1JWAB

Structure of the atp-bound moeb-moad protein complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
239
structure length
217
Chain Sequence
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
total genus 76
structure length 217
sequence length 239
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jwaB00
3IJRA 4UEJA 3UKOA 3T7CA 3SJ7A 5JCJA 2XXJA 3QE3A 4N5LA 4EDFA 4AJNA 1WPQA 1P77A 3WSWA 3TRIA 4CLOB 3L6DA 3QVTA 4DIFA 2DKNA 1HZJA 1U7TA 2O3UA 3KBOA 3GNTA 3G49A 1GYRA 4QO7A 4YDRA 4LGVA 3L9WA 3LK7A 1UUFA 3PHGA 5BSEA 4DPMA 2J3HA 4Y6RA 4R4JA 3OIDA 4L76A 1QR6A 2CVZA 2FSSA 1M75A 5ENDA 2G5CA 3K2BA 4E5KA 3I9NA 3NTOA 4JJGA 1O94A 3F46A 2W4QA 1PS8A 1C1XB 3I9KA 1AXEA 3U49A 4YT2A 4CLRA 5FEUA 1DIGA 3FWNA 3AFMA 4DLBA 2DTXA 3TNLA 4IBOA 1P3DA 3K6JA 4M49A 4JCOA 5G2OA 5U1PA 1GDHA 1R37A 1GADO 5A5EA 4ZA2A 1GY8A 2PD6A 2Z95A 2C2YA 3QHAA 4OSOA 4PLZA 5KKAA 3ZU4A 1E7QA 4GVXA 1E7WA 4NQZA 2HAEA 3HFSA 3ONEA 1H5QA 2I99A 3HDYA 4CM8A 1VJ1A 3MWDB 2ZCVA 3C7DB 4KTVE 5U4QA 3WG9A 2VT2A 3TL2A 2DFDA 4E3ZA 4D7AA 2PV7A 3ASVA 4RPJA 3OICA 3BA1A 5TJ9A 2ZQZA 3WYEA 4D0SA 3W6UA 4URFA 1YVEI 3QWAA 3RIHA 1UXGA 4R51A 4H3VA 5ES3A 4UUOA 4CM5A 3HN7A 1HXHA 5IXYA 1PQPA 4XQ9A 1PJTA 1R66A 5U9CA 1MC5A 2ZTUA 4HKTA 1DIRA 3F1KA 4Y9DA 3RWBA 3JQAD 3C24A 3LLVA 3OH8A 4EUEA 4YAKA 4P22A 3UF0A 4XA8A 3O9ZA 4IQ8A 4NFSA 2G0TA 1RYEA 1DHTA 1CDOA 4CR8A 4BB5A 1B8UA 5ER9A 2EJVA 1WVGA 4UEKA 2O48X 5DBIA 5TGDA 4I9HA 3MWEB 1MG0A 4XB1A 1L7EA 3WJ7A 1T2DA 2O3SA 2YQ5A 1I0ZA 2AQIA 1KC3A 1JDJA 4YAEA 2RAFA 4NK4A 4EEZA 5I8WA 4B7XA 4BNIA 1QKIA 3BIOA 1TEHA 1E1LA 5G0TA 3W4IA 1ZMOA 4WLUA 2BLLA 4NDNE 3DONA 3OEYA 4YJFA 1IY8A 3QVWA 4M86A 2VYVA 3SEFA 3OHSX 3K8ZA 4QEDA 3BMOB 2CMDA 1X1EA 3NV9A 4RQTA 4BGUA 1UXIA 2EF1A 4CLRB 2POQX 2Q46A 1Y5RA 3KXDA 5LC1A 2JFFA 3E8XA 1YBAA 2FWMX 4BGEA 1DFHA 2IE0A 5JCXA 4BGIA 1X15A 7MDHA 3GQVA 4YRBA 4DBVO 1DLIA 4L4XA 1NTOA 4JK3A 5TT0A 2Q2VA 2O3JA 1VM6A 2V6GA 1Q7BA 1YH3A 2OOSA 5JC8A 3Q9UA 4Z9YA 3H9GA 3LF2A 4FC6A 4B8ZA 3MJEA 1AHIA 4TRMA 4JQCA 4YT8A 2ZYAA 3QWBA 4LK3A 1MG5A 2P9CA 2YDXA 3FNGA 2O4CA 2ZATA 5CHEA 5K0ZA 5C37A 4M8SA 3HFGA 4BNVA 3WGOA 4BKOA 2CVOA 4NJMB 4FD3A 2BGKA 4KUEA 1QYXA 4RGBA 4BO8A 2NWQA 2YHUA 1NFRA 3L6EA 4XQEA 2Y93A 1KVTA 1YXMA 1NFQA 2BGLA 2NQTA 1YO6A 3EK2A 4EJMA 3VOSA 1HYGA 3FHLA 3KO8A 2O50A 1DC5A 3V1YA 5KJ1A 3ICPA 5CFZA 4OL9A 4TZTA 2WJPA 3FRJA 3TZ6A 3PHHA 1YJQA 3AI3A 2VCYA 1RM3A 3EVTA 5L9AA 1Q0LA 1GPDG 1ISGA 1OC4A 1XKQA 1E5QA 3JD4A 3WNQA 1UAYA 4YYZA 3WDSA 1ZJZA 3WICA 4JLWA 2JFGA 4E21A 1WMAA 2X0JA 1P74A 4PZDA 3L4BC 4Q3EA 3OA0A 3DO5A 1QSGA 2NUAA 2I67A 1P31A 5G0VA 3SLKA 2OFPA 1EFLA 2ZYGA 2PH5A 1B2LA 5K6AA 4WASA 2J8ZA 2VUUA 3LLSA 4ZQBA 3GFGA 5JY6A 4BL5A 3VPHA 1A5ZA 3ZU2A 2D5AA 1N8KA 1GR0A 4Z3DA 1GCOA 5HM8A 2BD0A 1VC2A 2TMDA 1BW9A 3AY3A 3OA2A 3GR6A 4HWKA 3FBTA 3RJ9A 1SEVA 3R0IA 5ILOA 4TMFA 4GGPA 4W99A 3ZV6A 3ZWVA 4DYVA 5I8ZA 3BTOA 4QUKA 3MJTA 3ULKA 3ZWCA 4RPLA 5JXWA 1Y7TA 3GEGA 5KJFA 5G0SA 4B7UA 4QX6A 5ENVA 4CODB 1T2AA 3G79A 1OFGA 4FDAA 1T1RA 1O6ZA 3DOCA 3ZHZA 1EQUA 3GVHA 4LCJA 4S1VA 1TA4A 3JQAB 4JBGA 4XX0A 1DDOA 1R4NB 1BXKA 4MKZA 1FMCA 1ZSVA 1HWYA 1XG5A 4R16A 1GZ4A 2JCYA 1IYZA 1E1NA 4NFHA 1UXJA 3CEAA 2I9PA 1HDZA 3WGHA 3WS7A 3H2ZA 1AN9A 1YOVA 4ALLA 1V6AA 2AXQA 3ONFA 3ZNOA 4E5PA 3T4XA 4ONEA 2F1KA 4KWHA 1K6IA 2GLXA 4BV8A 2EP5A 3JQ7B 2VZ9A 3NKLA 4GSLA 3W6ZA 5TSDA 3MJVA 3Q6IA 1VJTA 1PGOA 3GVXA 5CDGA 2ILTA 3OIFA 4WLNA 4TKLA 1KS9A 5FF9A 5TS3A 3GN1A 5L7WA 1AUPA 3GG9A 4DIOA 4TVBA 3DTYA 3RU7A 1Q0QA 3H4VA 3GG2A 4HNHA 4J0FA 1IPFA 1RJWA 1ZK0A 4MO2A 4TVOA 3VH3A 4GI2A 4YRAA 1ZMTA 1XWFA 3R6DA 4R1NA 1UDBA 4ZQEA 1HEUA 2I66A 4E5YA 3DL2A 3QIVA 4L74A 4OQZA 4BNGA 1MA0A 1IB6A 3WYCA 3PQEA 2PGDA 2YY7A 1EQ2A 1PZEA 5JYDA 3VDQA 1ISHA 4UUNA 4CUJA 3QLJA 3TL3A 4E33A 2GPTA 4L75A 1GUFA 3D3EA 3GPIA 4A73A 2R6JA 2CDBA 1GZ6A 1IL0A 1U3VA 1RM4A 1WXDA 2C29D 4PGFA 1E3IA 3ONDA 2X23A 1VI2A 5A9SB 3W8DA 1Z73A 1NXQA 3RJ5A 2X0RA 1YL6A 3ASUA 1H94A 3O4RA 1NQ5A 3ZV5A 4PG7A 4D43A 4QFDA 3KV3O 4OQYA 4UREA 4EZBA 2QZ9A 2FZEA 2TMGA 3JQ8B 1SAYA 1DOHA 4RZIA 1PGPA 4B3HA 5CP8A 1YDWA 1PS0A 2JD0A 1B8VA 1Q7CA 2YJZA 1N9GA 4W4TA 2O3TA 1L7DA 1R4NA 3RVDA 4WCDA 3GGOA 4E2WA 2R00C 5JAIA 1Y8QA 3FCOA 3ZV3A 5TF4A 3LZ6A 4KP7A 4E4YA 1V8BA 2UYYA 3FSRA 2HMVA 3WNVA 2GF2A 2VT3A 3KUXA 4LW8A 4OHUA 1E1MA 1F0YA 4IXTA 4JBHA 3WX0A 2CF6A 4CM4B 5DCYA 3KYDB 2VRBA 2A92A 1FXSA 3PFWO 2VUSA 3PJGA 4BNZA 5CEEA 2ZB3A 4U6SA 3ZNNA 3B1KA 2I5PO 4J1SA 4CMCA 3ON5A 5COAA 1GYQA 1RWBA 3AW9A 3RBZA 3PLRA 4IY1A 4WLEA 4MP3A 5BSHA 3NGLA 4FBGA 5KVCA 4CQMA 4ZU3A 3CIFA 1DB3A 3M6IA 1SZJG 3BTUA 4RJTA 3H7AA 4QQRA 4XIJA 3UN1A 5ADHA 3AI2A 2RIRA 3LSYA 3WGTA 1QYCA 1N92A 1ENOA 2ZJ0A 3HDHA 1XA0A 3B1FA 1ONPA 4FFOA 3TOZA 4QTZA 3GMSA 4I8XA 4JBIA 1V3TA 1TT5B 4IJUA 4RPHA 2WWRA 1UP7A 3VDRA 5BNTA 4RVUA 3DZGA 1XYGA 2D1YA 2AEMA 2DUUA 2DU8A 1XU9A 1B15A 1P1IA 2Y1CA 1AGNA 3Q2KA 4ROSA 2DC1A 3PWKA 4FPXA 1BTOA 1P1KA 3UUWA 5JY1A 4FGSA 1XR3A 1VLLA 4RVFA 2YV3A 4DLLA 4DMMA 4E32A 2Y1GA 4IQ0A 3EAGA 2DPHA 1MXFA 2C07A 2WD7B 3NUGA 5IZ4A 2UV8A 4EUFA 3JQEA 1MLDA 3X2EA 1ISFA 3M2TA 1M76A 2B4QA 4PLCA 4BNYA 4W82A 4CM9A 3I1JA 2V7PA 4J3FA 2QW8A 4MVJI 2P4HX 3N74A 1GAEO 3LVFO 4YBZA 4DREA 1I30A 5COBA 1IOLA 4MVJE 1GL3A 3WBBA 4B3IA 4GX2A 5B37A 3IOYA 1HE5A 3RAJA 2EJWA 4OOEA 5JDIC 3O03A 1ISIA 1IHXA 1T4DA 4HFMA 4YT4A 4FFNA 1G0NA 5JPIA 2X5JO 1F06A 5L95A 3NDIA 3O8QB 1K5HA 1WDLA 1KC1A 3UCFA 4BNLA 2X86A 4I9NA 1E7RA 1Z7EA 1BVRA 3PIIA 4EBFA 4YVFA 4B79A 2PNFA 3PGXA 3QWIA 3EC7A 1SNYA 3C7AA 1CQJA 3PYLA 5HRUA 3NTQA 3ZDFA 1PZGA 1KYQA 2UVDA 4B4OA 1HL3A 2DVMA 5KJ6A 2A35A 2B4TO 3BMQB 5TIIA 4BO1A 3RBXA 3DBLB 1QXSA 1VPDA 4Q3BA 4CM9D 3PJFA 4EUHA 1PSDA 1ZXLA 4R9SA 1VL6A 2Y0EA 2ZB4A 1B16A 3RSHA 1EUCA 2EEZA 4M1QA 5GZ3A 2HJRA 4RCVA 1FK8A 5DCUA 3WQQA 1R4MB 5L4LA 2JFHA 1LSUA 1ADBA 4PLTA 2Q4BA 4ZHSA 4PFJA 1LDYA 1D1SA 4K28A 8LDHA 1W6UA 4UUMA 2VYND 1RM0A 3U4IA 4J4TA 3EDMA 3H5AA 1CRWG 3INRA 2BFAA 3SBOA 2O3QA 4FSHA 3EZLA 3WFIA 1XQ1A 4FS3A 5KKCA 5HBRA 1P45A 2EW2A 1KVSA 4IGFA 2V6MA 4CM7A 3RFXA 1ONOA 1PL8A 2NADA 1EVIA 4QECA 3TZHA 4JGBA 2BFOA 4RVSA 3ZWAA 4GPD1 3CE6A 3K96A 4U6QA 4CMAA 3DHNA 4GLOA 3WWZA 1NYTA 4CLHA 1D4FA 3I9LA 3LT4A 3JYPA 1E3SA 4U8GA 2X9NA 1J5PA 4RDIA 1J6UA 4P4NA 3VVCA 4GQAA 2WEKA 1S6YA 4QT0A 3IKVA 4MPDA 2Q2QA 3HJAA 1LSSA 5TJHA 1P0FA 4CV0A 4UVEA 4E30A 1V35A 4MP8A 5EMHA 1B3BA 3GZNB 3GC6A 4F46A 1BXGB 4A2CA 4I9UA 3UHAA 1E6EA 3F5SA 5IN4A 1SOWA 3T4EA 2YDYA 2AE2A 4XZ3A 3D3WB 4RVDA 3K5PA 5L4SA 2JHGA 2CVQA 2W2LD 2ZYDA 2GN6A 3DTTA 1V3VA 1EBFA 1SBYA 2O4UX 2QHXA 5CPBA 3IP3A 1I32A 1DPGA 4Y67A 3F47A 4ZJUA 3VTFA 1NHWA 1LJ8A 2FR8A 3QVOA 5DP1A 2HSDA 3QA9A 2EKQA 4CQMB 1U3TA 4U7WA 4WGGA 2PZLA 1WWKA 5KVSA 1M6WA 1F17A 3S2GA 4JP3A 3U0BA 4CR7A 1CETA 1X14A 3NX4A 2CNBA 1YGYA 4NIMA 2FP4A 1NASA 1EVZA 3U62A 1LA2A 2VHWA 1GUYA 2EHDA 2EKLA 1E77A 1SB9A 1KEPA 4GX0A 1DC6A 3E6AA 5DBFA 3RC7A 4DC0A 1P33A 1NWCA 2ZK7A 1DFIA 3ST7A 1EZ4A 3E18A 2ZTVA 4R54A 4E0BA 1G6KA 1PJBA 2UUOA 4ZQGA 4BNNA 3WIDA 3NRCA 1VKOA 2YUTA 4WKGA 1UZLA 4HFNA 1PZHA 2DBVO 1PGQA 3M1LA 1DHRA 1PGNA 3UCEA 1VSUA 3DFUA 1G1AA 1KVQA 1C3VA 1NHGA 1ZJYA 3LT0A 3VHRA 3PXXA 4D41A 1R16A 1VKNA 5DP2A 5TNXA 4R41A 3QY9A 4AVYA 1TI7A 1PS9A 3WTCA 5TRTA 3IDSA 4BB6A 2FOIA 3R1IA 1IUKA 2P5YA 2E82A 3WJAA 4TRJA 4JROA 2GASA 2ZQYA 5DULA 3V1UA 4A27A 5ICMA 4CLXA 3EUWA 4HNGA 2BHLA 1W73A 5THKA 4E5MA 1EBUA 3HDJA 2D5CA 3HG7A 4BNHA 3RU9A 2Q3EA 4L4RA 3WWYA 5HS4A 4WEQA 1J49A 2E4AA 5IFLA 1E1KA 1AXGA 3VH2A 4L9RA 3QWHA 1ZBQA 4RL6A 5G0WA 5T8KA 3FWZA 4EEXA 4HY3A 1TT5A 1XSEA 3X2FA 2B4RO 3L4SO 4U0KA 2IZ0A 2P4QA 1N1GA 4ITUA 3G1UA 1GEEA 5HS6A 4N54A 4KUGA 2DTDA 2RHRA 4OKIA 2AW5A 3FNHA 4FC7A 2V65A 1LQTA 4BV9A 4NJMA 4J43A 1A27A 3S1LA 5F3RA 4XYLA 2BF7A 4B4VA 4A5OA 1YBMA 2JHFA 1E0DA 3OM9A 1X13A 2OHXA 1LI4A 3D3WA 4FFRA 1DFGA 1VL0A 4AG3A 1JAXA 3I4FA 2CZCA 3T7EA 5HWSA 1EE2A 4N5MA 1LBEA 2FHSA 3PQFA 2OORA 2X9GA 4J6FA 1DRUA 3QQPA 1JTVA 3GNQA 1GUZA 3A9WA 4MDHA 2H5LA 1Z82A 3JV7A 2C2XA 4MKXA 2DBQA 3KEOA 3TFOA 2O23A 2WYVA 1TXGA 4ND5A 1Y8QB 1C0LA 1NQTA 4BNKA 5C5IA 1BDMA 3P19A 2W2LA 3D64A 1I2CA 2E37A 3DZBA 2A94A 4LSMA 1H93A 4KZPA 3OJFA 4BNWA 3GVPA 2GERA 5EESA 3TZQA 3PWSA 2ZTMA 2HMUA 1K0UA 4II3A 2GCGA 1U8FO 1PEDA 1GTMA 4UVGA 2PZJA 3COSA 2R2GA 4J91A 2B5VA 4BO7A 3I6QA 1AE1A 1LX6A 1QMGA 4ALJA 2AG8A 3QP9A 3RC9A 3SJUA 4CMKA 3PJEA 2X6TA 3LYLA 5FI5A 2PGJA 4CMGA 1GQQA 2J5RA 2WDZA 3PWZA 1KY4A 1PWZA 4R1UA 4UVDA 4CQLA 3H5RA 1DJQA 3NTRA 5CG2A 1UR5A 4PG4A 3SC6A 1E7MA 5K6AC 2HDHA 4MVJD 3ROMA 3JQAA 1A7AA 4NZ9A 4K6FA 3KTDA 4BKPA 2PKQO 3KSDO 1LLQA 3JQFC 4O6VA 2OBNA 4XYEA 2X9VA 3EMKA 4GX1A 2CD9A 2A4KA 1DRWA 4EI2A 2AQ8A 2Y68A 5AYVA 3S2EA 3VVBA 2X58A 1ZZEA 2X7HA 3IJPA 4D3SA 1PJCA 3KETA 5IG2A 5JS6A 1YWGO 3W4KA 1Z75A 3GDOA 1Q2XA 2DBRA 4J0EA 4PG8A 1A4IA 1CYDA 2J6IA 1HLDA 2I3GA 3JQFA 3LDHA 4EJ6A 1CQIA 4D3FA 2GZ1A 5DZSA 1XU7A 2X8LA 2VN8A 2YHIB 4L4SA 3G3EA 3MCVA 4JX8A 1XHLA 4AFNA 1DAPA 3IMFA 3WQRA 4MVJA 4GGOA 3A4VA 3UFXA 2IXAA 5BSFA 1DBVO 4ZVVA 5BSGA 2OP0A 1T26A 4HADA 5BNFA 1A7KA 3ZN2A 3BYZA 1HYHA 1EVYA 1QORA 1DRVA 3W1VA 5A04A 5DNAA 3UCXA 1LEHA 3C1AA 4DLAA 1X0XA 1JVBA 3BHMA 1O95A 4IDAA 5J23A 4NR0A 2P9EA 1R0SA 4KOAA 4GKBA 4CL8A 3IL2A 1IZ9A 3FR7A 4IMRA 3N7UA 4XGNA 1N2SA 1NAIA 2OL4A 1QYDA 3WOHA 4ND2A 1EUZA 1S7CA 2PKRA 1LRKA 2IDZA 3W8FA 4AJLA 5F5LA 3DOOA 3INTA 4EW6A 3IC5A 4INAA 2Y0CA 4U0JA 3GMDA 1WZEA 3PK0A 4NG5A 2ZIZA 4JN6B 4DXHA 4BIIA 5KIAA 4PG6A 4A7PA 2AMFA 3DAFA 2C7VA 2E49A 1HF3A 3DC2A 4FJ2A 1XIVA 3E82A 4LMPA 1Q7GA 1YB5A 2PD4A 1U8XX 3VKUA 4DIBA 5A03A 5JSFA 5JYEA 1J4AA 3GFBA 5AOVA 2RH8A 1C1DA 4OXYA 3CSDA 3OBBA 3ZH2A 2Y1DA 1HE4A 2FN7A 4Q3AA 4DGSA 3STHA 2NACA 2X0NA 5B4TA 4ND3A 1FDVA 4B4WA 3D5QA 1EDOA 4J1QA 4IPTA 4YJGA 5MGBA 3WQSB 1YB1A 3HN2A 4GWKA 2BFPA 4YA6A 3U9LA 1ORRA 3ANNA 4AJOA 4Q39A 2HRBA 4RLHA 1WP4A 2Q1SA 4IMPA 4DPLA 1EMDA 1BHSA 1JKJA 3D7LA 3DXFA 4EJ0A 2OGUA 2H63A 3JSAA 2Q50A 4J4BA 1YL5A 2W2KB 2GSDA 1RYDA 3FD8A 2AA3A 5JLAA 1UAGA 2FSVA 5DT9A 2HUNA 4RF4A 1FDSA 3VZSA 1UXKA 2B0JA 1LUAA 1BXGA 1D1TA 1DJNA 2E48A 1I8TA 2VTEA 1F12A 3GUYA 3QV1A 1I36A 3Q0EA 4R3WA 2XF8A 3LC1O 1C0IA 4WLVA 3U4HA 4BO2A 1X0VA 4AL4A 3EZYA 2EV9A 1E92A 2GN8A 3ZWMA 3FN4A 5JMPA 2BI8A 1I01A 3JTMA 5A9TA 4DMLA 2RHCA 2XPCA 1I10A 3FPLA 3MTJA 1ZK2A 1ZSNA 1ML3A 1R4MA 4IGEA 4Z0HO 1PQWA 1H2HA 1H6CA 1UJMA 2EKPA 3FTNA 1W4ZA 3GA0A 1RKXA 5LDGA 5JDCC 1JW9B 3F9IA 3Q2IA 5G4KB 2NTJA 3PTZA 1ULUA 3BAZA 2JKVA 4GL4A 1Y1PA 3I4CA 4HUJA 4W9NC 3TZCA 1EK6A 3VTZA 3H9UA 3TOXA 3IUSA 1Z7BA 5JC1A 1CF2O 4GMFA 4DA9A 1R6DA 4AICA 4BNJA 5A1TA 3H8VA 2XOXA 3D4NA 3GGGA 2C54A 3BMCA 3F4BA 3DQPA 4ZRNA 5JO0A 3DZIA 2Q1TA 4NBWA 1O0SA 4O0LA 4OYRA 1IPEA 2D2IA 3GN2A 4ZQHA 1N7HA 4GVLA 3HSKA 3SLGA 4YRDA 1U2DA 3RBVA 7ADHA 3VC7A 4OIMA 1PJSA 5IXSA 3WFJA 4OSPA 1NQAO 3HB4X 2O7QA 4R1SA 1U3UA 4IIUA 1NX6A 5JAZA 1LU9A 1M67A 3GDFA 5C7LO 2DUWA 3TN7A 2Z5LA 3CINA 4GMGA 3QRWA 1PQUA 3PYXA 4NI5A 3G0OA 1O89A 1I3MA 3BHJA 2JCVA 4WOJA 1A9YA 4ND4A 3HB5X 1MGOA 6ADHA 4NNJA 4YR9A 3E03A 1ZW1A 1H9BA 1Z6ZA 3EY4A 4FIZA 2OZPA 2HU2A 1IE3A 4Y8VA 3OETA 2XAAA 2AG5A 1ENYA 3SC4A 3BMNA 1JWBB 1ZK1A 3JQ7A 1PGJA 3PVZA 4G81A 4DL9A 1ISMA 1R12A 4WCFB 4AJ4A 1JKFA 3TFQA 1GV1A 4A03A 4BNFA 2PK3A 2EXXA 2HKIA 3KSUA 1LRLA 2HMTA 4BMNA 4RF3A 4NBRA 3OQ6A 4Z9FA 2J3JA 4OJNA 1SPXA 1XQ6A 4OXKA 3W8EA 4O1MA 4D79A 4YQYA 5BQFA 3E9NA 1U5AA 2FPGA 2BI7A 3KB6A 3TZKA 4E6PA 3HUDA 1P1RA 3DBHA 4F6CA 2NU9A 2PKQP 4K6CA 1BW9B 2B5WA 3RFTA 1Y6JA 3ZHYA 3GDGA 3ZWBA 4CM1A 2VTDA 4MVJP 4O59O 3PPIA 2UDPA 2PGLA 1NVMB 1DIHA 2QG4A 4DUPA 5DOVA 3ZNQA 1C1DB 4GLLA 3DHYA 5JO9A 2OUIA 1RPNA 1U28A 3DHEA 1HETA 1ADGA 2Z1MA 4FFMA 3JD2A 4WUVA 2PFGA 2G17A 3DAPA 3TDKA 1HSOA 4U5QA 5BNIA 4WLOA 5IJZA 1L1FA 5I7FA 3WYBA 3DBVO 1FDWA 4NU6A 5JDCA 3EHEA 1LTHR 3PRJA 1K6XA 2VNAA 1GCUA 4KDFA 1XGKA 4MIEA 1ZKMA 4IM7A 3VH4A 1KY5A 1Z74A 2CSUA 2WSBA 3JQBA 5LCXA 4BVAA 4M54A 3TWOA 3AY6A 1KETA 2YV2A 3SX2A 3OJEA 1DC3A 2NVBA 1ADCA 2WD8A 4BO9A 3AJRA 4Q3NA 1H6BA 4P8RA 1ZK3A 1JLLA 3FR8A 3AUSA 1HDCA 3DMYA 3KZVA 3GK3A 3JQDA 3OJLA 1LNQA 1NQOA 2VWQA 1M6HA 1K3TA 1TLTA 2HO5A 4XKJA 1U4OA 3WLFA 2Q99A 2JAPA 4HV4A 5A9RA 4GKVA 2F00A 2OBYA 3CTMA 1DLJA 2YFHA 4JNKA 5DN9A 4D0RA 4FJ0A 4II2A 4YJFB 2Y0DA 3P2OA 1GV0A 1WDKA 3DBRB 4YJHA 2VWPA 4ZRMA 2NU8A 2VZ0A 4PZCA 4PRLA 3WGZA 4N18A 4BKRA 4BS9A 2VHYA 5G4KA 2IEDA 4I5FA 4EITA 1QYVA 4RVHA 5CG1A 4Q3CA 4YCAA 4H7PA 4FFLA 2HLPA 3UOGA 3RCBA 1U4SA 2PH3A 2X4GA 4S3MA 4W7HA 4BO5A 5GMOA 5CDYA 1TB4A 2GR9A 4R69A 1HDGO 4IDCA 5IAAA 2NTNA 3PFFA 4A10A 1KBZA 2C82A 4XQCA 1PZFA 4ZGWA 1QLHA 2VWGA 1Y9AA 2VZ8A 5TX7A 1I24A 4K1LA 4DQVA 2R00A 4FFPA 2DPGA 4CJXA 1R0LA 3HZZA 2IEBA 1OBFO 1W8DA 3L9XA 1CJCA 3ITKA 1YKFA 3JCZA 2YZ7A 4E5NA 1ZIDA 2H9IA 4F45A 1HSZA 1P0CA 2OMEA 1DO8A 1AHHA 3EVNA 1MV8A 4P4GA 1EVJA 5A02A 5GZ1A 2G82A 1MB4A 2B35A 3F1LA 4JXKA 4DQUA 1O5IA 4G2NA 3V2GA 3ICCA 4J90A 3TJRA 3DBHB 1XCBA 3MZ0A 1I2ZA 4OGWA 4Q3DA 2O7SA 1BMDA 3RFVA 2QYSA 4DWVA 3NJ4A 3TPCA 1ZSYA 4RZHA 4CV2A 5GZ6A 4TKMA 2J3IA 3D4OA 3ZWXA 1YL7A 2CUKA 2BFMA 1D3AA 4BNMA 3CZRA 4D45A 5JMWA 3I9OA 4GSKA 2DM6A 4YT5A 3UVEA 4L73A 3ORFA 2NM0A 3CZMA 3AM5A 4J9UE 1QP8A 4B8WA 2ZB8A 1HLPA 3AWDA 4CMBA 5CAEA 2Q45A 1QYWA 4PLHA 2DAPA 3OFSA 3DZHA 4ALIA 3BZUA 3E5MA 3VH1A 1PU2A 1X7GA 4J7CA 3ZU3A 1N7GA 1T2FA 4OH1A 2QYTA 1UZMA 4YACA 5F1PA 5I7SA 1NAHA 1BRMA 1NPDA 2D59A 3KYDA 4PN3A 1OI7A 4WEOA 1T4BA 3O38A 1FDUA 4WNIA 1MP0A 5T67A 2X0IA 4FOOA 3DBLA 4LRTB 1OAAA 4YJHB 2YYYA 9LDBA 3BMQA 1LDGA 2JCXA 3D5TA 1SCUA 4FN4A 1U5CA 4DC1A 1BGVA 1ZO8A 2Z1NA 3DFZA 3JQBC 1P1HA 1P44A 5CEJA 3IQDB 2CDCA 4YAGA 3V2HA 4FQ8A 2EGHA 5C7OO 3JQ8A 1B3RA 4BKUA 3B70A 1E6WA 4JJIA 3VZQA 5DOZA 2Q2WA 2C7GA 1ZEMA 3AU9A 4BOYA 3DBRA 5T8KC 5A3JA 3HDQA 1JAYA 2D8AA 4AJIA 2PLAA 4NH4A 1WDMA 2B69A 4ALMA 1NVGA 5I9MA 4YAIA 4CR6A 1U3WA 2AQKA 1F14A 4RLSA 5JDIA 2C5EA 1Q0HA 4UVHA 1Y81A 1BG6A 4BQRA 5EPOA 2PWZA 5JBIA 2GZ2A 4E12A 1NR1A 3DZFA 4PCVA 3Q3CA 5B4UA 2HQ1A 3S8MA 1YDEA 4XIYA 1YQGA 5G4LA 2AEJA 2WYUA 2H6EA 3KOUA 1DAOA 4PVDA 3QVSA 1CERA 3WMWA 1B0AA 1GU7A 1GZ3A 2IYOA 3DOJA 1LDEA 1CWUA 2P68A 3PI7A 3U4CA 1GQ2A 3E9QA 2NVUA 3HHPA 2I76A 1HYEA 3S55A 1IZ0A 3OJ0A 4PLYA 4BGVA 3TQHA 4LVUA 1H0KA 5IDYA 5TQVA 4CLEA 1U7HA 5COQA 5I9NA 4NU5A 1O9BA 1X7DA 3GGPA 2AE1A 4OO3A 1YBVA 3KYCA 1SOVA 1Q1NA 3KSZO 2GRAA 3CH6A 2O3RA 1NWHA 1ID1A 3RUAA 4B3JA 3V1TC 4Z6KA 4A26A 2ZJ1A 4YEDA 4ZD6A 3KLMX 3OEWA 4R1TA 2GUGA 3QSGA 4OKNA 4C7KA 4E31A 3GAFA 3JYQA 1DSSG 5F21A 4DVJA 4UULA 1LDBA 1Z45A 2VRCA 3DAGA 3I3OA 3K30A 2FPIA 1YJ8A 4Q9NA 3LT1A 3I9MA 4R68A 1PWXA 1JN0A 3PJDA 4CM8B 5IF3A 5EERA 4CM4A 2NTVA 3GHYA 2D0IA 1A72A 1YQDA 3DZJA 3MJ4A 5EQDA 1I3LA 3K2EA 3GZ4A 1ENZA 4AJ2A 1H2BA 4IJWA 5JAQA 1UDAA 1V9LA 1MXHA 3BMCB 3CMCO 2O2YA 4DBZA 4QSMA 1N1EA 4ILKA 1FF9A 4L0QA 5A9SA 3B20A 1KERA 3NDRA 5IDXA 4XCVA 4ZICA 1WW8A 4CMIA 4BKQA 2EGGA 1H6AA 3FNFA 1FJHA 3HE3A 3JQ9C 3A28A 3K73O 4A0SA 4J7XA 2IYPA 3OECA 4GAEA 4XYBA 4IZIA 3KYBA 3AOEA 2VRCD 3GRKA 1K2WA 2BH9A 4HFJA 4AJPA 3I5MA 4KQWA 1GQYA 3L77A 4E2YA 1V3UA 3OQ1A 1P1FA 3R3SA 2B83A 2J3KA 1PX0A 1P9LA 2JJYA 3ZHBA 1YQXA 4G5HA 4ESOA 4XRGA 3FPCA 5CPFA 1R15A 3AUTA 3DEYX 2NU6A 3ANLA 3K31A 3NT4A 2W2KA 1HDXA 3FNEA 3AY7A 1VJ0A 4YQZA 4BO3A 5EN4A 1HTBA 1NPTO 4BO4A 4O63O 4NHEA 1NFFA 2Y99A 3CUKA 3V5NA 3IIEA 4J4HA 5A5FA 2FY8A 1EFKA 3GF4A 4KWIA 3JQGB 3IUPA 2QX7A 1E3EA 2P9GA 4Z0TA 1UH5A 5TT1A 3C1TA 3NDJA 4WK6A 5A06A 2J5QA 4PLFA 2LDXA 3R3JA 2P2SA 2Y67A 3CKYA 3WIEA 3ZWYA 5KOIA 1PJ3A 3BTSA 3ETDA 5G0UA 3ZU5A 1NBOA 5L7TA 1BVUA 3O8QA 1ZXBA 3I9JA 1GEGA 5FYDA 4CMHA 2DFVA 3OIGA 2YFQA 4JIGA 4GX5A 5DCWA 3SXPA 5FI3A 5L4NA 5KVQA 3ZWPA 4CUZA 2YV1A 3FI9A 4JP2A 4PRKA 3FF4A 1ZFNA 1NR7A 3NJ8A 4J16A 2WYWA 1F8GA 2NU7A 3BTVA 1UXHA 2I6TA 4IXWA 4NBVA 2C59A 2IRWA 4MVJM 1LSOA 2CY0A 3KVOA 4KMSA 3DZKA 4IS2A 4CV3A 1HE2A 2J5KA 9LDTA 2QZZA 1MUUA 4AJ1A 1GFSA 5JW6A 4UAGA 2CFCA 3WGGA 3AI1A 1B26A 1ZK4A 2QRJA 1WZIA 4Z0PA 1C0PA 1ZCJA 3ZV4A 2WD7A 4HBGA 2P5UA 3P5SA 4CPDA 4WLFA 3BXXA 1LDMA 4GWGA 4Y6PA 4XJSA 4ZN6A 4QFCA 5AXDA 4IJKA 1PR3A 2WE7A 1DIAA 3PZRA 2LDBA 1K89A 2VWHA 1A4UA 1KEUA 1N5DA 3H9QA 1SO8A 4CMJA 2P91A 1PJLA 1YE3A 5DDIP 4D3DA 4XDZA 4LN1A 1PL6A 5T5QA 1NPYA 2Q1WA 3EW7A 3RKRA 1HRDA 3F3SA 3ZHXA 1HDOA 1PL7A 4XD2A 4MINA 4DRYA 5IZCC 1Y9EA 3GEMA 3LF1A 5C7IO 6LDHA 3GY0A 4PZEA 3RI3A 2QRKA 4LVCA 3ZW9A 5THQA 4WE3A 5L53A 4RF2A 4M87A 3U3XA 1F8FA 3SVTA 1LLDA 3HWRA 2FPPA 1E3JA 5F5NA 4XGIA 2AEFA 3I6IA 2CDAA 5JNLA 1SMKA 2OXIA 4Y6SA 1UP6A 4QXMA 5EL0A 3ZZNA 2YHIA 4IDBA 3CXRA 5ILGA 3GT0A 1XELA 4YAJA 3I23A 1ISJA 3VPGA 4C7JA 5KWEA 5JAMA 2PY6A 3G1TA 3JD1A 1LC3A 4CM3A 2C5AA 4D46A 1LSJA 1WLYA 1YS4A 4PG5A 1ZEJA 3E9MA 2EIHA 2A9FA 3GVCA 4I5GA 5B12A 4OXNA 4BO6A 2PZKA 4RORA 1MFPA 1U2GA 1P1JA 1WAMA 2V6FA 3GVIA 3AU8A 3H3JA 3QJ5A 1EE9A 3JYLA 1E5LA 4NK5A 5FFFA 3KLPX 1HDYA 4IUYA 4FCCA 4IZHA 2GNAA 3JQ9A 3B1JA 2HJSA 2IZZA 1A9ZA 4UVIA 4ND1A 4ID9A 2UUPA 1IHYA 2WTBA 2ZB7A 1B14A 1KIFA 1Y8RB 3CPSA 2OP1A 4IDFA 3H9EO 1X7HA 4RVGA 1DC4A 5L7YA 2SCUA 2I65A 1ARZA 4NBUA 3MOIA 4BMSA 5AXCA 2HRZA 1C0KA 3WTBA 4P38A 1BDBA 4WECA 4FW8A 4I5EA 1J0XO 3RKUA 1E6UA 4XWYA 4XYGA 3TSCA 3G17A 4OAQA 3IP1A 4IINA 4RPGA 4UUPA 1H9AA 3QWFA 1JU9A 1ADFA 3GRPA 3N58A 4BO0A 2GD1O 1SC6A 5JFOA 2X5OA 3IAHA 5TLSA 4MOWA 5KCZA 4XR9A 2PD3A 4LISA 3IKTA 2NSDA 2GO1A 1BSVA 3H2SA 1YB4A 4PIVA 2Y1OA 4XYMA 3RUIA 3E5RA 2ZKLA 3OJOA 2D4AA 2DBZA 4BMVA 4DYDA 3NT2A 1LLUA 4RQUA 3ZWWA 4R01A 4J49A 4CLDA 4PLGA 4F3YA 1QV7A 1ZNQO 2V6BA 3RASA 4B4UA 4BNXA 3JQGA 4R3NA 3VPFA 3D0OA 2W90A 3ETEA 1VL8A 4TROA 3NGXA 4P4LA 2NV6A 4OOFA 3AUUA 3OMLA 4IDDA 1M2WA 1NP3A 3PQDA 3OP4A 5I7VA 3NEPX 1IULA 4CV1A 3U5TA 3L0DA 1EDZA 4D42A 2NVUB 2UAGA 2YQ4A 4CQLB 3PHLA 2ZCUA 4IDEA 1I3NA 3ANMA 5TC4A 1KOLA 3A06A 3KEQA 5L45A 2NLOA 2BKAA 5BR7A 2PA3A 2Y1FA 4C4OA 3M2PA 1V0JA 1MFZA 4R5MA 1TVEA 2VHXA 3PIDA 3UAGA 4YB8A 4K9DA 1DXYA 1R0KA 4DQXA 2IZ1A 3C1OA 1U1IA 3KM0A 4KQXA 5HA5A 4IQGA 4M55A 1JQBA 5HTOA 3E1KA 1T24A 5T6BA 1VE9A 4CL3A 1MX3A 1YRLA 3KYCB 5IDQA 5KJCA 3JQ6A 4W9NA 1KVRA 1B7GO 4K26A 4E2XA 1LLCA 3QW2A 2ET6A 1ULSA 2ZTLA 2JD1A 4AJKA 2EWMA 4RO0A 3WB9A 3C8MA 1RM5A 1EK5A 1BXZA 4KUHA 1OZAA 2NVWA 3ZI0A 4BHTA 1EUDA 4YWJA 2PZMA 1QG6A 1Y5MA 5JE8A 4MJLA 4NJOA 1I33A 5A05A 4WPGA 3F4LA 2JAHA 1PJQA 3FTPA 5AXBA 5H81A 4TRRA 3A14A 5ICSA 4E2ZA 1T25A 2I3AA 4NMHA 3MJSA 3WMXA 3AM3A 5ER6A 1CEQA 1XDWA 4XQGA 3OF2A 3ADPA 5L3ZA 1U9JA 1OMOA 4MIYA 1KEVA 3GH3A 1GPJA 3NYWA 1LRJA 3ETGA 1A71A 3WR5A 1VSVA 4MKRA 5I9LA 3DDNA 2VYVD 3ENNA 3BHIA 3ITDA 3DMTC 2GN4A 5EINA 3P2YA 3VZRA 1JVSA 2BMAA 1B8PA 3PZBA 1NNUA 3PDJA 3GHHA 2BELA 3LC7O 4TSKA 5EQFA 4LCEA 5CDUA 4F6LA 2Y05A 3QVXA 5AQ1A 4D44A 3OSUA 2NQ8A 5EIOA 4PLVA 4YTEA 1KVUA 2EG9A 2HCTA 5EJ2A 3DMTA 4CUKA 4YJDA 2BGMA 3FBGA 2RBEA 4GBJA 1XEAA 3RUEA 3LQFA 3TF5A 4ZQFA 2WMDA 8ADHA 1LQUA 4HFRA 3RUFA 4WCFA 1UZNA 4W7IA 4J9VA 2G76A 4J2HA 2AHRA 3PDUA 3AOEC 4O5OA 3E48A 4FGWA 4QO8A 3WGQA 3EGOA 3ZGYA 4BNTA 2CF5A 3PGJA 4L8VA 2C0CA 4XDYA 2Q49A 2PR2A 4XR4A 5F1KA 3PEFA 4ALNA 3RUCA 3D4PA 4UEOA 1EEHA 2DTEA 3JYNA 3L07A 3ROQA 4XEHA 1XLTA 3KHUA 2X5KO 2FMUA 3K9QO 1SEPA 5B1YA 5KVVA 2B37A 2GYYA 4CQMD 3RC2A 1DIBA 2GN9A 2NNLD 5GY7A 1YOVB 3RUHA 2DLDA 3HADA 3JD0A 1HDRA 3ZCXA 3DWFA 2DT5A 3I83A 3DB2A 4CM6A 4H16A 5IDWA 4FOSA 5A3VA 1HT0A 3BMOA 3UICA 3MTGA 5DF1A 4IDGA 5IN5A 3GOHA 1FDTA 5ITWA 2H1SA 4LRSB 5LDHA 1W0CA 1E7YA 4X54A 5KNLA 3EYWA 3I52A 3HNPA 3O26A 3VPSA 4M89A 4FB5A 1M66A 1I3KA 2Q4EA 5CDSA 1NM5A 3BMNB 4J7UA 4MVJG 2FZWA 4YXFA 1LXCA 3PLNA 1HZZA 4XB2A 1UP4A 1O8CA 2W98A 3Q11A 3AFNA 3ZW8A 2VHVA 3ROKA 3MJCA 5IZCA 4Y98A 5L51A 2HK7A 3NT5A 3H5NA 2VOEA 4N5NA 4Z9XA 4N7RA 3UW3A 3JYOA 1JWAB 1NVTA 5C3MA 1PR9A 1Y8RA 3V2UA 4FJ1A 2FRDA 4MP6A 3AUAA 1SB8A 1OOEA 3P7MA 3PYMA 4NBTA 1OC2A 4MIOA 3GLQA 3GZNA 4J2OA 2QIOA 3RROA 4CMEC 3MOGA 1HKUA 4KDEA 4W6ZA 1C1XA 4EYEA 1ZH8A 2VYNA 3GAZA 4TQGA 3LT2A 1ZUD1 3UXYA 4OMUA 3AM4A 1G0OA 1QV6A 3ENKA 1E3WA 3PP8A 2HK8A 3U4DA 1T1SA 1HE3A 4B7CA 4XJTA 4E13A 3H9JA 4I1IA 2B36A 1T2EA 2HMSA 4XGKA 4PVCA 4PLPA 5T64A 4ALKA 5K9ZA 4Z3KA 4TWRA 1D8AA 1TT7A 3K92A 4J1NA 2Q1UA 4CMIB 4R9RA 3WBFA 3LU1A 5DBGA 3AK4A 1LDNA 1E3LA 4NPCA 4WNCA 4AJHA 5AVOA 2VOJA 2QRLA 4R5HA 2HK9A 3F6YA 2OO5A 4NFYA 3PHJA 3ROPA 3Q9NA 5H82A 1CIVA 4RDHA 5KTKA 5MDHA 3GEDA 4RV9A 3D1LA 3MEQA 4CLOA 2AQHA 1WMBA 3CMMA 3S2IA 3JD3A 3GPDG 4RPKA 3S2FA 5T57A 3AOGA 3RQSA 2W8ZA 4LMRA 1K6JA 1X1TA 1H6DA 4LSWA 1ENPA 2XXBA 4EGFA 4TRNA 3VAZA 5CDTA 4RF5A 1GD1O 4XRRA 4YJGB 4AJJA 2G1UA 2O2SA 1I5RA 1E3WB 1YONA 1JKIA 4MVJF 2VHZA 3A1NA 5ITVA 1ONNA 2GZ3A 1JA9A 1LC0A 4WJZA 3WGYA 2X22A 2WE8A 3H6KA 3B6ZA 3L4BA 1KEWA 3RC1A 3IS3A 3WXBA 2X1HA 4I5DA 5F1OA 5L40A 2JD2A 1C14A 1D7OA 3DR3A 1T2CA 1I2BA 2PTGA 5I7EA 3RD5A 3OQBA 3LC2O 3PHIA 2DQ4A 4FR5A 5H83A 3W4JA 4HP8A 2Y1EA 4AJEA 4OM8A 2GDZA 3GNSA 4TZKA 1BWSA 3Q1LA 2EW8A 3V8BA 3C85A 2WM3A 1ZVMA 1QRRA 4MVJH 3UGKA 3WSVA 4YPOA 2VUTA 3UH1A 5CEFA 4DPKA 1PTJA 4BQPA 4GH5A 3U09A 2QQ5A 3M1AA 3WLEA 1GYPA 3ZWOA 1N9GB 4BUCA 3WGIA 2RH4A 3H3FA 3HQ4O 2D3TA 4IJVA 3VPXA 4CMEA 2IXBA 1UDCA 3KRTA 5JCJD 4G65A 3VZPA 3L6OO 4WCFC 2BRUA 2EP7A 4JJFA 3F5QA 1MC4A 1DEHA 2IODA 1PJ4A 2FR0A 3ADOA 4J1TA 4WOKA 1E7SA 5BT9A 3ZNPA 4KTTE 2HMWA 4I08A 3RUDA 4HXYA 4PLWA 5KJEA 3JQCA 2GGSA 4DTIA 1VRWA 5B4VA 1PIWA 1QLJA 3C3XA 2RCYA 3ZWNA 2VQ3A 2EERA 2YW9A 4IS3A 2JL1A 3C7CB 3NAQA 2VNSA 5FWNA 3H65A 4BNUA 5A4DA 3GUCA 2E6UX 5AXAA 4HX5A 3VKVA 1WNTA 2Y66A 3ABIA 2C20A 4H15A 4IIVA 2FR1A 3INGA 1PJ2A
chains in the Genus database with same CATH superfamily
3Q3GE 2BUBA 4UEJA 3A6GA 4ME6A 3AVPA 4EPWA 4HYEA 3DSRA 1BEEA 1J9ZA 2QPLA 4DILA 2TMKA 2F43A 4R2WA 3U1TA 2XXJA 2AMYA 2FRXA 2OFWA 3MVEA 4MICA 2MINA 4UCFA 3KEGA 1Z56C 1NC1A 4FE3A 4MUXA 3RT7A 2B30A 4EG4A 3WLHA 3UGJA 4DR1B 1Y1KE 5LB4A 3STWA 1QMPA 5LKAA 3TINA 2O3UA 3KBOA 3E8SA 3GNTA 4G9BA 4LYFA 5JADA 3TNJA 2NXCA 1E9DA 1ESEA 1T5IA 4BKMA 5A1TA 1E0JA 1GYRA 3ANYB 2QU8A 4LGVA 3H1GA 2QVCA 1UUFA 5JROA 4DPMA 4JLDA 5TQJA 1TOAA 2WJVA 1VI6A 1QO7A 4JXJA 1K5PA 1YR8A 2ACEA 2FSSA 1M75A 5ENDA 3WK4A 1GSOA 5BSVA 1W9HA 4E5KA 4B82A 1SIWA 1JG7A 3OX1A 1SHTX 4KZKA 4YMTA 2XKJE 3I9KA 1HG1A 3AF5A 4Q3OA 4L8GA 4CLRA 1DIGA 1L3BA 3CE9A 5D5QA 1F3LA 5K3EA 1J97A 2DTXA 2WFAA 3WNBA 4CT0A 3KWMA 4HDAA 1DZIA 4WZBB 5U1PA 1GDHA 1P91A 2HHAA 1MEJA 5A5EA 2PD6A 1MO3A 3DBOB 2AN3A 3Q7PA 5KKAA 3VR1A 2A9RA 2V7TA 3M5PA 1E7WA 1GRNA 1D0IA 1ZC4A 3ZY6A 2BGJA 4TMTA 2ZR0A 4I50F 1OLUA 4JSRA 3THOA 4CM8A 3C7DB 2ZPUA 1JPVA 3TL2A 3GRRA 4L4UA 1OV6A 4E3ZA 2JGMA 3SF8B 4RPJA 4ZZ1A 1Z62A 5GIPE 3UG6A 4RK4A 1E2JA 1EYZA 4GYYA 4E7PA 3K5HA 2GHIA 4HZIA 4ZCSA 1FBNA 4KE9A 5C31A 3CN9A 3QBEA 4IOMA 3EX7C 1OGYA 3R8CA 5I51A 2N42A 5ES3A 1P17A 1DJPA 5JARA 3HN7A 1PQPA 1KP3A 1Z8HA 1K8ZB 3HCOA 1DCTA 3KOMA 1PLKA 2AI2A 1LTQA 1U7XA 3KU4A 1P4SA 3QKRA 4P82A 3F1KA 3JPWA 4JI4B 3C3BA 1J8FA 1ZI6A 1VLVA 5E8RA 2R86A 3C24A 4YAKA 1I1QB 3G8BA 3QYPA 4AWAA 4G5XA 3UF0A 3RVJA 1L5FA 1PT5A 1CUWA 3PEVA 4I4TB 4C2AA 2VDPB 2BDEA 1XXHE 3OX4A 4BB5A 4CG1A 1WB9A 3KJZA 3LBYA 4BMYA 1C5KA 3EFOB 4IEEA 5DBIA 4A8JC 5KQPA 4I66A 3HGTA 1G59A 1MG0A 4QGGA 3I32A 4XB1A 1DQZA 4D4IA 1DWPA 3ZHOA 2GAFA 4YFYA 5IH7A 3UHJA 1JDJA 2YICA 4MKHA 3L0SA 4EA7A 2GX6A 4F2WA 3EA5A 2B5OA 3BIOA 1I9CA 1GG9A 3QVMA 4RH0A 4UM9B 2VEOA 1VHQA 1ULHA 1EK2A 3T12A 1NNI1 4NDNE 3QBTA 2FB9A 2CLOB 4L72A 4L9SA 4XD7A 3BXOA 2ZT8A 3QVWA 4F6RB 5AHWA 3H99A 1Z33A 3KD2A 1N6RA 4O8ZA 2PUBA 3KQSA 3HMQA 2ZB2A 3DO6A 4YMSA 1F2VA 5J4YA 1KRHA 3NV9A 4YCLA 4BGUA 4E94A 3KJQA 1G8PA 4CLRB 4DDKA 1MW8X 5EZ6B 4REOA 2JFFA 2QD3A 3UXEA 1AV6A 4KMOA 4UDXX 4IRUB 3IJEB 3NI2A 3A2NA 4C89A 5JUWA 2HJHA 5BWOA 1X15A 2QRZA 7REQB 4JC5A 4Z4FA 4YRBA 4DV7B 3M6WA 2C9MA 4XVUA 4FMCB 2OD2A 2YWCA 1FU7A 4M4SA 1NTOA 1QK5A 4UFOA 2JH3A 5AW7A 2Q2VA 2K7ZA 5IZCA 1YH3A 2PLFA 3DV0A 3DM9B 3IKLA 3PQ5A 3Q9UA 3U1VA 1YULA 3T4PA 4A6EA 3LF2A 1J1IA 2MR5A 1L5YA 1ADYA 1ML4A 1WCWA 3EWAA 1GT91 3LPLA 1AHIA 4B8ZA 3DXXA 4JQCA 4Q4AA 1PD1A 3AXSA 3EMDA 4M88A 3DCNA 1RQRA 3CUVA 4RABA 2YDXA 2PUTA 4QASA 1DAHA 1S0UA 1KJ8A 4MQMA 2J31A 1VRVA 3HFGA 5C7YA 2YCBA 4F9TA 4FYMA 4BMZA 2XYQA 7REQA 4MRSA 3CF2A 2GEDA 4RGBA 3M3HA 1KI6A 1NFRA 2XWJI 1F20A 2ZS8A 3QFFA 4XQEA 1SKUA 1ITZA 1GAQA 1NFQA 1SU8A 3QU2A 2WV7A 4MQEB 2O7RA 3ZZ1A 4ENUA 3EK2A 1YFZA 4ZT7A 4EJMA 3VOSA 3RTDA 4ENVA 4BZWA 5BUCA 1DC5A 1V4NA 4ILEA 4R2XA 1O6BA 5J1TB 4TZTA 3DE4X 4KPGA 3JPYA 1CE8B 2XBMA 1DPFA 2BCGY 5CK5A 5B36A 2VCYA 3AI3A 1RM3A 5C1BA 5CYGA 4PTYA 3IEXA 1FXWA 1EGMB 2BHRA 1D2GA 2GK6A 1GPDG 1QOZA 1OC4A 1XKQA 2MWMA 2OD7A 1G18A 3NHZA 4FZ3A 3WDSA 1FNMA 1ESCA 1UMBA 1ZJZA 2CNNA 1T9CA 4PCLA 4PS1A 3IB6A 2JLRA 2WNHA 3R3VA 1P74A 2OLJA 3CEJA 4AXXA 1ATZA 1ELOA 2LW7A 2MIIA 3DO5A 2QGNA 3HVKA 4JLKA 4CCSA 3PXEA 1IJKA 4I5IA 4KITB 4NSNA 1JBEA 4S12A 1B2LA 1N25A 3IP6A 3VQTA 2ECPA 3LW7A 1UFRA 3I61A 2IQIA 5FT9A 2XE7A 1EP3B 3O9VA 4R2JA 2XIQA 1RVV1 4H27A 1WKVA 3NM4A 2D5AA 4F2HA 1J2EA 2K6GA 5D00A 2KB0A 2IBMA 5HM8A 1WMEA 3SNKA 4ZHQF 4ML3A 5DIFA 2W83A 3TQQA 3VYRB 2EQBA 4HWKA 5F3DA 3RJ9A 1SEVA 2XRFA 3R0IA 5EKSA 1O58A 5F64A 3C4VA 4TMFA 4IHKA 2ZBDA 2QZPA 3ZV6A 2IBTA 1NSFA 3TLKA 3BTOA 4KMMA 5EY5B 5DGHA 2EC5A 3IVRA 3QBVA 3GROA 1C0EA 3PPYA 4IOJA 5C8VA 5CFRA 4FB4A 3FG9A 1V7PC 1NY6A 2A30A 1WY7A 4FTWA 4BJ3A 3PEEA 1G7CA 1ZG3A 4HJXA 5ENVA 1FJXA 3GPLA 2UVPB 2ZE7A 3TQFA 4FDAA 1SC1A 4BLTA 1V7ZA 1J8VA 3T3GA 1O6ZA 3M7IA 3DOCA 4YP7A 4DHWA 1KK0A 1N6PA 5K51A 1S2IA 2Q7XA 5BO5A 3JQAB 2ODBA 4GC9A 3JQRA 4JBGA 4RK1A 4XX0A 5DNEA 4HVLA 1BXKA 5ITZA 3QITA 4D98A 2XUQA 1XG5A 3H0KA 4EW2A 2FHPA 2P65A 3VU1A 2JCYA 1IYZA 2PTHA 4OLBA 3VNVA 3AIMA 5B4UA 2GEJA 1E1NA 1GN9A 2X3YA 1H42A 4NFHA 3CEAA 5DASA 2HREA 1C9YA 3CISA 1D5CA 3MWGA 1KPIA 1ZOLA 3SQOA 1YKSA 3ZGNA 1PHPA 3MS2A 4YP6A 4E5PA 5TVGA 1RWWA 4ONEA 1IOZA 4EHDA 2WR8A 3JQ7B 3HU1A 4QXRA 2XZOA 3W6ZA 4N5HX 2H17A 3TDMA 3MJVA 1QNLA 4CBVA 1QF7A 5AJTA 1DTWB 3IOBA 3KB1A 3V4VB 1D6SA 3A3PA 3H5VA 1BH6A 1VCHA 2DPLA 4WLNA 1Y4AE 4EI8A 3K35A 1H05A 1UQRA 1CY1A 4WDQA 3LUJA 4OSEA 2LZ0A 2HF2A 1CVLA 4ZCLA 5L7WA 3UWKA 3HU3A 2WA1A 2C97A 3GJTA 2OHVA 2ZIAA 1U1DA 1L5GB 3DTYA 4BP8A 3GLGB 1VB3A 2GJAA 2Z43A 3GG2A 3N6XA 1IPFA 4KQ1A 4OLFA 3SY8A 1RJWA 1ZK0A 4QYMA 1W4LA 3VH3A 1QZTA 4NU0A 4QJ5A 2I71A 1ZMTA 2PS3A 3MLAA 5DBHX 1GTG1 1UDBA 4ZQEA 3QEAZ 1A1VA 4PAOA 1HEUA 4H77A 5H1YA 3TIGA 4B81A 5LQAA 1BVYF 4ATNA 1YDMA 3DKRA 4DV5B 3MPOA 2E4UA 5LZ5A 1UBMS 3I9V6 1EQ2A 1Y6QA 2G06A 3X1YA 5EJEA 1L5LA 3U0VA 3QLJA 2FEKA 2YH2A 4CFSA 5CT6A 3TQOA 4URXR 4AIRA 1TJ3A 2GPTA 2PZEA 2ID8A 2P77A 2YYZA 2XR1A 3D3EA 2AOXA 4RZXA 4YASA 5HKAA 3KQNA 2CDBA 3N1UA 4KPUB 4ESVA 4G9GA 1GZ6A 3BQNB 1TW2A 1A9TA 2Q28A 4TV8A 1W29A 1G8FA 4RA6B 1Q6YA 5FHQA 4EJ2A 1RM4A 1UEJA 1WXDA 1E3IA 5A62A 3I45A 3E27A 2X23A 3BXPA 3ONDA 4TTVA 2OKCA 2X0RA 5DHQA 1UDWA 2JVJA 3S3TA 3MN1A 2VTVA 5F7JA 1QVRA 3W5UA 2YXLA 1V5EA 4EZBA 2J6CA 5CXXA 5FO1A 4E09A 4LOKA 2Z6AA 4FD2A 1GFIA 3P9XA 2V8BA 1Z34A 3L84A 3F3KA 5DHPA 1PGPA 1AQUA 5CP8A 4B3HA 1VMKA 1UBNA 1YDWA 4HPXB 4BMDA 5IF9A 2JD0A 3EZGA 3GLSA 3T9FA 1N9GA 4W4TA 2QXYA 2YVKA 3P2JA 3KZNA 4E2WA 4WCDA 3EZ2A 1KJZA 2IYEA 4KPEC 2OD9A 3CNOA 3FCOA 5FJIA 5BYBA 4CEJB 4KP7A 4XVQA 4E4YA 1V8BA 3FSRA 2HMVA 1V71A 2GF2A 1P0MA 4P5PA 2VT3A 3AG5A 1I4OA 1BWPA 1PFQA 3K16A 4BB0A 2O8EB 4NS4A 1E1MA 1IG3A 3WX0A 4JBHA 3BFXA 2AFHA 1PW5A 4JOBA 1QGDA 2R7LA 2G72A 1ZOSA 3NHFA 3PJGA 3I04A 1P4GA 4Q18A 3ZNNA 4KKVA 1AGYA 1R9GA 3FDFA 3P5BA 1RWBA 1L4GA 3QNUA 4D9JA 3AW9A 3RBZA 3DCIA 4IY1A 3TD9A 5BSHA 1JKJB 3WBJA 5J40A 3NOQA 3NGLA 5KVCA 4ZU3A 3LGSA 4V1CB 4XWWA 3AVQA 1CUEA 3M6IA 2O8EA 4U4AA 3H7AA 2FSFA 3DQQA 3SBDA 2OO5C 4IFEA 1U2SA 4QQRA 1FUKA 2Q2NA 1QDUA 1W5AA 1TLFA 2B8TA 4QLBA 2OLKA 5JV5A 3LSYA 3ND5A 1N92A 1QC5B 4A0GA 2ZJ0A 5HGJA 3B1FA 1ONPA 2HWXA 3PXBA 3BZBA 4FFOA 2BZGA 2WWRA 3LW8A 3THRA 3VDRA 3CPEA 4RFLA 4RVUA 2D1YA 2D1QA 4ND8B 2DUUA 2YXNA 2WJJA 1R4AA 3GIWA 1FQJA 4ZC8A 3Q3HA 4YRKA 4L5CA 1Y6RA 4ROSA 5CMLA 1MVNA 5ICEA 1EWTA 1TEVA 4ARCA 5TQ2B 2X42A 4B7ZA 1MJ5A 2PRIA 1L7MA 4Q02A 3U3ZA 3GXOA 4HUTA 4F5EA 5K8JB 5FPSA 5KQGA 2YV3A 1X1AA 3FWHA 1UEXC 4O4HB 3S7ZA 1CK4A 1F2TB 2DPHA 2C07A 2CNOA 2FLVA 3BRWD 4W5HA 1ID8A 1CSEE 3X2EA 1WQ1R 4GXRA 3M2TA 3BIJA 5J63A 4AD8A 4BNYA 4W1PA 4IICA 4CG2A 2V7PA 1PJAA 1D2AA 2P4HX 3LVFO 4N4AA 1Z5ZA 2J48A 1U31A 2ATEA 2NU6B 5B58T 1CZNA 4LXXA 4QD3A 2EJWA 3KQVA 2W2NA 1WTCA 2C3YA 3G2IA 1V5GA 1X1SA 1PE0A 3AEXA 3EYAA 4K9LA 4WOCA 2OGSA 1L6RA 2HNKA 3SZOA 4CU2A 2X5JO 2XE4A 2ZM5A 3JZMA 3NDIA 4KAAA 4JS0A 1M8GA 2VNJA 4JMLA 1KC1A 2FW6A 2KBFA 3HZOA 1HI9A 3DTVB 4KVGA 1FC0A 3AEUB 3W06A 3O4JA 5HUHA 2X86A 1ZS9A 4MS1A 4Y1RB 2XTMA 4ZI7F 1Z7EA 2CL7X 3SJBA 5LZ4A 1E0SA 2VHQA 5G1PA 3UC5A 2YOHA 1RNLA 4YVFA 2PNFA 3A6PC 1VGQA 3AEZA 4MRPA 1FUYB 1UBKS 4P2BA 4I1YA 4KR3A 1RAGA 1E6CA 3R5KA 3NTQA 3I3SR 1PZGA 2IVZA 1KYQA 3PXXA 1MW9X 2DFKB 2DPYA 2I7DA 1CR1A 3L0CA 4KLNA 4GMDA 4Z0NA 3VOTA 2DVMA 5DB4A 3FCAA 4BO1A 2JJ2A 2OG1A 1AA6A 4Q3BA 5HKLA 3MAJA 4QJIA 2YY5A 4CM9D 3PJFA 3M0EA 4MS1B 1O54A 2HEIA 1QRAA 1B0UA 2JHPA 2JVKA 3TUZC 4BCBA 2FW8A 3KKEA 4UU1A 1I7LA 4I0WB 4UCXA 3WQQA 5CGQB 5D3MB 2QENA 1UANA 2Q4BA 4ZHSA 3OFNA 1G7TA 1VZ3A 3PUVA 3QSYA 1LDYA 1QTNA 3DNPA 1D1SA 2Z9BA 1H8ED 2K5UA 2WG2A 1AS0A 4UUMA 1O0CA 1PZXA 1KO5A 2XHZA 3CZCA 4ZWNA 5IH3A 2NZUG 3EZFA 2JFQA 3ZDEA 3KJXA 2IU4A 3EDMA 3OEHA 3INRA 5KPDA 3KEFA 4Q4LA 4YMIA 2O3QA 1WS6A 3NHAA 4FHGA 3AVTA 4AZ0A 1TCUA 3C6XA 4AC9A 1NXSA 1DTSA 3EZLA 1DQSA 1JFFA 3W0LB 4WN3A 3J81k 4R1OA 5HBRA 4D99A 1QO0A 2GA9A 1RYNA 2OHIA 4IGFA 4ITRC 3W78A 2WM9B 4OA5A 4C6HA 4EHKA 3W8NA 4CM7A 5HFAA 3RFXA 4LCBA 1E5VA 3ZS8A 2DOKA 3IAAA 2G9VA 2JAOA 2XSZD 2ZI9A 4LFBB 2OVBA 4HQ0A 4FUQA 4ETNA 2VH2A 3SX0A 4MUEA 3ZWAA 5IU6A 4U6QA 4CMAA 1T9DA 1P18A 2IY8A 3DHNA 1OXUA 3QFTA 4GBED 4JOSA 4M0EA 1USIA 4QEKA 4GLOA 5CFQA 4ZT2A 3B1WA 1E1QA 1TQHA 2CFIA 3ADKA 3THWA 3OFJA 3TM4A 3TTWA 3RNOA 3KOWA 4KPFC 1PLJA 4O1HA 4RDIA 2GAJA 3LPAA 4GQAA 2VRNA 2YHBA 4HRAA 4IIJA 3IKVA 4JB3A 5DK6A 1N8TA 2JPDA 2X7JA 3HJAA 3QUCA 3LP8A 4X1YA 3EVZA 5TJHA 2AR0A 3E9ZA 4MO9A 3W6NA 4CV0A 1H5NA 3UKJA 1XO1A 1KI7A 1R0XA 1V35A 4HGYA 1AT1A 4DJAA 1JKXA 1G6Q1 1N5OX 4QYIB 3IXMA 2HBYA 3NHMA 3B85A 5AJHA 2QG6A 5IN4A 3K9HA 5D8DA 2WKWA 1ZNXA 2YDYA 5PGMA 1MRZA 4XZ3A 3D3WB 5IVKA 1UPXA 4RVDA 4RMIA 5L4SA 2WJIA 4JGGA 3ZD9A 1FSPA 2CVQA 3DTTA 1TFUA 3ZKAA 4IVPA 1Q1EA 3PDWA 4HYQA 4QXQA 3ABSB 4XGQA 3CCCA 3IP3A 1VCNA 2IP1A 5T3UA 3WL7A 4DLZA 3QNMA 1DPGA 1YZHA 2YY6A 4Q4HB 2HRRA 2I4TA 5JQGF 3VTFA 2Z83A 1WZ2A 1XK6A 5DP1A 4HAIA 1ZU5A 3EASA 3HUTA 2EKQA 2SCUB 3ETNA 5LIPA 3G5LA 1V16B 2BZ1A 1JNYA 3T38A 3F2VA 1IM5A 1IY9A 1F17A 4YBRA 5GONF 3ROEA 3U0BA 3V4RA 2CDRA 1J2YA 3KUUA 3PA8A 4FEAA 1ZH0A 5JCZA 3TEFA 1K5DA 1U0GA 3TBHA 5KYWA 3TTUA 1EVZA 3QV2A 4L50A 1LA2A 3GPCA 4XD7D 2C2ZA 4KQ2A 3S0JA 1AK9A 1VG1A 4KXXA 5EJ4A 2MSDB 1JHRA 4JLBA 2H1LA 4IR7A 1NWCA 3CO0S 3AJAA 4LI0A 4A8JB 3HHEA 5AI9A 3RU2A 4R54A 3UOAB 4HH0A 5K0CA 2PR7A 4YIKA 2RSLA 2PUEA 2ZDGA 4PYIA 5DGIA 3U3RA 1OQAA 3NRCA 5CVDA 5EP1A 4IH1A 4JT4A 4BU0A 4W9MC 1ZD1A 3IBCA 4HFNA 2DBVO 1PGQA 1G5FA 3LE8A 4DS3A 3C4QA 1CB0A 3K72B 3QLVC 2WSYB 5DXJA 2RK3A 1KVQA 3QI7A 4MARA 4ZPJA 4U7GA 3OCYA 5JS2A 5JSYA 2X8BA 1SKQA 1TMYA 1CR6A 1VXRA 3QFCA 3SD7A 1Z0UA 3MGAA 3B2NA 2G1PA 1PS9A 2BF4A 3EIHA 1AA9A 3IDSA 5TRTA 3LMKA 3WTCA 1V11B 1IUKA 2P5YA 2E82A 4IMJB 4A27A 5DULA 1D2EA 3QEMA 5ICMA 1KNQA 2OFXA 2NO9A 2Z8YA 4IIGA 4CLXA 2PRKA 4JJ7A 2BHLA 3ESRA 5THKA 4GUDA 2D5CA 4BNHA 3THXA 3BFKA 4L6AA 4L4RA 2C7PA 2CMGA 1V5IA 4YO7A 1UK9A 2G1AA 4B44A 2DETA 1EFRD 3EZNA 1E1KA 2DERA 1UWCA 4TYPA 5GJBA 4DJEC 1JZTA 2BEVB 5LIRA 2IXEA 1ND5A 2D0PB 2D1SA 3S5UA 5T8KA 3BREA 2TECE 3FWZA 3CRZA 1MR3F 1U7WA 1TT5A 3HYRA 1XSEA 3PC2A 3I1IA 4QUDA 3T5TA 5AIAA 1TCAA 2HBZA 1VYTA 2HLHA 2RKBA 2ZUWA 3GMIA 1R50A 4IP0A 2RKOA 3E7PA 2BM9A 1EAMA 1GEEA 1HRKA 5ERXA 1BMFD 1W88B 2G36A 2JGDA 3R09A 4JB0A 2P75A 4N54A 4NECA 5HS6A 6GPBA 1OT3A 1SCDA 5HQ3A 3WRVA 1E2MA 1P2BA 4OKIA 4UJ5A 3WA6A 2ACWA 1XD2B 3I28A 4Z4HA 4BX8A 3K8OE 5KQSA 1JWLA 4KIWA 1QE0A 1Z3IX 1Z0DA 4URHA 2WP0A 1QJCA 4PE5B 2PGNA 1I1HA 1RQNA 4LY3A 4EENA 3U17A 2C5GA 4A5OA 1RP7A 4UJ3A 1IXZA 2CLLB 2PSFA 2A8YA 2W00A 6REQA 2JHFA 2VDUE 2ASVA 4G8BA 4C3UA 4KIFA 2XUOA 2ODPA 2OEPA 2NXJA 2GJ9A 1KAQA 3BRQA 1O6GA 1BDHA 4BECA 2W0MA 2J6HA 3I4FA 2CZCA 3KZCA 2CHUA 3O1IC 1LBEA 4AUEA 4WINA 2QL5A 3CYFA 4DMRA 1ZGCA 3QQPA 1JTVA 5HCNA 3A9WA 1FCJA 4MDHA 3JWIA 4E4RA 4KIGA 2YJ4A 4C0HA 4LZPA 4LSZA 1Y1TA 3OWOA 2GNOA 1LCIA 4W8OA 1ABEA 1EP1B 1SQGA 3BK1A 1NQTA 2XQKA 5C5IA 4MV7A 4YRSA 4F4HA 1OXTA 1E9EA 1H93A 4LSMA 4BNWA 4P7GA 3R41A 1M5UA 4RTSA 3DVAA 3UWPA 1SULA 1G8SA 5AW5A 1GU0A 4HI0E 4EVRA 3KAKA 4M1ZA 1GNRA 4PN7A 4EUKA 2ZJZA 5C5CA 4LG1A 1PFKA 3B1YA 2PZJA 2ZYRA 3VR5D 4I9FA 1PFGA 2G6TA 3GT7A 3KTAB 3ND8A 2B5VA 3OM1A 1LX6A 4K05A 4WXRA 2PXCA 4ALJA 3UJDA 2AG8A 1WV1A 2NAPA 3QLUC 4HN4B 4B6PA 1W36B 4C0KA 3PJEA 3B3JA 2OB2A 3LYLA 4HR7A 2GZRA 3VR6A 4CMGA 4W9RA 2LIVA 2WSSA 1GQQA 3TBKA 1A9RA 3CJRA 5CLJA 5LKRA 2PSSA 3E3OA 3P8ZA 4LHXA 3WY9A 2P78A 4R1UA 1OFUA 5GONA 3TXYA 4M21A 4RVCA 3LDFA 4BFUA 3R3ZA 4PG4A 4UU8A 4F8JA 4QVIA 3QBDA 2QV0A 4ZIRA 1A7AA 1XZLA 4NZ9A 1HBJA 2XDQB 1KR5A 2ZJAA 3M81A 1OX6A 2PKQO 3QKIA 2JIZD 2QTMA 1LLQA 1IHUA 1NP6A 5I7HA 1SN7A 1EVKA 5I9TA 3EMKA 4GX1A 2OHJA 2A0KA 4ZGGA 3SOZA 4RM2A 2R4UA 1D6NA 4XDHA 4EI2A 2AQ8A 3QFRA 4RA9B 3S2EA 3VVBA 2X58A 4W5NA 1VLJA 4MYSA 4BLVA 4EECA 4DRXA 3T5GA 1TAUA 5JS6A 3LA8A 1NONA 3EW9A 1VHJA 2DECA 3GDOA 1F9AA 2AN1A 4V1CI 4AY6A 7ABPA 5M5BA 1JH8A 1A4IA 2UYHA 3TNFA 2ZWPA 1OZGA 3PGA1 3NHRA 4DOMA 3UMYA 1DWOA 4LXQA 4B3MB 5HZMA 1AQLA 2GZ1A 1T3GA 3I5YA 1AK1A 3OE1A 3R7FA 1J1UA 2F4NA 2QDXA 2R79A 2SECE 4Q7QA 5GM1A 4AFNA 2R4TA 3CLSC 1YR7A 8AT1A 4X5OA 3AYXB 2XYHA 4CHTA 2CLDX 2QVGA 4RIGA 4RTPA 4MVJA 3FM9A 4FIDA 5K2OA 3EIOA 3KVRA 3A4VA 5BSFA 3PIRA 5LSAA 4P9NA 2OP0A 3X1DA 4HADA 5BUQA 1ISRA 2B1RA 3GWGA 1YS6A 3OY7A 5AW6A 2H7XA 2PKWA 3SKXA 2TSYB 4R8RA 3UCXA 4JODA 4PAMA 3ZK7A 1V7CA 1QDEA 2FEPA 2J0UB 2X0KA 3C1AA 1X0XA 2UVQA 4DLAA 1JVBA 3LLCA 4MV3A 5E6SA 1H23A 3CX6A 3C4JA 2JNWA 3COPA 3UXHA 1W96A 3ZE6A 2JFPA 4DLRA 3OPYA 4TWZA 1PR1A 4RGVA 3SHQA 1OH6A 2VP2A 1NA5A 1WF6A 1AF4A 3HL4A 1BIFA 3IP9A 3N7UA 5ARDA 3T3MB 4W5RA 1N2SA 2W37A 3CWCA 4FMDF 1QYDA 4FEGA 4AMBA 4JT8A 1AUOA 4MWCA 3QX3A 1PNVA 1S7CA 3LK6A 1AH2A 3KUDA 2PRZA 5HQJA 1IZZA 1JDBC 1QH8A 1BXRB 4B2IA 1TYDE 5F5LA 4KLZA 2CE2X 1GL6A 3TCKA 2EZ4A 3Q3EA 4EW6A 3FZYA 3IHKA 2YCLA 3IC5A 1J70A 4Q7JB 2I4RA 1MU0A 1AOXA 5E6RB 2DHRA 1Q0ZA 2R96A 4YRNA 4IIJF 3PK0A 1Y3DE 4MS4A 5JSUA 1KJWA 1WB5A 4QYTA 3TR5A 5KIAA 5LU8A 5HQTA 3KSMA 3TOCA 5FORA 2C7VA 2BGNA 3SHWA 4ZO7A 5AHRA 4IILA 1U8XX 3I2GA 2J85A 1UMCB 2Z9CA 4N8EA 5KDOA 2WIAA 3IT3A 1IEQA 3GFBA 2RH8A 1JNXX 3B1VA 1C1DA 3PXAA 4ZAXA 1XI2A 2IKSA 3CSDA 3HXLA 2WHXA 1DMRA 1RT9A 3O1LA 2QRMA 2PX0A 5L3VA 1CRZA 4C07A 1YCHA 2QTNA 2JEZA 3RSSA 1CUBA 2WVJA 2PZ8A 2XMRA 3BB4A 1IU9A 1FMFA 3B6MA 4MA0A 4MR7B 1NOJA 1TC2A 4RLQA 2JBWA 1JHPA 4MYRA 5AD1A 1YB1A 2XV1A 1DG9A 1G41A 3LKVA 4RIHA 1ORRA 1BJTA 1NKTA 2YHAA 3DPSA 5JD5A 3BDVA 2HRBA 1T9BA 4G5YA 4C4RA 3GLGE 1Z13A 3KCQA 3PENA 4GR9A 1SVOA 1OBCA 5IBQA 1R0WA 1JIIA 1LS1A 1B42A 3O8CA 1BHSA 1JKJA 3UA3A 2YYSA 2OGUA 2ORVA 4IZOA 2R11A 3A32A 4OY3A 1QYRA 5AM5A 1QV9A 4NH0A 3F6CA 1N9KA 3SQDA 3B6EA 4DV2B 2BM0A 2QXUA 4RF4A 1FDSA 2H3HA 3KYIB 4X1OA 1BXGA 1DJNA 4LJSA 1I8TA 1PK8A 4NULA 3TTTA 4JC4A 1GUAA 4KL8S 1I36A 1LFAA 4XSHA 5DCLA 1VIYA 1BCRB 4R3WA 4RETA 5FTMA 1ESMA 1OYOA 1Y89A 4BQFA 5HJ5A 3FHOA 3CVXA 2VTBA 1PVDA 1SM4A 1X0VA 1FNNA 3FIJA 3EZYA 2GN8A 3ZWMA 2IYYA 4LXIA 1KDYA 4PYLA 5JALA 4L5IA 3JTMA 5A9TA 2C83A 2RHCA 1I10A 3SMVA 4C01A 1E1RD 2QAGB 4TQUS 1YMUA 1O57A 1IPHA 3HYSA 1IZ7A 1XKLA 2VVTA 3BFVA 4FR0A 5TVKA 3UFXB 2H31A 4C6TB 2EKPA 3FTNA 4KXLA 4NMMA 4C0JA 1GZDA 3GA0A 4MLZA 3I1YA 5JDCC 4YREA 5LJLA 5HP4A 3ZTYA 1GZVA 2FPOA 2JH9A 3MMNA 2ZUEA 3FNQA 1FRFS 3UUEA 2G40A 1W5EA 1B8NA 3VNQA 2FE4A 2XE6A 2ZREA 4YJ2B 5KTTA 1WZNA 1EK6A 3MQ2A 3VTZA 1TU4A 1Z7BA 5JC1A 4X6LA 4DA9A 3ER8A 2R6HA 4AICA 2O07A 3H8VA 2XOXA 1QGAA 3D4NA 3GGGA 4BNJA 1BO6A 4EGCB 4OQNA 4CT4B 3OM0A 3BMCA 1GJRA 1XMVA 2JJ2D 1NXXA 4OU4A 1M8FA 1O0SA 3LY7A 4J3NA 1IPEA 5E3IA 2D2IA 1DADA 2V7UA 3RHZA 3MRXA 3QOYA 3EVDA 1UFOA 3LDUA 4OQEA 1J8QA 3O0DA 4AKTA 1U2DA 1X74A 1U2TA 1YZFA 2GCOA 5DRYA 3T94A 3WK8A 4G4SO 4PM4A 1BYIA 3VC7A 2ZI6A 5IXSA 2VLIA 3A05A 5BW5A 1Y1QA 2VQSA 5EOVA 2HIMA 3QHPA 2H1HA 4JUDX 3X1ZA 1NQAO 2YMLA 3HB4X 4MV0A 2GPAA 3RYFB 3NDBB 2G8NA 4R1SA 3AR5A 4IIUA 2VJBA 3T1NA 4E4TA 1SG0A 4DMGA 4L95C 1M67A 3BEOA 3DOHA 5AK3A 2OAGA 2JLQA 3GDFA 4H7EA 1UQUA 3ZIAA 2DUWA 1E4YA 3VI4B 5C7LO 3UPUA 5JQWA 5KHLB 3PYXA 4W1RA 2G9ZA 3AETA 3CLVA 3CNHA 1YR3A 1O89A 5NLLA 3IUEA 4PWZA 5IJWA 1O94D 2W6PA 4JLNA 1A9YA 2PBFA 1HNWB 1L5RA 3JWHA 3KDSE 4MUIA 3AZPA 4YR9A 3OX3A 5U4XA 3LXRA 1Z6ZA 2EKBA 4GLFA 5ESWA 1GGFA 1IE3A 2OILA 3GA7A 3OETA 2AG5A 2DFPA 3BMNA 1JWBB 1ZK1A 3JQ7A 5E95A 4OBXA 2VL7A 3SEQA 2Q5IA 3O4GA 2WWYA 2OYCA 4WY5A 3TLJA 4DL9A 1ISMA 1U9IC 2QQGA 2GCPA 3I2JA 3TFQA 1GV1A 4CKZA 5TMBA 5KS2A 2RE8A 1E1QD 2A59A 2HKIA 1QLWA 2IUUA 3KSUA 1W581 4ER5A 4H3HB 2IIVA 2CL0X 2IIQA 3ZGZA 4ZYUA 4HGPA 2FWNA 2ZSJA 1RHKA 2BFDA 3OQ6A 2MSEB 4WY8A 1JG3A 2YC2C 3MMZA 2CVPA 5M34A 3E61A 3Q7QA 4L6IA 4AX8A 3PVSA 3GPBA 3TZKA 4E6PA 3OCXA 4ZOEA 1P1RA 3KIPA 4S1PA 2NU9A 5H3HA 1GAWA 1BW9B 4FEYA 3GDGA 4HQKA 4CM1A 3H97A 2V3VA 3VJRA 2E0IA 4HB3A 4JLPA 2RGYA 2A5LA 2J0QA 2QG4A 5B64A 5IK2A 4A8JA 3IPXA 1XA4A 3DHYA 5D3KA 5LQSA 1HETA 1HURA 3DVSX 4UDOA 1JUDA 2HSEA 3VVLA 4BNDB 1OX4A 1P4JA 1RHQA 3BCSA 3LWZA 4AG6A 5HHTA 2B25A 1ZR2A 5BQ3A 3DAPA 3UM9A 1RMTA 5LZ8A 1OFHA 1SZPA 2HDOA 3R0ZA 5EHGA 3IMGA 4IXNA 1JMVA 3R0JA 4TMZA 3S1SA 3DBVO 2IEIA 1UBSB 3TVDA 5HJ7A 1GGJA 1QH1B 3IRVA 5KC9A 1NRJB 1XTSA 1TK9A 2V8OA 5AMXA 3HU2A 4GP6A 4NU6A 4O2RA 4CDGA 1LTHR 1YIAA 3LYUA 1K6XA 3PRJA 3WGMA 1UMDB 3GFQA 5CTAA 2A14A 1BJKA 2ETVA 4DSTA 5IASA 3B3AA 3RYFA 1KA9H 1S3FA 3G2HA 4NAHA 3QUAA 1N3YA 1O9HA 1KYZA 4H35A 2OK8A 3HJUA 4ZDWA 2FCAA 3JQBA 3JQPA 4GLJA 3O90A 2BRUC 1NUUA 2GBLC 3FFTA 4DZZA 1KETA 3AHCA 1ZGGA 2JA1A 2XZPA 4LVNA 1K08A 3I8OA 5CLLA 4YNBA 1JLHA 2BZ0A 1JQKA 4OK6A 3L7IA 3MRTA 2B7BA 2V5AA 3PRKE 3FR8A 3AUSA 3KZVA 3GK3A 3JQDA 4TTIA 4AROA 2QB5A 1KBOA 1A9QA 1NQOA 1TLTA 1UPAA 2VWQA 3L5KA 4IJ6A 4IX1A 5AWFC 2F8TA 1JEQB 1N2ZA 4HZUA 4GKVA 2JLSA 3JWPA 1M8JA 2OBYA 3AR6A 5H68A 4ZT5A 3CGGA 5DN9A 3RF6A 3G9XA 4D0RA 3FVQA 1YBHA 4D4JA 3KLOA 1GV0A 1Z0FA 3GJ6A 4H0NA 2IV3A 5KVAA 1AGPA 3O95A 1S5PA 2RGXA 2IXFA 2VZ0A 4KQCA 5FPKA 1G55A 2VHYA 3Q7RA 1K92A 2Q07A 2FV8A 2IUTA 1WZCA 3H16A 3H1TA 3QXHA 4RL4A 4RVHA 2HLPA 5LUBA 5LP6B 1U4SA 4QGAA 5G40A 5BURA 4B3SB 2Q3MA 1W36D 3B48A 3D8BA 4GP7A 3MUNA 1FQKA 5KX5A 1QONA 2QSYA 1CFJA 3P9YA 5LXTA 2EG5A 5IAAA 2NTNA 4NBLA 2VK1A 2IYNA 4ZARA 2UUBB 3VNRA 1A9OA 1W93A 1Y9AA 4EHHA 3STVA 1R6VA 2B4AA 3L4JA 1G20E 1V48A 2XJ4A 4KWCA 4FFPA 4CIAA 2DPGA 3MTEA 4H7HA 3WKAA 1W1IA 5A6SB 1UBFA 2IEBA 1DVRA 2VCEA 1W8DA 2OCKA 3L9XA 3GB9A 3THSA 3NC4A 4TTTS 2OCLA 3T1HB 3RRBA 4IH9A 3JCZA 3E3LA 4JLAA 2YZ7A 1ZIDA 2WFLB 2CJYA 1P0CA 1JHYA 16PKA 2HD4A 3A8TA 3CLRC 1S8AA 3EVNA 4HT3B 4JI2B 2G7MC 4NVRA 5A02A 3AYZB 5ALMA 5L3SA 3NATA 3KKKA 4R2MA 4DQUA 3DLTA 3R6LA 4J90A 3UUFA 3DBHB 3MZ0A 1QX4A 4O4HA 1J21A 4Q3DA 4IJMA 5FB3A 3KAJA 3JALA 3MTQA 5CCEA 3NJ4A 4LRYA 3BD6A 2WWWA 4QLOA 1NU8A 3UGQA 1RJ9A 1FNSA 4L6CA 2D0DA 3DO8A 4G0OA 1DBWA 1SHUX 1E3TA 1YL7A 1Z6XA 2E3JA 2WYHA 4R81A 4HGZA 3ZE2B 5FOQA 1B6GA 1M2JA 5DPMA 1XALA 1TGVA 2IZ6A 3K0HA 2M32A 1KY3A 3BBLA 4ZOLA 3RPEA 4L73A 5AVWA 5DWVA 3AM5A 4J9UE 4H6PA 2PCJA 1U65A 1AC5A 1S2GA 2Q45A 2P6UA 4PLHA 4UTNA 3MAAC 3DZHA 2EJCA 3QG5A 1X7WB 1R6XA 3L6UA 3G82C 3Q3IA 4L7QA 4QFMA 3ZU3A 4KK4A 4QUBA 2JG3A 1UZMA 4ZCTA 5I7SA 1NAHA 1BRMA 1NPDA 1HLGA 4UDYX 1P73A 4IQFA 3WHIA 4GM0A 3ZKWB 4PN3A 5BVHB 2J08A 1A76A 1T4BA 2Q9AA 3BJMA 2WUGA 1MP0A 2XMPA 4WNIA 2X0IA 3CLKA 1IXSB 2NOAA 1K7EB 3DBLA 1N5MA 4FOOA 1NW8A 1CV2A 1K5GA 1LDGA 2PO5A 2BFEB 4JBXA 3D5TA 1SCUA 4OLAA 5LOVA 3PX2A 4IRXA 5IAEA 2Z1NA 1ZO8A 3DFZA 3L0OA 1Z06A 2BFBA 3LCUA 4LZAA 5CTJA 5M2QA 2OHGA 3CR8A 1P44A 8ABPA 4JJ6A 3IQDB 2CDCA 1CNEA 3KB8A 2E4ZA 4KIJA 4RM3A 1G5IA 2O2XA 3TAHA 3ZPXA 3V2HA 4FQ8A 1PNTA 1AUVA 2R6R1 3JZFA 3NFYA 4KE7A 2HYDA 2O1WA 5C7OO 2HZ7A 4DB2A 1B3RA 3FKJA 4PNPA 3B70A 1GIAA 2VK2A 3I01A 3AI7A 5EIFA 3ZDQA 1E6WA 4ARAA 4ZYVA 2R7NA 4QA9A 1JU4A 2CXSA 2C7GA 1Q16A 1ZEMA 1E3QA 2F9MA 3AU9A 5AQEA 5T8KC 4BOYA 1A1SA 4ZTBA 3U3KA 1FX0A 3HDQA 5A3JA 2N3ZA 1U8EA 2RI6A 1XCLA 4DIMA 2B69A 4ALMA 3AVYA 5MN6A 4PFSA 4YRJA 1OLUB 2CXUA 4Z7JA 3SI7A 3UMJA 2FLKA 2OV8A 1X77A 3TYXA 4DSZA 1EA5A 3A6DA 1KZYC 4G0QA 3OKPA 4OLJA 2E89A 4EB3A 3FZGA 3TCXB 5EHZA 3PSHA 1OXSC 1QHNA 3GT4A 1Y7IA 4Q1DA 1FYVA 2X2EA 4E12A 3DZFA 3HKEB 5CX1B 4N0DA 3IQZA 1UCFA 4RENA 1V9CA 1UT6A 3HP7A 1F2DA 2A58A 4XIYA 1MABB 2H1RA 1JZQA 4Q15A 1JSCA 2WHEA 5NULA 2I4IA 5G4LA 3BF8A 4DJJA 3KJNA 3ER6A 2WYUA 4HDMB 5KB3A 3K1JA 4L3VA 1PYGA 2NP7A 1TM5E 4JJEA 4C22A 1RD4A 2JLUA 1DAOA 3E81A 1KOJA 3F67A 3KPJA 2C1XA 2UKDA 1SC9A 4L9AA 4RWEA 2IPXA 3J7TA 3WMWA 1GU7A 1GZ3A 3AQ4A 4IZ6A 3ZJVA 1LDEA 2WUEA 2OM2A 3CT6A 1MQAA 3HHPA 2ZUCA 1CUHA 3GFOA 4Z9BA 3LUFA