1JWAB

Structure of the atp-bound moeb-moad protein complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
239
structure length
217
Chain Sequence
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 76
structure length 217
sequence length 239
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jwaB00
1LJ8A 5G4KB 3NJ8A 3KSZO 1NWHA 4IDBA 1HF3A 3Q1LA 4HNHA 4QUKA 1JKFA 3OM9A 5IXYA 3BTVA 4WGGA 3S55A 3C1OA 1GEGA 4HFMA 3KSUA 1LDYA 2CDCA 4AJOA 3MJEA 4M54A 2A4KA 3RIHA 4ZQFA 3WYEA 1Z82A 4YPOA 2UAGA 3WX0A 2PKRA 1U9JA 3ZGYA 2JD2A 2AQ8A 1EVJA 3UAGA 2GRAA 4TKMA 1I3KA 3B1FA 4YDRA 4RPHA 3ZV5A 4CQLA 1WAMA 5T64A 2OXIA 3JD4A 3KUXA 5GY7A 2HMTA 1JWAB 4CR8A 1IYZA 3DBVO 5FEUA 4R3NA 3EVTA 2X86A 3JQEA 4ND3A 5L4SA 3NJ4A 4MVJF 3KZVA 4W99A 1PJSA 4PZDA 1O8CA 1QKIA 1WNTA 4JP2A 4WCFC 2O2SA 4L4SA 1U2GA 1TI7A 1YJQA 4HXYA 2PGLA 4JK3A 1A7KA 1GCUA 1YJ8A 1LTHR 4YJDA 2CVZA 2YHUA 5IDQA 1EEHA 5LC1A 1CEQA 1HDYA 3TZHA 1HZJA 2O3RA 3FTNA 1N9GB 3OEWA 4Y6SA 5TS3A 4J1NA 3UW3A 2IEDA 4ZQBA 4BNFA 4J4BA 5LCXA 3L4SO 3VAZA 1T2EA 1XU9A 4O1MA 9LDBA 3VTFA 1B26A 2B83A 2FP4A 4CV2A 4J7UA 5I8WA 4YWJA 2OP1A 2HUNA 3FD8A 4E2YA 2HO5A 2P91A 1FDUA 2ZYAA 4YEDA 1IZ9A 4KOAA 3I83A 1F8GA 2XOXA 4FQ8A 3B1JA 3U4HA 4DGSA 5ITVA 2JAPA 4KDFA 2GN9A 3OQBA 5L95A 2G82A 3DONA 3PJFA 4Z6KA 2VOJA 4KUHA 3QWBA 1BMDA 2W4QA 1ID1A 5IDXA 2IZZA 4A0SA 5ICSA 4EBFA 1WP4A 3VKVA 4XRRA 1KC3A 1Z7BA 4UEKA 4UVHA 5CPBA 2HMSA 1E1NA 1OMOA 3VKUA 3L0DA 4CMHA 4IMRA 1K2WA 2W2LD 1ISHA 4JJIA 5KOIA 4S3MA 1SPXA 2HJSA 1HEUA 4PLPA 1YQXA 3N7UA 3TZKA 2I5PO 4RDHA 1I2CA 4UEOA 2FR8A 1GU7A 3ETEA 2ZQYA 3HSKA 3GGOA 4JROA 5COQA 4CLOA 4J16A 2YHIB 3RUCA 2B35A 3LT4A 3VPHA 3VPSA 4OHUA 1QLHA 3PP8A 4PG8A 5HWSA 3RASA 1KS9A 4KMSA 5JDCA 4G2NA 4F3YA 2PGJA 1KEWA 1QG6A 3CSDA 3GC6A 2HDHA 2QRLA 3M2PA 2FN7A 1GY8A 4J6FA 4CJXA 2EHDA 3HUDA 4FFPA 3HB4X 1V35A 3NTRA 4IXTA 5ICMA 3RAJA 5ENVA 1LRLA 2ZCUA 4UVDA 4Z9FA 1DRVA 1ZZEA 4YT8A 2OO5A 3BHJA 1VJ0A 3F5QA 2D8AA 3ZHXA 2O7QA 5ADHA 1O6ZA 1A5ZA 3GR6A 1R0KA 3ZWBA 4BNTA 1PS9A 1PEDA 3EDMA 3JQAD 4RORA 2G5CA 3BYZA 4XIYA 3E6AA 4F45A 5B37A 3GGGA 3F4LA 1NPYA 3I9OA 3R1IA 2Z5LA 2Q49A 3QQPA 3OJLA 4I9UA 4WLOA 1KY5A 5LDGA 3ENNA 2J5RA 4TRMA 4LK3A 4E6PA 2AMFA 4BO5A 2CD9A 1XSEA 3Q9NA 4G65A 4NBTA 5H83A 1PGNA 1RJWA 3QVTA 1X0XA 4FPXA 4NJMB 1GQQA 2OBNA 4XR4A 4B79A 1W73A 2QZZA 5TT1A 1BW9A 1GL3A 1TLTA 4XCVA 4GI2A 1C3VA 4B4OA 3E9MA 3RROA 5HBRA 1FDTA 2GZ1A 1AE1A 4BO8A 3ICPA 4BO2A 5JY6A 1FDVA 3GUYA 1NP3A 1WDKA 5CDUA 3DBLA 4FJ1A 1EFKA 1UUFA 4LSWA 1HETA 1MB4A 5JAQA 1J6UA 4MVJG 2OUIA 4JJGA 3DTTA 4IJVA 4E2XA 1LI4A 2UUPA 5AXCA 2GO1A 1UXJA 1HYGA 3K2EA 3OH8A 1N92A 1PQPA 3PQEA 4FS3A 3GVIA 3MWDB 2DBRA 4B7CA 5JYEA 4YB8A 3IJPA 4YQZA 5EERA 5BSGA 2O3SA 1E3SA 1E3JA 5I9NA 2O3UA 5JLAA 3RSHA 2VTDA 1QV6A 1YL7A 2JFHA 4PLVA 4ESOA 4R16A 2ZJ0A 3UHAA 4FGWA 3IL2A 1OC2A 4FC6A 3VZQA 1VKNA 2GZ3A 3WR5A 3D5TA 4ILKA 2B4QA 3MJCA 3VDQA 5IXSA 3KLPX 4PFJA 1HDXA 4FDAA 2Y68A 3WXBA 4DVJA 1AHIA 4MDHA 3FPCA 2XAAA 5JAZA 4YRDA 4IM7A 1T2DA 1NXQA 5B12A 5JAIA 5K6AC 4GLLA 5JDCC 3K30A 5JFOA 4Q3DA 5C3MA 2VRCA 1LU9A 4Q3EA 4FC7A 1SB9A 1NYTA 4Q3BA 1R0SA 4ROSA 4YJGA 1R0LA 3JQ7A 3LU1A 4BMVA 5ILOA 4YT5A 4YACA 3WQRA 1MG0A 3DC2A 4I1IA 1ZK4A 3GRKA 4PLGA 4IDCA 5C5IA 4AJNA 1ZXLA 4J3FA 3UXYA 1NQAO 4MVJM 2PK3A 2IXBA 1HT0A 1XQ1A 2Q46A 3GNSA 4KUEA 3W4IA 4PIVA 1CDOA 3UGKA 5K9ZA 4E0BA 1I3LA 2NVUB 2ZJ1A 3KETA 2B37A 3H9UA 1K6IA 1ZK0A 1UH5A 2C2XA 3GZNA 4BHTA 4DYVA 4GKBA 1OAAA 2Q2WA 3VOSA 5IDYA 4DMMA 1HSZA 1EK5A 1Y8QA 3DZKA 3BMNA 1E7SA 5EESA 1C0PA 4RZHA 1QYVA 1RKXA 2VWGA 1Y8RB 4EW6A 2ILTA 4PLYA 5DBGA 1J0XO 1I30A 2YUTA 3A28A 3B20A 2AEFA 2ZKLA 4NU5A 4WLVA 3D0OA 4CL3A 1LA2A 1QSGA 3RKUA 1GUFA 2VHXA 4PN3A 2WTBA 4R1TA 4R41A 4CM9A 1R66A 3CMCO 5EJ2A 4O0LA 2QIOA 3DBHB 1SMKA 3FPLA 4W7IA 4BO0A 2EP5A 4U8GA 4ALMA 3ZNPA 4ZVVA 1CRWG 2DKNA 3PQFA 3DMYA 2F00A 3NDRA 3NDIA 4W4TA 3WS7A 3ONEA 1SO8A 4EUEA 1DC3A 1KERA 2GNAA 1NQ5A 1LEHA 4GX0A 4KQWA 4UEJA 3MWEB 1GCOA 1MLDA 5A9SB 4YJFA 2VZ9A 3ANMA 5F21A 1X1TA 2VQ3A 1AUPA 1DC5A 3I4CA 4BOYA 4D7AA 3WOHA 3PVZA 4XEHA 3PTZA 4PRKA 2JFGA 3KV3O 4TQGA 1YBAA 4WPGA 1MFPA 1YDEA 4BNGA 3L9XA 3C7AA 1MXHA 3NDJA 1JVSA 4LGVA 1EQ2A 1YO6A 2DTEA 3JQ8A 4TMFA 2D3TA 2NU8A 3B70A 4BB6A 3JD1A 3MZ0A 2CSUA 2EKQA 2PKQP 1PJBA 1NQOA 4M86A 4BGVA 3WBBA 1D1TA 1V8BA 2C5EA 1U3WA 4GSLA 4A27A 3U0BA 2NVWA 4CMAA 5KJFA 5G2OA 3R6DA 4E5NA 1LC3A 2HQ1A 3FWZA 3CXRA 5HS6A 1I33A 4EGFA 4ZJUA 3ZHBA 1SNYA 3AUTA 5TNXA 3FTPA 4AJKA 2IDZA 3QWFA 4EJ0A 1ENZA 1M75A 3OIDA 3UN1A 1MA0A 5KKCA 1N5DA 1GTMA 3GNTA 4Z3KA 3QY9A 5B4TA 3TFQA 4R69A 2NU9A 1EVZA 3OJ0A 4LRTB 2DTXA 3SJ7A 1R4MA 4BQPA 1H94A 4ID9A 4K1LA 4EJ6A 5L40A 1T1RA 3AM4A 2WJPA 1RPNA 3DL2A 5KJCA 4YT2A 4WCDA 2CF5A 3AFNA 1RM5A 2AXQA 5L9AA 3GVPA 3H9GA 2VWHA 2HSDA 3EZYA 3H5RA 4YYZA 3G49A 2X5KO 2NV6A 2DFDA 1HL3A 1Z45A 4AFNA 1ISMA 1E7RA 5CAEA 1YB5A 4MPDA 5IDWA 4GBJA 1DAOA 1DOHA 1S6YA 1YH3A 2TMDA 3ZV6A 3GPIA 5DOZA 1GZ4A 2AA3A 3SBOA 2VZ8A 3QVSA 1E1KA 4JX8A 1YQGA 3TWOA 1OI7A 4XQGA 3VPFA 5G0SA 2A35A 1K3TA 1FJHA 3HJAA 3ZHYA 3HFSA 4WASA 3H2SA 4D3SA 3QIVA 2IE0A 3VDRA 2CF6A 2P2SA 5J23A 3DHNA 4D79A 4BNUA 1HDRA 3H65A 5AYVA 1C0KA 1NWCA 4P38A 1OBFO 1PZEA 5THKA 2PNFA 1DHTA 3JQBA 1D8AA 2Q1WA 5DCWA 1LQUA 5FI3A 1YL6A 4XQ9A 2H5LA 1ISIA 3RUHA 3AU8A 1YKFA 4A03A 3E9QA 4OJNA 4UAGA 1YXMA 3H9EO 1ZEJA 4RVHA 1WLYA 3ZWCA 3AY6A 3GVXA 4Q39A 4NMHA 2PY6A 3WNVA 3RU9A 2OL4A 4I5FA 4KWIA 1Q7BA 4PLTA 3JQFA 2C2YA 2HKIA 4Q3CA 1Z6ZA 3H5AA 1ISFA 1GV0A 3MJTA 1LSJA 3LC1O 4CUKA 3FRJA 4CMGA 3UCFA 4PG4A 3DO5A 4XYGA 3U5TA 1JU9A 2GN6A 3CPSA 5JE8A 1ZMTA 4YAEA 5IN5A 4MVJE 4N54A 3W8FA 4I9HA 4RLHA 5ER9A 4PCVA 1YBMA 1DLIA 1F17A 2I9PA 3D5QA 3OJOA 3ZHZA 3TZQA 1LQTA 1V3TA 4HFJA 3E8XA 2AQHA 1PJLA 4J0FA 4J1SA 3TJRA 4B3JA 1Q2XA 4CMBA 1SAYA 1ZSYA 4LSMA 1H6AA 1P74A 2O3TA 4ND5A 5DF1A 3KYDA 1ZK1A 3GFBA 3ROPA 2J5QA 4TVBA 4CM4A 1P1JA 4FB5A 4MIEA 2O48X 4K9DA 1N1GA 3W1VA 3Q0EA 3RC2A 4RVSA 1T26A 3OQ6A 1GR0A 3IDSA 2B5VA 1CETA 3L6OO 1HE2A 2Y93A 3KYCB 2XF8A 1HDGO 3H5NA 4U7WA 1ZK3A 1E1LA 2HK7A 4R3WA 4TSKA 3D3EA 2I66A 2CMDA 3ZH2A 4XQEA 2RCYA 2NADA 4AJJA 4H3VA 2ET6A 2BI7A 4FJ0A 4DUPA 4NIMA 3JTMA 3L07A 4UUPA 4N18A 2W2LA 2HAEA 4UREA 3DZFA 3WQSB 1NAHA 2ZIZA 2G76A 3JQ9A 2GCGA 4BNKA 4CMJA 3Q9UA 4KTTE 1MXFA 2PD3A 3VVCA 4E32A 2RH8A 1MC4A 5FF9A 1V6AA 3GVCA 1SZJG 3MCVA 3Q2KA 3MOGA 4AL4A 1I01A 4Q3AA 2VYVD 1UDAA 5I9LA 3TFOA 3ROKA 3BMCA 3NGLA 1VL8A 4TZTA 4LRSB 1E5QA 4QEDA 3TDKA 4RPGA 4RO0A 2E6UX 1UDCA 2VN8A 3PDJA 1HE3A 3Q3CA 2DU8A 2YYYA 1H0KA 4EEZA 2EKPA 4I5GA 4HX5A 4GGOA 1P1FA 1I10A 1PJCA 2Z95A 3FBTA 3I9NA 3P2YA 3JQFC 4Y98A 4MOWA 3KVOA 3GLQA 2PH3A 1M76A 3OA0A 1YWGO 2Q45A 4L8VA 1U2DA 1EUDA 4EYEA 4E21A 1P31A 4P22A 4U6SA 1R6DA 1R4NB 4Y6RA 4Z3DA 3JQAA 1X14A 3I9MA 3B6ZA 3ONFA 1U5CA 1X7GA 1V3VA 2V65A 4PLFA 1B7GO 4BO4A 1OC4A 2BELA 3WGOA 1ORRA 1P44A 1Y9EA 2PGDA 3MOIA 4GWKA 4BGUA 4FCCA 7MDHA 5U1PA 3RUEA 3BA1A 4CUZA 2POQX 1E7QA 2V6GA 3I6QA 3V8BA 2VT3A 2HMUA 1ADBA 4IDFA 4C4OA 5CG2A 5A04A 5KWEA 1N7HA 1BTOA 1VI2A 2D4AA 4RZIA 2X0JA 4MVJH 2RBEA 1VLLA 2NLOA 3KYBA 4O59O 4OQZA 3GEDA 4R01A 2CDBA 2VWPA 2WYVA 3KEQA 4WOKA 3D3WB 2RIRA 4RPKA 3IIEA 1IE3A 2JL1A 4QT0A 5G0VA 3NEPX 4OL9A 1DDOA 1U5AA 3CH6A 1AHHA 3Q11A 5T8KC 3SC6A 4P8RA 3HWRA 4BO9A 4H16A 4MVJD 1NAIA 3G0OA 4AJPA 4FW8A 4MVJI 4DC1A 5CEFA 2H6EA 4OOEA 3ZZNA 1XDWA 2GYYA 4GL4A 4R5MA 5TC4A 2B4TO 3IAHA 2EV9A 5T67A 1GYPA 1HSOA 4LMPA 3F4BA 3JQ9C 3KM0A 4D44A 2YFHA 1E6EA 2WDZA 3MTJA 1X7DA 4NG5A 4XKJA 4BMSA 3AY3A 2EGHA 5G4KA 4CMCA 2A9FA 2O4UX 3WMXA 3ONDA 3VZPA 3EAGA 1XA0A 3ABIA 1IULA 3D7LA 3H4VA 4LCJA 4HNGA 3NKLA 1JKIA 3GN2A 2C29D 1Y5RA 4QXMA 3RVDA 4E2WA 2HMVA 4TWRA 2FZEA 5AXBA 3ZN2A 3ZU2A 3PWZA 3RU7A 2I6TA 1HWYA 1O94A 4B7UA 5JCJD 1E6UA 2FY8A 3DWFA 1Q0HA 2VUSA 3T4XA 4E5MA 1NPDA 2OFPA 2YQ4A 2TMGA 2FR1A 5CHEA 3DHEA 4BNLA 4NFHA 4FFMA 3EVNA 3BIOA 1F06A 2DLDA 4GWGA 2VHZA 2YY7A 4CM8B 3GMSA 2C5AA 1LC0A 3PJDA 1I3MA 4N7RA 4J49A 4BNXA 5I9MA 3FNGA 5BSFA 2BD0A 2J5KA 5DCYA 1D4FA 4W9NA 3GEGA 4EUHA 2WYWA 3V2HA 2ZTLA 5AXDA 1YDWA 3AOGA 2X9NA 1B8PA 5FFFA 2OMEA 4TRNA 8LDHA 3PHJA 1B2LA 5CDGA 1ZVMA 2HJRA 1VJTA 1ISJA 3GK3A 3NT2A 1Q7CA 1N7GA 4GPD1 3SJUA 3TPCA 1IPFA 3L9WA 1WMAA 4PZEA 4XWYA 1X1EA 4DLBA 3GG2A 1NM5A 3AUAA 1DXYA 3C8MA 3ITDA 3WQQA 4RVGA 1N9GA 1WVGA 4BNZA 1AGNA 1A7AA 5L7TA 4PG5A 2X6TA 3WG9A 4TRRA 2F1KA 4BGIA 3UCXA 1H9AA 2UVDA 2BHLA 2HRBA 3ANLA 3N58A 2I65A 4DC0A 3ANNA 1GQ2A 1V0JA 2DQ4A 3GQVA 3EK2A 4OO3A 1ZBQA 3VVBA 4BV8A 2Y1DA 1LDEA 1ML3A 2GUGA 3CKYA 3G79A 4I5DA 2B0JA 2Q1TA 4CMKA 4WE3A 1Y5MA 3E03A 5DBIA 1X0VA 1Y7TA 2VHYA 1LDNA 5TJHA 3UOGA 2JKVA 1RWBA 4RCVA 4F6LA 5F1PA 5T5QA 3CIFA 3VHRA 4LVCA 4CR6A 3RWBA 8ADHA 1JWBB 3JCZA 4GQAA 4ND2A 3OSUA 4IY1A 5JC8A 4CMIA 3JYLA 3HG7A 4GSKA 1J4AA 1PL8A 3S2FA 1U8XX 3VZRA 4DL9A 4YCAA 5CEJA 1I24A 4ZGWA 3DZBA 4MP8A 1DEHA 2Y67A 4TZKA 3L4BA 2G0TA 4YA6A 3B1KA 1ADCA 3P2OA 1GUYA 5IAAA 3H7AA 1NQTA 3OF2A 1XG5A 3DEYX 2WD7B 3GPDG 2Y05A 4OXKA 3RI3A 3D64A 1I0ZA 1LXCA 2IYPA 2FWMX 3L6DA 2IZ0A 2X23A 1KEPA 2V6FA 1E3IA 2YHIA 4FR5A 3I4FA 3KBOA 3F3SA 4G5HA 4MO2A 2D2IA 1B14A 1U7TA 5JAMA 3K96A 1QYXA 4BQRA 2ZB3A 2Q4BA 1ZJZA 3RC1A 5BNIA 3P5SA 4W9NC 1DB3A 3ZI0A 3F46A 4MVJP 1EK6A 1YL5A 3FF4A 3ZWXA 4NZ9A 2ZATA 4YTEA 5KJ6A 4JCOA 4ALJA 4MINA 4IQ0A 3WGQA 4ZU3A 1KBZA 4Z9XA 3PXXA 1NBOA 1O95A 1ZW1A 4CLRB 2O7SA 4K28A 3EYWA 4MKZA 4AJ1A 4FSHA 3GZ4A 3HDJA 3NAQA 3PLRA 3PK0A 1DC4A 3E9NA 5IZCA 4OKIA 4WLEA 3U3XA 3PLNA 3ZWYA 4HFRA 4NJMA 5CEEA 1LRKA 3QSGA 3ST7A 2EXXA 1UZNA 4NBUA 1ULUA 1ULSA 1ZFNA 1JLLA 3D1LA 5A3JA 2P4QA 2VOEA 4P4LA 2A94A 4B4WA 4PG7A 5ES3A 3FBGA 3ZWOA 1IL0A 4J4HA 2J8ZA 4GKVA 4OIMA 1UZLA 1KVSA 1PTJA 2BI8A 3RUDA 4E5KA 2FMUA 2EKLA 2NACA 3RC9A 1OOEA 5AXAA 1ENYA 1PJQA 1E3EA 2XXBA 3A1NA 2B36A 3G1UA 4YJHA 1WZEA 3SC4A 3JD3A 2LDXA 2NWQA 3DQPA 4QTZA 2P68A 1PU2A 3COSA 4RQUA 2NQ8A 4BO6A 4E4YA 1C14A 3GDFA 4FFRA 4ZHSA 2O2YA 3U09A 1E5LA 2PR2A 2QX7A 3KO8A 1DPGA 4IXWA 4ZD6A 3JYQA 4II2A 1LDGA 3JD0A 1EVIA 2NUAA 3M1AA 3PDUA 1QMGA 6LDHA 2VYNA 4IDEA 4KWHA 4IMPA 3S2EA 4RJTA 2J3HA 2Q99A 4UVEA 1U7HA 3F6YA 1Z7EA 5G4LA 4PVDA 4CUJA 3LF1A 4MP6A 3BHMA 4GMFA 4OOFA 1F8FA 4W82A 3QJ5A 1ZXBA 1EDOA 5DN9A 4YT4A 4HKTA 3ZWVA 1BWSA 1LNQA 3RBXA 1LDBA 1A9ZA 1XQ6A 3QLJA 5U9CA 4DIOA 5A9RA 5AOVA 1GFSA 2ZB8A 1PSDA 1N1EA 4TKLA 4CL8A 4HV4A 1E0DA 3CZRA 3AM5A 4Z0HO 4B7XA 1F12A 2GF2A 3W4KA 1D7OA 1E7MA 1Z75A 3FSRA 1CF2O 3PI7A 2HCTA 4XD2A 5DCUA 5B4VA 2VUUA 1I5RA 2CVQA 1CQIA 4BNMA 3GT0A 4H15A 1SC6A 3HN7A 1UAYA 1KOLA 3Q6IA 1F14A 3GF4A 1WPQA 1KEVA 1K0UA 3U4IA 2NU6A 5EN4A 4L75A 1C1XB 1HTBA 3DBRB 2FRDA 2AE2A 2NVUA 4B8WA 2B69A 2X9VA 3NT5A 3H9JA 3WFJA 5L51A 2H63A 1DIHA 2BGMA 3EUWA 3PGXA 2IRWA 2YV2A 4YAGA 3AU9A 3BZUA 5JPIA 1A4UA 3SX2A 2JHGA 1JN0A 1ENOA 3S2GA 1G0OA 2DBQA 2FSSA 4DWVA 5KVSA 4NJOA 1A4IA 3DZGA 1TT5B 4FFLA 3GY0A 2VCYA 5H82A 4EEXA 3DAFA 1B0AA 1XKQA 4NK4A 3BTOA 3GDOA 1DIAA 3INTA 4AJHA 1GV1A 1ZUD1 2WE8A 4OSOA 2EEZA 3GMDA 4NFYA 4XGKA 2X7HA 2J3IA 1UP4A 3GG9A 1D3AA 2PKQO 2CZCA 2Q1SA 5G0TA 4OQYA 3BTUA 1EVYA 3C3XA 3DBHA 4HBGA 2QG4A 2IEBA 2O4CA 3PGJA 4UULA 3ROQA 1UXHA 5CDSA 4LW8A 4PLZA 5K0ZA 3PWSA 1ZJYA 2GN8A 5DP2A 4DQUA 5BSEA 5FYDA 3W8DA 2BLLA 1UDBA 4CV1A 1UJMA 2JD1A 1MGOA 3AW9A 4IGEA 3MEQA 3QV1A 1C1DB 4NH4A 4LISA 3JQGB 4XGNA 4QQRA 4NBVA 1UP7A 4GVXA 4IUYA 2O50A 3OFSA 1A71A 3DHYA 3I9LA 4CM5A 3RFTA 2C07A 3S1LA 4R4JA 4PLCA 1Q0QA 3WFIA 1UXIA 4M89A 4XIJA 3CTMA 3I3OA 3I9KA 1E3WA 3ICCA 4IZHA 1I8TA 2W90A 1U3UA 9LDTA 3WGZA 4HUJA 2YV1A 2EERA 4KUGA 4OMUA 3RKRA 3CE6A 3AUUA 2NTVA 2O3QA 1S7CA 2X0IA 1QV7A 1UXGA 1W8DA 4GX5A 3LLVA 3GN1A 4U6QA 1UP6A 1WMBA 4LCEA 1JVBA 4ZQEA 5JMWA 4GGPA 3ITKA 2EGGA 2AEJA 3ZCXA 4LMRA 3WYCA 5DZSA 4AJLA 4CV0A 2PFGA 3E5RA 3H8VA 3GDGA 1DRUA 1NR1A 1DBVO 4M1QA 1R4MB 4AJ2A 2E37A 3IP1A 1ONOA 2Y0DA 4CLXA 2ZQZA 5FI5A 3H9QA 3PHHA 4RV9A 3VH3A 2DPHA 2NTJA 3ZWPA 1BXKA 2HK9A 1XWFA 2PLAA 3V1YA 3C1AA 1ADFA 1ZSVA 4R1UA 4OSPA 4CLEA 4M8SA 3GNQA 3PFWO 4CM7A 4NNJA 1DIRA 2X0NA 4D3FA 2H9IA 3W8EA 3PPIA 5KIAA 5F3RA 2PA3A 2X0RA 1I36A 2HU2A 3GHHA 4W6ZA 3AK4A 4XJSA 4DBZA 4FGSA 4WECA 1NHGA 4WK6A 4BO3A 2FPPA 3W6ZA 1M66A 2JCXA 4IZIA 3K9QO 3I52A 4PRLA 1BVUA 5KJ1A 2V6BA 4XYEA 3A14A 4BS9A 1P1KA 1N8KA 4NFSA 4NBRA 5T57A 4B4VA 3JQDA 3PYLA 4WLUA 2HK8A 3WYBA 3ZU3A 4IJUA 2YV3A 4Y9DA 1E3LA 3RJ5A 3NGXA 4J91A 1DLJA 2E82A 4EUFA 4HY3A 1QRRA 3ADOA 1WDLA 2JHFA 2Y1GA 1U1IA 1KVTA 1PWZA 2R00A 3LK7A 3GAZA 5EINA 3RC7A 2Y1CA 3STHA 4FOSA 1O89A 1VC2A 4J43A 4R5HA 2WEKA 1PR9A 5I7EA 1T4BA 1NR7A 4RVDA 3RBVA 4BKPA 3WGIA 1NX6A 3ON5A 4XJTA 1CJCA 3W4JA 5JSFA 1ZK2A 3DOJA 3LC7O 3NRCA 3ASUA 5JCJA 3K73O 2VRCD 4AG3A 1NVMB 2VNSA 1UAGA 5DBFA 4EDFA 2GLXA 4P4GA 5JO9A 3QW2A 3ZV3A 1E7WA 5G0WA 3CINA 3LDHA 1GADO 4JGBA 4I08A 1LX6A 1LBEA 1IZ0A 3HDQA 2Q1UA 5BNTA 1QYCA 3INGA 3RJ9A 4R51A 2LDBA 4CMEA 1CYDA 4WEOA 3V2GA 1MV8A 1E1MA 5TJ9A 5IG2A 4DREA 4FFOA 3OJFA 2IXAA 2Y0CA 1DFHA 3HDHA 4QECA 1ZSNA 4OXYA 3AUSA 2AG5A 3V1UA 2PTGA 2W2KA 3T4EA 4EI2A 3KYDB 4DA9A 4ITUA 5TF4A 1U8FO 2C20A 3BXXA 5HS4A 4P4NA 3WJAA 4YXFA 2JFFA 3PRJA 7ADHA 1JAYA 1P1HA 3MJ4A 4JBIA 5IN4A 4LVUA 1NFRA 1HZZA 2PD4A 5GMOA 4CODB 1KC1A 5JNLA 1IPEA 5LDHA 3HADA 3O4RA 3QA9A 2X9GA 1EUCA 2QYTA 3EMKA 1GPDG 1P77A 3BMOB 2EF1A 3RQSA 3PQDA 2O23A 1GYRA 1VKOA 5ITWA 1DJNA 1IHYA 1GDHA 2PZJA 1SOWA 5DP1A 1YOVB 1GQYA 1GZ3A 4XR9A 2I3AA 4ZRNA 5JY1A 4KTVE 1XEAA 2I3GA 4H7PA 3DMTA 2AEMA 3KYCA 3GA0A 3PYXA 1YS4A 4XGIA 5JDIA 5L4NA 4WOJA 3OP4A 3JQBC 3ASVA 3PEFA 5I7VA 3FNFA 3OIFA 4L4XA 2R6JA 4KDEA 2R00C 3JYOA 3NV9A 4RVUA 3A06A 5DDIP 3U4DA 1FXSA 4ONEA 4NPCA 3S8MA 1XHLA 5C37A 3IKTA 1X7HA 3JV7A 3WB9A 1J49A 2DUUA 3UFXA 1L1FA 3O8QA 3ZWMA 2GDZA 4S1VA 2NVBA 3LF2A 1GAEO 4FFNA 4WCFB 5BSHA 3N74A 1PL6A 1XU7A 5GZ3A 3I9JA 3PIDA 2BF7A 1H9BA 1I2ZA 2FPGA 5EQFA 1W4ZA 4C7KA 3C24A 3FI9A 4J2OA 4DQVA 1SEPA 2EIHA 1PJ3A 4EJMA 4IS3A 2GN4A 1PQWA 3QRWA 1Y1PA 3WDSA 4TROA 5BQFA 1QYDA 4IPTA 2D5AA 3ZNNA 4D43A 2OBYA 2YW9A 6ADHA 3VH4A 5MGBA 4RF5A 4WLNA 1BXGB 2UDPA 1B3RA 4OYRA 4R9SA 3T7CA 5C7LO 1NVGA 4RVFA 3QP9A 4U0KA 1QYWA 3F9IA 3IJRA 5TT0A 1PGPA 1VSUA 2Q3EA 3DDNA 1DO8A 1LRJA 2B4RO 1WZIA 3MTGA 4AJEA 3F5SA 4ZN6A 4U5QA 3IP3A 2NM0A 5C7IO 5A1TA 1R4NA 3DFZA 3HE3A 2W8ZA 2VNAA 2YFQA 2C54A 1YB1A 3F47A 1A72A 4Q9NA 1P0FA 5A03A 3D4NA 1PIWA 2GASA 4IDAA 1U3VA 1I32A 2C7VA 2YJZA 3O03A 5EPOA 2SCUA 4YAJA 4BKQA 5TIIA 2GD1O 1RM3A 3JYPA 3TL3A 1GYQA 5CDYA 5A5EA 3BMQB 3OIGA 4IDDA 3IC5A 1K6JA 3SLGA 4CQMB 5A5FA 1P1RA 2Z1NA 2CNBA 1QP8A 4UUOA 5KJEA 4YRAA 3C7DB 4RF3A 2WE7A 3I5MA 3UKOA 3ENKA 3OICA 1T2FA 2GERA 5EL0A 3D3WA 2DFVA 5GZ1A 4UUMA 3RUIA 3WBFA 3VH1A 3DMTC 1B16A 1T4DA 2Y99A 4DLLA 1ZO8A 5JDIC 4W7HA 2ZTVA 4NU6A 3GRPA 4PLHA 1H6DA 1XLTA 5A05A 4BNJA 4RGBA 4I8XA 3FR8A 1TEHA 4J0EA 4CQLB 1DAPA 3A4VA 3UF0A 3WICA 5JC1A 2WSBA 1K6XA 3HB5X 1K89A 1HYHA 1FF9A 3C85A 4QSMA 1Q1NA 5BT9A 3ZNOA 3PHGA 3AI1A 4TVOA 1NFQA 3T7EA 1Y6JA 3K2BA 3LT1A 1XELA 2EG9A 2NNLD 2RHCA 3GHYA 4ALNA 1YE3A 2AQKA 3UCEA 4RF4A 3P19A 3SEFA 1A27A 2I99A 2Y1OA 2R2GA 1OZAA 3M2TA 1EBFA 4PLWA 3WSWA 1D1SA 3K5PA 3KSDO 4XA8A 3ZU5A 3PJGA 1RYDA 3CEAA 4A10A 2BFAA 3LVFO 2JAHA 2Y1EA 3GVHA 3KHUA 4IJKA 1SEVA 4CR7A 5DOVA 5HA5A 4R9RA 1PZFA 1V3UA 4IS2A 2AQIA 2HLPA 4A2CA 4D45A 5CDTA 4CM8A 3DAPA 1EDZA 4D46A 1LLDA 4HWKA 3VC7A 5A3VA 3ORFA 1NHWA 4INAA 4J1TA 1FDSA 1LLUA 1XCBA 1LUAA 1KVUA 1R37A 3QE3A 3E18A 1EE2A 3RBZA 4E5PA 5IZ4A 1HLDA 2VT2A 3ADPA 3C7CB 4XX0A 2X58A 2E4AA 1T2AA 4F6CA 2P9GA 4JNKA 3CMMA 3ZU4A 1OFGA 4J4TA 2JCYA 1KVRA 2BH9A 4Y6PA 4K26A 1BVRA 1YBVA 4DTIA 3FNHA 1AXGA 4J7CA 1PL7A 4CM6A 4WJZA 4I5EA 3QVXA 4UVGA 4NDNE 3IKVA 2G17A 5L53A 2VTEA 1ARZA 3CZMA 3H3JA 2DBZA 4GVLA 3ULKA 3EW7A 3L6EA 2VWQA 1JW9B 4CMIB 4CLOB 4DYDA 3IS3A 1O0SA 3UH1A 1PS8A 3GFGA 4OH1A 1XIVA 3AI3A 5I8ZA 2PV7A 1KYQA 4QX6A 4CV3A 1B8VA 3IQDB 4E33A 1BXZA 1RM4A 2GR9A 4KQXA 1ONNA 3DZHA 5COBA 4ND4A 1DFIA 3JSAA 5JCXA 2X8LA 3NYWA 4IDGA 4XZ3A 4BV9A 4ZQGA 2NU7A 2ZB4A 3NTOA 3SVTA 4DPMA 3ZW8A 3NUGA 2G1UA 4R68A 4E2ZA 2RAFA 4D41A 5FWNA 2B5WA 4E30A 3V5NA 5K6AA 1HDCA 4YQYA 3WGHA 4A5OA 1EFLA 1PX0A 1M67A 1A9YA 4QO8A 1I2BA 3ZWWA 1TVEA 5DNAA 4JIGA 4CM3A 2WD7A 2YDXA 4BNYA 1U4SA 3JYNA 4BKOA 2Y1FA 1CERA 2DT5A 2OP0A 1P0CA 2RH4A 3GAFA 3ROMA 1NTOA 5B1YA 4MIOA 2D1YA 1WXDA 5A02A 5L7YA 2ZYGA 3OBBA 1BW9B 4O63O 3KB6A 3M6IA 2YDYA 2Y66A 5HTOA 4R54A 4L76A 3TN7A 3ZWNA 3EHEA 4PGFA 4ZQHA 1HRDA 5EQDA 2GZ2A 5F5LA 2FR0A 3WWZA 1WW8A 3INRA 3DBLB 1Z73A 2QHXA 2FHSA 2C82A 1LDMA 1PGQA 4OAQA 2H1SA 5I7FA 5JMPA 3KEOA 3FN4A 1T2CA 2ZTUA 3K31A 4QFCA 3WTBA 4DMLA 5TX7A 4CLRA 4BNWA 1NASA 5HRUA 4MKXA 1MUUA 1YB4A 1EQUA 3QWHA 2BMAA 2ZYDA 1H5QA 3TZ6A 3LZ6A 4YAIA 1EUZA 3PJEA 4FN4A 3F1KA 4HADA 2V6MA 5JO0A 2O3JA 3DZJA 1NFFA 2Q2VA 2UYYA 2YZ7A 1ZH8A 1XR3A 2FZWA 4IJWA 4CQMD 4YJHB 4DQXA 3TRIA 1ZMOA 4Q3NA 4D42A 1M6WA 3UUWA 1G6KA 5TSDA 2AE1A 2XXJA 4BO7A 2CUKA 1EBUA 3HDYA 4OGWA 5IF3A 1SOVA 3L4BC 3LT2A 4M87A 1H2BA 3HFGA 4NR0A 5GZ6A 4BNHA 1FK8A 3ZWAA 4CPDA 3AOEA 2HMWA 2BFOA 1E6WA 4U0JA 3KTDA 3R3JA 4DIFA 4DPLA 2VRBA 1ISGA 4J1QA 4CLDA 5L7WA 2QZ9A 3K8ZA 4L73A 4YJGB 3JQ7B 3Q2IA 2WM3A 3FWNA 4JLWA 1IB6A 1AXEA 4FJ2A 3WWYA 4BIIA 1BRMA 1ONPA 3ZV4A 4B4UA 3X2EA 1BG6A 1DIGA 4X54A 1JQBA 4D0RA 1CWUA 4O6VA 4WUVA 2BFMA 1IOLA 1HKUA 3E1KA 4YR9A 4JBGA 2JCVA 1HXHA 4JN6B 3FCOA 5B4UA 1E77A 4ALLA 5A06A 4NBWA 4J9VA 5KKAA 3H2ZA 3GOHA 3AWDA 3UICA 3G3EA 1Z74A 4PG6A 4LN1A 3GZNB 3PZBA 3LSYA 1VPDA 3AI2A 1Y8QB 4Z0TA 3BMNB 4FBGA 3LQFA 4JXKA 2J6IA 3E5MA 4J2HA 5COAA 3VPGA 3R0IA 2QRJA 1ZIDA 3WGYA 1QORA 4A26A 2ZB7A 5TRTA 2EW2A 1YONA 2IODA 4M55A 4J7XA 1V9LA 3H3FA 5IZCC 2YQ5A 3F1LA 4BKUA 2FOIA 3UVEA 2I76A 2P9EA 1ZNQO 1LSOA 1GZ6A 2BRUA 3TL2A 1NVTA 1JDJA 1QXSA 1T25A 1IUKA 2GSDA 4M49A 1F0YA 3FNEA 4BNNA 1Y8RA 4GH5A 1C1XA 1H93A 3RUAA 3DBRA 2C59A 1X15A 2X22A 1PGJA 1YGYA 4EITA 2PH5A 4G81A 3DOOA 4JBHA 1ZKMA 3WTCA 1T24A 3TOZA 5DULA 3TNLA 4E13A 5IFLA 4URFA 1UZMA 4N5LA 5CG1A 5KVCA 1SB8A 4KP7A 2CFCA 1U4OA 1TT5A 1PQUA 3PYMA 1R15A 4YJFB 1IY8A 4BNIA 4BNVA 2JD0A 3H6KA 3EC7A 5T6BA 2AHRA 1KEUA 2GPTA 4Z9YA 1O9BA 2VYVA 4L74A 1LSSA 1R16A 2QW8A 4XB2A 3S2IA 3DFUA 4NK5A 3V1TC 4RPJA 3WGGA 1EE9A 3RD5A 3AOEC 3WGTA 1BSVA 4ND1A 2CY0A 2NTNA 4YVFA 2VZ0A 4CLHA 4OKNA 2Y0EA 3JQ8B 1K5HA 3KRTA 4IQGA 5A9SA 2CVOA 3C1TA 4A7PA 4MJLA 1HYEA 2I67A 3EZLA 2NQTA 4XYLA 2C0CA 2FPIA 2OHXA 1U28A 3DXFA 1E3WB 1XYGA 4IIUA 1C1DA 4L4RA 3MJVA 1PR3A 5A9TA 4AICA 1QLJA 3DTYA 4QFDA 3JQGA 1YQDA 4JQCA 4PZCA 2PWZA 4D3DA 2VHVA 4E12A 1TXGA 2GGSA 4RDIA 3GGPA 3WLEA 1GPJA 3BTSA 5KCZA 3W6UA 3LYLA 3VTZA 1L7DA 3HQ4O 4C7JA 1P9LA 5MDHA 4AJIA 4UUNA 1Y81A 1DRWA 1PZHA 2D0IA 3ETDA 4GLOA 3KLMX 4AVYA 1KY4A 4NQZA 1H6CA 4F46A 4FD3A 4IINA 4QO7A 4Z0PA 3P7MA 4AJ4A 4DRYA 4CM1A 4O5OA 2P9CA 4MIYA 1VL0A 3GEMA 2EJWA 4RPLA 1HE4A 2C7GA 1HDOA 5JYDA 1Y9AA 3RFXA 2IZ1A 1BGVA 1M6HA 3OMLA 5L45A 5G0UA 2QRKA 4GX2A 5BNFA 4GMGA 3WIDA 3A9WA 3CUKA 2D59A 3SXPA 4HFNA 3WLFA 3NT4A 3K6JA 4XDYA 1GD1O 3VPXA 1P1IA 2Q4EA 3VZSA 2OOSA 3ZNQA 1M2WA 4BB5A 2Q2QA 3FR7A 2CDAA 4N5MA 2DBVO 5TGDA 3WNQA 4ALIA 4BUCA 3PZRA 3WSVA 3FHLA 3NTQA 4YBZA 1R12A 2BFPA 4ZRMA 1W6UA 4MVJA 3TF5A 1MC5A 1Q0LA 1BHSA 3EGOA 4YRBA 3LT0A 1ENPA 5I7SA 4NI5A 4A73A 2VHWA 3U4CA 2AG8A 2D5CA 5F5NA 2W98A 3QWIA 4R1NA 4ALKA 2DVMA 2E49A 4KZPA 4FIZA 2QYSA 2X5JO 2BGLA 5CFZA 2NSDA 2ZK7A 1ZEMA 4DIBA 3TZCA 4E5YA 3QWAA 3DR3A 1DFGA 3IUPA 4L0QA 5JXWA 1C0IA 1HE5A 1GUZA 2DC1A 3O38A 4Y67A 4XRGA 2X5OA 5JBIA 5THQA 4J90A 3DAGA 3OEYA 4D0SA 1Q7GA 4BO1A 3PFFA 4GX1A 4WNIA 4E3ZA 1TA4A 4K6CA 2J3KA 2BKAA 2JJYA 2OZPA 3O9ZA 1UXKA 3PWKA 4DLAA 4XYMA 2PZKA 4OM8A 1X13A 2VYND 1FDWA 3X2FA 4FOOA 4WLFA 1ZCJA 1I3NA 2Q50A 1VM6A 1P3DA 3RUFA 5EMHA 1JAXA 5ENDA 4OXNA 3K92A 3QHAA 3QVOA 5HM8A 1XGKA 2J3JA 1C0LA 3ZDFA 2IYOA 2DM6A 2Z1MA 5AQ1A 3ZW9A 4YAKA 2ZCVA 3I23A 2P5YA 4RQTA 2OORA 5KTKA 3HN2A 1CIVA 3G1TA 2P4HX 3ETGA 3MJSA 1MX3A 3OHSX 1G0NA 3WMWA 3JD2A 3LLSA 4EZBA 1DIBA 1EMDA 3IUSA 1QR6A 1WWKA 4RF2A 1DHRA 2X1HA 1MG5A 2W2KB 1IHXA 3WIEA 4CM4B 1PJ2A 1PJTA 4HP8A 4E31A 3NX4A 5L3ZA 5C7OO 1E7YA 4TRJA 3PHIA 4IGFA 3TOXA 2PZLA 5L4LA 2DUWA 1H6BA 3OA2A 3DOCA 4WEQA 1NPTO 2BGKA 3AFMA 5CPFA 3RCBA 2OGUA 1TT7A 1NNUA 4RLSA 1JKJA 4PVCA 3IMFA 3PHLA 5IJZA 3BHIA 3OJEA 1GEEA 1H2HA 4BKRA 1BDBA 4II3A 4JP3A 1LLQA 5KNLA 1HDZA 5DT9A 2WWRA 1DC6A 4CM9D 1TB4A 4JJFA 4XB1A 3OECA 3HNPA 4MP3A 3TQHA 3OETA 4DBVO 4B3HA 3LC2O 1PZGA 3U9LA 5BR7A 2WYUA 1ADGA 5T8KA 5F1KA 2DAPA 1PGOA 1UR5A 1YVEI 3BMOA 3KXDA 3AJRA 4GAEA 1JTVA 1YRLA 3BMCB 5AVOA 1JA9A 5ILGA 4MKRA 2UV8A 4XDZA 1B15A 5F1OA 1RYEA 3L77A 4IBOA 5U4QA 1CQJA 3IOYA 1YOVA 3QVWA 1KETA 3O26A 4UVIA 1B8UA 2XPCA 1VL6A 4RL6A 5H81A 1LSUA 4IIVA 1P33A 4BVAA 3O8QB 4XYBA 3V2UA 4K6FA 1P45A 1SBYA 4ZICA 5KVVA 1VRWA 4BGEA 4IQ8A 4XQCA 2DTDA 2EW8A 1BDMA 1J5PA 1G1AA 3E82A 4N5NA 3PIIA 3U62A 4DPKA 2V7PA 1PJ4A 2RHRA 2FSVA 5EIOA 3JQAB 3JQ6A 2WMDA 1VSVA 2PD6A 3I6IA 2PZMA 5JW6A 5CP8A 2E48A 5TQVA 1EZ4A 3VH2A 1W0CA 4R1SA 4WCFA 5A4DA 3GUCA 3E48A 3DB2A 1RM0A 4CMEC 3R3SA 4I9NA 2QQ5A 3HHPA 3DZIA 2ZTMA 1U3TA 2HRZA 1B3BA 1AN9A 1E92A 3D4OA 3JQCA 1N2SA 3GH3A 2AW5A 4B8ZA 1KVQA 1T1SA 3SLKA 1SCUA 1HLPA 4WNCA 1VJ1A 3OQ1A 2EJVA 4Y8VA 1KIFA 1BXGA 2DPGA 3D4PA 4WKGA 3AM3A 5ER6A 1L7EA 5TLSA 1PS0A 4BL5A 2A92A 2EWMA 3I1JA 1O5IA 3M1LA 1WDMA 4NHEA 4DXHA 5KVQA 3HZZA 2UUOA 4J9UE 1MP0A 1DJQA 4L9RA 1LLCA 2EP7A 3U49A 2WD8A 3TSCA 1DSSG 1VE9A 1FMCA 4ZA2A 4B3IA 1MFZA 2P5UA 4BMNA 3BAZA 1PWXA 3WJ7A 3EY4A 2VUTA 3RFVA 2X4GA 3AY7A 5JS6A 3BMQA 3KOUA 4CQMA 3G17A
chains in the Genus database with same CATH superfamily
2XH8A 1IN5A 4Q05A 2K2QB 4GYWA 1PCXA 1MJHA 2UZ1B 4D96A 5JH7B 5AOCA 5B7NA 1PNVA 1UOPA 1FZQA 3DDZX 2A3NA 2IU6A 4W7SA 3W1WA 1IJKA 4JLAA 2G8LA 2VF8A 2H4XA 3DMGA 3KP1A 4QUKA 1JKFA 1O0CA 3TNYA 1EGVB 4EWLA 4D0GA 4TTPA 1IATA 3OJWA 3KC2A 2O0KA 2YNMC 1PG5A 1GEGA 1V5WA 3IPRA 1KDVA 3REQA 3GWGA 3RYCA 1Y7LA 3UWPA 3WA7A 4AI6A 1LDYA 1OFVA 4LDPA 4Y0AA 3TSZA 4AJOA 4B81A 4G5RA 3QYJA 3AJ8A 4MW9A 4ZQFA 3VR5A 3ZDXB 3S1AA 3DMHA 2UAGA 1VKJA 2UYOA 4I4CA 2PKRA 3S7ZA 1U9JA 3WOVA 3ZGYA 1EWYA 3IVAA 1YFLA 2X4IA 1HYQA 1N32B 4YDRA 1WAMA 1SUDA 2NVOA 2OXIA 3ZHTA 2HZ7A 4IRMA 2EX4A 2QAGA 2VNJA 3OQHA 4OQ4A 4CR8A 2CL5A 4F5WA 3VVMA 4R3NA 2Q5EA 5BSUA 4DIKA 3EVTA 1JJAA 2X86A 5BR4A 1QFSA 5GONF 1SCQA 2OO7A 3DUFB 4KSYA 1XPOA 3T1TA 1X77A 2X3FA 3PHBE 2AIRA 3NJ4A 4K7JA 1P5JA 2Z4TA 2G6BA 4XOIA 4W99A 3S2YA 2IQIA 2YWJA 3RIYA 4L0CA 1O8CA 2J4DA 3ECAA 3LUFA 5UKDA 3SNHA 1TI7A 3DW3X 1YJQA 4HXYA 3CJRA 3ZE1B 2PGLA 3BERA 3K8OE 1A7KA 1H0HA 3A2MA 3ROZA 3SZGA 3EPHA 5KHAA 4K05A 4PV7A 4D8XA 1NJ1A 3CRNA 1GRQA 1J0EA 3IR7A 4Y2UA 1T4CA 5HYVA 1DRKA 3W7BA 2KHZA 3L41A 5LBUA 1N0VC 1RWOA 1U0TA 2OSVA 4ZAXA 1RI2A 5TS3A 4C4AA 5ES4B 1QOPB 4NHOA 3RU2A 1JMKC 1NXWA 1Q77A 4JVNA 4JY7A 4C0XA 9LDBA 1KRWA 4G0NA 3BORA 4F86A 1Z2EA 5U4XA 1M7BA 2BZ1A 1WSBA 2BSAA 2QM7A 4XX0B 4E1VA 1UBCA 2WHPB 4N8EA 5IBCA 3U1BA 1JB1A 1U2PA 3FCUB 4HEHA 4E2FA 3VYSB 4A5SA 1M0SA 2AOUB 2HO5A 4D0NA 2QTFA 4QYXA 4D8VA 1KAEA 2CZQA 3DVSX 1TYZA 4PPNA 4FQ8A 4DGSA 5K4GA 3QVGA 3RVBA 2RHLA 2DQSA 3OY7A 1VPTA 5KVVA 1TAUA 3ITNA 621PA 4IF4A 4XFKA 4ZU1X 2ODEA 4QUEA 2PQ6A 5HF5A 2QD5A 3QNMA 3QWBA 3BS4A 1QGUB 2DERA 3ACBA 2W2NA 1QB7A 3BDVA 1DZIA 2OTCA 3KR1A 3LFTA 2XDQB 4EBFA 4ZKEA 4U7PB 4XRRA 1P0PA 1Z7BA 4UD2A 4X66B 4AB1A 1YT5A 1NYLA 3MBOA 5KOJB 1NN3A 2G88A 1OMOA 4CMHA 4IMRA 3KLOA 2W2LD 1N9ZA 3MBIA 4KIJA 2ACKA 4JJIA 1SULA 1TZ2A 5EQJB 1E63A 1Y6RA 1W5FA 1SPXA 3RV3A 4C2AA 1NVXQ 2C3OA 3VHQA 3AETA 4MYHA 2A78A 3EFBA 4PLPA 3CT6A 2XVAA 2JGEA 2WTNA 5ALSA 2YW2A 1O87A 4UEOA 1M2VA 2HA2A 4OFWA 4YV0A 4H7FA 4EL0A 1F3LA 5HRCA 1T1EA 1PFUA 5CB6A 2OV2A 3FOAA 3BHNA 3HSKA 4JROA 3ZKWB 1E8MA 1LB1B 1UMKA 4J16A 4W8HA 4F2HA 3GRUA 4OHUA 2AOXA 2B0CA 2EBFX 2QDXA 2R8XA 2PDAA 1QDUA 1L7QA 1A5SB 1XQVA 2V7QD 4KMSA 3FOBA 4L9AA 4D0LB 5H0IA 4DQ0A 4F9FA 5BV1A 1XJQA 3NCHA 1Z5VA 4YQEA 1R27A 2V4MA 4QYTA 1Y6ZA 3CSDA 2QUZA 2NN3C 3VV3A 3BF8A 4Q7JB 1EUQA 2PG3A 3BFXA 3HUDA 4FFPA 1YVDA 1V35A 1A9SA 4CVNA 5ICMA 1X86B 2I80A 1RXUA 4JQOA 1A96A 1MZPA 1O6CA 3HZHA 1TC1A 1ZX1A 1VJ0A 1ZI6A 1M2EA 3UT5B 1DGQA 5AIAA 4PQGA 1TEZA 1JBKA 2WJGA 5CCEA 4EKNB 4FZVA 5C8XA 1R0KA 4BNTA 5DHFA 1ZVQA 3L8HA 3JQAD 4D9FA 2X7JA 4IOMA 1SUCA 2QJOA 3E6AA 2H7CA 5E2IA 3I9OA 2GM4A 3W3ZB 2XTJA 3QQPA 4JLNA 1NUQA 2R1TB 2V9CA 1PT7A 4UMVA 3ENNA 3RT9A 3T95A 1Q74A 3LQQA 3OZTA 1V4VA 1MO3A 3H4IA 4QNNA 4BASA 3LXRA 3Q9NA 3GQBB 4G97A 3ZJUA 1X0XA 4XR4A 1GQQA 3EXAA 2HQSA 2JKYA 1JT2A 4P4SA 1YFZA 2XZTA 2VJYA 4FW9A 2DF8A 1Y5LA 2IHTA 2XCUA 2P4UA 3PCXA 4NBSA 1IEVA 1WABA 3BMXA 2ZJZA 3Q10A 4FOLA 1G8PA 1TQDA 4FFVA 4LQDA 3UGQA 4B4OA 1FDTA 5BW4A 1WB9A 2GS9A 4QODA 4YMWA 2R7NA 2GJSA 5DSTA 4BKMA 2G72A 3HU2A 2JIRA 3D0KA 3MUNA 3D6FA 1FDVA 5CVCA 3RLIA 1NP3A 1WDKA 1TEVA 1YS7A 3SC2B 1EFKA 1GUDA 1UUFA 2CDRA 2IW3A 2XGMA 4HI0E 4LSWA 1U80A 4XDHA 5AW3A 5TVKA 1ZWKA 2AH5A 2WWWA 2AFRA 3A2LA 3VSAA 3ZC3A 4FMPA 4PQYA 1N6IA 4IJVA 3ZY4A 4REOA 2YBEA 1E1RA 2Z43A 5CM2Z 2AKYA 5A5DA 2GO1A 4G1CA 2XYQA 1AQYA 4UOQA 2BPOA 2XI4A 2FSHA 4BEJA 1KXJA 1N92A 2RGNA 1WM1A 3OH8A 3OWOA 4FS3A 2DBRA 4DMKA 5KNCA 4HDSA 4YB8A 4BXOB 4ZVMA 4MS1A 5C9ZA 4B34A 3IILA 2JI8A 2OBBA 2X15A 5CA0B 5I9NA 4UBMA 1JVNA 1QOZA 2A5DA 4PLVA 4KQGA 4B3TB 4EB0A 4U7JA 1IN4A 3MWGA 4U4AA 4R16A 4X8OA 2WJ3A 4DLXA 3LCVB 3I73A 3VZQA 2GZ3A 2FN9A 2GPNA 3DBOB 4L8WB 2EBHX 5SYMA 4XWWA 3QOFA 3ASYA 3H99A 3IVMA 4R9NA 3VDQA 3BD7A 4GHWA 5AW4A 2Y68A 3FZEA 5CFOA 3WK7A 1E98A 3ROXA 3GRZA 5CLGA 1F0KA 1A8QA 2YWXA 5FOTA 5K6AC 5B12A 5JAIA 4DJAA 2OFXA 3CO0S 1PLKA 2RAVA 2BMWA 2ZXEA 4ZI7B 4NEGA 1H1DA 2XOEA 3H2IA 5F35A 3TRJA 3BB4A 2K87A 2ZZNA 3L7AA 2QM8A 1NYTA 1VPLA 2V8OA 1N77A 2YIMA 3R5TA 1KYXA 2IUFA 2DFNA 1R0LA 3KAQA 3LU1A 4MQFB 5LWHA 3L7NA 3TAHA 5J4VA 5ILOA 1OLUA 5J2UF 5GTDA 3HTXA 2WVGA 3D3NA 1KJNA 2X7XA 2OO5C 1CQIB 1T3GA 4LJ4A 2ZUVA 1MG0A 2HU7A 4HMQA 3Q7SA 4A36A 3PRHA 1FW6A 1EXDA 1CF9A 3GRKA 1YR8A 1OXTA 4HPXB 3GBPA 1ZIOA 1GSAA 3PE6A 2ETXA 4RQAA 4IWNA 4ZO4A 4W5QA 3LJKA 2PK3A 4EAAA 3ZDAA 1HT0A 3W4IA 2HD4A 3EUFA 3VR1A 4P7BA 5C1IA 3WNBA 3STTA 5MN5A 2EF0A 2C58A 1XNQB 4LWPA 4KITB 2B37A 3T34A 3AF5A 4B31A 1XVIA 1DI0A 3D6VA 2FMFA 3H9UA 3Q3IA 1TFUA 1UH5A 3GZNA 3AY0A 4KDRA 4MO9A 1ECFA 1OAAA 1KI1A 1Q11A 2E6KA 3KQWA 1FX0B 4BX8A 1DDGA 2FKAA 3HABA 3Q87B 3FHJA 3AESA 1C0PA 2LXNA 3FTFA 4RZHA 5ETJA 4XCQA 3R20A 2ILTA 1J0XO 3UK7A 2AI1A 2VP9A 1CUWA 2FWPA 2PXCA 5LA6B 2DEUA 4Y1RA 2AEFA 4AMBA 1V9CA 1JQLB 3D0OA 1EINA 4CL3A 5YASA 5F3WB 2VHQA 2VHXA 1XAHA 2QU7A 4MB0A 1JUDA 1VOTA 4RA9A 1F1JA 4GXQA 5IVDA 4L8YA 2CXUA 2TECE 4D8WA 1MRSA 2Q8QA 4JXJA 5FKJA 4WVFA 5EJ2A 4HDRA 3FPLA 1CZRA 5E4JA 1U11A 1C9MA 1JR3D 4QU8A 3DFIA 4UHBA 1MB0A 3TGPA 2DWCA 4TV8B 1HH4A 2F00A 1E1DA 2XGGA 5SZHB 2JFPA 5KNDA 1ZMXA 4NRDA 2SECE 5HCUA 1EWKA 2N9UA 5HTKA 4EUEA 1KERA 5TEWA 5CYOA 2DCUA 4MPTA 2DKFA 4XWAA 3NVMB 2J9ZB 3OPYI 2GOYA 2FPLA 2ZYIA 4GX0A 4OLHA 4HTAA 2R8BA 4LC9A 2FW1A 3AILA 1V8ZA 4Z2AA 1PFQA 1MLDA 3MTDA 4EGCB 1JPUA 2IQ5A 5A9SB 1L5SA 3CZPA 4PU0A 2Z8ZA 4YJFA 2G70A 3HEMA 5TPWB 1XTPA 3E3NA 2P7HA 1VLZA 3AB8A 1AUPA 3I4CA 1LPNA 2PUWA 5ARCA 3W90A 1O96A 2FPUA 3NTLA 3O4IA 4RHXA 2E2WA 4G09A 4MLDA 2N46A 5HVNA 1YDEA 4BNGA 4N41A 4RZ3A 1T3ZA 1T8SA 4QYIB 1ZI8A 4FUTA 3I5XA 2PS1A 1VMAA 2DTEA 1KQ3A 1QX4A 4L7VA 1TEXA 2D3TA 3QKUA 3V33A 2IUYA 5LZ9A 5HBGA 3MZ0A 2CSUA 1P6UA 3EZGA 1J0AA 1RFGE 1VLHA 1NQOA 1SBIA 2H2HA 4KHZA 3U7EB 2C5EA 4BGVA 3L8FA 2C57A 3K05A 1U3WA 4GSLA 2FN8A 3UMJA 4IWXA 2Y1XA 3AHIA 3I45A 3TM4A 3WLMA 3UG7A 5ESDA 3P2IA 4ISCA 4MYCA 5G2OA 1U6IA 3CLVA 2HQ1A 3FWZA 3FOZA 1R0BA 1I33A 3LP8A 2H1WA 4RM2A 3T7IA 3ZHBA 4BFTA 1GTJ1 1EHIA 1MB9A 4O4LA 4WK4B 3UBTA 1PE0A 2OZEA 4WI1A 2XT9A 2JDIA 4DA0A 4EJ0A 1P17A 1BHO1 1ENZA 1W2WB 2C2MA 2ZROA 3FZGA 3GYBA 1XZBA 5HCIA 2IL1A 5FNVA 4D4KA 2R65A 2CYAA 2BP7B 2WWIA 4P32A 3TSYA 4KMOA 2NO1A 4BTVA 1IY0A 3V4OA 4P53A 3SJ7A 2IHKA 1R4MA 4F2PA 1W4LA 3MWLA 1XZNA 3TUZC 1D6MA 1T1RA 3AFGA 4ER7A 2FEWB 1WTCA 4NS4A 2JFWA 4UNPA 4OATA 5KJCA 2H8KA 1F2VA 3CVVA 5L9AA 2O6LA 3H5RA 3LWDA 3SMQA 4FSDA 5MHTA 4YYZA 2QN7A 1V5EA 2QPTA 4EQ6A 2NV6A 1KAOA 3FCAA 1Z45A 1V4NA 3U0VA 1ISMA 4NG4A 4B3CA 1YB5A 3AR2A 1GXSA 2KE5A 5IDWA 5AI4A 4GBJA 1DAOA 1S6YA 1R4ZA 1EDDA 3TE6A 1KBQA 2TMDA 2ZANA 4H7IA 1W6RA 4K88A 4BFYA 1KWKA 1LK7A 1XXHB 3GPIA 5DOZA 3WKCA 3H5OA 3LGXA 4TXMA 2VZ8A 2ZS9A 4QPZA 3SBOA 4B6FA 1YB6A 3L7DA 2F8LA 4QNRA 3CLUC 1N6PA 4UM8B 4DV2B 2FRXA 5G0SA 4NNOA 3P0RA 3UGJA 1RQRA 1FJHA 4DJJA 3W6PA 4MDFA 4WASA 2CV2A 4Z4CA 2VQ6A 2R5WA 3PL1A 3A4IA 2JEYA 3QIVA 5DHAA 2W22A 1A1VA 3GEPA 3FNQA 3SR3A 4HJRA 4DA6A 3FDZA 3BEOA 2BFEA 3H65A 1C0KA 1NWCA 5G3YA 1L1EA 5AYVA 3AR3A 1DHTA 3G0DA 5K0GA 3VVLA 2V3WA 2RAUA 2WT8A 1T8YA 3JQBA 1JHAA 3AT1A 1Q84A 1TK9A 2ICAA 4YALA 5FI3A 3SZLA 4N4AA 3WK6A 1YL6A 4XQ9A 3B1WA 5CLFA 3B5JA 1YKFA 2WM2A 4KC0A 1U31A 3E9QA 5B3JC 3DM5A 1U28C 1J42A 3H9EO 4KO4S 4REQA 1OBVA 1DV2A 3CWQA 2XGJA 4WTOA 1KEKA 3GLFE 1Z83A 2VJKA 1C30A 1M2OB 3NHFA 4OA8A 2I7VA 2VPTA 4NMHA 1VP9A 2W6MA 3CZ5A 3WNVA 3E8MA 3RIGA 4A0HA 3BULA 2OL4A 4I5FA 2Y6VA 1AKEA 2BH2A 1W85A 4B44A 1FYDA 2BF4A 3IBSA 1BU8A 4NTZA 2HKIA 2RMKA 4Q3CA 1USIA 1ND6A 3DD1A 3H5AA 4LI3X 4LTMA 1BJTA 5K8VA 1LSJA 1SXJA 1U9IC 2OGTA 4GC9A 4B5KA 4CUKA 1KARA 4CMGA 1LPOA 1MIOA 3TYXA 3DO5A 2C2OA 4XYGA 3RUPA 3NHPA 2K7FA 2JAWA 2Z56A 4R9VA 3TR5A 3R5KA 2JLVA 1FC0A 2WIDA 3GCXA 1JU9A 4ARZB 3GEBA 3IT0A 3L8YA 3MWKA 3R75A 3CPHA 4O2AA 4ER3A 4UM9B 1BVYF 1E1CB 3C3KA 2CJYA 3PKJA 2WQ6A 4RYDA 3HLYA 2CLFB 3E27A 5CU7A 5C5DA 1JP7A 3H13A 3EBPA 5K01A 3EIHA 1XXHE 3CW9A 1ZHHA 3BIWA 3QEJA 2HSJA 4FWIB 1V3TA 3G9ZA 3G9XA 1PJLA 4J0FA 5T4BA 1HKHA 4ZXPA 4LSMA 1H6AA 4ND5A 1EUCB 5BNZA 1NIPA 4TMZA 3GFBA 4YCCA 1OLSA 3AHGA 1KQPA 4TVBA 3LLUA 3KELA 3QELA 1NUTA 1U1FA 1VYUA 1G19A 3D0RA 2O48X 4IH4A 2Q4RA 4MIEA 2WWXA 5KYXB 1BQEA 3DMNA 3D3KA 4D26A 1GN9A 1T43A 2H17A 3G8BA 3IAAA 3OQ6A 3OF5A 3IDSA 1RADA 5H3LA 1H1LB 4Z4FA 1YRYE 2BV3A 4FE4A 2HL6A 2XF8A 3LW7A 3CH4B 3H5NA 3HWSA 2HK7A 2P65A 1L7RA 3N3BC 4MA5A 4QUJA 4TSKA 1I9GA 3HUUA 4YP6A 3SE0A 4CYMA 2V74B 3TIFA 4BMDA 2ET6A 2BI7A 4DY6A 4DUPA 3MTQA 4MRMA 5SY9A 4W5RA 4CCYB 3Q8LA 1SQ5A 3DDCA 4TWBA 1NVFA 1IN1A 4N18A 4YJ3A 5ALXA 1NAHA 1DU4A 1F3OA 2G76A 5KREA 2MYPA 3KE8A 2XCQA 1DEXA 4KRYA 4S04A 4JI0B 2H4FA 5CYFA 1MC4A 3H2KA 3UFXB 1WBDA 4XLLA 2I4MA 3PD1A 4L22A 3RARA 3K1JA 4ZV7A 1CUEA 1FTSA 1E4YA 3HBJA 4AL4A 3I42A 1I01A 1WOYA 1Z4PX 2VYVD 4ID3A 3UJCA 1UDAA 1ZD4A 1ZICA 2QJFA 3SLRA 5I9LA 4LZOA 3AQIA 3BIFA 4MV9A 1R10A 1RP7A 521PA 3TEMA 3EULA 4CI9A 4TZTA 3G2OA 1C3LA 4KX5A 5DASA 1E5QA 8ATCA 4MV4A 1I7NA 4ZOEA 2YOGA 4X7MA 3TDKA 5D3KA 1Z39A 3OQIB 1YJXA 4Q4JB 4WN3A 3OD1A 3EZ9A 3Q3CA 1NA5A 3OU7A 5GV7A 1FUIA 2ZIEA 1GQSA 2GARA 1E2JA 2OXEA 1A5BB 1H0KA 4ZAYA 1R0WA 3TVDA 1EJ2A 4DG8A 5HJEA 5JJKA 4EZEA 3MGKA 4RTMA 1WUJS 1DPFA 3WISA 1I10A 1DQNA 2ADFA 2LPMA 2Z95A 3FBTA 5BOSA 4EHAA 4P7FA 2CLEB 1V7PC 3KSAC 2Q6IA 4MJ3A 4MOWA 5FPYA 1U5BA 2C42A 3JVEA 4FLEA 3NC0C 4E5VA 2HHJA 1N6NA 1D2EA 1U2DA 3RTAA 1JSRA 4Y2GA 1KDOA 2HH9A 2PL3A 2JGLA 3B6ZA 3NH9A 1X7GA 1Y4UA 4D4LA 1V3VA 2V65A 3RAGA 4BO4A 5EP4A 1JHQA 1OC4A 3HCPA 2BELA 1RXSA 4UTXA 2IEGA 4U7WA 3UWSA 1ORRA 2CCGA 3WRYA 4IMIB 3FPJA 3E3MA 1XQWA 4LV5B 2VYFA 2ACWA 5BY2A 4DLSA 5KQPA 3BA1A 1L8OA 3Q12A 3HCFA 1E7QA 3N28A 4YQFA 3FYTA 3OUTA 3R4CA 4FMCF 1OGIA 4Y0NA 4DSAA 4GOJA 5LB2A 2HMUA 2KX7A 5CM9C 3EIWA 3N6RA 4IDFA 4RM3A 4C4OA 2L69A 1LFAA 1N7HA 3Q3EA 1BTOA 1VI2A 2D4AA 3EHDA 3NVAA 3FYUB 3OX1A 3PCTA 4G41A 2AR7A 2B94A 2J9RA 3MRSA 1QX3A 3STVA 2VPPA 1G21E 4B6JA 4D9NA 4ZZ1A 5H5JA 3KEQA 2XUKA 5LQNA 3FGNA 3D3WB 3M33A 1DXHA 4BV3A 3IIEA 1IE3A 3V48A 3OCWA 1QO9A 5G0VA 4ATNA 3VC2A 4CU5A 3CLRD 4BZPA 3FPAA 5DXFA 3UJ7A 3CH6A 5T8KC 2ZYSA 3S2FA 4P8RA 1NW7A 1VMEA 2QUIA 3VKHA 1P75A 1X74A 2JVKA 5LQKA 2EFYA 2PU5A 2BEUA 1P7PA 2JIZD 3DBIA 2WJIA 3IALA 2IKSA 2HWYA 3FMPB 3QE0A 4OOEA 1X1BA 2YY5A 5TC4A 4Q9LA 1AQ6A 3TLXA 4UQLA 1GYPA 1HSOA 4LDNA 1HRKA 4GNRA 4LMPA 2P9FA 4CQJA 4X9XA 3ZX5A 1OROA 3MTJA 5FNVF 3ZH9B 1VPEA 3Q0TA 1Y89A 5BWBA 5EP1A 5IUKC 3WQBA 4DZTA 1X7DA 5EMKA 1G5PA 1V7CA 2DJIA 1ZJJA 3AY3A 3OZXA 2ZDHA 4PG8A 5G4KA 3O91A 2A9FA 5E3IA 3ONDA 1XTUA 4F9GA 1D8TA 1KK0A 1XA0A 3U5ZB 1FLDA 1EBBA 1DBWA 1OYVA 1JKIA 2WOJA 3NKLA 3T1YB 3GN2A 3IE0A 8ABPA 3K9CA 3SXUB 3ZG6A 4QXMA 4E2WA 1JRLA 4YHHB 2HMVA 4TWRA 5AXBA 3RU7A 4Q4DA 4EPTA 1M10A 1NXSA 2I6TA 3E9DA 3EOAI 1E6UA 4RIIA 1NXVA 3USES 5BMOA 1QRTA 3DWFA 1XZFA 3VPAA 4AUKA 1IEXA 1PT8A 2O5EA 1RU3A 3KAPA 3ZHUA 2FNAA 5AVSA 1M1NA 2Z57A 4N5IX 3ID6C 4LECA 1PYDA 2F59A 1F0PA 4PEVA 3I8OA 4X6UA 2BVNA 4CM8B 4IF6A 4MWBA 4N7RA 1X7WB 1D0IA 5ADVA 2ZI5A 1SXPA 1K5GA 4I4IA 5BSFA 4QOEA 5REQB 5C4GB 3SE7A 1D4FA 4N03A 5AM3A 1EVKA 2ZTLA 1A8HA 1BGWA 2CLMB 3KBBA 3M6AA 3QENA 1WCIB 4Y2RA 3ZGVA 1S3IA 3CNQS 1RHQA 3AOGA 5BUCA 2QQ0A 4CKWA 1NVKA 2ZXUA 3X1DA 5M29A 1P81A 1H4TA 2RI6A 2YHSA 3JS5A 4D3YA 1VJTA 4FIDA 3GK3A 1TNDA 5AJHA 2DLCX 1R4AA 1T13A 1SBQA 1WMAA 3L9WA 4XWYA 1XRPA 1EB9A 4O0MA 3KZNA 4YUVA 5TDHA 3AUAA 3K09A 4YV2A 2QRQA 3ZDBA 3ITDA 3C7KA 3QVGB 1WVGA 4BNZA 1AGNA 4HVAA 1P2UA 1OF1A 4JU8A 4P7KA 5LP1A 1XEXA 1TD9A 3TX2A 4A23A 2PWPA 3WG9A 1XXLA 4K2AA 4HWRA 1YZTA 3PUVA 3UCXA 1H9AA 4C0BA 2BHLA 2D06A 4P81A 1E2MA 2I65A 2W6IA 2ERXA 1KFEB 5DTQA 3K16A 1WPRA 4YIHA 2JBAA 4BV8A 5J40A 4MW5A 1Z47A 2Y1DA 1VE5A 3CKYA 1NI4B 3QKRA 1TZJA 3RU3A 4NX2A 4MWZA 2B0JA 4JR2A 4Q03A 2IS2A 2AT1A 4G0ZA 4XGRA 4BLUA 3RIEA 1P7CA 2ZM6B 2QLTA 3Q85A 3ZGXA 3MIZA 4OYYA 3UJPA 2QSYA 3NLLA 4AMVA 2IHVA 2VHYA 3R0QA 2RCNA 1K7CA 2JKVA 2WA2A 3H5WA 1OXMA 2Q3DA 3FPBA 4G9GA 1IUNA 4S0ZA 4ZAVA 3AI7A 3GMTA 3D1JA 5T5QA 3KKZA 2F8SA 4O2AF 1JWBB 4X1KB 3TNFA 4RY2A 2HEIA 1DEAA 3SZUA 4QICA 4FP9A 4GQAA 4ND2A 4DG9A 2WJYA 5LNK6 4ERNA 3KOOA 1EFDN 1KIAA 3HG7A 5KTPA 3BWBA 2YJTD 1KKLA 3NASA 5LXTB 4JB2A 3C0KA 1YU9A 1T0JB 4BN4A 4ETIA 4JITA 1NY6A 1UEIA 4KGVA 2YFKA 3KLNA 3RO7A 5F78A 3H7AA 3MGBA 4FGUA 5EKSA 1NQTA 3OF2A 1XG5A 4TWZA 1CRLA 2VSYA 2ZBGA 2V9PA 3DEYX 3OVMA 5KTTA 3RI3A 4QGBA 2IYPA 4MI9A 1ZH4A 4JB3A 2V55B 4DLYA 1PG2A 3R3ZA 3CLKA 4D4JA 1HI9A 3F78A 1I1HA 2RG1A 1YBHA 2IXEA 2V6FA 3IDFA 3GXOA 2R6ZA 3ABOB 3STUA 3OCCA 1WQ1R 4GI3A 1YIDA 1XLUA 4G5HA 2JIDA 1DJLA 1VQ1A 2WI8A 4MAMA 4WKBA 2D2IA 3OQNA 1OKKD 4M0MA 4XWGA 4G8CA 4ZODA 4X94A 4EG7A 1OXSC 1ZUIA 5JAMA 2JJ1D 4HNAB 4XIFA 1V71A 4KI7A 5LQSA 4ZYUA 2GEDA 2QEQA 3I34X 1ZAYA 4D56A 4KPFC 3HI6A 2FFRA 3P5SA 4W9NC 2M6RA 4YJ3F 3ZI0A 5LQDA 3L92A 4HUTA 1UIRA 1YL5A 3EH1A 3LECA 4N0DA 4C89A 1JV2B 3L1VA 4ZU3A 4AF7A 1U9ZA 4X1YA 2ZW9A 3DOIA 3RM3A 3PXXA 4BQSA 3O93A 4MGIR 3S7TA 1RYYA 2O7SA 2XA9A 3EYWA 3MPOA 4K28A 1Z4LA 2RHOA 4MKZA 1J24A 3GWZA 1Z0JA 4AJ1A 4EW1A 4L5AA 2OKGA 1OT5A 4IAOA 1WXXA 3NIGB 3K9GA 1R6AA 3WHKA 1LBIA 3GUHA 1CQXA 3G02A 3ZWYA 4NJMA 5CEEA 3FI0A 4KLCA 2WJZB 1LRKA 3HKCA 3T99A 1IN7A 1UWLA 3GLSA 2EXXA 3WQHA 4CIDA 1ULSA 3A6LA 1T8PA 3D1LA 4G5OA 1N0HA 1VSBA 4P4LA 3RSOA 5C81A 4TLLB 4PG7A 5JADA 3FBGA 2UZ4A 1T6BY 3OOJA 4J4HA 3D8HA 1JSZA 3F6CA 1GPWB 3ND6A 5KYUA 1PTJA 1WL8A 5ICGA 4WT7A 3C3JA 4E5KA 2C3UA 3OM1A 4KVGA 2FMUA 1DINA 1TZMA 3QLUC 2NACA 3H8JA 2P0YA 1C29B 2CJXA 5FBKA 3SSAA 4IO1A 4FR0A 3E23A 1W0KD 3ETCA 2B36A 1FFCA 1V47A 2WNSA 4JDUA 2J5XA 3JD3A 1A2KC 4UHDA 3WXMA 1T2VA 3HZOA 5FR2A 4ZTBA 2HYIC 1RKUA 2P68A 5CW1A 3RSSA 4KIGA 4NENA 3QXCA 3M5PA 1PU2A 1NQWA 5K2OA 3PC8A 4LGMA 4BO6A 1B8OA 1GSHA 4YJKA 1P73A 3A36A 3ZPXA 3EW9A 3JYQA 3LO5A 3I05A 3PF8A 3IDQA 5KOYA 3CVYA 2Q27A 3QK7A 4IMPA 4RJTA 2J3HA 2YWFA 1V8OA 3I2FA 4EH1A 2OE2A 3IP8A 4QLBA 3ICQB 1GA1A 4HNRA 1LF5A 4X60A 4MP6A 4CUJA 3BHMA 4GMFA 1F8FA 1NJ6A 3HEBA 3MJRA 4UAJA 1OLUB 1EP1B 3KIPA 1LNQA 5SY6A 1Z9BA 4X90A 3W9UA 1A9ZA 5DN6A 4C0HA 2SHKA 1I1OA 2ZRBA 2PT9A 1GFSA 4L28A 5CW2A 3CVJA 1RI3A 4R81A 5BRAA 2ZWPA 3ENQA 4HV4A 4MEBA 3LUCA 1MCZA 1XB2A 4B7XA 2JLAA 4OI1A 5EUMA 4BCBA 3W4KA 3TZEA 2P9BA 4BJ6A 1JG7A 2UVPB 3RVRA 4Q3LA 2ZRMA 1TYBE 2V6JA 1X87A 4B6OA 1MC1A 1SZPA 3ILVA 1VE3A 2GHRA 3VQTA 1I5RA 2CVQA 1C3OA 2PGOA 2J32A 4H15A 1SC6A 5JD3A 4G0OA 4RKWA 4EG0A 1K0UA 1QCYA 2GN2A 4CEIB 4EY6A 5EN4A 1IZYA 2QWXA 3DJYA 5GQSA 2I1QA 1VHQA 5TQJA 2BR3A 4QPCA 1SQSA 1C1XB 2E85A 1A04A 5IYZB 2FRDA 1VMDA 4WNAB 3N76A 3E1GA 3TCNA 4G07A 4BJ3A 3FB1A 2GN1A 2H63A 1RYBA 2IZ7A 3DFMA 2A1IA 4PAQA 4JA2A 1V16A 3PGXA 3B3GA 3TH5A 1J8FA 1A4UA 3I2JA 5HK8A 3VNUA 1Z68A 3OT5A 5A7FA 1XPRA 4NJOA 1A4IA 2VCYA 3QPDA 4HDRB 1VE7A 3TI9A 4C22A 3DAFA 4M0LA 4B82A 1ZGGA 3R3HA 5JSZA 5L3RA 1B0AA 3F4KA 3GO4A 3T54A 2PIAA 5DK6A 3BTOA 5E0KB 3GDOA 1DIAA 4RD1A 4CFYA 5CJPA 1G7RA 3IUQA 4A8PA 5TXGA 2GEFA 2P1DA 3KSBC 4LZZA 4TMTA 3K72B 3W9BA 4FFBA 3QJGA 4IGKA 2J3IA 4P3NA 4XGKA 5LZ7A 1SZDA 2NV2B 3OE5A 2Q1SA 6REQB 1IQUA 3ELWA 1MHTA 5A0TA 1EVYA 4UULA 2QG4A 1P9WA 3FIJA 3HP7A 4WXMA 4PLZA 4QSHA 2ZBDA 5K0ZA 8MHTA 2EBUA 3KOMA 5K3FA 1X3SA 2IVFA 3WV5A 2D2VA 1DQRA 1UDBA 2YJ5A 3DV2A 3ZCSA 1F4VA 1Y3DE 4FLFA 3MEQA 1BN6A 2QT0A 3FUXA 3QV1A 3KHKA 4TKUB 4M37A 4NH4A 5ANRB 3RJTA 2HSWA 1PDOA 5KOHB 3O1JC 4IFEA 4P4UA 2C7BA 4MW6A 4QQRA 3ZVKA 1UP7A 4GVXA 4BGDA 2NXEA 3WYNA 4UNIA 3MWEA 2W48A 3BZWA 4MQ5A 3HY3A 4CM5A 4DDVA 2MMGA 2ZWMA 4ZO9A 5B2EA 3G82C 2YYAA 1I1QB 4MMZB 2RC5A 4R4JA 4HAIA 3S1LA 1GTG1 4DSNA 3T8YA 2ZAOA 3I9KA 3AIIA 2MYTA 4W5HA 4DLPA 2IEZA 2YZ2A 1J33A 4M0FA 4IZHA 3CNLA 4BDTA 1QIJA 2W90A 1U3UA 2UKDA 5A3QA 3SHVA 3FTEA 2YV1A 2EERA 1QS0A 4NXMB 2W6NA 1P8JA 3VJMA 4O4LB 2CN1A 3TNDA 3HSYA 3A0RB 4BUZA 1WF3A 3DT9A 3OM0A 4BVJA 2IX3A 4U6QA 4Q1EA 4L0DA 4GGPA 3ITKA 2Z9DA 4CRWB 1E18A 2OLEA 1GTZA 2AEJA 3SGLA 4H0CA 3ZCPA 3COJA 3H0EA 5IABA 2C4MA 2PFGA 3E5RA 3RK4A 3H8VA 3SHWA 1DRUA 1NR1A 1DVRA 3T5AA 1TVMA 1DBVO 1CR0A 1R4MB 1OFIA 2OB2A 3BB1A 3IP1A 4M1QA 4MSUA 1ZD9A 5DGIA 5DO9A 4JYCA 3V55A 3FB4A 3Q8MA 1L0BA 4ZJZA 3H9QA 5IJXA 4BNDB 3VH3A 3VDMA 1T8RA 4IHJB 2D2FA 2ILVA 5F9MA 1XWFA 2XUFA 3V1YA 1BS1A 3H83A 4GFDA 3WK8A 4A0FA 5L6MB 1G5FA 2Q6LA 4R1UA 1Z34A 2H4YA 4NY1A 4AYWA 1ACLA 3G8YA 3GNQA 3HHEA 3SM3A 1SKMA 4CM7A 4H77A 5F2NA 5B2ZA 1L5VA 3RIXA 1Z18A 2H52A 1FFGA 3W8EA 2YWRA 3KD2A 2QTTA 3OU6A 1USUA 3GL9A 2WKQA 4KG7A 4MEJA 2IBSA 4G85A 2YRXA 1JDPA 2PA3A 4BAZA 3DV0A 4CW7A 4YLYA 1EHYA 1W1IA 2CLSA 1XCJA 2WW8A 4W6ZA 1RQ7A 4DBZA 2JGIA 4FGSA 1ZOLA 1N2HA 3PNKA 4K6HA 5TE9A 2A88A 1U0EA 2BTOA 3DGFC 1I4TD 2FPPA 4HB0A 4H9GA 5DYNA 3W6ZA 5IVPA 3T1HB 1PL0A 1B73A 3DKIA 4HDKB 1BOOA 1QO7A 1BVUA 2PMWB 2UZIR 2VL7A 5SZJA 5J3JA 1H23A 1P1KA 4HTFA 4NFSA 4CIVA 2E4XA 3OKFA 1MO4A 3M9LA 4DCJA 1WB6A 5I8PA 5SV2A 3PYLA 4MYRA 3NO4A 2HK8A 3V8PA 4WNYA 3EWAA 1KYYA 2G1KA 1H1TA 1XZDA 1E3LA 3G88A 2WBLC 3RJ5A 4NAVA 3NGXA 4UHFA 3A9RA 3L82B 1JTFA 3VISA 4J91A 4DCNA 1UBRS 5KTMA 1ZS9A 5AJUA 3RVKA 1CS0A 2I7XA 3CURA 3LPCA 4RADA 3M9WA 5BYKA 4ZGBA 3ZQ4A 1Z3CA 2NYAA 2R00A 1YQEA 2HF7A 2XE8A 1PV2A 4R1MA 1XE3A 1IONA 4BN5A 5AVWA 2EL9A 2IZ5A 2NO9A 3NXSA 2PO7A 2LCQA 4LF6B 3NBYC 2Z2ZA 1NZDA 1NR7A 3CX6A 3VHXA 1V9SA 2VEOA 2OQIA 4RVDA 3UV6A 1EFPA 1QB8A 3DE0X 3H1AA 4BKPA 1QHGA 1NX6A 3AP2A 1G4HA 3IB3A 4PSDA 2EARA 4AY6A 1CJCA 3W4JA 1ELOA 3CEPB 3D6TB 4PIPA 4C3OB 3LC7O 4QBFA 4PWYA 2JASA 1NVMB 2W93A 5JT1A 3WDKA 4N3NA 3EFHA 5ALJA 4ZEOA 3TCKA 2HWWA 4P4GA 4EDFA 2X76A 5AWFC 2IYLD 4QRHA 4G1BA 3U2QA 2Z4SA 3UHOA 3DV9A 5ARBA 1NBEA 1PJ8A 2H7YA 3A6EA 3N5CA 1VBKA 4F7DA 1C3XA 3ABZA 3O31A 4U7DA 4DAOA 1FJ2A 2EJBA 4LX0A 3O4FA 2PUCA 4XIGS 1U3DA 3VNSA 4HVCA 3RJ9A 4CBVA 1WF6A 4HLDA 4CN9A 2QE6A 4JA0A 4R51A 4A2WA 4DRXB 3JW8A 3A8TA 3WWEA 4FOTA 1MV8A 3WC4A 3B3QA 3BBPA 1E1MA 1YQWA 1Z13A 4TLMB 4YFVA 4LYEA 3UJNA 3B38A 4OB8A 1KF0A 1Q19A 2LR0A 3NKVA 1JEYB 1NJFA 1PDVA 5CURA 1AZTA 1YRHA 1CRZA 2I55A 1TTHA 3T3MB 2F43B 2DHDA 2PTGA 2GZHA 2NPIA 3SN6A 1JIVA 1EU1A 3UB2A 1P4SA 1SKYB 4YRJA 5C5CA 5HS4A 4A9AA 4YXFA 1K9SA 2JFFA 4X0EA 1JAYA 1N0WA 2WWHA 3K0HA 3MJ4A 2P41A 5A4KA 1G63A 1Y1KE 2XZOA 3LY9A 1G3MA 3G7NA 3AKDA 1NFRA 3F5FA 4G9EA 1H3FA 1Y3CE 4C29A 1FVHA 4FT4A 4JFAA 4YMSA 5IT4A 4CODB 5JNLA 3KT3A 3CLSD 1AHNA 2A58A 3HADA 4ZHQA 3RKSA 3W5HA 1H22A 3HDVA 4QOSA 2XOKD 3AVUA 3EMKA 2I3BA 3K53A 3TOVA 4ZV4A 2VJAA 1XV5A 4UHJA 4RESA 3T38A 2C4UA 1YD7A 2PO5A 1VKOA 3HPQA 1DJNA 1IHYA 1GDHA 1CUXA 4NNPA 4XPIA 1CQJB 1GNQA 1XTZA 4ZVKA 5CCBA 4GS5A 4QUBA 1RWVA 3WRWA 1FTWA 4NATA 4CM4B 4EECA 1GG5A 2I3AA 2P6RA 1A82A 4FYKA 3AVVA 3ZE6A 1E9FA 3KEMA 4PNPA 3C6KA 1YS4A 5JDIA 1EFRD 4A2QA 2H0AA 3PEFA 3LFHA 3QTTA 1SXJE 1HL7A 2ZBPA 3A3KA 1QNFA 4KDEA 3KJQA 3LNCA 4F2WA 3N07A 4LXIA 4OHMA 2A57A 1FXSA 4IQFA 1HURA 2P6PA 4K9KA 4O4JA 3SKXA 1X7YB 2P27A 3IKTA 4TYQA 1X7HA 5FLEX 3WB9A 2ZG6A 1NR5A 2DUUA 3PUJA 1DTWA 3N0TA 3TS1A 3THXA 1OIWA 4Q4LA 3GJ4A 3ADDA 1U0LA 2P9YA 3IHLA 4PC1A 3LF2A 4WCFB 2P40A 1Y5IA 3K5HA 3P0FA 3QI7A 3A32A 3R6TA 4OVKA 5JPCA 1NONA 2WV7A 2VQFB 1GPNA 1PBNA 2V7TA 5FI0B 4J2OA 2O9JA 1YBFA 3QU2A 4MTLA 2GEKA 4FM9A 1R18A 3QRWA 1X1AA 4JZYA 1L5HA 1Y1PA 3MINA 3PRYA 5CNMA 5D3QA 1QYDA 2XITA 3DHVA 4RAQA 3RK1A 3SIWA 4DDMA 2BKUA 1RAHA 5FUMA 2IU3A 2OBYA 4ZZ3A 1Z33A 2Q9BA 1H2FA 3IAS1 2VHEA 1W88B 2BN4A 2OCLA 3ESYA 4HX9A 4RF5A 5AW9A 1BXGB 4WFKA 1BZYA 3I92A 4FHZA 2ID9A 4NMMA 5EWJA 3VU9A 3S2UA 4OYRA 4R9SA 3T7CA 5TT0A 1EVQA 3RS9A 3LIIA 4RV4A 2Q3EA 1VSUA 1DQSA 1OBOA 3SHOA 1LRJA 3MTGA 4YXWD 4DLRA 1ODIA 3OLVA 3U7QA 2Y2UA 1LS6A 3A1WA 4U5QA 4BZZA