1KSHA

Complex of arl2 and pde delta, crystal form 2 (native)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
164
Chain Sequence
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords arf-like protein 2
publication title The complex of Arl2-GTP and PDE delta: from structure to function.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kshA00
3ZZTA 3ZIAD 3DEFA 4LPSA 1WDTA 2WJGA 2ZJ2A 3E1SA 4LSGA 5D3QA 2QAGB 1R5NA 4LJ9A 4PAOA 3VX3A 5TVKA 4P0TA 3MD0A 3KUCA 1U8AA 4OBEA 4P31A 3TQFA 1G5RA 4M53A 2A5FA 2QMEA 2PLRA 3K70C 3LNCA 3OAAA 1DEKA 2UKDA 3NH6A 2FSIA 5FOTA 1WE2A 5FUXA 1OXXK 2DFTA 4JLVA 3CNLA 2VA8A 1YRBA 2MSCB 3W5JA 1CR2A 1COWA 3CB4A 3GLIB 5DSZA 2OV2A 3HWSA 4IDHA 1RRPA 2R6DA 2G77B 4B47A 3RC8A 2N42A 2NZ8A 3IIKA 5JRJA 1QG2A 2F1JA 4DCUA 4PAMA 4B48A 2OO7A 3QVVA 3T5DA 4M1TA 1DS6A 4IDNA 2NO9A 2NIPA 3BRWD 3KXKA 1GSIA 4KXFB 4A8JA 1ZRHA 4OYHA 1IHUA 4Q1AA 4PC2A 1AM4D 1HV8A 1FOEB 3QKRA 4JLMA 2JDID 3QKSB 3BORA 2FFQA 4GOJA 4A2QA 4JVLA 1UKEA 1N3BA 3QF4B 2FEMA 4HLDA 1KMQA 2DR3A 2OXRA 3EC2A 5CDFA 1KY2A 3IBGA 4N0EA 5EUQB 4EFNA 1AA9A 3DPUA 3IILA 4NU0A 4DUGD 4TTPA 4F7WA 4XVRA 4JBYA 4XJXA 2HYDA 4JLJA 4XSGA 5J4YA 3AVOA 4V0LA 1RPZA 1G64A 3IHLA 2XJ4A 4NCJA 3B13B 4D80A 4PSVA 3FE2A 2IC5A 2ZI5A 2YYZA 1NF3A 2ORIA 2RGXA 2EFCB 2J7KA 3QXXA 1X8LA 2H57A 1Z6TA 1OIWA 1Q20A 4L15A 1IN8A 3T34A 3KB1A 3QQ5A 2GVZC 2QQEA 3K0EA 3DL0A 3QXHA 3VKGA 2WWXA 3NTUA 3B60A 1QHNA 5JSZB 3TVTA 1XXHB 2XTMA 2DFLA 1OIVA 2KSQA 3LD9A 1AZTA 4NCHA 2JLVA 4D26A 1NVVQ 1G3MA 1E2LA 3IPYA 3EG5A 4B35A 1NVXQ 1R0YA 1ZNZA 1JAIA 1PV4A 4IOJA 1P9WA 3GJ7A 1IJFA 1YU9A 3MMPA 3AF2A 1EWRA 1N6KA 3FYHA 3TAUA 3NWJA 1G18A 2O5VA 4JMPA 4Q03A 4A36A 4OL0A 3TR0A 1N0WA 1I2MA 4FN5A 2FV8A 5KUTA 1GKYA 1N25A 1Z0JA 4HDQB 3ONWA 4YMVA 4JYCA 3ZH9B 3THXA 2WIBA 4DDUA 3ZIAA 2W83A 4EJSC 4IW3B 1WP9A 3KX2A 4LCBA 3EIHA 3CH5A 5EXSA 5EZ6B 2XB2A 3LO5A 4IVPA 3D3QA 1X6VA 2F3TA 3GJXC 4RCYA 4Q4AB 1MRSA 1NKTA 3K70D 4DC9A 1XPUA 1N6NA 2P2LA 2ZE8A 1Z3IX 3B7GA 4DSUA 1KK2A 1W5TA 2Z83A 2D7CA 4H1UA 2O0JA 2GJ8A 5BYKA 1TEVA 4TLCA 1ZUNB 1WA5A 5JJKA 3NC0C 4LBWA 1KK3A 1KOFA 4PC6A 2G0TA 1OXUA 4C0SA 1IBRA 2B6HA 2BKUA 3DKVA 4IFBA 1OXSC 2O8BA 1G3RA 4BZXA 3L8ZA 2QBYB 1KK0A 5G41A 2XOKD 1Q21A 2JDIA 3VR4A 2IYYA 3BFXA 3IQWA 4V0ME 3WNCA 2I1VB 2FSHA 3KKQA 3CF2A 1RIFA 4WVFA 4W5WA 4CEIB 3ZD7A 1XTJA 2B21A 2J9RA 3JZMA 3MWLA 4M9SA 5KPDA 1XPOA 3LQQA 3M1IA 3CONA 4LYHA 1OSNA 4AG5A 4DLYA 2C8VA 3WP0A 3BH6A 2XTNA 2VSFA 4V0OA 4DUGA 3ADDA 4WZ6A 1AJEA 4HAUA 1XTQA 2O0KA 2GBLC 2ZU6A 5CM8B 3PXGA 4BGDA 1W47A 1GFIA 2Z0MA 3DZ8A 1LNZA 2BBTA 4BFUA 1K5GA 3BH7A 3SNHA 5C18A 2G1KA 1EFHA 1JR3D 2CEAA 1BIFA 1M2OB 3U7EB 3N2IA 2J0SA 5C2JB 2W58A 2VYFA 3W8NA 1EFTA 4P4SB 4UXIA 2XSZD 5EP1A 1N6RA 4AYTA 3KXIA 1OE0A 1UDXA 3FMIA 4ZV4A 1KNQA 1UBGA 1XMSA 3C8UA 4AYWA 3OEHD 5L3SB 2VP0A 3QJYA 1JAHA 5HKKD 3UPUA 1W36D 1XD2A 1E9BA 2C5LA 3Q7PA 1LV7A 1L4YA 2NO1A 4HATA 4UJ3A 1ZMXA 3IO5A 2W00A 1I4TD 4I1OA 4A15A 3MUFA 5EP3A 2ZREA 3R9IA 3LDAA 4JJKA 3BC1A 4ILEA 1NN1A 2HUPA 4PO1A 2I3BA 2VSOA 4BRUA 2QE7D 4NTZA 4HAYA 1RVDA 2YOHA 3VX4A 3AKCA 4NCIA 4R2HA 4PSKA 3RS0A 2Q9AA 4LC1A 3TVDA 2PMKA 3E2IA 2N46A 4HB2A 5JMTA 2VF8A 1L8QA 2ZI9A 1TQ6A 4LYAA 3VR6A 4PHHA 5TV2A 1W4RA 3M6AA 3PITA 2ZS9A 3DKPA 2RGGA 3SI7A 3TR5A 1GILA 3FOZA 4C2UA 5FR1A 1JEEA 2YOGA 3U44B 4O25A 3VTKA 1ZU5A 4TTQA 4P32A 2PT5A 1T0HB 4G1UC 2OCAA 4D0LB 4YMWA 2O8CB 2D2EA 2PZEA 5JJLA 1G8YA 1KI6B 4FWTA 3D8BA 1E2EA 1EFUA 1AGPA 1E6CA 3DVLA 3Q85A 1SXJD 2E1RA 2KJQA 4M1WA 4RD3A 2XOKA 4W9MC 2WOJA 1E9CA 1DAIA 1NI3A 3O47A 1MT0A 4JLAA 2XZLA 4RCZA 1JALA 4U00A 4MYTA 2ZXUA 2P6NA 1Z07A 4RD0A 3SR0A 3WBJA 4B6FA 2QMUA 3IUYA 5FPYA 2H18A 5JI3E 3P1JA 1J7KA 2C77A 4DB2A 1OW3B 4TMKA 1VG8A 2Y8EA 3DZDA 3P20A 2V6IA 5FOWA 1N0UA 4NE2A 1Y63A 4PC7A 3SYLA 3U7GA 1RZ3A 2GJKA 5AUPB 2O8FA 1JI0A 4GRAA 1ZNXA 1Z8FA 2J45A 2ZRBA 2EYUA 2XSZA 4W5HA 2NG1A 1E4YA 4Q1CA 4BFZA 2QP4A 4BPBA 4HUQB 3SJAA 5IK2D 1R5OA 1G5PA 3AF3A 3OEHA 4HLUC 1XXHA 5HKKA 3HYTA 2W6ID 1KMHB 4LGMA 3LRPA 1CULC 1NBMA 2FU5C 1KK1A 4XD7A 2RGNA 3TNFA 1E96A 1S4QA 2BIFA 1Q1ZA 5CJPA 4BASA 1BH2A 1G20E 4OQLA 5H68A 4NMMA 3GQBA 4B75A 1WRBA 1TMKA 1U94A 1Z22A 4ASUD 1SVSA 4LBZA 4QHTA 5DE3A 3BFKA 2BBOA 1F2TB 3K8YA 1MRNA 2RGDA 3PCRB 1CR4A 1TQDA 1I4DD 2WBLC 1CJVC 4HYYA 4XOIA 2VTKA 3OEED 4EQ6A 1L2TA 3LH5A 2JAQA 3ZD6A 3QIAA 2O0HA 2IT1A 1G3UA 4ZPXA 4KBGA 4NP6A 4C30A 1RJ9A 1XEWY 4LK2A 3KQHA 2YHSA 5ANRB 2Z43A 4HLQB 1BKDR 1TNDA 2H8KA 1IN5A 2O8EA 1KO7A 2X19A 3KDSE 2REBA 3BFVA 3EPLA 1OKKD 2V3CC 4ABYA 1PLLA 4AYXA 2VP5A 2JLQA 2J7PA 3UMRA 1R8SA 2BBWA 1TAGA 2O8EB 1XCGB 1Z2AA 2PMDA 3PUZA 4Q4JA 1OFHA 1OFUX 2ZJYA 1AKEA 3D31A 4M4SA 3AVXA 5AJVB 4E09A 4WAUA 3AVQA 1IY1A 3N5CA 1XMVA 3ASYA 1SXJA 3DOFA 4LV6A 3SJCA 2Q0HA 3ASZA 4QBHA 3QG5A 1CRPA 1PUJA 3K9NA 4HDCA 5FUVA 1FX0A 1ODFA 2BC9A 2RCNA 2VPPA 3AVUA 4XWOA 2J3EA 4YDHB 4AKHA 3AP3A 4MGZR 3RS2A 4DDVA 1FUKA 3OF5A 3RNLA 1UBCA 1G8PA 2ZE7A 5KSYA 2A2ZA 3CZPA 3CH4B 2V9PA 1DOAA 2VF7A 4GMDA 1C9KA 3GLGE 4MKIA 4A1FA 2EWWA 2OG2A 1ESNA 2HV8A 3FMPB 4LYJA 1TQ2A 3W3AA 2ORVA 2BOVA 3V9PA 2IS2A 5FBRB 1TL7C 2GHIA 8OHMA 2TMKA 2UVQA 1K8RA 3KL4A 4KYIB 5CIQA 4ZCIA 4IOMA 4TMXA 2J0QA 1Z63A 2ZI6A 3A6PC 1J99A 4LZZA 5BN4A 4G5GA 4RZXA 5IK2A 4EFMA 1FW6A 3KTAB 5K8UA 4NYJR 1II9A 3C14C 3UWOA 3GFTA 3AH8A 4Q02A 2W6IA 1L7VC 5FI0B 2O52A 1O87A 5KYKA 2IWHA 4M21A 4OJKA 1ANKA 2DB3A 2YV5A 4BLOA 4XTRA 3LQRA 2QNRA 4PPGA 4I1SA 2OSBA 2WICA 1MO6A 4JIMA 4A92A 1OH5A 3FPAA 2GCNA 4KYUA 5FTKA 4B44A 1HURA 4CDGA 2ZI3A 3I72A 4CZ2A 1KI2A 3BGWA 3JVVA 4ASUA 4AKIA 5B58C 2BDTA 4KSCA 4A8JB 1HA3A 5JWHA 2ZJOA 3GEEA 1YZKA 3THYA 3KKMA 3QKRB 3MAAC 1EX6A 1VYUA 3O8BA 4V0NA 1BMFD 4ZIRA 5CK4A 3CR7A 3RRYA 3O8CA 3B85A 1CS4C 3DM9B 2IYXA 1AS2A 1ZVQA 2CBZA 3D7MA 1N6LA 2QL6A 3W5IA 2ZVQX 1A2BA 1HTWA 2C04A 1CKEA 1T4GA 3U44A 4B3CA 1G291 4JVSB 4N0DA 1OKKA 1MKYA 1GP2A 3QVUA 5AK0A 2GEDA 4GI7A 4LJAA 4JVMA 1SVOA 1JEDA 1NMXA 2CLDX 3VNVA 1F5NA 2PJZA 5JS7A 4YONB 4UNQA 4I99A 3KQKA 1E1RD 3FKSD 3RRNA 4Q66C 3K09A 1Q57A 2JLSA 4IEIA 4WZBE 2J1LA 2ZRJA 5FPHA 3UG7A 2G83A 1CEEA 1P60A 1YZTA 4PHTA 1II8A 4LJ6A 4CF7A 5JI2E 3PEWA 2VEDA 2ZRLA 4I81A 3I32A 1UFQA 2FWRA 3WNBA 5CYOA 2CHVA 1GAJA 1F6BA 2CK3D 2IEYA 5FPTA 2CL0X 3RC3A 4C9BA 4TYWA 1QHGA 4L16A 2GDJA 5JCZA 3CWQA 4DZZA 1CIPA 4TYPA 1JQLB 5FBVB 4XTCS 5CLQA 1KAOA 1F3OA 5JHHB 3PENA 1SVMA 2A5DA 3EARA 2GTPA 4AY2A 4Q19A 2FNAA 2QMHA 1C1YA 3BIFA 1X3SA 4Q9IA 5AJXA 3T1TA 3THXB 3LBNA 1FQKA 1SKYE 1CRQA 4CEHA 2REXB 1JR3E 3LVRE 3U4QA 1W2GA 1UPTA 1OXTA 4S2EA 2KBEA 1SKQA 1U2RA 4C0BA 3R20A 4Q7JB 2H7VA 1M34E 2R65A 5EXTA 1KZGB 4X8HA 5IHPA 2XGJA 1KMHA 4GP7A 1Z6AA 1II0A 2ZRMA 2DHRA 1XFAA 2Q3HA 5F98A 4Q7KA 2Q6TA 4YLGA 3W3ZB 1E9DA 4B2IA 3B1ZA 1IY2A 2BCJQ 2H1LA 4QNRA 1E69A 4QGFA 2FOLA 3H86A 4PANA 1T9HA 1Z29A 4LV5B 3IPXA 1E9RA 1G16A 1VG1A 3NXSA 2A78A 1KO4A 3X2SA 2O8BB 4KJZA 2ATVA 5FTMA 1T5IA 3O8DA 1DG1G 3HDTA 4EFLA 4CRWB 5DGXA 4D81A 1GIAA 1KJZA 1S1CA 1BMFA 2WZQA 1FNMA 5DH9A 2GJ9A 5BWMA 3SHFA 3LX5A 4JLNA 3A4LA 4LBYA 3GLGB 4HEJA 5JS8A 2QSYA 2FFBA 2G0NA 5CLLA 1BS1A 3WRXC 4TL9A 2BWJA 2WOOA 1JXOA 3AVVA 4TMZA 3QF7A 3CF6R 4D4MA 5HR5A 4M1OA 2XTZA 2OILA 3MRSA 4JT2A 5KDOA 3K0AB 2ZJAA 3KXLA 5UKDA 3QUSA 3THWA 4QFMA 3FKSA 2OXCA 4AIIA 3BJIC 4R2IA 2R8RA 1KI3A 2JJ2A 3I73A 2OBNA 2ZANA 4OI0A 2WJHA 3C5HA 1G8FA 1R7RA 1H8ED 2PX0A 2WAYA 4FMCF 2D2FA 2NO6A 2QGZA 1SXJE 3RS7A 3HU2A 1P5ZB 4JKIA 4B76A 1F48A 1ZD8A 1XPRA 5JWRA 1BO6A 4UJ5A 2A7QA 2BMEA 3MWKA 1DG3A 1KYIA 2VQSA 5L3RA 1GDDA 3C16C 4G5SA 2PLFA 2D62A 2GAOA 4PO8A 1XZPA 2HT6A 2JATA 4RZUA 5K8IA 1G7TA 3OIWA 3OHMA 2AFIE 5E7MA 1VYTA 4Z51A 1CJMA 4AURA 2AK3A 3SQXA 4LJ5A 4BZPA 4GZLA 5IF9A 1GKIA 1GRNA 1TPZA 2ONJA 1T5LA 4D82A 3PG5A 1M74A 5JWOA 4U02A 3PUVA 4EPTA 1RC8A 1XMJA 2CCKA 2FPLA 3LV8A 3VMFA 2IYLD 2A5JA 2IUUA 1E2KA 2XNSA 3LW7A 4D6PA 4QGAA 2QY9A 4JVNA 3PJRA 3T15A 2QTHA 1VTKA 4BFXA 3KTAA 3ND8A 3L82B 2VP6A 1YR8A 3RYTC 2JLYA 4ZCMA 1AS3A 5KPJA 1QBKC 3Q5EA 4CGZA 4JLPA 3K70B 3TE6A 1P3JA 1HUQA 3QXCA 4JLKA 1KI9A 2WVJA 2Z5FA 1Z83A 5KNCA 2V4ZA 2DBYA 1WBDA 1JQJC 4YQFA 3GJ3A 3CPHA 5TMPA 1R5BA 1JECA 2NO7A 3B9PA 4QG7A 5IDVA 4B3FX 1C4OA 2QAGC 2GJAA 2IYQA 3FB4A 4OHYA 3TAHA 3WBKA 3U6BA 3KFVA 3ICQB 4LHYA 3ZS9A 421PA 4DKXA 2OESA 1ELOA 4WOPA 2QT0A 1X86B 3EIQA 3RHFA 4GOXA 2KE5A 3GJ6A 3U3KA 2G6BA 4B74A 5C4GB 1LTQA 4LC0A 2B7BA 1KI4A 2OFOA 1GTVA 2WMOB 5CJ2A 3CUEF 3RRMA 1DVRA 5BYJA 3QOFA 4KHZA 1ZJ6A 4R9UC 2ZJZA 5CB8A 3QXJA 5J4HA 2QRZA 4HUTA 2FMXA 1SKYB 2UZ3A 1EG7A 5EJEA 3B1VA 4TMWA 1HE1C 4RD4A 1EFRD 2O8FB 2Z6VA 4ZDJA 4PTLA 1E79A 4XWKA 2CJWB 4DLVA 1E0SA 2GETA 5AUQA 4K81B 2F43A 4C2TA 2IF2A 4RD1A 1YJ5A 5EE5B 4TL8A 1U0HC 3TK1A 4Q21A 2ODEA 1W36B 3GLHA 5H1YA 3K0SA 4Q00A 2PT7A 4B71A 2ZPTX 4NYIR 4TQAA 3ZVLA 2G9NA 3EWAA 2ZS8A 3ZQ6A 1Z08A 4G0NA 1H65A 5G40A 3R8CA 4BLQA 5FUWA 1HEIA 4POAA 4LV8B 2WV9A 2JEOA 2P67A 2IYVA 1AZSC 4BZQA 5M04A 1SULA 4TN1A 4DDWA 5KSPA 2GEUA 2ZUBA 621PA 4KVGA 4KBFA 1K6MA 1T3SA 3V4RA 3U2QA 3L0SA 2HXSA 3EX7C 1F2UA 2ZU0C 2V1XA 4EQ6B 1UBEA 3MSXA 1N6OA 1QRAA 1YKSA 1M6NA 1V5WA 5AJYA 3U6KA 1RJ9B 1HH4A 3I1FA 4Q1FA 2WKPA 2RHDA 4OJQA 4A0GA 1PLKA 2WWGA 4LHVA 4GP6A 4A9AA 4EDHA 3IGFA 2JASA 1SVWA 1E2NA 4Q4JB 1E2MA 4MRSA 1FNNA 5HPYB 1NIPA 4IEEA 2WPDD 4DEYA 1GG2A 2ZUDA 4DIDA 1SXJB 1ZCAA 3WYGA 5EE1A 2JLWA 2GZDA 2JGNA 4NPHA 1Z2CA 3OE7D 4EAQA 4KITB 1FX0B 3IEVA 2AWOA 2P3SA 4B43A 5GJVC 3SEAA 4U7DA 2JLZA 1KDPA 4PHFA 3C4JA 1VMAA 1QVRA 2FZLA 5F9HA 2D4HA 5J4KA 3P4YA 4PXAA 2VSXA 2WWHA 2W6JD 1SZPA 4EPVA 2HXYA 3GJ0A 2ZJBA 3GLGA 1G6HA 3Q72A 4HDOB 1IM2A 1E3MA 1E2DA 1A1VA 3OFND 2YWFA 2GF0A 4KCGA 4BE7B 3MLEA 2FJUA 4L4UA 4ACAA 4CYMA 2ZETA 1S0UA 3K0AA 4MUAA 1IXZA 2IX3A 2YOFA 2W0MA 1QG4A 1QHHA 2P5SA 2WKRA 4XWAA 1EFRA 2ZRHA 2D3WA 4MA4A 4UNSA 5KU1A 4ERNA 3VKHA 2VHQA 4QM7A 1G6OA 1GITA 1Q1QA 1U8ZA 3CPJB 4JL5A 3B1WA 4KFUA 1SHZA 2IYZA 3CIOA 4OHXA 1W5SA 1XCMA 2JLRA 3EZ6A 4UXHA 5CM9C 4C4PA 2JJ8A 5GADl 2VP9A 3AKYA 3GCGA 2AHOA 3GP8A 2IS1A 4NDZA 1GNPA 4JSTA 2GILA 2VIIA 3EZ7A 5J40A 1S96A 3U7HB 2DWOA 3EA0A 3AKDA 4QBIA 3AB3A 5A5GA 3QENA 1D6JA 1E9FA 2IHBA 1P62B 1P2SA 2ZAOA 2CHQA 2ZRPA 4C0HA 1R2QA 2R2AA 4A4DA 4FMCB 3RANA 2VHCA 2FFHA 4AWXA 5FTNA 3B1YA 2V54A 2GZHA 3ICEA 3W6NA 2ZYWX 3TW4A 2ZR0A 2IUTA 1MO4A 2C03A 3CRW1 1U81A 1W4CA 1XTRA 2D06A 4NBSA 2BMDA 2Q9BA 3CRRA 2V7QD 1G7SA 1CR0A 5AUOB 4DHEA 3THYB 2QENA 4URYR 4MQBA 4G3XA 1RYHA 4ZIRB 3T5GA 1VIAA 2WMNB 5E7JA 2VLIA 1ZM4A 2VHUA 4KFTA 3TIFA 5BN3A 4TSFD 2DWQA 3CW2A 2A3RA 1E9AA 3TQCA 1KJWA 5EQTA 1XJ0A 2ATXA 1L4UA 1WMSA 3AQ4A 3QKUA 2RMKA 1Q3HA 3PVSA 2OEPA 1YR7A 4NYMR 1A7JA 2WJVA 4P3YA 3PFIA 5EZ5A 1D8TA 4OHZA 1G8HA 3NIBA 3LXRA 1IONA 3QG1A 2YZ2A 2IS6A 4FINA 3D6TB 3UKDA 2OLKA 2WIAA 4C3ZA 5FTLA 3U5ZB 1S3GA 1H8HD 2FH5B 4YXWD 1Z0FA 5ELXA 5F3WB 1CBUA 4L8GA 2YKGA 2WAXA 1R4AA 3OE7A 2I4IA 1ZYUA 3NH9A 5KDDA 3C7KA 1II8B 4F4JA 1R0WA 1GKUB 4RVCA 1EWQA 4D25A 1QHSA 1N6HA 1XD8A 4OK3A 2YWGA 1EESA 5HCIA 3DDCA 4PPFA 2NZJA 1PZNA 4IVRA 3ZVMA 1KJYA 3BD9A 5GJWC 2F9MA 2R9VA 5HE8A 5GVSA 1NSTA 3EZFA 5HZHA 2AD1A 3CM0A 3OFNA 5L3VA 1G7RA 3L0IB 1W1WA 1S8FA 2IYRA 4OHVA 2ZRIA 2ODNA 1TUIA 2C9YA 4QRHA 1E2QA 4CVNA 1CR1A 1MR3F 1VPLA 1Y3AA 3SHWA 4NL4H 1JR3A 3AP2A 5HE9A 2CJWA 1B23P 4CEHB 2BJWA 3IIJA 5K8TA 3U4QB 4FMBB 2IYUA 2J59A 3RLFA 1UDWA 3CX8A 1FTNA 4DEXA 4Q18A 3LVQE 3QPUA 4R98A 1G21E 3T1QA 4TMVA 2ZJ8A 1JBKA 1M8PA 4D0NA 4BLSA 4W5JA 4HB3A 4RSGA 4H9GA 4EPXA 1Z47A 3BBPA 3GLHE 3OESA 5TARA 3PEVA 3ADBA 1EGAA 1QDEA 2HF9A 4M9ZA 4RKEA 5TY0A 2YVUA 1W46A 3RSLA 5K8LA 1NJGA 3I61A 4QXAA 2ZTSA 4FCTA 2AN9A 3TUIC 3U3JA 3I4LA 1IAQA 2ERYA 3TUZC 3EWSA 3CBQA 4US1R 4IFEA 2FZ4A 4DRZA 2QE7A 1KO5A 3A8TA 3QEOA 1AKYA 3HPQA 4EJSA 2V7QA 5CK5A 3FTQA 1GNRA 2C78A 3RDPA 2VP4A 1ZM2A 2QROA 1KSGA 1NVWQ 1ZBDA 1DAMA 1GL7A 2ZSEA 1XTSA 2L0XA 3PIRA 5IT5A 1X1SA 4TSFA 3IO3A 4DCTA 4RFSA 1KHTA 3CNNA 1UAAA 5DHAA 1VHLA 5FH9A 1E2GA 3IHWA 4H1VA 2CLCX 2FA9A 3SOPA 3QXSA 2OM2A 3TSOA 2PCJA 3DMDA 3FWYA 3I92A 3REFA 4ZDKA 4EUNA 2NOAA 2W2VA 3K9LA 5J4LA 4A6PA 3EW9A 3THWB 2CMKA 1N0VC 4IDPA 1OH7A 2AXNA 3EA5A 1G9XA 3P26A 1E9SA 1GWNA 1H8HA 4PZLA 4JKYA 4YXWA 2X1VA 3ADCA 1KAGA 2QEQA 1W0KD 1VCOA 4DLRA 2OBLA 5DISB 3K0CC 4B3GA 4QNMA 3U7FB 2JLXA 1PJRA 1JPNA 3LW8A 4Z1MD 3FGNA 1E9EA 2V55B 3CO5A 4C0QC 5CITA 4F91B 1LB1B 4Y0VA 4F92B 3T61A 4OHWA 2R62A 3L2OB 2IXEA 2ZVPX 3LLMA 3RAPR 2EW1A 4MGYR 3C5CA 1XDBA 1TF7A 1FL9A 1YRAA 2GNOA 3TRFA 2CLSA 1U9IC 1XCPA 2GBLA 4UNRA 3I5XA 2YINC 1NVVR 5KTYA 5DO9A 2MSEB 4UKDA 4OQMA 1J70A 3EPKA 3W8RA 1TTTA 3LLUA 1DE0A 3SYNA 3KB2A 3AM1A 1NMYA 1UKZA 1GOTA 1RE0A 1XEXB 2EFEB 3B1XA 1A4RA 2AFHE 4BFTA 1X8JA 1Q3TA 4DLXA 4A0FA 4E03A 1UKYA 3A58B 2VL7A 4Q1BA 2F1HA 4MDEA 1JJVA 1T3LA 2Z4SA 3KQNA 2IUSA 1DAGA 2RGCA 4ESHA 4Q5IA 3LX8A 5GJCA 2JLUA 2FPMA 1W4BA 2C95A 3A1UA 2OT3B 4P4UA 1OLOA 2O8DA 2RGEA 2XB4A 3UANA 5SZKB 1DO0A 5G3ZA 821PA 2AKAB 2WWWA 2HEIA 1FMJA 2X2EA 4URWR 2PZGA 1ZM9A 3QBVA 1P2TA 1CJUC 3GEHA 1LF0A 3BXZA 2QGNA 1TF2A 2IXFA 1E2JA 4PX9A 4XH9B 3QBTA 1CF4A 2IYSA 3A1VA 3X1WA 4Q7LA 1QVAA 5AJWA 5HZKA 1XX6A 3OEEA 1G8GA 4YMUA 1MABA 5DN6D 2PJRA 3X1DA 2XXAA 4DCVA 3DO6A 2ZE5A 1UEJA 2AX4A 1JJ7A 4OI4A 3GJ5A 4IJMA 4HZIA 2BMFA 1XZQA 2W0SA 4D4JA 4PO9A 4PAQA 4NH0A 4MRVA 4PC1A 3NDBB 4IKEA 3B5JA 3CKLA 2ZEJA 4A8JC 2CHGA 1JR6A 4NHOA 2JA1A 2NPFA 1YHNA 3UATA 1MO5A 1T8UA 2YNMA 2IXGA 1LY1A 1AK2A 1KKMA 3GLFA 1YE8A 3WMEA 3ADKA 3LA6A 4C0JA 1W4AA 4JYBA 4AK9A 4JSYA 1PVOA 2AD5A 1F60A 4BECA 1RFLA 1NL3A 2F43B 1KO8A 2J46A 3BK7A 2ZYTX 3W6PA 4YMSA 1FP7A 4Z1MA 1GRQA 4TYYA 2RHMA 4JBXA 1R10A 3VFDA 3GLHB 2XZPA 3FFAA 2REOA 4KFSA 3IKJA 4ARZA 5DHFA 2EFGA 4PR0A 3RS4A 1LS1A 1IN6A 2MMGA 2ZRCA 4CEJA 1Z0KA 3NHAA 2AK2A 2GEVA 3HU3A 2QP9X 1NN3A 1WXQA 1SQ5A 1D9ZA 4PC3A 1Z5ZA 4I4LA 2CVHA 2VP2A 1ZC3A 1E2FA 1P73A 3AVWA 4OI2A 4AKEA 3C41J 1W49A 1GZSA 1G4UR 2JIZD 3VR2A 4Y0AA 3VU9A 5KSOA 1BOFA 3AF4A 5JEDA 4A0RA 4Q7MB 4HLUA 1F2UB 3JVUA 1HT1E 5EP2A 1RKBA 4KAXA 1Z6XA 3ZJYA 4HZUB 4B3DA 3UIEA 2P6UA 3H4MA 2ERXA 4A82A 1KIMA 1HYQA 3ZZ0A 1KI1A 1Q1BA 3FDIA 4QOSA 5G53C 5DIFA 4Z8YA 3BWDD 4GMXA 1AN0A 3AP1A 2H16A 2DY1A 4NZYA 3LY5A 1X8KA 2QA5A 4E22A 1I4LD 3SBEA 5B57C 2WM9B 1OV4A 3AUXA 1E1QD 4MH0R 1US8A 2CCGA 3CRVA 4HB0A 3BB3A 4K46A 2FSFA 5DN6A 1COWD 1KSJA 4DLUA 4IDQA 1E4VA 3SN6A 5F9FA 2X8AA 3BB1A 3CPEA 3I8SA 3F5FA 4DB4A 4WBSA 4W7SA 4EPWA 1ZIOA 2JCSA 2ZSBA 3N70A 3BAFA 3H84A 1P4SA 4NCNA 1M7BA 4IRUB 4EKDA 1T91A 3S1AB 2J5XA 1B0UA 4O0MA 4O2RA 3A4NA 2ZJ5A 1X1RA 1E1RA 2E9SA 2OAQ1 1QHHB 3OIUA 5FL3A 1FFHA 2EVWX 5HCNA 3NEYA 3ZYCA 4KSBA 4TL7A 3P27A 3KUDA 1JNYA 3T1VA 1EFCA 1NLFA 4QGHA 1VYVA 1G7CA 3BOSA 3G82C 3GJ8A 5KDLA 1P72A 3ZZUA 2WWYA 4PPQA 5AJZA 3GFOA 2PBRA 5LD2C 1XB2A 1NRJB 4AG6A 1CTQA 5JZVA 2CK3A 3VNUA 3IBYA 1Z6GA 4EIWA 1CLUA 4OK6A 4G5OA 4LOAA 3UXMA 3EIEA 4MUBA 1CJKC 1Z28A 2Q3FA 1U8YA 1NY6A 5BN5A 1J90A 1P61B 1J8MF 2XNDD 1NN0A 3FKQA 2FG5A 2VO1A 2J0VA 5EE0A 5CIWA 5FOVA 4TYQA 1IN7A 2OE2A 2AL7A 3KJHA 1AQYA 4Q48A 6Q21A 1XEXA 4X8MA 3T12A 3H1TA 2JIZA 1ETUA 3UWKA 4WIAA 4BFVA 3F3YA 3TKLA 1NLZA 1KDTA 4DSNA 4QM6A 2GXQA 4FW9A 4TLDA 3KFXA 4PZYA 4EPRA 4A6XA 5BQ5A 5P21A 5KHOC 4FD2A 1E32A 2FFAA 2YC4C 3CF0A 1OH8A 4RD2A 4WW0A 2HT1A 3BH0A 1CJTC 1OFIA 2EQBA 2ZI7A 4LBVA 4A0HA 3DMNA 4MRRA 3WYAA 1NP6A 4Z54A 2GCPA 1KTVA 2ZRAA 4BFSA 121PA 3LFUA 1HY3A 1DARA 3WRYC 2QTFA 1XEWX 2FN4A 2OAP1 2ZQ5A 4QBFA 5E95A 3SFVA 1ONBA 2GKSA 4ZI3A 1NIJA 4M0LA 5D3MA 1SVKA 3X1ZA 4MRPA 2VHTA 3CLVA 3RWMB 1A2KC 2JJ1D 3AVYA 1E1QA 4M1SA 4GL2A 4XIGS 1D2NA 4EPYA 2PX3A 1G5TA 3CR8A 3ZLJA 3LXXA 2MSDB 2P65A 5DI3A 2QPOA 3PV0A 2RGBA 3HR7A 5CYPA 5FL7D 4DT1A 1CP2A 1Z0IA 1A5TA 1T6NA 1RRFA 4URUR 221PA 4XSHA 4ZI2A 3WHLA 2X2FA 5FFMA 4JLBA 3TUJC 2Q3MA 5DYGA 1RW4A 1KDRA 2ZYVX 1HT2E 1U0LA 4PQRA 3MG9A 5JLJA 4LHXA 4MITA 3MFYA 3K9GA 4CT5A 1SVIA 4UNNA 1D2EA 2J0UA 2R44A 5DLQC 4WZAE 4R71A 1XTIA 1PUIA 1H8EA 5AR1A 3FMOB 2BKEA 3M0EA 3GLFE 1N2CE 2SHKA 1A82A 2EYQA 2IA5A 3QNUA 4WXRA 1YVDA 1UBFA 5TDHA 2LWIA 3KJGA 5J47A 1O3YA 4ZKEA 1AGRA 4M1KA 2NPIA 2NQ2C 2NMVA 1KZ7B 2OFWA 2FF7A 3SFZA 3Q8XB 2W2TA 3NBXX 1XJQA 2ZE6A 1N5LA 3DHWC 1QF9A 1IY0A 1T3HA 2WHXA 4L5BA 4LX0A 3B78A 3L8YA 3UMSA 2OCYC 4UXJA 3A4MA 1YZQA 2OFXA 1E2IA 2ZRNA 4UQOA 2XNDA 2EWVA 1R8QA 3UMFA 5BW8A 1SHKA 3Q5DA 2WKQA 4IXNA 1Q0UA 2XJ9A 3OZXA 3OIVA 5KSZA 1NMZA 3I8XA 4F4IA 1ZUHA 2P0EA 2UZIR 3HP1A 4G01B 1UADA 4M9QA 5FI1B 1U98A 4L9WA 3EPHA 2OUKA 3A1TA 5FOXA 1W36C 4EJSB 5G3YA 3VR5A 5JRZA 1G17A 2C9OA 4O2LA 3C15C 4M1YA 2XEXA 4TYNA 2RGNC 3TH5A 4TLEA 2C96A 3T35A 3M4YA 1WBBA 3PR1A 2KI5A 4CT4B 3I62A 2BEJA 4JT4A 4X8OA 1FQJA 4RFSB 4HAXA 2J41A 4HZUA 4YDSA 4Q9KA 3PUWA 5L3QA 1W7AA 1N5IA 4M9XA 3FMFA 4NYJQ 2QI9C 2HYIC 3L43A 5IRCD 2GCOA 2ZSFA 3KJIA 3L0OA 2CL6X 3A1WA 4F93B 2LKCA 2YC2C 3NEJA 4TT3D 4URZR 1RYFA 3V00A 1IXRC 1W48A 1AQUA 4HAVA 3B8HA 1XWIA 1WCV1 1XRJA 3BS4A 1OT3A 1KI8A 1G4AE 2EFHB 2RAPA 3NG1A 2JJ1A 5E3HA 4D4KA 1DAKA 2PCLA 2QPTA 3EPJA 2R6FA 1AS0A 3O8RA 3E70C 2RB4A 1GL6A 1Q44A 1OH6A 4LWZA 5FL7A 1P2VA 1VG9B 2P6RA 1CXZA 4LJ4A 2QP3A 3X1YA 2D74A 3G0HA 4B2LA 1OIXA 3SS8A 1XU4A 3AV0B 2CE7A 5LDDC 4NCKA 2NTYC 3IQXA 1SXJC 3K9HA 3NBZC 4DBLC 3S1AA 4MYUA 1FTSA 2ORWA 4IOLA 2FGJA 2IEZA 3WNDA 4C7OA 3QPVA 4Q9LA 1P75A 3R7WA 2IL1A 1BYIA 2QQ0A 2W2XA 3CX7A 1NG1A 2EU8A 2B8WA 3WMFA 2LCFA 5LB4A 3AVTA 2XAUA 3THOA 1ZD9A 2QMOA 3WYFA 1Z0AA 1VCNA 5JECA 4TQ9A 2IWRA 4MDFA 1G1MA 4LY6A 1XP8A 2HDNB 4BLPA 1M7GA 1W2HA 2ZSAA 1AIPA 1G3IA 1GRRA 1QHIA 3AKEA 2FSGA 1LS6A 2F3RA 4LYFA 2Z4RA 2X77A 2WTUA 5B2ZA 4KU4A 2O8DB 3H2YA 4IVQA 4Q9HA 3IDQA 3QEJA 4HSEA 2ANBA 4V02A 4MYCA 3V4FA 4ACBA 1Z6YA 3P4XA 2F6RA 1R0XA 4J0QA 1ZU4A 5E7IA 1ZNYA 4OQFA 3GJ4A 3CRQA 4JJZA 2KWIA 2ONKA 3H0KA 3K0FB 2K5UA 3K53A 2ODBA 1CU1A 1HQCA 3E5HA 4KO8A 3VKWA 1NBMD 4M2LA 4YC7A 4ZKDA 1YQTA 3SQWA 4XD7D 1P7CA 2HJVA 1MH1A 2IW3A 4ZCLA 1MABB 1R0ZA 1DPFA 2F1IA 2ZRFA 2XXAB 2XX3A 1G19A 1QHYA 4QHSA 1V43A 2ZI4A 4JL8A 4RZ3A 3GFPA 4NKRA 4BEBA 1D5CA 1VECA 5FBLB 3AVPA 2ZM5A 2YWEA 4BEJA 2ZSDA 4TZ0A 5C4MA 2C2HA 3IEUA 3NBFA 3LBHA 4Q9JA 1Q12A 2QG6A 3MCAA 3SE0A 3CWZA 2QAGA 1S1MA 1TF5A 2WPDA 1XTKA 4TT3A 4RD6A 1TU3A 2QT1A 3AEZA 4DLWA 4FIDA 4FCVA 2HCBA 1DELA 4TQUS 3GLFB 2OZEA 4AD8A 1P9RA 4US2R 4KVAA 5L8VA 1YR9A 5JHGB 1NSFA 2GESA 4IOKA 3BE4A 3DM5A 4Z8XA 3EAQA 2ZR7A 1S9HA 2Q21A 1WB9A 2ZRDA 2BHRA 1VKJA 5EXPA 4BLTA 2J7PD 4N1AA 3GLIA 1E98A 3A37A 2W6JA 4BFYA 3R9WA 2BV3A 2ZRGA 3B2EA 3SJBA 2QM8A 2V8OA 4ARZB 1E0KA 3SC3A 2VH5R 2IHYA 5C1BA 1N5JA 1ZM3A 2ZR9A 4RZ2A 4CEJB 1XNJA 3TLXA 1HE8B 2QORA 3DOEA 3U3MA 3K09C 2GK7A 2QU8A 4DIEA 3KKPA 2WJIA 3P32A 3QKSA 4R7ZA 2QN6A 1XF9A 1U99A 4O3MA 1BYUA 4FI3C 3TGPA 3SYKA 3QF4A 2CNWD 1UKVY 2FEOA 5FPKA 2F1RA 1S2MA 3ZDQA 2GVDC 2CVFA 3VU9B 2DWPA 3KJEA 1ZAKA 1DAFA 1OYWA 3TSWA 4PHGA 2BJVA 3BB4A 3HJNA 4MRNA 1E2HA 2B7CA 521PA 5CDFE 4Q4HB 1SVLA 3QY0A 3VR1A 1EXMA 3B9QA 3U61B 3VR3A 3QE0A 2F9LA 3QKTA 3VHLB 2FPKA 3IIMA 1E2PA 4PSAA 1NLYA 5EE9A 2WWIA 4LPKA 2V6JA 2G88A 4MGKR 4DSTA 2F7SA 2QAJA 2HLDD 3PUYA 4TZ6A 3R8FA 1ZW6A 4ON9A 2QTVB 2GAAA 3PQCA 3UK6A 1RRCA 1EX7A 2BBSA 5EXXA 5J4VA 1KY3A 1UJ2A 5FR2A 3ZQJA 5C46F 4LHWA 3VHXA 5JSZA 1E99A 2CDNA 3CNOA 3SJZA 2IYTA 3F0TA 1E0JA 4GNKA 3A1SA 3EXAA 1OJLA 4JZKA 1ZIPA 1US8B 5LBIA 1KI7A 4YMTA 3UG6A 5DNYB 4GFDA 4TMTA 1QZXA 2WSSD 4V0KA 3WY9A 4XVQA 1HQYE 4D2IA 4XVUA 3LBIA 4RY2A 5TB5A 3KZ1E 4MGIR 1T0JB 4RJLA 3Q9LA 4IDOA 4RFVA 2IF0A 1XMIA 4P4TA 2D7DA 5TXGA 4KI0A 4BWYA 1ESMA 5FTJA 4ZDIA 2MMCA 4KODA 1W44A 1QHXA 1XJCA 3GPLA 2F55A 5KNBA 4K8OA 4QL3A 1LF5A 5FPSA 1VDZA 5GJBA 2ZS7A 4FXPA 4QJ5A 4Q4AA 1NNEA 4QHYA 3QI2A 2OHFA 4QJ4A 2A30A 3AF0A 5EUMA 4TLBA 3AGQA 1XBTA 3AGPA 3RS5A 4QGGA 4OQNA 2VHJA 1OHHD 5LPNA 4C0KA 3U60B 4LJ8A 3N2EA 2QZ4A 1VCMA 3CZQA 2CL7X 4KLZA 3AF1A 2DFKB 1FP6A 2PL3A 2ASEA 4LJYA 4GT1A 3SZRA 4F4CA 4FMDF 4D0GA 1ZD1A 5KOYA 3HYRA 3HPRA 1KNXA 3KKNA 1Q22A 3EASA 3FFBA 2QBYA 2DPXA 1S3SA 1E0AA 3SBDA 3W6OA 2BCGY 3KQUA 4HB4A 4JS0A 4LHZA 4FCWA 2XITA 4WXPA 2FDCA 1N6PA 5EE3A 2AKYA 5SZJA 4MKGA 4TLAA 3ND9A 4G5RA 1FMLA 4PPNA 1ZC4A 3RABA 2BM0A 2CNWA 2QPAA 3I5YA 1IJEA 4CEIA 4GSYA 1ZM7A 3PEYA 2H92A 4QBGB 3LWNA 1NVUQ 2A9KA 2E87A 2FX3A 4TWZA 4V03A 4GPTA 4DCSA 3SDZA 2AR7A 4PQYA 1LFDB 3G5UA 1SGWA 1OF1A 1P6XA 2RGAA 2WSMA 5DYIA 2RH5A 4E5UA 3R9XA 1EK0A 4TL6A 3FHCB 4DLZA 3VAAA 2IYWA 3RS3A 2NGRA 4BUJA 2CXXA 5SZIA 1D9XA 1N5KA 1VHTA 2HLDA 4P4SA 1UM8A 1VIYA 721PA 3SU8A 3T06B 2IK8A 2ZITA 1J8YF 2P5TB 1NY5A 3CRMA 5JJIA 1JPJA 4NYIQ 3L0PA 1TEXA 3T1OA 4AC9A 1TUEA 5L3SA 4II7A 4ESVA 1KSHA 5D3MB 2OBMA 1U0JA 2OCBA 2ZROA 1GUAA 3K0FA 4Q4LA 5HTKA 2ANCA 3ZVRA 4N3NA 2HCJB 2YWHA 1KGDA 1P9NA 4HI0E 2ECKA 4OK5A 1KKLA 5DI9A 5JBQA 5GVRA 3TJZA 4B3BA 2WSSA 4QC2A 5DI3B 4B2PA 5AWFC 1U90A 2YJTD 2ODWA 3LAWA 1VCIA 4DJTA 4DT1B 1YZGA 2WJYA 1G41A 3B6EA 4L9SA 4JBWA 4LRWA 4BFWA 5H8WA 1FPMA 5EP4A 1WF3A 1OYYA 3U3OA 3AUYA 3Q7QA 2GXSA 2C99A 4LI0A 4KLNA 4AKGA 4OI1A 2LKDA 1G3QA 4FWIB 2J0UB 2NO0A 1ZP6A 1MOZA 1DO2A 1ZINA 3MJRA 3MWJA 4ZDWA 1W0KA 3CX6A 5BXQC 2DCUA 1TADA 3NBYC 3WMGA 4I1VA 1LW7A 2DFNA 2ZYUX 3ETLA 1DADA 4URVR 4LJ7A 4OKSA 4Q47A 3Q3JB 1OHHA 4KFRA 3TBKA 4RKFA 2O8CA 2BVNA 5KNDA 1XD9A 2HJGA 4OQXA 5AUNB 1GM5A 1KI6A 2KB0A 3GLIE 2PEYA 4TTRA 4QJ3A 1LVGA 3OIYA 4HLCA 2GXAA 4PQFA 4B32A 2QUZA 1DAHA 2PZFA 2JJ2D 4LUCA 4X8LA 4B33A 2PH1A 5KO2A 4C0AC 3BERA 2B8TA 1MO3A 4GBMA 5LB2A 2Q9CA 4A2WA 4B34A 4F38A 3NDPA 1YZLA 3ECCA 3NKVA 4GDFA 2GWHA 1OB5A 2GZAA 4DLTA 3PUXA 4MYHA 1IOZA 4WA7A 4S35A 4BQSA 4CW7A 1NKSA 5H70A 3WHKA 2I1QA 2ZRKA 2J87A 4MKHA 4AI6A 4Q4HA 4DSOA 1W0JD 3REGA 1GL9B 1WQ1R 1YZUA 3EZ9A 4Q1DA 2GK6A 3RSOA 4PFSA 1D2MA 5L3QB 2PEZA 1R6BX 1YR6A 1YZNA 2BEKA 4C0LA 3X1XA 3WP1B 1FZQA 3I3SR 5A0FA 2H5EA 2GCOB 3VQTA 3TSZA 2ZAMA 3ZS8A 3QSYA 2IBMA 2IS4A 4HUQA 5CB6A 4Q01A 1DTSA 2FE4A 4U5XA 2V1UA 2QM7A 1OB2A 3HR8A 4E07A 3MGCA 2BM1A 5B64A 3OAAD 4Q1EA 1UEIA 4MKFA 4B73A 4DDTA 1TQ4A 1XXHE 2VRWA 2EFDB 3J81k 2CCJA 1FUUA 1KO1A 2GJSA 3KQLA 3K1JA 1KDOA 1NBME 1NJFA 3RVBA 1E94E 1UF9A 5JCPA 2CE2X 4LDJA 1N6IA 4PZZA 2R6AA 2A5GA 1Q1EA 4BRWA 1NN5A 4DVGA 4BLRA 4JL6A 4IXMA 1Z0DA 2H17A 1M1YE 2OCPA 3JZAA 5FOUA 5FUYA 1TU4A 2R6GA 2ZUCA 4US0R 3KKOA 4V0MA 1F2TA 1XEFA 2AXPA 2DYKA 1PLJA 3FHTA 3WXMA 1RRGA 4D4LA 4A2PA 2C9CA 3MJHA 4URXR 2RKOA 4C7OB 2AWNA 3R7WB 3ZGXA 2QRNA 4DCNA 5F2EA 1ZCBA 2VBCA 1OPXA 1JXMA 2KBFA 2R6CA 4NYMQ 1VG0B 3K0CA 1T8TA 4GOKA 1K5DA 4NONA 2QSZA 4UNPA 3W9YA 3NC1C 5A4JA 3U3RA 5JFGA 1NG9A 2A5YB 2G3YA 2GF9A 4ZO4A 4DXAA 1M7HA 5LD2B 4HAZA 3ZVNA 3GD7A 4M22A 4DWJA 1GVNB 1DAEA 1IQPA 1DBSA 4G5QA 2C98A 4CIDA 4QKQA 4I1UA 3W90A 5JEEA 4ITRC 3B82A 1S9DA 3RWOA 1MV5A 1P2UA 3HU1A 3F8TA 1U9IA 4JLDA 2OLJA 5E4FA 5FBQB 2N1BA 2GRJA 2B92A 3A36A 3FVQA 1E79D 3NVAA 1ZUIA 1J2JA 3FHOA 3PEUA 1IN4A 3MWYW 2BMJA 3GMTA 4P33A 2GA8A 3QPWA 3W34A 4M8NE 1Z06A 1IXSB 3GEIA 3EZ2A 4GZMA 1XD2B 5B30A 2ZIAA 1KSFX 1ZNWA 2GXUA 1I2DA 2G1JA 4DLSA 4FMDB 1TX4B 4B6EA 1W0JA 5SZHB 3RRZA 1OFTA 4IHQA 3NHBA 1OXVA 2XZOA 4B3XA 1JB1A 2WWFA 2WJJA 1GNQA 4KV9A 5FBWB 4M1MA 5FOSA 5J5CA 3TW8B 2HF8A 3EC1A 4JLOA 3TMKA 4HAWA 2FGKA
chains in the Genus database with same CATH superfamily
3D8SA 3T9DA 4J0JA 3DEFA 3G23A 4OMUA 3TPFA 5JOQA 4JSRA 1LBTA 3QLTA 1P5JA 2WHYA 1TJPB 2R8ZA 1R5NA 4LXUA 4CN8A 4LJ9A 2AG5A 1L5YA 1JTFA 3W0LB 1OWLA 2FLVA 2ZATA 2PJUA 3MD0A 3KUCA 4OBEA 3OBBA 4P31A 2PNFA 3TQFA 4DLPA 1EKXA 1H42A 1CW2B 3FW1A 1L7EA 1Q84A 1MXFA 2BHNA 3DLAA 2G9UA 2NAFA 3GRKA 3OAAA 3ONDA 4FKZA 4IZIA 3VSCA 1DEKA 1F9EA 4FC7A 4F1KA 1WE2A 2A8YA 1OXXK 2DFTA 3KG2A 4U39A 3THRA 4M99A 2WVHA 3L4KA 2MSCB 3W5JA 1N8TA 3LTEA 1WY7A 4R1SA 3WADA 3GLIB 2OV2A 4IDHA 1RRPA 1N77A 3M3HA 3D7SA 2R6DA 4FB4A 4HAIA 5AVWA 4XFJA 4B47A 1FFDA 2NZ8A 3C98A 2NUPA 3OMLA 1QG2A 1SUWA 3OE4A 2PL5A 3DEIA 3T5DA 1DS6A 1Z38A 4Z0NA 1X1AA 2WFZA 1QS0B 4CI0B 3B1KA 3EGOA 1ZRHA 4IRXA 4J7CA 4LXIA 5FB3A 4KR6A 4LVNA 3R3ZA 4MARA 3BXFA 4PC2A 1BJRE 1FOEB 1NDUA 2JDID 3QKSB 4L5AA 5CA1A 3DZCA 4QGSA 4GOJA 3ROQA 3K15A 4DTCA 4Q3LA 3AUUA 2XAAA 4ZT6A 2BEVB 1YULA 2FEMA 2IXBA 3DBRB 1I0IA 4DV3B 4PV7A 3N53A 3ROMA 1BN6A 3C7AA 4P7KA 4XJTA 3KFLA 2Z8YM 1T9GS 2FAXA 3I76A 2PWYA 2CVZA 1AA9A 2OSVA 3DPUA 4NU0A 4QT0A 3CURA 1O96A 5LZ5A 4TTPA 2X3UA 3LYHA 4GMGA 4WDQA 3RRBA 3WK8A 2HYDA 4LRXA 4V0LA 4WE3A 1FUEA 1NU8A 1S4MA 2XJ4A 3IVGA 3NYRA 5EIFA 2WYUA 2X6RA 2IC5A 4LKRA 2N3ZA 4FDAA 2ZI5A 4OQQA 3R7DA 2ORIA 2RGXA 3F47A 2CNLA 3D8TA 3JQFC 5KYYA 1X8LA 4P98A 4OATA 2NU7A 3AONB 4M0DA 4DG8A 2Q41A 4Z7QB 1L4NA 2FY8A 3CPSA 4YIHA 3FSEA 4XLTA 2IZ5A 4TPKA 4BX0A 5BNIA 5K6AC 2ZBRA 1RCUA 3L7BA 2GBFA 2ZT5A 2X4GA 3FIUA 3TVTA 4BVLA 4CV2A 2IKQA 2DFLA 1NQTA 2PGIA 2XTMA 3FHJA 3FYCA 1CC1S 1KC3A 2JNWA 1NVVQ 1G3MA 2AA3A 2QXTA 2YQZA 3EG5A 4ZOBA 4IFIA 3UXMA 4UAUA 5I8WA 1C3LA 1JAIA 1N3LA 1N5MA 3SIXA 1PV4A 3HCCA 5J3JA 2PKCA 3GJ7A 4C05A 2O2GA 1JFRA 3TTXA 4B7AA 3C1TA 3LKBA 1IBKB 3JQGB 2O5VA 3LGSA 4Q03A 1ID8A 1F6DA 2BEUB 3DDZX 3DBVO 1EXWA 3ET5A 3KOYA 1I2MA 3KXPA 4FN5A 4I3FA 2UZ1A 3RYHB 2JRLA 1Q3KA 1OAKA 4CM7A 2QVGA 3LPNA 3CW8X 1N2IA 2RDMA 3D4PA 4HDQB 1SXPA 2PFSA 4JEMA 1YGYA 3ZH9B 2N0SA 3N05A 4MS3A 4BVHA 3THXA 3FCOA 3ZIAA 3LQ2A 5LA6A 4FQ5A 2W83A 5ELLA 1CQWA 4WGGA 4Y1GA 4ESOA 4UU8A 4ZC1A 4RAQA 3LO5A 4R1NA 2P6MA 4JAVC 5HKBA 1A7AA 3RQIA 1GN8A 3UK7A 4Q4AB 1WDKA 2OHVA 4PN3A 4RTOA 2ZE8A 1OROA 2HWXA 3CZ9A 1PJ8A 2O0JA 1ZUNB 1WA5A 2M2IA 4TUYA 2O48X 5JJKA 1LLUA 3HNOA 4KWHA 1KOFA 5SYAA 4M38A 3BQMB 2C2KA 3OJLA 1USUA 3GAAA 3WWCA 1DQRA 2BKUA 4IFBA 4YUVA 4FZVA 5LZ8A 2VJAA 1VC2A 3HBMA 3BRWA 1GYQA 3DL2A 4GWLA 4Y6PA 1FLDA 5I9NA 4C22A 1YRYE 4EELA 1UMDA 4Q3OA 1Q21A 4DQDA 5I7RA 3VR4A 2C5EA 4LQCA 3VAZA 1BA2A 2I1VB 4KGDA 5KQGA 5ALEA 2FDXA 2FSHA 1TFRA 1TTQB 1VBKA 1TXGA 1TLTA 4W5WA 1HYGA 2P2ZA 3S4YA 2J9RA 2P9EA 3KO8A 2XXJA 2JZNA 4Z4IA 3LQQA 1ZUD1 3PNVA 1OSNA 4AG5A 3F8WA 2K7ZA 2YWRA 1TU0A 3VVBA 2C8VA 4PIVA 2DFPA 3BH6A 1XMQB 1JH9A 3O6VA 1N1DA 4BIIA 3GRZA 3ELDA 3EVFA 4X6YA 2O0KA 13PKA 3BGSA 4LE0A 3FKJA 5TT1A 3PXGA 1JDJA 4ZYWA 2F59A 3NDRA 3WGIA 2IZ6A 2Z0MA 3ZI7A 3R9XB 1LNZA 5C51B 5LIRA 1K5GA 3BH7A 3R44A 5C18A 1X7YA 1EM8A 4EF5A 1HFWA 3EEBA 3EPPA 3UCXA 3GXOA 5FLXA 1L9XA 4M55A 2O2CA 4FEEA 4P4SB 1ZS9A 1FBTA 2VDNB 3Q9UA 1H4QA 3HB5X 5C7IO 2FCAA 4AYTA 1WB5A 3DD1A 4WV3A 3C74A 1OE0A 1UBOS 2DT5A 1XMSA 4RX1A 5B7PA 1OC2A 2E6UX 3C8UA 3IYLW 3OEHD 2VP0A 5AVQA 3HVKA 1E3EA 1E9BA 1KJ9A 3C3WA 1OLUB 4J49A 2PQ0A 2XR1A 4QWMA 1QXSA 5CA1F 3DTNA 4BFCA 4P3KA 5JLAA 5SICE 2NO1A 4HATA 3ZE8A 2WG2A 1VSBA 3UGKA 5TQJA 2PRKA 2VHZA 4I1OA 2QV7A 1SO8A 3DA8A 2J0EA 1YR2A 3MUFA 1PZXA 4X1YA 1P4RA 3LDAA 2WYIA 4OXXA 4AO8A 1UXJA 1U04A 2HMWA 1E3TA 2HUPA 1DT3A 2I3BA 4P2BA 1MQ9A 2VSOA 1IVYA 4BRUA 1OWNA 4C5CA 4UPDA 4NTZA 4HAYA 5T6BA 3AKCA 2O5RA 2WHRA 2A9PA 1PGPA 2Q9AA 1UXGA 1E1CB 4HB2A 4WH0A 4D74A 3P97A 4PR3A 5DM1A 2ZI9A 1TQ6A 2PGNA 1Z35A 4RHCA 2E85A 3EWIA 4PHHA 3HLYA 4Y6LA 5TV2A 3PITA 3FOZA 4RQBA 2RGGA 3KT8A 4TV9A 2JGIA 1O5OA 1PGNA 3SHOA 2NUTA 2GK3A 5FR1A 5FFFA 4ZVOA 4O25A 2R6JA 1KVTA 2Z04A 3WK5A 1R4MB 3KBBA 4I14A 4Q1VA 2PMEA 4FB5A 3L7JA 4IGEA 4AQ7A 4G1UC 5DTEA 1OLXB 5PGMA 1GR0A 3HBJA 4X1IB 2H4ZA 3EXFB 2PZEA 5CNIA 2AE2A 3I42A 4YCSA 7MDHA 3BICA 3DZFA 2R25B 4OJMX 4JJ8A 4IGAA 4NJEA 1ZA1A 1E2EA 1EFUA 2X76A 1E6CA 2BFAA 4EMSA 4EY8A 4EY6A 2HQOA 3QUAA 5KYTA 1ZESA 5CAEA 3AFGA 5ALMA 1JIKA 3ESCA 3LF1A 3HZZA 2X8WA 4JNKA 2DP4E 5DJ5A 2HQ1A 1VJTA 1PL8A 1E9CA 1U7UA 3MAGA 4LRTB 3WLMA 3KAQA 3ABRB 2C97A 4RS3A 1G6KA 3PXBA 1KRWA 2ONZA 5L40A 2XZLA 5LA6F 2EGGA 2BHTA 3R3UA 1MLDA 3NT4A 2ZXUA 1T9BA 2IPLA 3PSHA 4WCVA 5HMMA 2X8BA 3SR0A 3DBHB 3TR0A 3WBJA 4B6FA 4EBBA 3IUYA 5T67A 2PUDA 3W7VA 1SG0A 1ST2A 3P1JA 4WASA 2C77A 4S1OA 5LJLA 3DEAA 3UJ7A 1M8JA 2HPVA 1ZMBA 1JIQA 3C43A 3DZDA 4Z49A 1RLIA 3PZRA 1RHRA 2H4XA 4ID9A 1MN6A 4B8WA 1EDBA 2EDAA 1Y63A 2ETVA 1UPUA 1F2DA 2QYTA 4G9BA 4NECA 4UREA 3SYLA 3DAOA 2O50A 3U7GA 4TUYF 2A0FA 5K99A 1KF0A 1IJKA 1Z8FA 1LV8A 1T8SA 3WGHA 2WYWA 3ELUA 4BPBA 2A0WA 4HUQB 1IE3A 5IK2D 1F9AA 2JLBA 1BH6A 1R5OA 4INOA 1PJTA 3AF3A 3QUCA 4YGXB 4HLUC 1O89A 5IZCC 5KWEA 2C3YA 2UVPA 1T43A 3D6AA 4I8XA 4W6ZA 4ZVLA 3VA7A 2CV0A 1BS2A 3QFCA 1TAHA 3N8GA 1NBMA 5EGSA 4Z7NB 5KU7A 5M2QA 3BQ9A 3TNFA 2IGBA 2QL7A 1HE4A 3EGXA 2I4NA 3LU1A 5IDYA 3AKZA 1G20E 1BH2A 3QTLA 1EB9A 1AUQA 5H9WA 2Z6QA 3DZJA 1OGJA 5H68A 4BGIA 1Y3FE 2JFZA 2C0CA 4OUDB 2J3LA 1N9GB 1UZNA 1O9BA 1Z22A 4ER7A 4ZYZA 4CIAA 1IBMB 4JWTA 3DVQX 3BMCA 3BFKA 3M1AA 2WDZA 3H0EA 1W1IA 3OZAA 3RFCA 2G7ZA 2OV6A 3NIDB 1XYYA 3UUWA 3B36A 4A27A 1TQDA 2XMZA 4FQ8A 4HYYA 2XVXA 3OEED 4F4HA 4YJKA 3G5AA 1IEXA 1TIPA 1N2JA 2YV3A 2O0HA 2IT1A 1KHHA 1LX6A 2QX4A 3ML1A 2QX8A 1Z74A 2XE8A 4ZPXA 2OYCA 4C30A 5CD1A 4HYQA 1U0RA 1XKLA 1TVKB 2YHSA 1OR8A 3N5KA 1BKDR 4DQ0A 3KQHA 5AESA 2AFVA 3E9QA 1X87A 2REBA 3BFVA 4FNMA 4AYXA 2VP5A 2QRJA 1X7XB 2BBWA 1RJGA 1TAGA 4ZVVA 1LWNA 5IT0A 1ORHA 6ADHA 1E3DA 5IUNC 3TECE 1RLUA 4Q4JA 4MUXA 4AW9A 3V4LA 1CQJB 1JX6A 5AJVB 4WAUA 3AVQA 1LKZA 5K3EA 3U19A 4XEUA 1OBHA 2GTHA 3SC6A 3VC1A 3MTAA 2H0RA 3PJEA 4MIEA 5SYNA 2QOEA 4YH1A 4QBHA 4N47A 3FNHA 4JT9A 2QLJA 4TVSA 1CRPA 2BTOA 2FPGB 2J8ZA 3ELBA 2RCNA 3I9V6 3TZHA 1RTTA 4DE5A 4X6UA 1BD4A 5TF4A 2VPPA 1SKUA 4HDNA 3ZCSA 1N2EA 5K0BA 3D6JA 3AVUA 4NQRA 2M9MA 4JX9A 3RS2A 3LUGA 4WN3A 1JJFA 3EYAA 1FUKA 1M5UA 2FK8A 3AM4A 3GGOA 3OF5A 4OP2A 1UBCA 5KX5B 2Y76A 2A2ZA 1W75A 4IG9A 4Y9UA 2V9PA 4Z53A 1PFYA 1RYEA 1Q1AA 4A1FA 2EWWA 1VIVA 3NUQA 4OHMA 4Y2UA 4DCCA 4EHLA 3GNQA 4FT2A 4OX9B 1C9MA 3FMPB 1NXXA 4AULA 4Q12A 4TV9F 2ORVA 4FHCA 4MXDA 5I6DA 2BOVA 4REQA 3K20A 2IV7A 1GTG1 5FBKA 4KXYA 4QDOA 4PYKA 4J9UE 1XDUA 2PX5A 2ZIWB 3NP9A 1K8RA 3KL4A 5HK8A 4HCJA 3SQMA 1LH0A 1B2LA 2ZWIA 4IOMA 1XSEA 2G4VA 2VKQA 3T3PB 5DGHA 4GF5A 2BFCA 4RZHA 5AM4A 4JI3B 1ZN8A 5HP4A 4EX7A 4RZXA 4EFMA 1QH1A 2O19A 3D59A 5K8UA 4NYJR 1II9A 2VT3A 1TJYA 3H7IA 4RCVA 3LCRA 3GFTA 5G4LA 4BMPB 1HDZA 4TSKA 1TJ4A 4Q02A 1L7VC 3ANSA 4ZO8A 4IIXA 4NEGA 4E4RA 2G67A 5HW0A 1NI5A 1Y7IA 2Q50A 4K1XA 2NZXA 4OAOA 4M21A 5EVCA 3JYLA 5KYKA 4B3TB 5F1KA 3WYNA 2Q4EA 3O2QB 1NX9A 5ITWA 4GW3A 1RPTA 1Z75A 2QNRA 3CJTA 4XTRA 5G0SA 4I1SA 4QA9A 4L3VA 5HUJA 5KHLB 1L5VA 1OCEA 2GCNA 1AKQA 1SD5A 2J6BA 4Q9NA 1MAHA 1YR3A 3I72A 2PQMA 4U2DA 4AKIA 5DBOA 4PE5B 3DR3A 1E5VA 2AN4A 2LE0A 3G6KA 5A5FA 2VR1A 4X20B 1O54A 1IC6A 4BV8A 3HY3A 3KKMA 5AI0A 2HBRA 1XO1A 3P9ZA 4PNZA 1YZHA 1BMFD 3EIXA 3RIEA 3ORSA 4YN3A 3ZYZA 4JYMA 3B85A 2A0KA 3DM9B 2IYXA 3D7MA 4A7PA 2VBFA 5CFLA 4YCLA 1UK9A 3BRCA 3HZOA 5EL0A 2YHIA 5EOVA 2O9JA 2ZVQX 4IH9A 1EINA 4PYRA 4GYYA 2WU8A 3ZOKA 1T4GA 2ZIUB 3MTBA 1H6BA 2C4VA 4TRMA 4JVSB 4N0DA 1A7KA 3QH4A 3O7WA 4RSHA 2Z3ZA 9ABPA 2GEDA 3C1AA 1YK0A 2H2FA 2J3JA 1YOVA 2K2QB 4MW2A 4XQEA 5IZ4A 1SVOA 1NMXA 1UK7A 1CY7A 2CLDX 2EKQA 3EFOA 1SIWA 5JS7A 1BX0A 3KEQA 2RARA 1CY2A 2TS1A 3KQKA 4PY2A 1K68A 3L6BA 3SIRA 3HBFA 2H5LA 1NT4A 2JLSA 3DDUA 3LVBA 4IEIA 5MHTA 3AL3A 1V9SA 5ECDA 3HWX1 1H85A 2OWEA 1P60A 1B6TA 3NM4A 3UHOA 4CCAA 5BSHA 4KR3A 1H6DA 4XQ0A 4CF7A 5JI2E 3R7SA 1W6RA 3D2LA 1LEHA 2YBDA 3ELYA 4TXJA 2QWXA 1VRCA 5KYXB 2QUIA 4I81A 4TMYA 4G25A 4LRYA 2GKOA 2UAGA 2D1YA 1XKTA 1GTRA 2CHVA 3LM8A 4C9BA 2CK3D 5FPTA 2FZKA 2CL0X 2GRAA 5I9BA 3RC3A 4A23A 1QO9A 5EYPA 1WKBA 4BZZA 1M1NA 5A02A 3E8XA 5AT1A 4B45A 1QHGA 2ZBUA 3KPYA 3G8CA 2GDJA 5KYGA 3H5RA 1U2EA 4TYPA 1SVUA 1XZ8A 4B3IA 4CG3A 5D84A 3BK2A 1FP2A 5EPOA 4E5SA 1T2EA 3JRNA 3ZE2B 3PENA 2A5DA 2C2WA 4RF4A 3B20A 3DQPA 1PJLA 2HMTA 4Q19A 5CVVA 1B74A 4OIMA 2R6HA 5J58A 1C1YA 3BIFA 2WD7A 2Q1WA 1A9QA 3H97A 3IDOA 3LBNA 3PR2B 4LXTA 2O8BB 1ZOIA 4DWOA 3PEEA 2Z1MA 3E18A 3H2SA 1Q6ZA 3E5MA 4KZPA 4U2EA 3ZZMA 3CN9A 1U2SA 1JR3E 2REXB 3C6KA 3E3AA 2VRNA 2BRUA 3KOUA 3NS7A 4DV0B 1OXTA 2XB8A 1XMPA 3KQOA 4KI7A 4AZ3B 3R20A 4HN9A 4MCAA 4A8PA 1M34E 2R65A 3JALB 5CXXA 1KMHA 1II0A 2ZRMA 3R75A 4N76A 4JXZA 5F98A 4JB0A 1DEOA 1JTVA 2Z3WA 3NHSA 1KU0A 4YLGA 1WZEA 5AK3A 3ROZA 3SDBA 1UAYA 3B5IA 3TSYA 1A3CA 3B1ZA 4DA7A 1IY2A 2WPNA 4O2AB 5E9QA 3D81A 5LLSA 4C6TB 1CQIB 2FOLA 4NSNA 3H86A 3NR2A 1Z68A 2VJMB 5EXDA 1VJ1A 3PQ5A 1CY0A 3AEUA 1UFVA 4BNZA 4G0WA 1AQLA 4G1EB 3X2SA 4KJZA 1ULUA 1I4OA 2ATVA 1DI0A 1GLGA 4NBRA 4P1ZA 5E9WA 3LY7A 1UL1X 4B82A 3ZWYA 4C20A 4CRWB 2XCRB 4EZBA 1GIAA 3VZQA 1KJZA 4JT8A 3T5MA 4CM9D 1SU4A 4KG7A 4JGBA 5ILGA 3JATB 3N2GB 3OT1A 4F3YA 4AKSA 3BL8A 4KWTA 4JLNA 4V2UA 3UBTA 3MPOA 3A4LA 4LBYA 2ZYSA 4C7KA 2ILTA 3Q6NA 4FHEA 1DRJA 1AY0A 4ZPJA 5JS2A 2QSYA 1GV1A 3C6MA 4LMPA 4CG1A 4Y2PA 4OHOA 1Z37A 4OGLA 5B6IA 1POXA 3ZGZA 3DOCA 2GN4A 4B79A 1G5FA 2WOOA 3KYJB 2V7PA 4OV6B 1K7EB 1PAUA 2E4VA 4I4CA 4GG1A 4M1OA 1X1EA 4JT2A 4NH4A 3THWA 2C92A 2PUVA 3KUUA 3KXLA 3MS7A 5A5DA 1C1XB 3M81A 4MOWA 3UMBA 2V6GA 4CM5A 5CD9A 1ZGAA 1ZZEA 2ZTLA 4KIUA 4DQVA 4CDMA 1WHSA 2V0GA 2JJ2A 2GZ1A 2H6EA 2OBNA 2FKAA 1SCQA 3ZU2A 1V7CA 2F3QA 4TMFA 1P0CA 2UVDA 2WAYA 2D2FA 2XDQB 4NC9A 4XDHA 4UUMA 3FSGD 3R0JA 2HLHA 3TZKA 4JKIA 1F48A 1STOA 4B6QA 4JXJA 4OSPA 1DKLA 2F3SA 2W37A 5FO0A 3HV0A 3ZTYA 1JYSA 1KYIA 2VQSA 2Y0EA 5CLIA 1GDDA 4D3FA 3V46A 3KWLA 1D5WA 5DTRA 3FWNA 2CHFA 5DOVA 5IDWA 1PT6A 4PO8A 2YZNA 2C07A 3A6FA 2YIMA 4IQFA 4RK6A 5E1OA 3OIWA 5KAMA 1GGFA 1EUDB 1T1SA 1CJMA 2YVKA 4J4BA 1DUVG 2GBGA 2MOKA 2DUWA 3SYRA 3FH0A 4HRYA 3D3EA 4AMBA 4IJQA 1T5LA 4HFJA 1P18A 3PG5A 3PUVA 3EGDB 1XMJA 2P4HX 3VMFA 1UC4B 4PLYA 1D2CA 5DNWA 3D7NA 3EGIA 4UU1A 4KNVA 4TYMA 4D6PA 4KNWA 3VOSA 1YQGA 3G0DA 4EECA 1RXUA 4JC8A 3LLCA 2QD4A 4BFXA 4X9XA 3RYTC 2SICE 1SBTA 2C4NA 2DSTA 2ZBPA 3Q10A 4UDOA 3S27A 1DOZA 5KPJA 1QBKC 2I22A 1AMNA 3K70B 3AG5A 1P3JA 4YAGA 2EGHA 4QPPA 3ACDA 3AIOA 3BKXA 3DUFB 1ZGBA 3EG9B 1Z5WA 3H7AA 2EZ9A 4ZQIA 1Z83A 3L4EA 3WRVA 4HX2A 3FFWA 1JQJC 2PQ6A 1V5EA 2PSDA 3FD8A 5CXUA 4ALNA 4MROA 1PU2A 2X1LA 1R00A 1R5BA 1JECA 1BWRA 3HN6A 4J9VA 4ZODA 4QG7A 1DBWA 1ZICA 1JDBC 3ZY5A 2ZWVA 4F56A 3DE5X 1AHPA 3UJ3X 1X94A 2HJRA 4J7UA 3FB4A 4E32A 4ZEVA 3PD1A 3EY9A 3A6DA 1XV5A 2IQIA 3NOQA 3TAHA 4H6WA 1TK2A 1Y1SA 3KFVA 5ESXA 3EODA 3V4PB 5A5EA 5B3JC 3H5OA 4QQ8A 3HJHA 4B6OA 4BBZA 3PRYA 2GT1A 2EF1A 3U0BA 2AOTA 1HNZB 3EIQA 4GOXA 2JBWA 1W85B 2OC9A 1ZHFA 3CXRA 1WZCA 3SLGA 3U3KA 3WGTA 2G6BA 2OC4A 2UYCA 3OCJA 5DV9A 2I2FA 3W7AA 2X9QA 3JYQA 2OFOA 3ZD9A 2WMOB 1GO2A 5CJ2A 3H3FA 2AEFA 1OX4A 1TPYA 3I9OA 1SOWA 4UMFA 4HPWA 2BGGA 1RWKA 1TZ2A 4M60A 5CB8A 5J4HA 1TM7E 3H1AA 1KFEB 4OF4A 1JRLA 1KVRA 1SKYB 3HJUA 4ND5A 1VE7A 3O95A 2UZ3A 4KNYA 1QIEA 2HCTA 3B1VA 4TMWA 1T9KA 2DZDA 4IXWA 1HE1C 4K87A 4YGYA 1TCBA 2HLNA 4PTLA 1QQAA 4RKQA 1UT5A 3TIIA 4ZO7A 4DLVA 1U0GA 5A4DA 3F2VA 5KTSA 1EXVA 1OPRA 5L7WA 5AUQA 3JQ9A 1WL8A 1E64A 1YJ5A 1CHDA 2CXPA 3N75A 2HQRA 4J03A 3KZXA 2EKLA 3HRHA 4Y1FA 3GUHA 4PBSA 1CE8B 3WK4A 4BZWA 3TG2A 2ODEA 3PKJA 5K09A 3I2HA 2AQ8A 3PNYA 3K0SA 4L3OA 4Q00A 3E5RA 4M0KA 4JI2B 1KH3A 3OJEA 4NYIR 1DRVA 4TQAA 5A1TA 2QTRA 4ZT4A 3I6BA 4C6RA 3QFSA 3PHCA 4G0NA 5J1SB 3DKKA 2QR3A 4LGCA 4QELA 4BUZA 3QW2A 1JXAA 2JKVA 3ADOA 5FUWA 4POAA 3ZKWA 1RC1A 3MRXA 5DLPA 3VSAA 2QZ9A 4IUBS 1ZJ5A 2JEOA 2IYVA 2P67A 2R751 1CUIA 3GQBB 3NVDA 1NURA 4EG0A 1B6SA 1TGYA 4RHTA 5EJ2A 1FS5A 2ES4A 3C1UA 3ETDA 2NM0A 2M1ZA 2WG1A 3HN2A 3CRZA 4H60A 2GEUA 4JP8A 3UHFA 4CU5A 3J81A 1PWXA 1BRTA 1VP3A 1A8UA 2B94A 4KBFA 3PTLA 2ID4A 5AMXA 5J23A 2K87A 4YRCA 2K2WA 5HM8A 1QZUA 4B5KA 1F2UA 2ZU0C 2V1XA 3PNQA 4EQ6B 4IDCA 4AQDA 1QV6A 1UBEA 3HB0A 3MSXA 2YWDA 1E1YA 1J5PA 4WLEA 1D1QA 1V5WA 4PZEA 5AJYA 3NRBA 1HH4A 3F78A 5DNDA 1QG6A 2IVZA 1H94A 2OHIA 4KXVA 2YXNA 3OSZA 4WN9A 1BA3A 5JT1A 2RHDA 4NBNA 5K51A 2ROQA 1ONOA 2YWXA 1S01A 3UT5A 3F73A 4A91A 3C45A 4JIGA 4K8RB 2ESRA 4PINA 1IB0A 2WWGA 4LHVA 1UIRA 3QVGB 4GP6A 4DHWA 4NZPA 5ERGB 2BT4A 2VTVA 1E2MA 1NV9A 3SG0A 1IATA 4IEEA 4BX9A 4QU8A 1FXWA 2ISQA 3M9LA 4DEYA 1GG2A 7ABPA 4JHXA 3T9FA 3KLMX 3WSVA 2V7WA 1YNSA 1SXJB 1ZCAA 3NC4A 4EMTA 4RFLA 5HF5A 4OB7A 2JLWA 2GZDA 2IZZA 3SYTA 4P7BA 4EAQA 5F7JA 1T3GA 3PXUA 3Q15C 5DDIP 4U7DA 3SEAA 1LPOA 2ENWA 3VHXB 4F3TA 1DKOA 1PJ2A 3FNEA 1SBQA 3PRKE 2O59A 4PHFA 2VOEA 1QVRA 2Z57A 3N6VA 4BB6A 2D4HA 2QD5A 2G80A 1H22A 1RZUA 1SZPA 3G88A 2ZJBA 3RM3A 2B1QA 2FR1A 5COAA 4EPVA 2VRCD 2Q6OA 2W2QA 4WUTA 3Q72A 5G1PA 1M2JA 2FEXA 3VOBA 1RLMA 1M6VA 2TMGA 1JAYA 5K2MA 3N8DA 4CKEA 5FULA 1E3MA 2ZJ4A 3LCUA 3MJFA 2YJGA 3OFND 3OPVA 1QPGA 4KCGA 2UUAB 4IIDA 2AR9A 4CLXA 3DCJA 2X4LA 4JYAB 1KAHA 4EHJA 3B52X 5AQ1A 3RF6A 3K0AA 4EBFA 1EZ4A 1ZH2A 1GQ2A 5B6JA 2IX3A 1K8ZB 1QG4A 2I1LA 4ROTA 1QHHA 2WKRA 3EF0A 4ETWA 5G1NA 3MT8A 1EFRA 2X0RA 3CNBA 2FR8C 2HIMA 2P9JA 2BGMA 1B14A 3LHSA 5KU1A 3RAFC 3RIGA 1GITA 3JZFA 3UUFA 4DJ5X 4QM7A 4BWGA 3K5PA 1JG1A 5LQRA 3K9QO 1I7LA 3USES 5A9SB 1GLNA 2OZVA 1Z4OA 1XCMA 3EZ6A 3O90A 4YUWA 1XVUA 3BMOB 3FVWA 3HUFA 3PGLA 3GCGA 3PTZA 1BXGB 3GP8A 2GVNA 5AKLA 2ZR8A 1O8BA 1V25A 1DIBA 1GDHA 5C32A 2JZOA 5J40A 3RARA 3U7HB 1OLSA 3HDGA 4IZOA 2ZWPA 1H2BA 3AKDA 1A8SA 3AM3A 2Q1XA 1IK4A 3REQA 2Z4TA 4OLHA 1D6JA 4RNCA 1E9FA 4HWOA 4JY7A 1FYDA 3DBIA 3CQ9A 1PJSA 4OKIA 1V8DA 2VHCA 2FFHA 2PLWA 4X60A 4A03A 3O82A 3ICEA 4KR9A 5HWSA 3GVPA 1AO3A 3NGMA 5IC5A 4FDMA 5JARA 2IUTA 1KIFA 4JC4A 3WXBA 5GM2A 1INLA 4QYSA 1K97A 4MUJA 1XVTA 2Q9BA 5LYJA 3AR2A 2FWMX 3D5EA 4O1IA 4G63A 3T9CA 3THYB 3DCNA 2QENA 4JI6B 4C7BA 3LZ6A 4F7DA 4MQBA 2O06A 4FNAA 4IEFB 4ZIRB 1J8FA 5A2QA 1VIAA 2VG8A 3I53A 2E82A 3LYAA 2I2BA 1ZM4A 4HYEA 5BN3A 1GZUA 3VJKA 2MDTA 1DTEA 2GEBA 1MBZA 4W6QA 1E9AA 1L4KA 1UEXC 4JCOA 4NBVA 1KJWA 3RJTA 2CJFA 1XJ0A 2F48A 1L4UA 2P4UA 3QWBA 3WAKA 1C7FA 2C7PA 4W63A 4FOPA 5D1NA 2RMKA 1Q3HA 2CZCA 2Q3CA 2OEPA 5J63A 4F3RA 5HKLA 4GR4A 1A7JA 2OFPA 2HA4A 2WJVA 3LUAA 2C29D 1VLJA 2B1GA 4LY3A 2B0CA 2IVFA 5BPFA 4NMXB 4P82A 1F1JA 1FVFA 1MCZA 3AETB 3LXRA 3QG1A 4Q15A 3DD5A 4O6VA 4WXHA 2HA5A 2ZUUA 1QFXA 4CM4B 5AVXA 4IFTA 1WVIA 5F3RA 4XIJA 3GLTA 3IDFA 1A9OA 1JKJB 5HQ3A 4NDAA 9MHTA 2UXBB 1DLIA 1R4AA 1Y81A 1O2DA 2A35A 3JARB 4TTSA 4XOUA 3RBAA 4C88A 4COKA 1II8B 1R0WA 3ZDCA 4RVCA 1NNLA 3AJEA 5JYCA 1IDN1 1N6HA 1QHSA 2B36A 4RF2A 1QORA 4RTQA 4QYIA 5HCIA 3DDCA 2FF5A 5H3HA 4H3VA 3ZBUA 2H1CA 4UZEA 2QRKA 2BI4A 4WZZA 4PN7A 2F9MA 6ABPA 7GPBA 1PO7A 2WU1A 4UHKA 5FA5A 2CC2A 5E6UA 2JI7A 3EZFA 2HV9A 4BNDA 2AD1A 3CM0A 3CSSA 3QLJA 4MUIA 5L3VA 4N01A 1YL5A 4X1KB 4F9GA 4R5HA 4RF5A 2ZRIA 2WUWE 2Y05A 4UHBA 5AKZA 4AY3A 2BN4A 1DDOA 1CR1A 1VPLA 2BFFB 5LZ9A 2IEIA 4CMAA 1QMGA 3OFVA 4NL4H 5DHTA 1JR3A 3OZBA 3W9SA 3KOWA 2DHDA 3OU6A 2IPMA 4XYGA 4F8YA 1NTRA 1JDVA 2PYZA 4H7FA 3HB7A 4QDJA 5ALUA 3UY4A 1M34A 4CEHB 5CVJA 5HIIA 5K1ZA 4Y30A 3M49A 3T5CA 1FXWF 1GXSA 1UDWA 4HNHA 3CX8A 1XHFA 3EVAA 4JH0A 5DM2A 2PNJA 4QSHA 5K01A 3ZVKA 3DHEA 5JMWA 2AJLI 1M5TA 2E3JA 5CDSA 3T1QA 1JBKA 1TUBB 3BILA 2O1XA 4IHJA 4W5JA 3FOAA 1JIXA 3H83A 5TARA 5B1HA 3ADBA 3OESA 2X9VA 1GU7A 3A2MA 5TY0A 3RSLA 1G5IA 1NJGA 1WCIA 2H1FA 3C1OA 4OHRA 4QXAA 4RLHA 3I61A 1YL7A 2VH1A 2JAPA 2LBPA 4O29A 3U3JA 4LYEA 2C0QA 1P9OA 3EWSA 4US1R 4QARA 3RUAA 2R4QA 3Q3VA 1OI2A 1YOBA 3BVPA 3QEOA 1Y3CE 4DREA 4JOQA 5FPPA 4BNUA 3PCTA 1P7YA 3IR5A 1T36A 4L73A 1ZM2A 1ISIA 1NVWQ 1W35A 3M5PA 4JITA 5T4HA 1DAMA 1ODSA 2ZSEA 3IAM6 3N2NA 3QE4A 4EG7A 1J0CA 1XTSA 1U7ZA 3OQJA 4NFLA 5EJ7A 1YQWA 3RHSA 3IO3A 4CMHA 4RFSA 1XN4A 1RAFA 3E84A 1WXHA 4PCAA 5LP6A 1F06A 4W9NC 2B98A 4ZXPA 1E2GA 3F4KA 2XCOA 2B3DA 2FA9A 3INYA 3TSOA 4KDCA 3GL9A 2YV4A 2NV2B 4TRRA 5CHEA 3FWYA 4NAUA 2HOQA 4L28A 5ITSA 2YX1A 4K6CA 1RFGE 3M8KA 3TCXB 1QE0A 5KJ6A 5KS2A 3K9LA 2E37A 4YCDA 4L2IB 1QLWA 1K9SA 3KD2A 4A6PA 5J4LA 1LW6E 1N0VC 2GOYA 1L1QA 1T2UA 2VDRB 3PVCA 3S29A 1SKBA 1C0KA 2LV8A 2GSDA 4WLOA 3SEQA 1GWNA 2AI2A 5CDTA 3MXOA 4V39A 4INPA 4O1HA 1KAGA 1OA0A 1AD2A 1J39A 4IYRA 2B37A 4IXTA 4GR9A 4D8XA 3ESYA 5IN4A 3U7FB 4B3GA 4D0RA 3PGA1 3C70A 1B3BA 4UZFA 1E9EA 2UXCB 1S2OA 2I4MA 3ZX4A 4C0QC 3ORYA 4I9GA 5LYJF 4F92B 1J0DA 4H16A 5TEVA 4F5WA 1WXXA 2I4OA 3QU2A 1LNSA 1Z0ZA 1XDBA 4XCQA 1PEDA 3TTWA 3ZZTA 4GKJB 5DMXA 3RO7A 1JZTA 2GNOA 2ZKLA 3ACBA 1M76A 2GBLA 3V33A 4B85A 3GLRA 4NG4A 1NVVR 3BSWA 2VC2B 3OZEA 3SM9A 2NAPA 5IULC 4BXOA 3WJ2A 4X5OA 1HDGO 4YCMA 5AKJA 4J29A 4OX9Y 3LLUA 4DA9A 3BWYA 3ROPA 2L82A 5BSEA 3KB2A 2WIJA 1F0PA 5AK4A 3SMQA 1NMYA 2ACVA 3HR4A 1RE0A 1Y1LA 3A4IA 3B1XA 1A4RA 1LDMA 2LCIA 5CT5A 3ZQKA 5KAPA 1HEYA 1Q3TA 4JROA 3TCKA 3TL2A 3VR2D 4DLXA 5FA8A 4HAOA 1EQ2A 1P1JA 4S12A 1FFYA 3C24A 3N7AA 4F85A 1R0RE 2P1ZA 4EARA 3VC2A 4Y1RB 1DAGA 1E1DA 2RGCA 1Z36A 3ETEA 4RIIA 3WIVA 2PD4A 2HO4A 5EJ5A 1W4BA 4OA5A 3O3OB 3I9V1 2RGEA 4XB6B 4BLVA 3RUCA 2OOKA 3UANA 3DMFA 5IC6A 5SZKB 2X42A 1XTVA 3LOUA 4RSRA 5G3ZA 2P69A 3LZDA 4DR3B 3R77A 2QDXA 1QIIA 2WWWA 1PGJA 2HEIA 3RK0A 2X2EA 4KN5A 4URWR 2PZGA 1CJUC 2QVYX 4KXXA 4RMHA 2X13A 3CHYA 5BSUA 1TF2A 1DGQA 5FTWA 4XH9B 1QIHA 3EJ6A 2G07A 2OAGA 4G8CA 3PE3A 1Q1NA 3JZDA 2HA7A 2LR0A 4JUFA 4YMUA 1YA8A 1MABA 2PJRA 4XAQA 3CO0S 3E4CA 4DCVA 1ZX1A 1S8NA 1QFSA 4RKWA 2UZ0A 4D9MA 1X7DA 4GOOD 4P36A 2Y6VA 3GJ5A 2C94A 1EP9A 1WP4A 1X38A 3F9IA 1O4VA 2BMFA 2EZ8A 1DLJA 1C9EA 2B8JA 2Q4RA 4HZIA 5J59A 4D4IA 2IYPA 2PH7A 1A9XA 4PC1A 4QO7A 1UMCA 1TKBA 2XCSB 3ZGOA 4F4UA 3GRRA 5ICMA 4FYJA 4ZYLA 1U4SA 1ZXBA 1M0TA 3I64A 1OXKB 3CZ4A 4OLJA 1DBQA 2EJBA 1E7SA 1L7OA 4IHJF 1IXKA 1YHNA 2NPFA 4EZIA 5HKAA 4O59O 5TPWA 3W2GA 2BSQA 3GLFA 1YE8A 4CKCA 3ADKA 2R7MA 4JYBA 4AK9A 4JSYA 3RTCA 2AD5A 1F60A 1W34A 2C7VA 1Z33A 4JLSA 1RFLA 3GIWA 1U4NA 4L76A 3ELWA 5KMGB 1G42A 1Z17A 2J46A 4UTNA 2D1FA 1T0BA 1FP7A 1TYAE