2D1FA

Structure of mycobacterium tuberculosis threonine synthase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
349
Chain Sequence
b'QPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine synthase
molecule tags Lyase
source organism Mycobacterium tuberculosis
publication title Structural, biochemical, and in vivo investigations of the threonine synthase from Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 113
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 4.2.3.1: Threonine synthase.
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d1fA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d1fA01
2CLHB 4OFXA 2JC3A 2ZSJA 3V7NA 4D97A 1TDJA 2CLOB 5DW0A 2C2GA 5DVZA 1RQXA 2J9YB 3X44A 3FGPA 1TZ2A 2WSYB 2ECQA 3SS9X 5IW8A 1P5JA 3R0ZA 1TZMA 4OREX 1V71A 1V7CA 3DWGA 5JJCA 4LI3X 1J0DA 4D9FA 5HBGA 1KFJB 3IAUA 2TSYB 2ISQA 3SS7X 1K7EB 3PC4A 4IL5A 4KKXB 1CW2B 4AIRA 4AECA 5I7OA 1TZKA 1CX9B 3VBEA 4D8TA 1KL7A 1K8ZB 5BW6B 1D6SA 1A5SB 5IWCA 4HO1X 4D96A 3VC3A 1PWHA 1QOPB 4LMBA 3T4PA 1OASA 3DKIA 5E0KB 5J43A 1K7XB 1PWEA 1BKSB 3IQIX 3AEXA 5DW3A 1JBQA 1WBJB 5D86A 1VE5A 2ECOA 2BHSA 1K7FB 2CLMB 5T6MA 5D87A 1J0EA 2RHGB 4XUGB 1KFCB 5B3AA 3IQGX 4D8UA 4D8WA 1TJPB 1K8XB 3IQHX 5CGQB 4D9BA 1J0AA 3L6BA 4D9NA 2GN1A 4ZU1X 2CLIB 5B36A 2Q3BA 1KFEB 4L0DA 4NU8X 1WDWB 2RH9B 3AEYA 4LMAA 2GN0A 4HN4B 4D9EA 5I7WA 4D9MA 1F2DA 5KINB 2J9XB 3PC3A 4HPXB 5DBHX 5I7HA 4H27A 3RR2A 3DWIA 2CLFB 5B1IA 1TZJA 2CLKB 1Y7LA 1A5AB 4D9KA 4NEGA 1E5XA 2EGUA 4QYSA 3CEPB 1V8ZA 5CVCA 1UINA 3VSCA 4D9GA 1M54A 4WX2B 1UBSB 1K8YB 3ZEIA 5IXJA 1K3UB 2ZR8A 2CLEB 1C8VB 2O2EA 3HMKA 2ZPUA 3R0XA 1O58A 1QOQB 1C9DB 5J5VA 4D99A 4HPJB 1WTCA 1VB3A 5B55A 1TTQB 4L3VA 2DH6A 5B1HA 1C29B 1FUYB 4F4FA 1TYZA 5JISA 5I7RA 1KFBB 3L6CA 4L27A 3FCAA 3BM5A 1TTPB 3PR2B 3L6RA 1J0BA 1Z7WA 4D9CA 4ZQCB 4L28A 3PC2A 2C2BA 2J9ZB 2PQMA 4JBLA 2RKBA 3SPXA 4ZU6X 1A50B 1KFKB 1X1QA 2Q3CA 4PCUA 5D85A 2EFYA 4D9IA 2O2JA 1VE1A 5EY5B 5I7AA 4HT3B 5KZMB 1BEUB 1FCJA 1Z7YA 2V03A 4Y6GB 5D84A 2TRSB 3VSAA 5I6DA 5C3UA 2DH5A 1J0CA 4I1YA 4JBNA 5DBEX 3TBHA 3VSDA 2D1FA 4D92A 2BHTA 1WKVA 2CLLB 5B53A 4COOA 2GN2A 1UIMA 2TYSB 2Q3DA 1A5BB 3X43A
chains in the Genus database with same CATH superfamily
3D6VA 3PUXA 2JC3A 3S2EA 1DGQA 1JTEA 3AVXA 2Q46A 3EMBA 4QELA 1A9ZA 3DULA 4R41A 4ZZIA 1DXOA 3HLKA 3N2EA 1ZHOA 3KP1A 4GI7A 2ZIAA 2FPKA 4UVEA 5J5AA 1LBHA 1GDTA 1J07A 4LXHA 5C9ZA 5KTYA 1RPJA 5AESA 3DBHA 3F2IA 5C8VA 3HXKA 1DC5A 1JAXA 1E9EA 1PGJA 2J8ZA 4XX0B 1JHQA 5GZ6A 2G88A 2ZAGA 2E21A 4IG4A 1RLOA 1ZK3A 1U8TA 1H23A 4U3JA 2I8AA 3BMQB 1KY3A 3O7WA 1KNXA 4NYMQ 4CM8B 1ZUWA 3KG2A 2WKSA 2XJ4A 1AQNA 1FPMA 3UJPA 2VA8A 1R5OA 1M7HA 4TS1A 3WXBA 5DP2A 3W79A 4D96A 2IPNA 5GZ3A 2QVLA 4J43A 4JI5B 4C3OB 3AZQA 3H7IA 5EXPA 1FQWA 2B1RA 4ER0A 3QWIA 3VH2A 2A0WA 5KTKA 3DWEX 3KZCA 4NRDA 4QOEA 2FSUA 1TPYA 3UJDA 4OGWA 2VSNA 2CHQA 2ZB8A 1DO8A 2PXHA 3ZUPA 2BHSA 3PNLA 1ZWKA 4KN9S 5HOEA 2NZUG 1UJ4A 1KFCB 4MR9B 2BF7A 2GD2A 5AVQA 2WLTA 2H85A 3OQHA 2JAXA 1NJ8A 1W1WA 1OFTA 1L5MA 3A04A 1Z25A 3D3WB 3K4HA 2PL1A 3OZRA 4HGQA 4ZWNA 2X9GA 1NBWB 1RAIA 2ENWA 1JHXA 3A28A 3F6CA 3LVBA 4Q9NA 3EXHC 5SICE 2VK1A 4U02A 2PE5A 5KREA 5DGXA 1YAJA 1VLLA 1FRZA 3FVVA 2ZLBA 1N2OA 3F4LA 3NNNA 2IS2A 1XD2B 1BGWA 1PJCA 2RC6A 1Y1KE 3ZI7A 3AUUA 1E32A 2ZJBA 4CT0A 1B4DA 1GZ6A 1WCIB 1A9XB 3EXEB 5CXUA 1A95A 4NWIA 3FUVA 4EYSA 2XPCA 2OBYA 5HF8A 4TYPA 3ZWKA 1O87A 5FRDA 1JRLA 3GGJA 3KDAA 2HXGA 2BMFA 2X4DA 4EA8A 2V3VA 4MQFB 3TSAA 5G2OA 1XVTA 4WXMA 1FDTA 1OT5A 2FZWA 1K5HA 1XMOB 3JYHA 3ZUGA 5E9JA 3GFOA 5AVJA 3E7FA 4HVLA 5BUQA 2F4NA 1JALA 3H2GA 3WQSB 4OLJA 2IJGX 1I6WA 2PFKA 4V1CA 4RK6A 1NI4B 4INJA 1U5BA 2HQOA 2P9QA 2OV2A 2JJ1D 5E6RA 1JVBA 2WZDA 1J25A 1SVLA 3PHIA 4U0KA 1YQEA 5GJCA 4I9GA 3P2EA 4GPTA 3LUKA 4FOLA 4ZTBA 2CSUA 4Q7LA 4EELA 4YR9A 2FVXA 2O57A 2V7QA 3DE2X 3ZJYA 1MX5A 2IVFA 4R9UC 3T95A 3C48A 3UKJA 4AFNA 5KCZA 3MWFA 4P7FA 2OT3B 4YMGA 3LZDA 4L4XA 1P80A 1U7DA 3T3GA 5CM8B 1LSOA 3G5UA 4NSNA 3TW6A 3JQBC 3KYJB 1P9RA 4PCUA 1XLTC 2GFQA 3H5VA 5EIBC 2HT1A 2YIDA 5G4KA 3C6QA 4GGOA 3DB2A 1NVXQ 3A10A 4N8SA 4RQTA 3ZCXA 5H3CA 1CY1A 4I1YA 1L8QA 2ZE6A 5CT8A 1H0SA 3S27A 3BIWA 5LL6P 1S4MA 2Y68A 2QTBA 5JXIA 1UIMA 3UH0A 1OVMA 1D3AA 5I4CA 1R2QA 1KJIA 2J3KA 4Q9HA 3QUBA 2DWUA 4G5OA 3SF0A 2BAGA 4UNSA 2HSJA 2QGNA 2VP6A 1QANA 2CLOB 5ALGA 3THRA 2V6JA 2VPYA 3AR5A 4CUJA 4YDSA 2XMZA 2BMEA 5JAUA 3L3BA 4RU1A 4WUVA 3TLGA 4BVBA 1ID8A 1NWCA 5AK5A 2RJ3A 4QKQA 2WSYB 1XVAA 3BWEA 4GOKA 5IBPA 2JJ1A 3L92A 4NJMB 1IY8A 3L4EA 4JHLA 2PWAA 4B75A 4HLDA 1NHGA 2VJKA 2POCA 5FR1A 1T5TA 3HC7A 5EKDA 3WGNA 3VDNB 4E5DA 2V7VA 2V4ZA 3A2KA 4YT2A 5EIXA 1H2RS 1KERA 1DOZA 3RS9A 2IC5A 3K4PA 1TVMA 1WXWA 2WB4A 4IMJB 5BO5A 1B23P 4HNGA 5IC4A 1CD5A 5DXAA 1AMNA 1V16B 4OGFA 3PYXA 4P53A 2CLSA 1G8SA 3CIFA 2VAXA 1M1UA 2TS1A 1C5KA 1NURA 1S2IA 3AOEA 3NX4A 4QSHA 5ALKA 2WF5A 1KO4A 1S1MA 2ADFA 1C9MA 4Y2XA 4EAQA 2C99A 3AP3A 3PWTA 3D6JA 4J76A 5DHSA 4AP9A 2EW2A 4JOQA 3UIEA 2ZXUA 2OBMA 1E0JA 4O2RA 3DH0A 3I1FA 2W4QA 3BJRA 2HBRA 1KEEA 5JARA 3LC2O 1YB5A 5LA6F 2XDWA 4CMKA 5AUOB 5G1OA 2DG2A 4BAZA 4E2ZA 3USCS 1M74A 3C1OA 4ZAFA 4YUYA 4ZGBA 3V4SA 5BSFA 3IVMA 5HP4A 2WU3A 4TSFA 4EENA 3P9YA 3RDPA 1EFVA 1IXRC 1GYPA 1J0AA 2D4HA 2HGZA 3F7TA 4TQAA 4F2WA 2GEDA 2O2YA 5HPYB 2ZBRA 5CHEA 1WZIA 3RREA 4EARA 1AUQA 3HCRA 3PZBA 1RHKA 4HDQB 4HQFA 4MROA 5CDYA 1S8OA 5GQSA 1JHUA 3ZE1B 1JJFA 2NUBA 2X1VA 1UXOA 2CB0A 2W71A 4C5BA 3QXCA 1TQ4A 3T1TA 3HY3A 4XIGS 5DTIA 4RXMA 4FHGA 1BVUA 1RYZA 1JHOA 4J4TA 1VJ0A 3RQSA 3U9TA 1YACA 1OZ0A 3BOSA 2HDHA 1O1YA 2YC2C 1IHPA 4IICA 1YDHA 1GTVA 1RHMA 5AR1A 5AM1A 3BGWA 1C14A 1KK2A 4OXRA 3ZEIA 3QFTA 2VUSA 4L8VA 2EC5A 4BNMA 4QFCA 3GYBA 1U2QA 2CXQA 3ICCA 3GD7A 4M1TA 4DA9A 1AHNA 1VP9A 5C80A 1XRQA 1TM5E 5IMBA 4ZI7B 4H35A 4U2KA 1P19A 4F4CA 1RBYA 3SSNA 4E2FA 2OILA 5JV5A 3IT1A 3KQTA 1T6XA 3IV7A 3VVBA 1FQOA 4BO0A 1T5OA 3AEUB 1BWRA 5CB4F 5KKAA 3K3PA 4R98A 1W0JA 1F9AA 3B1VA 1RXIA 1IZYA 3DMPA 3LTEA 3Q6IA 1JKMA 2Z3VA 3W6UA 2UYHA 4TYYA 3N7AA 1H9CA 4FJ1A 3WGYA 1PG0A 2JFGA 3O0TA 2OGTA 2H5LA 4YVFA 1EA5A 3GLRA 4WUTA 4LZPA 3K9GA 3QTTA 1O95C 4L8WB 1ZH8A 3CNEA 3F3SA 1THGA 4HWKA 5A5EA 3E15A 3LQYA 5FV7A 5EY5B 2GCOB 1TIBA 4EK9A 5CBPB 2XT9A 3GB9A 4US2R 1N75A 3A6DA 3NPAA 3ZY6A 3KWFA 2AF3C 4OJTA 2NNLD 2QORA 3F8SA 3HB5X 2WBLC 2HK9A 3Q3GE 1IAVA 1WLSA 4GD3Q 4ENTA 5JMTA 4M1KA 3R5SA 3CR8A 4Z6KA 3VQTA 2IZ7A 1NW3A 4MR7B 3TNYA 3JQFC 3FMIA 4URWR 5TIIA 2YJ4A 2RCYA 3ZU6A 4Q0MA 2O7QA 3K8QA 3QG5A 2QRGA 2FUEA 5JD3A 5CTAA 3B1WA 1JIJA 1YL6A 4NEQA 3SYTA 1NXXA 3IDZA 3W6PA 4N0EA 2XNJA 4Q47A 5CVDA 1HNWB 1F2TA 1G5PA 1XZEA 3WGMA 1EX7A 1VMAA 1YBVA 4IAOA 1UK8A 4LPSA 4X1IB 1KIAA 4CF6A 9ATCA 2I7CA 1EK2A 3ADDA 5AUNB 1BW9A 2NU6B 2XUIA 1GTL1 3B8HA 1IN8A 4Z1OA 1FRFS 3NV7A 2ZDHA 1DQSA 3T4XA 1PD0A 3BWMA 4RUKA 3SZUA 4HDMB 3VTFA 2B4QA 2IH2A 5B7NA 3IQFA 1C3LA 2QENA 3PENA 3A4NA 1FBTA 3CSSA 1S89A 3MM4A 1NFRA 2WQZA 5CFPA 2FPPB 4LGMA 4KNYA 4UATA 2EIHA 3LLCA 4FYVA 1MGOA 2ZB2A 4RVNA 4DA7A 5JTUA 1PVDA 2ZPTX 4BTEA 1IEWA 4R6WA 1TAUA 5DMHA 4OUKX 4BBJA 4JT8A 3R4VA 2OD2A 2XVXA 5ILQA 4ZC8A 4KWHA 5K03A 3AFOA 1NDQA 1EVEA 1A2QA 1EJ2A 1D1TA 3P9NA 1J90A 3PGVA 4ZV9A 3ZHBA 3SS8A 5F1YA 2BMDA 1N5RA 4JP2A 3IR5A 1GD1O 2QRLA 1WULS 3PVCA 4JI8B 2PYDA 4Y1FA 3PFKA 2BM8A 1ZN7A 3UJAA 3VR2A 4RF2A 3G1WA 4H1VA 4RHXA 2C5AA 3IBSA 3AI3A 4UJ3A 4GVPA 4X61A 5CK4A 4AULA 4GRAA 2Q50A 3RFFA 3RTDA 3PEWA 1MCZA 2NZVG 4NDZA 4W7SA 2D54A 2YASA 2ZJOA 5B4VA 3M2PA 1L3IA 3EOBI 4NU0A 2HSGA 2IDMA 5JDCC 3HE3A 4Q16A 4CT4B 2O6HA 5JS1A 4MGZR 3TL3A 4ZN6A 3VSCA 1X0VA 1ZCBA 5GGXA 5JZVA 1BHJA 5REQB 3T9AA 2BFCA 2A8YA 2ZIXB 1JKFA 5IXYA 2H4XA 1P3JA 3P32A 4JB2A 1HO3A 1TCUA 3BMNB 4H59A 4KLAA 2VUHB 4OHKA 4R1MA 3TYXA 3DBRA 5BN3B 2CHUA 2OFOA 1WXIA 4X3CA 5E1DA 2GM3A 3TRDA 3RU7A 3VH3A 3WA6A 1U0NA 1L5QA 1WB5A 5HK9A 4BMZA 5HKOA 4N54A 2X8JA 1Z6ZA 3UAOA 1MNAA 5T3YA 1USVA 1WUHS 1EB9A 1Y3HA 3J81k 3OPQA 4UHKA 3GDFA 5L3SB 4UE2A 2XT0A 4CI0B 3TEMA 2YX1A 4Y2HA 1PTJA 4KPFC 1I1QB 3H9BA 4NZNA 4DDVA 5IT9A 4OI0A 5HCNA 4U7DA 2ATCA 4N3NA 2WT9A 1QG6A 3H4TA 1UM9B 1EP2B 3E84A 3HEAA 5JY1A 4NCJA 3H1BA 1XTKA 2PQMA 3PIIA 2PH3A 4G1UC 3JATA 4QXPA 4O4IA 3TR0A 4BO9A 4N7RA 3IAS6 2BWJA 1RQLA 4DIBA 1II9A 4Y6GB 1PG2A 1V6SA 5I51A 2R86A 4J2HA 4JLWA 2FB9A 1K4KA 1S2MA 2EZTA 1YR6A 2GJSA 3P4UA 4XGKA 5CW1A 3RT1A 5H4GA 5KWVA 5K3EA 4JOCA 4IKPA 3U5ZB 2BKEA 3I4CA 4LF4B 3V8RA 2RH4A 1XC7A 4AD8A 1DJMA 3QKRB 4I4TF 1U3DA 2CNOA 5TQJA 1KK1A 4TGLA 4BVEA 1HLGA 4EATA 2PUFA 5A62A 1AMOA 2OVFA 1RRFA 1PR3A 4A6PA 3O26A 4LE2A 3S1SA 2BGGA 5IG2A 1NUQA 3J7TA 4G5FA 1J09A 1RBMA 1RNLA 3U3KA 3V8NA 3T61A 1NYQA 3HL4A 3KJHA 3R7SA 4MXDA 1WMEA 5F9FA 4G63A 4BNWA 4X8HA 3FYDA 3SC6A 1VZ3A 5HG0A 1XK6A 5CRIA 5TR9A 2C9DA 4AIRA 1VLHA 2VF4X 3A2LA 5EHXA 2V0NA 5SZJA 5DNVA 1BA3A 3C3CA 4JGIA 4Q3CA 4EB3A 4IQ4A 5IZCA 4MP6A 4RD3A 1C0IA 1BXZA 4IWYA 3UHPA 4JZKA 4XB1A 2DFLA 2FJ0A 3ZE8A 3PHBE 5I7FA 2JI9A 2R7KA 1GUAA 2HCBA 5BUCA 6Q21A 5JDIC 2GKGA 4IIDA 4LY0A 4MCHA 3DL4A 4JLUA 1AQYA 3QBEA 4LYYA 2JIMA 2ZB4A 1ZUIA 1M2FA 3LP5A 2PS9A 2JLRA 1EESA 4AZ0B 4KO4S 1QM5A 1XMJA 4CYMA 2I2XB 4XM1A 1HV8A 2Y4NA 3ZV4A 1QMGA 3I8SA 3EZ2A 3FM9A 4MYRA 4EJSA 4X95A 1ORDA 1O8CA 5A3VA 2FKAA 1W36D 3SN6A 4Q4LA 5HBRA 4E5UA 1YE8A 3PLAE 1V5FA 2QNRA 4M83A 5EP2A 1UWCA 2ZUVA 4KXNA 1UC5B 4LMAA 5F1OA 4U8HA 4EVRA 1QONA 3OUUA 4LFBB 1RPTA 4AZTA 1ZUD1 4DIDA 2QL7A 4A7PA 2NXEA 4F3RA 5I9LA 5JZ9A 2L69A 4G25A 5JNSA 2C31A 1JIIA 3C8DA 4UEKA 3TDNA 4U9HS 2L82A 3H6HA 2PNFA 4P5EA 3UKOA 1JKJA 1GPH1 3I58A 1K98A 1EVIA 2CLDX 1Y9EA 1OXMA 1UINA 1U99A 2F7SA 3NHAA 2WFZA 4RH3A 8MHTA 2AHRA 2J07A 1FLVA 1FTQA 1OYVA 1HTTA 2B21A 2R66A 3BX1A 3GNSA 3KUCA 3LPAA 4IO1A 1U1EA 4A10A 4TL7A 1UZAA 2PFGA 4B46A 1IIBA 1RM4A 2FCAA 1FFXB 1LEHA 2M1ZA 2HZ7A 4Q3EA 4R7TA 4Z54A 6REQA 1QHFA 3HR7A 1Y33E 3I0MA 3VRHA 4NL4H 3KV1A 4YUZA 3V8VA 5IDQA 1M67A 2VDNB 4LWQA 1J7JA 3FFAA 5AW5A 5A04A 2GZMA 3JAKA 4LJAA 4A82A 4JQYA 4UVIA 5BSUA 5IX8A 1KQFA 4BUJA 1KEWA 1TK3A 2A2ZA 3C41J 1HFWA 3E23A 2A4MA 2DWPA 2VH2A 3LLUA 1DQPA 4NZYA 3V5NA 1SB9A 1MH9A 4YP5A 2OTCA 3F2VA 2QB5A 3EZFA 1EDEA 3SM9A 4A2CA 1FNCA 4NDNE 1IN6A 4JBLA 4CIAA 2GLTA 2RFLA 3QU7A 1SA0B 2H2FA 1JBEA 1B73A 2P0AA 3QLVC 1XCLA 4HDNB 4I99A 1JFFB 3GJ8A 3DZCA 1D2GA 3ILXA 5AM5A 2VJDA 2OHXA 1QV6A 5EHQA 4RZHA 3RUEA 5ECGC 2QR3A 2NUPB 1ZA2A 4MQEB 3AR6A 2K4MA 1MO2A 2AEJA 2J08A 2CF5A 2VJNA 2ZT7A 3WLOA 3ZCVA 4C9BA 5K0ZA 4BO7A 3OZIA 4OKSA 2BHRA 2A4KA 1U0TA 2R4UA 1YWGO 2WTNA 2JH8A 2JAWA 1EDOA 1YOBA 5LXTB 3C8UA 4FTWA 3GN2A 3K32A 5FOVA 4LZOA 1PQUA 1L9KA 3RFXA 3L06A 1SRRA 1KK3A 1XI2A 3U4MA 3C8HA 2F8TA 3EY4A 1OROA 3NH6A 3OPYA 2COKA 3AW8A 1VZ2A 2AG1A 2Z09A 3RROA 1E3IA 1EK1A 1XZQA 2ZRDA 2ZWMA 4LSGA 4KR6A 4WY8A 1QO0D 3H17A 2DCMA 2OORC 4U7TB 3HBFA 1QU2A 4JLBA 4JLDA 5FL3A 4L5AA 1XPOA 1UMKA 4JI4B 5LQNA 2JGJA 1TZCA 2QHXA 3IOMA 1URPA 2ZUUA 3EFBA 2FOXA 4YN3A 3I6YA 4XOUA 4CKBA 3DE0X 1GLGA 4J0DA 4ZDKA 1NV9A 4GMXA 4XYLA 3L7OA 4BX8A 2VQEB 2JLBA 2P4UA 3REQB 3N2GB 4P3KA 2C2YA 2AX4A 3KOUA 3COPA 1SBIA 3R6GA 3JAWB 4FNMA 4UCWA 4ZT4A 3S68A 3GRYA 1IUPA 1X1CA 3OT1B 3AF6A 2D8MA 4B0OA 3K1AB 4YDQA 1DKOA 1B8UA 3DVAA 1I2BA 1QQ5A 2P4QA 1NJ6A 3I45A 2QTZA 4RCYA 4UXHA 5BYJA 3UXEA 1E2IA 1T0BA 2H2DA 3OQNA 1GGMA 2HCRA 2QKYA 1BG6A 4XPIA 4HNAB 5F2OA 4QO7A 4PYMA 4DILA 2J5QA 3EGXB 5HQJA 1HE8B 1ZQ1A 4MS1A 3SE7A 2OR3A 5AK6A 1QYIA 1BC5A 1YO6A 4BN0A 3BKWA 1FRVA 2BP7B 1MFPA 3A4YA 3DTVD 3QA3E 3R0QA 5I45A 3VVCA 5K3SA 5TDHA 1E62A 1PW5A 1LDYA 1QHIA 1XZGA 1OSNA 2DUJA 5B57C 3L8CA 4GZLA 4O2AB 2QZ4A 4NE2A 3BH6A 4XW2A 4N49A 1T9DA 4I55F 5T5QA 1SBHA 3KKQA 1NJ2A 3CV3A 2BGJA 2BONA 1OZHA 1QOZA 2E5WA 2FPMA 3A1EA 4TSFD 5H80A 5TNXA 5AJZA 2VSYA 1YDMA 3ANNA 3CG0A 4G8JA 4M88A 3FOEC 1YRAA 4YAEA 3G79A 3MQ4A 1KQGA 4D9KA 5HQ3A 3QTBA 4QGSA 1FDVA 3EN0A 2WIGA 1K97A 1NRJB 5KC8A 4V0QA 5IJAA 4K3UA 1Z37A 3BSSA 3RYHA 3CG4A 2JHFA 4PTYA 2GASA 3MFQA 5CLJA 5JAHA 3NJ8A 5KDDA 1I4OA 3DYIA 2WTUA 4ONEA 5TF0A 2D7CA 4N01A 1P0IA 4IF6A 5AI6A 1KE1A 3ZGZA 4GW3A 1YIAA 4MYCA 5BN4B 4HEA6 1ADFA 5C1OA 3RVKA 2DF8A 2IELA 4FLFA 4GLLA 5EI5A 1XQ1A 4L27A 4X0EA 5CU7A 1OKKA 1S3GA 4JJIA 4HS9A 2IA5A 4OY3A 4WACA 1E4YA 1P4HA 2QY9A 3F7NA 4IGFA 5KUTA 4R2WA 5DASA 3FMOB 3PC8C 1MV5A 3FTPA 3NWOA 4KVAA 1E0AA 1RTTA 2YOFA 3CPHA 1QRAA 3NDBB 4LJ5A 3SDSA 1YFJA 3BJMA 1HOXA 2PT5A 4OBWA 1D5WA 4OU4A 1RC8A 5KQPA 2FR1A 2V5VA 2O05A 3R7FA 3O2NA 5JZSA 2G7MC 2BR5A 1QZ3A 3P96A 1SOWA 2LW7A 3CZ5A 5G1NA 2CWDA 1CJTC 1VPWA 2GVZC 2B35A 2YNMC 3O92A 1QVWA 2BISA 1ZM7A 4HK4A 2E4ZA 5FNVA 2PFSA 2PKQO 1E6LA 4B83A 5DNAA 3H4MA 1VRWA 4YC7A 5G02A 3TAXA 2C7QA 1HA3A 1SCDA 2OGZA 4KN8A 3ZGYA 4MRRA 4C6TA 1DWQA 3F90A 3OIYA 3QVXA 3U44A 2GNPA 4ESEA 2D7JA 1S1CA 4KXQA 2XZPA 2YUTA 3Q3EA 4K2HA 4EJSB 2IUSA 1B8OA 1NAIA 1KSFX 4P5PA 4BN4A 3G0HA 3P5SA 3I62A 1GUFA 3AI1A 1IQPA 4RJ2A 3JWEA 4V0NA 3UGQA 4UMEA 1OWLA 1YE5A 3WIOA 5FI1B 4YI5A 4YV2A 2W93A 3NBYC 1D4AA 1XXHB 5IWCA 4EOGA 2Z5VA 2B82A 3UANA 4DG8A 4ER5A 2FMFA 3CH7A 3I4LA 4CLHA 4LBWA 1R6XA 1J5PA 4Y2GA 1A1VA 3WLSA 4J9UE 1EVYA 1AKUA 1S3IA 4XD7A 4QDXA 3ICVA 3OTIA 2CVZA 4PSKA 1AHHA 1OXSC 5H5JA 1E3EA 4E33A 2NUTA 3MOSA 2FWAA 2ZTUA 2EBHX 1OAKA 1ZXLA 2I4IA 2X0IA 3G2JA 4NESA 1IPHA 5EVJA 3CRQA 1XNQB 4KCGA 4MS4B 1X7HA 2E55A 2HZBA 4L15A 2A9QA 1B3BA 2MOKA 3UW1A 5T7BA 3OEHD 5BOSA 2ZB7A 3HB7A 1I2MA 1EEXB 2GEUA 1N5IA 1OT3A 3ETCA 3FZQA 3ENZA 4KQGA 4L5JA 4PCAA 4YBZA 2PY6A 2RGDA 1YU6A 9LDTA 1RHRA 3NVMB 4JNCA 1JXQA 5AUQA 1GEGA 1OX4B 4OHFA 2XA1A 2H0AA 1HLFA 3EBPA 3H8SA 4NMMA 1L7OA 1KMHB 1IN7A 4F1WA 3X1DA 4XLTA 4KN6A 4Q39A 3KZXA 3LYAA 1TZJA 1U1CA 2KS6A 3PS9A 2YL2A 1DV1A 4LXGA 4Q3OA 4R8LA 3NCTA 2YW9A 4KXWA 4CMBA 2WHQA 2QRKA 2YH2A 4UNQA 2P9ZA 2JG3A 1NG9A 4KNVA 3KSBC 4JIMA 3GRRA 2C2KA 2NYAA 3ASVA 4B4KA 3GEBA 3BCRA 4HFJA 4XSVA 4FDLA 1MH1A 2WPDD 4UXJA 3PRJA 2JFFA 2IXGA 3CW9A 1DL5A 2EQAA 3BTUA 3MUEA 4JGGA 4B3JA 3K0CA 2FF5A 2GZHA 2YRXA 1N4DA 1RMQA 4AROA 5HTOA 1V26A 2PK3A 5KKCA 1CY0A 1RR6A 3IP5A 2G1AA 4QGAA 4TZKA 1ZH4A 3S7ZA 3UUWA 4U8GA 1TYZA 3VPHA 5L4NA 1H4SA 2KLHA 4YCJA 1PJRA 5HDQA 3H13A 2B69A 1QCZA 1NXOA 3DQQA 1Q3KA 3MJRA 3QV1A 3PF8A 4J03A 5DN6A 4A23A 4UTZA 2HOQA 1WETA 2Q5LA 1M76A 4CMJA 2WHEA 3NM4A 1PCXA 2P4HX 2VJMB 5A4JA 4ZU6X 2XGJA 2PRYA 2AN3A 4RD2A 1N0IA 4PONA 5CIWA 5LA6A 4CU5A 4ENWA 1SBQA 2C2MA 1LFAA 3GUZA 4FMDB 4UU8A 1XJ5A 5BRJA 1XZBA 1Q7TA 2RONA 2H6EA 4WPGA 4E5PA 1NVWQ 4EY6A 4D57A 3U17A 1TUGA 3QVGA 2PPVA 3U9SA 4XRRA 1QO9A 1AM4D 1HOTA 1ULBA 2XHEA 5G53C 5LQJA 3BT7A 1HLDA 1F4PA 1NQOA 1R6BX 1MVOA 1UH5A 2Z2XA 3B1JA 3D31A 3I2YX 3KKMA 2I4TA 4EW2A 3GBPA 4FDVA 3RANA 2W6IA 2XUFA 5L3RA 3GLHA 3B6ZA 4HQ6A 2IY9A 2ZATA 2QM0A 3GPDG 3OCZA 5DW0A 1WUYA 2QQGA 1B6RA 2E89A 2V7UA 1JF8A 4TM8A 4LUCA 1GCOA 2DR3A 1SU6A 4GF5A 3C6BA 4FGUA 4EVQA 3EHEA 2XGMA 3ZHZA 5CCEA 1XCGB 4ZYYA 1IY9A 4XGRA 4TRRA 1IQRA 1IWOA 4GPIB 2YIVX 5KNLA 4FC6A 4V2UA 3L1HA 1QIKA 2IYXA 3AB8A 1DS6A 1ODCA 3BKXA 4HGOA 2P91A 2XUGA 4LDJA 2FMUA 4X1YB 3ZW7A 4B5KA 5INTA 1W0KD 1Z07A 2P3QA 3R3HA 3EOZA 4IOKA 1H4TA 1I3OA 1HLPA 1YVRA 2Y3IA 3LW7A 3HZOA 4U2DA 3S4YA 4Z7NB 3SVTA 3R44A 1NVDA 1RAEA 3NRCA 4UM7A 1CF4A 1A82A 1BU8A 1T6NA 3BB1A 4K9OA 5C4MA 5CA1F 4C21A 4Q03A 5KJFA 2FWIA 2HRQA 2XI4A 4RH1A 1V37A 1GGHA 5LXTF 3RODA 3RHTA 1CQJB 3X1YA 3ZD9A 5FX2A 3UWKA 5JOQA 2A0KA 3I5MA 1SU7A 4FNOA 4NI5A 4Q9IA 4QBKA 3TVDA 4N1AA 1Q84A 4E7OA 2YMPA 4B1FA 4FZJA 5LFAA 1T2CA 2H52A 2J3QA 2RIRA 2RJOA 3UY4A 1JIUA 4J2OA 1PEDA 2R7LA 3LY9A 1NBIA 2C8KA 3B13B 3EVZA 3AIMA 1P7VA 4R2MA 1G8GA 2COUA 4HX2A 4IOMA 3ONNA 3DP7A 4CN8A 1ACLA 3NTVA 1XJQA 1RWMA 3AR7A 1KYYA 3FGOA 4LQDA 1HT2E 3E1GA 4MUXA 5TC4A 5JZMA 3HCPA 2GRAA 4BFXA 5HQTA 3W4JA 1PV2A 4HC4A 4JUCA 5TEWA 1PGQA 3B7GA 2W6JA 3I6ZA 4RZQA 1J8FA 3NEYA 2K7FA 3G2QA 2NU8A 1O4WA 3OOWA 5JSYA 2LR0A 3AHDA 1Z0KA 3FGNA 3OQIB 2HU7A 4BC1A 1YR9A 4J49A 2F3UA 4FDUA 3SAJA 1UBEA 1DDOA 5LA6B 3LDGA 4MMYB 4YQFA 3N2NA 1G21E 2Z5FA 1P44A 2ETVA 2IYNA 3PYMA 4HRYA 4LBZA 1GZHB 5LIPA 1N2ZA 3E7WA 2WKPA 4GMHA 4IWNA 2UXCB 1BN7A 3EDRA 1DKUA 2DPMA 3IUBA 3H9QA 1J1IA 4GVXA 1FVOA 1V7PC 1C9KA 2ZYWX 1XPUA 1U0OC 4AUNA 3H3JA 5C34B 5I7RA 2FEWB 1L8OA 2D1QA 3QVOA 1C2TA 4QUBA 2XVMA 3TIIA 3Q2KA 1WXQA 4KB5A 3ZYCA 4GT1A 5CFZA 1PF7E 1WDMA 2A9FA 5D7BA 4L9RA 1U7OA 3I4FA 5ITSA 5EQTA 4OQQA 4R1PA 4REQA 4JLVA 4ZHQA 3NHKA 3AUSA 2XOXA 3MJVA 3BK2A 3C7KA 3CM0A 1DDGA 4A0QA 3DDUA 1BH2A 2O2JA 3T3NA 3AFHA 4C43A 4CDNA 4E7PA 2OWDA 4HP8A 5K6RA 3LT5A 4XPZA 3UBMA 3ZTYA 2XOKD 3LY7A 3PR1A 5K7SA 4DKJA 4IH1A 2JFPA 1JG3A 1T36A 2NSLA 3NAGA 2CLLB 3LPCA 1F12A 2XMBA 3PFWO 4HXYA 4HSEA 1NNLA 2QEQA 4B81A 3A9UA 1RJ9A 1GARA 2NUAA 1T1IA 1T25A 2VDWA 5EJ4A 4OFWA 2IBTA 2BI7A 1W4LA 4AX8A 1EX1A 2VTDA 1JJIA 2VYNA 1Z5ZA 2XUPA 4P7GA 4IFTA 1XNGA 3LZCA 1ZXBA 1QVVA 1R1DA 1NF8A 4MQ5A 4MV0A 1UFRA 2JKVA 3RIEA 1ANKA 3DBRB 5BN3A 1I94B 3OJOA 4B7ZA 3COZA 2PTHA 3NHRA 2B30A 4JJEA 4PIVA 5EP1A 3S2ZA 1VFPA 1AS0A 3CRZA 3O8OB 2DE0X 2WF9A 2ZSHA 3R0VA 3PP8A 3BFXA 2DSTA 1T2UA 2DPLA 1P8AA 1H6DA 1X77A 3CT6A 2D06A 4OQEA 1Z5UA 4OP1A 4YJ2B 4LVNA 1G21B 1CQPA 1CU1A 4Y1RA 2FY8A 3MGCA 5T57A 4ADSG 4LIPD 2JFZA 3I92A 3UCEA 3EGXA 3GCGA 3NLLA 4M0PA 3TE7A 2IYWA 3GROA 2PVSA 3D3KA 4MW4A 4UZEA 5HCUA 5A5DA 5IT4A 1RXVA 2WWGA 4LJSA 3CUWA 1UAAA 2COEA 3T1QA 1VGQA 1C4KA 3KUDA 5F7JA 3V4VB 3WK7A 2YFYA 1AUOA 3OE5A 3TM5A 3X1XA 3KHUA 4DCOA 5K6AA 3TI7A 1XDGA 1YFZA 1JUDA 2WVJA 3AVVA 2ORIA 3LT0A 3CVVA 1XFDA 2D3WA 2PZEA 3DTYA 4H3SA 4IJWA 4LYGA 1RI5A 3EHDA 3VR5H 1ZR2A 4RPLA 1JMVA 2D0OB 1IATA 1MIHA 3K5IA 4W1PA 4I8IA 1NMQA 3GGOA 3KUXA 3B5IA 4O3FA 4CKZA 2ZZMA 2Y1DA 3DDHA 3GOHA 4L9SA 5EHGA 5BSMA 1GN9A 5JJIA 2OCGA 1MC4A 2J3DA 2OESA 3Q1KA 1DE0A 2HIAA 3BXEA 2JI4A 4YP9A 3RK4A 3VPAA 2XOKA 3VYVA 1CUWA 2BMWA 1O54A 3PB3A 4OI2A 1WHSA 1R8YA 1X80A 3N07A 4PAMA 1UMBB 3TQSA 3ND8A 3COSA 3HH8A 5ESDA 1RU3A 2VYQA 3BCHA 4IVNA 5GZ1A 4G0XA 3RPEA 4Q6BA 1JDZA 1AKNA 1KI3A 5ALIA 2O4CA 4UAVA 3GFTA 4GXNA 3O90A 4MWTA 2E48A 2Q07A 3KKLA 4CI9A 4AY2A 1R0LA 1PFQA 1XPRA 3ELYA 3EAGA 1R64A 1NMEA 4PO1A 3SKYA 3UYKA 4XARA 4M0UA 3GEEA 1FUYB 2X8LA 4C89A 1MX9A 1J97A 3X1JA 3H8JA 3PPVA 3R5XA 2C7VA 3DAGA 3E03A 4KXMA 3G23A 3GDGA 3GGSA 3K0FA 4M0CA 4LYAA 4A16A 2QMHA 4CTKA 2OHIA 4E51A 3DMHA 4LZAA 2EZUA 4E6PA 1RFLA 1GDHA 1ZINA 1DKLA 4PE5B 4PLTA 4LRSB 1JR3E 3MRTA 5AW8A 3VPSA 4A2WA 1J9ZA 5JCZA 4K9DA 1HEIA 1L5ZA 4Q1CA 2JCSA 2O1EA 1GVNB 1I4EB 2NU9B 3SP1A 2RGYA 4B8YA 1E7MA 4DF3A 4E3WA 3R6WA 1OFHA 3CFYA 3HUEA 4X90A 2X41A 2AHOA 4E22A 4LOAA 2L0XA 3SSMA 1W0KA 4OU5A 1AV7A 4L4UA 2JKYA 3DOOA 3VBCA 4AJEA 5A5FA 1U8XX 4WBSA 1FFBA 1B16A 4ZQFA 3DXFA 2CDCA 1JIVA 2BMAA 2ODBA 1EQUA 1WZCA 2Q3LA 3AXSA 3DKVA 3K94A 3MRXA 2I67A 4NMWA 4X64B 4WD3A 1M6YA 4G41A 4MA4A 1SOAA 1YZYA 1J5XA 1UZMA 4B6PA 2VDOB 1ULUA 1PJLA 2Z9DA 3WA7A 1UF9A 2Q4TA 5TF4A 4CVNA 4WINA 4YCLA 2QGZA 3VU3A 4LZZA 4RKWA 4GU5A 2C4VA 2F1OA 5DLEA 1UOOA 5IMSA 2GMWA 3TLCA 3VO9A 1Z4MA 4AG6A 1ZMRA 2D1SA 1K6EA 3VU9A 4TWIA 5CDUA 4NABA 2EW8A 3HP1A 3RT7A 1T1GA 5J2UA 4X66B 3QIVA 2M1XA 3JD4A 4EPRA 4INZA 3K1TA 3HU2A 4FFBB 5H59A 4DKXA 2DTEA 3A7EA 3WNCA 5F5LA 1Z0UA 2VK2A 1U9JA 3RC1A 2B3TA 1WUTA 2FW1A 4RY9A 2BCEA 4Z9AA 4G5QA 2XCRB 4KIFA 3KYCB 1P9LA 1P1HA 3TLMA 5IFKA 1JDJA 2BUBA 2NOAA 3E7XA 1UAGA 3ENKA 4TUYA 3T5BA 3P45A 2ZRMA 3EG9A 3AEYA 3NWJA 4FUTA 3D4BA 5LDHA 3I30X 2W8BB 3TIVA 2G1KA 1F5NA 1LWOA 1AZTA 1FTSA 3N2YA 1DVRA 3G9UA 4HNSA 5DM4A 1Z08A 3Q11A 2IDZA 3VNBA 2W0SA 3OLWA 1QBKC 2HAEA 4ZKEA 4KGZA 1NX6A 4FQ8A 2X1LA 3ZV6A 3IDSA 2R11A 4I3GA 3ZQ6A 2J0UB 3C3JA 3TD6A 3CBGA 2IYAA 3DOEA 3LVRE 4PAOA 1NP3A 5JBIA 1GGVA 3IP9A 3AUAA 4ZDJA 2JD0A 1OH8A 3OZEA 3WR5A 2YJTD 3K9LA 2DUUA 4YUVA 1C7ZA 4NJEA 2HFJA 4LZNA 1QGED 3ITKA 2HWYA 4HYEA 1JEAA 3E58A 4TRMA 1JDSA 1GZVA 1ST2A 2JHPA 4R83A 3C6KA 1U5AA 2W2TA 1OHHA 4CHGA 1NG1A 3IHTA 3KUUA 4HMOA 3CNNA 1LY1A 3R7WA 1N1DA 3AINA 1PLJA 4M9ZA 1F8XA 2W22A 2VDQB 3DAYA 3LFHA 3BZUA 2NZYA 2YOHA 3QKSB 4OBXA 3V80A 4D42A 4OUDA 3F74A 2R7MA 4U5XA 4J4HA 4TOIA 1HQDA 3C5VA 5FBKA 4H0FA 5M3BA 1WXEA 1NN0A 2GHIA 3KOXA 4I1SA 4YJ3B 4GL2A 5CYGA 4YQZA 3RUAA 3ZVLA 3FBWA 4CKWB 3DJYA 3ITEA 4TKLA 1J0CA 2NUAB 3VR5D 4YCSA 2QRMA 3NONA 3O2QB 3PQFA 4E5SA 1ZNZA 2KW5A 1L7AA 3B6MA 3ADPA 2H08A 5GONA 3ZDYB 2HW8A 3OE1A 4MS4A 5HQ3B 3VYUB 1IDN1 4AY3A 2GHRA 2AJDA 2ONZA 1T5HX 2BZ1A 4K6FA 2PMEA 1N8TA 1Y80A 1JMYA 1YH3A 4KR0A 4M8IA 2H1HA 2O14A 4UBIA 3RJTA 5JRZA 4DUZB 3EOAI 3W6OA 4AJHA 5AVSA 2B94A 2QRUA 1W88B 1WNTA 2ACWA 2VNJA 1W2GA 3EZXA 3IAM1 4LHEA 1LPNA 3CVOA 1QB7A 1F0PA 3M83A 3S7TA 3OI7A 5JUWA 3GFBA 2G6TA 5HIMA 1TQHA 2WJWA 2HADA 3BGOS 4O8ZA 5DM60 4HAYA 1Z2PX 1H8ED 4OF4A 3L01A 4HQLA 3ZZ0A 1TZKA 3ZGXA 1CUFA 1G21A 1VCNA 2CMHA 3EG9B 1Z7EA 4W1RA 3KQUA 1JXAA 3A6ZA 2XV1A 1KYXA 5GMOA 4EYOA 1XTQA 4LK2A 4Y2TA 3LIIA 3I01M 3VHXB 3LUJA 2ZJ7A 3V7WA 1NQAO 2EF1A 4RQBA 2FHPA 1AZSC 1Q5PA 1Z39A 2ZBPA 3B2EA 4DBLC 3OH8A 4QDUA 4U2EA 1M1ZA 1VHLA 4R1SA 3UK6A 4YEDA 1XZDA 2CGEA 3K35A 1C9YA 4EFKA 1AF7A 3EUWA 1YV9A 5KTOA 3DV0A 3KALA 3LHSA 4DLNA 4YMTA 1L5WA 2QP4A 1ESZA 1WXGA 4F9TA 4BOYA 4AYXA 4NFSA 1YZKA 1DBVO 1JFVA 3DUWA 3FYUB 1QK4A 3LI2A 2HMWA 3R74A 1CJKC 2QZ9A 5C8DA 2M6SA 4COKA 3TQIA 4X6XA 4ERNA 1TYDE 3U39A 2BFDB 4J0HA 2WJ4A 5E3HA 4IJKA 1X9IA 1IEXA 2BEVB 3K0BA 4G67A 1E58A 1J1ZA 2D13A 2X0JA 4MRMB 4Y67A 5KS2A 4MYTA 3IBYA 2W9XA 2D0DA 1DAEA 3SFZA 3ZWNA 2BC9A 2REXB 2O20A 3I6QA 4FNGA 1Y7LA 3D3JA 4NBWA 1KP3A 2BFFA 3DE3X 3OETA 1DOAA 2OQ2A 4MARA 2UU9B 7YASA 1Z29A 3PSAA 1RC0A 4WL0A 5AI4A 2G4CA 3W1VA 1P0QA 2ZIFA 3GNLA 2CHFA 3ELUA 4M0LA 1DLIA 1BS9A 3AQIA 4J7AA 4LDZA 1F2TB 4TZTA 3RYIA 3TOXA 3QX3A 2ZRQA 3KX2A 1SKAA 2PX3A 1UC8A 2I2DA 5EJFA 4ECEA 1GFIA 1AA6A 4P2GA 4JC5A 3WWPA 1TW2A 3CHYA 4QRHA 4BVJA 1VYVA 3D0OA 4PW0A 1T4DA 2J09A 1YJXA 3ABSB 5DYGA 2CT8A 5ADUS 1QIIA 1CB7A 1F3OA 3FA2A 1W88A 4EW3A 1ISIA 1BXGB 1FE8A 2B1GA 1NJSA 3QE3A 1CUEA 2IIPA 2VG8A 1W85A 3M0EA 5KVVA 3G0BA 4BFYA 2AJBA 3UMMA 4WBNB 2XVZA 3DD5A 2I9KA 2FPLA 1MB3A 4HDSB 3BCUA 2PX8A 1DRJA 1KSJA 4UD2A 5E7JA 1NOIA 4MQUA 2ZIEA 1GWNA 4IEFB 1PQ4A 2ID7A 3QKIA 4ZEVA 5B3JA 4RHEA 1Z38A 5EMJA 3JPWA 3A9WA 1Y48E 5IVPA 5DISB 3WL7A 4ZMSA 1B7GO 4X54A 2LUOA 3HK2A 1GVHA 3ZWOA 4BRUA 3STYA 5ALYA 1K5DA 2FUKA 2ZJ8A 4QPNA 4LV6A 3WSTA 4EYKA 5A4DA 4KXUA 5CVVA 1KDVA 1T0PA 2JJMA 1CR0A 5TT1A 4B32A 2CNBA 1N57A 4Q93A 1ZYUA 1E20A 4FFRA 3KFXA 3NALA 4ZVVA 1XDSA 1YULA 3U4HA 1ZVVA 4MUKA 1QIEA 2EJTA 1KJWA 1HI9A 1GNLA 2J46A 1QKIA 2WIAA 3OZAA 3Q0IA 3L7CA 1DC4A 3CEMA 4HBGA 5KWIA 1U0RA 1GNPA 1XAJA 3ROKA 2ZYHA 3P9ZA 2WIDA 1LS1A 1WCV1 2VDPB 4JC0A 3TPZA 4URHA 3H1EA 1N6LA 2ZKIA 1VL2A 1KL7A 2WTAA 2QRPA 1QTQA 5I8WA 1NJGA 2PBRA 3NT4A 4P4TA 4EO4A 3VTZA 3K8ZA 1Z8FA 4X93A 2CHEA 5ARBA 2M2IA 2QTRA 1MG5A 2WKRA 4D9HA 2LBPA 1O5OA 5HVNA 1P62B 5FO1A 3G7UA 4I50F 3D5TA 4JL6A 4IUYA 4OJQA 4WXHA 3EZLA 3GCWA 3OCYA 3SC3A 3BH0A 1Y4SA 3CNOA 3GMSA 2GK3A 3LTNC 2ACEA 3PVSA 1S2NA 2E5LB 1CUGA 3D3WA 5KNBA 3PTZA 4LAFA 3NVKI 4EG1A 3RRNA 3D1VA 1EE9A 1P1BA 2NMVA 4CEHA 3P2JA 5JNUA 3U4DA 3EGWA 2AFIB 2MIIA 3OO0A 3L77A 5FOSA 1FIUA 4BZQA 2W0MA 5IBRA 5IP5A 2IPLA 3HV2A 2EKZA 5A6SA 5BWOA 4QVKA 3GLHB 2VAMA 2ZUSA 1B43A 2QL9A 2IT1A 3DL7A 3IOYA 3QXSA 4ZU1X 3UAGA 2RGEA 5T4EA 3FF1A 1J49A 1SVOA 4BO5A 3NVDA 2C5GA 1EXWA 1CV2A 4B4WA 2AI2A 1JSRA 1OFVA 1REQB 3A06A 4JQSA 5I9BA 3OKAA 1QP0A 1NXPA 3IAS1 4I1RA 1KQNA 2C42A 4IDFA 5I7HA 2IHKA 3KELA 2IV2X 1SUBA 5DTMA 2DULA 4G26A 1IM8A 2AE2A 1QXSA 3I28A 4K28A 3SQOA 4HLUA 4Y0AA 3QU9A 3VSBA 5FWAA 2YWJA 3E05A 4BIIA 3VAYA 3B5JA 2O0MA 1ADBA 3LDUA 2G4VA 3W9YA 3D8RA 2JAUA 3ROZA 1KYVA 2Q2VA 2HMVA 1SG9A 3ABRB 3EC2A 4KQJA 2GXAA 3R7AA 2QJTA 4L57A 1SFRA 2EG9A 2WMDA 2YXNA 3QJYA 2PMFA 1NR7A 3OMWA 3SZOA 3EEFA 4U63A 3BIOA 2M32A 3O1HB 2JHAA 4EB0A 4LBVA 1BXRA 3DDNA 5KOHB 4NU6A 2PRZA 2BTQB 2YZGA 2YICA 3S70A 2QV0A 3KWLA 1YZVA 4DANA 1L5SA 1ZESA 3SX4A 3EFOA 4EUHA 5ECYA 3UHFA 2EL7A 1KDTA 5CB4A 2XRYA 2FH5B 3AEQA 4Y9RA 5ALUA 3SGLA 1ZM9A 2X42A 5JIBA 2I9PA 3FNEA 2ZM6B 4M9SA 1Z2EA 2VBIA 1NLFA 3OIDA 4LHSA 4B9EA 2II6A 4U9UA 4YAKA 1R4AA 1K2WA 3HMQA 3HYCA 5D85A 4ZT3A 1ABEA 5JWHA 6GPBA 1WMFA 5EZ6B 4C88A 3FVQA 4YRNA 1EAMA 3G5AA 4I3FA 1X7XA 3OIUA 2VXBA 3L8MA 1K6JA 2PU5A 4MKHA 2XMPA 3OECA 4GMGA 2YWEA 1N2HA 5HSGA 4L3WA 3TG8A 3H2IA 2BOVA 2JDID 2YFHA 4UJ5A 4B3IA 4P22A 3ZJVA 2H9IA 5JQGA 2K6GA 1WCXA 4P84A 5AI0A 2B1QA 2VNAA 2AGVA 5U1PA 4GP7A 5JVDF 3K15A 3VJKA 3LJKA 4U7JA 4G1BA 1G16A 1II8A 1UKCA 1XGKA 2IHNA 2JAPA 2XB4A 5COBA 4EI9A 3R0ZA 1CSEE 4AMZA 4FW8A 3DL2A 3IHLA 3VJLA 3ZE6A 4YP7A 4PZCA 3EY9A 5EJMA 2BFWA 1RWOA 3ZCSA 1UC9A 3AUKA 3UN1A 4RY2A 4E5VA 4WVFA 3H9CA 2LZ0A 4WFIA 5L6LB 5AYVA 1DJOA 2R79A 4BMYA 4LN1A 2NZ8A 2RSLA 4BNTA 1QQ7A 2HJHA 3LOQA 4MYUA 4PXAA 2HHLA 1E2QA 4BBPA 3RSZA 1M0WA 3HV0A 2EJUA 1YTUA 4BPRA 3OZWA 1UL1X 3ZDBA 1E2MA 5CEFA 1QH9A 3ROQA 2EW1A 1VYTA 2C0QA 5K4HA 4FYPA 5F12A 2DX7A 3CKMA 3HGQA 3B60A 3A3OA 3DTVB 3N74A 1G2IA 3R9KA 3P2OA 4PX3A 2UZAA 1U1FA 1EDDA 4L5CA 4CZ2A 2O8FA 1WB6A 2FFHA 1G7CA 2DETA 1UMCA 2FX5A 4HDAA 4ETNA 4B4VA 4QVIA 2YN2A 4DMLA 1N9GA 2WTXA 3INYA 4NV0A 1P4RA 1WB4A 3A27A 1QDUA 1UMDB 4ND6A 1IM5A 1V6AA 4AKSA 1NU6A 2EKLA 1RI2A 3GJTA 3PZRA 4TV9A 3HJFA 3ZY4A 4Z2AA 5JCXA 2FA9A 4GUDA 2H29A 4HOYA 2WMOB 4R9VA 1JJBA 5ARCA 1A9OA 2C95A 2AW5A 1I7LA 4RM3A 3ZIUA 4B3SB 4JSRA 1K9SA 1RRGA 1GYQA 1EGQA 2OP1A 4QECA 4EQ6B 5L45A 4AY6A 1PUJA 2AB0A 1TXGA 5KB3A 4XEUA 2IKSA 2VKQA 1ES9A 2P40A 3JWPA 3KSRA 1THZA 1DI0A 4XUDA 1U7TA 4YJ2A 3HVUA 1YRLA 2MR5A 3JATB 3O75A 1X15A 1EINA 4IJMA 4QAJA 4RVUA 2Z56A 5FI0B 2JLYA 2W6OA 2EDAA 2HBQA 1PT5A 3CXUA 4FW9A 3TUZC 3UQZA 1X1EA 2CBZA 2X9LA 3NWPA 4D98A 1UCFA 2FQWA 1I24A 1UK7A 2JIBA 1H94A 2XD9A 1BCRA 2ZJ1A 1T9HA 4GRIA 4XX0A 1XF1A 3A58B 5FXMA 4F04A 5LOVF 4Z4HA 1RYDA 2R8BA 5GVRA 3SR4A 5LYYA 2XWJI 4QPDA 1Z7BA 1LSSA 3GH1A 3L4SO 4G56A 1PEYA 2Z98A 3MWDA 1JI0A 2GF2A 2KLBA 1FYWA 4H7KA 2FMTA 1FDOA 4ZO8A 4MGIR 4X9XA 5FPHA 2JGLA 4B3HA 3HVHA 4MUAA 4NJEB 4XYMA 1H3EA 1GQQA 1Y5RA 2NVBA 4CLRB 4DLLA 1AS2A 4JN6B 1WQ3A 2RHBA 3OJEA 4CFSA 1XV5A 1Z62A 1FDSA 2IEZA 1KI6A 3DWFA 2P65A 2FSIA 3VSDA 4NAHA 2CD7A 5AW7A 2GM5A 5LKAA 1QIFA 1A2KC 1SR8A 4LY6A 1SXJE 2CFTA 2V6IA 2W2XA 3GFRA 4NP6A 4UU1A 3ST7A 4UTRA 3IE0A 3G2MA 2GS9A 2G83A 5HRCA 2QVCA 1QFXA 4DZTA 1PT6A 3AYZB 4Y6QA 3FIUA 2IXEA 4WZAA 5JRJA 5MN4A 1KH1A 4O25A 1OPXA 1ZCFA 1I36A 2CB9A 3R7DA 4JYAB 3R5TA 2BLLA 3ZHUA 2EZ9A 2JJ2D 3WGKA 4YR7A 2WICA 1SUPA 3L49A 5C4GB 1JDPA 4RZIA 1EJ6A 2G17A 1S6YA 5YASA 1OBFO 1ZH6A 2QX7A 1UWLA 2PX2A 5AVKA 3FRHA 5G40A 4A1FA 3ZDQA 5EUMA 2HR1A 3SS7X 3UTCA 1TU0A 4UNRA 5BQXA 3O4GA 2VATA 4F7DA 3VTAA 4IXWA 2QI9F 3FKSD 4UUOA 2JD1A 4LVUA 4EMSA 5A71A 5DTQA 3CLTC 2PMDA 4WNAA 3IELA 1O8BA 1V9SA 1Z33A 1A5SB 4RPKA 5MN5A 2XZLA 4TMWA 5CT9A 3TLYA 1O03A 4PGMA 1ZSYA 4LCBA 1XBTA 2JGEA 4AZ3B 2NVOA 1U8FO 3BE5A 1I7SB 4YDHB 2QTWB 4QODA 4MUGA 1ZX1A 1RDFA 3QKWA 4XSGA 2IWHA 4CDRA 2Q0HA 4HYTA 3LCVB 1I33A 1ZGGA 2R00A 2FOIA 1QFZA 1XZLA 4MGKR 1RPAA 2D8AA 1HE5A 1E6KA 3TIXB 2AMLA 3HVIA 4KN5A 4EHJA 1GTRA 2VNHA 2DAPA 2P9BA 3LCMA 1EVJA 1M2HA 1OGJA 2VSXA 3FHCB 4MKZA 4NEHB 2IYYA 5KPJA 3TUJC 1G291 2D5AA 4L8GA 2PJZA 1CDOA 1YJ8A 3AKYA 2AFHA 4MUJA 1PWZA 1N25A 2DPXA 1TCCA 1B6SA 5L3VA 1WXFA 4ZZ3A 4LZWA 4EJ6A 3G9TA 2PQ0A 1SG6A 2MMCA 4DDMA 1W1IA 2CUZA 2QQEA 3NNSA 3LFUA 3UUEA 3IOEA 4CG2A 2NQ2C 1DIGA 3EG5A 1XLTA 1T8WA 3GL9A 3RYIB 3I1JA 1JFRA 2ZJ4A 4HL6A 4XJTA 3WMFA 1GZUA 1X7WB 3W8RA 3N3AC 2NQ8A 2X86A 4WA8A 5EA2A 4GI3A 1EFCA 2Q21A 1I5RA 1UC4B 4UVGA 1XMXA 4NV3A 4E5NA 4OGGA 1CUJA 2CDNA 3D02A 5FJJA 2ZROA 4EZIA 2FVYA 3GJYA 5FAXA 2F9LA 1KI7A 4PM4A 3Q7PA 5FT9A 3M6MD 4WNCA 4ZRNA 1S0UA 2C2HA 2P2GA 4F2DA 1RI4A 1EBUA 4R9RA 2G1UA 2VHJA 1UXKA 1PJAA 2JI8A 3IESA 4AUKA 4DCCA 4Q02A 4ZDWA 1GOTA 3AHHA 5BV0A 1VKZA 4YMUA 2UUAB 3R76A 3WLNA 5GIPE 3P2IA 3DVSX 3MPOA 4OMUA 1I7QB 4QBIA 2G09A 2WUDA 3O4JA 3VMMA 4BP3A 1GLVA 4JKOA 1CXZA 2CXOA 4O5OA 2MINB 2GCPA 5HUQA 3VKWA 3PFCA 4E94A 2FZLA 2BGWA 4WK6A 3OLXA 4UTNA 2VJQA 4EYEA 1W25A 3VSAA 4F2GA 5DBOA 2JLUA 5I48A 1VDZA 3ESAA 3HU3A 4C7MA 3TZBA 4F72A 1NOJA 5CB6A 2QXYA 4ZVKA 2I6TA 1WS6A 1EDBA 4ANFA 3C3AA 2ZSJA 1GSHA 4GYKA 5C4IA 1CWUA 4BX0A 2DSNA 2VUUA 5L40A 2OCKA 2HU2A 4ZJPA 3KQSA 5DNDA 2YV3A 5ESRA 4W6QA 4FYHA 1Q1EA 2H8KA 2R87A 4EG4A 2DR0A 2DGDA 2QPLA 2G82A 2VP9A 3DUFB 3G9ZA 3RU3A 5BVHB 5CA0B 4JUIA 4OFBA 3SJBA 1L7BA 5IT5A 2H9YA 4QUHA 2P2NA 3NO4A 4LOJA 1T5DX 2D1TA 1XJWA 3UV6A 4ND4A 4Q1DA 5H02A 1JJ7A 1KDOA 4O2AA 2G8NA 3BB3A 4EX7A 2PDAA 3HJBA 1N6PA 4Y2UA 1KRWA 4BNIA 4KQ2A 1VE6A 1ZZEA 3AFIA 3UB2A 4ALMA 2XZDA 3DTVA 3H16A 1JR2A 3W9UA 1N9ZA 1NXTA 1PKXA 5D86A 1EZZA 3U7HB 3OE7A 4C4YA 2FEAA 4PGAA 3LO8A 3T7CA 4M98A 5BWMA 2VN8A 2BJVA 4X85A 5SYMA 3ZK7A 4JI2B 4W9NC 4BRZA 1C1YA 3G82C 5EYPB 2PUGA 2HJ9A 4I55A 4MQBA 1USGA 1W9HA 4C06A 3CH4B 2QTVB 4PVDA 3KPUA 4TKVA 4WXYB 2XOEA 1ZICA 1JKXA 3MXOA 3MTQA 4BNHA 3GJRA 4HATA 4KBGA 4RJJA 1TECE 2PUDA 1YGPA 1O9HA 3VKVA 3A3KA 3C5EA 4FBMA 4L0CA 1Z0SA 4EJSC 4F4UA 4MYHA 1WBDA 2YQZA 1DDIA 1BX0A 1LBSA 2O2XA 4C0WA 1XYGA 1XCPA 3TSWA 2WWRA 3WQRA 3V1KA 4IHJB 1PR4A 2RKWA 4CUZA 2O52A 5ALRA 3TAUA 3ZJUA 2Q5OA 3JTMA 1L4NA 2IRWA 3ODGA 4MCAA 1DKQA 5LZ9A 1NJ5A 4W8GA 1T24A 2ZR8A 2YHSA 4KLNA 2AFRA 1Z6AA 4U9IS 1MVNA 2FZ5A 5JEDA 3IUMA 4QPZA 1E1CB 2FX3A 2B5WA 2WUEA 2O3SA 2Z83A 2ZTLA 4HAOA 3UF0A 2Q1SA 1NBHA 2GA9A 2IOFA 1KS2A 3KEFA 5LP6C 3RVLA 4PG8A 1E3WA 2IUYA 3T7TA 1Z0IA 4EGFA 1YT5A 4DS3A 3KQKA 3GX1A 1BWSA 4KU4A 4MKGA 1DAHA 3KHTA 3OURA 1UXIA 1PZXA 3GT7A 5T4FA 1WHTA 3BMOA 2AJTA 3FZEA 4GBJA 4TL6A 1VJGA 2JA1A 3BL8A 3K9BA 3OX2A 5LQUA 1CZLA 1DQNA 4YJGA 3PQ7A 1RQRA 1TGVA 1RWKA 2HA4A 1XNHA 3MQFA 4FC7A 3TOSA 4X8MA 1ZOSA 3FHTA 1Z2NX 4JBGA 4DR6B 3PD1A 3DLIA 2ATIA 3CWZA 3H04A 4ZAWA 1B8VA 3P0RA 1GRNA 1W48A 3TBHA 1Z35A 3MZ0A 2Y1KA 1V1MA 3D9QX 3O94A 2ZCUA 2CCJA 5FJIA 1EM8B 1CULC 1J2JA 3HU1A 3K5WA 3QVSA 5B1EA 3C4JA 4MVJA 1GY8A 1CUSA 4OBBA 4I4NA 3MIIA 1EFRA 1H1TA 1POWA 1F6BA 3GRUA 2N75A 4KFUA 3HA7A 4D74A 2OCBA 1YQWA 4EJ2A 2EU8A 5BMOA 3QMMA 3QQPA 3ZBQA 4FT2A 1WRBA 3LZ6A 4R2HA 5H4HA 5JQWA 5DHRA 3STXA 1REQA 3VR3D 3GQBA 3S1AB 4BV8A 2WF6A 1ESDA 2YRFA 4YT8A 1SEVA 3DBVO 4CL8A 3JD3A 1V45E 3OF2A 1AF4A 1Q0LA 2A5GA 1BGVA 2JD2A 3UUFA 4EG0A 4O3MA 5DM70 3V7FA 5J40A 1C7EA 5F5NA 3B6IA 1OAAA 2G0TA 1YDFA 4HWTA 4AXXA 5EJGA 1SZDA 1ZJ5A 2I7DA 1NBMD 4DRXA 2RHHA 3I37X 5T4BA 3IT3A 1U81A 4GSLA 3YASA 3EIXA 3BILA 3G02A 4JI1B 3HI4A 4F3YA 1SB8A 1TUEA 2PLWA 4RZSA 2R6AA 1KDPA 2NU9A 4C7KA 5KVQA 3VMFA 1LDGA 1X3SA 2E4VA 3B82A 4MUNA 5EJIA 4UAGA 4BNYA 5AFSA 1A88A 2ZRGA 4TXJA 3H8VA 2KE5A 3R6LA 1EX9A 1X86B 4C4OA 2XD4A 3FWHA 2VQDA 3IAEA 2YJ3A 4UTOA 3WICA 4L4ZA 2RG7A 3HP7A 4JQCA 4LX8A 4QEZA 2BM1A 1MHTA 3N9IA 5JAMA 3QNWA 4Q1EA 4AJJA 1FUEA 1KHHA 4CCAA 2G25A 3T4EA 3KQYA 3HKDB 2NPFA 4H3VA 1XTZA 4UUMA 4KMOA 2OQVA 5JADA 4G81A 3RJ9A 3OMXA 4HTFA 4O1MA 2IBMA 4GKJB 3AUFA 4MOWA 4B40A 1ULZA 4DIEA 2KQUA 5SYNA 2BKUA 3WQQA 2MSKA 1TJNA 3PWSA 4DABA 1Q22A 1SHUX 3C7CB 5AKEA 4RCZA 4DT1A 1U7ZA 1GTSA 1F7UA 4PLWA 3HHPA 1DQRA 1P2TA 1EKXA 3RIMA 2ZEJA 3DXZA 4PYKA 2IZZA 4ESHA 4MI9A 3RJZA 1KZ7B 1NA5A 3T0GA 3FNQA 4LJ8A 1TCBA 2OAQ1 3SE0A 3WLKX 5L3QA 1J6UA 4DXAA 1D2EA 1E9BA 2GCNA 3K0AB 4ZVNA 2AXPA 4LS3A 4MQ6A 2X0KA 3LFTA 4PFJA 4QJ4A 4Z9BA 4JQOA 1CYDA 2I4OA 4NCNA 5AI5A 3SYNA 3WLRA 4U2FA 4TMKA 4Z5XA 5LWHA 1LNSA 2G70A 3MTGA 2VS1A 3JZAA 2GAIA 3BG5A 5JH7F 4ZYWA 1D6MA 1VHDA 4QBFA 1JQ5A 4X92A 3C8MA 4M86A 3I5YA 1LPPA 2C9ZA 3WWCA 4B80A 1PK7A 1NE7A 4NBRA 4UM9B 1HORA 1LS6A 3GPLA 4HTFB 4H4DA 2DOKA 2M9MA 4ZCIA 3OKPA 1A5BB 2R8XA 4HDSA 4HGPA 4MI3A 3SR3A 4E3ZA 2FFAA 1IUOA 3F6PA 3W8EA 4S35A 2EJBA 4N5MA 4JL5A 4AS3A 1BZYA 1LC3A 1C7IA 3A1SA 2MSDB 2NAFA 2O8CB 3QOXA 2J7PA 4YAGA 3GRZA 5AK0A 3G7SA 4UAJA 4N0DA 5B7PA 3GRAA 3ISVA 1PR9A 1K86A 4GOLD 5JDCA 1PNRA 5KNCD 3B1XA 3FXAA 1L9XA 2WFMA 3N2LA 2FG7C 2QTTA 4UHBA 4F6RB 1E2NA 4HD8A 4KKXB 2D2XA 2H7XA 1DMRA 3OD1A 1MW8X 3HR8A 3DVLA 3CRW1 2HRZA 3RIXA 3TNJA 3WQBA 2HWUA 1DO2A 4Y7CA 1V43A 4QTUB 2W90A 1Y9ZA 3CZQA 2M6RA 3CLTD 3EGIA 3MRVA 3H1FA 3BD6A 3CSDA 4N76A 1C50A 3HJCA 5ENVA 4AP6A 2AK2A 4IX9A 4OL9A 2FPGB 4HDKB 2XGSA 3F8TA 4DNQA 2JGIA 5C3MA 4I81A 3SQDA 3FR7A 4B3MB 3C7DB 2BN4A 3CR7A 1X2EA 3EZYA 4R54A 5DEOA 4ARBA 2BYTA 3TW8A 3HRIA 1EUYA 2OY0A 3X1WA 1CJSA 1E94E 2E1RA 3I9LA 5KOIA 1VXRA 5CFOA 5EUCA 2PH1A 1XVUA 2BRUA 2HMTA 2PKXA 4NTZA 2G04A 4RACA 2Z6QA 1E7SA 5LMCA 4B4DA 2H65A 1MZVA 2H7CA 4BV3A 2O3UA 3N2ZB 5EKTA 2C7OA 1PZMA 1GUDA 2QTMA 5EIEA 4FIDA 1CUVA 2QRZA 5LMNB 4Z4QA 3F96A 2PA0A 3CZPA 5BW5A 4L0MA 4TQUS 1ENOA 4CV2A 4JDUA 1TQ2A 4JSTA 3FPCA 4M76B 1FJ2A 2BP7A 3ZHYA 3ZNOA 1ZN9A 5CM9C 5LZ4A 3STTA 1V4VA 5DYYA 3QJ5A 2JAQA 1RT9A 4JBXA 3X3HA 4DCUA 2DM6A 1W5EA 1SG0A 2QS9A 1PR1A 1UJ2A 2UZ3A 3HKBA 2IHZA 1YXMA 1GT6A 3Q5EA 4KI7A 3KETA 4C01A 4F3KA 4L1KA 2CJWB 2J45A 3KXIA 2QMEA 4R3NA 5CNIA 1TTQB 5IH3A 4FYWA 3T5AA 3FTEA 1C0PA 3LQKA 3F4BA 4BKOA 4CV3A 6YASA 1T4CB 4TRJA 5BVGA 4EKYA 4WBXC 1G3MA 3GVIA 4JEIA 4I4CA 3W9BA 1L4EA 1D0VA 1UXHA 3BXXA 1T0HB 1XEXB 2UDPA 2HPVA 2P1ZA 1CC1S 4Q7EA 1RLMA 1I4TD 3GMIA 4TWZA 4GLFA 4HYYA 3BHIA 3U4QB 4CLXA 4QIHA 5HKKD 1G20B 1VE1A 2E1PA 2EBUA 2JZCA 4FI3F 3R7BA 4E1AA 5A5GA 1T9ZA 2OSVA 1FCJA 2C29D 2Q8PA 4YIHA 3CX3A 1LSJA 4HS4A 5DM1A 1X1DA 1G9TA 1ODIA 4LWOA 1G5QA 3W5HA 2RHLA 4XB6B 3COWA 1W4CA 4QEKA 5JNRA 3U1TA 2PM8A 1ZC3A 4CKYA 4DUGA 3ER9A 3T5DA 2OO7A 1LKZA 3UH1A 4ZFNA 4W9MC 3FPHA 2BY4A 2QN6A 3C6YA 3OJCA 1SCIA 3AIOA 3FF4A 3MSCA 3KQMA 1UPXA 4HZGA 5IYZF 4HEJA 3R5HA 1T43A 3ZOZA 4UPEA 1NASA 4B33A 4TLEA 2CKMA 3QU2A 3ZBPA 4KPEC 1BEZA 2H5IA 4YREA 5TJHA 4C7OA 1PLLA 1VTKA 3OJLA 1Q1AA 3T3OA 5CP8A 4G1EB 4BFWA 1NN5A 1P74A 1E7YA 5DT2A 2OHVA 1XA4A 2V4UA 3PGKA 2R8OA 4NFLA 1W4AA 1OBOA 3ZEAA 3B3AA 4Q15A 3FVRA 5AW4A 2VUIB 4HGZA 3VR3A 3M9WA 5PGMA 2PZKA 2HI0A 1ZM3A 3D7KA 1DUVG 4C0BA 1H8EA 4L2IB 3IEPA 3LUDA 1COWA 5EMMA 1A4UA 1VLMA 1G6HA 2QUJA 4PINA 2FEOA 3CNHA 3ZGVA 4BS9A 2VEOA 2X6RA 3IXLA 1A04A 3SZGA 3IB3A 1K08A 1LRKA 4K40A 3FHOA 2G1JA 4W8OA 4XX1A 1KPGA 1VKHA 5AVOA 3W5AA 1RE1A 3HS3A 2B8NA 3NVAA 4YJKA 4GSYA 1OX4A 1FOEB 4J1TA 5DLQC 2A9VA 2ZJFA 1QLJA 1SVMA 2QLFA 3Q3HA 1KP9A 5DCLA 4LXUA 4LYDA 3T52A 3N0VA 1N8KA 2A5DA 1TT5A 2GUWA 2I8LA 2JASA 2WU1A 4A0GA 4TSRA 1M5TA 2BFBA 1E9DA 1AGYA 1UFOA 2OYSA 4NPHA 1V1RB 4K6MA 3ON5A 2AKAB 3PT5A 4R16A 4EI2A 3QENA 4BB9A 4FD2A 4N3CA 1IU9A 3PYLA 4MKIA 5FL7D 2C3PA 2WY2D 1Q1BA 3OZ7A 3BXZA 3GT4A 2DKOA 2MSLA 4FCVA 3B1YA 4RLHA 2CYBA 5A1TA 1PR2A 1UBSB 2ZITA 3TMAA 3A6HA 1LLFA 3JQ7A 4IH9A 4Y18A 2I62A 1QV7A 3QFSA 3W5UA 5EWLB 1XAHA 2WA2A 4JXKA 5DNYB 2XQIA 1UJBA 2G9ZA 3K6KA 5EL0A 4AX4A 4KITB 3PUYA 3R9WA 3THYA 1BNCA 2PSHA 3VDXA 3ZW9A 4YV1A 1FSSA 1LU9A 4WECA 3RGGA 4XA8A 3TTYA 1V7ZA 3GDWA 4O2AF 1U2DA 1IN5A 4Q3KA 5EHZA 3MJEA 3O6VA 8ABPA 4AG3A 2D0IA 2C03A 1V39A 1DZ3A 3LX8A 4Q7KA 3JQ8B 3ZWQA 2WILA 4KQ1A 4RXUA 2BJHA 4R7GA 5C31A 5CT6A 1GZ5A 2IPOA 2ISSD 2CZGA 5TT0A 1XMPA 3HI6A 4A8TA 3JVDA 2UXDB 1MG0A 2L18A 2I1LA 4IV5A 3IKLA 4GE3A 2BMJA 2VHZA 3IKJA 2MWMA 4JJKA 1M34B 4RKFA 2Z04A 4FXOA 3S5JA 2PYZA 3EODA 3FNBA 1X7GA 2B7CA 1NPDA 1Y8RB 5M5BA 1DBPA 1VBFA 4TLCA 3LDAA 5B7QA 1B0UA 3V55A 3GRKA 2E49A 5KTMA 3O1IC 2HA6A 4PRZA 2V9ZA 1V3VA 2BGKA 4QULA 3WJAA 2Z6VA 1KMNA 4RMNA 1Q50A 3SI7A 3ZQJA 5JNWA 1Y34E 2YW2A 2HA2A 4PZYA 4QYXA 1P2SA 4YAWA 1V11A 2PBZA 4L07A 1FSZA 4A0FA 5CVUA 3IJRA 3EZ9A 4E70A 5JS7A 2WWIA 1L8LA 4MQFA 4JBHA 3VR4H 4IPTA 3GHHA 3QGMA 1MP0A 1TU3A 1SPXA 3A1VA 4QDTA 4DRZA 3WGQA 4EB8A 3I2IA 2FN9A 4IDDA 4RS4A 4CF5A 5JLJA 5KJ1A 2VPTA 4N41A 5EWJB 3CUSA 3R5JA 4J4BA 3GVCA 3DBOB 3MB5A 3PNVA 3P2MA 3STVA 1MXFA 4YNBA 4AZSA 1QR2A 3VJRA 4NULA 4M1WA 3F6RA 1FVFA 1DCFA 1GR1A 5T8KA 2I78A 1X8LA 1PRYA 3K1ZA 3UFXA 2XZTA 5A6VA 1BO6A 5IEBA 2IP4A 4WFQA 1OH5A 1I30A 1NVFA 1J2TA 2OZPA 4NFHA 1WHSB 1X80B 2QE7D 3I9V1 5IDWA 3O3NB 4UPDA 5LP6B 4I7EA 1ZH2A 2PSJA 5CFLA 2UUBB 1WCIA 3EXEA 1E1CA 2ZSUA 5GY7A 3RJMA 4BMCA 4ZYUA 4LXIA 3B53X 1M0SA 4PHFA 2DBVO 1IUKA 1GU7A 1GR0A 2FR0A 4IHJF 1ONOA 1CF9A 2VBCA 1UOQA 4AQ7A 2F43B 4WOBA 1T6ZA 4WXEA 2WIKA 4KIWA 4CF4A 2X3YA 3NT5A 3ZLTA 3SM3A 2C2WA 1KZGB 5LWQA 3L0BA 3NETA 3OBBA 1YZTA 2VQ6A 1KGDA 1DC6A 1E0DA 2GJ8A 4QL3A 3GD5A 4Z7OB 1OQAA 4RTLA 4B34A 3H9EO 4ZODA 1KFEB 4H1UA 5CNMA 3ZBTA 1TO2E 4OHPA 2Q5EA 4HNQA 4ZJZA 4ZZ1A 3TK1A 2C78A 2J0SA 2OCIA 3AJ9A 4GMKA 4RPGA 1IZZA 4G5RA 1TEXA 3TJMA 3QVGB 4TWJA 2C8JA 2PR2A 1OXBB 3GUCA 4HLNA 2CUKA 3PX3A 1OI2A 9ABPA 1RYBA 4FEEA 4IILA 3K9QO 4FFMA 1IOLA 1LDNA 3F78A 5BURA 2AOVA 4NOKA 2GLXA 1ZJ6A 1KI1A 5K3BA 3TKYA 4OJKA 5M2QA 1U9CA 1T29A 2EX1A 2GESA 3F47A 1NBEA 1RACA 3M9XA 3PITA 4EG5A 1C41A 2QQFA 1ZJWA 3LUCA 1VGRA 1IHUA 3AKEA 3P0EA 1IHOA 5CIQA 4C5CA 3RK1A 4CG1A 1KP2A 2SNIE 4GPEA 4HPJB 5MFPA 1ZW6A 4K5QA 2PJDA 1EVQA 4LISA 4MVWA 2VYVD 1H2EA 1HNNA 2X0EA 5KIAA 4KO2S 2OPHA 2GXQA 4QHSA 5AJUA 4H7DA 1D2HA 3FNGA 3MWGA 3HQ4O 4ZAXA 5K3CA 4GP6A 1L3CA 1SPBS 4K9NA 3ED5A 4WZBB 3L6RA 3EDQA 1M2GA 3V1UA 4LJ6A 5DRYA 3CUKA 3D8UA 3Q6MA 4S1PA 2P27A 1QUEA 2GBPA 3JALA 2AZTA 1EDZA 5BQPA 3UXHA 3OAAA 2HO4A 1QVRA 2J7KA 4C5AA 1RJ9B 4K87A 4W7HA 5HFAA 2D2IA 5K8CA 3MBIA 2J41A 4G0QA 3TI9A 3CURA 3ZWPA 4BN5A 2JFHA 3IYLW 4GP9A 5DBEX 1QNLA 2IYFA 3QEMA 3QF4B 1GGKA 1L1FA 3KEGA 2HQBA 3BRSA 2IHTA 2NUPA 4EDHA 3S8MA 1XZ8A 3O74A 3D0KA 5LLTA 2XA2A 2W4IA 4UHHA 1MTZA 4LFAB 2F3QA 2HK6A 4RAQA 4DCVA 2JGDA 5DXFA 1OI7A 1V5GA 1Y8AA 2FF7A 4ILEA 3TJZA 4DY4A 5HUJA 1TKAA 2VRNA 3HPQA 4PPNA 4D2IA 3P8ZA 1N2CE 2WD7A 3Q85A 3FSEA 2PJRA 4RTMA 3L7NA 1X7DA 4IINA 1LD3A 4R3WA 5JALA 1VL8A 4PLZA 1I51A 3NGXA 4JVMA 4YRCA 4FCCA 3T1OA 4CEJB 1ZUNA 3PXXA 1NPYA 4K81B 3IR6A 5BSRA 3THWA 1YHNA 2VBFA 1C3JA 3E0XA 2FPOA 2BLNA 3GARA 4DWJA 4Z49A 3DB1A 3LA8A 5LKRA 4OD0A 3VBEA 1X7XB 1ZHHA 2ZYRA 2XCQA 4J7XA 3BGIA 5EIHA 3HVJA 5IZ4A 1XKXA 2YNMD 2OWEA 4E12A 2PA3A 3AUJB 3DZHA 1JAIA 2Z4TA 4CKBB 5K99A 1XLUA 1K6MA 4ND3A 2HRRA 2OHGA 3OCWA 3JSXA 4RFSB 1FFGA 5DN9A 5CBKA 1JT2A 3H1PA 4AKIA 1OF1A 4DA0A 1I9CA 4DV2B 4ND7A 1WBJB 3DOCA 3LU1A 4GZ5A 5BR1A 2GF9A 2YXBA 4OMFG 2ZBGA 3EMKA 5D87A 3JQDA 2HN9A 1TCAA 2AR9A 4KXFB 1SBZA 4NX2A 4RSGA 4N65A 5KDOA 2O8DB 5B1YA 4S0XA 1FVHA 2TECE 2O7NA 3A2NA 1Y3FE 4YRMA 1JH8A 3A6FA 2ZUBA 4F85A 1HKHA 5I47A 2LDBA 4HRVA 4QUDA 4FGWA 4W9RA 521PA 3ZX5A 1JDBB 1WDWB 3A1TA 1D03A 1WXXA 4TX1A 5BUZA 1N77A 3QE9Y 1PUIA 5HDBB 1P9OA 5T6BA 1R27A 3GU3A 1BE6A 4H08A 4IJ5A 1T8YA 4XGQA 3ZNNA 4PGGA 2IZOA 1PYGA 1MTOA 4MIKA 4O6VA 4PPFA 1GZDA 1YAHA 2A33A 1BVYF 4LXTA 2J3JA 5DBIA 3PDIA 1ISSA 2GWHA 4HYQA 1V8ZA 4Q3DA 2IIVA 4LXXA 1PJ3A 1TKBA 1WMSA 4L8YA 1NVVR 3HHEA 1MJHA 3WGVA 2I4LA 2WYOA 5J2TA 4OI4A 4LRWA 3ZQUA 5AQEA 4EYQA 1KH3A 1YFKA 4XCXA 2R9VA 3FUXA 4MRPA 4LEIA 1KIFA 1JWBB 1N32B 1XCBA 2AI3A 3K0FB 4QXOA 2Y8EA 2C77A 3VH1A 5B64A 5KQMA 5LZ2A 4CV0A 3FY4A 4L0QA 1UADA 1YUMA 4CKEA 3GJ3A 3ND5A 3E5HA 5FPPA 4AL4A 1AK1A 2IE0A 2GBFA 2WM3A 4H7HA 2WB2A 2C3YA 1TUBB 3OEEA 1E2LA 2EKDA 1SKBA 1XDDA 1R4NA 2TMDA 4RVHA 2AA3A 1XALA 5EP3A 1ENPA 3PKZA 1NV8A 1GRVA 2RBGA 4GR5A 3T6KA 4DV6B 3WHIA 1YBHA 1KJYA 3O4VA 1YIOA 5EHIA 2X8BA 1T1RA 1JG6A 3T7AA 3SPXA 5AVVA 1EFPA 1F60A 1OLSB 2EGGA 3AVWA 4CEJA 3NOXA 4QGGA 3LLMA 1D1SA 2Q1YA 1IBRA 4PQFA 3E2MA 3I6BA 3LL7A 3RYCA 5BQ3A 4OPMA 3AV3A 1YD7A 4Q37A 1G4HA 2G3YA 4YUXA 4X3OA 4CL2A 2CLHB 3UCFA 1F8GA 3VU0A 2GERA 2GXUA 4LHVA 4PQYA 4DQ0A 4UOQA 2Z0MA 2WZQA 2C7BA 3BRQA 4E07A 5I01A 5L8VA 1FL9A 2CYCA 2P3OA 2Y1FA 1GPKA 3P97A 4ACBA 4GAEA 4K6GA 3ETHA 1FTYA 1A72A 2FZVA 1DBSA 2V59A 4GECA 4NYIQ 4ZRMA 4CPDA 4CEHB 5LU9A 1XP8A 1QHSA 2Z95A 2ZIZA 4B7AA 1GTG1 1V7CA 3LPMA 1Y6FA 1W87A 2YZ2A 2QLJA 5DHQA 1V96A 1F3LA 3ZDDA 2RGNC 3F5SA 2NVUB 1C4WA 3H9UA 4CDGA 1UJ5A 3L4BC 4FGKA 3UCXA 1YONA 4G1CA 4TMYA 1IBKB 2ZG6A 1WPGA 4XVQA 3LNTA 3KJZA 4W5QA 4DDHA 1M2OA 4CIVA 1JFTA 5DB4A 3HTXA 1H5UA 5EE5B 1NVAA 1NYRA 1YMVA 1CUYA 2SCUA 1D9ZA 3AJ8A 3MMPA 4O0LA 1P81A 1P91A 3MTIA 4TV8B 1J8YF 1VHWA 5BW4A 4BGVA 4QWMA 2VPPA 3EF0A 4S1TA 5FH9A 4D46A 5AHKA 3WGGA 3L0DA 1AKMA 4ARCA 1DJQA 3GVHA 1X94A 1DKPA 5HMMA 1NGSA 3OPYB 4FYKA 4XZ3A 3HCWA 1KU0A 3QY9A 3L07A 2WWHA 1TLFA 2EXXA 3I83A 3KVYA 2QE7A 2YZNA 3L0CA 2RCNA 3C5WP 4MKXA 4QFDA 2YYYA 3VOAA 3MW8A 2OEPA 2RHDA 1P72A 1TMGE 4KAFA 2A9RA 1IOWA 5JDIA 2D62A 2OLJA 3DKPA 4WLFA 3ZHXA 1FP2A 4R8KA 5LP6F 3VZQA 1JB1A 1KHTA 4LSMA 1KO1A 4BASA 4F6RA 2A1UB 3EPJA 1C3XA 3FG9A 1OV4A 2R96A 3L8EA 3KTAA 2R1UA 3N8KA 3O3OB 3U3DA 3N1UA 3ZJ4A 1E69A 3ZV7A 1X9GA 1KF0A 2C57A 1VPDA 2Y9PB 1V8OA 3TQTA 5F5XA 4RHYA 1YBMA 1P7PA 3OVMA 3REFA 5C1DA 1Z2CA 1TKCA 1OGYA 1XL1A 2ZE8A 3OQJA 3RU2A 2JATA 4G84A 4ECAA 1UFVA 3GR6A 1D09A 2WYHA 3U1BA 1M2OB 1TD1A 3KLMX 1C9JA 4FKZA 4QC2A 4XB2A 3VYWA 3WLPA 3QMWA 1Q91A 1R0ZA 3WMRA 4KRFA 1AKYA 1CY4A 3OG9A 1F7VA 2O06A 3HDYA 3UGJA 4JP5A 1A76A 4ZOEA 1DU4A 5LYJB 4FDTA 4HVTA 5T41A 1II8B 4IDGA 2Q4BA 1NKVA 5IKXA 3PV0A 4F2PA 2LP4Y 3VPFA 3PU6A 3PKJA 2Y2VA 4DWWA 5LQRA 3BMCB 4ZXFA 2QD4A 4BVKA 2D1YA 3K70D 5G1PA 4A6EA 3IERA 2ICAA 1YR3A 2FUG6 2O7SA 4KQHA 4AF7A 5EJ2A 3SIXA 2O07A 1W5AA 5IJ0B 4YCMA 4XLLA 2P77A 1SQ0A 3TX2A 3REOA 1OB2A 2AZ4A 4HAZA 2OOKA 1WB9A 4X20B 5THXA 4EJMA 1P3DA 5CA1B 2OHHA 1NC1A 3IAM6 2A92A 3QRWA 4WTOA 4CMHA 1UT6A 4KDCA 1XRPA 1SEPA 3WC4A 2OGWA 1L7NA 5CLQA 3RNOA 1IN1A 3CX8A 3KAJA 5HGJA 3BZWA 4C7VA 1Z22A 1HSZA 2PN1A 3UXYA 3EGOA 5AIBA 1V48A 4NVRA 1KARA 4FX2A 4OX9Y 3HA3A 3MS2A 4WDRA 1XMVA 4JXXA 5BN5B 2AJ8A 4ESVA 3QYPA 3RYFA 1EEHA 2OB2A 4W1SA 4LSWA 4DBVO 1R0XA 4YV0A 1VCHA 4DV0B 1QRRA 3LC1O 3H5TA 1CS4C 1IJFA 2CW5A 1NRIA 1ZITA 3SOPA 2I4MA 1DEOA 3MQ2A 4R1TA 3KQOA 5AHRA 1QSGA 1Y1SA 3SLGA 3EW9A