1E7SA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
314
Chain Sequence
b'KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE SYNTHETASE
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase/reductase
total genus 109
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7sA02
3CINA 3CSDA 4BNKA 2G76A 2AA3A 3WYBA 1B3BA 2JFFA 3NDJA 4II2A 3TZHA 5CDUA 1HSZA 1ZK4A 4J3FA 5EPOA 4BO4A 3CPSA 3OA0A 2EJVA 3HDQA 2NWQA 2Y1GA 3B1KA 4PG8A 3VTZA 1HE2A 1PGJA 1P44A 2BFAA 2P5YA 3IUSA 1AXEA 1EUZA 1XG5A 2UUOA 1EVIA 5I7FA 2OXIA 3RUCA 4NBTA 1DIHA 1S6YA 5C7OO 3OP4A 4HNHA 4E2XA 2AEJA 3BMOA 3PYMA 4ALMA 1QV6A 1X14A 4CMBA 1DJQA 1CETA 3EW7A 1JKJA 3KZVA 4JCOA 4YJDA 4CUJA 3TPCA 3BTVA 2I99A 1I10A 1YS4A 1Z74A 3OETA 4AFNA 3I9JA 2CD9A 3WYEA 2SCUA 1VSVA 3DMTC 3PWZA 3RKRA 8LDHA 5G0TA 3MJSA 1EBUA 1AUPA 1X0XA 3S55A 3GK3A 2WSBA 3BMNA 4UUOA 1A72A 2V6GA 4BKRA 1QXSA 3RCBA 3N7UA 3KETA 3ENNA 2PWZA 3PHJA 5I8ZA 4CLOB 2OBNA 4I5GA 2PD3A 3TL3A 1NNUA 4PVDA 2I3GA 3OQ1A 2WYVA 4KUHA 1UXIA 3ANNA 1U8XX 2CVZA 3I4CA 3TFQA 1UXKA 5F3RA 2ZTMA 1DFHA 1BHSA 1QYVA 2B5WA 3ZNPA 1ML3A 1WWKA 1U3UA 1XSEA 4M87A 4PRLA 4AJPA 5JBIA 4XR4A 2W2LD 3X2FA 2G5CA 4HFNA 4CM4A 2GRAA 4CQMD 3SEFA 3WGIA 4Y9DA 1EUDA 1A4UA 5AXBA 3QVOA 4FFMA 1UZLA 3RJ5A 1AN9A 1I24A 2NVBA 3C7AA 2WE8A 2XXJA 4II3A 2H9IA 5L40A 4Z9XA 4GWKA 5DULA 3GFGA 1G0OA 1VKNA 3IP1A 4JQCA 1ZSYA 1WNTA 5DCWA 3I9LA 2O3UA 5A05A 4OM8A 4Z6KA 3RC1A 3WG9A 4KZPA 4M49A 5TJ9A 3E18A 4J2HA 3TOZA 2EERA 4GPD1 1ENYA 3WX0A 1E6UA 1ADFA 3LLVA 2PZLA 3A1NA 3E03A 4IQ8A 4Y6PA 3ON5A 1Z82A 4J4TA 3PP8A 5ES3A 4UVIA 4BNHA 1E77A 1DRUA 1PL7A 2BFMA 2BGKA 2VOEA 3KHUA 5C7LO 5EMHA 3RUDA 4ND3A 4BKUA 4BO5A 3P5SA 5L7YA 1OC2A 1D8AA 5EERA 1JWAB 2VUSA 3PI7A 2ZCUA 3RUIA 2EJWA 2FR8A 2GYYA 3LF1A 5JC8A 4J1SA 4AJ1A 2IYPA 1Y8QB 4GVXA 2J5RA 2X5OA 4TQGA 3KO8A 2PZKA 1TI7A 5TRTA 4CMHA 5BSFA 5K9ZA 3Q3CA 5JCJD 3K2BA 5A3JA 4AVYA 3DL2A 4ND4A 4MVJH 2DVMA 1GEEA 1F0YA 3HFGA 4DIBA 1ONOA 1LU9A 1NQOA 2F1KA 3H3JA 1U8FO 4QQRA 2X4GA 2DBRA 3GG9A 2JHGA 4NFHA 5K0ZA 1QV7A 2DBVO 3PZRA 2A35A 1VM6A 5JLAA 3TDKA 4M54A 1WPQA 4DGSA 4BIIA 3AUUA 4PZDA 4PFJA 2O50A 5A9RA 1R0KA 4CM3A 4XRGA 3WFJA 1MLDA 4DUPA 4N18A 1T2AA 4RVSA 1VLLA 4BNMA 3FPLA 2HMTA 4Z0HO 1Q7BA 2AE2A 5J23A 1N92A 4FR5A 2PKRA 1BG6A 3ZU3A 1LDGA 4IMRA 1H6BA 2XOXA 1M6WA 3JD4A 4N7RA 3SJUA 3CKYA 4OAQA 2NLOA 4U0JA 4RORA 1ZEJA 2GNAA 2GUGA 3AI2A 4E2WA 1JA9A 3ETGA 3GMDA 4DTIA 1WXDA 4AJJA 1T24A 4DC1A 1HLPA 4YPOA 3OSUA 3ANMA 1ZZEA 5CP8A 3G79A 2H5LA 1JDJA 3PHLA 2HMUA 4ROSA 3PJEA 3OFSA 1YRLA 2R00C 2Z1MA 1PZEA 1T2CA 3IJRA 1T4DA 1GV1A 4LVUA 4CLOA 4MVJI 4NFSA 4KDEA 3RSHA 1YQGA 4FQ8A 1DO8A 4WNIA 3AI1A 4YBZA 3V2GA 3DAPA 1K6JA 1GQ2A 2DTXA 3Q9NA 3KYBA 4QFCA 2TMDA 4AJOA 5ILGA 2VNSA 4NG5A 2HMVA 5F1KA 4CR6A 2NU6A 3VDRA 2IEDA 2X5JO 4BKOA 5KVSA 4XGNA 4D3FA 4PVCA 3D1LA 1PJCA 3C3XA 4MINA 2NVWA 1O89A 4OSPA 1EVZA 5BNTA 4QXMA 4UEJA 4MPDA 2CDBA 2ZB7A 4LVCA 2NNLD 3WYCA 1QP8A 4ALKA 2B4QA 1PJ3A 2BGMA 4RZHA 3GMSA 2VUTA 2GR9A 3HDYA 3JSAA 4B7CA 3VVBA 1ZIDA 4R54A 3VH3A 1PS8A 3MJTA 4YYZA 5B4UA 4E33A 1OC4A 1YB5A 3WBBA 4MKZA 4OIMA 5U1PA 4RLHA 3RI3A 1UR5A 4HUJA 1YGYA 5IZCA 4YAEA 5JYEA 3F3SA 3NT2A 1FDVA 3S1LA 1B8PA 3PFWO 3B1JA 1B2LA 3TF5A 2IZ1A 4DA9A 3OJEA 4RQUA 1M76A 1ZSNA 1ENOA 1NWHA 4TRNA 2NADA 1E1KA 4Y8VA 2D5AA 4CV2A 5JW6A 4GMFA 1EK6A 1JKFA 3HUDA 4CV1A 5G0WA 1Y8QA 2B4RO 3JD2A 2ZYGA 1YKFA 3JD0A 2CFCA 3ZV3A 1YDWA 3GT0A 4GWGA 3ZH2A 1PR9A 4NJOA 3U4IA 1PEDA 1YONA 3ROMA 4XDZA 5IFLA 4YDRA 5I8WA 1JLLA 4YQZA 3JQDA 4YTEA 3AJRA 3RQSA 4OOFA 4Y6RA 1ZVMA 4EGFA 3FNEA 4K9DA 5A03A 1PX0A 1U7HA 2QZZA 2W2KB 3OBBA 4DLLA 1NR7A 4NU6A 4F6LA 1EZ4A 2C7GA 2X9VA 5HRUA 4PIVA 5TQVA 1SCUA 3F47A 4FOOA 4J4HA 1XU7A 4ONEA 1AGNA 2R2GA 4JJIA 3TOXA 4LSWA 3OJ0A 4CMEA 4DBZA 2X5KO 2JAHA 4TROA 1CEQA 3C1AA 4I5FA 3JYLA 4IJUA 3AUTA 4G2NA 3PHHA 4AJHA 1GQQA 3RWBA 4KQXA 2AMFA 3QVTA 4NK5A 1Y5RA 4CM5A 1LC0A 4R3NA 2OMEA 5G0SA 3WBFA 2V65A 1GQYA 5A5EA 4YJGB 3H8VA 1P0FA 2HUNA 4ZGWA 3ZWCA 3LT4A 3PLNA 2BMAA 1ISMA 4JX8A 5IZ4A 4QTZA 1Y5MA 2CF6A 3GNQA 3E48A 1TT5B 3HFSA 5C3MA 1B26A 4ZU3A 4CLHA 3GH3A 1PS9A 2P5UA 3HQ4O 5LC1A 1CIVA 3H3FA 4ZRNA 1ZO8A 1RM4A 2NTJA 3FR7A 3WGGA 4M86A 5JAMA 1UZNA 4TZTA 2X7HA 1V6AA 3GEDA 3ZWMA 3EMKA 3HHPA 4IGFA 1LLCA 3GVCA 4LCEA 3HN7A 2EGHA 1NHWA 2VZ8A 4K6CA 4XA8A 1NQ5A 1SZJG 3IDSA 1P1HA 1UDAA 3CZRA 4I9UA 4J1QA 4IDEA 3WDSA 5CG1A 4A5OA 4EYEA 3OH8A 1CRWG 3SC4A 2B35A 4JGBA 1E6WA 3GNTA 4NMHA 4E2ZA 2AQ8A 3O4RA 1P1JA 4E0BA 2O3RA 4J6FA 1RYEA 4E5KA 3DAFA 4ALNA 3NDRA 4BQRA 2J8ZA 3M2PA 2IDZA 4L4RA 4L73A 5COQA 1PJSA 3ONEA 2Q2QA 3SLGA 1XELA 3WB9A 3PLRA 4EZBA 2Z95A 1Q0LA 4BNWA 3MTJA 1QRRA 3UOGA 2VZ0A 4E31A 2OHXA 1MB4A 2D59A 2J5QA 3G3EA 3I5MA 3H2ZA 3RFTA 1SOWA 4W7IA 1HLDA 3F46A 3Q2IA 3DONA 2VCYA 4Q3BA 4CUZA 2BHLA 1YQXA 5JC1A 4NJMB 2IXBA 4HBGA 1P33A 4IPTA 4JN6B 1R6DA 3UH1A 2HK9A 4HADA 1KVSA 5TX7A 3DO5A 3KV3O 2O4UX 3D4NA 1JVSA 2EG9A 2Z1NA 4IDBA 4G5HA 4B4WA 1LRJA 3E9NA 3F6YA 5G0VA 4NPCA 1PGOA 2X86A 2FSVA 3LC7O 4IUYA 4BHTA 4CM1A 3FHLA 2C2YA 4HY3A 2VYVD 5B1YA 2I67A 2O7QA 2YHIB 1U3VA 2IODA 3U4DA 1NBOA 3TL2A 1E0DA 3QQPA 4HKTA 2ZKLA 3MZ0A 4ND2A 3ZHBA 2W2KA 3PEFA 4U7WA 3KTDA 2YV2A 4ND1A 2CF5A 4FS3A 1LDEA 3AM3A 2AW5A 1HZJA 4BNZA 1UP7A 1CQIA 3ZDFA 1C1XB 2W4QA 1MXFA 4XD2A 4BO0A 5L9AA 1ZSVA 2AG5A 1EK5A 2UDPA 1OZAA 2JCXA 2W8ZA 1E3IA 1IHXA 4DPLA 1XQ1A 3VZPA 3GEGA 2X1HA 3FBGA 2IE0A 1TB4A 3JQ7A 4R5HA 1Z45A 5IZCC 2D1YA 4DYDA 4RO0A 1BRMA 4A2CA 3FCOA 3GUYA 1AE1A 4INAA 4GKBA 4KWIA 3NAQA 1EUCA 1G1AA 1K3TA 3E9QA 3BTUA 4H7PA 4Q3AA 4Z3DA 4YJGA 5CDGA 1GZ3A 3K30A 1X7HA 2O3TA 2YJZA 4A03A 5IN4A 4WOKA 4JBHA 4QSMA 2CDCA 4CQMB 1O6ZA 3C8MA 4DMMA 1ENZA 2E6UX 4PLTA 1JAXA 4ITUA 1TT5A 3KSUA 4TRMA 4CODB 4URFA 3KSZO 3TQHA 3E6AA 3RAJA 3VDQA 5A9SB 3G1UA 2HMSA 3H9UA 4IINA 1D1TA 3TZKA 3NGLA 4GGOA 4K28A 4E2YA 5L45A 2HJSA 3PQFA 3N58A 1RPNA 2P68A 3OIGA 4WOJA 2FY8A 4H16A 3SXPA 3JQGB 1MX3A 4R51A 1ZJYA 2JHFA 5BSGA 3L07A 4D45A 4LCJA 3PRJA 4ZQGA 1RJWA 2OUIA 3MOIA 3U5TA 1T2DA 2H6EA 4W9NA 4Z9FA 5L7TA 5ITVA 1WZIA 3GC6A 4MVJD 1P1FA 1H94A 5T8KA 1GD1O 4BO2A 1HDRA 4PN3A 1X0VA 4EDFA 7ADHA 3GGGA 2Q1TA 2VHYA 4XEHA 4NQZA 3A14A 5A1TA 1HXHA 4YB8A 4WCFB 3ZU5A 4GBJA 1KEPA 1DEHA 3LC1O 3W8EA 4BKPA 3NTRA 3I52A 3PK0A 5A06A 3X2EA 1H6AA 3GVHA 3VTFA 1WVGA 4MJLA 4PG7A 4IS2A 1Q2XA 1V3VA 3DDNA 5CEEA 4M89A 1F12A 4OH1A 3U09A 1DIAA 1ADBA 3W8DA 4HXYA 4F45A 2FN7A 2Q1SA 4NJMA 1U7TA 1NVGA 1UDCA 4I5EA 4BGVA 4CLRA 1QR6A 3GZ4A 1F8GA 1LEHA 3P7MA 4JBGA 4NH4A 5A5FA 4AJ4A 1GPJA 4YJFA 5CFZA 5EN4A 1LTHR 3AW9A 5EL0A 4MVJE 2C5EA 4E5YA 2PA3A 2AQKA 1QORA 1DAOA 1YJ8A 1L7EA 3I83A 3TFOA 1PTJA 5C7IO 2YHIA 2G82A 3D5QA 2HK7A 1Z7EA 1GCOA 1VRWA 5F5LA 2C20A 4RLSA 3D4OA 5JMPA 3ZNQA 4NDNE 1NAHA 4MIYA 1H5QA 4WLNA 1KVTA 1GUYA 4OGWA 1MC5A 1I36A 4RCVA 2A94A 2X9NA 1LLDA 3CUKA 4ALIA 1VPDA 3ZU4A 5IDWA 4FSHA 2RCYA 4XYLA 3OF2A 2DFDA 1KOLA 4YAIA 5C37A 1QLHA 3AM4A 3KOUA 1SEPA 5THKA 2IZ0A 5BSHA 3F5SA 3ICPA 4OYRA 5TS3A 2EKLA 1I2BA 3I6QA 2PH5A 1IB6A 4OKIA 2HKIA 4KP7A 1NFFA 1MGOA 4NBUA 2W2LA 5IN5A 3ZW8A 4CQMA 4XYGA 3ZWPA 4OHUA 1IZ9A 1KEVA 2E49A 3AU9A 4XCVA 3U62A 4R41A 1E1MA 1IOLA 3S8MA 1GZ6A 2AEFA 1K2WA 5TGDA 2O2SA 3AUSA 5A9SA 1JAYA 5JCXA 1C0LA 3GAZA 2UYYA 4BNUA 2RH4A 3F1LA 4IJVA 4U8GA 2VHZA 3U4CA 2C29D 3VHRA 3V8BA 3L9WA 4YR9A 4NI5A 3T4EA 2HRBA 1NVTA 2R00A 3PWKA 4OQYA 3K9QO 4KUEA 4XX0A 1IHYA 2BELA 4GLLA 3JYOA 4CM7A 4YA6A 5G4KB 5HA5A 2YDXA 1WZEA 3PYXA 1FDUA 1MP0A 4H3VA 5G2OA 4BNNA 4DREA 3KUXA 4KMSA 3DEYX 1I5RA 3SJ7A 3V1TC 3WGQA 3ZNOA 4BO7A 1IZ0A 3IKTA 4WK6A 4QECA 2CZCA 1ULSA 2PH3A 3E8XA 4BV9A 2JKVA 3VAZA 4J4BA 4WCFA 1VI2A 3DZKA 4DQUA 2GD1O 3RUAA 3ABIA 5L7WA 1JTVA 1EQ2A 2DBZA 1EVYA 1O5IA 3DOCA 2B37A 3BMQB 3AK4A 3RUFA 2ZIZA 5JXWA 3CMMA 5JFOA 3L6DA 1XKQA 2AE1A 3GR6A 4P38A 4G65A 1DIBA 5JMWA 2GZ1A 3ITDA 3DBRA 4GMGA 1Z75A 1YQDA 1GYRA 2PFGA 4ZN6A 5ICMA 5FWNA 4NK4A 4AJEA 4EJ6A 1DC5A 1PSDA 5DOVA 2IXAA 3WLEA 1A5ZA 1TEHA 3EAGA 1FDWA 3GOHA 1UAYA 4FW8A 4NR0A 2PY6A 4GL4A 4RVDA 3ZZNA 2NQTA 4RDIA 2NVUB 4DIOA 2Q50A 3ZNNA 3VKUA 4Q3EA 5CDSA 1U5AA 3ZHYA 1B16A 1IPEA 4W9NC 3EYWA 2W98A 2C5AA 5T8KC 1SMKA 3BZUA 2PD4A 2FZEA 3B70A 3T7CA 4DBVO 2UVDA 4E5MA 3VPHA 1DJNA 3NT5A 5TT1A 1PGPA 3I6IA 1PL6A 4L76A 5DP2A 3Q6IA 3S2GA 4FFOA 7MDHA 1EMDA 4FGSA 4BQPA 3UN1A 2BH9A 3IL2A 2VYND 1LRLA 5IXSA 1E3SA 4WJZA 1O9BA 2O3JA 2Y66A 2FPIA 2ZB3A 3H65A 4C7KA 4DWVA 3DBHB 2GGSA 2VHVA 5CEJA 3ZGYA 4QO8A 2J6IA 1YE3A 2O2YA 3A9WA 3ANLA 4J90A 3ZWWA 3JD3A 1PQPA 2OZPA 2Q1WA 3BHJA 3PPIA 3DWFA 1SNYA 1O8CA 4GVLA 1HEUA 3KB6A 3Q1LA 2QRJA 3JQAD 2D3TA 2O3SA 4GX0A 3KLPX 4FIZA 4UUPA 4Z3KA 2AQHA 1U2GA 2PZMA 5CDYA 3A28A 4RF4A 1N5DA 2DUUA 1F06A 3GEMA 3IOYA 4PLCA 5H83A 5GY7A 1V3TA 4MOWA 3WGYA 2DQ4A 1ZMOA 2YYYA 4CUKA 2VZ9A 1I30A 3WWZA 4JROA 1T1SA 1UH5A 5T6BA 4OKNA 1NX6A 2GO1A 4QEDA 2EV9A 2PZJA 5G0UA 2GZ3A 5A3VA 1CJCA 3V2UA 3AI3A 2NM0A 3MJ4A 3FPCA 3INRA 3CXRA 5G4KA 3O03A 2WE7A 1TT7A 1ZNQO 2EKPA 4LW8A 1ZW1A 3LU1A 1MV8A 3GA0A 1A9ZA 3IC5A 3SBOA 3ASVA 2ZCVA 3PZBA 4R1NA 4CM6A 4PG4A 4B7XA 5CDTA 3D3WB 1V3UA 2J5KA 5HTOA 2OGUA 4J49A 1JQBA 1LNQA 4E6PA 4MIEA 2B69A 3GFBA 4F46A 4ILKA 5TF4A 4R16A 4BMVA 4PRKA 1LBEA 4XKJA 5THQA 4FPXA 1N1GA 5DBFA 4Q3DA 4BO6A 3H9JA 5BNFA 2VNAA 4ZQHA 3O26A 4LN1A 3C7CB 4P4NA 4FCCA 5GMOA 1N7HA 3PVZA 1NHGA 3W8FA 1DC6A 1M6HA 2WJPA 5C5IA 2DU8A 1LJ8A 3NTOA 4IGEA 5KKAA 1BSVA 4B4UA 4BO9A 1M66A 4J43A 4GLOA 4AJNA 2EXXA 4HFRA 2NVUA 3MJVA 4RPHA 1F17A 3LK7A 2CNBA 1KVQA 5JPIA 3HDJA 5KJEA 4W7HA 3ZWNA 1QSGA 4O0LA 3H6KA 3HWRA 1DFIA 1Z73A 3QWHA 3ZHXA 3V1YA 4JP3A 1YDEA 2AHRA 3WQQA 5B4TA 4YWJA 1BTOA 1ISHA 5LDHA 3QY9A 4WCFC 2OP0A 3W6ZA 1ARZA 4B4VA 3F4BA 2VWHA 1C1DB 3EY4A 2VT2A 4N54A 1GAEO 3DHNA 1N2SA 1AHIA 3QWAA 2ZQYA 4F6CA 2Y93A 2OFPA 1H6DA 3COSA 4S3MA 3NGXA 3DBHA 1PQUA 3K8ZA 4CMIB 3H2SA 3R3SA 3DFZA 3ROPA 2GN9A 3VH4A 4AJLA 5H81A 4GX2A 3RC9A 4IDFA 1EBFA 2RAFA 4FD3A 4BMSA 4EITA 3EK2A 1P3DA 5EINA 1ZXBA 1U28A 1DIGA 4QX6A 3QWIA 1X1EA 1MG5A 4P4GA 4XR9A 1MA0A 3KYCB 3ROQA 4MO2A 1DB3A 2Y1FA 5JDCA 4IY1A 5ILOA 1MFZA 4L4XA 1DFGA 4DPMA 5JO9A 1DOHA 1P0CA 2X0IA 4D3SA 5HBRA 3TSCA 1P9LA 4R01A 1BGVA 4UREA 3IUPA 2PD6A 2QQ5A 1WMBA 3GVXA 4R1SA 5F5NA 3NV9A 1OMOA 3NEPX 1OFGA 1YVEI 3WIEA 2OBYA 3E82A 4I5DA 2C2XA 4ZICA 2JCVA 5KVQA 2YV1A 2NTNA 1HDXA 3TZCA 2D0IA 1QKIA 2WYWA 1EDOA 1WW8A 3RU9A 2VOJA 3DFUA 1ADCA 4L8VA 1LQUA 4ZQBA 3EZYA 3T4XA 5KOIA 2VWPA 3DZFA 4O1MA 3UHAA 5DBIA 4ZJUA 1WLYA 2I66A 1F14A 3CTMA 3CH6A 3OM9A 4TRJA 3L0DA 4EW6A 4CM9D 5ENDA 9LDBA 1IPFA 4IXWA 5TSDA 2C0CA 4FN4A 4QT0A 3NRCA 3RKUA 5IDQA 1WDKA 4WLVA 4YJHB 3PGXA 3ZWYA 4GX5A 1I3MA 3OJFA 1J49A 1UUFA 4L74A 1Z6ZA 2O23A 4WEOA 4KDFA 4N5NA 4Z9YA 1H93A 2VT3A 2Y05A 4BNLA 2C59A 1LUAA 4D41A 2RH8A 4EUFA 5IDXA 5JAZA 4WGGA 3W4IA 3QHAA 2NU7A 3K73O 3AWDA 2EW2A 1BXGB 1N9GB 3PYLA 4XQEA 4DL9A 2CUKA 4GX1A 3HDHA 4IIVA 4IXTA 3ZU2A 1P31A 1PGNA 1Z7BA 3NUGA 5F1OA 1BDMA 2QW8A 2FP4A 3WFIA 3QJ5A 1YBMA 3ST7A 3ADOA 1PJTA 4J7UA 1O95A 3RC2A 1PL8A 2AG8A 3WSVA 1MUUA 2E48A 1B14A 3WICA 5A04A 1YB4A 4XIJA 3GDOA 1V0JA 1E7SA 1EFKA 2JJYA 5ADHA 2R6JA 4LSMA 5AQ1A 3F1KA 4XWYA 2VTDA 1E5LA 1YBVA 1ZK3A 1RKXA 1N1EA 4JJGA 1LDBA 3S2FA 2E37A 3VZQA 1HDCA 4EEXA 2DUWA 3RBXA 1LRKA 5MGBA 4TZKA 4TKMA 4TWRA 1C1DA 1YJQA 1Q0HA 4MP3A 1FXSA 1NASA 4J7CA 4AICA 2JCYA 4EEZA 1A7AA 3G17A 1EFLA 3K31A 5U4QA 1VC2A 3BA1A 3DC2A 1IL0A 4KTVE 4TMFA 4R3WA 4BOYA 4CMIA 3K92A 1UDBA 4U6SA 2QYSA 1ZMTA 1DAPA 2O7SA 4FBGA 4P8RA 3E1KA 3MJEA 1E3WB 4GGPA 3EZLA 2V7PA 3PHGA 4TVOA 3LYLA 2NACA 1IY8A 2ZYAA 3ICCA 4BUCA 2X6TA 2QYTA 2WWRA 1BDBA 1R66A 3ZV6A 3U9LA 1BVRA 1I33A 1PJ2A 5ENVA 1BWSA 1PQWA 1J4AA 2TMGA 3GHYA 1BW9B 4UEKA 1CF2O 3O8QB 1UZMA 3PXXA 3OQBA 4L4SA 3GF4A 4R68A 5DF1A 4YRAA 2Q99A 1T4BA 1NTOA 1DRVA 2EP5A 3ULKA 2X9GA 1HSOA 1ISGA 1KBZA 1UAGA 3AFNA 3UAGA 2OORA 3UKOA 3BXXA 3OMLA 4GQAA 1DLJA 4GI2A 4AJ2A 4TSKA 4J1NA 3MCVA 1KY5A 1TXGA 3DBVO 4IZIA 4FC6A 4I8XA 4JK3A 4P4LA 5HS4A 1YB1A 4RF3A 2EHDA 1U5CA 4B7UA 1Q7GA 1DIRA 3MWDB 1E1NA 2G17A 2PGLA 2YFQA 3ENKA 4TKLA 1DRWA 4DPKA 3HADA 1HWYA 2QX7A 4OSOA 3V1UA 4BNXA 4KQWA 3RASA 1FDTA 1Y1PA 1YOVB 4IDAA 2CDAA 1DBVO 1T2EA 1MXHA 4ZVVA 3B6ZA 5L4LA 1ZH8A 4J7XA 4JXKA 2PGJA 5FYDA 4FC7A 2O3QA 1P74A 3FTNA 3K6JA 2CVOA 1PU2A 3OJOA 1B8UA 3GDGA 3DZHA 3LLSA 5TIIA 2YUTA 3QSGA 5L51A 3FNHA 3K2EA 3MJCA 4B4OA 5KTKA 1Y9AA 4CMAA 2EKQA 4YJHA 4NZ9A 2WM3A 2FHSA 3GHHA 4WLFA 5L95A 1U2DA 1HYEA 1E7QA 1H9BA 1H0KA 4PLHA 1LDNA 3JQ6A 3LQFA 2Q46A 3WJAA 4IJWA 3QIVA 4RVGA 5JDCC 4CR8A 5L53A 5BQFA 5T67A 1OBFO 3JQ8B 2BFOA 1N9GA 2Z5LA 3LZ6A 2Y99A 1W0CA 5L4NA 5TC4A 2RHRA 1LX6A 5EQDA 1FF9A 1VL8A 5IDYA 4BNYA 8ADHA 1PZGA 3OIFA 5AXAA 2AQIA 1K6XA 1SAYA 4PZEA 3DZJA 2GF2A 1Q1NA 1C0KA 3C85A 3VH2A 4A10A 4A7PA 4D44A 1E5QA 4D43A 1GFSA 3QVSA 3H5NA 4HP8A 3VVCA 4OJNA 3UICA 4BS9A 3DTYA 4F3YA 1QYWA 4UVEA 4E5NA 3JQAB 1H6CA 5AOVA 3OHSX 4JJFA 1FK8A 5BR7A 3D64A 3DZGA 4B3IA 2UAGA 2WTBA 5T5QA 1P1RA 2B5VA 3JV7A 4E30A 1G6KA 3VKVA 5IAAA 3AFMA 4IDGA 2VWQA 5L4SA 4OXKA 3M2TA 5B37A 2D8AA 3ZWAA 3WTCA 2Q4BA 2RHCA 1C0PA 1UJMA 1GUZA 2F00A 5B4VA 2DBQA 3GVIA 4ZQEA 2FSSA 3I9NA 1PJBA 4HX5A 1NWCA 3JQ9A 3PDUA 3WGTA 1KVRA 2ZB4A 3BHIA 3PIIA 1NFQA 1E3EA 2IRWA 2IYOA 4MDHA 3NTQA 5EIOA 1PWXA 3DHEA 4Z0TA 4J0FA 1KY4A 3WIDA 4Q39A 4RPJA 1ULUA 2YFHA 3O38A 3UVEA 4ZHSA 2GN6A 2OO5A 1AHHA 1ID1A 2ZYDA 3NX4A 1PJQA 5CEFA 1T25A 2Y0DA 1CWUA 3SLKA 4KOAA 5F1PA 1LSSA 1BW9A 1HF3A 3O8QA 3ZWOA 4RDHA 3WNQA 3IJPA 1LXCA 1XWFA 3GNSA 1F8FA 2I65A 1HL3A 5FEUA 5JYDA 1DC4A 2DFVA 1R0SA 1U9JA 4NBVA 2D2IA 2EP7A 1OAAA 1LDYA 4JLWA 4MVJF 4MVJM 1QMGA 2GPTA 3CE6A 2A92A 4Y6SA 1I3LA 1CQJA 3BTOA 3JQBA 2I9PA 4MKXA 4PLYA 2FOIA 1IE3A 4K6FA 5KVVA 1Q7CA 4W6ZA 1YOVA 3QW2A 1HETA 1HKUA 1KEWA 3TZ6A 4AG3A 2Y1CA 5CPFA 2HRZA 3LT1A 3AUAA 3ZI0A 3I23A 1SB9A 4WKGA 1R4NB 1C1XA 2P9CA 3PIDA 1ZEMA 3I1JA 4RV9A 3WJ7A 3ZWVA 3AU8A 5IF3A 4L0QA 5AXCA 4CL3A 1VE9A 4Y67A 2EIHA 1GEGA 1QG6A 1MFPA 1B15A 3PQEA 2FR1A 1GYQA 3WGOA 2AXQA 4XZ3A 4A26A 4BGIA 3KEQA 1KC3A 3ZW9A 1GV0A 2HLPA 2CVQA 4RVHA 4FOSA 4NBRA 3ZV5A 3HJAA 1D7OA 4CM4B 1SB8A 1SBYA 2NU9A 3DR3A 2LDXA 1L1FA 3CMCO 3JQ8A 3HE3A 4TVBA 4IIUA 1NQTA 4J9UE 1NQAO 3EGOA 2Y1EA 2X0JA 5DDIP 1E7WA 1NR1A 3FBTA 5KKCA 2FMUA 2WD8A 1KIFA 4I9NA 4ID9A 2OL4A 2DLDA 1SPXA 4UVGA 2PLAA 2VYNA 1LI4A 3QWFA 2C54A 1W6UA 1XEAA 4A73A 2BRUA 4D0RA 4E5PA 1PJLA 4CM8B 3BAZA 3DHYA 3I4FA 2I76A 1GL3A 3P2YA 3RBVA 5MDHA 1PIWA 3TWOA 4YEDA 3L6OO 4D79A 2DM6A 4BGEA 1BXKA 1I8TA 1DHRA 4DQXA 3JQGA 1NYTA 3WOHA 1O0SA 3I9OA 5GZ6A 3JQAA 1XYGA 6ADHA 4YAKA 3RROA 3RIHA 1OI7A 3FF4A 2HK8A 1R15A 3GZNB 4HNGA 4MP6A 3AY3A 4ND5A 4B3HA 5I9NA 1B7GO 3UXYA 2PTGA 2E82A 5I7VA 3WGHA 3O9ZA 1DXYA 1XLTA 4G81A 1RWBA 1NPYA 4O6VA 3GGPA 4HWKA 2PKQP 4YRBA 9LDTA 3E5RA 3KBOA 2DT5A 4YT4A 1XGKA 4OOEA 1SO8A 3PGJA 5JCJA 4HV4A 1JWBB 3IKVA 3WLFA 1PWZA 5JAQA 4CV0A 2VUUA 2HCTA 3H5AA 2I5PO 2H63A 1XCBA 1MG0A 2ZB8A 4RF5A 3NT4A 1I3KA 2BI8A 2NSDA 4CL8A 4RPKA 3JYQA 5I7SA 1SOVA 4ALLA 4DIFA 4XQGA 2C07A 3FRJA 2X0NA 3WXBA 1XQ6A 4FDAA 1NPTO 3H4VA 4NFYA 1LDMA 4BB6A 2YDYA 1M2WA 1ZBQA 2BLLA 1ZCJA 4S1VA 4XYBA 2Y67A 1QYCA 1EEHA 4BL5A 2VRCD 2HQ1A 2BF7A 2DAPA 4XGIA 3OIDA 2ZTLA 3HG7A 3G49A 2Q45A 2DPGA 4CPDA 1FMCA 3EHEA 4MIOA 3VPFA 5KJ6A 1JU9A 1B3RA 4RL6A 4E12A 1ZK2A 4GH5A 3I9KA 4OL9A 4RQTA 5JSFA 5L3ZA 5A9TA 2X58A 1HT0A 3UF0A 2B4TO 2Y68A 3UCFA 2ZJ0A 3ZHZA 3H9EO 1QYDA 5GZ3A 4WECA 3ONFA 1R4NA 4XJTA 3JQ9C 3OQ6A 3AOEC 2JD1A 5TLSA 4B8ZA 3IS3A 3GRKA 4RJTA 3A4VA 4PLFA 3I3OA 3WS7A 4XYEA 3QRWA 3D5TA 1I0ZA 3PJDA 4BMNA 5F21A 2OP1A 3WSWA 2IEBA 3ZWXA 1LSUA 2NQ8A 2V6BA 3BHMA 4M1QA 1W73A 3QVWA 4R4JA 2Y0CA 3IQDB 4BVAA 1N7GA 1XDWA 2Y1OA 3PHIA 2DTEA 4RPGA 1HE5A 3CIFA 4E4YA 2PNFA 3UUWA 5CHEA 4BB5A 4OQZA 2HAEA 5JY6A 3DQPA 3ZWBA 2VN8A 2NUAA 1GYPA 2DC1A 3D3EA 1UXGA 5BNIA 3PJGA 4CM8A 1XIVA 3JQBC 5KJCA 1LSJA 3SVTA 2HU2A 3V2HA 2WD7B 1M67A 2WYUA 3LDHA 3JQFA 2XPCA 3JQCA 3RBZA 2I3AA 1GZ4A 4CLDA 2J3JA 2RBEA 3S2EA 2O4CA 1D3AA 1ISJA 4U0KA 1VJ1A 4WPGA 4UULA 2W90A 5CAEA 2EGGA 2GASA 3GZNA 1W8DA 3T7EA 5KJ1A 3U3XA 2FRDA 1U4SA 4I08A 2P91A 3NJ4A 4N5LA 4KWHA 5A4DA 2PK3A 2FWMX 2J3HA 5TJHA 3AOGA 3ETDA 3RUHA 1WP4A 4OXYA 3GN1A 5HS6A 3WR5A 1H9AA 3QV1A 3JYNA 2FPPA 5DNAA 4TRRA 4A0SA 1KC1A 1YL6A 1K5HA 3BMQA 3H5RA 1DLIA 4XB2A 3RVDA 5TT0A 4PCVA 1G0NA 2X0RA 2Q4EA 5K6AA 5A02A 2POQX 4PG6A 2HJRA 3DXFA 3RD5A 3WQSB 2GSDA 1KERA 2H1SA 3FR8A 3CZMA 1RM5A 1IUKA 2D5CA 5FF9A 4DLAA 5B12A 1YL5A 3UCEA 3K96A 3VPXA 3GY0A 1IULA 1FJHA 4D42A 1V35A 1I32A 3FSRA 3D7LA 4CM9A 4EJMA 2Q2WA 4ZA2A 5DN9A 4DXHA 1TLTA 3PTZA 3GPIA 5HM8A 3GRPA 3E5MA 3L4BA 5COBA 1JW9B 3ONDA 4BKQA 4BO8A 3DAGA 3UFXA 3G1TA 2Q1UA 4J91A 5CG2A 4FJ2A 1P1KA 4X54A 1BXZA 3FI9A 4FFNA 3QVXA 1ZK1A 4CMJA 2BD0A 3F9IA 1IYZA 1YL7A 4FFPA 2WDZA 4IMPA 3RC7A 4XQ9A 3S2IA 4PZCA 4CLXA 2QRKA 4R1UA 2YQ4A 4WUVA 3OECA 3C24A 4GKVA 4MKRA 2UV8A 1NXQA 1P77A 3GPDG 1BMDA 2BGLA 1GTMA 2CSUA 3LSYA 1RM3A 3AY7A 3L6EA 3L4SO 5EESA 2Q49A 2FZWA 4M55A 4WCDA 3HN2A 3LVFO 1LC3A 4B3JA 1X13A 3KLMX 4WLOA 1J5PA 3PDJA 4LMPA 4IBOA 4P22A 4MVJG 3DBLB 1K6IA 2YQ5A 3IAHA 1KETA 3QP9A 4R5MA 1LLUA 1VJTA 4WLEA 5KJFA 3FWNA 4XGKA 1D4FA 3N74A 1GADO 4DRYA 1CDOA 3JD1A 1P45A 4WNCA 5IG2A 4K1LA 1C0IA 3A06A 3QE3A 4Q3CA 3B20A 3EUWA 2XF8A 1VKOA 4J0EA 1KVUA 1QYXA 4WLUA 1I3NA 5DT9A 5BSEA 3AY6A 4D0SA 2XXBA 5COAA 3PWSA 3MOGA 1A9YA 4R1TA 1J0XO 2X23A 2WD7A 1E7MA 2LDBA 4IQ0A 4PLVA 1LQTA 2DPHA 2EF1A 2ZQZA 2XAAA 3WWYA 1U1IA 1EVJA 2V6MA 2YHUA 4YT2A 1DPGA 3INGA 1EE9A 3I9MA 1R16A 5CPBA 1NVMB 3VPGA 4NU5A 1PJ4A 3F4LA 4J16A 2HMWA 3FNGA 5U9CA 1NFRA 2Q2VA 3HB5X 1ENPA 5KVCA 1U4OA 1B0AA 1RYDA 2OOSA 3D3WA 2YW9A 2G1UA 3RUEA 1R12A 1JN0A 4AJIA 2GN4A 3GUCA 4JBIA 3HNPA 3M1LA 4YT5A 1LLQA 3PJFA 4NHEA 2GZ2A 4R9RA 3W6UA 1Y7TA 3KYDB 2WEKA 5JE8A 4E21A 1A27A 4W4TA 2JD2A 4A27A 2VYVA 3HSKA 5AVOA 4BNIA 1Y8RB 1HDZA 4BNGA 4FB5A 5FI3A 4XRRA 3MEQA 3WNVA 3FD8A 3IP3A 4XB1A 1VL0A 4D3DA 1PZHA 2ZJ1A 3IIEA 4RVUA 5G4LA 2RIRA 2YV3A 1UXJA 1R37A 4CMKA 4DQVA 2VWGA 1ZUD1 1NP3A 2UUPA 3JQ7B 3JQFC 2VHXA 2YZ7A 4HFMA 1T1RA 3SX2A 3Q11A 4I9HA 1UP4A 1VJ0A 1A71A 2J3KA 1YXMA 1AXGA 2JD0A 1HTBA 4PLWA 1Q0QA 2ZTUA 3L9XA 6LDHA 2G0TA 1C3VA 4O5OA 1XHLA 4ALJA 4DYVA 3R3JA 2HSDA 3JTMA 4Z0PA 3NJ8A 3Q2KA 4W82A 1C14A 4CLEA 3P19A 3UCXA 4PLGA 1NM5A 3BYZA 4PLPA 4KTTE 1P1IA 1WMAA 4O63O 3QWBA 3WTBA 5JO0A 5JY1A 1YO6A 4J1TA 3W4JA 4W99A 3MWEB 4CQLB 3KXDA 2QG4A 4MVJP 4R69A 3U0BA 1E3JA 4GAEA 4YCAA 4WE3A 3DTTA 5K6AC 4BV8A 4BNVA 5KWEA 3VC7A 3HB4X 3KRTA 4IJKA 1I01A 3WMXA 1NPDA 1R4MB 4XDYA 1T26A 3BTSA 5ITWA 5FFFA 5JS6A 1E1LA 4ESOA 3ITKA 1DSSG 3DBLA 5IJZA 2B0JA 3LC2O 4QFDA 1X7DA 3ZCXA 3C7DB 2P9GA 3LT0A 3Q0EA 3NDIA 1PR3A 4RF2A 1ADGA 1M75A 4YAJA 1I2ZA 1H2BA 4R9SA 4MVJA 1KS9A 4EI2A 3KYCA 3G0OA 4RPLA 1H2HA 3H7AA 4HFJA 1EQUA 2Q3EA 3L4BC 3JQEA 2VRBA 3GAFA 3ZV4A 5LCXA 1PZFA 1T2FA 1RM0A 4EJ0A 5I9LA 1HZZA 3BMCB 3RJ9A 4WEQA 4M8SA 5I7EA 2J3IA 4XJSA 4B8WA 1SC6A 4CMGA 4E32A 3D4PA 1PS0A 4UAGA 4L9RA 1GPDG 4BO3A 5DZSA 5EQFA 2X8LA 4IDDA 2ZTVA 4DLBA 1UXHA 2CMDA 1X1TA 2I6TA 3FWZA 3UW3A 4AL4A 3QA9A 4CJXA 4OMUA 1BVUA 4DC0A 4CLRB 4ZD6A 4IS3A 4OO3A 1ONPA 3KVOA 1ONNA 3DZIA 1ORRA 4C7JA 3C1TA 3U4HA 2YY7A 3M6IA 4YJFB 5AYVA 1DC3A 3ZN2A 1NAIA 2GERA 1MC4A 2QZ9A 2P2SA 4RZIA 5TNXA 5JDIA 1YBAA 3KYDA 1PGQA 1DHTA 3GGOA 4Q9NA 4U6QA 4UEOA 3SC6A 1XR3A 4YRDA 5T64A 1Y8RA 2B83A 3NYWA 4B79A 1UP6A 1B8VA 2EWMA 1E6EA 1HYHA 3EVNA 3ADPA 2Y1DA 1GCUA 1ZK0A 1CERA 1K89A 1BXGA 5ER6A 1HYGA 4BNFA 3WQRA 3RFVA 1HE3A 3IMFA 4YQYA 1E3LA 5H82A 3FNFA 5DCYA 3DOOA 5DBGA 3H9GA 1YH3A 5DOZA 3B1FA 4DMLA 1GU7A 4BNTA 4JP2A 4YAGA 1X7GA 1QLJA 1VSUA 2NTVA 3GVPA 2PV7A 5FI5A 1CYDA 1XU9A 4MP8A 4YXFA 5ER9A 4NBWA 2A4KA 2C82A 4GSLA 3E9MA 2JL1A 4NIMA 1LA2A 3FTPA 1E92A 3KSDO 3ASUA 3DZBA 2AEMA 2DKNA 3V5NA 1D1SA 4PLZA 4CV3A 5IXYA 4K26A 5ICSA 4D7AA 4GSKA 3L77A 1L7DA 3EVTA 4CMCA 3DMYA 2BI7A 5T57A 1ZJZA 4CQLA 3DMTA 1GR0A 3LF2A 3VZRA 3NKLA 4LK3A 2C7VA 3OEWA 1S7CA 1YWGO 2B36A 3OICA 3PQDA 4IM7A 1ZXLA 1XA0A 2DTDA 3JYPA 4E13A 4QO7A 1DDOA 3D0OA 2IZZA 2V6FA 3STHA 1R4MA 4IZHA 2PGDA 1ISFA 3AOEA 5JAIA 1ISIA 1E3WA 4N5MA 2HO5A 2PR2A 1VL6A 2GN8A 3KEOA 4CMEC 4EUEA 3W1VA 2ZK7A 4XIYA 4Q3NA 2JAPA 1JKIA 1GY8A 1EDZA 4YVFA 2NU8A 3M1AA 1KEUA 2VTEA 1ZKMA 1GDHA 1E7YA 3VH1A 1JVBA 1TA4A 1OOEA 3BMCA 4XYMA 1Y81A 1KYQA 2BKAA 2NV6A 5GZ1A 3BMOB 3GLQA 4U5QA 2JFGA 2QIOA 2FPGA 3OJLA 4WASA 4L75A 1K0UA 4J2OA 4BO1A 4YT8A 3JCZA 1HDGO 1W4ZA 2VHWA 1V8BA 3GQVA 4ZQFA 3DBRB 4J9VA 4ZRMA 1V9LA 5DP1A 3W4KA 3QLJA 3C1OA 5KNLA 3F5QA 3PFFA 3VZSA 4LRTB 4Y98A 4PG5A 4RVFA 5BT9A 3TNLA 4RGBA 3CEAA 3HZZA 3BMNB 3ETEA 3R0IA 3WMWA 4CR7A 1ZFNA 3GDFA 4UVHA 1U3WA 4EUHA 3ROKA 4KUGA 2ILTA 4UVDA 1R0LA 1Y9EA 2VRCA 4IQGA 2CY0A 4AJKA 2VQ3A 4UUMA 5LDGA 3MTGA 3UGKA 3AM5A 3TJRA 2QHXA 2EEZA 4LRSB 2P4QA 4EBFA 1A7KA 3ORFA 1HRDA 2GCGA 1WDMA 2QRLA 2EW8A 3INTA 3EDMA 4FGWA 4PGFA 3Q9UA 5KIAA 5DCUA 1LSOA 2PKQO 3VOSA 1A4IA 3H9QA 5JNLA 5EJ2A 5KCZA 4XQCA 4UUNA 3RU7A 1TVEA 2X22A 4C4OA 3DOJA 2P4HX 2JFHA 4FJ1A 1HDOA 3U49A 3TRIA 5I9MA 3R6DA 1EE2A 4LMRA 5AXDA 1J6UA 3BIOA 1Y6JA 2P9EA 2E4AA 1N8KA 3GG2A 2GDZA 3KM0A 4DVJA 3K5PA 3TZQA 4D46A 1X15A 3DB2A 4O59O 4QUKA 3FN4A 1HDYA 1U3TA 4NNJA 4BNJA 4JNKA 2ET6A 2A9FA 4LGVA 3OEYA 4FJ0A 2FR0A 5HWSA 3WGZA 1HE4A 3GN2A 1E7RA 1SEVA 4FFLA 5JDIC 1WAMA 2O48X 2GLXA 2BFPA 2HDHA 3OA2A 4BGUA 1FDSA 2D4AA 1WDLA 2WMDA 2ZATA 4I1IA 1GUFA 3TN7A 1I2CA 4JIGA 4YACA 4H15A 4E3ZA 4OXNA 1O94A 3EC7A 3VPSA 3RFXA 4LISA 3R1IA 4IDCA 4FFRA 2Y0EA 3P2OA 3LT2A
chains in the Genus database with same CATH superfamily
3IMGA 2WUEA 1TU4A 2PWAA 2F17A 4N5DA 4MRSA 2G76A 1YZYA 5DEOA 4ARBA 1TECE 4II2A 3CH4B 3WGVA 4B7AA 2BFWA 5MFZA 4H9GA 2HHJA 4J3FA 1BCSB 3W3AD 2P5SA 4BO4A 4OGFA 1FVXA 3CPSA 2NWQA 3FXAA 2Y1GA 3B1KA 3EZXA 1CUYA 2PRYA 3BH0A 3KZCA 3VTZA 1PGJA 1VRCA 1BGXT 1XRRA 1ZN9A 4C4TA 3G8YA 4QXAA 1QLWA 3GLHA 1EUZA 1QK5A 1XG5A 1EVIA 4HVTA 5UKDA 3TTSA 1AZWA 3OP4A 1PR6A 2VH2A 3JZDA 1A96A 1KYTA 3EVGA 3HS3A 5JS1A 3N3AC 1DJQA 2QM7A 1F60A 2NTYC 2GTPA 3BCSA 1CETA 3KZVA 2BCJQ 2QK4A 1JR3A 3FGNA 2RK3A 1QFYA 2PU7A 2IOQA 4KHZA 4YJDA 4CUJA 3OFKA 3TPCA 4UFPA 5AVUA 1BMFD 5ALPA 1YK0A 1Z74A 2F2TA 4B5KA 4AFNA 2BFEB 3IVXA 1SUBA 3JVDA 3LPCA 1YVUA 1O6CA 2OXCA 4NE7A 4NPHA 2QRNA 4V2IA 4Z9BA 2W2VA 5G0TA 8LDHA 3NC1C 4EF4A 2YRXA 4RTOA 4MXDA 1FDOA 1XJ0A 4L8FA 1WKVA 2WWIA 3GJ0A 5GONA 2C4VA 1QHHA 4UHCA 2OCDA 3A1UA 3FUWA 4BPRA 1R8QA 2I4LA 2WG2A 2WW8A 4MCIA 4XUGB 4YGYA 5FPHA 4I5GA 1NJ5A 4D8TA 2HMYB 3FSJX 1NNUA 2I3GA 4WKOA 4BV3A 4EB0A 3K9BA 4FCVA 3ZLBA 1IWOA 2Q1YA 4KUHA 3AF1A 3FH0A 1X1BA 3BSFA 1U8XX 2CVZA 3I4CA 4WKBA 1EJBA 5AW4A 2QRMA 2DETA 1IN4A 1C3OB 1DFHA 1M1NA 1QYVA 1Y1KE 2ZTMA 3K20A 4IVPA 4BIMA 1QH1A 1U3UA 1XSEA 3CZCA 4M87A 2E55A 5GVRA 2MSCB 2W2LD 2WTNA 2JK0A 2YMPA 2WFMA 5FYQA 4RA6B 2UXDB 3SEFA 3ASZA 1EUDA 3COYA 3IA2A 5AXBA 3VNUA 4WN9A 1SCKA 2R9VA 2NVBA 1EM8A 2VSNA 2ZRMA 2QN1A 2QTCA 2A6PA 2VUHB 3G2NA 3NM5A 2ID7A 1GLGA 4WW0A 3WIBA 5JJKA 2EZTA 2XJ4A 4FT4A 1UBCA 3QE9Y 3QUCA 1CFJA 1KI3A 4N3CA 1GAQA 1VKNA 3WLJA 2VC2B 3R9IA 1RJEA 5CCXA 3RT1A 1FUIA 1E9AA 1IN6A 3DOUA 3RC1A 3BRQA 4EFMA 1L7QA 2VSXA 1J33A 3GJ4A 4M49A 4WH0A 1GTJ1 3IX7A 3U13A 4TGLA 4J0JA 1JYSA 5F9FA 4X90A 2FFQA 1ADFA 3LLVA 5K3DA 3E03A 4HH4A 3U19A 3TUIC 1OIXA 3ON5A 2ZU6A 3SF0A 2WSIA 3PP8A 1O0BA 4UVIA 2O2EA 3KWLA 4BNHA 3KHUA 3R75A 2BGKA 4AP5A 1OE0A 3RUDA 2C2BA 3TEFA 2WB4A 1JMKC 3I5XA 3H4MA 1QGUA 4DLPA 1KK3A 2QNRA 3BAFA 1HQCA 1IHDA 4MR7B 5FOQA 3NFRA 3RV3A 5K3BA 1SCBA 3UOAB 2EJWA 4P1ZA 4C3UA 5IYZF 1DIOB 4J1SA 2NZ8A 1JA1A 4EKYA 1ZRHA 3C45A 2J5RA 2GBLA 4TWIA 1JZSA 4CMHA 5K9ZA 2Q3JA 5T4HA 2W8BB 3A1TA 2QMQA 3DL2A 3HCDA 1OTHA 4HPWA 4AVYA 5SYNA 5AESA 3UK1A 1BS1A 3EW9A 2OPHA 1FNCA 4G8JA 3WY9A 5E7QA 1DQNA 3RABA 4EFNA 5BMVA 3N2LA 4AS3A 5ALSA 2PRJA 1LU9A 4KK3A 1UK8A 4GGMX 4H3SA 1OD6A 2J9GA 4IHJB 1U8FO 3TG8A 4E70A 4D96A 1ZIXA 2R11A 1ODCA 5KZMB 3A11A 3GLGE 1SUWA 3R5XA 1HE1C 2A9PA 5C32A 3RSOA 3K0CC 5K0ZA 5LWQA 2P6UA 3P20A 2DFKB 4JZKA 4IWYA 4BIIA 4DQ0A 5JECA 5CJPA 1WEHA 3ADCA 2C84A 2ECKA 4K0RA 4XM1A 4EA6A 4XRGA 1TYEB 3EZGA 3L18A 4HG2A 5ALRA 3WFJA 1LB1B 4LHSA 3THXB 3QEAZ 4OGKA 1T2AA 4EB8A 3QHQA 4ENTA 4YUAA 4Z0HO 3UT5A 2AE2A 5J23A 3FSEA 4JC8A 2IPOA 1L6IA 2XTNA 5KQPA 2H0QA 3LH5A 5SYAA 5IT4A 4IMRA 1BDJA 6AT1A 3H0CA 2XUIA 1M6WA 5DLPA 1KOJA 3U7EB 1C7JA 1COWD 3ONWA 3TLMA 4OL0A 4PSAA 4DCOA 4G1MB 2GUGA 2GNAA 2NU7B 3SOZA 5F1YA 1NW7A 4DIEA 1AS3A 2QE6A 5JRDS 3SVLA 2FUEA 3ETGA 1VTKA 1ZRSA 2QVLA 3GMDA 3KTAA 4KQ9A 4PGHA 1H5UA 5DIZA 4QXQA 3L1JA 1HLPA 2ACKA 4HEA1 4DC1A 1AS0A 1DX4A 1UINA 4GZ3A 4NONA 5CP8A 4DSAA 1JDJA 1WULS 1W88B 3PJEA 3OFSA 1N2EA 1NBEA 2BSAA 2EZ8A 3KSMA 2Z1MA 5FWAA 4F1JA 3U7FB 2VP0A 1AF7A 4X7BA 3EFOB 3EDOA 1T4DA 1GV1A 1SQFA 3PF9A 4LVUA 3U7IA 4CLOA 2J5BA 1BN6A 2BT4A 1YQGA 3DCJA 2R7KA 4KDEA 3RGGA 3RSHA 3VR4D 3AI1A 4YBZA 3V2GA 1PYGA 4I1SA 2Z5GA 3Q72A 2WNHA 1OH8A 1XVIA 4P3XA 1GQ2A 2RCNA 1DKPA 3PGVA 1Q16A 5GIOE 1CS0B 4Q1AA 1Z33A 5ILGA 3TCNA 2AWOA 2NU6A 1VLMA 4GM0A 3VU8A 2IEDA 4GE3A 4AN1A 4BKOA 1T6ZA 4D9KA 2NQ2C 4GF5A 1KRXA 4MI3A 4X44A 4FR2A 2IHBA 4HD8A 3QKIA 2ZIUB 4LYAA 4MINA 4GKKB 1O89A 1M74A 1QZUA 2RI0A 3B38A 3E7WA 2A2ZA 3PUKA 4FR0A 4JU8A 2ZULA 1A69A 1GT6A 1PW7A 4UEJA 4WL0A 4ZOBA 4CTJA 1B1AA 2CDBA 2ZB7A 3VR1A 2WB2A 2VLBA 1Y6RA 3Q7QA 1E1QA 1PDVA 1QP8A 1UL1X 4FW9A 1I13A 4DNPA 4PINA 2NZ2A 3W9UA 3R6LA 1T3HA 2GR9A 3JSAA 3O2JA 1ZIDA 3EXFB 1B00A 4R54A 3VH3A 1PS8A 2VDUE 4ZO7A 3MJTA 1LBQA 1YB5A 1Z5PA 3HMQA 4QRHA 4C0BA 1B6SA 3WBBA 2H1WA 4TXLA 2IYUA 2NYAA 4HRAA 2D3WA 1UFRA 4JUCA 2BEWA 4MDYA 3IPAA 2FQYA 3F3SA 4MR9B 3WKCA 1ZVKA 3TB6A 3JASB 4EB6B 1Y89A 4Q7MB 4X6UA 4O1IA 3NT2A 1T8SA 4RK5A 1BX0A 3S1LA 4AS2A 3PKZA 5KC8A 2Z8XA 1RU3A 1B2LA 5BV2P 5JXJA 2IZ1A 1S89A 2AHOA 2F6RA 2ZJBA 2V7GA 2XEDA 1DAMA 1YHZA 3CURA 3GZJA 2XZOA 5CLHA 3EFBA 1W0KD 4TRNA 4TTSA 4L5IA 1KNXA 3SFZA 2V96A 2D5AA 1F0KA 3PEWA 5JW6A 3CO5A 3U4GA 3HUDA 3WA7A 3FYTA 1YAJA 2B4RO 2AC2A 2ZYGA 3A2LA 3JD0A 1LPNA 1SU8A 2WA1A 3H5TA 5FNVF 2QLNA 1YDWA 1UKCA 4G2TA 4PAOA 3SXJA 1U11A 3L0CA 2ZSBA 1JWLA 3CWZA 3QUQA 4W8HA 2IQ5A 1XMIA 3MBKA 1CY4A 3PB3A 2YTZA 3WV4A 4YQZA 2BMJA 1NJFA 3GWGA 3SKVA 3ZBUA 4NV1A 3RQSA 2I62A 4NFLA 1L5YA 3FNEA 3WGKA 5A03A 1PX0A 3MD9A 3ZZMA 2IVFA 2BFNA 1MTZA 5AJUA 1TL7C 4WFKA 4BMDA 5A4FS 4IUDS 3QGMA 2PPLA 3AHCA 1T0IA 2YUIA 2P6OA 3CN7A 5HRUA 1M72A 1N2OA 1VIMA 4Z53A 4QUGA 1H2YA 1SCUA 1U9YA 3BXZA 3BCUA 4FOOA 4I81A 4RPIA 3VR3D 1DKRA 1XU7A 2P67A 5CM9C 1CT9A 2AYYA 3ABRB 4CMEA 3Q7IA 4DBZA 2JAHA 3GBPA 4GLJA 1CEQA 2P2NA 1G21A 3AUTA 3CF0A 2D0DA 2EFYA 2FF5A 3CHYA 3O3NB 4KQXA 1H65A 5K0BA 4QQFA 5IAOA 4EPTA 4NK5A 2AZXA 4QOJA 4WCVA 4ZK6A 2FW6A 1JEQB 1NBIA 4LRXA 3NH6A 4B40A 5LZ2A 4CM5A 1N3BA 1LC0A 1Z37A 2OMEA 2V65A 4MUXA 2OSVA 5HKOA 2I8AA 4MULA 4YJGB 4LJSA 4QEKA 3LT4A 4CG1A 4JX8A 4HH1A 3J7AC 4QTZA 1MDFA 2VJBA 3T9AA 5IM4A 1OKKA 3E48A 3N8HA 3QVJA 4H7EA 3QOYA 1HG0A 1KZ1A 2XZDA 1BJKA 2QAGA 3AR5A 3OTWA 5B1HA 3EEOA 1B26A 2ZDGA 3DSRA 3IKJA 1QUFA 4QQKA 5JISA 4WBNB 1XZBA 2GAJA 2VK2A 3M1YA 3TMKA 3IP6A 4JAVC 1KKLA 2WJZB 4JMPA 1IXRC 4QGSA 3BXPA 1QCYA 2X15A 3G88A 2WD9A 3WGGA 3L93A 4S2EA 2WZBA 3FFBA 4JJ8A 4LKOA 3S4YA 1V6AA 4FLMA 2VHJA 5FX2A 3VNBA 1ZD2P 3I2HA 5IJXA 2FZLA 2QJOA 2J32A 1HNNA 2LUOA 1TU3A 5E1MA 5HRCA 4YDRA 3N59A 5JMTA 2X2OA 4K6CA 1KFJB 1NHWA 3L0ZA 4TLMB 5F33A 4HQ6A 3JY6A 3WDSA 2PKWA 4YP7A 4ENQA 4TZ6A 2AJTA 4IDEA 1CRWG 3GWZA 3FKSD 1MH1A 4Q1CA 1SXJA 4X66B 3PPVA 2V9PA 1G3IA 1EXVA 1DRJA 1U0LA 3O2NA 3OAAD 1JEOA 2O3RA 5E2BA 2ZYWX 4P54A 1AKNA 3RIGA 1NVVR 3D54D 5DTJA 2HU8A 3NDRA 1W4LA 2IX3A 2WF5A 3MXTA 3RV4A 4L4RA 1XTSA 2E2WA 1Z2OX 2IK8A 2FEPA 2J41A 5ALJA 3F5FA 5ILQA 2PHZA 5FHRA 3VU0A 1AB5A 2VA9A 2IHKA 1PR1A 1DAKA 3N6VA 3BRSA 4XPZA 2MWMA 2VZ0A 4DFDA 1GSAA 3V46A 3UC9A 2RGWA 1JU4A 3HCEA 4GSYA 4NVRA 4I1YA 4Y9TA 3G3EA 1AO3A 2DB3A 1SOWA 2PLRA 3G2QA 4ZVTA 1GFIA 4CU2A 4GI1A 1HFEL 5C80A 1HOTA 4C6RA 2OAEA 3ZX4A 5KSZA 4INOA 2MOKA 3VR2D 4Q3BA 4WA8A 3R7WB 4D6PA 4N7JA 4R2MA 2IXBA 5JC1A 4MMXB 2Z2JA 4IPTA 4LHVA 2V45A 4JN6B 4RV5A 1KSFX 4EYSA 2G7MC 1KVSA 1I1HA 3DO5A 3KV3O 2O4UX 1Z8HA 3D4NA 4IDBA 2Z1NA 1RQNA 4BJHB 3F6YA 4JVLA 4US1R 5LWHA 5LQUA 3SM3A 5DLQC 2UZAA 2P6MA 2QVXX 4AQYB 1PGOA 2X86A 5K7SA 3CZ5A 1FYEA 1OIWA 2VYCA 2O1SA 4MGZR 1HT3A 1A8SA 3IOCA 3G2JA 2I67A 2GLTA 2O07A 3QPAA 1PEYA 1SD5A 1MZVA 2G1JA 4N12A 4UM9D 2JI6A 1L3CA 3LXMA 3T7KA 3A8TA 2YIVX 3BRCA 1CEYA 5EUQB 3PE4A 4U7WA 3OCVA 2YV2A 4FS3A 3MUNA 2QTNA 4MARA 2XNSA 2ZBQA 1RS0A 1HZJA 2W0MA 4LXHA 3NANA 4KI0A 5JH7B 2YX1A 5ECGC 3UTDA 5KYNA 4ZAFA 1MXFA 4XD2A 3SBEA 3NUQA 3RVJA 1EK5A 3WRXC 1M2GA 2X7XA 1U99A 3KQPA 2Q3HA 4WI1A 4EW3A 1KP9A 4C6SA 3O47A 4G01B 1XQ1A 5AVTA 2RG7A 2Q5CA 2IY9A 4KO8A 3ECSA 3TTVA 5EKTA 3BGSA 5IZCC 3HCWA 3AI7A 1VZ2A 2Q5HA 1KPIA 2XWBF 5JNWA 4GZMA 3AF0A 1T0PA 2O7NA 1WE2A 1EUCA 5CDGA 2ZR9A 3TRFA 2KS6A 2YC2C 5E0KB 3TW6A 1GZ3A 3I2JA 3K30A 3HUTA 4FFWA 4WOKA 3RVOA 4DLVA 1PT5A 2XNJA 3UJAA 1UJBA 2Q8QA 2QUIA 2E6UX 4BDTA 3NM6B 3Q3JB 1TT5A 3O3MB 4ZVMA 4Q4CA 3KSUA 2ZRGA 3QX8A 1KJWA 1QO9A 3DPIA 3Q7RA 4INZA 3GLFA 2OCGA 1R6UA 2WSSA 1EGMB 3DVSX 1Y4ZA 2FSGA 4LJLA 3MPOA 2GPYA 3G1UA 5A9SB 4Q6WA 2DUNA 2JFOA 1T2UA 1KDRA 4YLGA 4ZI7B 1NJ8A 3MGBA 3PQFA 2J5XA 3O94A 4NOLA 1RPNA 1BEZA 1U9IA 1EP1B 4KMOA 4H16A 4QTUB 1GHTA 3E5HA 4OQNA 1RHRA 3CRNA 1KMHA 1RAAA 2QQGA 3DDSA 2I1LA 2OUIA 3MOIA 1FB5A 2JASA 1EG2A 1OWNA 4W9NA 4Z9FA 1WHTA 3U5TA 1CSEE 2EWWA 1CE8B 2Q5QA 1OILA 3I37X 1IG0A 1G9XA 1NXPA 2CZGA 4ZIRB 3FSGA 1MJHA 4H1TA 5INTA 4TTPA 2HZ7A 7ADHA 1AC5A 1DOZA 1EH5A 2M1ZA 3ANTA 4MGIR 4EHBA 2Q1TA 2VHYA 2AB0A 4NQZA 1HXHA 4OHWA 1FU8A 5DRTA 2GNPA 2O8BB 1BXRA 2BUCA 1N3LA 2WC1A 4FOLA 3RR2A 3NTRA 1U7PA 1JG6A 1V6CA 5J58A 4HEHA 1H6AA 4IOLA 4V2UA 4ZEXA 4CI9A 1GGKA 1J06A 2RHJA 3KL2A 3FAKA 4U8HA 3SMVA 1T6NA 1NNI1 2AKYA 3BK1A 1JPVA 1M10A 1Z5GA 3DTVB 4FE7A 1ZGGA 1Q2XA 1V3VA 1YDMA 3H2HA 3K6SB 2IBSA 1NF8A 2V59A 1M34B 4U7DA 1NZJA 3ESZA 3OX3A 1NLUA 5AW3A 3N5KA 1JJ7A 3Q5DA 1F12A 1S2GA 4LMAA 1PFKA 3TX2A 3RTCA 1U63A 3UAZA 4JYCA 2Y77A 3BILA 4HXYA 1K06A 3PR3A 4LNUB 3GGCA 3TUJC 8AT1A 1P0MA 1JHDA 1WXWA 1UDCA 2HSZA 4O4IA 4CLRA 4R83A 1OZHA 5EQTA 1QR6A 3GZ4A 1UF9A 2YHAA 3P7MA 1QP7A 3FYHA 3RYFA 5CFZA 1GPJA 3NPMA 4YJFA 5EN4A 3RS3A 2YWDA 3ZZTA 1QG0A 2C5EA 4E5YA 1X39A 2SECE 3LXRA 1C1YA 3ZTWA 2EJTA 4I5IA 2H57A 1L7EA 1V4NA 3I83A 2FUCA 2WF6A 2YHIA 3TGPA 1LPMA 2FQ1A 1O8BA 1T8WA 2G82A 3CXUA 3VZCA 2MINB 2JI9A 4QJ3A 1BMFA 1A5SB 1LBIA 3BD6A 1N8NA 3BQNB 3VNVA 1NAHA 4MIYA 1H5QA 4LXQA 4M7OA 4Z8XA 1I4TD 4P4TA 1JPUA 1GUYA 3ZVNA 4ZT4A 3EIUA 4D4GA 1MC5A 3IIIA 2A94A 2X9NA 2WF9A 4RCVA 2O8DB 5LZ8A 3CUKA 3ESCA 1ZYUA 5CVEA 2R66A 4FSHA 1L5HB 3OF2A 2BE7A 4Y1RA 4N9QA 2QM3A 2A1UB 2Q5FA 4NDAA 3OEHD 2E5LB 5DX1A 2R48A 5JD5A 4EQ6B 2AMYA 3BUSA 4MV5A 2C7PA 2VSQA 4QGGA 4A0GA 2CFIA 5JJBA 2BSQA 3ICEA 2IZ0A 4ZFNA 5GGXA 1P75A 4GQIA 4B4KA 4OJQA 5TS3A 3TW8A 3SJZA 3GJ5A 1IB6A 1T1EA 2F3TA 2JGLA 3EA0A 3L0SA 4LDAA 2C7QA 2PUGA 4HN9A 4OKIA 4F2DA 2UZ3A 4KP7A 1NFFA 2W2LA 1Z2CA 1C41A 1IZ9A 1XDSA 3ECAA 3N8IA 2E49A 4EHIA 2NVOA 1G5RA 1U0GA 4Q3KA 4RLFA 1QF7A 4RFVA 3U62A 4DLKA 2H8GA 5I9SA 4YMVA 2W6JD 1IOLA 1X9GA 4K8RB 1GZ6A 3ZUGA 3ZD7A 3AUSA 4CKEA 2I33A 5KEIA 2G3YA 3MQFA 1I1OA 1XNQB 3ESYA 2HRRA 5JCOC 1P3JA 5EWLB 3VHRA 1JQLB 2VHZA 3GCWA 1SHJA 2VA8A 3QFSA 4IIXA 1P8AA 2FEMA 4GT1A 2X1MA 3NNDA 2QEQA 4OX9Y 1NVTA 1D09A 5LQCA 4B80A 5EJ5A 1GGHA 1ZOPA 3PWKA 4YH1A 4D8XA 2X4DA 4XX0A 1IHYA 4TYMA 1IBCA 4UNQA 1K7CA 3HFJA 1LPSA 3AETB 3J7TA 4BJ3A 1HEYA 1WD7A 2WPDD 2VSYA 2JAOA 2PVPA 5ARDA 3ZE9A 2P6NA 2ZPTX 4P3OA 1ODKA 4PCLA 4DREA 2PGNA 3KUXA 3OTIA 1P6QA 1MO3A 4EENA 1QGDA 3FE2A 3DEYX 3W2GA 3SJ7A 3WGQA 3ZNOA 4RENA 4WK6A 4A23A 3MS2A 1QVWA 3E8XA 2QZSA 3UPTA 3P8ZA 4H1WA 3BD9A 3GH1A 4WCFA 5CFPA 4GMHA 2IA5A 2VJQA 4X85A 3ABIA 2DCUA 4R8SA 4NQRA 1JTVA 1EQ2A 3HKCB 1IOVA 4AUNA 2R1TB 1QAOA 3TW0A 3Q15C 2NUPA 3ZY3A 1E4EB 1VL1A 4X20A 3AK4A 1L4MA 2UVPB 3L7MA 2POCA 4N65A 1ZOOA 1AQNA 4FUTA 1XRSB 5KU1A 2QS9A 3IKLA 3P9XA 2KLHA 5C7OO 5JJIA 1XKQA 1N5OX 1CB0A 4GL2A 2W2QA 2AE1A 3W5CA 3FLAA 3ZJVA 1RFLA 5JMWA 1PX2A 2IY7A 2GZ1A 1MENA 2IC5A 4GUDA 2EFGA 3TGWA 4ZMRA 4GMGA 4I2VA 5A62A 1YQDA 1GYRA 2QT9A 2PMBA 1V8PA 4NK4A 3U3KA 2ZRIA 4EJ6A 4G25A 2XA2A 4ZRDA 3GPLA 4F71A 3LIPA 3EAGA 2ZRCA 3GOHA 2PUFA 3PWTA 4RVDA 3ZZNA 5D3MA 2IX9A 2NQTA 3HJFA 4E2FA 1V1JA 3KJGA 2Q50A 1ECPA 4KR7A 2PNJA 3R6TA 3VKUA 4Q3EA 4WY8A 4L02A 4EJSB 1KI4A 3V34A 4DIDA 2XOEA 4P2BA 3EYWA 1PJAA 4YIKA 4BEJA 3U16A 5T8KC 2FLVA 5GJWC 1HBJA 2CLDX 2AUNA 5LP1A 4O2AF 4P7GA 5LYJA 3QK7A 1PYDA 2UVDA 4MLPA 4P7FA 3AVWA 3BE5A 3EY9A 2N9UA 3T5BA 1DJNA 5DHQA 4E5MA 2NT3A 2ZS7A 5CT5A 3RGWS 2BBWA 4CCSA 1JDZA 2VDJA 5DP2A 3S2GA 1OFVA 1EK2A 3ND9A 1U8EA 2C9OA 1KQPA 2M6SA 4HDRA 7MDHA 1EMDA 1V7ZA 5DASA 3OU6A 4BQPA 4ZCIA 4US2R 4JQSA 1QH0A 1D2CA 2QRVB 2IPMA 2GAFA 1LRLA 2BZ1A 5IXSA 1KK0A 4I4TF 1L5LA 4YY3B 1UBFA 3H65A 1UM8A 4CT5A 5KTSA 7MHTA 3P0RA 4UZSA 4FINA 5JIBA 1T3GA 2GGSA 4AJ9A 5CEJA 3QSYA 3ZGYA 4TXHA 4QO8A 1DWPA 1ZHFA 1XDZA 4LHWA 4LNAA 3GRZA 3Q88A 3HSYA 3HO8A 1SJ9A 3WAKA 2OZPA 5IVPA 3V42A 3K1AA 4C7OB 3NKVA 1LW7A 1O8CA 4WKCA 3Q1LA 4DT1A 1PN3A 1E9FA 4D26A 2JIBA 3VU9A 1SQSA 5AJWA 2QX8A 2R2AA 1SG6A 4A8JA 1ATZA 5I48A 2IOHA 4B17A 3I30X 1U2GA 1ZA1A 1D0VA 2FCRA 3GEMA 3IOYA 4L6AA 3B13B 5H83A 3V3KA 3LOUA 4L2IB 1F2VA 2H4FA 5PNTA 1Q0SA 4FT2A 2YYYA 4GC5A 2OEPA 3WZ2A 4BVGA 1ZHOA 1I30A 3MIZA 3U4IA 2QLFA 2A1TR 3N7TA 4HX2A 4DCVA 2VJMA 4KBYA 5K05A 2GK3A 4KC0A 1NX6A 2GO1A 4Y2TA 4JJ7A 4QEDA 4BU0A 4BQEA 4KSCA 3TQRA 1MZPA 1E2MA 3LBFA 1CJCA 4MA4A 5FD8A 4Y0VA 1QO0D 1RXSA 2NM0A 3BERA 1Z39A 3FPCA 2FW0A 3TDNA 2RGCA 2PL3A 4INPA 2QTMA 2AF3C 1GTSA 5ESWA 2WE7A 1S1MA 1PFWA 1TT7A 2EKPA 5FBZA 5H3HA 1ZW1A 3NM4A 4JEHA 4ENWA 4ENUA 1A9ZA 3KQTA 2I6QA 4HDSB 3SBOA 3ASVA 1LTKA 4AZ0B 1W0KA 2EFDB 2Q7OE 5LQAA 1YZFA 5CDTA 4PG4A 4B7XA 4C89A 1ADJA 1E2KA 5IJ9B 1XZCA 1BCSA 2CXHA 4GZ5A 1BU5A 1MVOA 2V1XA 5C1DA 5J40A 1ZIOA 1MKYA 4R8RA 4UBLA 2G5GX 3NHSA 3CTPA 4J49A 5HTOA 2R65A 2PLFA 1N6PA 4HDQB 1Q21A 2B69A 2EOAA 4ZZ0A 2PG3A 4ILKA 3S8EA 3L0OA 3MT8A 4R16A 3L4KA 3O8DA 1X1RA 1LVUA 1XDBA 1ZINA 4HLNA 4PRKA 3O4HA 5AK6A 1T5TA 5JXHA 2XUQA 2DWUA 4RVCA 2XUKA 3LY7A 2XDYA 4I4NA 1E4YA 5BNFA 2VNAA 1ZH0A 3FMGA 4H4DA 4LN1A 3CX6A 1MAVA 1T3ZA 4EMBA 1N1MA 3A1DA 1V5WA 4R1LA 1M6HA 2BFEA 1BDHA 4EQZA 2QSYA 4H7DA 1W75A 3KPVA 3VR3A 2KSQA 3NTOA 2FP4B 4RSHA 4B4UA 4B2YA 2JLVA 1ESCA 1C29B 1YT5A 3BH7A 4J43A 4G5GA 2FPLA 2NVUA 4HZIA 5KTTA 1CUAA 4LX8A 3AL2A 2BL4A 3GJ7A 4G4IA 2GPNA 4IJMA 4GXNA 4PHCA 4ENSA 1THZA 4G37A 3NHUA 3B9PA 4REQA 1XXHB 2FEXA 1KVQA 3DDCA 4H1UA 3U60B 3SG0A 1E2EA 4W7HA 5BRNA 1XNGA 2JW5A 4JLUA 2NO1A 1Q14A 3HWRA 3JARB 3KHTA 1DFIA 1Z73A 2HQOA 3FUUA 4LI3X 3B52X 3WDLA 4UATA 4XCQA 3ZHXA 4CL2A 3O91A 4NC9A 4BXOB 2AHRA 1ZLXA 4LX0A 1C3OA 3E15A 4KH0A 4YWJA 1G6HA 2QN9A 5KOJA 3DV2A 2VTBA 3IERA 1ISHA 4KIJA 3WXMA 4HVCA 4ZYLA 5J59A 3QY9A 1UEXC 4IQFA 1U0FA 1M1YB 2IUSA 3QPVA 4FU0A 5EOVA 3W6ZA 1R5BA 4WUTA 5ALDA 1G7TA 4B4VA 3ICQB 4QWWA 3ISVA 1EFTA 3F7MA 2B6HA 4S1TA 1C1DB 3KKZA 1ESNA 4EAAA 4LOAA 1AHIA 1M0SA 3QVGA 3RS5A 1S7GA 1O9GA 4G5FA 5HF9A 4F6CA 1CTQA 2Y93A 4B81A 4BLTA 1FMJA 2F8LA 1YD7A 5EHXA 3OTQA 3NGXA 2OCKA 3DBHA 3LJKA 3EDYA 3DFZA 2R8XA 2RGDA 2DKOA 3CZAA 4WKPA 1B6GA 3I0ZA 4YMTA 4CG3A 2YNMC 2WJHA 4GX2A 4IDFA 2CKDA 4MWTA 1RKVA 3FGZA 4QRDA 4PGAA 4BMSA 3RC3A 3EK2A 2A3RA 3BH6A 4ZVKA 2XT0A 4TMYA 4Y18A 5FUWA 1GNLA 3FKSA 3WGUA 3FB1A 4QX6A 1GTG1 1UFKA 4IIJB 1T8UA 2R1VA 3OUUA 5BV7A 4DUYB 2ATEA 4P4GA 3CSUA 5AM1A 3NATA 5ALHA 5IULC 1DB3A 1WRBA 3OAAA 1A98A 5ILOA 3HB1A 1DFGA 1G8AA 1YRYE 1WHSB 4KMMA 3QX3A 3L8MA 3CLRD 1L4KA 1S2NA 4BZWA 4LYDA 4D3SA 4EECA 1Y6FA 2R3SA 2AFRA 2RARA 4UREA 2Y6VA 3EDCA 4U9HS 3DAHA 1OFGA 2ZAOA 4EG5A 1H8HA 4F11A 4I5DA 2C2XA 4GLFA 1SKUA 3TGLA 3AVYA 5I4KA 2YV1A 2NTNA 1X86B 2D0IA 2IW3A 4L3OA 3GFFA 4JC0A 4JUFA 3O4VA 4IXDA 3A4LA 4Q12A 4V38A 3WADA 4FX2A 1MB3A 3ANXA 4G0MA 521PA 3M6UA 2BFDB 2QAJA 4OB6A 1EDBA 4K2AA 1VMKA 4RFSB 2P9HA 5CMLA 1KQ3A 3A4NA 5IUKC 1Q77A 1WLYA 2I66A 4N5IX 1UBEA 1OH7A 3V48A 3WYGA 3F6SA 5FLXA 4INJA 2I4OA 5DE3A 2ZE7A 2REQA 1H0RA 4JJ4A 4OLJA 5ENDA 3DMHA 3THXA 4F3CA 2C0CA 4AMZA 5BN4A 1JX6A 5ALOA 4IVNA 1DPFA 2H00A 4DRXA 3PGXA 3GBSA 2R96A 4W9MC 1II8B 2CMHA 4ZYTA 3K0SA 1NQVA 5CVCA 3GV0A 4BBPA 3DYVA 1T13A 3EQ7A 2BE9A 2YZNA 4L74A 4L22A 3PD1A 5EIFA 2R0QC 2J87A 1Q1EA 4LFCB 1EVQA 4DCPA 5LZ7A 2VT3A 4EUFA 1LUAA 2XB4A 1O7JA 2RH8A 1O5OA 1JDUA 2C4MA 2I1VB 3OIVA 3R3HA 4DLUA 4YMUA 5JAPA 1GRCA 2EJUA 2NU7A 3C6YA 3E9CA 1Y7PA 2I7DA 3AWDA 4N82A 2EW2A 4GOKA 1N9GB 3OE1A 3H2IA 4MQBA 5K5EA 2WP0A 3HDHA 3HXOA 3OIWA 2P2YA 4RIGA 4IXTA 1Z2AA 1P31A 1Z7BA 5CNJA 1KFEB 4NXNB 1BDMA 1TRHA 5IEBA 3FYUA 3UA3A 4P53A 4MW7A 3WWCA 1ID8A 5IPFA 3U7JA 5K0JA 4FVTA 1W88A 2RJOA 3ST7A 2B0CA 2CJWB 1SU7A 1GSOA 2Q6IA 1IK6A 1PJTA 3P27A 4J7UA 4CF3A 3RC2A 4H4EA 3UENA 4OI0A 3NWEA 4LYFA 3HZOA 2HPZA 3T54A 1A77A 2E48A 2AZ4A 3WICA 1TM7E 1X8JA 2A59A 2FW1A 2PBLA 1A8IA 2P0EA 4LJ8A 2VQDA 1K27A 1RJDA 3GDOA 1OB5A 1TTPB 4NKRA 4X95A 3PC3A 3AFGA 5ADHA 1OF1A 4LBZA 4ODIA 1MC1A 4I2NA 5KC9A 2WAMA 3JVIA 2VTDA 1W4RA 2KBFA 2Q29A 1LDBA 5LNK1 1DBWA 1AQIA 5TQ2B 3HXTA 2E37A 3FPKA 3O9VA 5SV2A 3S2FA 1I7QB 1ZA2A 4QHYA 3LGSA 3RBXA 2V3CC 1Q17A 1OX4A 1IJFA 1Y3HA 2P7HA 3EIFA 3QFFA 4MVWA 4TWRA 4DNQA 1W2WB 2CLSA 1KWGA 3EXHB 4HI0E 1NASA 5CDFE 2VPQA 5H16A 3EZNA 1GPMA 3G9XA 4JEMA 4URZR 3K31A 4D0NA 5U4QA 2IYYA 1IM2A 2V8OA 3BE8A 4KTVE 2ZWPA 1WZCA 4O2BB 4OQMA 1Y37A 4AMGA 4QUAA 3HHEA 1ECCA 2AI3A 5KWIA 3OTOB 4U6SA 1HKHA 5LU8A 1ZMTA 2P8JA 4L08A 1QFZA 2O7SA 4FBGA 2D1TA 1MCZA 1KARA 2I2BA 3NZEA 4P8RA 1E3WB 2ZJFA 4BU1A 3EZLA 1TCBA 3PEYA 4NE2A 2NACA 1FTYA 3CNEA 1HURA 2QYTA 5C8YF 2NPOA 2Z0MA 4M8LA 3JASA 1BVRA 4KPGA 4RNDB 4OD0A 4KPYA 3MW8A 4D97A 5CB4A 2QOEA 1PQWA 1J4AA 3HUEA 1E0KA 1V47A 2XUGA 3PXXA 4L4SA 5M29A 3GF4A 2PAFA 5A0FA 1O4WA 5KS2A 4NP6A 1IBRA 1TAUA 2ACWA 2IH2A 1R3UA 5BSUA 1YQUA 2X9GA 3G89A 1V4BA 2CDNA 3I0NA 2HLDA 5ALWA 2NXNA 3DB1A 3OMLA 4IL5A 4AJ2A 1DJMA 4QTYA 3DO8A 1Z4OA 4R1MA 4EBBA 1TXGA 5HS4A 4I8XA 4CU5A 3EPHA 2WIGA 5KCMA 3NUZA 1N2BA 4BWFB 4TKLA 5EE1A 2XQVA 1E2LA 4N49A 3CX4A 4KQWA 1FDTA 1Y1PA 1WVMA 1SUPA 4UQPA 3TXAA 1DTWB 3WQHA 4Q9KA 3E4DA 1J0EA 4IQ4A 4Q05A 4F9GA 1H9CA 3KFLA 3R0JA 4WD3A 1M2KA 2VK1A 2KYRA 4V02A 2W9XA 3UIEA 1WPRA 3OJOA 1B8UA 3X1XA 5IH7A 3LLSA 5TIIA 5FBLB 1WD5A 3GEBA 5KTKA 3PICA 1ZJ5A 1BHQ1 5JNUA 4YJHA 4URWR 2H54A 4UXJA 3UMFA 2B6NA 3X43A 3GHHA 4FMCF 5L95A 4EX6A 1E7QA 3HWWA 3EIQA 3I04A 1H0KA 3DKPA 1DO2A 1EGVB 1LDNA 3JQ6A 2BMWA 3OCUA 3VVLA 2ZJOA 1OHHD 3CS3A 2Q46A 3ETNA 3LQFA 4MEBA 5D7NA 3AR9A 3QIVA 4LY3A 2PXHA 4RVGA 5JDCC 5L53A 2HJ9A 1JQKA 2W00A 5BQFA 5T67A 3DLTA 1W87A 3QYJA 3RVLA 3S28A 2HYIC 1WTCA 1X87A 1Y4AE 4B31A 1M8KA 4WNAB 3W5UA 3ZD8A 2XYGA 2GZAA 4NULA 5KTRA 1IRIA 2ZI4A 1JEYB 5L4NA 1PV4A 2ZT6A 4FYJA 1DO0A 5BQ3A 1JIXA 4GYWA 3WK4A 3IXLA 4WBNA 1R9JA 3F5MA 3EGDB 3V1MA 3AT1A 5IDYA 2W71A 1PZGA 3IHTA 3OEHA 5CVUA 3UYLA 3DYBA 5TE9A 1N57A 2D5BA 4JJEA 5A7GA 4A10A 3MCAA 1QPGA 4H7IA 1L4UA 3IPXA 1C81A 1VJ5A 2FCAA 3QLVA 5JD4A 4OQPA 1W4AA 3VVCA 1B6RA 1JGTA 4F3YA 4LZZA 2QYOA 3NBUA 3JQAB 2WKQA 2YZMA 3DQZA 3PR2B 4Y0NA 4JJFA 1FK8A 4X92A 1W35A 4ZCLA 4B3IA 4LXXA 2UAGA 4LJ7A 3A9RA 5BR7A 5KYWA 1ZKDA 2B5VA 5T5QA 4BB9A 4UDXX 4IMJB 1JI0A 2PJDA 4KREA 3ZDBA 4I6GA 4GEKA 2YVUA 3L8CA 4M4SA 4RLQA 1BS2A 2W6JA 6NULA 5EFOA 1RAEA 1FMLA 2BKVA 2VWQA 2SKDA 3HB0A 1B42A 5L4SA 4O8ZA 2YN0A 2JPDA 1RHMA 2RK4A 2W6OA 3TLCA 5CXXA 4BBAA 2XVAA 4DAOA 2X42A 1MEEA 1C0PA 5KMGB 1GUZA 2P6PA 2TS1A 3EAQA 2J7KA 2O06A 2R1ZA 4QAJA 5K51A 1KQGA 4DIKA 2HLNA 4MAMA 4O3MA 1RXYA 5BQOA 1G38A 4YJ2F 1YZVA 3WGTA 3PDUA 1XJ5A 3TO5A 4F8YA 1KVRA 1FFDA 1HMPA 1RC8A 1QOPB 3CNQS 1NFQA 2IRWA 4KQHA 3EC2A 3MSXA 2WU0A 3NXSA 2ACVA 4Q39A 1ULUA 4Z4GA 4RGQA 3RVMA 5K99A 2VAXA 2FSPA 4ZHSA 1OAOA 2GN6A 1AHHA 1ID1A 1UDXA 2ZYDA 5DBOA 5HCIA 4AIRA 5JFTA 2P77A 3QLUA 1T25A 5C5DA 5LU9A 3AF5A 1WKBA 4ZYVA 2HU7A 1I0IA 4AKEA 2JLRA 1LSSA 2B61A 1BW9A 4EVSA 3T41A 1ULHA 2QN7A 4P7JA 4RZ3A 1KKMA 3ML1A 1TC2A 3WNQA 3QNWA 2PXCA 3IJPA 3HL0A 5H3CA 4M6WB 3FLEA 1F8FA 1P62B 2ZSAA 3G7SA 1Q22A 4TV8B 1IN7A 4PTZA 3R8XA 4NBVA 3WRVA 1OREA 1T9AA 2EP7A 1OAAA 2NAFA 5TGZA 1D0SA 4UPDA 3UKJA 4C20A 4K1XA 1QMGA 1PLJA 2GPTA 1CK4A 1E8NA 4UTRA 4F97A 3DR5A 4HYYA 5AJTA 4EHLA 4D8WA 1GL7A 4FCTA 3WMFA 5KINB 1I3LA 1CQJA 1D2EA 1TZ2A 1X2EA 2AWNA 3MWDA 3T5CA 3LNTA 1FQWA 3JAWB 4KXWA 4Q4HA 4YJ3A 5CM2Z 1S2OA 1IE3A 4BQSA 2NZWA 1Q7CA 4AN0A 4JBWA 1KEWA 4RJKA 4H2DA 5HCUA 1GZSA 1SKMA 3IPYA 2RKBA 1NOIA 3PCTA 3I23A 2HWWA 2HJWA 1SB9A 3SN6A 5A1JA 2CHEA 3AP1A 4WKGA 1Y5IA 5EJMA 1AU9A 2ONKA 3PIDA 2YCLA 1ZEMA 4CKXA 5JH7A 1TM3E 3AU8A 1TGVA 4ZVUA 3TQQA 4W9RA 1UQUA 1DMSA 4KN8A 2YC4C 3L41A 3FNIA 2JJ1D 4C7XA 5HSGA 2ZUFA 1NUTA 1ACMA 2AOXA 4F7WA 4TTAA 3LY8A 5HZGA 2P2GA 4MAFA 4A2WA 3FMOB 2D7CA 1C50A 2ZRLA 4NBRA 4QVKA 1D7OA 3PNVA 4AF7A 5LQRA 4CM4B 3PC8A 5B57C 3V3TA 1F2UB 1SB8A 1WF3A 3G2KA 3L8HA 3PXDA 3F7OA 4J9UE 1WG8A 1NQAO 2GM3A 9ATCA 2MT9A 1GSIA 2Y1EA 2X0JA 2XCIA 2GCIA 3HJUA 2AKEA 4B7ZA 5ERYA 4JY7A 4RKYA 4KMRA 3TKYA 4ID9A 5M04A 1OYWA 4ZGBA