1JWAB

Structure of the atp-bound moeb-moad protein complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
239
structure length
217
Chain Sequence
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 76
structure length 217
sequence length 239
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jwaB00
4IMPA 1U7TA 1HDOA 4E2YA 1QYDA 4XR4A 3PYLA 3GVCA 3KYBA 3KO8A 4J6FA 1EZ4A 4Z9YA 2QRJA 3GMSA 3ROKA 3OMLA 1YJ8A 4R3WA 5T64A 3DO5A 4IDGA 3W4JA 3IIEA 1PJTA 4DGSA 2WD7B 5A5EA 4RF4A 2W98A 4GBJA 5L7WA 4ZRMA 4RVGA 3I9KA 2GCGA 4CJXA 3PYXA 3TSCA 4B4WA 2OL4A 1V9LA 4QECA 4AJKA 5DCWA 3COSA 3DBVO 3VZQA 2GSDA 3RSHA 1HE2A 1XA0A 4XYGA 2VHWA 1MC5A 2GPTA 1Q0LA 1ZXLA 5ILGA 2VYNA 1KS9A 1DC6A 2DBZA 3I1JA 4BIIA 3LVFO 4XGNA 1XU7A 9LDBA 3AUUA 3OSUA 4FW8A 1WW8A 3C7AA 5JCJA 2YHIB 4OKIA 3F46A 1G0NA 4MVJG 4K1LA 1VI2A 4R1TA 1M6HA 4Q39A 1ZW1A 3QVTA 5L53A 3K92A 5L45A 1DHRA 3F4BA 4R4JA 4F45A 5KKCA 1LSJA 4INAA 3UXYA 2BFAA 2PZMA 2ZYDA 4I08A 4DVJA 3PWZA 1GUFA 5AXAA 1GPDG 1HSZA 5B37A 3ZU2A 1GQ2A 4PLWA 2CY0A 4PLPA 4Y6RA 5L9AA 2BELA 5L51A 2CVQA 1QG6A 4OGWA 4YJGA 1IL0A 5DNAA 1Q1NA 3RUAA 3TPCA 3CMMA 4ID9A 2PKQO 4BKUA 5G0SA 1AHHA 3VPFA 3PQFA 2X9VA 2OP0A 1ISMA 5IN5A 1ISIA 1PS8A 1UZNA 4YT5A 4DMMA 1ZBQA 3F9IA 4PRLA 2A4KA 3BMQB 4IM7A 3O4RA 4IGEA 5FEUA 1Y7TA 5JPIA 3O8QA 4NJOA 1VL6A 3D5TA 3JD3A 2JD0A 4AVYA 2GN6A 4Z9FA 3H7AA 4DXHA 3ZN2A 1NBOA 2Y99A 4Z0TA 3SEFA 5IJZA 5KVSA 1A9ZA 4ZN6A 2NACA 3OJFA 1HE5A 3PHIA 4DL9A 1PZEA 2W2LA 3X2EA 4FBGA 4RV9A 1MUUA 4NU5A 4Z0HO 4DREA 3IJPA 1U3UA 4KQXA 1GTMA 1NWHA 1PJSA 3QY9A 1BHSA 1YS4A 1LC3A 1DXYA 2OORA 5JYDA 1FF9A 3NTQA 4MPDA 2D0IA 1O5IA 4R68A 3INTA 4JGBA 5H82A 1GPJA 4P4GA 1LDMA 1O95A 5ER6A 1GV0A 4NDNE 4J16A 4EDFA 4W7HA 1HYEA 3ASUA 1R0LA 4D0SA 1DIRA 4XDYA 1PSDA 1M6WA 5ADHA 3KHUA 4RDHA 3BMOB 3I4FA 3GEMA 2CMDA 2Y0DA 9LDTA 1ONPA 2NLOA 4LMPA 2VYVD 1PJQA 4B79A 2C20A 3DXFA 3VVBA 3NJ8A 1DPGA 1RWBA 4ALLA 3GVXA 4CLOA 3JQAB 3IAHA 2C7VA 4R5HA 3WGYA 3ZU4A 2O3UA 3VAZA 4TVOA 1LQUA 4E33A 1Z82A 1U4OA 4XYBA 3PGJA 1S7CA 5ICMA 3SLGA 4B3HA 4J4HA 3PQEA 1HZZA 1T1RA 4WLEA 2H6EA 2AMFA 3ZI0A 2VZ9A 3MZ0A 4J1QA 3RUIA 2O23A 1GUYA 2GD1O 2PZLA 3AY3A 3VOSA 4L73A 1FDWA 4NK4A 4NPCA 5I9NA 4NBWA 4XA8A 5T67A 1UR5A 1B15A 3KETA 1B8VA 1M2WA 3JQGB 4I5DA 5KKAA 1N7GA 5IZCC 3GA0A 4IDBA 3GDFA 1IY8A 3GNSA 3JYPA 5TGDA 4D0RA 4E4YA 4HFRA 1Q0QA 3QQPA 2EF1A 4YAEA 4XYLA 3BTVA 5EL0A 2XXJA 5ENDA 2V6GA 3NX4A 5T5QA 4ND3A 2YYYA 2WM3A 1KEUA 3F1LA 1IB6A 4WCFA 3W8EA 3SBOA 1JA9A 4EGFA 5F5NA 2PGDA 1XG5A 4RPJA 5LCXA 2HSDA 2QRKA 4GVXA 4NI5A 1F8GA 2EKLA 5CDUA 4ZQBA 2ZIZA 2O4CA 3PFFA 4DRYA 3UCXA 1LLUA 1X14A 3WTCA 4YJDA 5JLAA 1KIFA 2JHFA 3NDRA 4IXTA 4OOEA 1L1FA 2B0JA 3DAFA 1OC4A 1GY8A 3L4BA 1DEHA 2H63A 5JCXA 5IG2A 2W2KB 2RCYA 2ZTLA 1KEWA 2EWMA 3K9QO 1AXGA 2J8ZA 2Z1NA 5BQFA 1D7OA 1A4UA 3GK3A 1R16A 1R15A 3AM3A 5JO0A 5ITVA 1CEQA 3AY7A 4E5MA 4TRNA 5FF9A 4GL4A 2UVDA 3R0IA 4GMGA 3UHAA 3EAGA 4J1SA 4B4UA 1U9JA 1U2DA 4CMCA 4XIYA 1ADGA 1P1RA 1M76A 2IEDA 1P0FA 1VKNA 1UP4A 3H5NA 3U3XA 2VUTA 3ZHXA 4BS9A 3PIIA 2X1HA 1A71A 1GR0A 1X13A 4XCVA 3PEFA 1ZK0A 4IS3A 2NVUA 2R6JA 3JQEA 3JD0A 2I67A 3NKLA 3RJ5A 4CMIB 1UZLA 4DIFA 1ONOA 2VWGA 4IJUA 1DRUA 1ORRA 3EMKA 1QKIA 3EGOA 3DBLB 1D3AA 3GFBA 2X23A 1JN0A 3QRWA 3RASA 4NH4A 2JL1A 2YY7A 1UDAA 3SLKA 3WMXA 2DLDA 2NVBA 3QVXA 1J4AA 3GAFA 5T57A 4Z9XA 1B2LA 1TXGA 4KWHA 2XPCA 3BA1A 4ZJUA 1HYGA 2OO5A 1CQJA 1X1TA 3D3WB 4AJ2A 1GZ3A 4MDHA 3WBFA 4FFNA 3C1OA 1K0UA 3G1UA 3KVOA 3VPGA 4DTIA 3T4XA 3DL2A 4E3ZA 1QLJA 1NP3A 3DONA 3DHYA 3TZ6A 1G6KA 1XDWA 1W0CA 1KVRA 4JP3A 3G17A 3VH3A 2ZCVA 5G0VA 2Q1UA 3GMDA 2VCYA 4L4XA 4JK3A 4XEHA 4R1SA 3ETDA 3BMNA 3HDHA 4HUJA 2DTDA 1YWGO 4XKJA 3D1LA 3WQSB 3RUDA 4BNFA 1OFGA 1R12A 4WJZA 1E7YA 2BD0A 1X7GA 3U0BA 5B4VA 3ANNA 1VRWA 1WZIA 4BNWA 1I36A 4YAKA 1RJWA 4BO3A 3LQFA 1NX6A 4GSKA 3OM9A 3N74A 4UREA 4EW6A 4TRRA 1XQ1A 1TI7A 4YPOA 1JAXA 3WFIA 4EJ0A 1KVSA 4RPKA 1ZEMA 3B1KA 4YJHA 2FP4A 2C7GA 2UDPA 4JBHA 4TRMA 2JAPA 2FWMX 3QWHA 4ITUA 4Q3EA 2Y66A 2OBYA 2G0TA 4UEOA 5U9CA 2PD4A 3KLMX 1J49A 2X5KO 2UV8A 3ITDA 4NBVA 4YAGA 4NFYA 5LDHA 1N9GA 2EJVA 2Z5LA 4X54A 3ZV4A 3PPIA 1BTOA 3GAZA 5TLSA 1NQOA 4BKPA 2NADA 5CAEA 5FFFA 2QZ9A 3NGLA 1YGYA 3RU7A 4PLHA 3GY0A 5MDHA 2IXAA 4O0LA 5JS6A 1H2BA 2ILTA 2PV7A 3ADOA 1LUAA 4RVDA 4YJGB 4AJHA 1R37A 4JJFA 4ZICA 4XRGA 4Y6PA 4II3A 4DUPA 3ICCA 1DHTA 1ZH8A 1BVUA 3OF2A 5HM8A 4U5QA 1AXEA 1BW9A 1SCUA 4MP3A 4R1NA 2RBEA 2GLXA 2B69A 4HNHA 3H4VA 1EK5A 1PEDA 1QYXA 3H65A 2QYTA 2P5YA 4AJ4A 1DC5A 2DPGA 2O2YA 3GDGA 4DQVA 2P4HX 3ROMA 3GUYA 3WICA 3QHAA 3VDQA 4TRJA 1CJCA 3O8QB 4RZIA 1E3IA 4DLAA 1RM3A 3ZNNA 3VHRA 3K31A 1DSSG 4B8ZA 2GN8A 1H93A 4WCDA 3OQBA 2H9IA 3QW2A 2FPIA 3FHLA 3FCOA 1KVUA 5JAMA 1PQUA 2V6FA 4F46A 4J2OA 4FQ8A 1EFLA 1K5HA 1P31A 2GNAA 1UXJA 3IQDB 4D3SA 2DUWA 2JAHA 4IJKA 3S55A 4K26A 4J4TA 4A0SA 2C5EA 2G5CA 2HDHA 2P91A 2VT3A 2YV3A 3GQVA 4FFPA 4IS2A 4XIJA 4A26A 5K0ZA 3BMQA 1ARZA 2FSSA 4CLXA 3A1NA 3TJRA 4RLHA 5A9TA 4IY1A 3WGIA 4RGBA 4ALMA 1Y8RA 2Q50A 5JMPA 3H8VA 3RU9A 2UAGA 1V8BA 1ZEJA 1KC1A 4NFHA 3H9QA 4YR9A 4PLZA 2E6UX 2Y0CA 1YQXA 1U4SA 4AJNA 1GYRA 2C82A 3D3EA 5G0UA 1E1MA 5FI3A 3GVPA 3WLFA 1C0KA 5C7IO 1HDCA 1QV6A 5DT9A 4ZD6A 2ZTMA 2CDAA 1PS9A 2P9EA 3GRPA 3DAGA 1U1IA 3FI9A 4CLOB 3EC7A 4WEQA 3QVOA 2OBNA 1HDXA 4Q3NA 4CM7A 2GERA 3QSGA 3V5NA 2I99A 2J3JA 1YO6A 1VE9A 1Z7EA 1A27A 4JIGA 3BMOA 3BTOA 2JCVA 3OJEA 4P4LA 5IN4A 5F1PA 5TSDA 1A4IA 1CF2O 3AFNA 3DR3A 4BMNA 3EHEA 1XIVA 4GQAA 3AJRA 4IDAA 4HX5A 4GVLA 4OYRA 1KC3A 1DC4A 4XQ9A 3AUTA 5A02A 4UEJA 4H15A 1HLDA 2OZPA 3IS3A 1BMDA 1PGQA 2BF7A 3S1LA 2WE7A 4NMHA 4DYDA 4CQMA 2Q4EA 4XJTA 1NR1A 4S3MA 1ID1A 1LDYA 2V7PA 3T7EA 1U8FO 2TMGA 4XB1A 2UYYA 4CUJA 3M1AA 2HCTA 3DZHA 1CRWG 1T2AA 3A4VA 3RFXA 1FDTA 3CE6A 4NIMA 1ISGA 4D43A 3F4LA 1YB4A 1RYEA 3JQGA 3NRCA 3AUSA 4FOOA 4JCOA 2AQHA 2PGJA 4KUEA 5THKA 3MJEA 3OIGA 3GNTA 5L7YA 1MGOA 2ZCUA 3RBVA 1AE1A 1EBUA 3ASVA 3BHIA 4NG5A 3ZV3A 5L4LA 1YH3A 1MLDA 2VNSA 2ZQYA 1CETA 1QLHA 4I9HA 4MINA 4FSHA 4YWJA 1N5DA 1YDEA 2PLAA 5EIOA 2BHLA 3MWEB 2C2XA 1H6DA 2Z1MA 2HQ1A 1E3LA 4FD3A 4QX6A 4BOYA 5ES3A 1PJ2A 4BHTA 4CM4B 4EUFA 2CVOA 4HP8A 2FZWA 4L0QA 3MJSA 3IC5A 4XQGA 5KJFA 1NPYA 2RAFA 1EMDA 4KP7A 3VPSA 3QJ5A 2X22A 4YQYA 3IKVA 5L95A 3KUXA 1B14A 1Z74A 3BHJA 3I9MA 4E0BA 3ZGYA 4ZGWA 3H3FA 2ZTVA 4ND4A 4BQRA 5FI5A 3DMYA 1WMAA 2QZZA 2WJPA 3FPLA 3LC2O 1KEPA 3I9OA 4JXKA 1DFGA 4OKNA 2GUGA 3VVCA 5TRTA 2NVUB 3WYCA 2Q4BA 4MVJF 3FN4A 3O26A 3OIDA 1BGVA 1H5QA 2FMUA 2O3SA 2YHUA 4YT8A 3DOJA 3GRKA 3FTNA 5EERA 3I9LA 1ONNA 5JCJD 5JC8A 5JO9A 1H6BA 4YQZA 4ZU3A 1AN9A 1MP0A 3FWZA 1IPFA 5A4DA 4RPGA 1FK8A 2AEFA 2DM6A 3Q1LA 1LNQA 5FYDA 2NWQA 3JD4A 4GLOA 4NQZA 5DCYA 1H6CA 3JV7A 1X0VA 4JLWA 5GZ1A 3WNVA 3ZWWA 4E2WA 3HB4X 3TNLA 3ZHZA 4CMIA 2DBRA 1SO8A 3MCVA 2HK9A 1XELA 4PVDA 3FR7A 2H5LA 1T2CA 2VUUA 3DBLA 1U3TA 4IQ8A 1BVRA 3EYWA 5AQ1A 4BGUA 3NTOA 1MA0A 3PWSA 1E7QA 1JVBA 1PQPA 3JQBC 4CPDA 1E7RA 1YL5A 3AY6A 3CMCO 4ZRNA 2YQ5A 1P1IA 3BMNB 3DFZA 3PJFA 4WUVA 1U5AA 3E18A 2BI7A 3CZMA 3FR8A 4E5PA 4XQCA 4KUHA 5TS3A 4RCVA 1EE9A 4PCVA 4N5MA 2E37A 3QWAA 1EDZA 1UXHA 1BXZA 1T25A 1GFSA 2IZ1A 1X15A 3WB9A 2A92A 2HJSA 1I24A 4H7PA 4RO0A 1ZSVA 2EP5A 2YV1A 1LSSA 1UXGA 3F3SA 1BG6A 2IE0A 3JQ8B 4LK3A 5A06A 2D5CA 4KUGA 3GN1A 1PWXA 3DBHA 5BSFA 8LDHA 1GADO 4YJHB 4QSMA 3KSZO 3WGGA 2IRWA 2X5JO 3I83A 3K2EA 4OAQA 4WLVA 1VL8A 1YKFA 2RH4A 4WLNA 4WLOA 4B7CA 2G76A 4BV8A 2Q49A 1VLLA 2Q2WA 4TZKA 1H2HA 3T4EA 1N9GB 5T8KA 2E48A 3ZWOA 4W9NA 1Q7GA 1PIWA 3WS7A 3F1KA 5GMOA 4K9DA 1WP4A 4FFRA 3ANMA 2D1YA 1LC0A 2P2SA 4KDEA 4FJ0A 5L7TA 3HJAA 4OH1A 4D41A 1VKOA 4FC7A 4K6CA 5CG2A 3OIFA 2NSDA 4GX0A 3RI3A 4RPHA 4Y98A 3I52A 4FB5A 1LDBA 3BZUA 4FFMA 1BDBA 4A27A 3OJ0A 1GAEO 1VM6A 2YDYA 1V3UA 2DTEA 1E7WA 1BW9B 1E92A 1ENPA 5IFLA 3LF1A 4RQUA 4E5KA 2ZYGA 3RC2A 1PGJA 4NBTA 4WOKA 1BXGA 2J5RA 1EFKA 3P2YA 3WWYA 3WIDA 3WNQA 3E1KA 1SBYA 3ZWBA 3FRJA 4J9UE 4IQ0A 3LT1A 4FJ1A 1W73A 1EQ2A 1PJBA 4BO5A 1C1DA 1BDMA 2J3HA 2DKNA 4RF3A 4FGSA 5EQDA 2Y1OA 1F17A 3C7CB 5I8ZA 4TROA 1GYPA 1PJLA 2OGUA 2VRCD 3GEGA 4UVEA 5DDIP 3BMCA 5IXYA 2NNLD 3B1FA 2EGHA 3P5SA 1HZJA 1GU7A 4PZDA 5L3ZA 3AOEA 3INGA 2WDZA 5JYEA 4Q3AA 1Y8RB 3NT4A 2CF6A 2FPGA 3D4NA 3JQ6A 1UAYA 5KIAA 5A1TA 2X0JA 5CDGA 3P2OA 1ZFNA 4OSPA 4URFA 1TEHA 2FN7A 2Y05A 1FDVA 1O8CA 1XR3A 2EXXA 2PWZA 1MG0A 1KOLA 1Q0HA 2AA3A 3TZCA 4D44A 4PIVA 5K6AC 3C3XA 4L74A 1L7EA 1P1FA 4EYEA 4GX5A 1Z75A 1NHGA 1DDOA 2FY8A 1N7HA 1TLTA 4A03A 4LN1A 2VT2A 4U6SA 5H83A 4CL3A 4FPXA 1J5PA 1IHYA 5CHEA 1HSOA 2E4AA 1HL3A 1XSEA 2P68A 2X0RA 1Y81A 3JQFC 2GASA 4CR6A 2AW5A 1WMBA 2SCUA 3PJGA 3PK0A 3W4KA 5HBRA 2JD2A 2YQ4A 3E9MA 1UUFA 1NVGA 5DULA 4GX1A 3ZNQA 4ALNA 4AJLA 3WLEA 2IYOA 4H3VA 1YBVA 5JDCC 1LLCA 4Y6SA 3ANLA 3GC6A 4WASA 3DOOA 1I8TA 4EZBA 1P0CA 4IXWA 1E0DA 4BUCA 5IF3A 4QFCA 4R69A 2DPHA 1E5LA 1NVTA 2GDZA 4LSMA 5C3MA 3H3JA 3LK7A 3MOGA 4NZ9A 2DU8A 4YXFA 3WGZA 1ZXBA 2F1KA 4CQMB 4DYVA 5C7OO 1DJNA 1T2DA 3GN2A 4P22A 3D64A 1VSUA 2ZB7A 4OO3A 2X9NA 3ZHYA 1GUZA 4P4NA 2YDXA 2J5QA 1JU9A 3GDOA 5TX7A 3L9WA 3WWZA 3MJ4A 5HS4A 1E7MA 3VH1A 2NQ8A 1PL7A 2X7HA 2ET6A 3E03A 4B7XA 4DC1A 4ESOA 4MIEA 2R00C 3C1TA 1QXSA 1MXFA 1FXSA 4E32A 1F0YA 2HK8A 1Q7CA 2LDBA 2WYVA 3RUCA 3RROA 4UAGA 2JCXA 4DC0A 2EKPA 4OHUA 5L40A 4GKBA 4PG4A 3AU8A 1EQUA 4MOWA 2QG4A 2EJWA 2Q1SA 1ISJA 3WG9A 4BGIA 3INRA 2AE2A 3G49A 3OETA 1QYWA 4RF5A 4XYMA 5CP8A 4B7UA 3HSKA 2QX7A 2GYYA 4OIMA 3HN7A 5EMHA 3Q6IA 1YONA 3MTGA 1ML3A 4EUHA 1XEAA 4KTVE 4HFMA 1JLLA 1JVSA 3AI3A 4PLGA 2ZB3A 1RM0A 4IZHA 1BXKA 4KDFA 5GZ6A 1U5CA 1UH5A 4R01A 1MV8A 1YQGA 1DRVA 4G5HA 1E7SA 3KB6A 4EITA 1NTOA 4L8VA 1DLJA 2AXQA 3HDYA 1F06A 4IDCA 3M2PA 3JSAA 3UCFA 2CSUA 2BH9A 5EESA 2O7QA 2R2GA 3PQDA 3K73O 3NAQA 4LGVA 3TFOA 5IDYA 1D1SA 3OP4A 4CM4A 4IUYA 3L4SO 2Y93A 3KV3O 3RQSA 1NQ5A 3WGOA 2BGKA 3ZV5A 4YTEA 2X0IA 2XOXA 4PLYA 1SZJG 1ISHA 4BQPA 2DFVA 3ZWCA 5B1YA 1PZGA 4OMUA 1R0SA 3CXRA 2XAAA 4UVGA 4Y9DA 2C07A 2PKRA 2WEKA 4HFNA 5BSEA 1E6WA 2O4UX 4ALKA 2PTGA 1R4MB 3CINA 3FBGA 2C5AA 4CR7A 1EEHA 4HXYA 3R3SA 1GQQA 1UP6A 3HZZA 2VYVA 5JAZA 5JNLA 5DN9A 4EEZA 5CDSA 2JKVA 1W6UA 1Y6JA 2DT5A 1I2ZA 1YOVA 4XGIA 1VPDA 3VZSA 3DZBA 4LSWA 3AUAA 5EN4A 5JDIA 3GUCA 3LT2A 5JAQA 2FOIA 3E6AA 1WVGA 5A04A 4WK6A 3PJDA 4C7JA 4R9RA 1ZSYA 4MVJA 3UF0A 3ZU3A 1ENZA 4ONEA 5U1PA 1CDOA 2X8LA 3CZRA 5L4SA 2HMTA 3H2SA 1WNTA 1UJMA 1HDZA 3JYNA 4JNKA 2OOSA 3UCEA 5F5LA 4PLVA 3FSRA 3D4OA 1DAPA 1O6ZA 1XLTA 2ZQZA 2EERA 5JE8A 1WPQA 3U4DA 5IZ4A 4IINA 3OH8A 3PGXA 3KM0A 1O94A 1E3WB 2YZ7A 2GRAA 2P4QA 1NR7A 3DBHB 4TKMA 4E2ZA 2PZJA 2I3AA 4OXYA 2VTEA 4UVHA 2GR9A 5THQA 4CMEA 1XGKA 3DZJA 3DMTA 1KY4A 3FNEA 3GG9A 3GZ4A 1U28A 3BTSA 1SB8A 1UZMA 4PZCA 3PDUA 2OMEA 3JYOA 4TSKA 2O48X 4R51A 4BL5A 2BGMA 3WSWA 2ZJ1A 2YJZA 3OA2A 1P44A 3AI2A 1PQWA 1MX3A 3K8ZA 3RKUA 3CIFA 2GF2A 4G81A 3TOZA 4CLHA 3JQ7A 3JQ8A 1AUPA 3UGKA 4LISA 3VTZA 4YVFA 2QHXA 3WX0A 1JKJA 3EZYA 3Q9NA 4J7XA 4HY3A 2DFDA 1WAMA 4AJPA 1M66A 1YRLA 4RDIA 4YYZA 1ZK4A 3JQ9A 1H9BA 1ULSA 2B37A 4BB5A 2X58A 3QWFA 2YFHA 4FIZA 3TL2A 3FBTA 1T26A 4K28A 3GFGA 1RPNA 4U0KA 1W4ZA 2I65A 1J6UA 2EKQA 4R5MA 5L4NA 1BXGB 1HT0A 1LDNA 3DZIA 5DF1A 1WLYA 2PD6A 3WOHA 4L75A 3RWBA 4TKLA 4Y67A 1NVMB 3PHJA 4CMKA 5CEFA 4IDFA 2BMAA 4QQRA 1VC2A 1IOLA 3ROPA 4CQLA 5IXSA 3WXBA 1C1DB 3IJRA 2OP1A 3PHLA 2C0CA 4PLFA 3NYWA 3ONDA 2HAEA 4YEDA 2JFGA 3E48A 3JQAD 1EVIA 1B16A 1EUCA 3S2FA 3LYLA 3G0OA 1YBMA 3BMCB 3DZGA 4FJ2A 2VN8A 1HE3A 2C2YA 2IDZA 4BO1A 1K6XA 4WCFC 4JROA 4NFSA 3CSDA 1ZK3A 5JSFA 5G2OA 2AQ8A 1B0AA 4RJTA 3T7CA 5TIIA 3TFQA 1EUDA 2O50A 2X0NA 3GLQA 4J7CA 3TF5A 1YVEI 1B8UA 2I9PA 1EUZA 1XCBA 1I5RA 1DB3A 1S6YA 2D3TA 2P5UA 1XYGA 2DTXA 2A35A 3JYQA 4IDEA 5I7EA 4B3IA 4PG8A 4GGPA 1LEHA 1E77A 3U4IA 3RKRA 4TMFA 3ENNA 2HUNA 4OL9A 4MVJE 1NPDA 4ILKA 4A7PA 4CLDA 3UKOA 4XGKA 2BFMA 3ZW8A 2JJYA 4CLRA 5U4QA 5A9SB 3HHPA 3QIVA 2DQ4A 5EJ2A 1GD1O 2E49A 2OUIA 3GVHA 4Z3DA 5JY6A 3U9LA 4BNUA 5JBIA 2VQ3A 4R3NA 3V1TC 3EZLA 4AJEA 1ZJZA 3U62A 4IIUA 4F3YA 2BFOA 1C0PA 2O3QA 1KBZA 1K6JA 1WDLA 4PGFA 1Z45A 4WE3A 4WLFA 4YB8A 4I5FA 4B8WA 4DMLA 3KSDO 2PH5A 3ZNOA 5JW6A 4MVJP 1HYHA 1Y8QA 5CDTA 1LSOA 1PJ3A 3I6IA 1A9YA 3IP1A 4BNZA 3HE3A 3UW3A 1E5QA 3V2GA 1K6IA 4BNNA 2IYPA 3LLSA 3PJEA 4JBIA 4MKZA 4I9UA 5G0TA 4L9RA 3ZWNA 1PR3A 2EP7A 3I3OA 5A5FA 1JW9B 1X1EA 2Q45A 2VNAA 4B3JA 2JD1A 1PR9A 2HMVA 1X0XA 2DBQA 1F12A 2VHZA 3LC7O 3GPIA 2WYWA 4Q3CA 4JN6B 1ENYA 2NU7A 1V35A 2WMDA 2AQKA 4O1MA 2HMWA 3ST7A 3NDIA 2X5OA 3KRTA 3JTMA 1C14A 4CM9D 5GZ3A 2B36A 1Y5MA 3ONEA 5COQA 5TJ9A 2OXIA 3UFXA 2O7SA 5F21A 5A05A 2NU6A 3OECA 1CIVA 1LRJA 2WWRA 3D7LA 3LU1A 3PVZA 4RVHA 4N5LA 2QQ5A 1QYVA 3HDQA 3TZKA 1LX6A 1N1GA 2C59A 1LDEA 1Y9AA 4GWGA 4U0JA 3ZU5A 5KJ1A 4I5GA 2I76A 4L4RA 4M49A 3CKYA 3MTJA 3SC6A 4E12A 4EJ6A 4A5OA 4LMRA 5KWEA 3ETGA 3L6DA 4YJFA 5TNXA 5A3VA 1XHLA 4RVUA 1ZSNA 2VHXA 4GWKA 4NR0A 3G79A 4QO7A 4WLUA 3B20A 3LZ6A 2PY6A 2AEJA 3IOYA 5JFOA 4YRBA 1VL0A 5CFZA 4GPD1 1LBEA 3OQ6A 2CF5A 4IDDA 2O3JA 4G65A 3DTYA 1ZO8A 4RVFA 4XD2A 1Y9EA 5G4KB 4YCAA 1IZ0A 3ZH2A 3WSVA 3FNFA 1DIAA 3RIHA 4UULA 3IKTA 2LDXA 3K2BA 4BO8A 4IPTA 2BGLA 4LRSB 1MFPA 1YXMA 4WKGA 3PDJA 4J1TA 2J6IA 2O3RA 1HTBA 4IBOA 3KYCA 1BSVA 3OQ1A 1NHWA 3V1UA 3DAPA 2JFHA 4W4TA 4QXMA 3JD2A 4BGVA 1E3SA 3A14A 4TQGA 4CV1A 2VYND 1HDGO 4WOJA 1E6EA 1QP8A 2B5WA 3E5RA 5JAIA 3PWKA 5LDGA 3F5SA 4PZEA 3W8DA 3NV9A 5GY7A 4PN3A 2ZTUA 4R1UA 3A28A 2FRDA 3D5QA 1YOVB 3Q11A 4FFOA 5FWNA 4P38A 3I23A 3PZRA 4NK5A 4PRKA 1U3VA 4AG3A 4BO6A 1UAGA 1E1KA 1ZKMA 5COBA 1DC3A 2A94A 3GH3A 3BTUA 3OA0A 1R4MA 3E9QA 1H94A 4Z0PA 1I01A 4OXKA 2VUSA 2RHRA 2VZ0A 4MIYA 3A06A 2POQX 3AK4A 2FR8A 1G1AA 1UXIA 2E82A 3MJTA 3RFTA 4GH5A 2I3GA 1PU2A 3NT5A 4MKXA 2ZJ0A 3GHYA 4BO4A 5KTKA 2NTVA 2AG5A 4ZQFA 2DVMA 5I7VA 4UVIA 1PTJA 1V0JA 4DPKA 1H0KA 2RH8A 4MO2A 8ADHA 4QFDA 1HWYA 2Q3EA 4J0EA 4XZ3A 3JQDA 1N2SA 2BRUA 3HB5X 5HS6A 1LTHR 3FWNA 4O6VA 3VH4A 3KXDA 2B35A 4HBGA 5B4TA 1I0ZA 1ZVMA 3SVTA 3ONFA 1YL7A 4J4BA 4YRAA 2J5KA 1FDUA 4E13A 1PX0A 2VWQA 1PZFA 3O38A 3GGPA 3JQ7B 2W2LD 4BNXA 1E3WA 2QRLA 1SOVA 3EY4A 1KY5A 3H9UA 4J91A 3AWDA 1ULUA 2AQIA 5KVCA 2Q1WA 4M87A 3UAGA 2VWHA 3NUGA 1D4FA 3ZW9A 5EQFA 5HRUA 1I3LA 3ZHBA 1YL6A 5TF4A 2D59A 2TMDA 4Y8VA 3IDSA 5IZCA 3R3JA 3MEQA 2NUAA 5AYVA 2HRZA 4AJIA 3UH1A 3KYDB 4Q3DA 3MJVA 1JWAB 2PZKA 1QYCA 3DHEA 4A10A 2NTJA 3DB2A 4D3FA 1A7AA 2EG9A 1U7HA 4GI2A 3AOGA 1C3VA 1UP7A 1NQTA 4YT4A 3BAZA 3TN7A 3HFSA 1MC4A 1OC2A 1DIGA 1R4NA 2HRBA 4XWYA 3ZWAA 5AOVA 3DDNA 3H6KA 3PLNA 1CWUA 5MGBA 4Q3BA 4BNGA 4TWRA 4CQLB 1YE3A 5I9MA 5AXDA 3PZBA 1ENOA 1U3WA 3WGQA 4JBGA 3PI7A 4ALJA 4CUKA 4BKQA 6LDHA 4R54A 2HMUA 2NU8A 4W82A 1TT7A 2NQTA 1VJ1A 2NV6A 1M75A 5I7FA 1XKQA 4CM8A 3IMFA 5C37A 2YFQA 3CUKA 4I9NA 4H16A 4WPGA 1JKIA 2WYUA 4U6QA 2G82A 5JXWA 4J3FA 3VPHA 3GVIA 4HWKA 3C7DB 4FS3A 4DPLA 1Z6ZA 5K9ZA 3QVWA 1T4BA 4I8XA 4XRRA 3LT4A 3BIOA 1JDJA 3S2GA 4L4SA 4RVSA 3PIDA 5TJHA 3H9JA 4HNGA 3PYMA 4XX0A 3ZV6A 2B5VA 2QIOA 4W99A 4KMSA 3HDJA 3PLRA 3M2TA 3EW7A 4XJSA 3PP8A 5A03A 1GYQA 2I66A 3HADA 4HADA 4HKTA 4R41A 1SMKA 1WDMA 1T24A 3UUWA 3EK2A 1F8FA 2PGLA 4CLRB 4GLLA 3GNQA 4L76A 4CM5A 1T4DA 2VRBA 1LRLA 4PLTA 1LLQA 1Y1PA 3VH2A 4B4OA 1B3BA 1FMCA 3Q2IA 4DQXA 2IZZA 3O03A 1X7HA 1GZ4A 2UUOA 2ZB4A 4U8GA 4QTZA 4CMJA 4EUEA 4R16A 3WIEA 4W6ZA 4CUZA 1HRDA 1Y8QB 2Y67A 3EUWA 4ND5A 4ND1A 1EK6A 3DOCA 3WQQA 4XDZA 2PH3A 3U49A 1DOHA 4UUPA 1GZ6A 3AM4A 4XR9A 1IULA 4NBRA 5A9SA 3WGHA 3X2FA 1JKFA 3RUFA 4FGWA 4PG7A 4IJVA 3L9XA 2W8ZA 3ABIA 4MKRA 2PFGA 2Q99A 3GF4A 5AXBA 1PGPA 1WWKA 3JYLA 1ZCJA 3MOIA 1T2FA 2EW2A 3RJ9A 1GCUA 3CH6A 2FR0A 5KJEA 2DUUA 1GEEA 1EVJA 3RD5A 3GGGA 4KOAA 3K30A 1Q7BA 3NDJA 1B26A 3VPXA 2PA3A 1OBFO 5BSGA 2D5AA 5DBIA 1KERA 2B4QA 2OFPA 3STHA 4Q9NA 4F6CA 1XQ6A 1N8KA 1TVEA 4YBZA 3NJ4A 3I4CA 4RQTA 1UDCA 4K6FA 1PZHA 3SJ7A 1P1KA 4YA6A 1X7DA 1IYZA 1HDRA 1YB5A 3C24A 4AL4A 3GPDG 2Y1CA 3S2EA 4EI2A 3E82A 3P7MA 2BFPA 1B3RA 5DP1A 1FJHA 1GL3A 2EHDA 1NFQA 3CTMA 3RBXA 4OM8A 3SJUA 2C54A 1VJ0A 2WTBA 4DBVO 2BKAA 4YJFB 3ZDFA 4Z3KA 1P33A 4MVJD 4CM3A 2G17A 4GMFA 2IODA 4MVJI 4JP2A 4N54A 1VJTA 1HE4A 3PRJA 4BMVA 1DIHA 3H2ZA 4XYEA 4YAIA 3M6IA 3F6YA 3WBBA 2NVWA 3KBOA 2PNFA 4AICA 4CODB 4YRDA 3V2UA 3IL2A 3EDMA 1RM4A 1ZK2A 4OQZA 4MJLA 2GZ1A 2VRCA 2ZATA 3IP3A 1CQIA 4M89A 5I8WA 5IDXA 4GSLA 4LCEA 2HMSA 3E5MA 3V2HA 1R6DA 2DAPA 4OXNA 1ZZEA 1LU9A 1LI4A 3NEPX 5H81A 5T8KC 1I3NA 3C1AA 5F3RA 4N5NA 4F6LA 4W9NC 1KYQA 4E21A 1MG5A 3TZQA 4CM1A 1LJ8A 3FTPA 1Z7BA 1IZ9A 2O2SA 4JJIA 3KYCB 3SXPA 1E1NA 5ER9A 3V8BA 4BMSA 4P8RA 3PHGA 1NPTO 4RZHA 4IIVA 1DBVO 1TT5B 2HU2A 1IUKA 4MIOA 4AJOA 3GZNA 5G4KA 3TL3A 3F5QA 2RHCA 2JFFA 2V65A 4FFLA 7MDHA 1C1XA 4KZPA 1NWCA 4WEOA 4M1QA 3RUEA 1QORA 3OEYA 4XB2A 3TQHA 3KOUA 2NTNA 4LRTB 1LA2A 4JX8A 1IPEA 1MXHA 4GKVA 1I3KA 3OHSX 1OMOA 1ADBA 2D8AA 4GAEA 4RPLA 3JD1A 3WMWA 4BNHA 1N1EA 3WGTA 4CV0A 4WNCA 4E5YA 2VHYA 4II2A 2CDBA 5KVVA 1SC6A 1DLIA 5ENVA 1P1HA 2VOJA 3H9EO 2Y0EA 1O9BA 3WR5A 3FF4A 3RUHA 3W8FA 3DBRA 4E30A 7ADHA 1A7KA 3LT0A 3VKVA 4WGGA 2FPPA 3ROQA 1PJ4A 4A73A 3U09A 3S8MA 5KJCA 4D46A 5BSHA 3V1YA 2C29D 4TVBA 3HQ4O 1ADFA 4R9SA 3WJ7A 1VSVA 3AOEC 1Z73A 3RCBA 2HKIA 3W1VA 4BKRA 3QV1A 2I6TA 5F1KA 1YDWA 3OJOA 1ZNQO 3RBZA 1P45A 4B4VA 1IE3A 4QEDA 3ON5A 4J2HA 1RM5A 5LC1A 3K6JA 3Q2KA 4BNIA 1EVYA 1NNUA 4CM6A 1T2EA 3KLPX 1B7GO 3PTZA 4E31A 3ETEA 3TRIA 1GQYA 2V6MA 2W4QA 3CPSA 4KTTE 1NFRA 4UUOA 2V6BA 3DQPA 1E6UA 3L6EA 5F1OA 1NM5A 3ZWVA 1OZAA 4RORA 4DPMA 2CNBA 2IZ0A 2Q1TA 4I1IA 3BYZA 4NJMB 3RC7A 4A2CA 2AE1A 3HG7A 3KTDA 1YJQA 3GR6A 3LF2A 3OEWA 5G0WA 4OQYA 4BO0A 1HKUA 5CDYA 5KJ6A 5EPOA 1D1TA 2CVZA 1SNYA 4UVDA 1E3EA 2YUTA 3CEAA 3OICA 3OJLA 5KOIA 4AFNA 4UUNA 1V3TA 4PLCA 4N18A 1PL8A 1I3MA 5TT0A 4MP8A 2FSVA 1EE2A 1C0LA 2FZEA 3L0DA 5I9LA 1W8DA 3R6DA 3ZWYA 1DFIA 1R4NB 4FC6A 3WQRA 2VWPA 4D42A 3I5MA 1U2GA 3GHHA 3ENKA 2NM0A 3LDHA 1F14A 4DLBA 3EVTA 1I2BA 4CMAA 3ORFA 1I2CA 3MJCA 1R66A 2IEBA 4DA9A 5HA5A 2GZ3A 2UUPA 3L77A 1TA4A 2PK3A 3QP9A 5KVQA 3KYDA 1D8AA 3TOXA 4ZQHA 4QT0A 2EGGA 5JC1A 5A3JA 5C7LO 1EDOA 1SEVA 4KQWA 4LVCA 4IGFA 4J0FA 5KCZA 3KZVA 2WD7A 3U4CA 4CM8B 3ICPA 5TT1A 5JY1A 1QSGA 1BRMA 2D4AA 2X4GA 3M1LA 1NAIA 1UDBA 3N58A 2HLPA 3UN1A 3U4HA 2P9CA 2YW9A 4O63O 2ZYAA 1ZMOA 3I9NA 3ZNPA 1JQBA 1BWSA 3HN2A 1HETA 4FN4A 2AEMA 4YAJA 1WXDA 5AVOA 1NFFA 5BNIA 4ZVVA 4CQMD 4J49A 1XWFA 3VDRA 3GOHA 2GN9A 4M54A 4NHEA 1ZK1A 4NU6A 3ZWXA 4ZQEA 2F00A 3G1TA 2OHXA 2YHIA 4WECA 4LCJA 4DLLA 4BB6A 3WDSA 3VZPA 3FPCA 1M67A 4IMRA 4DIBA 5DBGA 2VTDA 3QVSA 4BNVA 3SX2A 1P9LA 4MP6A 4BGEA 3AW9A 1NQAO 1NAHA 5DZSA 2AG8A 4ALIA 3HUDA 1PS0A 4IZIA 1EVZA 1I10A 3L4BC 3OBBA 3QWBA 3RC9A 3VKUA 1TB4A 2B4TO 4PVCA 4E2XA 1WDKA 1RYDA 1B8PA 2VZ8A 4OSOA 1DO8A 2B4RO 1PL6A 4CMBA 4BV9A 1KEVA 2DC1A 5JMWA 3WYEA 2Y1DA 3AFMA 2CFCA 2CUKA 2EIHA 4S1VA 1DRWA 4DIOA 1P3DA 5A9RA 2Y68A 5J23A 4ZHSA 4ZA2A 1PGOA 5CPFA 2P9GA 3RVDA 4N7RA 3OFSA 4FR5A 2YV2A 3PFWO 4WNIA 5AXCA 3WYBA 3O9ZA 4ND2A 5IDWA 3JQBA 1ZMTA 3PXXA 1DJQA 1AHIA 5TQVA 4BO2A 3DZKA 4XQEA 1J0XO 3Q9UA 3S2IA 3QA9A 4RL6A 5IDQA 2VHVA 3DC2A 3VZRA 3ZWPA 2JCYA 1HDYA 3B6ZA 5C5IA 2ZK7A 1WZEA 1I33A 4PFJA 1IHXA 3VC7A 2WSBA 5CG1A 2J3KA 1QR6A 2Y1FA 4GGOA 1GEGA 2XF8A 3ZWMA 4EBFA 4Z6KA 4IQGA 4BNJA 4C4OA 4CLEA 4CV2A 5HWSA 5JDIC 2Y1GA 3H5AA 4HV4A 1R0KA 4JJGA 2I5PO 1G0OA 2PD3A 1SB9A 4LW8A 4W7IA 5DOVA 4D79A 4PG5A 3EVNA 1ZIDA 1SOWA 3Q3CA 4J9VA 5BT9A 4BNKA 1A72A 4NNJA 4M55A 2EW8A 1GCOA 4M8SA 2ZB8A 3DTTA 2X9GA 3GG2A 3TDKA 3W6UA 4JQCA 1K89A 5ITWA 1SEPA 2GGSA 5CEJA 4AJ1A 2EEZA 6ADHA 3BXXA 3DWFA 2PR2A 2X86A 3GT0A 1EBFA 3LC1O 1I32A 3W6ZA 1NASA 4OJNA 4RLSA 1PWZA 4BO7A 5G4LA 4CMGA 3B1JA 4DWVA 2BI8A 3KEOA 4CMEC 3D4PA 2NU9A 5DBFA 3JQAA 4BVAA 3JQCA 3DFUA 5COAA 3DMTC 1ZUD1 5HTOA 1U8XX 2GO1A 3ADPA 4D45A 1OOEA 4YACA 1T1SA 1C0IA 2Z95A 1E1LA 4YDRA 1YB1A 1N92A 4UEKA 4AJJA 3AI1A 1YQDA 2AHRA 3LLVA 4D7AA 5CEEA 1MB4A 5IAAA 2DBVO 4O59O 1HLPA 3AU9A 3DZFA 3LSYA 5KNLA 3UVEA 3RC1A 2HK7A 3RFVA 3TWOA 3FNHA 3N7UA 2PKQP 3JCZA 3H9GA 3QLJA 4WCFB 2Y1EA 2FHSA 5B4UA 3HWRA 4FOSA 4U7WA 5DOZA 3W4IA 3A9WA 1QRRA 3ULKA 1NXQA 4BO9A 1HEUA 3HFGA 4BNLA 2D2IA 5BNTA 4KWIA 3JQ9C 2G1UA 3PHHA 1Y5RA 3GGOA 1LQTA 1DAOA 1O0SA 3GZNB 4HFJA 2A9FA 5CPBA 1A5ZA 1CYDA 4OOFA 1MFZA 1C1XB 2QW8A 1CERA 1I30A 4J90A 2B83A 1K2WA 3HNPA 1JTVA 2O3TA 2W90A 3I6QA 5EINA 5T6BA 1FDSA 5DCUA 4FDAA 1H6AA 3E9NA 2H1SA 3BHMA 2XXBA 2X6TA 2GN4A 4J7UA 4EJMA 2ZKLA 5BNFA 2BLLA 4IJWA 4CR8A 4DQUA 3RAJA 2RIRA 3ZCXA 1K3TA 4UUMA 2FR1A 4PG6A 1V3VA 2WE8A 3H5RA 1SPXA 1Q2XA 3G3EA 1KETA 1TT5A 2IXBA 1ISFA 1LSUA 1RKXA 1AGNA 3DBRB 4MVJH 2CZCA 4DBZA 3VTFA 4BNTA 1LLDA 2VOEA 1PJCA 1ADCA 4J1NA 2J3IA 5ICSA 1DIBA 3NT2A 1HF3A 5K6AA 2WD8A 3L6OO 3DEYX 1PGNA 3ITKA 3DHNA 4C7KA 5DP2A 2W2KA 4G2NA 4TZTA 3QE3A 4NBUA 3I9JA 4ROSA 4EEXA 2QYSA 5I7SA 4FCCA 3KEQA 3L07A 1XU9A 4CV3A 1GDHA 2CDCA 2CD9A 3K5PA 4J43A 2JHGA 3WJAA 4ZQGA 1OAAA 4D3DA 3Q0EA 4O5OA 1ZJYA 3NGXA 4BKOA 3JQFA 3WTBA 1KVTA 3TZHA 3ZZNA 3E8XA 3GEDA 1KVQA 1V6AA 1QMGA 4CM9A 3FD8A 5ILOA 4GX2A 5JDCA 1LXCA 5B12A 3C85A 3WFJA 2GZ2A 1JAYA 2Q2VA 2Q2QA 3UOGA 2Q46A 5TC4A 3B70A 4E5NA 4CL8A 1LDGA 1SAYA 3C8MA 4YT2A 1P74A 4RF2A 3FNGA 1GV1A 3KSUA 3NTRA 1HXHA 3R1IA 3UICA 4M86A 4MVJM 1OI7A 1NYTA 1LRKA 1O89A 4LVUA 3MWDB 1UXKA 3U5TA 1JWBB 1YBAA 3QWIA 5BR7A 3P19A 1DFHA 4CMHA 1P77A 2R00A 4QUKA 3AM5A 3K96A 3F47A 1QV7A 1L7DA 2HJRA 4BNMA 4E6PA 3IUSA 4QO8A 4I5EA 3D0OA 4BNYA 3IUPA 2EV9A 3D3WA 1P1JA 3SC4A 1E3JA 4NJMA 2HO5A 1H9AA
chains in the Genus database with same CATH superfamily
3GOQA 4PXAA 4IMPA 3OJWA 4B48A 2ODPA 2AVDA 1HDOA 3C4QA 1CDDA 2JPDA 5KYGA 2D7DA 4O4JF 4QLBA 4ENQA 2WWHA 3NM6B 3T5CA 1VIMA 4ZDWA 5ES4B 1RZRD 2H29A 2PL3A 4R2JA 1JFFA 5BW8A 2P4EA 1N2ZA 4Z9YA 1RE0A 3RRXA 4FKMA 4PSKA 1Q95A 2FN9A 4MQEA 3M6LA 1SUPA 1YJ8A 3OMLA 3DO5A 2DFLA 3HI6A 3P9YA 3QENA 4D4IA 3LHKA 2WD7B 2I22A 4RF4A 2QUKA 2WAMA 3C4JA 4GBJA 3DV2A 1KE2A 5EG5A 3RV4A 3ZJ5A 4DSAA 4CEJB 2BZGA 1IQPA 1PT9A 2J1LA 4MGHA 5HQJA 3SX4A 3KOOA 3UHPA 4CJXA 3UAYA 5ADVA 4AJKA 1QFYA 1O5TA 5DCWA 4KXXA 4DLNA 3VZQA 4RXMA 4ZMSA 2XCLA 3PXEA 3CPJB 3KT8A 4YIKA 1KNQA 3UHFA 1N5IA 4XYGA 1LTKA 5KREA 2XUDA 1C3LA 3IVXA 1YDFA 2Z3VA 2AG1A 2Q6OA 3ZKAA 5F9MA 4KPGA 1Q44A 3PCTA 3VSDA 4AK9A 2VYNA 1KS9A 1M3SA 5ESDA 2Z8XA 5JQGA 4ZVOA 1XU7A 2O2ZA 1EZ1A 3QELA 4AF8A 9LDBA 1N32B 5JCJA 3UAZA 2GF0A 5EJGA 1UJCA 3ORYA 1YZYA 5DTJA 4Q39A 1WSAA 1PT8A 4FZ3A 4ZP1A 5HM6A 5BVGB 1TZ2A 3U7GA 4IZOA 1IQ0A 4PANA 3F4BA 4CIXA 3W5JA 5KKCA 1KQ3A 5K8IA 3UXYA 1E1RD 2K87A 3TBHA 3VV2A 1KR5A 4DBLE 3PHCA 4MGZR 4NPAA 1V7QA 3E58A 5BN4A 3K1JA 3PWZA 4KQGA 4TT8A 5D3ZA 3N0WA 1GPDG 2CWWA 3G5TA 1BOFA 1T3LA 4GE3A 3SYRA 3H19A 4M1OA 3ZU2A 3EB9A 5KNBA 4KO3S 1WZ2A 1JR2A 4IIBA 2ZQ5A 4PLPA 5AKYA 4B33A 3MGGA 3CUVA 3H2HA 2ATIA 5L9AA 2BELA 2QROA 4EHNA 4FZ5A 1QG6A 1V5GA 1P2FA 5L51A 1IHOA 4ZZ3A 3ZD6A 3G2NA 5IAEA 4Q9DA 3TPCA 2FPIB 3CMMA 4CDGA 3MIIA 5TXGA 2W4MA 1V7ZA 4BKUA 1AHHA 3PQFA 4IO0A 1R3UA 1TQDA 1IBSA 1S2NA 4RD1A 1SPBS 4LWZA 5DLDA 2FZLA 1E64A 1ISMA 4PHFA 5DTQA 2R6ZA 1JXOA 1PS8A 4XE5A 3HCPA 1G38A 3KS9A 4YT5A 1ZBQA 2MHCA 4Z4QA 2NO6A 2XWBF 3FHOA 3MTIA 4Q05A 1UMDB 3C6MA 1RDFA 3MRVA 4QUJA 1ZLYA 3M4JA 3O4RA 4IGEA 1PLKA 3LQKA 4OREX 1E6LA 3TR0A 5JPIA 5E1DA 2CXTA 2HJWA 2O1EA 5KI6A 3D5TA 3JD3A 1A9PA 4FCWA 2GN6A 1CEXA 2O8VA 2Z2IA 3H7AA 4IJ5A 4IV5A 4YLEA 3SEFA 1OX4B 1U3CA 4YAOA 1P8AA 4X41A 4U1RA 2WPDD 2J0QA 5FJJA 4B3MB 2XGSA 1L4UA 2R2AA 4DL9A 2R8PA 4FBGA 3L8MA 2RGNC 4V0KA 2K6GA 3TS1A 1MUUA 2QNRA 3AI7A 1ECFA 3QXSA 1U3UA 1GR1A 1NWHA 2FRDC 4MPRA 1C9EA 4RJLA 2BGUA 3IUQA 2FN3A 3P27A 3N3BC 4X3CA 4BUJA 4WBNB 1QP4A 4FXOA 4RKWA 3O4GA 4KHZA 5A0VA 1WVIA 5I4CA 1V8PA 5FPHA 1RQGA 5H82A 1NUUA 1YZLA 3KKQA 2QSJA 1O95A 3P97A 3T8YA 4A82A 3AKEA 5EOVA 3JATA 3ZH9B 3ZK7A 3C3YA 4GSYA 4QYIA 4DDMA 4L08A 1HYEA 1W47A 1TOAA 1NOJA 1R0LA 5DGIA 1YQ9A 4D0SA 2DYKA 1JG6A 3F5MA 2PZEA 2ZUWA 1S1MA 4P7GA 2WB2A 4ZAWA 5ADHA 3TLXA 1NRXA 3TGWA 3ZBUA 5BUZA 3N70A 2C04A 1W36C 4BXOA 2CMDA 3L84A 3X1XA 4YV0A 9LDTA 4JJ4A 2I4LA 1YK0A 5EUBA 3VZCA 3D4LA 1ESMA 3ZZMA 3VJMA 2VYVD 1KQFA 3DXFA 4ZDIA 4IFTA 1W1IA 2GZSA 2JJ2D 1C4WA 4ID3A 1BCSB 5DISB 3T7RA 4EUKA 4QVKA 3MFYA 2C7VA 3DT8A 3O73A 4TV9A 3ZU4A 3VAZA 5F51A 1OYYA 1T8UA 2BRUC 1LQUA 4TVOA 4B8YA 1CVRA 1S9HA 1BA2A 3PGJA 4XYBA 5DHPA 1NBWB 3K1YA 4I50A 2QLTA 2IUTA 4WUTA 4B3HA 2ZSAA 1UM8A 4C87A 5I4IA 2RGYA 1IN7A 4WLEA 4D4GA 1A2QA 1RWQA 4LOLA 3U7IA 2CBZA 2LKDA 2O23A 2NO7A 2W6PA 2JGIA 2GFQA 4CL0A 4B6GA 2I03A 1JDPA 4NPCA 2DGDA 3GD5A 2AFHE 3PGA1 4BMOB 4UE2A 4EY6A 2C3OA 1F4LA 2W11A 3JQGB 4ZODA 4HT3B 2UZ4A 3ZG6A 1EGMB 2Q3BA 4R8SA 1N7GA 1O94D 2NZJA 4LX0A 2C8JA 2VJLA 4YJ3F 1U9IA 4DHWA 1MOQA 4FYPA 3O4FA 4A0QA 1MZVA 1PR4A 1W5BA 1WCV1 3SN6A 3SY8A 3FPKA 3P0JA 1X7YA 3NLLA 4JP8A 2VPIA 4E4YA 1Z5ZA 5LNK1 2R6HA 2ASEA 4MW9A 1X9HA 1WQ1R 1N33B 3BTVA 4WXHA 5IKEA 2XCQA 1AM4D 2RHBA 1U7XA 4HO1X 4Y1RB 4GPEA 4MGYR 5CNMA 5TE9A 3MWLA 3F1LA 1TJ5A 1CULC 1XCPA 2C83A 2QXUA 2XV1A 3W8EA 3LBHA 3OZWA 2PS0A 3IQFA 4RPJA 1P80A 1NF2A 2FWAA 2ZIZA 4RA6B 4J0KA 2A1UB 1L5KA 3TLKA 2V7UA 1LLUA 1P73A 2GK7A 2C2OA 1KRWA 1KIFA 3CISA 5KTPA 3SQOA 4YJ2B 2JHFA 3NDRA 3E9EA 3MTEA 3VR6A 3RS4A 2B0JA 3I73A 1GY8A 2OLKA 3B7PA 2O9JA 4F3TA 2PJRA 2A5LA 1BIFA 4ZT5A 1XZ8A 2IOFK 2RCYA 2ZTLA 3K9QO 1C8BA 1QH8A 1NXTA 1JBKA 1Z4JA 1AXGA 3RT1A 2J8ZA 2Z1NA 3PQ2A 1T4CA 1A4UA 1W2GA 4JQYA 5BQFA 3KB1A 3LI2A 2R25B 2VVTA 2YMQA 4E5MA 1RI3A 4AO8A 4O3MA 4I4IA 2QLLA 3K72B 1K4KA 1B43A 4MUXA 3UHAA 5FD8A 4NJEB 2BFEA 1YUNA 3DCYA 3EAGA 3MINB 1FU8A 5LZ5A 2QS9A 3NHRA 4MW4A 1U9JA 1S3IA 1SY7A 13PKA 3OPMA 3WAJA 1M76A 2IEDA 5JNWA 2GH1A 4DC9A 1VKNA 2BVNA 5AKGA 2R7AA 3H75A 1X3SA 2X1HA 5D3QA 1W94A 1A71A 3TM4A 4DMGA 1GR0A 1ZGGA 1W46A 2DHCA 2PKXA 3AZPA 5I7HA 2R6JA 4H1WA 2ZUTA 1RIIA 3EXFB 3JD0A 2XZOA 2XTAA 3VHQA 5SY4A 1UZLA 1CUZA 1TTHA 2VWGA 2QRMA 2PJDA 1G6Q1 3JARB 4IJUA 5TS2A 1Q0SA 2YOFA 3EGOA 1B0UA 2Z43A 3GFBA 1J0CA 1KMMA 1X3LA 3PPVA 4MVWA 5L3QA 5LKAA 5LJIA 3KPWA 2H2HA 3FUCA 4HDOB 5G1NA 2D4HA 3GLGE 5SZJA 3CRNA 1NQWA 1RWXA 5C53B 2ID4A 5FL3A 1PZXA 3P26A 5AW4A 5FOWA 5DGTA 1BX0A 3OTQA 1BU5A 3OKAA 4L07A 1VJGA 2OKGA 4MA4A 3OHMA 5I7WA 3A6ZA 4PYQA 1GZ3A 1ORWA 1GGFA 3IJEB 3UBMA 3PEWA 3J7AC 3GGDA 1TYAE 2NT4A 4FFNA 3DDCA 521PA 1RXCA 4DARA 4I6JA 4KIGA 3DL2A 4E3ZA 3WLHA 3DONA 4ZU1X 2QN1A 3T0FA 3DHYA 1C3OA 2RHGB 3VPAA 4G5SA 3JY6A 1KVRA 2WFLA 3LP8A 4AX4A 5GWXA 4JY7A 3ABQB 4BE7B 2XITA 4JK3A 2A9OA 721PA 2GESA 5NULA 1ZJ5A 3FLEA 3T52A 3ETDA 4GG1A 1EVKA 2CNWD 1CG6A 2DSNA 4G5FA 4ABYA 3CUSA 2O5VA 4F8YA 3HDHA 4HUJA 2DQKA 2XHZA 3OOWA 3D1LA 3B12A 5J2UB 3RUDA 3COYA 1W49A 4MWZA 4UCFA 1X7GA 1XVUA 2ONCA 2HRDA 2JA2A 3R0QA 2EOAA 3ANNA 4D4JA 1QK3A 2ZXEA 3E2PA 1WZIA 1T1EA 5CU7A 2Q5OA 4BNWA 3U61B 1RJWA 4BO3A 3GBSA 1P5JA 2OB2A 1BMFD 3DEJA 1VQ1A 4OAPA 3TNYA 1O9GA 5D5HA 4RY8A 1ST3A 4AKIA 4IDPA 1Q19A 1XQ1A 2C5FA 4YPOA 5DNCA 5FFMA 4G1UC 4DG5A 3VR4H 3SOZA 1SRRA 4YJHA 1M1NA 2F9FA 3PICA 3O5AA 4PO9A 4EYQA 3QWHA 5IKMA 3BGWA 2Y66A 2Q6LA 2YHSA 5DT2A 2Z2YA 3QPUA 2G0TA 2QD4A 1BD3A 5AHXA 4Z9BA 5D5PA 3A9SA 1IEQA 5AK5A 3FVTA 5DEOA 3I6ZA 1B1AA 5F9HA 2BUBA 4O4JA 5IXJA 1N9GA 1NXVA 3IP5A 3MA0A 4GMDA 3H83A 4PS1A 1HT3A 2EQ5A 2JEZA 1UBHS 2Q5FA 3KNZA 2WF9A 1U3GA 2X1MA 2NADA 1K8RA 1A7UA 3Q0IA 1M0WA 5FFFA 4TTPA 3ZYCA 4BKPA 4BLSA 2IXAA 3BK2A 4G4GA 4Q9HA 2R5WA 3QVGA 3ADOA 4YJGB 1VLJA 1R37A 4ZICA 4UMDA 1DMRA 3ZKWA 1JQJC 2I29A 1K63A 1Z07A 4II3A 1HEYA 4AG5A 4EPTA 3RIMA 3OF2A 2C4NA 2CXXA 2ODQA 1V16A 4YP5A 1RAEA 4U5QA 3SQDA 4RBNA 1PNTA 2WABA 2ZW9A 3FJYA 3EXHA 4R1NA 2P3OA 2J30A 3NM5A 4LF7B 3VBCA 2E4VA 3EYAA 2NUTB 2YWCA 2P5YA 3CONA 1DC5A 1K7EB 2XMZA 5AKIA 2JNWA 5DLPA 1O58A 1CYEA 2B6HA 3LY5A 2AKAB 4YMTA 4XFJA 2FE1A 2NZ2A 1ZCBA 3FFAA 4JLKA 3V8VA 4RFVA 2P2ZA 2EL7A 4TRJA 1LV7A 1P61B 4AN0A 1XA3A 5CA0F 4PAWA 3VHRA 1GZ5A 2JEOA 3K31A 2GN8A 3EFEA 3L3BA 3EWAA 1ZGBA 4HDKA 1H93A 4B8ZA 1FBNA 3RSQA 3QW2A 4BWVA 1DG9A 3G7SA 2JFOA 3FHLA 2JLWA 4LZNA 4R1QA 1KVUA 2V6FA 4F46A 4OHKA 4HC4A 3IUBA 3GJ5A 1EFLA 2RJOA 4MV1A 3ZU6A 1JP7A 4MIKA 1LKZA 1V5IA 2JAHA 3V97A 4A0SA 2P91A 2D5BA 2G5CA 1GSAA 2VT3A 4FFPA 4F60A 2OFWA 2BY4A 2FDRA 2VDWA 5DLEA 3ITNA 5EFOA 5FNVB 1ZGJA 4A26A 4G4SP 3X1JA 4QWMA 4CLXA 3WIUA 3VKHA 3GA7A 4RLHA 2GA9A 1W0JD 3H11A 3WGIA 4RGBA 1XDZA 4KN9S 2G7MC 3GGSA 3KVVA 1FLAA 3MSCA 3T41A 1I6WA 4FFWA 1CP2A 4GVPA 5ITZA 1N6LA 3E81A 1CB7A 2C9YA 3RU9A 4F3RA 3RVNA 2GJ9A 1V8BA 3KZXA 1ZEJA 5D7NA 4OHMA 3DLTA 3LQRA 4NFHA 3H9QA 2ZDGA 1I5OA 2CVPA 2Y0CA 3L7KA 3EVGA 3COVA 5ALRA 1K27A 5INTA 4JVOA 4X3OA 4XGRA 3ZGXA 4LFAB 1BHQ1 3H1PA 4Z4GA 2JG3A 5DX0A 1C0KA 1NMQA 2WJHA 1DBQA 3KL2A 3QA3E 1J8VA 2YNMC 4HXFB 4LY6A 5E8JA 3GJ3A 1QV6A 3L06A 4UEQA 2CDAA 5CR9A 3GFFA 1IXRC 3LK6A 4KWTA 1P5RA 1L5NA 3GRPA 1U1IA 2WNIA 3EC7A 2BGTA 2REOA 3EH1A 3H3XA 2WYOA 4Q3NA 3E2MA 1BX1A 1DE0A 4MUKA 4D9MA 1I4WA 2OZEA 1DQYA 4U9HS 3LQ2A 2AFVA 4XUCA 2HA6A 5LQCA 5ARDA 1YR8A 3KUDA 3BMOA 3BTOA 3OJEA 4IH1A 4YRKA 1Q0ZA 3BGSA 2B61A 2QPLA 3HR8A 1R10A 3V7FA 1CUGA 2IYSA 3QXHA 2RGAA 2Y9MB 1IQUA 2HSGA 1DTWA 3K05A 2K5UA 4IDAA 4GVLA 3HVJA 3CR7A 3UMCA 1IM8A 4XQ9A 1JDVA 1W36D 3U3MA 1MIOA 4UEJA 2NXJA 4H15A 1KAGA 4IO1A 2QTCA 1MB3A 2WE7A 1UBRS 4NMHA 1W59A 2P4SA 3AHEA 5FWXA 3OUTA 4Q1EA 1JMYA 1JKMA 3U0VA 5L3RA 4IIDA 5IUJC 1OZFA 4RYDA 1FJGB 4RPCA 2YJNA 4JBWA 1A9XA 4WADA 1AGRA 4AJ9A 5C1DA 4ITVA 4ZYVA 1KARA 3FFWA 4QZVA 4XB1A 2A5GA 3ORRA 2IWHA 4D4KA 2HHLA 2UYYA 2OC9A 3BILA 4MV8A 1R5BA 4HPXB 4LZJA 3DSRA 3DZHA 1T2AA 3HYNA 1W35A 3CE6A 2ZYTX 2X6QA 4EUSA 2LKCA 2ZLBA 1BXRA 1USIA 2CNOA 3KQPA 4OHPA 2OXFA 3OMXA 4H1TA 4EY4A 5CB8A 3KDAA 4DIDA 4JCOA 2PGJA 1DZ3A 1AKWA 3FDFA 1JLMA 3RBVA 1EBUA 1Q1GA 3ASVA 3TB6A 3TW8B 3IBGA 4NG5A 3RWMB 3S40A 2ZQYA 2Q4RA 1KDZA 1U0OC 5AVQA 1ZCZA 3FPGA 4TWIA 1SXJE 2Q4DA 4B32A 2H1OA 1NW4A 2TS1A 4LHWA 2DJ5A 1YDEA 3WL6A 5EIOA 3R44A 4LYAA 5CT8A 1QHSA 2R85A 5DN6D 2HQ1A 3JSXA 1FYWA 1EFVA 1E9EA 4TYPA 4CF6A 4B2PA 3GLTA 4RVOA 5DHUA 3VI4B 3TSYA 1G9XA 3MJSA 3ROKA 3JRXA 3AHDA 3IC5A 4XQGA 2VNIA 3BK1A 3HJTA 4IEEA 3I2GA 1TYBE 5IMSA 4GYKA 4N39A 4G8CA 1KYXA 1RP1A 3BQ9A 2X22A 4RWZA 5EVCA 5L95A 2E5LB 1QGUA 3KUXA 4ZVSA 3AFIA 5ELMA 3I9MA 1WW3A 1Z74A 3GWZA 4DCNA 4FEGA 3WRXC 3CLSC 3ZJ4A 1DI0A 1NNSA 4FDMA 1XDDA 2OWDA 2QZZA 2WJPA 1TCUA 3KCQA 2CNDA 1U5BB 3DVQX 3LHIA 4BRWA 3LC2O 3E4CA 4JXKA 3QJGA 2BSXA 4IV0A 1DFGA 2NVUB 3B3JA 3DDOA 3Q7RA 1H5QA 1RS0A 2XVYA 2YHUA 2F6RA 3PXUA 4GOMD 3DOJA 4QDKA 4RIHA 3WDKA 4A0RA 5EERA 4YT8A 5JWRA 1HR0B 2AX3A 3NDBB 2VUIB 1HQYE 4H6PA 4YUVA 4FVTA 3ZCSA 1ZBDA 1EDBA 4FOLA 4ZI7B 1P7VA 1R3DA 3FWZA 5KNDD 3V32A 1FRVA 5CYPA 2NOAA 3FY4A 3L0OA 3Q1LA 5CW2A 2EFGA 1CIJA 1XL1A 3ICWA 3JD4A 3VYWA 2V5VA 5C1OA 2BGRA 2VPYA 4FYIA 1DBSA 5DLQC 4KYTA 3OEHA 2WHQA 3JV7A 4JLWA 2XXAB 2FTKE 1UBJS 3VR4D 3VU0A 2DBRA 3ZW7A 4PPNA 3WYGA 3AF2A 1SIUA 1UPBA 4PVDA 1PR2A 4E94A 1CUJA 3L0IB 1CNMA 1U3TA 4IQ8A 5A2QA 5K0LA 1BVRA 4KFTA 4QELA 4BGUA 4B46A 1KK2A 2WF6A 1YZGA 1E7QA 1PQPA 1RPJA 1STOA 2H1CA 1Z22A 2X5XA 2ZR9A 5MFPA 5AVKA 4D3XA 4DLYA 3CMCO 1T8YA 3IBFA 4FMCB 1FJ2A 2F3UA 4MV5A 4NL4H 1Y3DE 2W6QA 1NF8A 3N2GA 3ZK8A 4LTDA 1E9CA 4KUHA 4QU9A 1EE9A 2JGEA 3GLHB 1PI3A 2WIKA 1ZINA 5FV4A 5MN4A 3OQIB 4O2AB 1G3QA 4J3JA 2C1XA 5IDVA 1FEZA 3RS5A 2JLAA 5FJIA 1S02A 1YR3A 1WHSB 1T25A 4HLNA 2R5NA 4KFCA 3P71T 3PX2A 2BBSA 1O4VA 5JT1A 4BMZA 1X15A 5AD1A 1K98A 3WB9A 1I24A 3K1ZA 4PNHA 4RO0A 4ZJZA 1OBCA 1SG6A 4MTLA 1LH0A 3F3SA 1BG6A 4GPIB 3D6NB 3EZXA 3PSAA 1I7NA 2B8TA 2B4AA 8LDHA 1GADO 3P9SA 1JKJB 1KR2A 1A8QA 3A9CA 3V9PA 3F96A 1UMCA 3KSZO 2VR1A 2ON6A 3OURA 1K97A 1OIXA 2JIDA 3KJXA 3ZI7A 5LUAA 3AR6A 4ARZB 4WLOA 3SLRA 4EG3A 3SM9A 1H2EA 4GDFA 2Q49A 1ZNYA 3T4EA 4EVSA 3H2GA 3TDMA 2DCMA 4QPJC 1P1CA 5T8KA 2F8LA 3VNSA 1SUCA 4ANFA 3HKCA 1VPWA 1PIWA 3KUKA 3L8DA 2MOKA 3WS7A 2YWFA 1AO3A 5CAEB 4KXYA 5AKZA 4JXZA 3I58A 4D9JA 3OVMA 4KQMA 5FR2A 3WKBA 4BU0A 3C8ZA 2AJDA 1J25A 3G5AA 3OTGA 2P2SA 2Q2NA 2QTZA 3F2IA 4FJ0A 4GC5A 4KDEA 3BB4A 4ON9A 4JT4A 1VKOA 4ZQCB 1GZHB 1GWNA 4MJ3A 4K6CA 4CGYA 3K0CC 1HURA 4KVFA 4MQ6A 3RI3A 3VMMA 4I6GA 1CS0B 4EVRA 2IX9A 3K71B 3EA5A 4A27A 1F8UA 1GAEO 3EGXB 3IEXA 1EP9A 2BTOA 4QGFA 3RSGA 5LNK6 1BW9B 3ZXXA 4RZXA 4E5KA 4F9GA 1IUNA 5E4FA 2UZ0A 4H7KA 1KSGA 3PFNA 4Y2RA 3EMVA 1NJ6A 2PX6A 4WOKA 4XDHA 3BKWA 3FPJA 2XD4A 4MO9A 1EFKA 2PG3A 3WIDA 3WNQA 4B0PA 2KJQA 1EWQA 1QUEA 1G8PA 4NCAA 4IQ0A 1QK4A 2XA2A 4FN5A 4ZT7A 2HGZA 3VOBA 1Y8AA 1X2EA 1C1DA 1N5RA 4TS4A 1YI1A 3ZS9A 2J3HA 3VYVA 2PUVA 2V7QA 5E2IA 4W5NA 3QXGA 1F17A 3TOCA 1T6NA 4KQJA 5I8ZA 2QT1A 3K0FA 4TROA 1E2GA 1GYPA 4FEYA 4OJKA 3AEUA 1K08A 2EGHA 1TIPA 3LBFA 4O5AA 1P7YA 1ZM9A 4RL4A 1GU7A 4Q9IA 2ZRFA 3IB3A 3AOEA 4ZGGA 1UADA 5JAOA 3H2IA 3L93A 3WGVA 5EKTA 5JYEA 2CF6A 4DYHA 3DBIA 3FCEA 2YXPX 4JDUA 4EECA 5CDGA 3KVYA 1G20E 4ZGBA 3P2OA 3RHSA 4PAQA 1FFAA 1FUEA 5EJAA 4D8VA 4P3NA 5A6SA 3FE2A 2FN7A 4HJRA 4G8DA 3ZEAA 3LC0A 1FDVA 1IBCA 1BDIA 1RKBA 1C9MA 1FUYB 1RWWA 2EXXA 1UK8A 3A7EA 3C16C 1YAJA 1KOLA 3TZCA 4CCYB 4D44A 4EG7A 1SUIA 2XVXA 4GW3A 2QRPA 2PMBA 5ERXA 4Z4HA 1BQ3A 1P1FA 2IK8A 4B80A 1L3CA 2H4XA 2WUDA 1XF1A 4IJMA 4WZBE 4L22A 4QC2A 2HCJB 3DDHA 2FY8A 1N7HA 1ADJA 1XNGA 4K81B 1TLTA 3EIFA 4LN1A 4UHDA 3MF4A 4TKUA 4Z5XA 1R64A 4FFDA 3BSSA 1G7CA 5H83A 3D2AA 2F9LA 2C1ZA 3I0NA 3RO7A 5LMNB 1IHYA 4A6DA 2WWXA 1HSOA 3HWSA 1Z38A 2V54A 2A0KA 2CMKA 2P68A 1EEXB 4PTZA 2FR8C 1PNOA 3EVEA 3O82A 4KLNA 4BUZA 1TLFA 2DPYA 2OG2A 5DTRA 1GSIA 3T9FA 5HBRA 1RQ7A 5F77A 3FYDA 1JLHA 3GQBA 2BM9A 4MI1A 4ALNA 4G63A 3LRPA 2IYOA 2OCLA 1YBVA 1PLLA 1L7RA 5CLGA 3ANLA 4D02A 4WASA 1I8TA 4EZBA 1ZOIA 2NU7B 1VB5A 1CK4A 1E0DA 1UFRA 1NJ2A 2G71A 2QN6A 1KO8A 2V59A 2WHPB 1JLRA 2ZI3A 3DNPA 1NL3A 3N6VA 5A3RA 1ZCAA 3UMBA 4NZ9A 1IEXA 2YNMD 4LJ5A 3WGZA 1ZXBA 2V9CA 3HY3A 4AY6A 5JH7F 1R7RA 1J1IA 1QHIA 2XMCA 1VSQA 2ZBGA 3L8HA 4NOLA 3RUPA 3Q72A 4CQMB 5C7OO 1DJNA 2P40A 5LQAA 2MMCA 4DNFA 3LCMA 3W2EA 2FSGA 4QASA 2X9NA 1GUZA 3KWMA 4RHEA 1CRQA 2C31A 2J5QA 1X1CA 2YDXA 3EBPA 3HRIA 3L9WA 5KMGA 3MJ4A 1MAAA 3ETJA 5HS4A 1N2XA 1JAIA 1G8AA 2B8EA 3BQMB 2ET6A 1V8OA 3HM2A 2XT6A 4RYLA 5I9SA 2IA5A 1REQA 2A6PA 3NRJA 5AK0A 1QXSA 2ZIVB 4W63A 5KQGA 2YKGA 5D1HA 1MC8A 4DNQA 2K2WA 1T5OA 3D59A 3MLEA 3L7BA 1JEYB 2WYVA 1Q6ZA 1T2UA 4R9NA 4CF3A 2J67A 3MWGA 2H4JA 3OPXA 2UUCB 4WKNA 3GJXC 5L40A 4OHUA 4X20B 5D87A 1H4TA 4GKBA 4AC9A 3LP6A 3C41J 4OU5A 2ES4A 2LTAA 3A6EA 3U80A 3ZQ4A 3SMQA 2FWJA 5C8YF 4IIXA 4D9FA 3DVRX 5K0SA 3TGLA 3GJ0A 4JAVC 3G49A 3OETA 2AGVA 4Z8XA 4NC9A 1OWNA 4D9BA 2J45A 2GFIA 3M9WA 4XYMA 4YK7A 2HIGA 1KWKA 2X8JA 3HSKA 2GYYA 2QM3A 5EMHA 2WUEA 1YONA 3H7IA 1A9QA 1G4HA 1LPBB 1OW3B 2NO9A 3WLNA 3X1DA 1ML3A 5GP1A 4KTVE 1KU0A 2QENA 2JA1A 4DF3A 2BBTA 3GO4A 3I12A 1Y4DE 2D5IA 5FI1B 1J1ZA 3E7WA 3WQBA 5K2MA 1U5CA 4YRRA 1L4FA 2P7HA 1FRFS 2ZUUA 3LPNA 4GR5A 5GM1A 3EEOA 1YQGA 4HLQB 2VXCA 3KB6A 4DM3A 3QNWA 4NS1A 2JIQA 1GHTA 1RXYA 2FQXA 3OKFA 4EKDA 5H59A 5P21A 4KWCA 4MUIA 1UF9A 4IDCA 5LYJA 5SYMA 3HK2A 4B9EA 4BVKA 4B5KA 1EIWA 2C2MA 4P34A 1ABFA 2CSUA 1K5DA 4UE6A 2BH9A 1AO0A 1H2WA 4LV8B 4DNPA 1M34A 1A5TA 1U0TA 2V3VA 2C2ZA 2R2GA 3PQDA 4P82A 4TL8A 5BOVA 3RLIA 4LGVA 2QTHA 1QNLA 3TFOA 3G02A 1D1SA 3UJ6A 2ONKA 4CM4A 4EJSA 5A4FS 5IBRA 5EKUA 3RK1A 2GD6A 1TKRA 2A9QA 1NQ5A 1P2BA 2GAFA 4FHEA 5HNKA 1OYOA 3OU7A 2JH3A 3QOFA 5DW0A 1BN7A 4MCJA 4YTEA 2XOXA 5KTMA 5D6OA 2N0SA 5BR1A 3JAKA 2R8XA 2WJZB 3R3UA 4GOXA 4DDWA 4RTOA 1E59A 2DFVA 4FZVA 3ZWCA 2XB2A 4XCQA 3RVKA 1E0JA 4LF4B 3CXRA 2IPOA 2I91A 2XAAA 4UVGA 2C07A 3MPUA 4EF5A 2R7KA 1E6WA 2CD7A 2O4UX 1KJ9A 4U7FA 3K94A 1VTKA 3GJ8A 2LCQA 3K0SA 4M37A 3CLSD 4HDMB 4CR7A 3QITA 3EASA 3V7YA 1VKJA 1YQWA 5JFOA 4K05A 4PN7A 4RD6A 1XTVA 5GJVC 2WYHA 3FUTA 1HNZB 1UP6A 3HZZA 5JNLA 2HXGA 2DPMA 5DN9A 4EEZA 3FKSD 4G8BA 4OHOA 4DR3B 1CUAA 4RELA 1NY5A 1W36B 3NG1A 4RWEA 5LFAA 3P9NA 4G0YA 1F48A 1GNQA 5JDIA 4UHJA 1QTNA 3LT2A 1KI9A 4WT7A 2J3LA 4LY9A 5ICEA 1XCMA 1DV2A 5FA5A 5A04A 1C1YA 2BMEA 4JLMA 3PJDA 4C7JA 4LY0A 4K3VA 4P54A 1ZSYA 3UF0A 1QZUA 1UC8A 3N6RA 4Y2PA 4U3JB 2ATEA 3SSAA 2ZI4A 4O4LF 4BV3A 1LFAA 1ABEA 2JVKA 1EFHA 1HRKA 4TLLB 4JNKA 1VYHA 5DW3A 4PX5A 3UCEA 2AKYA 1E2LA 5EKDA 5F5LA 4UD6A 5FUVA 3TLZA 1W2WB 3D4OA 4UQPA 3C3BA 1QNFA 2EERA 1F2VA 3M5DA 5FI0B 1KI3A 2RIPA 3R9IA 4AMBA 3U4DA 4JLOA 2BCEA 2IDKA 3BMXA 3KM0A 4PHGA 4AZ0B 4WK0B 4YDHB 4BFTA 3N2KB 3HU2A 5BSVA 2GRAA 4UJ5A 3ZXSA 4DB4A 1QTRA 1O95C 4JB0A 5FBLB 4CMEA 2E1RA 4QGAA 3L1JA 1VHJA 4DMHA 1XGKA 2RAUA 2NXNA 2BCJQ 2AX4A 2NSYA 3G9TA 3HCCA 3DMTA 1ORTA 3NFYA 2W48A 3ELYA 3UOWA 4YQEA 4MWGA 1UBMS 2OK7A 3BTSA 3GT7A 1SB8A 4GEGA 3PNKA 2X19A 4R8KA 3HJUA 4Q3KA 3GUVA 3PDUA 4MS4A 4RZSA 4TSKA 4KXUA 1C4OA 2PGNA 5TPZD 4BL5A 1XE3A 2ACKA 2B1RA 1XJ0A 2X1VA 1P44A 3AI2A 3FDJA 3OA2A 4DR1B 1MABB 2R7LA 5DNDA 2BYTA 5H80A 1T8WA 3PT9A 1XN1A 2PLRA 4F9FA 4UM9D 3JQ7A 3JQ8A 1AUPA 2ZUBA 1RU3A 2Y76A 2A67A 2I6FA 3V6LA 4PX3A 3EZYA 3ETHA 3Q9NA 4J7XA 4HY3A 5KNBH 1YRLA 4RDIA 1OX5A 4ZZIA 4ITRC 3DEHA 1NF3A 1E1CB 3QWFA 2LUOA 4FIZA 1CUVA 3KKEA 4UDXX 1WU8A 4N8SA 1VG1A 2GO7A 3IPRA 2W8BA 4K28A 1TECE 1TYCA 4EQZA 1QZZA 5JFTA 4H7DA 4LF8B 2ZAYA 2P6NA 3NHZA 4U0KA 3DE0X 2EKQA 5CCDA 3WRVA 4DA8A 1BXGB 3AY0A 1HT0A 4OHCA 1MB0A 1VCNA 5C1IA 1JHZA 3MTAA 1QAQA 3HKEA 4PPYA 4EIWA 1ZNXA 1OPXA 4TMVA 3UMFA 1ICEA 5D7BA 4KGZA 3UPDA 3TCKA 1MHTA 4Y67A 2QT9A 1Q16A 4QYMA 5CNKA 4QQRA 3MHPA 1ECCA 1VC2A 2GK6A 2HHAA 2XQFA 4HAWA 2VJYA 1TYEB 3WXBA 1U9IC 2BBWA 2OP1A 2F59A 3PHLA 3EWNA 1EUYA 2HEIA 3VU3A 1H3EA 2LV8A 2HDOA 6REQA 2IH2A 3B1ZA 3OQVA 1B16A 1Z8HA 1EUCA 4P08A 4Z99A 5JNRA 4BRSA 5KYYA 2ALJA 4UNPA 5TQ2B 2A84A 3C15C 4CT4B 5J58A 3LCUA 3CZ5A 4LZLA 3PL1A 5AMXA 1D4OA 1ZIPA 1P6QA 3HBAA 1SBTA 3OOYA 1G3RA 1QRAA 4DIMA 3R0JA 1U90A 3CSDA 2YY6A 2W6JA 3KXPA 4F3NA 4PNEA 4WY2A 1R0XA 5JSFA 5JXGA 3LIIA 2ESRA 3CRQA 4EVIA 4RJTA 3PQ7A 4UZEA 1G17A 2GILA 2I4MA 1EUDA 5IYZF 2O50A 1ZKDA 3GDWA 3RK0A 1JX6A 4J7CA 4QPPA 3KFVA 4NSNA 1YVEI 3RR2A 2EYQA 5JFGA 3QYJA 5KYKA 1AKRA 5AW9A 1L5HA 2VPWA 3KZMA 3QEMB 4Q7KA 1G5QA 2CBXA 3PUIA 5FWDA 1WY5A 4JBXA 5CVVA 2A35A 1KXZA 3W9UA 4HAXA 1QC5A 2QE7D 1M8GA 1XD8A 4LIPD 1NR5A 1T34A 1SC9A 3S8EA 1EJ6A 2QP3A 3TR5A 3QFFA 4KLZA 1RQXA 5E4TA 3R20A 3IMGA 5BWCA 1IHDA 2W2NA 3OZAA 3UKOA 4XGKA 3ZYZA 3ONNA 2BFMA 2DUMA 4OMCA 4BTLA 2LCIA 4CLRA 3GLUA 3FUUA 3GFSA 1TM4E 4KXLA 5U4QA 5A9SB 5EJ2A 5TQ0B 3FHTA 2OUIA 4Z3DA 2QL6A 2SCUB 4NH0A 2R8ZA 3P9KA 4IHJA 2O0JA 2QRVA 3M5CA 3UO8B 5JBIA 2I2XB 2WB4A 4BEJA 2UYHA 1JJAA 5IH7A 2QJOA 3COJA 2Z56A 3BB1A 3QSYA 3TAHA 3UQZA 2R6FA 2CT8A 2ZJ2A 5ED4A 4HEA1 1K6JA 1G5RA 4OVKA 4OXRA 4RHCA 4YB8A 3UJBA 5GONA 5JW6A 2WU3A 3COWA 1Y8QA 2CKMA 1LSOA 1IMJA 1A9YA 2FW6A 2JAOA 2XVMA 3CURA 1UPFA 4UHKA 4BNZA 1KZ6A 3Q8XB 1E5QA 3UW3A 1FXUA 2OXRA 3MWFA 1VG9B 3W2TA 3ZE9A 4BKMA 1F9EA 2ENUA 3X43A 3FSJX 4IGAA 2FKAA 2YJGA 4MS3B 5AM3A 5AKJA 4MKZA 2KB0A 3UYKA 5G0TA 2DR2A 4LFBB 3VDNB 2EP7A 3ZWNA 3I3OA 5A5FA 4DKJA 1FNSA 3R74A 3PNLA 3FNQA 1PFQA 4RMIA 2XX3A 4Q9JA 1NZFA 1WUKS 3C3EA 1P2TA 4Q3CA 2ZSEA 1ENYA 4J03A 1MKYA 3HUUA 2AQKA 2OSVA 3TVTA 2X5OA 1SURA 3KRTA 4U2DA 1C14A 5LQDA 4RS4A 1Y5MA 1JIIA 3C3AA 5COQA 1SVSA 1U81A 1NIJA 5ECWA 3TOSA 1M2GA 4V3BA 4JODA 1CY2A 5CVEA 3UFBA 4KSYA 3MLAA 5GJCA 2WWRA 4ZCSA 1DELA 1RAHA 3D7LA 3LU1A 3PVZA 4OPMA 1RRFA 3SIWA 3UOAB 2OCBA 4N5LA 4X7PA 3RHZA 1E18A 5FT9A 3R9WA 4CG3A 3TZKA 2P35A 1L1EA 4U8HA 3VR6H 1Z0ZA 4EI9A 5EEHA 1P7ZA 2IFTA 2LBPA 2WKQA 4I81A 1Y9AA 1V95A 2EX1A 3K9GA 1ESCA 4WMLA 1RSZA 3P2JA 2IXFA 1M9NA 1U2GC 3CKYA 3QPWA 2CLMB 4L4ZA 4M49A 4FT4A 4ZVPA 4E12A 1E66A 1JR4A 4LMRA 4OGKA 3MUOA 3R0XA 4F12A 1PFUA 1VXOA 4YJFA 3HGMA 4F6RA 5TNXA 4OCZA 2R4QA 3D3NA 4L50A 1XHLA 4XSGA 4RVUA 3DEAA 5IUKC 1DBWA 4NR0A 3KOMA 4QHSA 3B20A 4WLUA 5EYPA 3EUEA 2ZR8A 4WNAB 4JS0A 1LJUA 3SP1A 3SZLA 5KYXA 1Z2NX 5DE3A 4WZAB 2O7NA 2I71A 1JSZA 2I3BA 3D6VA 4NEHB 1J5EB 2IUEA 2J3EA 4JI8B 1VLHA 3CXUA 3EZ9A 3HR7A 4K9OA 4BC1A 3WZ2A 5K3BA 4AKGA 2CDNA 4WN3A 2C9BA 4BV2A 4MPJA 4EFMA 3Q88A 1GPYA 2I7DA 2ODWA 5DK6A 5JI3E 1CIPA 3C14C 4DJDC 1ZO8A 5H4HA 2ID9A 4YCAA 5GOZA 3ZDYB 9MHTA 3GP8A 3FNFA 2QI9F 3OE1A 1GZSA 3DR5A 2VP6A 2ZP1A 3K9CA 3LHFA 4UULA 1E4EB 2LDXA 1H5NA 4MJXA 2C2KA 4LRSB 1ST2A 1JFVA 1YXMA 2R6DA 5MGNA 2CL6X 2JH9A 3CUYA 1Y4SA 4BZXA 2J6IA 4IBOA 4AKHA 2GCNA 3HVUA 2ORWA 3KYCA 3ER9A 4NXNB 3OQ1A 1Z6QA 2JFHA 4GZ3A 4HZUB 1TAUA 4CV1A 3R7AA 2VYND 3RGWS 4FWTA 1E62A 2OILA 1KDYA 3QF7A 4HYTA 4HGZA 3E5RA 5JAIA 2VHCA 3AXSA 2IHUA 4HH4A 4ZDJA 3U48A 3TFWA 4LOHA 2EWVA 4C08A 3BEOA 1URPA 4K9KA 4S1PA 3W8DA 4ZAVA 4CKCA 5GY7A 2QVGA 3EXHC 5EEGA 4DLXA 2Q3CA 3KELA 3DDWA 2O7RA 4OXXA 3KQNA 3A4LA 4IVNA 4N7BA 3AESB 3QUBA 2PX5A 3KKNA 3PZRA 4BO6A 2YWXA 5LP6A 1B8OA 3FCCA 1X7ZA 1ZKMA 2G36A 3TTSA 2A94A 5ECGC 1E2UA 3HKDA 2J32A 3OA0A 4XAQA 4C43A 1R4MA 3I61A 1H94A 1T1IA 1I01A 2QVBA 3CW2A 2RHRA 4LRYA 4XVCA 4JR2A 3M4YA 1B42A 1XQXA 5KNBD 1XTIA 4WKPA 3EVAA 1IXYA 2EAUA 2POQX 4O29A 3MGAA 4UBLA 3MJTA 1PEAA 5SYAA 3K2QA 4NWIA 1QTIA 1RVDA 1YZUA 2OHIA 2QN9A 3NT5A 5KTKA 1NT4A 2GAJA 3ZXYA 1J2TA 1P4AA 2GBPA 1WA5A 3T5AA 4BRUA 2ZJ8A 3G9ZA 1ZNWA 1JG4A 1H1DA 1PTJA 2CYCA 3E5HA 5ALUA 5IC6A 2YJ4A 3IDZA 4EUNA 1V0JA 2HU8A 2KMLA 4MR8A 3RAFC 2VXBA 4PCLA 3NC0C 3DA8A 1T3ZA 4QDTA 3I5YA