIA 3BEOA 2ZQ5A 2OFFA 2C9DA 4PG4A 4BKRA 1H1TA 4WCDA 1YUNA 4Y9TA 2GK6A 2VQEB 4ARZA 4X20B 3R40A 2P9QA 2W6JD 3DOIA 4G67A 3GUCA 5K8TA 3BXZA 4IUBS 2ZYVX 1TC1A 2CDAA 1EXNA 5EMJA 2WMYA 1KZ4A 4JDUA 5FL7D 3CA8A 1W5EA 4DUGD 1OAKA 1ZD5A 2B69A 3GEPA 3N1UA 2W2MA 2ZVQX 2EHJA 2R1TB 3OM0A 4MV1A 1I7NA 4UUOA 4B8WA 5JD5A 5KX5B 2NT3A 3O91A 3TL3A 4M1ZA 3FR7A 4IPTA 3SKVA 1SXJD 1S01A 1C3JA 1D09A 5KTYA 1Y37A 3UMMA 1RS0A 5CDTA 1YJAA 5LBIA 2PPLA 4C0KA 4EHAA 3CO5A 1QB8A 3V34A 4BO3A 3UMRA 2YYZA 3HA2A 4OLFA 1DIHA 1N2CB 4TKVB 5A6VA 1E3MA 1PR4A 3JVEA 3HR4A 2VZEA 3HCFA 5BN4A 3PGKA 3NHSA 1NU6A 2JFZA 3I83A 3ODGA 4MWZA 5TVKA 3VTAA 5AQ1A 3OMLA 3GLHE 4GPBA 1Z8DA 4KXXA 4RZXA 1BEUB 1N2CE 4F3YA 2XADA 4C22A 5CB4F 4Q1BA 4RPCA 3ZZUA 4IWYA 1N6NA 4HXGA 2KLHA 3F7NA 4NESA 5KDOA 3PUKA 1N6PA 3FZQA 4HWSA 3MXOA 2DY0A 4JBXA 2AQ8A 4JXKA 4URUR 1WPRA 1Y4UA 1RJDA 2HLDA 3VJLA 3BRWA 4HNUA 5HRCA 2HIAA 3J81k 5DBEX 3GVCA 1WXGA 4J0QA 4P4TA 4C4ZA 4TN5A 2CE7A 3G49A 4O4LA 5A2QA 3B5JA 2JB9A 1P29A 3CF0A 3DE0X 1V6CA 3MB5A 3SJBA 5JANA 2E82A 1A72A 1I4WA 2P6MA 4JHXA 3A6LA 1QLHA 2BBOA 3R6LA 4DMHA 4B44A 3NU1A 1V95A 1W49A 2NADA 4WLEA 3U9TA 1XCJA 1K5GA 5CX1A 2XCOA 4N0DA 4EKIA 1MG0A 2E0IA 3MPUA 5G3ZA 4YNBA 1JXQA 1QP8A 2P2ZA 2WFLA 4UOQA 4EHDA 3ETLA 2BFWA 2XCRB 2GNAA 1EHIA 1H0SA 3K0HA 1CUHA 1ARZA 4IHJB 4PYKA 2CSUA 5MGNA 2VK1A 5EEGA 3HM2A 1CQJB 4FBLA 3CV3A 4POOA 1MO5A 3IH5A 4IH9A 4U7JA 5SV2A 3WICA 2AMFA 3BJMA 5FWXA 4J0FA 1RBMA 1WPGA 1QIIA 2OCLA 2E48A 3G9TA 4KCGA 3KB8A 5HF8A 3MINA 3IJEB 1AUXA 3HB5X 1WABA 1DTWB 4OO3A 4QLAA 3BB3A 4GKJB 4YACA 2HLNA 3AJEA 3RYIB 4ZJPA 1FOEB 4KN8A 3UAVA 2WUWE 4F4FA 1M1UA 1MEEA 3B6MA 2LTAA 4L5CA 2VUUA 3FFXA 4MW4A 3WL8A 1E0AA 3OKCA 2OQRA 5C4GB 4CM9D 4L7VA 2Z1MA 4LOIA 1UJ4A 4Q03A 4FQ8A 3S99A 2FQQA 2FFBA 1N6HA 1NONA 1U8YA 1V37A 2ZB4A 4X7RA 3W78A 5I7FA 1JTVA 1Y5IA 1SCQA 3MD0A 4DR7B 4KHZA 4BO6A 1JI3A 4EA9A 1F51E 4CQMB 1H3EA 1WCWA 3KUDA 4BVLA 4CVNA 4HC4A 3PSHA 1EP9A 2G71A 1JAYA 3BKWA 3PC4A 2QX4A 2J4FA 5JYEA 1R8JA 1N1GA 2WA2A 1HBJA 5I9LA 2XB2A 1QYDA 3AIIA 4MRMB 4HH0A 1NA5A 1R7RA 4YJ3A 5F1PA 4H4DA 3LT4A 1K9VF 1UBTS 1WY5A 4R7ZA 1YHZA 3ZWNA 2RGYA 4Y7CA 5IH3A 4E2FA 4NSNA 1S7GA 3ZCVA 2WPDA 3L93A 1XZAA 1JT2A 2JDID 3GFPA 3I6MA 3OOJA 4ZOCA 5KCZA 2C9ZA 3A1NA 2B6HA 5DYNA 4UM5A 5ESXA 3EQ2A 4Z4HA 1RPJA 3RIYA 4CLRA 4F85A 2WIGA 4MUKA 3RFUA 1Z68A 3Q3IA 5BSVA 2GCPA 2NTVA 1JIXA 5PGMA 2OB2A 3CW2A 4ZDKA 1FNSA 1QONA 2IFTA 2K6GA 4AMBA 6AT1A 1CU1A 1KC1A 4Q37A 4DARA 5JU6A 4TRRA 1N2CA 5DYTA 2B8EA 2CJPA 5B36A 4CEJB 5CIYA 3JD3A 3DTVB 3T9CA 1VP3A 3CE9A 3C97A 4Q15A 4EYQA 4F6LA 3HYSA 1KIFA 2QI9C 3HKBB 3FWZA 1JG3A 3PNOA 3UTCA 3CF6R 4Q9AA 2FZKA 5DBGA 4BZQA 1ZK2A 5C46F 2FWMX 3GARA 1NQAO 2B99A 1IB6A 1M6VB 5DSTA 2OAQ1 2JAHA 3OZFA 4U2EA 2QS9A 3BWYA 2PUGA 1MOZA 2ZBQA 1E0KA 1R4AA 1R3UA 3GO4A 1F4VA 1J21A 1ZAKA 2JAPA 4Q4DA 1G2QA 3TLKA 2WU8A 2FP4B 3E22B 4S1OA 5EQDA 2V0CA 4G4SO 3IQGX 3QBEA 2XMQA 1A3CA 2WSSA 2J09A 2WFZA 3KT8A 2CF5A 4JFRA 3C43A 3M1LA 3UMJA 1X9HA 1IBRA 4NCHA 2XXAA 5BN3B 2FR0A 1NBHA 5KYGA 4GLLA 2NUAA 4HATA 5HM6A 5TQ0B 5HBRA 1JKXA 4LC9A 3PUHA 2OYSA 1X7XB 5ECDA 1R0XA 2VR1A 2H51A 1T4GA 1RC1A 2HFJA 4HNAB 3DSRA 1TVKA 3TOSA 2A94A 2H1IA 4IEFB 3ZDZB 4ZYWA 1XPUA 2A1TR 3GZ4A 3K1JA 5TARA 3QF4B 1ZQ1A 2VP6A 4MVJP 4PZPA 4D3YA 3AQIA 4Z4GA 2HSJA 2MU1A 4DV5B 2JD2A 1P4AA 2ZROA 3GZNB 2PSDA 1XU4A 2XMSA 1D2CA 1XCGB 1EEXB 3VISA 2B1GA 4L8VA 4BC0A 3TN7A 4A0HA 3S2UA 2H2IA 3K8QA 3K4HA 3OFND 1XKLA 2OXRA 3K9GA 4L9AA 3SM3A 2PD4A 3W5VA 2NACA 5K8IA 1N7HA 2JCVA 4H16A 4TLEA 3HXLA 3PL1A 1I24A 4G37A 1ZU4A 1RZ3A 4FYIA 4Z99A 5FR1A 4XYEA 4TLLB 3LDFA 1U2TA 3QW2A 1OVMA 4O63O 3A2MA 4X1YB 3WRYA 1QV6A 2M6LA 4FB4A 3L6RA 4PLVA 2A14A 3LW8A 2R7MA 1KJWA 3A2LA 1JB1A 2C00A 2PTGA 2I87A 3BGDA 5F9MA 4CQLB 1ISMA 1PKXA 1XZEA 2ID9A 3ASZA 1XZ8A 5G41A 4ASUA 5FTKA 2UDPA 5U4QA 2D62A 3RTCA 1J23A 4ZALA 3UK7A 2CBGA 4PG5A 2YW9A 2O8CB 1F06A 1LVUA 3EA4A 3Q0TA 4PAGA 1QQAA 2GM9A 2PX5A 3CPJB 3VH1A 2OR3A 1WVMA 5L7TA 4X24A 1JJIA 2QA5A 1VCOA 3DCNA 4LNAA 4MARA 4DY4A 2PLNA 4D57A 3SJZA 1G5TA 2FZEA 4K6CA 4RY9A 3QVGB 2ZWIA 1KS2A 1QPBA 1UJNA 4RY0A 3JZFA 2IPAB 1BGVA 5IN5A 3TLCA 3DEHA 1YFJA 3WYEA 4DJFC 1OFTA 3FTNA 4KBFA 2BGGA 2B2XA 2R79A 1BDMA 4G07A 5HF5A 3C5WP 3VAYA 1KJJA 2OCAA 5HMMA 3WYAA 5IKEA 1MIOA 1J2JA 2CF6A 3EGOA 4K8OA 4KQWA 2ZDHA 3QLUC 4J76A 1JQDA 4P31A 5DSZA 4H08A 1DJOA 1GG2A 3KLOA 4MHSA 4Q7LA 3TO5A 3AW9A 1V8ZA 3ZGVA 1MAVA 1GKKA 2BI8A 4BNNA 4BWGA 4DSOA 4F86A 4H1WA 3ESZA 1ATZA 1VJ0A 4HVLA 2FZ4A 3FKQA 5IM5A 1NW8A 2X5XA 3L92A 2VQ6A 2FFHA 5A1JA 3ZHTA 2QT9A 3EISA 3KELA 3SHOA 2NU9A 4DR2B 4MAAA 4B4OA 3TCNA 3VR6H 2F8MA 3TVYA 3IEKA 4GP7A 4FJ0A 1L5GB 2QRPA 4BP1A 1NBMD 1Z18A 2VSQA 3N0WA 1RAAA 4EL0A 1UINA 2VNSA 2IUTA 4UOZA 2GZHA 1GZSA 1JXOA 2ZB3A 2ZBRA 4JJGA 4PCLA 4YCBA 2CLFB 2AG0A 2IA5A 2JKVA 4NHEA 1G6Q1 2JPDA 1JWAB 1VB3A 4FIDA 1NTOA 1VPWA 1JU9A 5CEEA 2K7ZA 3W4KA 3IIJA 4CYMA 4U8HA 2WSYB 3GBVA 4Z7JA 5EXDA 2J7PA 2O8FB 5EMLA 1PKEA 1QKKA 2JCSA 3W3AA 3S29A 1ZRSA 2ROQA 2JNWA 4CG1A 1QCDA 3BK2A 2HSWA 4I3HA 4AX4A 3AI7A 5CUQA 2FGJA 2CT8A 1WOMA 3HB1A 4CLDA 1U7ZA 4WFKA 4BWFB 4WKBA 4AJNA 3PFCA 4TWZA 2NX2A 1A8SA 3E9DA 2BEWA 5B1EA 2IHZA 4HMOA 1ONOA 2GWHA 4WNCA 3DXZA 3ISTA 3H18A 2OHFA 1F17A 5IRCD 2RI0A 3KQOA 4LNHA 3D2CA 2JATA 2CL6X 2J3QA 1REQA 1BXZA 2XUJA 3HK2A 3BXXA 4UHKA 5K6AA 2K7FA 4V39A 1DGQA 1OZGA 4RDHA 5CEFA 1Y3FE 2EBHX 3NHMA 4R9SA 2I71A 2BZGA 4D8UA 1BKSB 4E5UA 2GVZC 1VHWA 4LC0A 4EPXA 5BQ3A 2OV4A 4UNSA 3B89A 1A97A 3MVEA 1LQ2A 3MMZA 4M8KA 4QJBA 2HSGA 4I14A 1SCUB 4EM6A 3B1WA 2XUPA 1K6JA 2BKLA 4LQLA 2H2DA 3TTYA 4PS0A 4BQEA 1EX6A 3GLGA 1MZVA 1B6RA 1XC7A 1OFIA 2AC2A 3UGJA 1H4SA 3R0QA 1EE2A 1PEDA 3W6OA 2GFQA 3BMCA 1MRSA 2VDVE 5FWNA 4QHYA 4N6OA 1HF3A 4O2RA 3MT9A 1E9SA 1SHLA 1SXJA 4R05A 2IDZA 5K0TA 1NFRA 5LZ9A 2QPLA 1G7RA 2DFDA 1N1DA 2FUNB 2VDKB 2YZGA 3BJIC 3BXOA 5I3ZA 2RC5A 2CXXA 4MVJG 1ZINA 2ZTUA 3R9IA 4E03A 4BOYA 2C1XA 2K5UA 4I1VA 5FPSA 3G82C 2DH6A 3BE6A 2PNJA 5K0SA 5KI6A 2W6JA 3X1WA 4JLJA 2XTAA 4R5HA 1QHIA 3RC9A 4JVOA 2CUZA 2ZK7A 4MQEA</