2D1FA

Structure of mycobacterium tuberculosis threonine synthase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
349
Chain Sequence
QPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Threonine synthase
publication title Structural, biochemical, and in vivo investigations of the threonine synthase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 113
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 4.2.3.1: Threonine synthase.
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d1fA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d1fA01
5I7WA 1QOPB 1BKSB 4LMAA 4D96A 2CLEB 1TYZA 3RR2A 1X1QA 2ISQA 3L6RA 4KKXB 5D85A 4QYSA 5DW3A 1PWHA 3L6CA 5I7OA 4D9GA 4NU8X 5JJCA 5KINB 3DWIA 1F2DA 4AIRA 5IWCA 1M54A 1CW2B 1TTPB 1Y7LA 1J0BA 1O58A 3BM5A 2Q3DA 1Z7WA 3VSCA 1K7FB 4LI3X 1D6SA 3ZEIA 1J0DA 3V7NA 3R0ZA 5B1IA 1K8ZB 4D9KA 4D9IA 5JISA 1WTCA 4COOA 1A5AB 1KFJB 3T4PA 2BHTA 2GN0A 4XUGB 5HBGA 5E0KB 5IW8A 4D99A 1J0EA 5J43A 2TRSB 1KL7A 3FGPA 1VE5A 1C9DB 4L0DA 3DWGA 5CVCA 5DBHX 5B1HA 2EGUA 2O2EA 1V7CA 2Q3BA 3VSDA 1V71A 2ECQA 4D9CA 2J9XB 5I6DA 2Q3CA 5I7AA 1VB3A 2CLHB 1KFKB 3PC4A 2RKBA 2TYSB 1A50B 4H27A 4HN4B 2BHSA 4OFXA 3CEPB 2J9ZB 1K7EB 2ZSJA 3TBHA 1PWEA 4HO1X 2EFYA 3AEXA 4PCUA 5C3UA 3VSAA 5J5VA 4Y6GB 1WKVA 2O2JA 1FCJA 2CLOB 1WDWB 2GN2A 4L27A 4JBLA 2CLFB 5DBEX 3HMKA 5D87A 1C8VB 4ZU6X 4AECA 1OASA 5D86A 1JBQA 4IL5A 4D8WA 5B36A 3SPXA 1Z7YA 4D97A 1KFBB 4D9FA 4D9NA 3SS9X 5DVZA 4D8TA 1TTQB 1TDJA 1FUYB 2TSYB 4D9MA 4F4FA 1K8YB 1J0AA 2CLMB 3VC3A 3L6BA 3PC2A 1A5BB 3X43A 1KFEB 4HPJB 4HT3B 1E5XA 1C29B 1K8XB 1TZMA 1UINA 2D1FA 5T6MA 3IQIX 4D92A 5I7HA 1KFCB 2GN1A 3R0XA 4JBNA 4D8UA 5B53A 1K7XB 1TJPB 1P5JA 2RH9B 2ZR8A 4I1YA 1V8ZA 3IAUA 2CLIB 3VBEA 4OREX 4WX2B 3IQHX 1WBJB 3IQGX 2WSYB 1BEUB 4L3VA 1J0CA 1TZJA 2CLKB 2V03A 5B55A 5BW6B 5DW0A 2J9YB 3AEYA 4NEGA 1UBSB 2C2GA 2ECOA 2PQMA 2CLLB 5KZMB 4HPXB 4LMBA 4ZQCB 2DH6A 5B3AA 2ZPUA 3PR2B 2RHGB 5D84A 2JC3A 3PC3A 1K3UB 5I7RA 1QOQB 1VE1A 1TZKA 1RQXA 1TZ2A 1UIMA 2DH5A 4L28A 3X44A 5CGQB 3SS7X 1CX9B 4D9BA 2C2BA 3FCAA 5IXJA 3DKIA 4ZU1X 1A5SB 4D9EA 5EY5B
chains in the Genus database with same CATH superfamily
5GM1A 3NCHA 2O3SA 3A1NA 1ISIA 1OFIA 3IJEB 4QARA 1Z38A 2VDLB 4IHJB 3R3VA 1E3EA 1R88A 2V45A 3AY6A 2GRJA 3AR4A 3SICE 5E4FA 1Q1BA 4H3VA 5IMSA 1I5EA 2NV0A 2GN4A 1HNWB 2UU9B 1W9HA 2A92A 3UAOA 3OX2A 4J16A 4HDRB 4G5QA 2CMHA 3OG9A 2NUPB 1M5TA 3KP1A 2NZXA 5GGYA 2JBHA 3QVMA 3D5QA 4GXQA 3MLBA 4A5SA 3KELA 1Q21A 5DULA 2W00A 3FOFC 1KVRA 1VZ3A 2Q2NA 5FCDA 2GBLA 4LDPA 3JQ7A 3C1UA 1LW7A 5ALQA 4BRUA 1RCUA 6REQA 2DTXA 2DU8A 2GXSA 4R5HA 3GLVA 4RF2A 4NCAA 4KRFA 2BI8A 4RA6A 1H2RS 4JP1A 5LC1A 3UB4A 4RVCA 4TUYB 1NM5A 2JFBA 1SUFA 4GOJA 3TL3A 1M6YA 2Z43A 3HCCA 1DTWA 5I7AA 1XZKA 4URZR 5DCWA 4D6XA 5JIBA 4GPAA 2CFOA 1KFKB 2UUAB 1GQOA 1X2EA 3AVTA 1CUYA 3WL3A 2BFMA 3GUVA 3TLZA 4LSMA 2IHVA 2NYRA 4OXRA 2I2WA 3PWSA 5AQ1A 1XQVA 3LECA 2WIKA 4IFEA 2EFYA 1LZKA 3NNDA 3UF0A 1H94A 3LIPA 4M46A 4MWSA 5EKTA 1G2OA 3BBLA 1A8QA 5TE9A 3F3MA 4A1FA 4RTPA 3VZQA 2HF9A 3K2IA 2JH3A 3PEUA 3SPXA 4G5XA 1I5OA 4I50A 4I0WB 2I65A 1SXJD 3HCEA 3QKWA 3TE7A 3H5AA 1EDEA 2JLCA 2YVAA 5DISB 4G09A 4F38A 1E2GA 2G83A 3TZQA 2CXQA 1DOAA 2MSNA 2PL5A 4DV2B 4GLFA 1CY6A 2H1SA 4Y9UA 3ZV4A 2P9GA 5ECYA 4ILEA 3WKEA 4M1MA 4F12A 4M7RA 3HU1A 2YINC 2AQKA 1CUIA 2BELA 4H31A 3ADPA 4M0UA 5DGTA 3AHDA 2J3JA 4C7JA 4J76A 3WO0A 2GK7A 3ZZTA 4J29A 1NUUA 1QX3A 1EX1A 2P5UA 4IQ0A 3I2KA 4KWTA 4RD3A 4TRJA 4AMZA 4CLRA 4A8PA 1M7GA 2C2GA 3ZPXA 1DLIA 3X1ZA 4MQFA 3E0QA 4R5MA 1N77A 1VLZA 2VAWA 1YCGA 2HJWA 3U26A 4EKDA 5I5EA 4OHXA 2ATCA 2D1QA 2PS1A 4HX5A 4KXNA 2AOTB 1QUEA 3X1YA 3I9V6 3KPJA 1C9YA 1Q20A 3WBJA 4GOOD 4Z8XA 4C04A 3CINA 2BSXA 1N7JA 4DNXA 1SO8A 4BMVA 1NFQA 3AV3A 2ZUCA 3NRBA 1DV2A 5DRTA 4MGEA 5BQ5A 3CLSD 3D7RA 1WQ3A 3DTVD 4MJ3A 4EP1A 4LJLA 3EPHA 4NENB 3ZIUA 1CYEA 3PPIA 5BMVF 3DMRA 3ZVLA 4CFSA 3U7QB 2SCUB 4FWBA 3EUAA 3OURA 3MUEA 3EXHB 4CEIB 4R98A 4F04A 2C4HA 1PQWA 1U8AA 2V9ZA 3CZRA 1I30A 2O0KA 3OZAA 5ER6A 1NBHA 2Q27A 2VT3A 4EGQA 1FYWA 4BLRA 4ZAYA 1PJAA 2A5JA 1JHYA 4PRKA 2RK4A 3MWGA 5TQ0B 4MV9A 3U9TA 3ZQJA 1I7PA 5E9QA 4F9TA 1R9JA 3SVZA 3P9QA 5AVZA 4RQTA 2PX4A 2BE7A 3IIIA 3FTCA 4RLSA 3DOHA 1CFJA 1TRHA 5H02A 5E1MA 2NN3C 2XODA 3QOFA 3UQYS 4TYMA 4IS2A 4CN8A 5LNK1 4I55B 5JVDA 3DCJA 3DWGA 4WBNA 3COVA 2BLLA 4DAOA 3ZY6A 5DHUA 1M8GA 4WWHA 5EJGA 1ADCA 3IBFA 4P98A 5LWHA 3DWEX 1CDEA 3BSSA 2VPTA 4G6ZA 4MRRA 1XYVA 1LI4A 2JGAA 2EKZA 3WGQA 1Z0FA 4ZAXA 2PNFA 2X8AA 4MQ6A 4I4TF 5FJJA 2QNRA 3WJ1A 4E13A 3ANYB 3KEMA 5JY6A 2WYOA 4WZBA 4QIHA 5GVRA 4RLFA 3B7GA 4W1SA 3VKVA 2P3SA 1MO5A 5A03A 3NBXX 5IAJA 4DPMA 4PY2A 4R0VA 2YRWA 1R64A 4PNEA 1SPXA 2O2JA 2V7UA 1T6XA 3HCRA 5AKLA 2Z98A 4XX1A 4C0XA 3EASA 4MVJF 4PO9A 3CURA 2VHUA 3HM2A 1YNSA 1RI1A 1WCIA 5DWDA 1N5DA 1CCWA 4A9AA 4PCVA 2PRSA 2W2OA 1NSYA 3PHJA 2WMYA 1ID8A 2VHWA 2IVFA 2WF5A 4AW9A 3GLGE 2OD9A 4HWRA 3NBUA 1U02A 3H5TA 3LW7A 1ZG3A 2JFXA 4IXNA 4LYFA 1YFLA 1NJSA 1XR3A 2IW3A 4HPJB 1I51A 4BV9A 1I4DD 3QX7A 4OBXA 4K6HA 3OTOB 2WKQA 3B6ZA 5J9FA 2Q5HA 5CDYA 3GLFE 3FOZA 3FDZB 3C5VA 2K2WA 1A71A 2DMRA 1B6SA 5KTMA 2HLDA 3VBEA 2FX3A 4ODIA 5TARA 4E07A 5K6TA 2J9FB 2N42A 1UJMA 2QOEA 2IPMA 2KI5A 2JIPA 2VP0A 3OU2A 4BLUA 4EG8A 3OIDA 2IYVA 1GADO 2DHDA 2ENWA 3H4IA 2G5TA 3TDNA 4AY5A 4D44A 4ERXA 1TAQA 2YJ6A 1QRSA 4G1UC 2WV7A 4DMHA 1DB3A 1Z8FA 2FCRA 2I22A 4PNHA 4B3TB 3MPUA 2OFOA 4IIYA 3OZDA 4LZOA 3WK7A 3GFSA 3OCXA 4Q66C 2ZRAA 4AS2A 1L5HA 4ID9A 2R9VA 2CMGA 4X41A 3IEMA 1UK6A 1XD2B 1QB8A 2EJBA 3DM5A 4UNQA 2GCNA 1M83A 4ROSA 4X90A 3KCQA 2OG2A 3BXGA 4B2PA 4X1IA 3TLKA 1L7PA 5FBWB 3CXUA 4G1CA 2FPLA 3ETNA 2QTNA 2RGAA 2OQ2A 1CTQA 2X0IA 1TW2A 3DAGA 4X1KB 3S6JA 3K0FA 4R9NA 3UJAA 4M3NA 2BWJA 5FJIA 3KJXA 4KQ9A 4CKWA 4KKXB 3WDLA 1X1SA 1XJWA 1G38A 1Z4KA 2H4WA 2DYKA 1JHUA 5MN6A 2XXAA 1F06A 2ILVA 5CNKA 1ESNA 3QBVA 1NP6A 1QIGA 3Q5DA 3SZRA 1RYMA 2ODPA 1VL8A 3HZZA 1CUEA 2ON6A 4QTYA 4ZA2A 1YUNA 4OB7A 4BO5A 2QTTA 1Z8NA 2BFBB 2XVMA 3JZDA 4FFWA 4MV6A 1BX1A 3LWZA 4P92A 4ZU3A 5B1IA 2RDMA 3L7LA 5JMTA 2I3GA 2JF0A 1UMCA 3IT0A 1KFJB 2I71A 4C76A 3UANA 4JASB 3ROQA 2Q7DA 3EXFA 4F2GA 5KNCH 2UV8A 3C3BA 3GP8A 4GD3Q 3T8YA 1Z2EA 3GUYA 4R9SA 3F7NA 1CIVA 1ZGZA 1VGRA 1XNGA 4R0MA 4K6KA 2VJYA 3OFSA 2BSAA 5THQA 4PZYA 5FOWA 5ESXA 3RYFB 2YQ4A 3JQAA 5TV2A 2PPVA 4AMYA 3IX7A 2OMKA 4UEWA 2WFLA 1YAJA 2YR0A 5KSZA 1GTRA 3CEPB 3PZBA 5JSFA 3DLHA 4XCQA 1PEAA 3E8XA 4JUIA 4L22A 4OMUA 2JG3A 3KYCB 3CSSA 2D7JA 4R8MA 4U5XA 3COZA 4NH4A 5K3FA 3O8QA 1ATZA 5D1NA 2VWGA 4DRXB 3HWX1 5DGIA 5L4NA 3KQLA 1M34A 2WG2A 3RVLA 5CXXA 2FRXA 4E32A 3FTDA 2R79A 3T1OA 1KS9A 3WL7A 4AECA 4MWEA 1NNUA 5B36A 2PS3A 2LCIA 3IR7A 3C6ZA 3CJTA 1THMA 4QU5A 3ZCPA 5KQLA 4WGFA 2OXIA 4HQ6A 1OH6A 2YMQA 5CA1A 2FZVA 2W6NA 5DMXA 1RAIA 3G5UA 3O2SB 5C8VA 3PPYA 4H9GA 4HT3B 4I1VA 4QZVA 1Z4QA 2V7EA 3E4DA 2XCTB 1HI9A 1ZKMA 1K86A 3L3BA 3ZDDA 2PT9A 2H1WA 4FEYA 4D82A 1HYQA 5FEUA 3ILSA 4BQNA 2NPFA 2NP7A 2JGIA 3FVRA 3KSAC 3ZHZA 5F98A 3SFTA 2GXAA 1BE0A 3DEKA 4Q1FA 4ZAVA 4LY9A 3MBKA 3B9BA 3DCNA 3IQGX 1RADA 1V25A 2OHFA 4OFBA 2DECA 4JP5A 4NOLA 3RVSA 2G9NA 5BSWA 1NV8A 1BGWA 5LJLA 2GDZA 4C88A 2ZI7A 3GZNA 2ZRLA 4HB2A 4OPMA 4I19A 4EHNA 1ULSA 1E94E 4ASUD 3GDFA 4XARA 1XD8A 1T13A 1FLAA 4BO9A 1SKYB 3T6KA 2IIVA 3R7BA 3A36A 5E6SA 4E2FA 7MDHA 4CEJB 1W87A 4I1SA 4HVAA 3RABA 3K9GA 4FYVA 1Y4ZA 5B2EA 1J24A 5LKRA 2VDWA 1PJBA 3VYSB 5KYNA 1LNSA 4K2AA 1OOEA 1UWLA 1EDOA 3EY4A 4PHCA 4W6ZA 3FGNA 4F3RA 3OPMA 3TZEA 1MVOA 4HB4A 2P0AA 4F2PA 4NYJR 2R8ZA 3CNLA 3Q9SA 4CKEA 3NR2A 1KVQA 5AXAA 1E5VA 2EV9A 4ZALA 2ZI5A 4IQFA 3AQIA 3D7KA 2JAUA 1UMBB 1ZW6A 2BCGY 3B48A 3NVDA 3PQCA 4Q3KA 2ZKIA 4UBMA 3FI9A 4UBIA 2DUUA 4U39A 3V46A 3HWRA 4NJMA 2O6HA 1MOZA 2O0LA 1NMEA 1T26A 3NORA 1NDHA 2LPMA 4ARBA 1RRMA 2KBEA 5EJ5A 2EGHA 3R5KA 2SBTA 1DVRA 3G2JA 1YASA 3SN6A 1NC1A 2ADFA 2GM5A 3GJSA 3C3YA 4DA7A 1ULTA 1CUGA 2AF3C 1XTIA 1ZS9A 3KDAA 3YASA 2Q5QA 1MN6A 3O2NA 4L85A 2C8JA 4LWQA 1E5TA 2FSHA 4G41A 2AG0A 3CWCA 3CUSA 4HUJA 4U7PB 3RNOA 4HLUC 3I4CA 4RL6A 4EUNA 3D7NA 1IRIA 3X2EA 2Q0SA 4LX0A 1NC3A 2WHYA 2GXUA 3MMZA 2PX3A 3L7NA 5HIAA 4KQGA 1OWOA 3OAAA 1CKEA 5F9MA 2B21A 1A9TA 2WSBA 1C1XA 5CD9A 1QK3A 2HL6A 3H2KA 4DJ5X 1MU0A 4ZT5A 4JEHA 1PFVA 3QE2A 3KSRA 3P9ZA 1VIDA 4C7BA 1EFTA 4LKRA 3RUHA 1QIMA 1X7GA 4A6DA 4HQOA 3UGJA 1PFWA 3DAOA 3DDUA 3P2YA 5B4UA 1G8PA 3A2MA 3I12A 3OD1A 3QLUA 1X86B 4RU1A 1K92A 5CBPA 5I8WA 1KMMA 4DQKA 3KQMA 3UNXA 4MP6A 2VXCA 3G68A 3T1VA 4OJKA 1RPJA 3WKAA 3B7PA 5BW8A 3SXJA 4IIJA 1A7JA 4Z9AA 4RFLA 2FPKA 5BVHB 5KMGA 3VR0A 4OYYA 1BDMA 1NRJB 3ROEA 2ZJ0A 5DGXA 2JIDA 5KNBA 4WJKB 2V55B 3W77A 1FDTA 2DBVO 3W79A 3GGDA 5K0CA 3N59A 4LF5B 3O8DA 3AL2A 3V2HA 2G77B 3GR6A 1Y7IA 3OT5A 2HBQA 4FFSA 3UOAB 4R83A 4N82A 4UTPA 2V9PA 1H8ED 1NUSA 4JWKA 2XF8A 3WE7A 3RJ5A 4B45A 5IULC 4WY2A 1Z2NX 1LLUA 1X7YB 2IZZA 2QYSA 4YMSA 3VNBA 521PA 1EB9A 3P2IA 4MDFA 1AM4D 3AP2A 3DBLA 1JDBB 4QUJA 5EUCA 3G5MA 4J91A 2D59A 3PWTA 4NG4A 1QCYA 3NAGA 5FFMA 2YS6A 1F5NA 2PFKA 3NM5A 3OJCA 4NC9A 4ZVLA 1PJRA 4RTLA 2B6HA 1WPRA 1XRLA 3QNWA 1JJVA 1WMEA 4L4RA 2P30A 1Y6FA 1K3TA 3ADOA 3GGPA 2N75A 2QI9F 4B5KA 3MQ2A 4LC1A 4UEJA 4Q4CA 4G1EB 3L43A 2DB3A 4G8JA 4DRYA 2PMDA 2H08A 1JR6A 2JFPA 4QOJA 1M75A 4XLTA 4NKRA 4GH5A 1HDXA 4GXNA 1XAIA 4TKVB 3TL6A 1TVMA 5I7EA 3MGBA 1TUEA 3OEWA 5I3CA 3I53A 3DO6A 4E46A 1FSPA 4URUR 3CLRC 4GPIB 3DPUA 2P67A 4EJFA 3R9WA 1MJFA 4DQLA 1K8QA 1MG0A 1W2HA 4QASA 2D1RA 4UASA 4ZQEA 3WGMA 4ROTA 3U7RA 5JU6A 2XA2A 5H4HA 5AJVB 5C7LO 3I1YA 3OQJA 1ZH8A 1JKIA 2JKYA 1ZQ1A 2Y0PA 1QCCA 1X7WB 2D1SA 4N1AA 4E3ZA 2HHCA 3LX6A 4DSZA 5BQ3A 1TKCA 4XVQA 4GF5A 4JODA 2QRUA 3U1TA 1H0RA 1L4FA 1RE1A 1US8B 4M0PA 3LPAA 3AHJA 4MKXA 2R1UA 3T3DA 1VXOA 4ZVPA 3ZX4A 3I23A 1H5NA 5I01A 4X7PA 5KX5A 1K9SA 5MN5A 5AI6A 2JLQA 1NJGA 1I1QB 4FFNA 4C4ZA 4GDMA 3ZZMA 1OBHA 1GUDA 1QG2A 3I9FA 3HKCB 2PO7A 5FX2A 4DYVA 3DJFA 5BR8B 2FSGA 3A1FA 3TBFA 4C7MA 2TMDA 2Q07A 2X8JB 4RIEA 5FPTA 2DGDA 4LJ7A 3D43A 1D6SA 1FTQA 2PLRA 2OCBA 3MM4A 1S9DA 4AJ9A 1K8ZB 2QVXX 3Q7EA 4NJEB 3HFJA 3TQHA 5LBIA 2FX2A 1VYTA 5FI1B 1WL8A 3GO4A 3FCEA 3M7IA 1FX0B 2Y1KA 3BD8A 4JMPA 4RMJA 1M1NB 3QU5A 3TSYA 3AU9A 5KYVA 1U65A 4KN8A 3MGKA 2C0PA 4KDEA 1BRMA 3JQGB 3GBPA 4LJ5A 1THZA 3UT5B 1L6IA 4D9CA 5IYZB 3C3AA 3JCZA 3RLFA 4Q16A 1QHNA 2RBKA 5KYGA 4E5PA 3UK2A 4G4GA 4AUNA 1N6HA 1U9IA 3EVTA 1B41A 4HN4B 2QLJA 1CDDA 2VFAA 3JD1A 3PT9A 1KI6B 1R10A 4KJZA 4XTCS 1WG8A 4JDUA 2IKQA 3V4LA 3PGVA 3L6DA 2HA3A 2O3JA 3DMHA 3ETLA 3TK1A 2QF7A 1L7RA 4ZHQF 5JO0A 1KTVA 1ZGCA 4BLQA 4Q4AA 3UKOA 4M8IA 5BV7A 5J59A 1C8VB 2OHIA 5AHWA 1XOIA 2I03A 4NP6A 1UKAA 4V0RA 2QRVA 3NLLA 3MTAA 4KIJA 5U9CA 1KFBB 3GJ5A 4Q1VA 3AR3A 5DHSA 4YRZA 2P4SA 3KQOA 4G1MB 1EEHA 2QN1A 4MAFA 4OXNA 5CB0A 2HHJA 5AJTA 5IKXA 5FEMA 5THXA 1VRVA 2A1TS 3ZWVA 3QU7A 3TSZA 2PLWA 4AJPA 3AEZA 1M2KA 1ZEMA 3WWPA 5JQGA 2Q4OA 5H81A 4Z1MA 4H1UA 5LXTF 3HDQA 1ZISA 1HKHA 2QD3A 1ORWA 4MKIA 4N0DA 3EZNA 4QBHA 4UQOA 4BEBA 5BOSA 4KHPB 1UXKA 2CZQA 4R2KA 3F67A 4L50A 3JYOA 4II2A 4BMPB 1I14A 4JI8B 4RPHA 5L3SA 4B3BA 1W6UA 5EZYA 4DXAA 2ODBA 3U1VA 5DN6D 3STUA 1XZMA 3FKJA 3HNRA 1SRQA 3P45A 1AGNA 1D7OA 1L2TA 3E82A 4M1YA 1HQYE 2ONYA 4LSZA 1NMSA 1U0EA 4FDAA 4Q34A 3RFTA 1DAKA 1EQUA 3OC0A 1MB0A 3CH4B 4JJZA 2WJAA 1JXAA 2NZ8A 3IR5A 4G0XA 4C0WA 4F0JA 1P9LA 2RC5A 4TWBA 5TDHA 4LN1A 4Z2AA 2XB4A 4K6MA 1RAAA 4C0HA 2VZEA 4FWIB 2ZBUA 2FMTA 3CE9A 4X97A 2O5RA 3O4JA 2YFKA 4RV9A 5K9ZA 1TW3A 2L0XA 2VNHA 4DV0B 2ACVA 1FS6A 4RZSA 3QHPA 4UHKA 3O0DA 2C2BA 5IUJC 4X5OA 3R9XA 1B74A 3FCAA 4KHZA 2VSXA 2ALJA 1P2UA 2G4VA 2QWXA 2RONA 5F5LA 3OBBA 4UARA 4D9HA 5IG2A 4P80A 4MWZA 3NEAA 4Y2UA 3IJ5A 5I7WA 3IUBA 3Q8WA 4JLSA 4CI0B 2ZS9A 4N5NA 5F7JA 4PFQA 5J2TA 4TRMA 2IFTA 3G5LA 4L75A 1TYCA 5IFKA 1W36B 2AZXA 4G9GA 1M8PA 3C1AA 4B83A 3MJVA 2VIIA 4P38A 2MOKA 2X9GA 3HJFA 1WPGA 2Y4NA 2ZIXA 3K2BA 1PJ8A 1HDEA 4LJ4A 4PONA 4MWGA 5D3MB 2Q3LA 4KE8A 4PGGA 2BZ0A 5IABA 3GGCA 4MQEB 1UUFA 4ZCTA 3ZDBA 3MIIA 1WUHS 5KUTA 1MAHA 5BNZA 3WSVA 3JW8A 1AV7A 4NMLA 5BWCA 3AVOA 4ZCQA 3UMRA 2VH2A 5CYGA 4GQAA 5BT8A 3W04A 1K06A 5JS2A 1UPAA 3K0KA 1BEEA 3TINA 1QS0B 1NTRA 1QPGA 2H51A 4JOSA 3TUIC 3UC5A 3QU2A 2Z1MA 4Q93A 2QENA 2RH4A 2W8BB 1J20A 3BZWA 2C7BA 1UMDA 2FLKA 3W9UA 4TYQA 5TX7A 5HW0A 4O4LF 1E6CA 4I2NA 1B8VA 1G5TA 2MTBA 2MINB 5AKJA 3TR0A 3WIEA 3S68A 1YUMA 3OZRA 4I66A 3LXXA 3C7AA 3AEQA 3KWMA 1NVAA 4HYEA 1ICEA 4IH9A 3PFGA 1UPCA 1KH2A 2QTCA 3QPDA 3U3MA 4CVNA 3KVOA 4Y6GB 2ZQYA 3WBBA 1XJ0A 3NTQA 3F4KA 2GKSA 4KZPA 3OT1B 4H15A 4NMXB 3K0CC 2QRQA 2RFLA 3U44A 1JZTA 1EK1A 3OSUA 1KE1A 3JAWB 4LZPA 1EFKA 3URKA 4G4SO 4TV8B 1E63A 3DXZA 1MGPA 4M9RA 1AUOA 4W9NC 3ZUPA 2QL7A 2X5JO 4DC9A 4N3GA 1KNQA 3LS2A 1KIFA 2JCVA 3BICA 3GFTA 3AILA 4Q0MA 1VLVA 3RS2A 1F7VA 1VSVA 5CEJA 1EWTA 2WB2A 3MB8A 4MTLA 1GM5A 5EG5A 1XVUA 2ODWA 3HBNA 4HEA1 1X80A 3S29A 5JSUA 2GD2A 2XMBA 4BYMA 2SECE 5JJBA 4PF1A 2X4DA 2AEJA 1N3YA 4KVZA 1T0IA 2AFHE 2X86A 3FDJA 1COWD 4ID3A 2RHRA 4EDFA 3DMDA 4RPKA 1QO0A 3DOCA 3IALA 4V0NA 2GM4A 3RGGA 1UAYA 2G9RA 4JJKA 1IQRA 4P6VF 1R37A 3GPDG 4HLDA 2O3TA 3IAAA 4KCGA 1R74A 4ND4A 2ANBA 2FSUA 3IAHA 2ZROA 4HUQA 3O7WA 4DCVA 1FXUA 1UBJS 1DOZA 2VEDA 4U4AA 1A2OA 1D4ZA 1F5SA 2NSDA 2OOKA 1ULBA 4Z3DA 1Z88A 1ECLA 5JCOA 2DLDA 1EI9A 2V98A 2O8EB 2W48A 3GQVA 4QHTA 4QTTB 3TL2A 2UZ1B 2QKYA 3ROGA 3ZYCA 4DLLA 4KNVA 5IUKC 1YR8A 2XVZA 2RJ3A 1SQ6A 4CDRA 4JXKA 5HKKD 1T1SA 3FETA 1C1HA 2QX7A 3CE6A 3MTDA 2WAAA 2Q7OE 2HPHA 1R9NA 4NI5A 1ZVMA 1MH1A 4XVRA 4NMHA 3U3OA 4MS4A 3V7UA 4G5HA 4JVMA 2G88A 3GBVA 1QHHA 4Q9KA 1U63A 1TM7E 3S44A 4F84A 1LZLA 1YZVA 5NLLA 1SC9A 1FSZA 5J40A 3F9RA 3ASZA 4FX2A 3FHTA 1H2WA 3HMQA 4X94A 3R7WB 3HABA 3WIDA 4OHYA 4Y67A 1ID1A 3ODGA 4XWGA 3CVOA 5FR1A 3IP3A 5K8LA 3EAFA 1T36A 4Y6QA 1U6IA 3VZSA 1GFWA 5AOBA 4KR3A 3MJRA 3N6VA 1PNVA 3K09A 3LK7A 3M81A 1HTTA 3DAFA 3DL7A 4X45A 5DK4A 4Z0NA 3EHEA 3RUCA 3WSWA 2K7FA 4BN4A 1A9YA 2ZIAA 4ETIA 3CCFA 5TF0A 2OAEA 2WBLC 3FHJA 4EI7A 5IX8A 1NVFA 3T3HA 1DX6A 3WRYC 3RH0A 1UEJA 1VBNA 2V6BA 3KQYA 3OFJA 4GMFA 4H7HA 4M1TA 1GG5A 1PK7A 1GEGA 5KKNB 3NHFA 4O59O 2IX3A 1YVUA 2PEZA 4DIOA 4BB0A 4FMCF 1WU8A 5EHXA 3L93A 1U8XX 2XZLA 2AHOA 1Q5PA 1QR2A 2VJAA 4BAUA 3FPSA 5K0EA 1LDYA 1BWPA 2R60A 3NHJA 4FHGA 4EATA 2W2QA 3EJWA 3ME5A 1H2BA 1MB4A 3KB1A 3ONEA 3MGGA 4KMSA 3TX6A 3KZKA 5JHGB 1RC0A 3VZPA 4TSFA 2ZAIA 4XWAA 2X9LA 3BSFA 3R7NA 5C8YB 1WCV1 1TM1E 3A3PA 2BBTA 1DJOA 3U9LA 3NIGB 4UNPA 4D9MA 1CUBA 2VP4A 2VYCA 2BH2A 4AVYA 2W6JA 1E64A 4LFCB 2R8XA 2J59A 3VU9A 4E14A 4YR9A 1J2UA 5KJ1A 1BSVA 1C50A 1S7CA 3MWYW 1E7RA 1OWLA 1QANA 2RGGA 3GFVA 3H7AA 3OPQA 3PDHA 4P86A 4EPWA 4KN6A 1I3LA 3FB4A 2EZ4A 2W90A 4D4JA 1IOVA 2PXAA 3AVUA 1T2UA 4A0RA 2CNOA 2WT8A 1E2BA 3T95A 3BWDD 3WO1A 2ZK7A 2BOVA 2FX5A 2XT0A 2YC2C 4MI1A 4YMVA 5HVNA 5JAZA 4HPWA 4NZOA 1P77A 2FDXA 1SRRA 2O9JA 3R0IA 4X1OA 3EF0A 2VA9A 4CCSA 1P2DA 4QGGA 1FXWF 1U0SY 1QBGA 3DPIA 1FFXA 1JLLA 3HJRA 1PGPA 4PZUA 3KUDA 3V2UA 3PKJA 3UA3A 4PC2A 3P9SA 2CKDA 2CNWA 2OOSA 1OB2A 4GLBA 4RY8A 5DI3A 4HQRA 4C4TA 2I4RA 1MD9A 4MW5A 3OFND 4LPKA 2QMQA 3FY4A 5IARA 1DJMA 2YY6A 3PGJA 3UB2A 2DE0X 1IOWA 4TRNA 2KE5A 3MXOA 3RTEA 2DQKA 1U98A 3IDOA 5JSYA 1W25A 1RLIA 1R0WA 1T2EA 2AZDA 4RK1A 4XH9B 3VGPA 3SVLA 1S2LA 1YZFA 3IUPA 2OYRA 2H18A 1HDRA 4BNXA 2HLPA 4RFVA 4U2KA 3GQBA 4I1RA 2HMVA 4HZGA 3OJLA 1MLDA 1OPRA 2WNSA 1WEKA 5HYVA 5FBHA 3KHSA 2Q28A 2ODNA 3L1VA 1LB1B 4X85A 3VUEA 3SBXA 3R9KA 2Q3FA 1ZD5A 2IV3A 4GP9A 1RRVA 3GLGA 5IVHA 1NY6A 2VJCA 3IKLA 4GLLA 1IAQA 4YJGA 2A9JA 1RQ2A 1LLCA 1YMVA 2Y93A 4TS4A 2FUEA 4DCJA 3IEPA 4TTSA 1FFAA 4KRYA 3JYLA 2XT9A 2GZDA 5KYYA 3ZCQA 2Q46A 2QRGA 1Z7WA 2FQWA 3GLFA 2FSPA 3G89A 3PD1A 5AHXA 2E7ZA 3ZEIA 3UXYA 2AI2A 2Q1XA 1TA4A 3AXTA 4JFAA 1P0QA 2XNKA 4XUGB 1YSCA 3Q8XB 5FLYA 5CEEA 2W2KA 3O74A 4HRVA 1E2EA 3G2OA 4HDMA 2X7HA 4P2BA 3OEHA 1WP4A 1TPYA 2O2EA 4CV3A 3CNHA 4I1OA 3STYA 4IVRA 1YHZA 5KYUA 4B74A 2XGOA 4ZOLF 1R0KA 3B12A 3TEJA 1WSDA 1IMOA 2HTFA 4ZI7F 1GILA 2GLUA 3V1MA 2WPNA 3WI7A 4GYYA 1QKKA 1QQAA 5K3SA 3S7ZA 4JVOA 1IM8A 3Q3VA 1YZKA 4JKYA 1QYXA 4EEZA 2XMSA 2RGDA 4JLBA 4MCAA 3QVOA 4IYJA 2OMEA 4LV8B 2FWIA 3IQEA 3O82A 1J9ZA 5JNUA 1O6BA 3C3CA 4BNKA 4PAWA 1FYDA 1S3SA 3OWOA 4D5GA 2W2XA 4LJYA 4MK4A 4RCVA 1C81A 3RKSA 3GK3A 4LYGA 3OQBA 5LIRA 3FMOB 2BMJA 1KJWA 4AZ0A 1H65A 3AFMA 4B40A 3RD5A 3SIPA 1H1LA 2P5SA 5DLPA 1G9TA 3ZEAA 4I14A 3TPFA 3ICWA 3WK4A 4BZZA 1E69A 3R3UA 5DT9A 4HAXA 4R84A 4C0SA 1WNTA 1A95A 4URVR 5B37A 3JASB 5BSGA 2OAP1 4C0KA 3AIKA 1NVKA 1KARA 3HVUA 4CT0A 4YRSA 1AGYA 4IDHA 4OHPA 2X77A 1R0LA 2XOEA 4ZOAA 4G4IA 5AJUA 5CFQA 1P5JA 1IN4A 3RSHA 3TO5A 3WWEA 1WRBA 3P0JA 2MSDB 5LBTA 3KYIB 4BCDA 5MF6A 3A9WA 1UKZA 3QI2A 1FLNA 2IY8A 3KT6A 4M36A 3VKGA 5BV2P 1U8ZA 2BGUA 2CLKB 4DZRA 3UIEA 5ERXA 3E5HA 1HETA 1LBQA 3ZY5A 5DTJA 2F43A 1ISFA 2IYPA 1P19A 3OE7D 2IHBA 4AK9A 3K92A 4C7OA 3CW2A 4JC4A 2P3LA 4FZ3A 5A71A 4YY3B 1J1UA 3I30X 1ZN7A 4EY8A 5CBKA 4Y18A 3WGLA 3K4QA 1PGNA 4M9XA 5JH7F 1EBUA 1O6ZA 4D6YA 2E1PA 1YD7A 1WB5A 4J7XA 5DTEA 121PA 1DEAA 2W93A 5JQWA 1PX0A 3K6SB 5CM8B 2OXFA 2DFNA 1J00A 3D4OA 4KZKA 4MYSA 5BWBA 1UBTS 4J7UA 3CRVA 4C5CA 3S2IA 3THYB 1Z2OX 3E3MA 4CL3A 2BMAA 1JKFA 1GNQA 1YFKA 2IY9A 3L6EA 2A5DA 3QE0A 4MA4A 5IK2A 3W5SA 4EB8A 5KWIA 1P1HA 3U1BA 5B3LA 3P9PA 2LP4Y 3OA0A 4F56A 4LOKA 4DCGA 3CT4A 3I64A 4DBLC 3BIOA 2G0TA 4BO7A 4U2GA 1J99A 1A2KC 4NU8X 5FPQA 3TQSA 3HH8A 1TQ8A 1UPFA 4S2UA 5DWQA 1ZC4A 5ICMA 4JMLA 3CLUD 1SD2A 5LYJA 5K0GA 1W5FA 2H5JA 3H9BA 4AZVA 1JEYB 3DJYA 3TW8A 4ZIRB 5B64A 4NCIA 1FZQA 4Q9HA 3CM0A 5FORA 3QQ5A 5CJJA 3QEBZ 5JPIA 3IV7A 1A4UA 2REQA 1U0TA 3M3HA 3QM1A 3TIVA 3VYTB 3WZ2A 1ODKA 3ZX5A 1JP7A 1AU9A 5EMNA 3VO8A 4G2NA 1PK9A 4XVHA 3EXHC 2Z9CA 4JUFA 5J5CA 1XF1A 3I1IA 4CG1A 2P9QA 4XQ9A 3NFYA 1ZKDA 1ZLXA 3OA2A 2D7CA 3KU4A 4E70A 1DHTA 3PGLA 5JWHA 3A3YA 4J0FA 1RQGA 3Q2KA 3HJHA 2TYSB 16PKA 5KNBH 1J33A 1F2UB 1I6WA 3LQYA 1XFDA 2NU8B 1M0EA 4ZCPA 4CF6A 4HXYA 4DW8A 2PUAA 2ZUUA 1TT5A 5AKEA 3GEGA 4L95C 5HDQA 5ELMA 3D8RA 3ND7A 4ZGGA 2IYLD 1KO5A 2QZ9A 3QEOA 2GFIA 2HJ9A 4M9CA 1G3UA 4MEJA 4RD6A 3M5CA 4EK9A 5IDXA 5DP2A 4KSYA 4FE4A 1QYIA 4BHTA 1NRWA 1EJ2A 3VBCA 3U4MA 1XBTA 2V8BA 4Q9LA 1JIVA 2VYQA 2AG1A 1Z4MA 3NBZC 2N1MA 5HCIA 4ZQGA 5HIIA 3FI0A 2IEAA 5FO1A 3B8EA 2IHKA 4RSGA 2GAIA 3RTBA 2ZYRA 3OTQA 4AL4A 4G23A 1EWQA 3T3IA 1VJ5A 2PBLA 3KYDA 3LYUA 5AHKA 4G85A 3T1QA 1N6OA 3BGIA 5CJ2A 6REQB 1OYOA 3PLNA 1IZYA 4NYIQ 4ZVKA 4BLTA 1QRTA 3VNVA 2C7RA 5F2OA 3HK2A 3U40A 4KH1A 1TLTA 1Q77A 1ADJA 1C7FA 1DTWB 2BMDA 3NC1C 4DL9A 2H0QA 2Q41A 5LLTA 1G8KA 2CXTA 4CKYA 1JLHA 4AM8A 4EH1A 3LQRA 1YC2A 4WX2B 4MYRA 1S3GA 5AM0A 1BKDR 1CUVA 3DW3X 2BFFA 2GJKA 3IT2A 3GLRA 2IKSA 3KE8A 3R6DA 3W2TA 3AFHA 3CEAA 4OU4A 3HLTA 1TO2E 1X1TA 3Q40A 2RHOA 1ADBA 4GOXA 5ENDA 3U6BA 4H77A 5BYAA 3GDGA 4YDRA 3HXMA 3GVPA 3PE3A 1ISGA 4LDZA 3E9NA 1K75A 3OHMA 2I2BA 5FLEX 4I50B 2ZETA 4NZMA 5INTA 3ANXA 3KRTA 3KV3O 4XR4A 3A2NA 3QOWA 1JSZA 1VL5A 1LW6E 2PRJA 1W19A 1TM4E 3DP7A 1YL7A 2Q1YA 2R1VB 4CMEA 2B9VA 5CT6A 3IUEA 4EZIA 2B4TO 1OVGA 1L9KA 2EWWA 4KB5A 5IKPA 4D74A 4JLPA 1YDGA 2B1QA 2V7QA 2PJZA 3VVBA 4I8XA 4LZZA 4WKNA 4O2AA 4QU0A 5JSHA 4E22A 3CRRA 3NASA 3NX4A 3VR2D 3LY7A 2OXTA 2IW1A 3WLJA 4CLRB 1ODCA 2YJ4A 1ST2A 1H05A 3IIEA 4AJ1A 4DPLA 2V3CC 3CVJA 4DR4B 3ZXSA 2F00A 3E9EA 1USGA 3HKDA 4OVKA 3NIBA 2WD7A 1IWPB 1OILA 1CETA 1QGAA 4HCJA 4ISCA 2JLZA 5CTJA 3JQRA 5EJ9A 3DDZX 4WTOA 1PZEA 5CA0A 5JADA 5IN4A 3ADBA 2JLAA 4HSEA 5AQEA 2ZBRA 1NP3A 1JBKA 4LHVA 3H8WA 1DCKA 1AQUA 4LZWA 4ESHA 1FJ2A 2HCFA 2C83A 2F1RA 1DFHA 3MTQA 4TM7A 4MVYA 3HRKA 2K6GA 2ZCUA 3AG5A 3KR1A 1HE3A 3OEEA 4N7RA 1T5BA 2XCOA 3JAMA 4EARA 2XF2A 1RAGA 3ANSA 4J9VA 4HJRA 4RWZA 5MGNA 3W4KA 1YBAA 1E1DA 2ZSFA 3GHHA 2XJ4A 1U81A 3ROXA 1RXYA 3L1IA 2BGLA 2W0MA 4QUGA 3H2IA 4H27A 1L1FA 5K6AC 1CRPA 5EAIA 1N9GA 1GNSA 3RHSA 1W29A 3UAGA 3L0IB 1YR2A 2OK7A 1Y63A 4OJTA 1NI3A 2NSHA 5FXMA 1AXEA 3P4XA 1QIJA 1BG6A 1EZZA 3C5HA 3H3XA 5KOJA 3R7SA 4AWAA 2JHPA 2QS9A 2QRKA 5CH5A 3KAJA 5TS2A 1X74A 3GZTB 2YVUA 4FB5A 4Z0HO 2D62A 3HR4A 4YH1A 4HL6A 4ZI2A 2G0AA 5MFPA 3K0EA 1G9SA 4IBOA 1Z73A 2FAXA 4K28A 4LVUA 1ONBA 5ALRA 3R7LA 4B87A 4EHAA 3AT1A 3G8AA 3KHKA 3LRPA 3KJQA 1MP0A 1JWBB 3O47A 4Q24A 1HQDA 2ID8A 4QQ8A 4EI8A 1E96A 1HG1A 1LRLA 3MOSA 1CVIA 3N3BC 3EIOA 4FEGA 4QELA 4WBNB 2FDCA 4DSNA 4ZP1A 1U4OA 4EAQA 2D1FA 4ND2A 2ATIA 5J3JA 1UZUA 4N03A 3E7PA 4BFVA 3PC7A 4PG7A 3QLVA 2A0UA 4N5MA 3T3PB 2CFSA 4KACA 4X54A 5FLXA 4BUZA 2W9XA 7REQA 1YKGA 2V5AA 1N2IA 1Q15A 3AW8A 3HCFA 4HAWA 4XRGA 3EIHA 1O54A 4GWKA 4YROA 1G3MA 3L9XA 3V3KA 1UKYA 2H5EA 2JI6A 2UKDA 3FBWA 3PA8A 1R0CA 4RGBA 2XCIA 4I2VA 4DV7B 5AW2A 2O2CA 4DR1B 1WHTA 2VDQB 1P4RA 4IJQA 4MA5A 3GVXA 1WCIB 4IUYA 4EY4A 1H0SA 4YAFA 1CEEA 3IVCA 1TGVA 3N0TA 2B2XA 1ZOPA 2ZJ4A 3LKBA 1KJIA 1OCEA 1ZNYA 2Y3IA 3LC1O 5BNWA 1JEEA 4IKEA 1BOFA 3QPCA 5CYPA 3PPXA 1Z4OA 1H2EA 1XC7A 3WYGA 2OEPA 4EJ0A 4LRTB 5EHIA 1C3VA 2PJDA 3D4LA 5EGSA 4OJQA 3EDCA 4Q03A 3RBZA 3JZMA 4IAOA 4DLZA 5E7QA 1BIFA 4JT4A 4ME6A 4Y1EA 3QVJA 3WK9A 4YAUA 1DC6A 2H1RA 4QVGA 1NGSA 3L0DA 4JEIA 3ANMA 2BDUA 4U1RA 3FE2A 5TPWA 3SJUA 4IHQA 1I2MA 3U4QB 1DKOA 1BW9A 3N8DA 4RFSB 1FNDA 2PVCA 1U94A 2WKWA 1UDXA 4DLUA 5E2IA 2R97A 1WUJS 2IP2A 3SHOA 1PSZA 3B38A 3CJQA 3WGNA 3TJZA 3CKLA 3K3PA 3GEIA 2ZT5A 4W9RA 4GM4A 1DQYA 4Z9FA 3X1KA 4D41A 1I7SB 3K31A 3MOGA 1L5HB 1N34B 1DBSA 1U7HA 3MCUA 3ESYA 4NFLA 3ILYA 5CLFA 1C14A 1XCOA 3ZLTA 2WM9B 3THWB 1KR2A 4B4VA 1WR8A 2Q50A 5EXDA 4M0DA 3CMCO 1UBEA 3VV3A 4RTSA 2VHJA 4EJMA 2I3BA 2QLTA 1N3IA 4JVNA 4PTLA 1K4KA 3DCIA 3Q8MA 3K0FB 3I28A 4ONEA 5FAXA 1MHPA 1SCJA 3TRFA 4C3OB 3GPBA 4KBYA 2P6RA 3M6VA 1DDOA 5TQVA 1YTLA 4CKWB 3GRCA 3RYIB 3G3EA 3TBHA 5HGXA 5FWXA 4ZOQI 1GTJ1 1PWEA 1ZBDA 4ARZB 4KPUA 1I1NA 1TLFA 5K0JA 3VR4H 3L8FA 5EP4A 4B35A 4BE7B 3HDHA 1A27A 1ZUNA 3BQNB 1DX4A 4TMYA 1YBVA 1EP2B 1TGYA 1H9BA 1ZD4A 3PWZA 1P60A 4JYAB 4WECA 3T3MB 3ZLBA 3DZ8A 2BFNA 4YLEA 3PJEA 2VP9A 1KPIA 1R2QA 4ZCIA 2NYUA 1YQUA 2OUIA 1Y5MA 4RZHA 5ALLA 1EWYA 1D2MA 2DHEA 3NO4A 1L7BA 3SYLA 3VFDA 1KY4A 1ZM3A 4E5NA 5IZCC 3CNEA 3AERA 2HEIA 2GJ4A 2PZJA 2VXBA 1T0HB 3ABQB 4GGMX 1NZJA 5A02A 4MUKA 1GL9B 1RU3A 1OPXA 1J25A 2YV1A 3PNPA 2F1HA 4HMOA 1ESDA 1C4KA 2WFLB 1W49A 2HM7A 3F2VA 2COUA 4HG2A 4QPNA 3QXCA 5AKYA 3S40A 4UTVA 4O4JF 1RVV1 1JH9A 4W8GA 2F8SA 2NV2B 4DTIA 1YJQA 1ZUWA 2VRBA 4Z4HA 3FLBA 4MYDA 2WA1A 2PL9A 1E7SA 2ZSHA 2XUJA 3LBAA 3ORYA 1ZRNA 4JOCA 5DNWA 5K3FB 4BATA 4RSMA 4BNIA 5T3UA 5H16A 4AX4A 3OOSA 1GGKA 1TMYA 1OHHA 1F7UA 1JDBC 3OZWA 1L7AA 1CP2A 3NHYA 3AR9A 7YASA 4ZK6A 1C1DA 1UOOA 4FNGA 3H42B 4DZTA 1ZNZA 3DVQX 1RMQA 4XSGA 4F6RB 1XCJA 3TSOA 5GTDA 4CXMA 4MWDA 3OM8A 1FE8A 1QF7A 3G5AA 4ZVUA 5JALA 4LY6A 3AUYA 3DOEA 1Y89A 2P9JA 4KLAA 4K8OA 3OQNA 2XX3A 3C8DA 3GP3A 4DGQA 3AUJB 4M1EA 3AKZA 4L28A 4LMPA 4TLEA 5CA1B 3H18A 2XDQA 4I9UA 1TM2A 3P0IA 3A9TA 5J2UB 1FLDA 3SYMA 4X20A 3Q5EA 3JQFA 3AF0A 4ZKDA 1E1CB 2HT6A 2YS7A 3D5EA 3MK31 4DLBA 3P2OA 4KQKA 1KQ3A 2IHJA 5CW1A 4R8VA 4Q1BA 5ENZA 2WD8A 2YXNA 4XR9A 1Y37A 1U0BB 3T1TA 1IEVA 3HI4A 2YHIB 4LXQA 5IJWA 2YTZA 3MA0A 3BFPA 1R0BA 1YQWA 5DYGA 2OG1A 2LRHA 1MAWA 1XTUA 2Y1XA 3TJMA 3RWOA 4AIRA 1Q92A 1M72A 1V16A 1JR4A 2XR1A 3I1JA 3LIIA 3UGKA 4EYKA 5JWOA 4NBNA 1G8YA 3SK0A 1YA8A 1C3OA 1QDUA 2I2FA 3SIXA 2NW6A 4DCNA 1D2NA 2PUDA 1J23A 1DE0A 5BY2A 2WTXA 1Z5UA 2XE6A 4E4YA 2I4OA 5L4SA 2HNKA 2CVZA 1T24A 1Z4JA 1PNTA 2EBWA 3ACDA 4ZRMA 1EVKA 2HK6A 3Q7RA 4IFTA 2H29A 1SHZA 1XMJA 2VDWB 3IV9A 3FSGD 4OQLA 3M6UA 4ALLA 1CE8A 2H92A 5A2QA 3EVZA 2CDRA 5E2BA 4TLAA 3REFA 1JB1A 1U3FA 2VPYA 1NMZA 1Z45A 4P7KA 3SBEA 4ZCRA 2EP7A 2BISA 1GDHA 1SIWA 2VDRB 2WFAA 3L8ZA 4GKBA 1CY0A 2P1RA 4Z7JA 2JARA 3BK1A 2VDUE 1B26A 4A23A 1XXHB 2BRUC 3HYRA 4WKGA 3K6RA 3M6IA 1HE4A 1ESZA 3INYA 3O4VA 4FNOA 1G18A 4MGYR 3CW9A 3LQQA 3WL4A 4GRDA 3WZLA 4L4UA 2PA3A 4YLYA 4DLRA 5FOVA 5ALTA 3RS5A 5IDQA 3BCHA 3T3GA 2OPHA 2AWNA 4F21A 1E3TA 2FGKA 3TB6A 5CM9C 2I99A 3ED1A 2WAOA 3ZVMA 2CHUA 1NI4A 1LPNA 1QTRA 5HFAA 5JCJA 3MINB 3BA6A 1RR6A 1RXEA 1RP7A 2C42A 4KVFA 1TF7A 4M9UA 2O8BB 4G1FA 2FMIA 3X1MA 4BN0A 1L5ZA 2KM1A 2OV1A 2AYZA 3JARA 3LWBA 1ZMRA 3HNOA 2M6KA 4F91B 4GRAA 2Z04A 1GD1O 4B32A 5KPDA 2GB4A 2O5VA 2G8NA 3DNFA 1GDDA 2HHAA 4P7JA 1PQYA 4FIDA 4GNKA 5AK3A 5TRTA 3K5HA 1SOMA 4DUZB 3RS7A 3GAFA 3KKOA 3WLKX 3L7AA 4D7AA 5IUNC 4NXNB 3L07A 4E5SA 4FB4A 1C1XB 1PLJA 1KERA 1ETHA 1R9GA 3AFNA 3JAKA 3BMCA 4RVHA 2JHFA 2QPOA 1XZDA 4PE5B 3PVZA 2NXJA 1YV9A 2DUWA 1H4SA 5B53A 1RWNA 3HR8A 3HM9A 3DLTA 5KYTA 4UUOA 1U7OA 2JZCA 2J9GA 1P4AA 4FSDA 4ZXPA 3NU1A 2W6CX 5EXSA 1X7HA 1NQOA 2FSVC 3DMPA 3KJEA 3F7OA 4OXYA 3RRXA 1UCFA 1UXOA 4IIJB 1K6IA 3OO1A 1UBHS 2PQMA 4J0QA 1Y3BE 1ZUHA 2HV9A 2IE0A 3IUYA 1AJEA 3GJTA 3UMJA 2V5VA 3KKEA 2CW5A 4ZAFA 3NHSA 3R8XA 2OK8A 2WU0A 1YOBA 4YO8A 4PEVA 1YDHA 2OD2A 4IJWA 1ISPA 4ENSA 2B83A 3DBVO 3MNFA 4WCVA 2QQ0A 1GDTA 3BIWA 3G0OA 5UKDA 4CKCA 5IT9A 2DETA 1KORA 2B8WA 4Q3OA 1IJFA 3EQ9A 4KLNA 3IAXA 5AVVA 4MI3A 2H31A 2LZ0A 5CLIA 2BEWB 2DHQA 3DBLB 5AKKA 3HCOA 5AR1A 3T7RA 3CUWA 3NVAA 2A86A 2GK6A 4IIEA 3W7VA 5F1YA 3UGTA 1ZM9A 1FFEA 2FSFA 1B1CA 1O57A 3F4LA 1CY1A 2IUYA 2VQDA 2W2TA 1J8FA 1PFQA 3LOPA 3PXBA 3N1UA 1E6UA 3SFZA 2DRIA 1QM5A 3HB7A 1P9NA 2QU7A 3DLIA 4CMGA 1J2YA 2ID7A 2FW0A 2IELA 4P4LA 5AW3A 3T34A 3SSMA 4JJEA 4Q39A 4BLOA 3D6UA 4J3NA 2F3SA 4BMXA 4CRWB 4IGEA 3L8GA 4Z8YA 3Q8LA 3R7AA 3WLRA 1G5FA 3CLUC 4I46A 5GJCA 1RRPA 2POQX 2AJLI 5D8DA 2OYSA 2AJDA 1NY5A 2IH5A 2J0VA 2P6PA 2TMYA 1A4IA 5IW8A 3S4YA 1MA3A 1KQFA 3GRVA 2GBIA 4QLBA 2IZOA 1V11B 2ORVA 3IDFA 2JFVA 1SOWA 2QW0X 1HL7A 5D00A 3PNMA 3F8TA 4EVIA 2PJRA 1IBLB 2Q3BA 1PSWA 1QZUA 4YAWA 5AUOB 3K8OE 1W36C 1OXVA 1O5IA 1N2JA 3OWXA 1F14A 1Z18A 1O4WA 1X1BA 4KYVA 4OUKX 3HCPA 1TKAA 5HRAA 4WXHA 4AKIA 3DFZA 3SNHA 3S1SA 5LR6A 3PT5A 3HQ4O 4FFDA 4X7RA 3C7CB 1GPUA 2Q4TA 2Q49A 4OI4A 5TMDA 3ZVKA 2NIPA 1OZ0A 1WSAA 3EOZA 3NBMA 4LK2A 4EPYA 3K9NA 1P1CA 3IVMA 2GETA 4GQIA 2VKQA 2OCIA 1KQPA 3ILVA 3O8OA 4RV4A 3RG8A 2HIGA 4IJMA 2O59A 4R6WA 2Y99A 1RWKA 2I7CA 1DO0A 4BNJA 2Y71A 3HVRA 2PMKA 2Q1TA 4J3JA 3GD5A 1EK6A 3NIFB 2GYUA 3D8HA 3WL5A 2QZSA 1V7PC 3F96A 4HQNA 4TXNA 5CPFA 4KDCA 3ESDA 5FDFA 5LKAA 1YGYA 5KPJA 4DR7B 4P83A 1RYFA 4QFMA 2XH8A 4PANA 4U8GA 4DHEA 1RLTA 3KVNA 5AICA 2HDOA 1FUKA 1ESCA 4WZAE 3LC0A 3KTOA 4QHSA 1EFRA 1Q0QA 2F1OA 1DT3A 1O95A 3DD5A 4I36A 3U7IA 2UVPA 2WF8A 3DMYA 4JXJA 5C0OE 2FR0A 1KU6A 1N36B 3K0SA 1V3QE 4YX9A 1KSFX 2AXEA 4FJ0A 3T1NA 1K89A 5AUNB 2HXYA 2ZIZA 2NSYA 2YHUA 2WYWA 3B89A 3L05A 4FFOA 3RYTC 1Z6XA 1ZH4A 4FHCA 2VZ8A 4NYMR 5TEVA 3RVNA 4EENA 1VLMA 3KJFA 4CF5A 1OLUA 1O08A 1YRWA 2XE8A 1EHCA 2OORC 3P8ZA 2QVZX 3EXEB 3OKPA 2B5WA 4JJIA 2XYRA 4XD7A 3C14C 3ZH9B 3SSNA 2QRVB 5ARDA 3RVPA 2R6JA 3E3AA 3GWZA 2XNDA 2VDKB 2G9UA 1OGIA 2PKWA 4PPNA 1KY2A 2ZBVA 1UDWA 3SDBA 3E03A 3U13A 5C53B 2H1CA 1C1YA 4MW7A 4AWXA 1ZRHA 4J43A 3GRFA 2BGMA 3VMFA 4D43A 3FW1A 3V9AA 1TU0A 3FBTA 3A10A 4S05A 1G3RA 2XWBF 1W1WA 1A5SB 2IPAB 2VJBA 3ANNA 3B60A 4G5SA 4IO0A 4Y30A 5EYPB 2A58A 1KDVA 1PHPA 2HWUA 3IP6A 1IZ7A 3UJBA 5T8KC 2P78A 1YHNA 2GDJA 1BKSB 3MBOA 5CMLA 1Q83A 5IXSA 4Z4EA 4ZKEA 4TYPA 4DNQA 2QYOA 4BP9A 5AK5A 3AJRA 4ZEWA 5A1JA 4UD6A 2P2SA 5FBZA 1KH1A 3UWKA 4M83A 4A73A 3O95A 3ROZA 2YKGA 3SR0A 3WHKA 4PU0A 4RLHA 2IYWA 5L3QB 2IEYA 3D54D 4IIGA 1Q1AA 1LVGA 1N1DA 1T9CA 3H11A 1EFCA 5ARBA 1Q19A 4F71A 2NZYA 4PLCA 5HX7A 5JZ9A 1OA1A 3QTLA 2ZT7A 1XZQA 3VR1A 4I4CA 1M9NA 1OFTA 1PS8A 2HLDD 3TCKA 4RENA 4AZWA 4RTOA 1IN8A 2H48A 4FNAA 1Y1KE 4X44A 1SWWA 1Z39A 2LIVA 3QY0A 1FP4A 1VSUA 3JQ8A 1NQWA 4F92B 1JKMA 2OXEA 4CYMA 2QTVA 1E5DA 1M1YE 2ATVA 4P93A 4EJ6A 2A4MA 3TLGB 4FNMA 3D3QA 4PWZA 3HSKA 4YRBA 1IN1A 3R9XB 2Q0XA 4JSYA 4QO7A 1S89A 2NXEA 4FD2A 4RKQA 1WF6A 5COBA 4WPGA 2FMHA 4ZOEA 4ZI3A 3AO0B 3AW9A 1ITZA 1IUNA 2Q6IA 2B0CA 4FU0A 4L8WB 4A27A 5CFOA 1GJRA 1DRKA 2PX0A 2ZG6A 5CLJA 1CB7A 1O87A 1OUMA 1P5RA 1Q0HA 3O3NB 3PNSA 4AUEA 2MR5A 2XBLA 3HRHA 4CQJA 1MZVA 2QN8A 2I7TA 2OZKA 1TLLA 2YJ3A 3LE8A 3TTWA 2DVMA 5JRJA 5KYWA 2GSDA 3LOUA 1FQKA 2HA6A 2ZIXB 3H9CA 2X14A 3PNKA 3KKLA 4R81A 4N4AA 4D8VA 1NW5A 3GFRA 4P7FA 1CNEA 3OPVA 3DL4A 5FBKA 1A4XA 3NHBA 2EX4A 3I2HA 1T2AA 3PCXA 2ZP1A 1KGDA 3PGMA 2Q5FA 3UAVA 2E9SA 1YRHA 4D3YA 1EJBA 1T29A 3EWIA 9LDBA 2C97A 3TB4A 3MJCA 1CR2A 1E0KA 2ZRBA 3HJGA 3QIVA 2V6IA 1IPEA 3PHBE 5BSHA 1G66A 5IT5A 4G26A 3B85A 2R86A 1EYZA 1UJ6A 2QL9A 3KLMX 2YRFA 4L3VA 1SUAA 2X0DA 3RK0A 5L9AA 2C2YA 3G6WA 3JD2A 1RYDA 4ZCMA 4CR8A 1EKXA 4KO8A 3LDAA 2C61A 4ML3A 4H17A 1W85B 2CCKA 5FPYA 5L6LB 1F0PA 1DMRA 5AM1A 1KC1A 3G1UA 3JQAD 3U44B 2WZCA 3MTJA 1I94B 2G28A 4YLGA 3ZGYA 3NOQA 2C59A 4B4DA 3RADC 3R3SA 3UXMA 1H9CA 1EM8B 3PD0A 4CL0A 2PGIA 4ZV4A 4LX8A 3CX4A 1E4EA 1F0NA 3L8HA 1VDMA 5HIJA 5LZ9A 2C7QA 4FZJA 4B47A 5DLEA 1WV1A 1UWKA 2CSUA 1A9PA 1XLTC 1WF3A 4R2MA 3V5NA 2ZE7A 3M34A 1RZUA 2A84A 2YWCA 4LAFA 5A3VA 2W6ZA 3DC7A 2WFMA 1N33B 5CVEA 1WP9A 3N7AA 1RHQA 1C7ZA 3B1XA 2C7OA 3E22A 3NOOA 1C9NA 3F71A 2KX7A 5FT9A 1F6WA 3LUKA 3WXMA 2XI4A 2JJ2D 4FI3C 3KIPA 4QDJA 1N2ZA 4XB2A 3BKWA 2Z2JA 4FHEA 1M6VA 5DDIP 4MULA 1C2TA 4KQMA 2Z9DA 5F4BA 4F9GA 5IWCA 3WXBA 2CNBA 1XNQB 3IGFA 1JHOA 3V80A 3RUEA 4BJHB 2B7LA 1W34A 1LJ8A 2J9RA 1PTJC 2XCQA 1H6CA 1WMBA 3CH5A 4ZOCA 2PANA 1R8SA 2QRNA 3KTAB 2EGGA 3SJBA 2GPSA 1DARA 3P0FA 4HSGA 4QJ5A 2R84A 3FROA 1QE3A 2MSKA 4JJGA 1UMKA 2ADMA 3WB1A 4AQYB 5C8DA 3LPCA 4MVCA 1BCRA 4CQLA 1VE5A 4KMOA 4YCDA 2JFQA 4RXTA 5JYBA 5MFZA 1NBAA 3ZDZB 3MLAA 4R16A 5I9MA 4CFYA 3PFWO 4CM9A 1W4LA 4RE5A 1WULS 1XMSA 4PC1A 3W4IA 3PF9A 4HHEA 3L1KA 1U3GA 2QXTA 4KXMA 4TV9F 4PX9A 3CN7A 3AVYA 4RD2A 1W2WB 2HU8A 4YUVA 1P29A 4L8FA 3WVNA 4P3PA 3T0FA 3VOAA 2F1IA 3VR6A 1QHHB 1O9GA 2GZAA 3EGDB 4BLVA 4IMPA 2DBQA 3JWGA 2VN8A 4CHGA 4FQ7A 1N0UA 3AF2A 4E4RA 1SKQA 4MVJP 3K20A 2BTQA 2CBXA 5J1TB 4EG0A 1B73A 2C00A 1XRSB 5ULLA 2P2YA 4HDOB 2QU8A 3JQEA 4JUDX 1B7GO 2DKFA 2HSWA 3G9TA 5F12A 4B3IA 3HC7A 1MCZA 3LYLA 5G02A 2FI1A 2IS1A 1W0CA 3E18A 4KXXA 4O4HF 1SULA 1E5XA 4R01A 5BN5B 2JLUA 2ESRA 3KKQA 3LP8A 5T6MA 3WLNA 1X13A 4OQEA 1AGXA 1VLJA 1RAEA 2W2VA 2EG5A 2P9EA 2RGCA 4QJ4A 4O8ZA 1VJ0A 3KL4A 2Z1DA 1L5YA 4Y6RA 3ZY2A 2QD5A 4H3KB 4HI0E 4XYMA 4L3OA 3H9QA 3G2PA 4XSHA 4FBLA 4TVOA 1U3TA 1XALA 1BFUA 4AN4A 5I7FA 3KPYA 2BEUB 1ST3A 3HG7A 5HS6A 2ET6A 3PPWA 4BN5A 1KBOA 1QAQA 1HBJA 4X95A 2F90A 3QITA 3T35A 3H5OA 2WQZA 3TOXA 2DEUA 4NDNE 4OHRA 2WUGA 3WWOA 2V3VA 1IN5A 1RHJA 3C5CA 4IV5A 2O8FA 2QLMA 2IEDA 3E7XA 2OWDA 4OKIA 3I0ZA 2IOQA 2DERA 4ZYYA 3KPVA 4Z9XA 4GEKA 4PRZA 3FYUB 2RGYA 2C9DA 1AUXA 1DBPA 1Z82A 3KXLA 3GROA 4PSUA 5EJ2A 1PR5A 3B51X 3GFFA 3ROKA 5EP1A 1LQTA 1SQGA 4N18A 3B20A 2DP4E 1JR2A 4LGVA 4EGCB 3EBPA 3K1ZA 4IHJF 5LOVB 2R48A 3P20A 1X9HA 4IVNA 2AXNA 1XTJA 3OLQA 1J49A 2EWVA 3NPAA 5I5GA 3S2UA 1PRYA 5KNBD 3JYQA 5HJ2A 1KAEA 1NATA 1VL1A 1GEEA 1PZMA 5BMVA 2X8BA 4O1HA 4MAMA 1RT9A 3DEYX 3KUXA 3SC2B 4A8JA 4BO3A 1NXSA 1Y7PA 3MS2A 4HWGA 5H1YA 4UOZA 5EA2A 2OYCA 2XAAA 2Z4SA 4R54A 4NTZA 1YQEA 5LQSA 4O8CA 3KEOA 4GM0A 4JIGA 5JDCC 3VHQA 1U3UA 3IHLA 3CEHA 3T3EA 5JTUA 2ZM6B 2GEVA 4XCXA 2EDCA 2JGEA 3HZRA 4N7BA 2HA0A 4B7XA 1CV2A 2EQBA 2GCOB 3AEUA 3GRYA 4KXVA 4W1PA 4JI5B 3W0LB 1M5UA 2D5BA 4BECA 1VKRA 5H7XA 2B4KA 1GN9A 4EKEA 3DO8A 4TUYF 5JCXA 2VBFA 4UVDA 1P2TA 2WJYA 3PYXA 1GPJA 3H3JA 4DR6B 4DLXA 3C4JA 3P27A 4M88A 2ONCA 3R41A 4Q7MB 1JKJA 4GR4A 3RU3A 2XCSB 3LHDA 3KE9A 1QLWA 1TK2A 4U6SA 4G0UA 3NAZA 2FKNA 3NUQA 3UH0A 3WHLA 1AZSC 3GQBB 2J4DA 2BGRA 2IS2A 1PNQA 4HYQA 1J9EA 2R6GA 3KAPA 3KQQA 4V03A 4CIXA 2D0PB 4I4TA 4C21A 1B8OA 5CG1A 3GLGB 1UQRA 8ATCA 1U8YA 5MGBA 1KJYA 1P2BA 1RP1A 2PUHA 3EULA 3E1GA 3RAGA 4E4TA 1A7AA 2OHGA 3EVGA 4WI1A 4C4XA 5A4IS 4U9HS 3HYLA 3I9KA 1DUVG 1RRKA 2C84A 1AXGA 4G01B 1BFDA 2UXCB 1PS0A 1WDWB 3NB0A 4X00A 4BMSA 4D0LB 1HDZA 1OU0A 2WKPA 3ZD8A 4YAIA 2SICE 3KQUA 3HKEB 1V47A 3DE1X 3EGIA 3LQ1A 1PW5A 1N1EA 4S1NA 3OQ1A 1MJNA 3ZKAA 3TQOA 3IE2A 4CLEA 2BC9A 1WMSA 1YACA 2VYFA 3QKTA 4ENRA 3HXLA 3I52A 4O08A 1U8TA 2AC7A 3VYUB 3CR8A 1DGQA 4HDMB 3EGWA 4W5NA 4JGGA 2ONKA 4QDUA 1Y3DE 2QTRA 4H59A 5GJBA 5E2AA 3CZCA 4AJHA 3WHPA 4YAOA 5KYUB 2JEOA 5EC8A 2G82A 2FMKA 3GOQA 4KDRA 3RHTA 3ZQ6A 3MELA 5DEIA 3TIIA 2AH5A 3L7OA 1BXRA 4KSCA 5B4VA 3A26A 4I1YA 4AMGA 1HQKA 1P7PA 3PNLA 1WCXA 4OHOA 3TTVA 3GGJA 4EJSB 5LQJA 2PXHA 1FYEA 2O0MA 5JPCA 2JLBA 3ROFA 2YC4C 1BHQ1 4KW7A 1YS7A 5C3MA 1X3SA 2GCPA 2ERCA 3JZFA 1U1EA 5EIBC 2AEEA 3ZDAA 4WXEA 5B58T 4HXEB 4YRAA 1KP3A 1FMTA 1O9BA 3PYMA 1V8PA 3DXFA 1NM5C 2GN6A 3I1FA 2JIMA 3IVRA 1T4CA 2QN7A 5E9JA 1YVEI 2PH5A 5B7GA 2CXNA 1DAMA 2ZKLA 2VQFB 4L08A 4Z3OA 4QLAA 3R23A 3KJGA 4MW6A 1C30A 4GWLA 3PXGA 2KLBA 1MRSA 1VMEA 1M2VB 1DP4A 4L9WA 1RJ9A 3QFCA 4RK6A 5FQNA 4EHLA 3ZGLA 3ZG6A 2BFOA 3JX9A 4Q3LA 1GPDG 1NVVQ 5D2CA 2C20A 1SHUX 3E84A 1V0JA 1FC0A 4J90A 3ZZ1A 2F67A 2UZ4A 2E1RA 3DOJA 1QKIA 4JT9A 1F8XA 1DTEA 4EMUA 1ZGHA 3HB0A 2O7SA 5D6OA 3TGPA 4TSKA 3EXAA 2W70A 4DWJA 4NMWA 4XX0B 3CY6A 4QNRA 3LT1A 3S5JA 2XUAA 1OT5A 1Y7LA 3CZ9A 2F43B 3FWKA 5E3JA 1Q0UA 4FGKA 5JC8A 1QIKA 4RETA 4C7OB 1J07A 1DAGA 1BU8A 1IHPA 2X13A 5CYOA 1B0PA 4ZT3A 4CCAA 4Z1MD 2HMYB 1IWBB 2B6NA 1WD5A 1RBQA 3VAYA 2JFWA 1VB5A 1L0BA 1ZOIA 1YS4A 2RIRA 1K6JA 4MUFA 4MXDA 5GY7A 3EFBA 1EJ0A 2ZDQA 3IMFA 4JC8A 4PHTA 1GPYA 2AS0A 4TLLB 2HX1A 3Q87B 5LB4A 4G0OA 4WGGA 2W6PA 5FTNA 5G3YA 1WUIS 2HF8A 2Q0QA 2OFXA 3KFLA 2ACEA 1QYVA 1SY7A 1XN1A 2D2IA 3EVBA 3FR7A 3N2YA 4BV8A 1GVHA 5JWRA 1VB3A 2ZZMA 1R00A 4BKPA 5JSKA 4MGIR 4U3JA 5JSZB 2J7PA 5BWMA 3NWJA 2QY9A 3HCAA 3L7IA 3OETA 4NABA 3OESA 2R2AA 4IXDA 1M8KA 1EFVA 2H4HA 3GGSA 1SBQA 3BCSA 5FB3A 4Z53A 1BGVA 2ZJ1A 2N0SA 1GTVA 3ACBA 5J5VA 2EZ9A 2HRRA 3BL6A 4J1QA 2QRZA 1KMHA 5BV8A 1VZ2A 3DLAA 4DR3B 2P7HA 4FTWA 4EKIA 5LYJB 1WNFA 2O7QA 1KI2A 3TW8B 2DBYA 5L53A 3U60B 3C48A 3VTKA 3WYCA 1YB5A 2REQB 4CM8B 1DAFA 1I01A 2POCA 5FBLB 1M2WA 2QL5A 2XLBA 1E61A 2ZJ3A 4RA9A 4DJFC 2UYQA 4ZYUA 5HUQA 4AULA 3L9WA 2VC2B 1QHGA 1A3CA 1VKNA 1O8BA 2PBRA 3B36A 2E4AA 3VTFA 1SJ9A 4EHDA 4GC5A 3HUEA 3Q15C 4JLNA 1AKQA 2PUJA 4ZEOA 1PD0A 1Q22A 2PRIA 3TLBA 4YPFA 4UHDA 3UYLA 1XLWA 2QVCA 2PGAA 4JJFA 4IJUA 2QSUA 4NAHA 1OFUA 4IGFA 1HO3A 3RSZA 5BW6B 3G8DA 4PAQA 3T5PA 3U81A 1JU3A 3UKJA 4DDKA 3OBIA 1PJ4A 1Z2PX 2FRVA 3HNPA 3CVXA 2Q6OA 4OL9A 5AIBA 3ELWA 2WSLA 1DQSA 1GTMA 1JXQA 1LX7A 1TK3A 1B6GA 4MTCA 4R8LA 2O2XA 4DQ0A 5EVCA 4KQ6A 1V3TA 2DFTA 2H1IA 3HL0A 3FSEA 1U0GA 2PG3A 3L46A 1G7RA 1MAUA 4M6WB 5LMZA 2ZWPA 1DAHA 3IULA 1FU4A 1H2XA 3GXOA 3VOSA 2J5BA 3AM3A 3GIWA 4I1UA 3V8MA 3C5EA 3KAQA 3OJFA 1KSJA 4GZ5A 1W5EA 2CVOA 4ZC8A 1YUBA 2CV2A 4NDZA 1QHYA 1FQOA 5T64A 5C18A 2C7GA 3CSDA 2WYIA 4B6RA 2NZWA 1D9ZA 5GZ6A 5JAHA 2B25A 2P91A 2YXEA 2CUKA 2DM6A 4S12A 4HX9A 4P2GA 1X7DA 3NYRA 3RSSA 4DVJA 3TTXA 5BURA 1A7KA 3DWIA 2WNIA 5IKEA 2C1XA 3SS8A 2GOYA 1Z2AA 3GJ7A 1GGNA 2XQFA 2IWRA 3BWYA 5LZ2A 1MQ8B 1L7EA 2F7SA 3BXZA 1VG1A 5DEOA 1GHTA 4F4JA 1GAXA 3O8LA 1Y6RA 4F3NA 3DVRX 1MFPA 1FP7A 4C6HA 3PNYA 3M6LA 4L8GA 2WG0A 1E3SA 4CKZA 1D8TA 5AI0A 5KTKA 4TQAA 1QO0D 3AHFA 1OAAA 1VSQA 3OQIB 4HBGA 3X0DA 4EM6A 3D59A 1AQYA 1JNXX 2WTEA 3GELA 3K94A 5ITZA 3O8RA 1AXRA 1VM6A 1T9GS 3F6RA 4BNHA 1DIGA 5GZ1A 2GCGA 1AMNA 5F2KA 3EXG2 3UHFA 1A50B 3QKSB 4MPTA 2W0SA 3A37A 2JBWA 2HEGA 1X2BA 2EZUA 4BPBA 1GZ3A 3BWEA 3DUFB 3PV0A 4N3CA 3RE1A 3UENA 2C0CA 3CH7A 4M1SA 2B8JA 3N86A 3SHVA 3PUWA 4DDVA 1ZUD1 3H99A 3E81A 1DG9A 3P1JA 3TOCA 1LPMA 1IIRA 4HQFA 3RSFA 4MX8A 1PT8A 1BO6A 1NG9A 2WD7B 3OPXA 1G5IA 4M55A 5DLQC 1NIJA 1Y5LA 4D97A 1DC8A 4GIBA 1AKWA 1RM5A 3CR3C 2HA5A 3TD9A 3F6SA 4D4HA 1CUXA 4DIBA 4LZLA 3ZOKA 3BWMA 2CNLA 1XPJA 4DV3B 4OX9Y 4JBWA 3KPUA 3DKPA 4IXTA 5FWYA 1JG3A 3L8CA 3M9LA 4W99A 3OCVA 4G37A 2WF7A 2DR0A 2G09A 1GFSA 4PPFA 4AIIA 2AT1A 4CMKA 3IESA 4DEXA 2CLIB 3P9YA 1N9GB 2DTDA 5DCYA 5FKJA 2ZJOA 5NULA 5JDIC 2GF9A 5F76A 1ZK2A 2HAEA 1DEXA 7AT1A 3MTBA 3H5LA 3OHPA 4V3CA 4KMRA 4ZO7A 2EBHX 5FI5A 4DY6A 3QBEA 3TW0A 4JJ7A 1GTL1 4TKUA 5C31A 3RTAA 3V34A 1Z35A 3PC8C 1F0KA 1M2OA 1QVWA 1PJSA 1VPTA 4D3SA 2D4AA 2X4GA 2LXNA 3P2JA 1J9GA 5K20A 2OGTA 5M34A 1X7XA 1G8MA 2ZGVA 2XMPA 4YP1A 1T3GA 3TEFA 4MKHA 3ZU5A 4N5HX 3H83A 5DSXA 1E2MA 2A9RA 1GL3A 1MC4A 3AGQA 4BL5A 3K5IA 1ZY2A 3DONA 1ABEA 4KLRA 6NULA 4BE9A 1TYBE 1TYAE 2FUCA 3AP3A 2HR1A 1UFOA 3PEEA 3Q5GA 5DX1A 5H0IA 4CEHA 4W82A 2VUIB 1XVTA 5CYFA 1Q6YA 3M5DA 1CR6A 3DNMA 3F46A 2VPQA 3MHTA 3OTHA 4I6EA 1LJUA 2W6IA 1QOPB 4TL8A 3QELA 3R40A 4MGHA 1XRRA 5DBFA 3ZS9A 2ZVPX 5U4QA 4Q3CA 5CLLA 3FOAA 4CTKA 5C4IA 4TSFD 1AZTA 2CBZA 1Q11A 2B8TA 2OHOA 3NMUF 2FWAA 4QJIA 4TWZA 2VHEA 4HH3C 5D6NA 3U7FB 1KEEB 4JVLA 1Z0SA 3WGZA 1ZK4A 2CL0X 3R74A 2JD0A 4Q7EA 3WLOA 2MSWA 5LMUB 5A1TA 1DAOA 2XEDA 3EG9A 3D0KA 1P80A 3G7NA 5JISA 2UXDB 3KSUA 4E7OA 4WZAA 3C3WA 3ECCA 1WXDA 1GTZA 3SF0A 1DO8A 2Z57A 4OMFG 2LV8A 3NDRA 1T5OA 1V26A 3EXG1 3KSDO 2H00A 3QE3A 4WZ6A 4QYMA 1GZ4A 4X93A 3NHMA 2VEOA 3HP4A 3BXXA 1KJNA 5L7WA 4F5EA 2G4CA 2ARKA 2HF2A 2DKOA 5CM2Z 2EFJA 1Q7BA 3KKKA 3SE7A 4HRXA 5F78A 1DQPA 4FFBA 3WTCA 1QB7A 1DC5A 2XZTA 1CRLA 3A8TA 4EZBA 3SQOA 5F3WB 2CNWD 2IPXA 3D8SA 3JQBA 5AJXA 4AXBA 1E0SA 2OHXA 1XE3A 2QUAA 1B8UA 5TPWB 2XSZA 4LGMA 3F6PA 1P7ZA 1NVDA 5DASA 4QXAA 4UEOA 2XT6A 4UMVA 4QBTA 1BW9B 3ZTYA 4F11A 4ZHQA 3LI2A 5FWDA 2PUVA 1KZHA 3WLPA 1QR6A 1UJCA 1BEZA 1ZJ6A 2P2DA 3R3ZA 1TU4A 4JK3A 1K63A 2PWAA 4UHCA 4DUPA 4NOMA 1P0PA 2ETXA 1QMGA 4U0JA 4NHOA 3U2QA 4UCFA 3WNBA 2F55A 1QFMA 2GR9A 2V3WA 5L51A 2BZGA 2O5CA 3JR3A 2QMZA 1YMUA 3BQMB 3NI2A 2Q4DA 2QVLA 4WNAA 1NXXA 4KEAA 5E38A 3PB3A 2SNIE 3ASUA 1PHRA 4FT2A 1ZA2A 3CFYA 3PQFA 3ZI0A 4BNLA 4DNPA 2JGFA 1BXGA 5JCZA 3VAAA 2QUHA 4E31A 5LXTA 1XT6A 4FILA 3CMMA 1BYUA 2BPOA 4FW8A 4WNIA 2YYYA 3BWBA 3KLNA 3COPA 1BJTA 1IY0A 1P81A 2JI4A 2C07A 2GD1O 5FWXB 3ENVA 1M1YA 3HWSA 2OQVA 3OEHD 4YTEA 1HDYA 2JLSA 5DPMA 1NJ2A 5EERA 4FYWA 1UBSB 1WDKA 4R9UC 3TKLA 5M2QA 1JXOA 4RS3A 3PEWA 4LNUB 3R9IA 1TKRA 4WLEA 3RV4A 4ZQCB 1ZUNB 3HJTA 3HYSA 1D0IA 3TDKA 2WU8A 4WQMA 2HSGA 2ZJ7A 1NJ5A 4FZRA 3CLTC 4R1OA 4UBLA 2FEOA 4GGPA 1ZMTA 1G8AA 1PEDA 5DK6A 3UOWA 3WISA 1JFFB 5CIQA 5AW0A 4JYPA 4PQFA 1OTHA 3CZAA 5BRAA 1XMVA 2XOXA 2G1UA 4H7IA 3L5KA 3C24A 4UU8A 4C4AA 1XK7A 3AERB 2NU6B 1P1KA 2FG7C 4L73A 4PSVA 3FX2A 4CM5A 1URPA 2P6OA 3TSWA 3C98A 3QBDA 1UKEA 1SIOA 1UC4B 2KLHA 4L7VA 3W1WA 3ST7A 5KU1A 2EQ5A 5C5IA 3L40A 2PKQO 3HJBA 1GLGA 4NU0A 1D7AA 4L9SA 1S2MA 2CWDA 3GCWA 1LWNA 1L8QA 2P2GA 3SX0A 3UMBA 2XKKA 4P08A 3EXIA 4TMKA 4X1YA 1AO0A 1R6TA 5KTSA 1HT0A 3V8QA 1NBME 1AQ6A 1AY0A 2WWTA 4P22A 4E94A 1N2EA 1GA1A 4F7WA 2XUQA 1VKOA 3GA0A 3KT3A 1EGAA 1W0JA 4LPSA 4ZAWA 3NUZA 3QW2A 3A25A 3AR5A 2Q1WA 4UU0A 2PAAA 2GN0A 5IYZF 1KK1A 3AUTA 4V1CI 3BRQA 5HGJA 3RUIA 1J0EA 3DZFA 4KQCA 4PZ0A 1IEQA 3I42A 4GYKA 4KPGA 4QTUB 4RMGA 4EWLA 3HI6A 2ST1A 1VCIA 4FFLA 5HJ5A 4ZRDA 2VF5X 4EF6A 2YMMA 4BJ3A 1SMKA 5DHQA 1PYGA 5ALWA 3VR6H 2JBAA 1R6UA 2GK3A 2ZSUA 4OOEA 4X20B 1N5RA 4AY3A 3QVKA 1TYEB 4ND1A 2VPZA 2FEPA 3R5XA 3TOSA 3UUWA 5DWVA 1U04A 1PJZA 2A5FA 2AOWA 5I9IA 3KQPA 4BFYA 1BCSA 1DFGA 1FK8A 4O4LA 4OIMA 1KAHA 4DMMA 5HR5A 1E1KA 1NXTA 3BUSA 3D2BA 1Y8RB 3IOCA 1DEHA 4FINA 3VR5A 1KOGA 2YWFA 2WE7A 4LYYA 4H1VA 2GEFA 5CU7A 1W4RA 2ZAGA 1X39A 1CBUA 1N8NA 1C0IA 4K2HA 1HFEL 1F60A 1V16B 4JX8A 3RJZA 5TS3A 1W5BA 5K2MA 4E09A 2FPGA 4P4GA 4Z54A 2YQ5A 2ZRHA 1C3OB 3IVAA 3KX2A 4N01A 3ZE0B 4HDNA 1Z0DA 2HWKA 1PWZA 3OSZA 1YRLA 2J7KA 4RF4A 2C31A 3NW9A 3FMFA 1MX3A 1NW9B 2XMGA 3U5TA 2N3ZA 1UKCA 4NQZA 4XIGS 1CE8B 3CEMA 3VVLA 1PGOA 3RBXA 3FNQA 1BGXT 3E5RA 3KKMA 3KO8A 1A0OA 1P2VA 2FZKA 3H65A 1UINA 4DG8A 1POXA 1VYUA 3F9CA 3HRIA 3JWPA 5ALZA 2QMHA 5FL7A 4C78A 1J5XA 3PFBA 4EA8A 3B2QA 5KB3A 3NBAA 3SMQA 1MDFA 1V95A 4IJVA 4FC6A 1D2EA 3V42A 1MENA 3VPGA 4AD8A 4Y2HA 4MMZB 4WZZA 3T4EA 3PDUA 4EVSA 4ZCLA 1U9YA 5FFFA 3ZHBA 3G2NA 4G0YA 3PUJA 1MH9A 3R5HA 1SCQA 1SB9A 5PGMA 2P4QA 1J7JA 1SCAA 1H1DA 3PVCA 3FNHA 1NI4B 2VWQA 3I2IA 2C99A 2WHXA 2YDYA 3N0VA 3RARA 5A3RA 1IH8A 2C2OA 4YJDA 4YRNA 2YJ5A 2QG6A 3A11A 4QODA 4MRVA 4RXMA 4D45A 4RM2A 1RWXA 4KWEA 2HZBA 4D3XA 4DIUA 4XWKA 1NASA 3LQ4A 4HZUB 4J1NA 1VE7A 3UMVA 5C8ZA 1U2PA 1KA9H 1A69A 4X84A 1ZWKA 3W2HA 3FNRA 1VIYA 2XA9A 3FVTA 5AVWA 5AI5A 4LRYA 2F3TA 4V1CB 4YRDA 5FOSA 1K2WA 3JAKB 4OQPA 2AG5A 2NSJA 1OYWA 2VO1A 4OLHA 1QJ4A 1TKBA 2WRZA 3E1SA 4HFNA 3ABIA 3SKVA 3VYVA 2K4MA 1GO2A 4PYNA 4I5DA 2D8MA 3M3PA 2VA8A 3KUKA 5HKAA 1JSCA 1OLSA 2QZPA 3SCZA 5JJCA 4B7ZA 5C5CA 1O7JA 4ZPXA 1VCNA 1RKXA 4HTFA 5C80A 1YU6A 2G6BA 1T1JA 2OBXA 4E3WA 2AJTA 1FDRA 5FV4A 5DCLA 2IHNA 2D6FA 2BUCA 3V7NA 3LX8A 2DUJA 2W2LA 1Q0SA 2ZLBA 1QYRA 1NN1A 4QL3A 3R6GA 4LDQA 4Z4IA 1YI0A 4P84A 2NT4A 2GNPA 2QUIA 2Y77A 3O9VA 4FHZA 5BQPA 2CMDA 3WTBA 2Y8EA 1RNLA 4BO1A 4LSGA 3VNRA 2ORIA 3KEGA 4RGYA 5FO0A 1GYRA 3CUEF 1QRUA 2FU5C 1Q44A 5K2OA 1N0WA 1NOIA 5I4KA 4YA6A 1TUBA 4XUEA 2PRYA 4Z9YA 4LRQA 1RBZA 3W2IA 1XKXA 1JIQA 1NNLA 4BBZA 3QFRA 4MVJH 4CDMA 9ATCA 2H9AA 2M6SA 3R76A 2X42A 5CVUA 4EL0A 2WF9A 4GM1A 3SI7A 1MFZA 2YN0A 2AN3A 4JLUA 4TV8F 3GGGA 1B8NA 3RFUA 4FHDA 3RHZA 1OI7A 1KYVA 1MOQA 3GNLA 3AVQA 4V24A 5K3CA 1D6JA 3DF7A 1E7MA 4Y9TA 4OOFA 3ZHOA 3GAZA 3I6MA 2V7QD 3NKLA 3KLPX 1K5PA 1DBVO 2NU7A 4Q4HA 2NYVA 3Q0IA 2OBBA 2L69A 1VPDA 2O1XA 1TVEA 4FKMA 4QPZA 3UJCA 2ZIWB 1JIJA 3BFKA 3K2QA 2VBGA 2FP4B 4TYWA 1KEZA 2HMTA 5K0FA 1D4AA 5H82A 2UZ0A 5IRCD 1ZOOA 2PKQP 3V48A 3F78A 4EAAA 3BPSA 2JEZA 3DDSA 2QGFA 1H6AA 3CF2A 3D7LA 1TK9A 3FPJA 4KWHA 4S0XA 1ULZA 1HT3A 3D5TA 1TMGE