1E7SA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Epimerase/reductase
molecule keywords GDP-FUCOSE SYNTHETASE
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7sA02
2VTEA 4IY1A 1N1GA 1V9LA 1ZIDA 2OO5A 4YJFA 5DNAA 3Q9NA 2EF1A 1TT7A 2EW8A 2VWGA 5U4QA 5MGBA 1F12A 2EXXA 2P4QA 2HMUA 2CVQA 5DOVA 4XWYA 5COAA 1KEWA 4EUEA 4B8ZA 4R69A 4W9NC 4PLYA 1V6AA 4QXMA 1DSSG 1EUDA 5IAAA 3P19A 3HE3A 4PN3A 4R3WA 3TSCA 2Y67A 3DHYA 1LDMA 4BO3A 1U9JA 1P33A 2X0NA 5EIOA 3ZHZA 4PG5A 3GRKA 4YACA 5I7SA 1EDOA 2LDBA 3GRPA 4ID9A 5JDCA 2DBRA 5AXCA 1I2ZA 3IOYA 1XELA 3GDOA 1ZJZA 2O3RA 1JQBA 3G17A 3WNQA 4CMIB 1C1DB 2JKVA 1UJMA 4RQTA 4J4HA 4A2CA 1XLTA 3T4EA 2CVOA 1ZK4A 2X9NA 3AM5A 3KZVA 5F3RA 1FK8A 4ZHSA 5JMWA 3ETGA 4M1QA 3ABIA 3WTBA 3SEFA 4YWJA 1MX3A 3NDIA 5IDQA 1VLLA 3OJEA 2BFAA 1JAXA 4IS2A 5LDGA 2PR2A 3UCEA 1IE3A 3AI3A 3P5SA 1HL3A 3ANNA 1V8BA 4AJOA 4KQWA 1MC4A 3VTFA 2ZQZA 4TRMA 4MVJI 1WVGA 5A1TA 1KBZA 2B4TO 2IZZA 1DB3A 4RL6A 5L9AA 3L4BA 3E18A 4IDCA 5B4UA 1T26A 2XAAA 3WGQA 5L95A 1LLDA 3DZFA 4IZIA 1GPDG 3Q0EA 2NU7A 3AUTA 3GDFA 3H9QA 3G3EA 1HE4A 1ADGA 2G1UA 4EEZA 1LC0A 1WPQA 1DJQA 5KKCA 1WXDA 2DUUA 2ZYGA 3OIGA 4UVHA 2OZPA 3UOGA 1IULA 4WLVA 2AEJA 3WIDA 3OEYA 4OKIA 1M76A 1Q1NA 3E9QA 1MLDA 1C14A 2JAPA 4JJFA 3NT2A 1ZMTA 5HTOA 3I52A 4U7WA 4MVJM 5EN4A 1E1LA 3GUYA 1H2HA 5JLAA 1JWAB 2C2XA 3AUSA 1NR1A 2JHGA 2X1HA 4DYVA 5B1YA 1YOVA 2O48X 4RVHA 2E49A 2W98A 2CMDA 3AK4A 2OGUA 1MB4A 1J49A 1EVYA 2O2SA 2JFHA 4OOFA 3S2FA 3CZMA 2Y0CA 4II2A 4W7HA 1IL0A 1P1FA 3MJCA 3QVSA 4JP3A 1I8TA 5JDIA 2PFGA 1L1FA 1GEGA 3DFUA 4QTZA 4BO6A 3H8VA 1QV7A 4QUKA 4YEDA 1W73A 1U7HA 3FBGA 3INTA 4YDRA 4BGVA 2Q4EA 4TKLA 3F9IA 2NVUB 1DFGA 3DFZA 3BHMA 3PIDA 4HV4A 1NVGA 4PIVA 1D4FA 2HAEA 1T2DA 2H5LA 5HBRA 2QRKA 2FP4A 4DUPA 4BO2A 1VKOA 5BSGA 4IBOA 4Q9NA 3ZH2A 1SCUA 1U3UA 2OOSA 2PKQP 3C7CB 3N58A 3TZKA 5KNLA 3LK7A 1U8XX 1IZ9A 1JKIA 4Q3AA 8LDHA 3SLKA 3IIEA 5F5LA 3PYXA 4BO8A 4DQVA 2YQ4A 4S1VA 3NJ4A 1PQUA 3RCBA 5I9NA 1MG5A 3KYDB 1AGNA 4K6FA 5T57A 3ZWPA 4GAEA 2W2LD 1DJNA 2C82A 1NM5A 3I83A 4CQMA 1M2WA 3VPGA 3PHIA 3VVCA 2Y93A 3DMTC 3AI1A 4Z9XA 4KWIA 1I33A 3OQ1A 5IZCA 4DBVO 3NJ8A 4TRNA 1FDUA 4BQRA 4CODB 4R1SA 2HK7A 1X1TA 2HRBA 2Y0DA 1RYDA 1XCBA 2GSDA 1QLHA 1TI7A 1TXGA 3D3WA 1E92A 5JY6A 1YRLA 4E5MA 3W6ZA 3HB4X 1ENYA 4FFMA 1SAYA 4PZDA 3AFMA 4NZ9A 4GQAA 4OKNA 3M1AA 4K1LA 3PJGA 3WGHA 4E0BA 1GEEA 3BHIA 4IDFA 2AE1A 4JNKA 5JCJD 1C0LA 2BKAA 4MKZA 4WCFB 3I5MA 3LLVA 1YB1A 5U1PA 4UEKA 3A28A 3H2ZA 5KCZA 3PFWO 4DXHA 4URFA 3MJEA 3JD3A 1EQUA 4XQ9A 4B4UA 4OO3A 1UDBA 3JQAD 1H6AA 3RU9A 2YFHA 3QV1A 1E6EA 3B1FA 4F6LA 5TLSA 3ZU2A 4AFNA 1KVSA 5AXDA 1RM5A 1SNYA 3PHJA 3OA0A 4B3HA 4U6QA 3RQSA 4CLHA 1QG6A 3QVTA 1E5QA 3FNEA 5C7IO 4GWGA 1YBAA 2Q50A 3WFJA 4GLLA 5H82A 4ZD6A 4H16A 2CFCA 2HDHA 3C7DB 4P4GA 1GCUA 3NDRA 2C7VA 3PP8A 5GZ1A 2D0IA 3ZGYA 1T25A 3ZW9A 1OZAA 1ISIA 3KLMX 3HJAA 1PJ2A 1DOHA 1H94A 1PJCA 4EGFA 4MIOA 2RH4A 3BTVA 3UXYA 3V1TC 2AXQA 5DBIA 4BHTA 5ER6A 1BSVA 3S55A 2FN7A 3QRWA 5JAQA 3C8MA 3OJOA 3EHEA 2EKPA 1V0JA 1N1EA 4FFNA 5A04A 2X9GA 1O5IA 1PZFA 3K8ZA 2Y1OA 1ISMA 1ARZA 2NQ8A 4JBGA 3H6KA 2NNLD 3V5NA 1AXEA 1Y9EA 2IEDA 3S8MA 2A9FA 3RASA 4NFHA 1UUFA 4XB1A 2D2IA 3HDQA 1UP6A 2P9CA 4DVJA 4BNIA 5DULA 3BHJA 2P5UA 4Y6PA 3GVPA 9LDBA 1BXGA 1NBOA 2FPPA 3LDHA 1Q7BA 3MOIA 3P7MA 4YAGA 4DA9A 1UR5A 1FDVA 2PH3A 3IKVA 3OJ0A 4CMEC 4Y6RA 5LDHA 2HK8A 4J7CA 1U2DA 1E1KA 3BZUA 4LW8A 1OOEA 4P4NA 1MXFA 3VDQA 2WD8A 5EESA 5A5FA 5F1PA 4XDYA 4ALNA 4IJKA 4K28A 4HWKA 1Q2XA 3HQ4O 4NJOA 3PWKA 4JQCA 2JAHA 3FR8A 4MP3A 4YCAA 3Q2IA 5THQA 1AE1A 4KUEA 1Y6JA 1R4NB 1WDMA 4ZQBA 5DT9A 2DT5A 5IN5A 1H93A 4A26A 5BNIA 1A7KA 4A10A 3FR7A 1WZIA 1LLUA 1W8DA 2CUKA 1P1IA 3DMYA 1R4MB 3UW3A 4CPDA 4E5YA 1DLJA 3PFFA 5THKA 1LDNA 3OF2A 5G0UA 4IMRA 4UEJA 4EEXA 3DL2A 1A9ZA 1DC5A 3DOOA 5HS4A 2J5RA 3UH1A 3K2BA 4O0LA 4LCEA 1I5RA 2UVDA 1RM4A 2AQ8A 2BELA 1Q0LA 1GD1O 3STHA 4CM8B 4EDFA 1ZK3A 1I3NA 1HDCA 2BHLA 2FR0A 2VYVA 3KSUA 2G82A 1SB8A 5CDTA 3A06A 2OP1A 1YDEA 3L6OO 4N5MA 3OP4A 3ROPA 4XB2A 2OFPA 5CEJA 6LDHA 1H6CA 2WSBA 3JQEA 3GQVA 4IJVA 3FNGA 5JS6A 3GA0A 1LEHA 3AM4A 1ADBA 1VI2A 2V6FA 3HWRA 5EMHA 5HA5A 4BQPA 3PQFA 3IMFA 4E3ZA 2VZ0A 3LYLA 3S1LA 1JW9B 1PR9A 4FD3A 3BXXA 1R37A 3GGOA 3L6DA 3GN2A 4E33A 4AJEA 1E7YA 4QO7A 3FD8A 1JAYA 3GF4A 1M75A 4HFJA 4O1MA 2PGJA 5KJEA 4OXKA 3MCVA 4FR5A 4UULA 3NGLA 3QLJA 3PJDA 2WD7A 4E4YA 1NQTA 1BG6A 1WWKA 1PGOA 2R00C 4WE3A 5DZSA 1OC2A 4JBHA 5B4VA 2WE8A 1MXHA 2OMEA 3C85A 4ZRNA 2QZ9A 2D1YA 1A4IA 4XA8A 4N5NA 4U8GA 3DBLB 3L4SO 2DVMA 3BMQB 2JD1A 1EUCA 3DAPA 3IL2A 4IGFA 2WTBA 2P9EA 2PKRA 2ZTUA 3D64A 3HSKA 3T7EA 3HHPA 3OJLA 4FFOA 4QT0A 3B6ZA 3FF4A 3CZRA 1PQPA 2CF6A 2W4QA 1D1SA 5JO9A 3CUKA 5CPBA 1C1DA 4WK6A 4WNIA 4GL4A 3KUXA 3U62A 2VHWA 1WLYA 2AE2A 3UN1A 4J91A 3EMKA 3GLQA 4CM9A 2HLPA 1YL5A 2VUTA 4I5FA 2NQTA 3EW7A 3OETA 4LSMA 4WLNA 1XR3A 5L7YA 1I3MA 3JD4A 2IYOA 5CDGA 5A02A 1N7HA 4RPKA 2RH8A 4RJTA 1DO8A 4FJ1A 2AEFA 3H9UA 1YKFA 3OA2A 3U3XA 1PGQA 1G0NA 2GLXA 1LTHR 3WDSA 1EDZA 2Y1CA 1RM0A 1YL6A 3H3FA 2HJSA 4BMNA 5L3ZA 1XYGA 3ENKA 4RQUA 2VNAA 2E48A 3RU7A 1JDJA 3WMWA 4E5NA 4ZJUA 1PR3A 2O3SA 1KY4A 4CUJA 5IDWA 1B3BA 3GC6A 2POQX 2DPGA 4QX6A 2GZ1A 4E5KA 3GAZA 3E8XA 2Y99A 3OIDA 4FIZA 4UVGA 1NQOA 4KTVE 4TROA 3ICPA 1LDGA 4BUCA 2VWPA 1IYZA 2ZTLA 4CM4B 3ONFA 3QE3A 4KP7A 2CD9A 1DIGA 3UHAA 4F46A 3PHHA 4QECA 3UFXA 1E3SA 2JJYA 2RHRA 3IP1A 3ONEA 2CDCA 3W8FA 4PG6A 4M89A 1Y5MA 3NAQA 1QMGA 1SPXA 2A94A 4Z3DA 4ZN6A 5TC4A 1B0AA 3U4HA 4AICA 5ICMA 1EEHA 1UDAA 3Q1LA 1F0YA 4YAKA 2YHIB 4NIMA 5H83A 3D5TA 4BGUA 5DP1A 4K6CA 1K6JA 3KV3O 4YAJA 5JNLA 3ZNNA 1OBFO 4RF3A 4AJLA 1E3LA 4XRRA 4I9HA 4NHEA 1ADFA 1EUZA 1ZH8A 4YQZA 3G1UA 3KB6A 2PZJA 1K6IA 4LK3A 3BYZA 3GVHA 3DZGA 2EERA 3GMDA 3PGJA 1ZEMA 5G0SA 3W4IA 4PVCA 4YPOA 1B7GO 1NFQA 1U1IA 1EVIA 4XRGA 4QSMA 3PDUA 4I9UA 5CP8A 3W6UA 4R1NA 3UAGA 1LLQA 2A4KA 4R5HA 2P4HX 3ONDA 1E7WA 2Y1EA 4UVDA 5BR7A 4ZA2A 2NVUA 1XQ1A 5EQDA 1AUPA 2Q1SA 3RUCA 3WS7A 4UUMA 4MVJG 1P74A 2QX7A 3EY4A 4WECA 3UF0A 2DBVO 3HDHA 5I9LA 4PRLA 4GVLA 4J4TA 2QIOA 3HG7A 3OQBA 1QKIA 3DZHA 1YBVA 1O8CA 1DLIA 8ADHA 2YYYA 3E48A 5A03A 2D4AA 3LVFO 1Q7GA 3TOZA 3H4VA 4YRAA 4CMHA 1E1NA 2DAPA 4AG3A 2ILTA 3CMMA 3KYDA 1P77A 1WAMA 3L9WA 5L53A 3GFGA 4E2WA 4XQCA 1HF3A 1OAAA 1DFIA 1PS9A 1PJBA 1E3IA 1YJ8A 5AXBA 2C54A 3IJPA 3RUHA 5HWSA 1HDOA 3BTSA 1F17A 4J6FA 4N5LA 5T8KC 5KOIA 5DDIP 1QXSA 4NNJA 2X58A 2NWQA 4AJHA 3QY9A 2BGLA 3UICA 1T4BA 4LVCA 1PJ4A 2OHXA 5I9MA 4NI5A 1KEVA 3P2OA 4Q3NA 1NFRA 2O7SA 1P1RA 4MIYA 4NBTA 3JQBA 1RJWA 3FRJA 2OORA 2X5KO 2O7QA 4WCFA 1B8UA 4GGOA 1YONA 2CDAA 4D7AA 3JD1A 3BTUA 1HDYA 2VYNA 2OBNA 2GN9A 3ZV3A 3D0OA 3GFBA 4NJMB 3ZWCA 2ZCVA 4NBVA 1LBEA 2CNBA 4J16A 5KIAA 3RJ5A 4A7PA 3RROA 3GHYA 3U4IA 4IDAA 3JQ9C 4W4TA 4CMKA 2OL4A 4IDBA 4IQ8A 2ZK7A 4XIYA 4LMRA 1JTVA 4IXTA 4RVSA 1BVRA 5G0TA 2PV7A 3VPHA 3VOSA 1K3TA 3UGKA 3I4FA 1PQWA 2IODA 3FBTA 4YTEA 2AW5A 1PGNA 2C7GA 4Y98A 4XGIA 5TSDA 1P44A 3KYBA 4DQXA 1P9LA 4YT8A 1EK5A 1V35A 4RCVA 3ZWWA 4E2YA 4CV1A 1T2FA 2YW9A 2DTEA 1DRUA 1MUUA 1QYWA 4PLTA 1QYCA 4HFNA 4RDIA 5JFOA 1U3TA 5EPOA 3CH6A 4I1IA 4N54A 4RPGA 2AHRA 3HN2A 3NKLA 1LXCA 3OM9A 2PZKA 3WXBA 1W0CA 2B37A 3C3XA 4WOKA 3WJ7A 4AJNA 4OOEA 3ETDA 4J1SA 4B7CA 1C1XB 4JBIA 5FF9A 2EP5A 1R66A 1Z82A 4TRJA 4H3VA 3BTOA 3FNFA 4JGBA 4BO0A 3WQSB 1BXKA 5MDHA 1ZK0A 2P2SA 2NUAA 3GN1A 5JDIC 1NX6A 1TVEA 2W90A 3GEDA 3DB2A 1ULUA 1V3TA 3PK0A 5DBGA 1M6HA 4RLSA 2QRJA 2X5JO 4FFRA 5TT1A 2ZB4A 1L7DA 4M87A 4EBFA 1QR6A 5DF1A 1PZEA 1UP4A 1LJ8A 4BNZA 2O3QA 1ISJA 4UEOA 4Z9YA 2HCTA 4HKTA 3HN7A 4BNWA 1G6KA 1H2BA 1GUFA 4PLZA 5K6AA 2DC1A 4KDEA 1NPDA 4RDHA 5TIIA 3K73O 3DTTA 5AVOA 5A4DA 1R16A 4I9NA 4ILKA 5FI3A 3TRIA 2EIHA 3JQAB 4MVJA 3GH3A 2RIRA 5JPIA 1KEUA 4KUHA 4PLCA 1M66A 1VL6A 3KHUA 3CINA 3D3EA 4B3JA 3W1VA 2I3AA 2DUWA 3ZWYA 4XR9A 2PA3A 2NM0A 3VTZA 5F21A 1R4NA 2HMSA 4INAA 1CQJA 2J3IA 4AVYA 4R1TA 1DRWA 1GYPA 4MIEA 2VOJA 3ZWVA 3OMLA 5A5EA 1EK6A 1N9GB 2UAGA 4OSPA 2I6TA 3PWZA 4IGEA 4OGWA 4CMAA 4YJGB 4Q3DA 1SB9A 1PIWA 5IJZA 5FWNA 1X7HA 2DBQA 4FGWA 3DO5A 3DOJA 1PL7A 1D8AA 1BHSA 5FYDA 3E82A 3WGOA 1GZ4A 3LC2O 3R1IA 4OAQA 5ITWA 1A27A 3FSRA 1LLCA 4X54A 3VH1A 3Q2KA 4XR4A 1RM3A 1HWYA 2CF5A 3TN7A 4PFJA 3WTCA 3OFSA 3FI9A 3WR5A 1PZHA 3G1TA 1LX6A 4CM8A 4IDGA 4J1NA 3RJ9A 1E3JA 4BNGA 1CIVA 4MDHA 1Y8QA 2FOIA 3M1LA 1IHXA 3RBXA 4OHUA 4BV9A 3HNPA 4O5OA 1EBFA 3SXPA 3ZU4A 3A4VA 3QVOA 3O8QB 5JC8A 1EBUA 4GSKA 3RIHA 3WSWA 2X6TA 3GNSA 3HB5X 1MGOA 4HFRA 3F5SA 4RO0A 3EDMA 4XYMA 3VAZA 4TZTA 1ENOA 1X7GA 1BRMA 3IUPA 1ZO8A 1Y9AA 1F8FA 1NPTO 3H3JA 1JKJA 4A0SA 4ALKA 3M6IA 3RFXA 1W4ZA 4BVAA 2R6JA 3FPCA 4DMMA 3PGXA 3QJ5A 4I8XA 4J0FA 4IDDA 4RF2A 1U4OA 3D1LA 3GVXA 4W9NA 1A71A 2AMFA 2VWHA 2Q1WA 4B8WA 4DC1A 1U28A 3B1KA 1ISGA 3RSHA 4WLFA 4GMFA 4BNLA 4BO1A 3R6DA 1EMDA 2E6UX 3BMQA 2YDXA 4XKJA 2DBZA 1NVTA 5ILOA 5G2OA 3VH2A 3C7AA 3PQEA 4CL8A 5L40A 1I3KA 2JCVA 4L4XA 1EE9A 3QVWA 5JCXA 4BNFA 2C20A 3WGYA 5I7FA 1GAEO 1ONOA 1Y8RB 3D5QA 4KMSA 4ZU3A 1LNQA 2I66A 5HS6A 4A5OA 4CLOB 2HMVA 5GZ6A 3AOEC 4BV8A 4YYZA 2FZEA 3NUGA 4CLRA 2G76A 4CLEA 4DPMA 2GUGA 3MEQA 1EVZA 3AUAA 2PNFA 3SC6A 1XU7A 1LDYA 2VRCA 3E03A 3GOHA 4CV0A 1HE3A 3QWIA 2ZIZA 3JD0A 1NXQA 4CJXA 3F46A 1H9BA 2NTNA 3JQFC 3K2EA 3E9MA 4FGSA 4BKUA 4J49A 4DIBA 5L4SA 1DFHA 4ESOA 1JKFA 1J4AA 1PS8A 4GMGA 5DN9A 4NPCA 4DIOA 1PJLA 3ZWNA 4GX2A 4LRSB 4HNGA 3ITKA 2VUUA 1U7TA 2OP0A 3NT4A 1ISHA 2TMGA 3VHRA 1A72A 4CM3A 4GWKA 4GH5A 3DAGA 4TVOA 1ZK2A 5TF4A 4BKRA 1YQXA 4R01A 5G4KB 1P1KA 3IS3A 2HJRA 1NHGA 2DKNA 2XXJA 3DONA 1LDEA 1HRDA 3MTJA 3WYCA 2V65A 2VHYA 3TJRA 4BNUA 4NMHA 1C0IA 3ZHBA 2O3TA 1RYEA 5EQFA 2JD2A 3TWOA 3V1UA 1ML3A 1VPDA 5LCXA 1HYHA 3LF2A 4YRBA 1AHHA 4YJDA 4ZGWA 5JAZA 3OEWA 4BIIA 2W8ZA 5FI5A 1RPNA 3QWBA 5U9CA 4PG4A 3IP3A 1UP7A 3DZBA 5C3MA 1EZ4A 1NFFA 1ZXBA 2WM3A 3DDNA 4CR7A 5T5QA 1V3UA 2C59A 4QO8A 5TJ9A 2X8LA 3SC4A 1CETA 4UVEA 2B69A 4GX5A 1JWBB 5CAEA 5KJCA 3BMCB 4UREA 1UH5A 4EI2A 4DREA 3ST7A 2E37A 2GNAA 4NU5A 4CV2A 2DPHA 1MG0A 1JLLA 3JQ8B 4MPDA 4Q3CA 1L7EA 3CMCO 4DPLA 3QQPA 1LI4A 1FF9A 1KVTA 1LRJA 2Y1DA 3IDSA 1LUAA 4OXYA 1DC4A 5BNFA 5L4LA 3C1OA 2C5EA 4RORA 4YJFB 3K30A 4J1QA 3KYCA 1ENPA 4L74A 5CG2A 3L07A 4DMLA 1HLDA 5COBA 3RVDA 3WSVA 3H5RA 5DCUA 2PH5A 5KVQA 4D3DA 2FR1A 3F47A 1NTOA 1CWUA 1ZKMA 2VOEA 4QQRA 1ZMOA 1LRLA 1SEVA 2AQIA 2ZB8A 1U5AA 4AJ1A 4IIVA 5L45A 1YBMA 2QQ5A 4ZICA 1TT5A 2HQ1A 2ZYAA 3U0BA 1ID1A 3O4RA 2GZ3A 2NTJA 3O9ZA 2GD1O 4IM7A 5JMPA 2HO5A 1LDBA 3T4XA 3DMTA 1HYGA 2GCGA 3HADA 2A92A 5A9SB 5AQ1A 4NFSA 3L77A 1CERA 3NV9A 3C24A 3PZRA 4OQYA 1YGYA 1DDOA 1UDCA 1KIFA 3N7UA 4GKBA 3CEAA 4MOWA 3K9QO 4TVBA 1HXHA 1GZ3A 1MV8A 4DC0A 5JAMA 1J0XO 4XZ3A 2VHVA 2NADA 4XIJA 4PLVA 2PTGA 3FN4A 3PYMA 3ENNA 1QYVA 3PDJA 1HDXA 1B16A 4JK3A 4E5PA 2P68A 1X7DA 3H2SA 1X0XA 5C37A 1YO6A 2F00A 5CHEA 3AI2A 4HBGA 1YQDA 1WDKA 2Q2VA 3CXRA 3FCOA 3FWZA 1JA9A 3DHEA 3RAJA 2BGKA 3NTRA 1EVJA 4RPJA 4M8SA 1T2CA 1R12A 2B36A 2DTXA 4O6VA 4NJMA 4WASA 4OXNA 4UAGA 4CMCA 2YY7A 4A73A 1OFGA 5IXSA 1UXIA 2W2KB 5JSFA 3TZHA 2GN6A 2NLOA 1GV0A 2GN8A 4FB5A 1XDWA 1B8PA 3GHHA 1P1JA 5EL0A 4RV9A 1LRKA 3ZHYA 1QYXA 1C0PA 4II3A 4R4JA 3JD2A 3VKUA 4CQLB 3FPLA 1Z7EA 3WG9A 1LSOA 1Z74A 2VHXA 2EW2A 5TT0A 4IS3A 3TZ6A 4YXFA 3PHGA 2VT3A 1WNTA 3IC5A 3KLPX 4KQXA 3IUSA 1R0KA 4F3YA 3PVZA 4QEDA 2W2LA 3LC1O 3KXDA 1N8KA 2EJVA 3RD5A 1U3VA 3CPSA 2I5PO 3Q6IA 1YOVB 3UCXA 3ZWXA 3RC2A 4W7IA 4BO4A 1YDWA 2C29D 5TS3A 1KY5A 4NG5A 4OM8A 3W8DA 5CDYA 1NWCA 2H1SA 1I32A 4RPHA 2D3TA 3E1KA 4XEHA 3KO8A 3M2TA 4JJGA 2Q1TA 4D79A 3U4DA 2VTDA 1OI7A 1PTJA 1IUKA 3HUDA 4HFMA 4CMIA 5A9RA 4FW8A 4GBJA 1F8GA 5JCJA 1AHIA 3TQHA 2B0JA 3IQDB 2BFOA 4BNNA 1IB6A 3F6YA 2P91A 1CEQA 3RUAA 1E1MA 3SVTA 1N92A 4CMEA 1MC5A 3AW9A 3GPDG 2J3HA 1KYQA 3HDYA 2B4QA 3GVCA 4IJUA 4WNCA 1YVEI 3GAFA 4R3NA 4D44A 1E6UA 5J23A 1I0ZA 1PS0A 2YJZA 3JQAA 4HUJA 4CM1A 4R51A 3JYNA 3LQFA 1PL6A 1IOLA 1W6UA 3EUWA 2ZTMA 4JJIA 1HKUA 3OJFA 4XQEA 3JQGB 2I67A 4RVGA 3BMNB 5CEEA 1SO8A 4LRTB 4NR0A 1I30A 3GY0A 4PCVA 1N9GA 1VE9A 3QVXA 3WICA 4L73A 4LMPA 3AY3A 1PSDA 2FPIA 4YJGA 1E7QA 4AL4A 1E7SA 1GL3A 1LSSA 4RF5A 3ULKA 1DBVO 4MVJF 5JY1A 3WGZA 4BKOA 3ASUA 4IUYA 1GQQA 1LA2A 2X86A 2ZQYA 3DHNA 3MJ4A 4BB5A 4R16A 1KOLA 3D3WB 1Y5RA 4U0JA 1Z6ZA 1E3WB 3INRA 1CF2O 4N7RA 1YWGO 2SCUA 4CMJA 2PGDA 3DWFA 4BNVA 3VDRA 2EV9A 1GTMA 3DBHB 4NFYA 5FEUA 3QWHA 4ZRMA 5B37A 5IF3A 3ZWAA 3DBRB 4GLOA 1OC4A 3KSDO 5I8ZA 3Q3CA 1NYTA 4ND3A 4UUNA 2XPCA 3O8QA 4KWHA 5KVCA 4PLPA 4BNTA 2X0JA 3ORFA 5JW6A 4R68A 3I9MA 4MVJD 2ZKLA 1J5PA 3D7LA 2V7PA 5IXYA 1MFZA 2PY6A 1NQAO 1B15A 3GNQA 3LT2A 3B20A 3VC7A 1N7GA 1X15A 4XQGA 1XU9A 4E31A 2PGLA 1TA4A 4ONEA 3I9OA 3PLNA 4AJIA 3I6IA 5K9ZA 3DTYA 4OQZA 2UUPA 3CSDA 3JSAA 2QHXA 5EERA 3G49A 4Q39A 3JYPA 2R00A 4DPKA 1FXSA 1ZFNA 4GX1A 4ZQGA 3LC7O 2EKLA 4LCJA 5AXAA 2O3UA 3AUUA 4EJ0A 1PWZA 4I5DA 2JD0A 3VZRA 4XD2A 1LC3A 3H5NA 1DHRA 3I9NA 4BNJA 4XCVA 2QYTA 4U0KA 4YJHB 3ZWOA 3MTGA 3LF1A 1UXJA 1Z7BA 1HSZA 3K5PA 1FDTA 2BF7A 3ZZNA 5A9TA 3MJVA 4PZEA 3L6EA 1Y8RA 3AY6A 3H9JA 5FFFA 1B8VA 5KVVA 1S7CA 4CLOA 3WFIA 2GO1A 3PLRA 1UXHA 4AJ4A 1EFLA 1ZZEA 4JP2A 5IFLA 5JO0A 4Z0HO 4Z0PA 2IDZA 2R2GA 2ZB3A 5JDCC 4DQUA 2YV2A 3RBZA 4PG8A 3RUFA 2QG4A 3V2HA 2H9IA 4Z9FA 1O89A 3UCFA 1KERA 2Q2QA 3WWZA 2JL1A 1CDOA 1QORA 1YQGA 3ADPA 1WW8A 1FJHA 2NVWA 4WCDA 4E6PA 4J7XA 4WLUA 4B7XA 3VZPA 5CFZA 1VJ0A 2QRLA 3DZJA 1DIAA 5C5IA 1I24A 2GRAA 4BKPA 1DPGA 4NK4A 1DIBA 2A35A 3BA1A 2C0CA 2WWRA 3NX4A 3ROKA 5DCYA 3HZZA 4A27A 1YJQA 3JYLA 2WEKA 3K6JA 5CDUA 3VPXA 4MKRA 4B4OA 2NU8A 3ZU5A 3JQ6A 4WJZA 4IMPA 1NVMB 1QRRA 1BW9B 4RLHA 3SJUA 4F45A 5F1OA 4HADA 4XGKA 1VSUA 5BSHA 1HYEA 5TJHA 4XJTA 3DOCA 5BQFA 4OJNA 1PGJA 1R15A 4PVDA 3E5RA 3L4BC 4L75A 3F1LA 4N18A 1NAHA 1QP8A 3WGIA 2J3JA 4JIGA 4PRKA 2FRDA 2EP7A 1UZMA 3I4CA 1HE2A 5BNTA 2Y1GA 3NEPX 3E6AA 2D59A 5ICSA 4CQMD 3U9LA 2Y0EA 2O4UX 4RZHA 1F06A 3I6QA 4IJWA 1P3DA 4J43A 3PQDA 3H9GA 1B26A 3F4LA 4CR8A 2Z1MA 4GPD1 4CM6A 4EUHA 1E7RA 1NNUA 1MA0A 3JYOA 4NDNE 4IIUA 5EINA 3KBOA 1ZCJA 2IYPA 5CPFA 3IJRA 4OL9A 1DAPA 2YQ5A 3BMCA 3Q9UA 5T6BA 2O3JA 5TGDA 3VH4A 2DTDA 2HK9A 3EC7A 2Q2WA 4XYEA 2HMWA 1EQ2A 3EAGA 4Q3EA 3DQPA 4D3SA 5KJFA 1F14A 5TNXA 1VM6A 1BDMA 4KUGA 3W4KA 4Z6KA 1PJTA 4XJSA 1ZXLA 4LSWA 2WJPA 2G0TA 1LU9A 1ZUD1 2VZ8A 4MVJH 2H6EA 1D3AA 2J5QA 4FFLA 1KS9A 2J5KA 4RVUA 4DWVA 2P9GA 1P45A 4JX8A 2Q1UA 2GF2A 2V6MA 4MKXA 3GNTA 3K31A 2WD7B 1AXGA 3PI7A 3PWSA 5KVSA 2UYYA 2PD6A 3S2GA 1X13A 3SJ7A 3SBOA 2BGMA 3AJRA 4R5MA 3WGTA 4CMGA 1VRWA 3U5TA 1J6UA 3K92A 3VZQA 1DC6A 3GDGA 3OQ6A 4WEOA 3D4PA 3VPFA 4M55A 2DFVA 5K0ZA 2B4RO 1GY8A 2DU8A 3I23A 4TSKA 4GGPA 2ZJ1A 7ADHA 4XYGA 3JQ7B 5A9SA 2VCYA 3L0DA 4Z3KA 2ZYDA 3OSUA 4HXYA 3RC7A 5L7WA 1WMAA 2OBYA 4BL5A 2C2YA 3T7CA 1SBYA 5T8KA 1U2GA 4QFDA 5ENDA 4HY3A 3ZNPA 1DC3A 5KKAA 4E32A 2X0IA 1HTBA 4FC6A 4BGIA 4DLAA 4E2XA 4WLEA 5B12A 3PJEA 4WEQA 5AYVA 1NR7A 3OIFA 1R4MA 1A5ZA 1ZNQO 1XSEA 5IZCC 4B4VA 4GKVA 1DAOA 4B7UA 2BH9A 4IINA 1N5DA 4YAEA 1YB5A 4CUZA 4WUVA 5C7OO 2GZ2A 3RWBA 2XF8A 3DEYX 1SOVA 4ND2A 4RGBA 4EYEA 4DLBA 4Y67A 2JFGA 4WOJA 1XGKA 4XYBA 2B5VA 1BVUA 1I3LA 2AQKA 3E9NA 1RWBA 4YB8A 3RUDA 1SEPA 2FWMX 3GUCA 3ZW8A 2X5OA 3JQ9A 4NQZA 2C07A 2FSSA 4YT4A 3WBBA 2W2KA 1Z73A 4E30A 1CJCA 1Y81A 1BDBA 2CDBA 3CTMA 5BSEA 3I1JA 4IQGA 1ZK1A 2JCYA 4LGVA 1M6WA 5ER9A 2FR8A 4GSLA 5A06A 3WOHA 4J2OA 4YA6A 2VRBA 2VNSA 2PK3A 2CVZA 2Y1FA 3QP9A 1JVBA 4CQLA 1BTOA 5CDSA 3H9EO 4ITUA 2PWZA 3RC1A 4J9UE 3ZNOA 3C1TA 4BNKA 4D42A 1IHYA 3RFVA 3BIOA 1GYQA 5JYDA 3U09A 4C7JA 4F6CA 4PZCA 1ZBQA 3GEMA 3O38A 3V1YA 4LISA 3NTOA 2VWQA 1YL7A 3AU8A 1E3EA 3HFGA 4ZQEA 4BOYA 4GVXA 3QIVA 1Y1PA 1NAIA 3VVBA 1OMOA 3I3OA 4KDFA 2HUNA 4EJ6A 3ASVA 1Y7TA 2BI7A 4OMUA 4YBZA 1XG5A 3DBLA 3INGA 1H5QA 3X2EA 2GDZA 3E5MA 3UKOA 2HU2A 2I3GA 4E12A 1HDGO 3HDJA 3DR3A 4E2ZA 2I65A 3C1AA 1K6XA 4MO2A 1LQUA 2J6IA 4YR9A 5C7LO 2VYVD 1KETA 3ON5A 2FSVA 3ZNQA 4DYDA 4D3FA 4R9RA 4JN6B 1ULSA 1QLJA 1XHLA 2BFPA 1KVRA 3AY7A 1HSOA 3A1NA 3TNLA 5KJ1A 3QSGA 4CR6A 1UXKA 3DBVO 2WYWA 1HLPA 4I08A 5GY7A 3IAHA 4O63O 3O26A 4FOOA 2IXBA 2G17A 5HRUA 4Y6SA 1EE2A 2DQ4A 1PJ3A 1DIRA 3QA9A 1DXYA 3L9XA 2B5WA 3JQGA 4J9VA 4TMFA 3RUEA 4PLWA 3BMNA 3ITDA 2OXIA 5L51A 3ZN2A 4NH4A 4MJLA 1BXZA 4R1UA 1MP0A 4ROSA 2HSDA 3DAFA 4B3IA 2Q49A 2RAFA 1DRVA 5TX7A 2IEBA 3LLSA 4FDAA 4YRDA 3VPSA 4D0RA 3MJSA 3DZKA 2TMDA 1VKNA 4DBZA 3W8EA 1XEAA 1H9AA 3QW2A 2PD3A 1E3WA 4WPGA 4ND4A 1O9BA 3H5AA 2NU6A 2FY8A 1NQ5A 1QSGA 4CM4A 3MZ0A 4PLGA 1ZEJA 2Z1NA 3DBHA 3GZNB 1TB4A 5TRTA 4IXWA 4B79A 3DBRA 1FDWA 1GUYA 1PGPA 3CE6A 4D41A 1VC2A 5JXWA 3R3JA 4CM9D 1C3VA 1LQTA 1ADCA 4C7KA 4BNXA 1WZEA 1RKXA 4WLOA 5JBIA 2YHIA 4XDZA 4BB6A 4BO7A 1I01A 2IRWA 4CM5A 5JYEA 3ZHXA 1C0KA 1GCOA 3GGPA 4U5QA 4DRYA 1P31A 4P38A 5LC1A 3SX2A 1NHWA 3JTMA 3ZV4A 4AJPA 3Q11A 4AJ2A 4ALMA 3BMOB 3TZCA 2E4AA 3WJAA 1YXMA 4EW6A 3TDKA 4C4OA 1UAYA 4H7PA 1ONPA 5ENVA 3WWYA 3WQQA 2IXAA 3ZV6A 1GQYA 1TLTA 1IY8A 1UXGA 2QW8A 1DEHA 2GGSA 3NDJA 2HMTA 5F5NA 2Y68A 5ILGA 3ZI0A 5IZ4A 4I5GA 2EJWA 4JXKA 4DLLA 3WYEA 3ZU3A 3GPIA 3LT0A 1PX0A 3CIFA 3JV7A 1BGVA 1O95A 3EVNA 4IDEA 1HEUA 4YAIA 1D1TA 3GG2A 4ND1A 2Q99A 1GPJA 4KZPA 1U8FO 3GG9A 3VZSA 4YJHA 2DM6A 1B14A 1X14A 1U5CA 2VN8A 3G79A 4FBGA 4JLWA 4OYRA 3W4JA 3GR6A 1XA0A 3KVOA 3WBFA 3PZBA 3AFNA 4TZKA 2FMUA 2NSDA 2NVBA 5IG2A 3V8BA 2O23A 3EZYA 5T64A 2VUSA 3AOEA 3ROQA 1GADO 1ZJYA 2ZATA 3OBBA 4TWRA 3ZV5A 1HT0A 2I99A 2X4GA 4G65A 3PXXA 4YT2A 2X22A 1PL8A 3B1JA 5AOVA 3GT0A 4J2HA 3WQRA 1UAGA 2V6BA 5L7TA 1PWXA 4EJMA 2Y05A 2FHSA 1G1AA 2GPTA 3EGOA 5COQA 2PLAA 5A3VA 1KC1A 2WDZA 3JQFA 2Q4BA 2YHUA 1I2CA 5JE8A 3FTNA 4UUPA 3SLGA 4UVIA 3NYWA 5DOZA 3M2PA 4NBUA 5KJ6A 1H0KA 3IKTA 1SC6A 3OHSX 4YQYA 2YUTA 1GR0A 4FOSA 4ALLA 1HE5A 5DCWA 3NTQA 4ZVVA 3ZDFA 5KTKA 3ANLA 3FNHA 2AA3A 4DTIA 4W6ZA 1LSUA 4ND5A 3PRJA 5JC1A 1BW9A 4PG7A 2YZ7A 3LT1A 1T2EA 3TPCA 2C5AA 1UZLA 2H63A 4J4BA 4J90A 4MINA 1E5LA 1U3WA 2B83A 3A9WA 3BAZA 3S2IA 1GYRA 2BRUA 4ALJA 1QYDA 4J0EA 2EGGA 1WP4A 5I7EA 4CMBA 1A7AA 3FTPA 3TL2A 2CY0A 3PTZA 5TQVA 1P1HA 2ZTVA 3I9JA 4IQ0A 4AJJA 4DGSA 2BD0A 4W99A 2Y66A 4G2NA 3ZWMA 2BMAA 3ROMA 4G5HA 1Q0QA 2NV6A 4M54A 4R54A 1FDSA 4K26A 4S3MA 1O6ZA 4FPXA 2BLLA 3DC2A 3EK2A 3X2FA 4DIFA 3MWDB 4Q3BA 4BNMA 2WYUA 4HNHA 4Z0TA 1I10A 1Y8QB 2YFQA 3KOUA 1YB4A 4PGFA 1R0SA 5KWEA 1NWHA 1K2WA 2NU9A 4TRRA 3EZLA 4BGEA 3LU1A 4R9SA 2J3KA 4L4RA 2PKQO 1IPEA 2JHFA 3PJFA 3RFTA 4KOAA 1I2BA 1XIVA 4XYLA 3JYQA 1AN9A 1NPYA 4WKGA 1E6WA 2B35A 4RVFA 5IN4A 3GEGA 4EZBA 1C1XA 2ZJ0A 1H6DA 1KEPA 3QHAA 1ZVMA 2EEZA 4OIMA 3KSZO 3LSYA 1GUZA 1O94A 1HDRA 2ZB7A 2VYND 5DP2A 4GI2A 1X0VA 4TKMA 4BKQA 2NTVA 2I76A 2X9VA 3RKRA 4RF4A 1G0OA 1XQ6A 4L76A 5DBFA 3AM3A 4FQ8A 1M67A 1YH3A 3ICCA 2AQHA 4E13A 1HZJA 4YVFA 4UUOA 3WIEA 2CZCA 2Q45A 3VH3A 4CLXA 1KC3A 2DFDA 1KVUA 5BSFA 2PD4A 3OH8A 1PZGA 4OSOA 2JFFA 1LSJA 2IZ0A 2XOXA 3H7AA 5GMOA 3JQ7A 3U49A 1GQ2A 1ONNA 4BMSA 2V6GA 1P0FA 1T2AA 1BWSA 2DLDA 4ZQHA 6ADHA 1JVSA 1NASA 3OICA 3P2YA 3TOXA 1VJ1A 4L0QA 4R41A 2X23A 3KETA 2HRZA 1Z75A 4CLRB 2AG5A 2PZMA 4CQMB 3AWDA 1IZ0A 3JCZA 1JU9A 2O4CA 5ITVA 1BMDA 1VSVA 2AG8A 1CYDA 4W82A 2D8AA 2VHZA 2GYYA 2YDYA 4ALIA 5A3JA 1K89A 4MVJP 2X7HA 4M49A 4RVDA 2F1KA 1XKQA 3B70A 5T67A 3TL3A 4EITA 1E7MA 4L8VA 3H65A 4L9RA 4FCCA 5G4LA 1VJTA 1ISFA 4G81A 4AJKA 3GMSA 3KM0A 3GVIA 4PLFA 3RBVA 1SMKA 4O59O 3COSA 3UUWA 1QV6A 1XWFA 2BFMA 3RC9A 5IDYA 1A9YA 1PJQA 5HM8A 4HP8A 2G5CA 4BS9A 1TEHA 1DIHA 3JQBC 4BO9A 4JCOA 3ANMA 3F1KA 3DZIA 1IPFA 4JROA 2CSUA 4D43A 1ZSNA 1P0CA 1PJSA 1ZSYA 4BNYA 4WCFC 5L4NA 3GK3A 1E0DA 2UDPA 5IDXA 9LDTA 2PZLA 3V2UA 2P5YA 1YE3A 3DXFA 1NP3A 4MVJE 2NACA 1X1EA 3ZWBA 1JN0A 5CEFA 1DHTA 2FZWA 1HDZA 1SOWA 4FJ0A 2EWMA 1T24A 3EVTA 3WLFA 3OECA 3S2EA 4E21A 3ZCXA 2OUIA 3AOGA 3KTDA 3PEFA 5G0WA 1Z45A 2RHCA 4J7UA 2GR9A 4CL3A 2VQ3A 1Q0HA 4MP8A 4J1TA 3KEQA 3VKVA 5H81A 1KVQA 4P8RA 1V3VA 1EFKA 2RCYA 1O0SA 1B2LA 3MWEB 2FPGA 4CM7A 2D5CA 1ZSVA 3QWAA 1ZW1A 3LZ6A 4NBRA 1WMBA 3V2GA 3TF5A 2JCXA 1GV1A 3O03A 4J3FA 3ADOA 2E82A 1K5HA 3WLEA 1PU2A 5ADHA 4FS3A 1T1RA 4BNHA 2AEMA 1GFSA 1R0LA 1R6DA 3EYWA 4MP6A 4Y9DA 1E77A 3PIIA 3A14A 7MDHA 1T1SA 2RBEA 3CKYA 2D5AA 3D4OA 3TFQA 4FFPA 3WMXA 2GERA 3F5QA 3F3SA 4TQGA 5GZ3A 4K9DA 1U4SA 4PLHA 2Q3EA 1UZNA 5CG1A 3AU9A 3NGXA 2ZCUA 3RKUA 4RZIA 3KYCB 1YS4A 2I9PA 4YT5A 1PEDA 4D0SA 1VL8A 2WE7A 4LN1A 4D45A 1VL0A 2VZ9A 2GASA 3HFSA 2EHDA 2WYVA 1GZ6A 4IPTA 3QWFA 1BXGB 3PPIA 3FWNA 4I5EA 3RUIA 1TT5B 2VT2A 3NRCA 1T4DA 2EKQA 2IZ1A 1HETA 2GN4A 3R3SA 4KTTE 4B4WA 4BO5A 2UUOA 5K6AC 3JQCA 5B4TA 2BI8A 3WGGA 2QZZA 1FMCA 4CV3A 4P4LA 4FSHA 4CUKA 1SZJG 5G4KA 4FJ2A 1B3RA 3UVEA 4FC7A 4BMVA 3MOGA 4EUFA 4A03A 4CLDA 2QYSA 4D46A 4U6SA 3K96A 4IZHA 4P22A 3FHLA 1I36A 3JQDA 1K0UA 2ET6A 3WB9A 3PYLA 3R0IA 4QFCA 2UV8A 4NU6A 2Q46A 3GZNA 2X0RA 3G0OA 5I8WA 4L4SA 1S6YA 4GX0A 1H6BA 3GZ4A 2YV1A 3I9LA 4LVUA 5EJ2A 1HZZA 3KRTA 2EGHA 5ES3A 3ETEA 1MFPA 2IE0A 1N2SA 4WGGA 2O2YA 3LT4A 1CQIA 2O50A 2VRCD 2Z5LA 1A4UA 2Z95A 3D4NA 4ZQFA 3WNVA 4H15A 2HKIA 3WYBA 1ENZA 5JAIA 1CRWG 3NT5A 1D7OA 4RPLA 1ORRA 2LDXA 3N74A 3I9KA 3PHLA 3TZQA 3F4BA 4XGNA 4XX0A 3GGGA 3BMOA 3MJTA 1GU7A 2J8ZA 5I7VA 5BT9A 2WMDA 3JQ8A 4NBWA 3KEOA 3U4CA 2EG9A 4Y8VA 4DL9A 4M86A 3WX0A 2XXBA 3TFOA 4OH1A 4FN4A 5A05A 3RI3A 4HX5A 2YV3A 5F1KA 1Q7CA 1WDLA 1GDHA 5G0VA 4NK5A
chains in the Genus database with same CATH superfamily
3HO6A 4IY1A 1BKSB 4UC0A 1N1GA 3QXJA 2FLVA 3DNPA 1TUGA 3EZ7A 2QJTA 2H4XA 3OTGA 1NN5A 3FUVA 1F12A 4M7RA 5KTPA 2HMUA 5JS2A 1SXHA 1DOZA 1IZZA 3RVNA 4RWEA 4ABYA 1M5UA 1ZD8A 3R24A 5DM2A 2NO1A 1V6AA 1QPZA 1RJ9B 1U28C 3EMBA 3P19A 1AKYA 3UKDA 5B3LA 1E9DA 4R3WA 5SZJA 3LNCA 3DHYA 1LDMA 1GGHA 1S4QA 1GSAA 4HEA6 4TOIA 4LFCB 4G56A 4AX4A 1KH2A 4JLPA 4FSXA 3ZHZA 1Q3HA 1EUCB 1CY6A 2WFLA 4FMDB 3GRKA 1BHO1 2JFNA 4PG5A 1NC3A 5F77A 2OCGA 1U0LA 3E7WA 4E08A 1Y9ZA 3UOWA 3GRPA 4E03A 5I4CA 2VBGA 3EEIA 4X1YA 2GPJA 4G4JA 2AKYA 1EK0A 1I2ZA 3IOYA 2VO1A 3QUBA 1LQ2A 1ZJZA 2PH7A 4JSTA 3L6BA 2O3RA 3G17A 3MTQA 5ALNA 4CMIB 4G0VA 2J09A 4RQTA 1PFWA 4DV5B 1QNLA 3HRIA 1VG8A 1R6TA 4A2CA 3ILYA 1NIJA 1NMQA 3ZQJA 5B1HA 6REQB 2IIPA 4EB6B 5F3RA 1W4BA 1EA7A 1SIUA 2P77A 4ISBA 4BBPA 4M9ZA 4MGHA 3DT6A 4RVCA 3VV2A 3WTBA 3SX0A 4O4HF 1Z5UA 4LF8B 1FU4A 3ZQKA 4YWJA 2AF3C 2X14A 3RH0A 1TM1E 1QOZA 3NDIA 3L8MA 1TZ2A 1O9HA 2BFAA 5LDGA 1T3GA 3QVGB 4DLPA 1UKAA 1UFRA 4IOLA 3SEAA 4GG1A 1HL3A 1RP1A 1Y1KE 3ANNA 3DFIA 5JQGF 4KR3A 1V8BA 3RS5A 2N0SA 7MHTA 1HT1E 2JFOA 3P2MA 4JIMA 3JPYA 2X1MA 2QX6A 2XNJA 4MVJI 4HPWA 5IANA 2HV9A 4Y18A 2CNLA 3GLGB 5EGNA 2FVYA 5L9AA 3I8SA 4OHPA 2B25A 3AV3A 5AVUA 2C1XA 3A6FA 1MW9X 2EYUA 2XAAA 2GJKA 3AVYA 1T8UA 2JJ2A 2WJAA 4MUIA 4RJIA 3TNJA 3OZDA 1T8WA 1GPDG 2QTWB 2XA1A 3Q0EA 2CHUA 2HXGA 2VCHA 3AUTA 2WUGA 1H0HA 1ZBDA 2G1UA 1AS3A 1LJUA 3TKLA 2DUUA 3WL7A 3OIGA 2M1XA 5GM2A 3UJ8A 4Q7JB 3IMEA 5JNVA 1J24A 1SD2A 3DMGA 5CFRA 4AQYB 2AEJA 4I1RA 2XIJA 4H08A 2NP6A 3K0CC 3QOXA 1C14A 2BGWA 1UDRA 4CL0A 3OZAA 3NT2A 3LY5A 2QDKA 5HTOA 3X1KA 4I5IA 2H1OA 1E1LA 1TX4B 3AL2A 3FYUC 2FW1A 4MQFB 3EC2A 4R2XA 1QIKA 2JHGA 2X1HA 3G5TA 3KLBA 4QG3A 5JEDA 4YREA 4UBMA 4OG2A 1W36B 2E49A 2W98A 3AK4A 3FDJA 4ENWA 1IN1A 4B45A 5H02A 1J49A 2OQVA 1U8TA 2ZYWX 1RAHA 1XJ5A 1Y63A 4N6OA 2WSYB 3S2FA 1VDMA 4MUNA 1VHTA 3CZMA 3HP1A 3KZ1E 1QIEA 4W5QA 3QVSA 1S3IA 5K8CA 1I8TA 2VF2A 4NCXA 2WINI 3L0ZA 1G5IA 1OX4A 2PFGA 4JAVC 5ALKA 3RT9A 4CL2A 2HA7A 4XD7D 3K0BA 4BO6A 1DCKA 2F8SA 2ODTX 4R2KA 5EYPA 2JLVA 1WDWB 3INTA 5T41A 4YDRA 4BGVA 4UJ5A 4RSHA 1H22A 1UKBA 3DFZA 3KKLA 4MPJA 5DHRA 4F3TA 1Z4QA 4M7OA 3JZIA 4BY9E 4PIVA 2HAEA 5B7PA 5ELLA 3B6JA 5HF6A 5MFPA 2QRKA 4DIMA 4MI1A 1DVRA 3N0VA 1VKOA 3LUGA 5BSGA 2R751 4M37A 4EG1A 1FP6A 2JLBA 2ZWPA 5TQ0B 1X8XA 3KHSA 5AVTA 3T06B 1G8YA 1IZ9A 1F2UA 1XC7A 3NBMA 3P27A 5LOVB 1JKIA 1ZJ4A 8LDHA 2W83A 3RRJA 3SLKA 3WQHA 5F5LA 4H0NA 3PYXA 1EFTA 4BO8A 1ODLA 1XTJA 1PQUA 3EODA 4TKVA 2WWHA 1Q6ZA 2ZETA 4K6FA 5T57A 4G3XA 4GAEA 2XUZA 1DJNA 1RIIA 1NM5A 1M2WA 2J41A 3HEMA 4D81A 3VVCA 4US2R 1ZNYA 4A2PA 2PVSA 2ZULA 1TLFA 2HCFA 2ZSEA 3OQ1A 2QROA 4N82A 4QJIA 2RHDA 4TRNA 5FBZA 1BHJA 3PC6A 5BN5A 2ZSKA 1RYDA 2FRXA 4U2GA 5JZBA 1QE5A 4A8TA 3FOFC 3W78A 4OCZA 1P5JA 1TI7A 4FVTA 4GBGA 4DVGA 2IIBA 2PUJA 3D3WA 3A9UA 2YMPA 5AK4A 4LQ4A 3MK31 2ZJZA 5K3FA 4XUGB 1CT9A 1JG2A 4ZMBA 2F43B 3PD1A 1SAYA 4M1MA 4JLUA 1Z38A 3AP3A 4GQAA 2WRZA 5IAOA 1SBTA 4NV0A 5IJ9B 4E0BA 1YAJA 1Y37A 4RETA 1GEEA 4X1IB 5EE9A 3UHOA 3L4KA 3GJ8A 1MO2A 3ED1A 4JNKA 4HAIA 4RHEA 2X40A 5CLGA 3TXYA 5JCJD 4MMYB 1C0LA 4YCAA 2WKRA 2YRWA 3QV2A 4MKZA 3AEUB 4WCFB 1R27A 1Z12A 2C5FA 5KCZA 2OTCA 2FXVA 3BZWA 4JYCA 4QPJC 4XWAA 4YMWA 4U7DA 1UJBA 3IUMA 5HFNA 4URFA 3ZBPA 1O97C 3MJEA 4WRRA 3EA4A 2WSSA 5K0GA 4Y2XA 4M0PA 3IVRA 3IE1A 4PGAA 2OYCA 2FZGA 4WFQA 1C7FA 2YFHA 5I9SA 3RU9A 4AYTA 2DPYA 5EXTA 4L4UA 2P3SA 1JEYA 1WMEA 3A4TA 2PFKA 2XGSA 1CZNA 1SU6A 3PUJA 1QG6A 4BQOA 1QRTA 4H6PA 3F9CA 4F8YA 4GWGA 3HUTA 1IIRA 4EFNA 3VNUA 4HWTA 4GLLA 4UDOA 1DMRA 4OMDA 1ZISA 5C0OE 2YN4A 4CFSA 3IAXA 3H2KA 4H4EA 2BHSA 3SXJA 2Q3MA 4Q34A 1G4AE 5BMOA 2AN3A 1YB6A 3B3QA 3C6ZA 3PCXA 1Z4LA 2D0IA 3ZGYA 1T25A 1TM4E 3HJCA 3ZW9A 1G8MA 4GHWA 3F90A 5HJ5A 5E8RA 2H2FA 4OHMA 3MINB 1E8MA 3FDZB 1PJ2A 1TTHA 3CUYA 3NPMA 3P9PA 3ZKAA 1Y6FA 3QY0A 3B6MA 5GPBA 3NR2A 3V1TC 2GWHA 5C5EA 2PUBA 2BMJA 3A4LA 2Y2UA 1UANA 2FMFA 3TQQA 4BHTA 1D2RA 4L78A 3HJHA 2H2AA 2XA9A 2ID8A 1CUGA 5EIBD 2W6QA 3ISJA 3H1AA 4ZXFA 5MN6A 4E15A 3KUUA 4M53A 5ESXA 5C8YB 5HR5A 3V55A 2PDAA 2Q5HA 4Y2UA 2NYUA 2PWAA 3T7AA 3AVWA 4WA8A 1OFIA 1SVKA 1MEJA 3NOOA 3PQ8A 1AXEA 2G4CA 2C7OA 3RTAA 1PEYA 3S8MA 3HMKA 1CR1A 3KE8A 4IJ6A 4K8RB 4X84A 3R3HA 5BUQA 1UPXA 4XB1A 4NG4A 1JEJA 2II6A 2P9CA 4TMXA 2CMHA 5F9HA 1TCCA 2Y3IA 3ODGA 3BHJA 1V25A 3QNUA 2G5PA 4LBVA 4Y6PA 9LDBA 1QFJA 1PX2A 4HS9A 4CDGA 5TF0A 1Q7BA 1YACA 3GJRA 3P7MA 4D98A 4EDHA 2H5JA 3A6EA 1Q7RA 1IH8A 2PH3A 2EVWX 4S0XA 4CMEC 4Y6RA 4C7XA 5WRFA 3HBFA 3BZUA 4O2AF 1AKMA 4RJKA 5EMJA 1SRRA 4P4NA 4OJKA 1MXFA 2HIAA 3E2MA 4Y7CA 3ZYCA 1B6TA 2NNWB 4C0BA 3P97A 4ALNA 3MPUA 1JQDA 4CEHA 3ZH9B 1J2RA 1REQB 2JI7A 1HEYA 2HWXA 4HWKA 1B6GA 3A6JA 4NJOA 4P4TA 2FZVA 3ZK7A 1NE2A 5THQA 4HHEA 3A37A 6REQA 5ARCA 5LQRA 2VK2A 4NAVA 5A6VA 3IJEB 4FLEA 3HB0A 4B3SB 5IN5A 1QK4A 1A7KA 1RNLA 2OG2A 3FR7A 2PBFA 1WZIA 4BFCA 1HEIA 5DHQA 5MF6A 3JAKA 1W8DA 3DMYA 5AJHA 3LK6A 3SC2B 5THKA 5ERGB 5G0UA 1LY1A 4YXWA 4BMOB 2PG3A 4UEJA 3VDMA 2C5GA 1KZ4A 3ELWA 1C9DB 3HKEA 4UCFA 1MHTA 1V4BA 3BREA 2EWWA 2HSZA 2LKDA 4IV5A 1WCWA 4OIFA 1TYDE 1T10A 5H16A 1R0ZA 2GHQA 4RNCA 3RSFA 2UVDA 4WNYA 1M8GA 5CGQB 4H9GA 4CEIB 1SIWA 2J5XA 4NLLA 5DHTA 1ZK3A 3RBAA 5E9QA 4X95A 3P2IA 3CW2A 2HQRA 2BSXA 2OP1A 1YDEA 3L6OO 4E5VA 2H4WA 1RI3A 2OO3A 4BRZA 1CULC 1IXRC 1UMBB 4JEMA 3SK0A 3U7QB 5TY0A 3VJMA 5EHIA 2NYAA 3I01M 2WSBA 3B5EA 3IP5A 4F7DA 4WBNB 4PZUA 3Q3JB 2YZNA 4OQLA 3ENWA 1EX7A 3GQVA 2R7MA 3FNGA 3N8NA 2LIVA 1LEHA 1JHQA 3IEKA 3SZOA 4BX3A 1Z34A 1H66A 1ADBA 3DTNA 1VI2A 2V6FA 3ANTA 4HDNB 4IMIB 2R85A 4IX1A 5EMHA 4E3ZA 2VZ0A 4HOYA 3S1LA 5C8VA 1JW9B 2J3LA 2OCKA 4X64B 2PCJA 3BXXA 3GGOA 3L6DA 3GN2A 4GDFA 3VJRA 4QO7A 3FD8A 1M75A 3OLQA 4HFJA 4UU8A 2PGJA 4BN4A 1FFXA 5HQTA 3ISTA 1RD4A 4Z4FA 4H0CA 3LVQE 3DT8A 1MD9A 1QGZA 2BHRA 4ZO8A 4YASA 2ROQA 4B2YA 4B44A 1WA5A 2WA2A 3PJDA 4DRXB 3N8DA 1P2BA 4DJFC 2AR9A 1MW8X 5GJWC 2VQSA 1PGOA 3NTVA 5CJ2A 4WE3A 3AGQA 2FEWB 2WG0A 4WNAA 5B4VA 4ZRNA 2Q5EA 1A4IA 4XA8A 1OJ7A 4N5NA 4U8GA 3DBLB 2ZI3A 3L4SO 4EY6A 2DVMA 3EDQA 3BMQB 2R5FA 3PC8C 2DX7A 3NYQA 3WNVA 5KQSA 3T3PB 1BX0A 2WTBA 3LL4A 4F72A 2P9EA 1ZJJA 4E94A 4WJLA 3D64A 4LDJA 1TM7E 3BWMA 3P1JA 1SKYB 1GDDA 3Q3EA 4D97A 3OJLA 1MR3F 1DWPA 2MINB 3FF4A 1N2ZA 2CVFA 5GV8A 2GF9A 3CPHA 4YAUA 3JAMA 3FRIA 3N2LA 4U6NA 1V6SA 3ZUGA 3B1VA 3VNSA 1KXZA 5AK3A 4HDKB 5JFTA 4GL4A 2QN8A 1BCRB 3G7NA 2RAUA 4OU5A 2ZJ4A 1QRDA 3LZDA 3U62A 2G70A 3O3MB 4OAOA 2AE2A 1C9JA 3UN1A 5M5BA 1AXRA 3GLQA 2Q4DA 1PWYE 2DHEA 2FZ5A 2HLPA 5E2BA 4I5FA 2O14A 3IIKA 3DMNA 3OIWA 2GEKA 3FDIA 3MJFA 1FXUA 2JBAB 5L7YA 1HBJA 3JD4A 1NDQA 1AZLA 1G66A 5A02A 3G23A 2V3CC 1N7HA 2XNDD 1GILA 3LKZA 2C2GA 2OBFA 4FJ1A 4YRTA 1VLZA 3Q4GA 2O0JA 1WZCA 1GLNA 4IX9A 4NXMB 4IWYA 5GJBA 4CWAA 3PRKE 3G13A 4CTMA 5J5AA 1G0NA 4YP1A 2Y1CA 2XZPA 2HU7A 3MPOA 3B5JA 4C4ZA 2FSFA 2I2FA 4WKPA 1QIGA 3TRJA 1SXIA 5KYUB 3O0DA 4BU0A 2Y1WA 1EBBA 3OUUA 2I34A 2E48A 1J0CA 2IY8A 1JDJA 3WMWA 3M1IA 4ZJUA 3RRBA 1QIJA 3GXOA 2E3JA 3WO0A 2O3SA 3F2VA 2PL9A 3Q5GA 5EZQA 5HX7A 1Y98A 1MB0A 2P78A 1THZA 4HJXA 5D1HA 4S05A 1NBHA 2YWEA 1T0PA 4PSUA 3HBMA 1JIVA 4FEYA 4QX6A 2GZ1A 1V1MA 4V3CA 5EQTA 5LZ8A 3OIDA 1JZQA 1NLYA 3IR6A 5HCUA 2OKCA 2Y9MB 1QDUA 4NBSA 3ICPA 4RXTA 3G2PA 1LDGA 2XQIA 4ER6A 4BUCA 3MAJA 3T7KA 2YN2A 2VWPA 1GGVA 1SHUX 1JQJC 4O3MA 4NAUA 4MUEA 1EXVA 1QRAA 4F84A 4KWTA 2IU3A 1W0KA 4KP7A 4EYSA 2CD9A 1YMQA 3QMVA 1H2XA 3PHHA 1D2AA 1WHSA 4KJXA 5HCIA 1R0CA 4PZAA 1SELA 5EP4A 4HNUA 1D07A 4HNAB 3I2FA 4J07A 3NAQA 3K5WA 1ONSA 4TX1A 2ORVA 3AR7A 1GGJA 2HEGA 4PXAA 3MYYA 4MLDA 3C98A 2ZBQA 1MA3A 2YHIB 1JLRA 1SD1A 5L6LB 1QGDA 2HREA 2HRCA 4HRVA 4I36A 3KV3O 4K6CA 4X8LA 3GP3A 1KRXA 1LTKA 3SEQA 2A9PA 1E3LA 2Q5IA 3M6LA 3N0XA 4I9HA 3Q41A 4KVAA 4NHEA 5DTMA 4YQZA 4A8PA 3G1UA 3WRYA 2XVYA 4C4YA 2PZJA 1K6IA 4Y2TA 5NULA 1L8QA 2O19A 4CE6A 3ZJVA 5AK6A 1EWYA 1UM9A 2F64A 3MMZA 4JX9A 3SG0A 1EVIA 2IU6A 1JDBB 4ROTA 3U7IA 5ADVA 1E5DA 1DBIA 2O59A 4R1NA 4RZQA 1JXMA 1VLQA 2A84A 4LZPA 2IHBA 3UAGA 3AKZA 1N78A 2ZUUA 3V7UA 2PEYA 4Q24A 2O2IA 1ZRHA 2HYIC 4UVDA 3EH2A 3ROFA 2J0EA 2FJ0A 2NVUA 1XQ1A 3HYCA 3R76A 3K2QA 2Q1SA 4H35A 1IJBA 3SBDA 4P5DA 3VJKA 2Q4OA 1E2PA 1OZHA 4KIUA 3UF0A 1PLJA 2BFCB 3SF0A 2DSNA 3HDHA 5I9LA 4GVLA 5BSMA 3EVZA 4OTZA 4ID3A 5AJTA 3LCMA 5ALSA 1ZX1A 4UU0A 2B94A 1DLIA 8ADHA 3K9NA 2FEKA 3SSOA 4U2BA 1AZTA 3TOZA 2V0CA 1L7AA 3E27A 2LCQA 1L5WA 5A0TA 3H4VA 3CY6A 4O2BF 2BFBB 2DAPA 1K97A 4TUYF 2DMRA 3X44A 5BWLA 3CMMA 2FZKA 2OCBA 1Q2UA 3GJ0A 3KV1A 3KYDA 4G07A 4JC0A 4GE0A 2DR0A 2P0EA 3GFGA 4E2WA 5JS1A 1HF3A 3EEOA 1OAAA 1DFIA 2IOFA 1U2TA 4BLOA 4A0QA 4DUGD 1JB9A 1E3IA 1OLSA 1YJ8A 4JVLA 3M5CA 3MS4A 3V1LA 5CW1A 4V3BA 5HWSA 3BTSA 1WUKS 2WMOB 2PIDA 4ZAGA 1S0UA 2DUNA 1QZUA 3PITA 2NWQA 3Q7PA 2WF7A 5KYTA 1U1CA 3OPMA 4B3XA 2WU4A 2XYQA 4MEAA 2PTHA 3UICA 2C04A 4RXMA 5I7HA 4D0LB 1UFVA 5LMCA 2OHXA 3VR5D 1PCXA 4NI5A 2A6PA 1KEVA 1LI5A 2NSLA 4DSOA 2LW7A 3DVAB 3H42B 4NBTA 3RQIA 3ZU6A 4C7MA 3ADCA 4U5XA 4CKEA 1AKVA 3OCJA 1RJWA 3FRJA 5CB4A 2ZRIA 2CE7A 4OY3A 1E9RA 2NTEA 3F6PA 4LWPA 3ABRB 1ACJA 2N46A 2O7QA 4AXXA 4YMUA 1B8UA 1NBWB 5PGMA 1YONA 1XI2A 3ENZA 4GXNA 3D43A 3BEDA 4TKUB 4EKGA 2OBNA 1YFZA 4NJMB 2HD4A 4NBVA 5C35A 2P8SA 1F4LA 1TA9A 2CNBA 1TMKA 2OXCA 2Y1LA 5DLPA 5F76A 2O2CA 1U1GA 1JJ7A 2WUWE 2OPBA 4ZAZA 3WGKA 3K6SB 4XOIA 4GPBA 5KTSA 4UNPA 2OL4A 4IDBA 4IQ8A 3N87A 4H4CA 1M2VB 4WBSA 4BX2A 1XPJA 3G0BA 2FX3A 2WFAA 4IFEA 1JTVA 3UWOA 1U6KA 4IKOA 4BVEA 4F1WA 2WTAA 3VOSA 1K3TA 4FCTA 4WFIA 3IMGA 1NRJB 1Y4DE 2IODA 1W0JA 2Z04A 4HAYA 4DJJA 2JFWA 1A95A 1PGNA 2C7GA 3FPKA 1H8HD 4HX9A 1OLXA 4RSRA 2FRVA 5TSDA 3LUKA 5DLQC 1V1RB 1RI4A 5ALFA 5LXTA 2IS1A 3C15C 2DBYA 3HUFA 3RARA 1V35A 3VBCA 3A6DA 3ZWWA 3U4MA 1YS2X 4R1QA 2YW9A 1FMJA 2GEFA 4N49A 2I6SA 3L2OB 5CCXA 1FFWA 2HJVA 1DRUA 1GCIA 1KO7A 2HU5A 3PUXA 4PLTA 4RMGA 3MWJA 3CT4A 5LDDC 4I1IA 5EJGA 4N54A 4RVOA 4WXMA 2AYXA 3NKLA 2PZKA 2BSAA 1XZKA 2WMYA 1JEQA 5LU8A 3ZS8A 4AJNA 1C30B 1ZN9A 3D4IA 3ETDA 3I72A 4RMHA 2JW5A 1DJLA 4QC2A 1KYXA 1C1XB 2R84A 3G8BA 1QE3A 1XTTA 5FF9A 4NE9A 2CUTA 1J42A 1R66A 4QASA 4PPQA 1YOBA 4ZANA 3FNFA 4OX9Y 4BO0A 5FJIA 1BXKA 1YZYA 3CRW1 3Q10A 3UUFA 3GN1A 2IPMA 4RFSB 5JDIC 1TVEA 3AEKB 1GHTA 3GEDA 1PVOA 2JHPA 1UBNA 1WZNA 4YYEA 2C84A 1ULUA 2JGKA 3PK0A 3HCDA 3K9HA 4FE7A 2EZ9A 2X5JO 2JAXA 2IZ7A 4Q12A 4IP0A 1L7DA 3HJRA 1Q0SA 1SQGA 4M87A 3ICQB 2RGAA 1QR6A 2ADMA 4PX2A 4LYFA 5CVUA 5DF1A 5E95A 5AUQA 1NYRA 4ZODA 2A5FA 4Z9YA 4RTLA 1KJ8A 3H8SA 4U02A 4AMYA 4ZKDA 3IT2A 4X6LA 4OB6A 1NPDA 5BW5A 3LY7A 2R8YA 4DV4B 2H5EA 5FI3A 4HLQB 3VNQA 3TS1A 3V4LA 3JQAB 2C9BA 2IV7A 3FX2A 3GH3A 4K81B 4NOKA 4FGKA 4ZVPA 1J8DA 4RKYA 1M66A 1EVEA 1T2UA 3GUUA 4M76B 5F2OA 4QM7A 2GBLA 2P0YA 1VZ3A 3LXMA 4QLAA 1ZG3A 5DE3A 2ADFA 1FX0A 2I3AA 3WNCA 1JI0A 4DM4A 4WXHA 2WDPA 1EX9A 3PKIA 1LFAA 2XDYA 2HMSA 3H97A 2IH2A 1FYEA 3TOSA 3UMCA 4OLFA 1DRWA 4R1TA 1BDIA 5F7XA 3H1EA 3MCZA 1RJFA 2I6TA 1JBQA 3C8ZA 2Z4SA 3GAMA 4FFSA 3NFRA 2WWWA 4Y1RB 4EG8A 3TD9A 4CQNA 3IALA 5LFAA 1EWVA 1HMYA 4C7OA 4CKCA 5IJZA 1QTIA 1X7HA 4JBNA 1Y3IA 1U90A 4PPYA 1D8AA 1BHSA 1C7RA 2ZS8A 4EB3A 1GZ4A 2OBLA 2FPMA 1A27A 2Z8YA 3MXOA 3R0XA 1NUUA 4X54A 2FZCA 4DS3A 1KYIA 1ELOA 3RAFC 3S8YA 1E1RA 3F6EX 4NARA 4M4SA 2JCBA 3EBOA 3FI9A 4HBZA 3V8MA 5D6OA 3WR5A 5H9WA 1OH5A 4X66B 4JNCA 2X3FA 4FX2A 4J1NA 1R4ZA 2H4HA 1GL6A 2BGRA 4TKZA 4YV1A 3KJZA 1FFEA 5F23A 3JALA 5D00A 5KDDA 4AYWA 4BV9A 3O84A 2XWBF 3FWPA 4NS1A 1ZP6A 4O5OA 2O2JA 5KSWB 3T3NA 3A9SA 3HWSA 4QNNA 4ARCA 4Q7LA 2CNKA 1B0PA 2H0RA 3ZD9A 3G89A 3QVOA 1F8UA 4JB2A 5BY2A 4OGLA 4UARA 1MTZA 2RGYA 2ZDQA 4HFRA 1MGOA 2ODWA 1BMTA 2EYQA 3F5SA 1M5TA 5J4LA 4QFBA 2FUCA 2OYSA 4KDRA 2GCOA 4XYMA 1JYSA 1IBSA 1ENOA 1X7GA 4HF7A 5DWVA 1U1EA 2QRPA 1H69A 1FFCA 2HIMA 4XCXA 1JKJA 2VUIB 4TYQA 5HIJA 1XX6A 1W4ZA 1TFUA 3TD6A 3TEJA 3QITA 1K3FA 2PBZA 2HWUA 2R6JA 4MAAA 5CM8B 2PEZA 3SR4A 1L4UA 3IE2A 4AN1A 4I4CA 4BQNA 1IN5A 3MOSA 2AKAB 4GD3Q 4QOSA 4Q4AA 4HDRA 3FZQA 4RHCA 4X6YA 2ZJYA 4RF2A 1IWBB 3GVXA 4NONA 1TD1A 2W2OA 4JLBA 4LRUA 4B84A 3WRXA 1JALA 2Q1WA 3DSRA 3JVVA 4YJ3B 4E1BA 3B1KA 2JGFA 2JKZA 3VRHA 3RSHA 1M1NA 4D3YA 4WLFA 1Y3DE 2FPGB 3OUTA 4GMFA 4WK0B 5FBLB 4BNLA 4LF5B 3NTUA 4EL5A 1JFFA 2CHVA 3CHYA 3NC0C 2ZXUA 2BEWB 1O95C 4MW1A 4BUZA 4DNQA 2ORIA 1U1DA 2B61A 1ZD3A 1P2TA 4NYJQ 2WTMA 1AK9A 2BUCA 1JQ3A 1KI6A 1EE9A 2O1WA 2ZUBA 2FX2A 3QVWA 3ERCA 5JCXA 4BNFA 4O08A 1H2FA 1F38A 2RH9B 4CI0B 3NLLA 2CFTA 3GMTA 5JXGA 3AR6A 2XE7A 5CMLA 4DAEA 1ONOA 4URUR 1EXMA 1M2NA 2QNRA 4HNQA 4PFKA 4RMIA 2I66A 3S70A 4F06A 2O8EA 5GZ6A 4BV8A 1O08A 2Y6VA 2MWMA 3LY9A 3OHPA 1ZL2A 1O03A 1QG4A 4DA7A 4YYZA 4HGOA 5IMSA 5A7GA 3DOUA 4K6GA 4CLEA 4QTXA 3LM8A 4NEQA 1GNTA 3FB1A 2UU9B 2NV2B 3VYVA 3O8NA 3MEQA 4P82A 5K20A 1NZFA 4JR2A 1QF9A 3BFKA 4KQIA 3C3PA 3ZY3A 5C4MA 1TVKB 16PKA 3QWIA 2ZIZA 1KARA 2G80A 1JR3A 1UKYA 3T7JA 2VIIA 1OBOA 1NXQA 2AI2A 3ZBQA 3A04A 3PL1A 1Z06A 2C5LA 4X45A 3EE6A 3JQFC 1ICIA 2CLDX 4FGSA 2IP2A 4J49A 1E3TA 4Q7QA 1IOWA 1SUPA 5L4SA 1DFHA 3KJNA 1L7MA 1NGSA 5DN9A 2L18A 2O9JA 1MB9A 1X94A 3TNFA 1PJLA 5HKKD 3ZWNA 1NYLA 2XSZD 4MGEA 1J70A 3VSCA 4CNQA 1KDTA 3DM5A 1SQ0A 1Y1QA 3KHTA 2HRQA 2V74B 1NUAA 1ISHA 2TMGA 2VG8A 2M2IA 3NT4A 4TVOA 1XZMA 1G21A 2PJZA 5K0EA 1UODA 4BKRA 2ZUFA 1OB2A 4HXEB 5BR4A 4NOMA 1AZSC 2KLHA 2X8JB 3QPUA 2DKNA 2PWBA 2YHSA 2YJ5A 3A2MA 3Q40A 3EMVA 1WCIB 4JB3A 5AW5A 5HKOA 1QE0A 2RKBA 3S5JA 1XMXA 3KJFA 4NMHA 1BX3A 3H4IA 3ZHBA 3WZMA 2MYUA 4HH4A 4LX8A 1J0AA 1RYEA 1D9ZA 1JBKA 3AXSA 3E70C 1I13A 5EQFA 2BRUC 3NBYC 1CQZA 5ALDA 1P1CA 4RZXA 3EIOA 5BSVA 1ZOIA 1P61B 1VPDA 3QFCA 1AHHA 4YJDA 3I2YX 1Y7LA 2J48A 2HBZA 1LK5A 2QTFA 2W8ZA 1RPNA 3BEOA 3NHBA 5EWMB 1BXRA 5HQJA 4JI2B 1U7ZA 2QRNA 3RSOA 4PG4A 2DF8A 3K8YA 1QHIA 1CU1A 3R23A 3N70A 1UP7A 2GTHA 2V7UA 1RXCA 2ZSBA 3IDZA 5C3MA 3NCHA 3INYA 1NFFA 5BWBA 4N3CA 1Y5IA 1TW3A 2ZI6A 3RJMA 2JNWA 4QO8A 7AT1A 4BVLA 5AM0A 1B93A 4CT4B 4ARUA 4BFXA 4EWLA 2G6BA 2ZE7A 3L0CA 4FINA 1XTZA 1EB9A 1PW5A 4JLJA 4GX5A 4LY3A 4QU8A 4UVEA 1JWBB 2GWRA 3A9TA 2O57A 5H4HA 1PSZA 2QTAA 3H9BA 5CAEA 5IJWA 5KJCA 5LBIA 3CF4A 4AY3A 4EI2A 1ATZA 4DREA 1X38A 5LLTA 2YJNA 2BI4A 3Q3HA 3VR6D 3GP8A 4CV2A 4YX9A 3U3RA 3B89A 1H0SA 2YV4A 1N2BA 3TLXA 2YASA 3TTYA 2HA2A 2QM0A 4MPDA 4EPTA 1KO8A 3I73A 1G7TA 4OA8A 3L5OA 5CCDA 3AL3A 3QQPA 1S8AA 5KHAA 4PHHA 1UPFA 3DWIA 2H7XA 3NRJA 5LPNA 4KQJA 4LK2A 3WL6A 4OXYA 4Z9BA 4QEZA 3VR4H 1IMOA 1W9HA 1T0HB 3GLUA 3NHRA 4CCYB 3K30A 3O5AA 1QC5B 3EPKA 1ENPA 2JAQA 4G86A 1P0IA 4F2DA 1HDEA 1TJ4A 3ESQA 3SNHA 4DMLA 1HLDA 1E2UA 3M4YA 1XD8A 1JBEA 4GQBA 2QUHA 5COBA 4BC1A 2PH5A 1C8VB 2N1BA 3BK2A 3GCGA 3QF4A 4S1WA 2DWOA 5KVQA 3U39A 1NTOA 1NX9A 2VOEA 2MIIA 1U80A 3KFXA 1ZMOA 4KN8A 4TLCA 1LRLA 1SEVA 1UZAA 2ZB8A 3T99A 3UGJA 2F4VB 1ORIA 1QG2A 4AKSA 3H16A 3PNPA 3ADBA 5IASA 2BHTA 5IARA 4OK5A 4ZICA 1FDRA 3DL4A 1D8TA 2HQ1A 1NP7A 2PX6A 1FEZA 1NONA 2GZ3A 4C0HA 1T29A 4I4TF 2EQBA 3CLTD 3KAPA 1KEKA 2HO5A 1LDBA 2AFIB 1JJFA 3WHKA 1FS5A 4EVIA 3P4UA 2VP0A 3VYRB 1JHRA 2XRYA 1FTSA 3P94A 3KUDA 5LNK6 1K7EB 3RT1A 1JHVA 2W22A 2ZBRA 1XAJA 3R0ZA 4TVBA 4AUNA 1J0XO 2J32A 2VHVA 4UDXX 4V02A 3L6RA 4XIJA 2WHYA 4LJRA 4X85A 3K94A 1IBRA 1IEVA 4PLVA 4QYIB 1ULAA 1C3XA 1Y1TA 4U9IS 2QBYB 1NLUA 1XMVA 4BP3A 1HDXA 4J0IA 2XTZA 4D80A 5B1IA 1X0XA 2DYKA 1YCHA 2QLNA 1CZHA 1JIKA 1RTKA 1UMDA 1M2GA 1YO6A 5CHEA 1IXZA 1E8DA 4HBGA 4AS3A 1E79D 2AC2A 4YO7A 2FCAA 2Q2VA 3CXRA 2Q7DA 1D5WA 1RYNA 3I1FA 4I3GA 2NO5A 1X7XA 5KO2A 1UBCA 2FQWA 3DHEA 5EUCA 2BGKA 4UTZA 1AGPA 1KA9H 3NTRA 4AJ9A 3EJWA 1EVJA 4MR8A 3WWPA 4UFPA 4RPJA 4UPVA 1N6OA 4HCJA 4AP9A 2B36A 2A88A 4XD7A 2HU8A 3QFSA 1Z8FA 2NTYC 3O4FA 4OXNA 5KYNA 3OHMA 4HAOA 4R9VA 1NF2A 4BZQA 4EB8A 4WT7A 3P9NA 2Y92A 3TTVA 4A73A 5IXSA 5JHGB 3BORA 2W2KB 1VE5A 1NXWA 3TLBA 2W6ID 4ESEA 4EO7A 5AW1A 3FMIA 2VDWB 3A0RB 4AZ0B 1XDWA 3LHDA 5SZHB 4U7JA 5KNDD 1VGVA 1C80A 2IUSA 3OWOA 4NENB 5DSXA 5EL0A 3Q0TA 2VDQB 1KPGA 2YZGA 1OV4A 1EM8A 4MMXB 2XRFA 3H83A 2IQIA 3PD0A 3PBKA 2PFSA 4IF6A 1E20A 3X1MA 3UJ9A 3WG9A 1LSOA 2I55A 3DEKA 4K46A 1N2XA 3OOEA 3QBJA 2VHXA 5CH8A 2V97A 2EW2A 4AS2A 1TECE 4YXFA 3H2GA 1FCJA 1QCYA 1WW2A 2VT3A 3R40A 1AQUA 5LLDA 4UKDA 3MG9A 4FZJA 3GLIA 3PVZA 4QEDA 1J5XA 3E7DA 3UB4A 3TLGA 1HR0B 1ESMA 2DJ5A 5CVVA 1U3VA 4HWSA 4J1TC 4HL6A 3E15A 4XM2A 1JPVA 4Y9SA 3SKXA 1Z4KA 3UCXA 3ZWXA 1TKAA 2ATIA 3HUUA 3VSDA 3FDXA 2E18A 2XADA 3QUCA 4W7IA 5KWSA 1SCAA 3GRAA 1Y1LA 4J0CA 2IV3A 3ADKA 1X74A 1XUOA 4IQFA 4L8FA 3TLAA 4Z54A 3W8DA 5K8LA 1DBQA 1NWCA 1DC7A 5AUNB 1C2YA 5F64A 3AHJA 4XEHA 1TFRA 2GS9A 2XZDA 5DW0A 4E14A 1J20A 2OXFA 5JRDS 3GYGA 4LKOA 4AC9A 3U6KA 4IIDA 3KR1A 1SKQA 4G1UC 4D79A 1PV4A 2VTDA 1FFBA 5HF8A 1IUKA 4Q00A 4CMIA 2PN1A 1MAAA 5JCJA 1Z37A 1R6UA 1KP9A 3K8OE 2B0JA 2C1ZA 3IBGA 5EFOA 3AXTA 3BXGA 3F6YA 2G5TA 2AG1A 3BFVA 3RUAA 4DY4A 4EB6A 3GFRA 4L4ZA 5ESDA 4OHXA 3V8RA 5IH7A 1N92A 2BYTA 1N5LA 3FPEA 2J3HA 1EDEA 4RD4A 3OIYA 1A2KC 1CR0A 3KWLA 5DHSA 3Q8LA 3P0HA 4D44A 2QP4A 1X8JA 4R3NA 3ZCQA 3EXFB 3LUFA 5BQXA 3L46A 1PFUA 2QK4A 3VOBA 1C9MA 5CITA 4UD6A 1RLUA 1ULBA 2AZ4A 3FYCA 1GZ7A 3E84A 1U2EA 3O2JA 4QHSA 1PL6A 5E1MA 3ZZ0A 3LNTA 3QVGA 2IKQA 4RKEA 2YRXA 1G5FA 4AZWA 2ZTMA 2IUUA 2I03A 1PK7A 3OJFA 1X9HA 3WKAA 5AKKA 1RQ2A 3I05A 2ZJ6A 3BMNB 4RVGA 3C6QA 5DYNA 4F38A 5CEEA 4TYMA 2D7DA 1I30A 4HMOA 5EZ5A 3BBPA 2RMKA 1N9GA 1EQAA 2X9QA 4IH1A 1CP3A 3BSWA 4P92A 3HPRA 2N42A 4KG7A 4L73A 3WICA 1NVXQ 3AY3A 1PSDA 4D4LA 1N36B 2QR3A 2RHWA 4IEEA 2IOQA 5TQ2A 1E7SA 2DWCA 1Y6GA 1LSSA 2GPSA 2BN4A 1U0EA 5LP6F 2BONA 1JJAA 3R7SA 1KZGB 4BVBA 1Z5WA 4GUDA 2ZPAA 4M0UA 2E5LB 4KVFA 5HMLA 3ESXA 1Y5RA 2JDIA 4U0JA 2CE2X 3AKCA 3QOWA 2SCUA 5H5JA 2PGDA 2XDWA 2IKSA 3DWFA 4EKNB 2K2QB 1EFVB 3QXCA 1ZH6A 2BGNA 1OU4A 2XUQA 2XNSA 1XZDA 3DBHB 3F49S 4Y6OA 5IYZF 4UE2A 5K0LA 4ZRMA 3A6LA 3WGMA 3IOEA 3ZE6A 4GLOA 1W5EA 1JMYA 1XFAA 3ELUA 4NX2A 1DBRA 2I29A 4ND3A 4RLFA 4ZEMA 3HCCA 1ACLA 2AN9A 3DHWC 3EG9B 3P4YA 2D0PB 5KX5B 2HJHA 5KVCA 1NL3A 2F3UA 2NN3C 4OI2A 4UMFA 2IBSA 5E3IA 4EEKA 3ANXA 3ORFA 2PLRA 3WV5A 1N5IA 1KDPA 2VH5R 2ZKLA 3B3GA 3DOFA 3FUUA 5HKBA 1FNMA 2H1RA 2PY6A 2V7PA 1NQAO 5IXYA 5KNBD 4HRXA 4M1SA 1JSXA 2Z08A 2BP7B 3LPMA 4ETIA 3IKJA 3CH4B 3SVZA 2PGLA 4ONEA 3PC3A 4NMXB 3RDPA 3BSFA 2LXNA 1CY4A 4LC1A 3DTYA 1EIWA 1ESZA 1XRJA 1MB3A 2R6AA 3PEEA 4LJKA 2G83A 4BB9A 2QTVA 5BOVA 3SD7A 4DPKA 5F2NA 2P1DA 1YI0A 2I2CA 3BGDA 3C39A 2CZGA 1YZ3A 3ELBA 3JARB 4L3WA 5FTJA 3WK9A 4XWKA 3MWLA 1Q0RA 4LZJA 4PHFA 4ZQGA 4I3HA 1DKLA 3AUUA 1PWZA 3H2JA 3O93A 2RHJA 4L5JA 2TMYA 3VV3A 1L5GB 1LC3A 4YUYA 2AOTB 3I9NA 4BNJA 3EF0A 3HA5A 5IC6A 3TNDA 3ZWOA 3DKRA 1XTIA 1YVDA 3E35A 3GPBA 3TRFA 4CG3A 5BWOA 3O3CA 2B34A 1JTEA 1T1GA 1U0HC 4I50A 4AUMA 3OE5A 1RCTE 2BF7A 3EF1A 5IJXA 5AW3A 2CLSA 5EE0A 1HOXA 5I7OA 1Z5OA 1SXJB 2Q6LA 3L06A 5CLJA 2GZHA 4NPHA 4WBXC 2COKA 5FFFA 5KVVA 4RHYA 5B7GA 1PL0A 4CLOA 3WFIA 2AWNA 3PLRA 1UXHA 1ZZEA 3C6BA 4JP2A 4KAAA 4K9QA 5DGHA 4W1SA 2N9UA 5IFLA 5JDCC 4QGBA 2R5NA 4LSGA 2YV2A 2Z2JA 3RBZA 3RNLA 1ZC4A 2J9XB 5DNVA 5FTWA 3TLMA 5AOAA 5LYYA 2QG4A 3TLCA 1YFLA 5LN1A 1FYDA 3B3AA 4BEVA 1IQUA 1NUSA 2NT4A 3QXSA 3OKFA 3UCFA 3IPYA 4M1EA 1PK9A 3SIRA 4TQUS 4GYYA 2QEQA 2C31A 1YQGA 3BILA 1W85B 4MR7B 3D3QA 2NVWA 2QWXA 1KI9A 3JWJA 4UEWA 2I2WA 2Z4TA 1Q22A 4L5CA 1FVFA 1NVVQ 1DIAA 3CUWA 1L5NA 5C5IA 5LQCA 3L18A 4FYPA 4IFIA 1ZAKA 4ZN6A 2G0NA 3TQOA 4LY6A 4K9PA 4DCCA 4NK4A 3AB8A 1CQPA 5ALYA 2A35A 4K6KA 1JSCA 4AB1A 3I3SR 3MUNA 3VC1A 1YJQA 2DCMA 2A3NA 3JYLA 5CDUA 1F6DA 2GBLC 5EIXA 4DQKA 2UVPB 1CP2A 1SBZA 2NU8A 4B34A 3JQ6A 4FDUA 4M9CA