1E7SA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase/reductase
molecule keywords GDP-FUCOSE SYNTHETASE
total genus 109
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7sA02
5JAQA 4I5GA 2OGUA 3PQDA 1BXGA 2ZTMA 2GCGA 2J8ZA 4Q3EA 5GZ3A 5KVQA 4FDAA 1SAYA 1ZW1A 3WGHA 3ADOA 1X7DA 5IDQA 3K31A 2EJVA 5G0VA 5IXSA 4QX6A 4EYEA 4EW6A 5B4UA 4GI2A 4JBHA 3ZH2A 2DFVA 2X4GA 2DAPA 4CMKA 1ZK3A 1A4UA 3NYWA 5A4DA 5JAMA 3OMLA 1H6BA 3VTFA 2ZYGA 4J49A 4ND3A 1LEHA 3NDRA 4INAA 1VSVA 8LDHA 5L7TA 3KB6A 1B7GO 5DP2A 3U3XA 5ICMA 3BMQA 1PJLA 3TNLA 1I3MA 5L40A 4AJJA 4Q3NA 3LC2O 4CQMB 1K89A 1VKNA 1O94A 3WXBA 1YB5A 2GERA 4MVJD 1HE2A 3HZZA 1H5QA 1QYDA 4WCFB 2PH3A 4QEDA 4RZIA 3LLVA 3K5PA 3P2OA 3UCEA 5ER9A 4Z0PA 4DMMA 1VJ1A 4Q3CA 4MVJF 4AJHA 2Y1DA 3OECA 5F1PA 1OFGA 2P9CA 1QYVA 1ENYA 3KSDO 4XZ3A 2UAGA 3MTJA 5A5EA 4JIGA 4NJOA 4P4NA 3H8VA 5CDSA 1DSSG 2DUUA 1ISFA 4XEHA 3CSDA 2NU6A 3V1TC 5GZ1A 4JCOA 3RQSA 4BO7A 2Q2WA 1PJQA 3MCVA 4J90A 1T4BA 2YV3A 5TJ9A 2B35A 3AJRA 4FW8A 3CINA 3AFNA 4IIVA 2B0JA 5F5NA 4YPOA 3VTZA 4BGIA 4J1SA 4CQLB 2BF7A 1FXSA 3EZLA 2VNSA 3TL3A 3VH2A 2O3QA 1DOHA 1E3WB 5EN4A 3MOGA 4CMIB 1PWZA 4YB8A 3UAGA 4DLLA 4E31A 3CZRA 2GD1O 4F6LA 3GNSA 2GR9A 3BZUA 3OH8A 3WNQA 1H0KA 1OC4A 4XQGA 3S2IA 4YQZA 4IJWA 3QWFA 3QA9A 4WLNA 3PRJA 1ZSVA 2AQHA 1EMDA 3W4IA 3F47A 3DBRB 4ONEA 5DZSA 3ZNPA 3QWHA 1U7TA 1XIVA 4DC0A 3IKVA 3AM3A 4YT8A 1XU7A 3D5TA 5L3ZA 4R01A 4FD3A 4ND1A 3RAJA 1N9GB 4B4UA 1MP0A 4D0RA 1E7WA 4AJKA 5JAZA 1K6XA 2LDBA 3PHLA 4KUEA 1KVQA 3O03A 4CM4B 4NU5A 4M54A 5COQA 4O0LA 4PG7A 1R15A 1N7HA 4CM4A 4EGFA 1CF2O 5ENVA 1E77A 2DPHA 1OZAA 4Y6SA 3DZGA 2EHDA 1NQOA 2P5UA 4RGBA 4PCVA 4N5LA 5B12A 1QXSA 4YRBA 4GLLA 4GSKA 4M55A 3K2BA 3ZWWA 4IDBA 2G76A 3ANNA 3IMFA 5ITVA 4GKBA 2ILTA 3GUCA 1ISHA 1JLLA 3PFWO 2Q4EA 3AOEC 1Y6JA 2FR1A 1QRRA 1P77A 1LDEA 1EZ4A 1FF9A 2O3RA 2C82A 4TZTA 1Z7BA 3N7UA 3F1KA 3SBOA 4CUKA 1QLJA 4CM3A 4XDZA 3FR7A 4RDIA 2YW9A 3L07A 3KVOA 4A7PA 1YBVA 3FN4A 3QVWA 3OBBA 2OUIA 3FWNA 4YCAA 2V7PA 2I67A 1AN9A 1VSUA 4LMRA 1DRUA 3ZWBA 1ZK1A 1NQ5A 2OO5A 3ORFA 2CDAA 1ZMTA 2I65A 1GU7A 4UEOA 3IUSA 4D43A 5CDTA 2I9PA 3DZJA 2POQX 4ZA2A 5IZCC 5L45A 1YB4A 4LVUA 1JTVA 2HJSA 3JQAD 4FGSA 4ZN6A 4RV9A 3AUSA 3ROPA 2PY6A 5JY1A 5CDUA 2DTDA 4FJ1A 1NPTO 4YJFB 4K9DA 4A5OA 3OQ1A 4Y6RA 3DBHA 2TMGA 2AE2A 1DC6A 2VYNA 3NX4A 3RC9A 5C7OO 2Y1GA 3P5SA 3R0IA 4DBVO 1JKFA 3VH1A 1I2BA 4YVFA 1LC3A 4JQCA 1VKOA 2H63A 5I9LA 3BAZA 4RVHA 3UCXA 4AJPA 1ISJA 4HX5A 3HDQA 3VDQA 2Q1TA 3NEPX 4TKLA 5G4KB 5A9SB 1T2AA 3FNHA 3ZHBA 3JD2A 5IZCA 3BTUA 3AY3A 4ILKA 2Y1OA 4NFHA 2IZ0A 1CRWG 3LT2A 1GV0A 4NJMB 3SJUA 4J3FA 5A02A 1UUFA 2Z95A 2GN8A 1IHYA 4J4HA 4NJMA 1Y7TA 3PZRA 3WGQA 1NFFA 3RBZA 3AFMA 4IIUA 1E1NA 4G65A 4ZQBA 4K1LA 4P4LA 2BRUA 5T6BA 2OP1A 2PZLA 2AG5A 3RUCA 3O8QB 4L75A 4J9UE 3RFVA 4WLUA 2XPCA 2EP5A 2VHYA 1WDLA 2RH8A 1C1XB 1PJ4A 1LQUA 2QRJA 2ZJ1A 3G17A 4IJVA 4L0QA 2R2GA 1KC1A 2ZKLA 4O6VA 3ZV3A 2VUTA 4ZD6A 4D44A 1QYCA 4L76A 4KTTE 3T4XA 2V6FA 4TSKA 3FNGA 2PD4A 3I4CA 3WWZA 1TI7A 4ZRMA 1DAOA 1E1KA 2ZJ0A 1YJ8A 1VLLA 2Y67A 4R69A 4N7RA 1UXIA 4NG5A 1SBYA 2X23A 2ZTLA 4OL9A 1ZUD1 3JD1A 4KQWA 1WZIA 4XQCA 1PQUA 3ZU2A 5ADHA 2PR2A 1ONOA 1O5IA 2GASA 3NT5A 4GMFA 3NTQA 4IUYA 2CZCA 3HN7A 1GZ6A 4KDFA 3B6ZA 4DIBA 3B1KA 4BO9A 1WXDA 1EFLA 3AOGA 3ETDA 4KDEA 4DXHA 2PGJA 4MIEA 2BI7A 2H1SA 4FR5A 3ETGA 1PS0A 2P4QA 1U2DA 1Z82A 4OGWA 1DFGA 4IMRA 4JBIA 3T4EA 2PK3A 4A0SA 3ADPA 3BIOA 3ZZNA 3DO5A 3X2FA 3WICA 2NACA 3DZIA 3DL2A 1NXQA 9LDBA 2G1UA 2B37A 4I5EA 3LQFA 3PGJA 5IN5A 1YDEA 4TMFA 5A06A 1U28A 4R9RA 2Q99A 3QHAA 5GMOA 1TVEA 6LDHA 1SB9A 2Y1EA 3I9LA 3AU9A 1LNQA 2NADA 4NPCA 3AM5A 3EC7A 1KY5A 1XGKA 5G0WA 2OP0A 3ANMA 3JYQA 4OXYA 3ZWXA 5B4TA 2J3JA 3M6IA 1IE3A 5LC1A 1PWXA 1BSVA 4IXWA 1ADBA 2DU8A 1EVZA 1QSGA 5EQFA 1C0KA 3MTGA 4F6CA 4IZHA 3GAZA 7ADHA 2NQTA 1P44A 2YUTA 1WMAA 1VM6A 3CUKA 1JKIA 3FBGA 1I0ZA 4ZICA 2JCXA 3WIDA 2IXAA 4ALMA 5TLSA 3H4VA 3L6EA 4E12A 4PFJA 3PK0A 4E5NA 4WJZA 4YYZA 1LLDA 2W4QA 1DDOA 1RPNA 5ICSA 1JAYA 4O1MA 3DAFA 1VPDA 1ISIA 4NBTA 1C0IA 1CYDA 5F5LA 4BGVA 1DC5A 2AXQA 4R9SA 3GZ4A 3KUXA 4CV1A 2O3TA 2X6TA 2Q4BA 1XQ6A 1T1RA 1VJTA 3V1UA 4WE3A 3P2YA 2I3AA 5C5IA 2WYVA 2PZJA 2VTDA 4BQRA 4G2NA 4EJ6A 1UXKA 2PGLA 3W6UA 3O26A 3DR3A 4RF2A 2IE0A 3F6YA 4PLYA 4I1IA 3OA2A 3OM9A 4YJGB 4CR8A 2JFGA 3JQGA 3F4LA 1C14A 4MP8A 1XU9A 1NM5A 2FR0A 3H5AA 5FI5A 4E32A 3IC5A 3RI3A 2CF5A 1F06A 3RUDA 1T2FA 4EDFA 4Y9DA 2JCVA 4RLHA 5AXDA 5TQVA 2BGKA 1MLDA 2UDPA 3KOUA 2DQ4A 4Z9YA 3AOEA 1LLCA 3HE3A 5BSHA 1J0XO 3MJTA 1JVSA 2IYOA 3AW9A 3FRJA 1MG5A 2VZ0A 3GVXA 4XJTA 1P1JA 2YFHA 2QYTA 3NKLA 3WTBA 4UVGA 2HCTA 1NQTA 3E9MA 5A5FA 2IXBA 1ENOA 1HLDA 2Q45A 5ILGA 4WCFA 3A14A 3KEOA 1D1SA 5JDIA 3DMYA 5I7FA 1SZJG 4BV8A 1P1KA 5BT9A 2HMUA 3ZV4A 2OORA 3H2SA 4IQGA 4ID9A 4R1TA 4IDAA 1HT0A 2VCYA 4TVBA 2BI8A 2VUUA 4DC1A 1I01A 4J9VA 3DFZA 4OH1A 5A3VA 2Q50A 1KYQA 2CMDA 1R66A 4FFLA 3UW3A 3AUTA 1BGVA 4BV9A 5JSFA 4YAEA 3VKVA 4CMHA 1JW9B 3PEFA 1KEWA 2J3KA 4DPLA 2EKPA 3ENNA 4MIOA 3HFSA 2VUSA 4N5NA 3S2EA 4WNIA 4UEKA 3EK2A 4ZRNA 3HHPA 4XYEA 1SNYA 2UV8A 1P1FA 1X0XA 4I8XA 4XGIA 4YQYA 2OOSA 2ZQZA 3DMTA 3VZQA 1YWGO 1T26A 1C1XA 4M49A 5ER6A 1HZJA 2FSVA 3NJ8A 3EW7A 4YDRA 3JV7A 2YHIB 4BO1A 5B1YA 1IPFA 5DOVA 2NU9A 3GN1A 3OJFA 4IJKA 4DLBA 4IDGA 1P0FA 2X58A 2IZZA 3DTTA 3I83A 4WEQA 3DFUA 3OJLA 5MGBA 5A03A 4IDDA 1JQBA 3CMMA 3KYDA 5BSGA 3CH6A 3L4SO 1Z74A 3H5RA 1FDUA 1Q7CA 1VI2A 2C5EA 4KUGA 1E1MA 3RFTA 4NZ9A 1I24A 4D45A 3UHAA 3VOSA 1BWSA 1J4AA 1YE3A 2PH5A 4D0SA 4RVSA 3ZCXA 4CM9D 3ZV6A 4EJMA 3LLSA 2FZWA 2WE7A 4ZU3A 1E5QA 1A27A 1N7GA 2Q1WA 3WGZA 2EW2A 4OM8A 5KOIA 2VNAA 4RF5A 2FPPA 3AI3A 3WSVA 3I5MA 1KIFA 1GZ3A 1AXEA 4J7CA 1N8KA 1DC3A 4BHTA 2E37A 3D4PA 3INGA 2XXBA 3OIFA 5EQDA 1B2LA 1T24A 5JXWA 5G0UA 3HJAA 3HQ4O 2ZB3A 3PHJA 5KTKA 4WOJA 4A26A 2O3SA 3HUDA 1LDYA 5U4QA 1EK6A 5KVVA 2X5JO 2AEFA 3F5SA 3I4FA 2WYUA 3UUWA 2D0IA 1GPDG 3D0OA 3H65A 4BO5A 3BMOB 3TQHA 4AJLA 1M2WA 3L9WA 3S8MA 3I9NA 1FMCA 2UYYA 2EERA 3JQBA 1BHSA 4AFNA 2C7GA 1GPJA 3WLFA 1PQWA 1UAYA 3PJEA 2Y1CA 1HYHA 1IL0A 3D4OA 3WG9A 4RDHA 4BKQA 3UN1A 4AJEA 2JFHA 4MKRA 3H9QA 4A03A 2J3HA 2YFQA 4DWVA 5EESA 1ZK2A 4NBUA 1NPYA 1LLQA 3QY9A 4XQEA 4WNCA 3GGGA 4MP3A 4DQVA 2IDZA 2O2YA 2OL4A 4DVJA 3ASVA 4HFMA 1ZEMA 2CVOA 4R3NA 4UUOA 3OQ6A 4CMIA 2C20A 1XSEA 2IYPA 1IY8A 1YL6A 3I9JA 3ZHZA 5AYVA 3QQPA 3N74A 3PDJA 3FNEA 2Q2QA 3RSHA 1H93A 2JHFA 5FYDA 3CIFA 1VL8A 4CLDA 3WWYA 4FIZA 4TRRA 4BNZA 1SEPA 2C29D 2X86A 1TT7A 1PGJA 2E49A 4YAKA 3JD3A 3C1AA 3EMKA 3DZBA 3BMCB 1GD1O 1NFRA 5CPFA 1MC4A 4YACA 4IQ0A 4LRSB 3D3WA 4O5OA 3G1TA 3PHIA 5K6AC 3VVBA 1S6YA 3JQFA 1P0CA 3PLNA 1HDRA 5L95A 4OSPA 2X8LA 3GRKA 4IINA 8ADHA 1OI7A 4NQZA 3HB4X 4D41A 2C7VA 1W73A 2DC1A 1GADO 4R4JA 1KEUA 1P9LA 2NU7A 3D7LA 3WDSA 4PLZA 3F9IA 4BNKA 3NT4A 5AQ1A 4ZQGA 2QG4A 3DAGA 4EITA 1CQIA 2OMEA 3ZWVA 1U4SA 2BH9A 2Y68A 4IPTA 4U0JA 1R37A 2Q3EA 3LU1A 4NMHA 2AMFA 3HWRA 4RVFA 1HKUA 1QLHA 3DC2A 4OSOA 2IZ1A 3WGIA 3PJFA 1CJCA 3VPHA 3KSZO 3QVXA 2W2KA 1E7QA 3P19A 4G81A 2Y1FA 4QQRA 1WDKA 2HRZA 3MOIA 2D3TA 3A1NA 5AXBA 3JCZA 5IAAA 1X15A 2G82A 2DBQA 3IOYA 2ZB8A 3RFXA 1IHXA 2WWRA 3FTNA 3Q2KA 5COBA 1PGQA 4PZEA 1Y5RA 2GN6A 3RWBA 4B3JA 3PWKA 4AJOA 2ZATA 4KWHA 1JU9A 5B4VA 1HETA 3RU9A 3E5RA 4N5MA 1IB6A 5K0ZA 5A05A 4D3DA 5T57A 3DHYA 2C2XA 3A9WA 4GGPA 4J4TA 1G6KA 3UGKA 2RAFA 3COSA 1BVRA 3JQ7A 1QP8A 2B5VA 3BHMA 4QFDA 1CQJA 1AHHA 1LUAA 1MFZA 2JD2A 4Y8VA 1RM5A 2EP7A 1Y8QA 2BFAA 3SXPA 4R16A 5DT9A 2CVZA 4R5MA 1WAMA 2OHXA 2QHXA 4R1UA 1ISMA 3ST7A 3JQDA 3JQEA 4BNXA 4CJXA 4CPDA 1KY4A 3OEYA 2RBEA 1JKJA 4HV4A 2J3IA 1PS8A 4S1VA 4JJGA 2OBYA 1XKQA 1YXMA 4FN4A 3TZ6A 1P1IA 5K6AA 5CEJA 2D5CA 3AK4A 4XGKA 1I3NA 2O2SA 2X0JA 2ET6A 3AY6A 3UICA 4J4BA 3GR6A 3ZW8A 4PZDA 5BQFA 4BNFA 3E48A 4TQGA 1PZGA 1U7HA 1YBMA 1N92A 4U0KA 4YRDA 4KZPA 1DIRA 3RUFA 1YVEI 5JS6A 1CETA 3LSYA 2EIHA 4NH4A 1F14A 1LRJA 2YZ7A 5G0TA 1E0DA 1OOEA 4GLOA 3HB5X 4HFRA 4FS3A 4TKMA 5BSFA 3VH3A 2RIRA 2GN9A 4B3HA 1G0OA 2JFFA 1YGYA 2VRBA 4W99A 3DONA 3JD4A 3GOHA 1DB3A 1TB4A 4J1NA 4BNYA 3W8FA 1ID1A 4XYGA 1ZVMA 3WLEA 4BB5A 2QW8A 2EV9A 1D7OA 4XR9A 3TWOA 4P22A 3ROKA 2GZ3A 1QMGA 1BDMA 1W6UA 4JJIA 1B3BA 4LK3A 2PKRA 3W1VA 1F12A 1KEVA 3INTA 3OQBA 1P31A 3H3FA 3LF1A 4RL6A 1YQXA 3O9ZA 5JPIA 4H7PA 1HE3A 1PSDA 4WUVA 4I9NA 3RKUA 4FBGA 3P7MA 1E6EA 1PGOA 3L4BC 1NBOA 3U4IA 3ITDA 3E8XA 1I5RA 2HSDA 4YT4A 4MDHA 3DBLB 5I7VA 3S2FA 4UAGA 3TJRA 2Q46A 4ITUA 3UKOA 1NWCA 2GGSA 5L4NA 2ZCUA 2EF1A 3ZDFA 3BYZA 3VHRA 1HXHA 3KYBA 3KLPX 1NHWA 1WVGA 2YY7A 4GH5A 2BFOA 3JQ8A 3UCFA 3RUHA 3B70A 1L7EA 4YT2A 3PVZA 4NR0A 2RCYA 3PDUA 5HRUA 3GEGA 1A9YA 1XG5A 4BNMA 3ZW9A 4BO0A 2HMTA 3R6DA 2O7SA 4YWJA 1O95A 5G4LA 4IMPA 3L6DA 2IEDA 3JQBC 3FCOA 5G4KA 1BRMA 5DCYA 5JFOA 4J1QA 4K28A 3CXRA 3OF2A 1UDCA 1VL0A 1ZKMA 2O50A 5JLAA 4WLFA 2I66A 2CY0A 2HDHA 3ABIA 5DP1A 2VYND 2F00A 2PWZA 1NTOA 2Z1NA 1D1TA 5L7WA 1ZO8A 2AW5A 4UUMA 3OHSX 1E5LA 1YB1A 1B8UA 4NDNE 3DQPA 4YJHA 3WSWA 4B7CA 3RU7A 1NWHA 2WJPA 2DPGA 3DOOA 4WOKA 4UEJA 5I9MA 3UH1A 1JVBA 5U1PA 1YH3A 3ICPA 4E5MA 1NYTA 3GK3A 3JQCA 1ZH8A 1VC2A 5KVCA 1XLTA 4LRTB 3U4HA 2CNBA 4GX2A 3QSGA 1BXGB 1M6HA 3VKUA 1SOWA 4WK6A 4L4SA 3K8ZA 4URFA 5LDGA 1KVUA 2EEZA 1CIVA 1Z7EA 4PRLA 1M76A 3L0DA 1PS9A 4BNWA 5A3JA 1I3LA 1O89A 2Z5LA 4MKZA 2V6GA 3GVIA 3QWIA 5JYEA 5U9CA 2EXXA 3VPFA 4LISA 1P3DA 1P1RA 1E92A 2IEBA 4WECA 1O9BA 4GX5A 3NDIA 3LZ6A 4PLGA 3NV9A 2FR8A 4BNGA 4EEZA 1X0VA 5A1TA 5ITWA 3U09A 4LSMA 4JP2A 3OETA 4A73A 1J6UA 2D5AA 3LDHA 3EDMA 3EVTA 3RUAA 3MJEA 2VZ8A 4CUZA 2HK7A 1T4DA 3GEMA 3UVEA 2FPGA 1JWBB 1SMKA 4B8WA 5H81A 5TS3A 4J7UA 1QYXA 4HBGA 4E2WA 3I9OA 1WWKA 1C0LA 5IDYA 1GEGA 1HYGA 2B36A 4GQAA 5EIOA 1GYPA 1GCUA 2WTBA 3VPSA 3RIHA 1R4NB 3ETEA 4XR4A 2EWMA 1ARZA 4BNVA 4ESOA 3E9QA 4DLAA 1HDCA 3QP9A 3CE6A 1AXGA 2NTVA 1ADGA 2JKVA 4XQ9A 5IJZA 3NJ4A 3GN2A 4Y67A 2XXJA 1GQYA 2B69A 5TC4A 1YJQA 3WMWA 4OQYA 5CP8A 3DMTC 1Y8QB 3W6ZA 1YL7A 2WDZA 1OMOA 4B3IA 3ZU4A 2ZTUA 3SC6A 1Q0QA 2QZZA 4CV0A 4MINA 4OO3A 4EEXA 1U8XX 1A4IA 1XDWA 5THQA 3JQ7B 2I3GA 4CLXA 1ZSNA 1D4FA 5ES3A 5HWSA 4BO6A 3MJVA 4ZQFA 4CUJA 1K2WA 4L9RA 3M1LA 1Q7BA 4IS3A 3C24A 3QE3A 4RPHA 2HK9A 5DOZA 2PD6A 4YAGA 1T2CA 2NV6A 1G1AA 6ADHA 4WLVA 5BNFA 4DTIA 2UVDA 1Z6ZA 3GGOA 1U9JA 4Z3DA 1TA4A 1WMBA 5IZ4A 4XIYA 5GZ6A 3B1JA 1Z73A 3EGOA 4J91A 2ZK7A 3WGOA 3I6QA 4O59O 3TFOA 4YXFA 2YV2A 1GL3A 3ONFA 1BG6A 5JDCA 1GEEA 3MJSA 3GNTA 1DAPA 4EBFA 1Q1NA 1I2CA 1EDOA 2VHWA 1H2HA 5JNLA 1LJ8A 4ZQEA 4E6PA 3L9XA 4F3YA 4CLEA 1ML3A 2VT2A 3FSRA 3SLKA 4AJ4A 1U4OA 1WZEA 2R00C 4HNGA 4Z0HO 3IP1A 1PX0A 1TT5A 5TGDA 4NI5A 5C37A 1B14A 1XWFA 1XELA 1UP7A 1ZXLA 3JQGB 4IGEA 5A9TA 2CSUA 4II3A 3NT2A 2WEKA 4YA6A 1QV6A 2NLOA 4J2HA 2X5OA 3KZVA 1ZBQA 1T2DA 4GGOA 3RC1A 2BD0A 3F3SA 3MZ0A 2QRKA 4JBGA 4XB1A 3M2PA 1P1HA 1EE9A 3IAHA 4MJLA 4Z0TA 4BL5A 3OP4A 1BTOA 5TNXA 3IJPA 4ZJUA 2PA3A 1FDTA 2Z1MA 1H6DA 4RVDA 1KEPA 2H5LA 1DFIA 1DJNA 1PZHA 3GC6A 2DBZA 4XDYA 2QQ5A 4N54A 4CLRB 1H94A 4BNTA 4DQUA 4D7AA 1K6JA 4NBRA 4IDEA 4H16A 5CG2A 1Y8RA 2QX7A 3RVDA 3DZHA 1UP6A 1YKFA 4PLCA 3DHEA 5TIIA 2A35A 2WD8A 2WD7B 1E3IA 2OBNA 4NFYA 4GX1A 1LSJA 3RROA 1LLUA 4GKVA 1VRWA 4EUHA 3BMOA 4TWRA 3ZU3A 4KQXA 2O3JA 2HAEA 2CVQA 3L4BA 4RF3A 1CERA 5CPBA 1SO8A 4FQ8A 3RBVA 4MVJA 2JL1A 4TRNA 2BELA 4LSWA 1QORA 4R5HA 4BO4A 1Y81A 3H9JA 1AE1A 4OKIA 1HZZA 3G3EA 1KVRA 3E03A 5KCZA 5TF4A 3IS3A 3TSCA 5LDHA 2V65A 3ANLA 4BOYA 1A72A 2H9IA 3KETA 1SPXA 3I6IA 4PIVA 9LDTA 4IM7A 3HADA 5CG1A 1FDSA 1NP3A 1D8AA 3QVOA 2W98A 1A7KA 4WLOA 3BHIA 3PYMA 4PZCA 4ZQHA 3NUGA 5JO0A 3TOZA 4MOWA 5DBFA 4BNHA 4GBJA 5DBIA 3VZPA 3WBBA 5L4LA 5AXAA 5JAIA 1NR1A 4K6FA 2BKAA 3Q6IA 3W4JA 2FMUA 1ZFNA 1BVUA 4XYLA 2LDXA 4ALJA 5BR7A 7MDHA 5A9SA 5EL0A 4L8VA 3MJ4A 3GY0A 1O0SA 1A71A 1ISGA 3JYLA 1M75A 3QW2A 3H2ZA 4JLWA 4CL3A 2B4QA 3KYCA 3PIIA 5G0SA 4DYVA 5A04A 4M86A 3OJ0A 1I30A 1PJBA 2E48A 5KVSA 3ZWNA 1ONPA 3PFFA 3EZYA 1H6CA 2YQ4A 4CMGA 2J5RA 2NVUB 3ENKA 1Q0LA 2A94A 3DZFA 1PEDA 4M89A 3KXDA 3TZQA 1P33A 2TMDA 1WNTA 2X0RA 1ADFA 4E5KA 1PJSA 1RYEA 2JCYA 2Q2VA 4DBZA 1MXHA 4UUNA 1E3EA 4GWKA 1B0AA 5TT1A 2YHIA 1EE2A 4XIJA 1VE9A 5AOVA 4P8RA 2NWQA 3C7DB 3SVTA 3LK7A 3WYEA 4CLRA 4UUPA 2J6IA 1CWUA 3GFBA 2EG9A 2EW8A 3AY7A 3HN2A 2GZ2A 3PWZA 3E6AA 5T8KA 1NNUA 4AJIA 4HKTA 3V5NA 4RLSA 1Q2XA 4LW8A 2P68A 4CMBA 1ZK4A 2B4TO 3JYNA 1GAEO 3GPDG 2UUPA 3SEFA 4OKNA 1C1DB 4YR9A 1I36A 2VHXA 3M2TA 1LDGA 4RVUA 5T64A 3HDJA 3OJEA 4BNJA 4BNNA 5KJ6A 3LT4A 1H6AA 3HDHA 1ONNA 2V6BA 3JQ8B 2J5KA 4LGVA 5KJEA 3U0BA 1LXCA 1ULSA 4BGEA 3FNFA 4L4RA 2EKLA 4C7JA 2W8ZA 1ENZA 4IJUA 4IY1A 1PQPA 2FWMX 1GUYA 4B79A 5JCJD 4NIMA 3WB9A 5IDXA 4PG4A 4CMEC 3AUUA 3CMCO 4MP6A 2Y93A 4XX0A 1UR5A 3ICCA 3WQRA 4A10A 1PGNA 4CV3A 4D3FA 4DL9A 3WTCA 5KKAA 5A9RA 2HQ1A 1BXZA 1ZCJA 3EUWA 4UVDA 5LCXA 4YJFA 2VOJA 3IDSA 5C3MA 3C8MA 3GMSA 5JDIC 3F4BA 1MB4A 5J23A 4K26A 4M1QA 4E0BA 1N9GA 4MVJM 5CEFA 3GVHA 3CPSA 3UOGA 4FFMA 1U3WA 5TSDA 4FCCA 4KP7A 2DTXA 1DO8A 4CQMD 4J7XA 3RCBA 2BGLA 2PGDA 2VWQA 5JC8A 1D3AA 2VWHA 4CODB 3WQSB 1CDOA 4XYMA 4HNHA 3VAZA 2X22A 1GYRA 3MWDB 4OAQA 2GZ1A 2D4AA 4R54A 3VH4A 3R1IA 1X1EA 3V2HA 3RASA 1NVMB 2Y66A 1LDMA 1NFQA 3G0OA 4MVJI 3GH3A 1R4MA 3DZKA 4GVLA 4DIOA 2GF2A 3MJCA 2Q1UA 3OICA 4YAIA 1F0YA 2YQ5A 3D3EA 5DF1A 3RJ9A 1OC2A 2PKQO 3PP8A 2AQ8A 3ROMA 3O8QA 1N2SA 2DBVO 4CQMA 5AVOA 1TT5B 3PPIA 3WBFA 3K92A 3TF5A 1HDZA 4R51A 4QECA 3QVSA 4DPKA 3GVPA 1O6ZA 3IUPA 1H9AA 3DOJA 5ILOA 3NTRA 4BKPA 4UREA 3TZHA 3H9GA 3PJGA 3ZWYA 1EVIA 4S3MA 4IXTA 4OIMA 2ZIZA 3AU8A 5IDWA 3SJ7A 3LC1O 2VZ9A 3TN7A 3BMNB 4L4XA 1HSOA 1I2ZA 4HXYA 4PLWA 3D5QA 3V8BA 1V3VA 3FHLA 5DDIP 3PGXA 1HDGO 2FHSA 2VTEA 2X9VA 4MVJH 5TX7A 4XWYA 1YOVB 4DYDA 2HK8A 1ZSYA 3PLRA 1GUFA 1KETA 4IS2A 4NBVA 1JDJA 5I7SA 3Q0EA 4BMSA 1ENPA 4FFOA 5JC1A 1I10A 4YBZA 2EGHA 4CLHA 1TLTA 3KO8A 4CM9A 4XA8A 5K9ZA 3G1UA 1RM3A 3E18A 2PTGA 3DBHB 3WGYA 3ZNOA 4GAEA 4JN6B 1BDBA 1S7CA 3GHHA 3UFXA 3KHUA 1X7GA 5DCUA 3PIDA 4DPMA 1N5DA 3JQAB 3CTMA 2YJZA 1G0NA 1GQQA 2YDYA 1HEUA 4CLOA 4YAJA 3FD8A 1RKXA 4RPKA 2O4UX 1X13A 2HMVA 1DIBA 3GDOA 1PJTA 1XCBA 1JWAB 1XA0A 3C7CB 4XRGA 4EI2A 2WE8A 4B4VA 3ROQA 1F8GA 1ZMOA 1KC3A 3Q1LA 1GFSA 4XKJA 3RC2A 3WJ7A 3VZRA 3OJOA 1PL6A 2Y05A 3SC4A 1MV8A 1XR3A 1XYGA 3JYPA 3KV3O 4W9NA 1K3TA 2NU8A 5C7LO 4QTZA 1J5PA 4TROA 3FI9A 1L7DA 4QFCA 3O4RA 4I08A 4OOEA 4PVDA 1UAGA 1JN0A 2VN8A 2JJYA 1A7AA 1ZXBA 3QLJA 4FPXA 1PR3A 3GVCA 1DRVA 1Q0HA 1QG6A 3WGGA 3GMDA 3FPCA 2D2IA 4Q3BA 2VHZA 4TRJA 5I8WA 1IZ9A 4PLVA 4YJHB 3TRIA 3ASUA 2D1YA 4WKGA 2DTEA 4YEDA 3F1LA 1HYEA 4M87A 1EVYA 2HMSA 2NQ8A 1DHTA 4Q9NA 5F21A 4GL4A 2DLDA 3WFJA 4J1TA 3ZWAA 1YRLA 4KUHA 5F1OA 2SCUA 2GO1A 1U8FO 2DKNA 2ZCVA 3ONEA 4IZIA 4YJGA 2NTNA 3T7CA 5COAA 1LC0A 5L51A 1HDXA 1ULUA 2D8AA 4PLPA 4C7KA 2Q1SA 4W7HA 2UUOA 1ZEJA 3K73O 2W2LD 1V9LA 1A5ZA 4P38A 3GGPA 4RZHA 5DNAA 2ZYAA 1U5CA 3GZNA 3I9MA 4MKXA 4PRKA 2JD0A 3DOCA 2JAPA 3GUYA 3JQFC 2PV7A 3U4CA 3VZSA 3T7EA 2X9GA 2I5PO 5I8ZA 1FJHA 2BFPA 2O23A 4Z3KA 4HWKA 4OXNA 4U7WA 2Q49A 1QR6A 2B4RO 3ZWOA 3GT0A 3Q2IA 5JCJA 5KJFA 1PJ2A 1F8FA 2CFCA 1Y9EA 1GQ2A 3PJDA 1HTBA 1VJ0A 2ZQYA 1Y8RB 3A4VA 1YBAA 1RM0A 4ALKA 1ZK0A 5THKA 4BO8A 1B8VA 5TJHA 1YOVA 1R12A 2DVMA 2DBRA 1PJ3A 2VYVD 3EAGA 2H6EA 3JYOA 4WCDA 3ULKA 4BQPA 2VWPA 4PN3A 2J5QA 1MUUA 1ZZEA 1IOLA 3LC7O 1KVTA 1SB8A 4PVCA 1M6WA 1EUCA 1PGPA 1TEHA 3W8EA 4MVJP 4E2XA 3C85A 3PQFA 2P4HX 3WMXA 2VT3A 4BB6A 4WLEA 4CLOB 4I5DA 4CM7A 3PZBA 1PU2A 2FRDA 2QRLA 4J0FA 2C5AA 4AL4A 3OA0A 3PHGA 4BO3A 2ZB7A 3PQEA 4E4YA 3GQVA 3ON5A 4B4OA 3QWAA 1LX6A 4U8GA 4CMAA 2G5CA 4RVGA 4OJNA 5ENDA 4OMUA 1V3UA 4ND5A 4D42A 2BFMA 4R1NA 5BNIA 4B4WA 4N18A 4J6FA 4JP3A 2G0TA 1T1SA 3KSUA 1IPEA 4FOSA 1HE5A 1PL8A 3IQDB 1WP4A 1U5AA 5GY7A 3BXXA 1SOVA 1V6AA 4IGFA 1KOLA 5MDHA 1KS9A 4W4TA 4I9UA 4RORA 3VC7A 3RKRA 2GUGA 3ZNNA 1UXHA 1NPDA 3KRTA 3DB2A 3WYCA 3JQ6A 2CDBA 4J43A 4Z9FA 3AI2A 2VYVA 1UDBA 1WDMA 1R0KA 3WNVA 3GFGA 1RJWA 4GVXA 1GYQA 4FFPA 2NNLD 4NK4A 5DULA 4BNLA 1LTHR 1PTJA 1NAIA 4QT0A 3LVFO 3MWEB 1LSOA 2AEJA 4MVJG 2GYYA 2BLLA 2FY8A 4RO0A 4TZKA 1YO6A 4QO8A 3C3XA 2G17A 1EUZA 2AG8A 1IYZA 2CF6A 2HO5A 3H9UA 3HNPA 3JSAA 1TXGA 3KLMX 2HRBA 4IBOA 1AGNA 2NVUA 3CEAA 3EY4A 1GUZA 2NUAA 3NGXA 4GX0A 4AVYA 4LMPA 4LCJA 5KNLA 3N58A 4EJ0A 3U62A 5KIAA 4OOFA 3FR8A 1X1TA 2NVWA 5JDCC 4LVCA 4E21A 3U49A 1A9ZA 1KERA 1F17A 4BS9A 3LF2A 3M1AA 1E3JA 1PL7A 3OSUA 3NRCA 1NAHA 2OXIA 2X7HA 1R4NA 1XQ1A 2O4CA 2YHUA 3PHHA 3E5MA 2HLPA 2HUNA 1LSSA 4TVOA 4CM8B 2FZEA 1DPGA 2VHVA 1YQDA 1HL3A 3GDFA 3QIVA 3U4DA 2PFGA 3UXYA 5BNTA 1W4ZA 2FP4A 3PXXA 4X54A 5TRTA 5KWEA 2HMWA 1B26A 2FN7A 1GCOA 5TT0A 4D46A 1BXKA 2NM0A 2O7QA 3ZHYA 1MC5A 4Q3DA 4Y98A 4E2YA 5HBRA 5H83A 3D4NA 2I76A 3C1TA 4RF4A 3SLGA 3TZCA 3FWZA 2WSBA 4TRMA 4PLTA 4U6SA 2P9GA 5JY6A 4PG5A 3HSKA 1EVJA 1GTMA 3DDNA 1DRWA 3O38A 3B20A 5KJ1A 1DLJA 1LQTA 1N1EA 4UVHA 5F3RA 2HU2A 3EVNA 1YONA 3UF0A 4DA9A 4CMCA 3IL2A 3GDGA 4YJDA 2P9EA 3AI1A 1FK8A 1HWYA 3K30A 2PZKA 4FB5A 1ADCA 2VOEA 1R0SA 3I23A 1H9BA 1NX6A 1DFHA 1DHRA 4OYRA 4KMSA 4Y6PA 4B7UA 4DMLA 1JAXA 4U5QA 3ONDA 1E6UA 4XJSA 3DBVO 3F46A 4QXMA 3JD0A 1EDZA 1GZ4A 3NAQA 4W7IA 1UH5A 2IRWA 4J2OA 1MXFA 3KBOA 4NBWA 1YL5A 4LCEA 1R4MB 4R41A 4Z6KA 1V35A 3RC7A 3QWBA 1HDYA 2EKQA 3ZNQA 2W90A 1J49A 3DXFA 3ZU5A 3H7AA 1EBFA 3C1OA 3ZHXA 2AQIA 4ZGWA 2C54A 1B8PA 3BMCA 3MEQA 4WPGA 4I9HA 3WR5A 4BMVA 4CR7A 2PD3A 2AQKA 3PTZA 1EFKA 3AWDA 3V1YA 4I5FA 5JMWA 3OEWA 2GDZA 3DTYA 2QIOA 2I6TA 4L73A 1H2BA 3GA0A 1LA2A 3TZKA 5CAEA 2WM3A 1DJQA 1PR9A 4JK3A 2V6MA 4F46A 1LU9A 4DRYA 1ZJYA 4E3ZA 5HS6A 5IFLA 3KYDB 3GF4A 1V8BA 4O63O 4JJFA 3H9EO 3KYCB 4AJ1A 5HS4A 3HFGA 3WYBA 3RUEA 3DBLA 3F5QA 4NK5A 3NGLA 3VDRA 3AM4A 3QJ5A 4ALNA 1PZFA 2P2SA 1YDWA 4FFRA 4J16A 5IN4A 2A4KA 5FI3A 4CM8A 1W8DA 2GN4A 3TFQA 4BNIA 1E3LA 3W4KA 2IODA 4WASA 5EPOA 5CDYA 3JQAA 4IQ8A 2YDXA 4R3WA 4K6CA 3GG9A 1R0LA 5EMHA 4WGGA 4YRAA 1HSZA 4OXKA 5I9NA 3GZNB 3PWSA 2RHCA 1B16A 1HE4A 2WMDA 2ZYDA 4E13A 3VPXA 2PKQP 1P45A 2HKIA 5EINA 1K6IA 3CZMA 4DUPA 4RJTA 1I33A 2FOIA 3IJRA 1SC6A 3E82A 3PI7A 1N1GA 4FOOA 3NDJA 3WQQA 3FF4A 2Y99A 2X0NA 2QZ9A 3R3SA 1E1LA 3K2EA 4XGNA 2OZPA 3GEDA 5KKCA 1EQ2A 3WX0A 4CM6A 2VRCD 1VL6A 4OHUA 3V2UA 1SEVA 2DFDA 4BKUA 1RWBA 2D59A 1M66A 4OQZA 3BTVA 1UZLA 2WYWA 5CDGA 5JCXA 4E2ZA 3IP3A 4MPDA 3I52A 4LN1A 1T25A 5C7IO 4PLFA 3ZN2A 2X5KO 4BKOA 1DC4A 2FPIA 2VRCA 2XOXA 3JQ9C 4ND4A 4UULA 4PG6A 4DQXA 3TOXA 1Z75A 3SX2A 3U5TA 2C59A 1QYWA 1WW8A 3E9NA 4B8ZA 3PYLA 2YYYA 2CUKA 2B5WA 2E6UX 3BTSA 2YV1A 4XCVA 3DAPA 4H15A 4BVAA 1E7SA 2A92A 3PYXA 1U3VA 3LT0A 3RBXA 1L1FA 2NVBA 3I3OA 1Y9AA 1K0UA 1E3WA 4JXKA 3STHA 4C4OA 4HUJA 1PZEA 5T8KC 1JA9A 3H6KA 2C0CA 1RM4A 4HFNA 4XYBA 3I9KA 2PLAA 5CEEA 4BNUA 1B15A 1M67A 4RCVA 1NVGA 4GMGA 2C07A 4YTEA 3TPCA 3A06A 1LSUA 4P4GA 3BMQB 3WOHA 1UXGA 1UZMA 3ZWCA 2Y0DA 1DBVO 1HLPA 1PIWA 1PJCA 2F1KA 3Q9NA 4E33A 1C3VA 1ORRA 4Z9XA 2GRAA 3ZV5A 4ZHSA 4KOAA 2DM6A 3L6OO 2R6JA 4UVEA 2AA3A 1KVSA 1C0PA 2I99A 4PLHA 3L77A 5IG2A 2ZTVA 5FEUA 3GLQA 1W0CA 1R6DA 1UP4A 2AEMA 4R68A 4MVJE 4GWGA 5DCWA 2JAHA 4XRRA 2RHRA 4II2A 1U3TA 2GLXA 2GPTA 3G79A 4FSHA 2CD9A 5G2OA 4E5YA 4PG8A 1DXYA 5KJCA 1E6WA 3K6JA 5EJ2A 3DWFA 2WD7A 1FDVA 1ZNQO 1OAAA 2X0IA 3LT1A 3DHNA 3ZWMA 4XB2A 4JGBA 1C1DA 4FGWA 4RPGA 5AXCA 1BMDA 1R16A 1UZNA 2A9FA 2Y0EA 3AUAA 4NHEA 3GHYA 2QYSA 3ZI0A 1I8TA 3R3JA 1AUPA 4E30A 1IULA 4RQUA 1LBEA 2E4AA 4D3SA 5T5QA 3IKTA 4RPJA 1X7HA 1NR7A 3E1KA 4CQLA 2VQ3A 2NSDA 4CV2A 2NTJA 4R1SA 3S55A 4HFJA 3EHEA 3OIGA 1GY8A 1EQUA 4BIIA 1NVTA 4NNJA 1QV7A 2GSDA 4WEOA 1YQGA 1IUKA 1DEHA 3Q9UA 2DUWA 3G49A 1LDBA 4XD2A 4FC6A 4RPLA 3ZWPA 1Q7GA 5L4SA 4JROA 3D1LA 3H5NA 3WS7A 1GV1A 5CHEA 3V2GA 4PGFA 3GNQA 1UXJA 2P91A 4QUKA 5JYDA 1MX3A 1Z45A 4UVIA 3QVTA 4AJ2A 3FPLA 4A27A 2C2YA 2AE1A 3EYWA 3K9QO 4HP8A 1HDOA 1P74A 3QV1A 4M8SA 4J0EA 2DT5A 3B1FA 4B7XA 4F45A 3KM0A 1DLIA 5JE8A 4CM5A 2X1HA 1LRLA 1T2EA 1UDAA 1Y1PA 4QSMA 5B37A 1HF3A 2ZB4A 1I32A 4CL8A 3Q3CA 3INRA 1XHLA 2E82A 3WIEA 2W2KB 2Y0CA 4W6ZA 2XAAA 3VPGA 1KBZA 3GPIA 1O8CA 3VVCA 3FBTA 1EBUA 2VWGA 3C7AA 1U1IA 4QO7A 3OIDA 1NHGA 2FSSA 1WLYA 1E7YA 3DBRA 4ND2A 5DN9A 3H3JA 5HTOA 3K96A 1MA0A 1X14A 3RD5A 2X9NA 1E3SA 5L9AA 2JHGA 3GAFA 4FFNA 5L53A 1B3RA 1ZJZA 4FC7A 2B83A 4BUCA 3JTMA 4EZBA 4W82A 1LI4A 3CKYA 3WGTA 3BMNA 1HRDA 1QKIA 1OBFO 5H82A 4MIYA 3IIEA 2OFPA 4MO2A 4Q3AA 5JMPA 4A2CA 1DIAA 4BGUA 4DIFA 2HJRA 5I7EA 3TL2A 1EK5A 1MFPA 1V3TA 4BKRA 4CR6A 4FJ2A 2R00A 4NU6A 3WFIA 5CFZA 4BO2A 3LYLA 1RYDA 3U9LA 2EJWA 5IF3A 2BHLA 1I3KA 4U6QA 5JO9A 1NQAO 1SCUA 2RH4A 5T67A 4JX8A 3GRPA 5FF9A 1V0JA 4L74A 1CEQA 2CDCA 4ZVVA 1BW9A 1LRKA 4GPD1 1EEHA 1WPQA 1ZIDA 3FTPA 4BMNA 3KTDA 3RJ5A 1BW9B 3I1JA 1IZ0A 1E7MA 3OFSA 1XEAA 3ITKA 5FWNA 3JQ9A 4EUFA 3TDKA 1U2GA 1LDNA 4EUEA 4Q39A 2O48X 3BTOA 3D64A 4ALLA 4ROSA 5EERA 4RQTA 1GR0A 1Y5MA 4GSLA 2BMAA 4AICA 1GDHA 4ALIA 1EUDA 5FFFA 1E7RA 2JD1A 5L7YA 3WJAA 4E5PA 3S2GA 1U3UA 3BA1A 3D3WB 1DIGA 5HA5A 1NASA 5JBIA 4HADA 4CMEA 5IXYA 4FJ0A 4JNKA 1MG0A 3DEYX 1YS4A 2GNAA 2O3UA 4CM1A 1MGOA 4CMJA 2PNFA 4KTVE 1AHIA 2P5YA 5F1KA 4HY3A 5BSEA 2XF8A 4KWIA 4DGSA 3HDYA 2BGMA 2EGGA 4IDCA 2PZMA 4H3VA 3NTOA 4DREA 2AHRA 3S1LA 4AJNA 5HM8A 5JW6A 3W8DA 1FDWA 4NFSA 3KEQA 5DBGA 4WCFC 3HG7A 4D79A 2W2LA 3QRWA 1K5HA 3RUIA 4AG3A 4IDFA 4YT5A 3BHJA 3X2EA 1UJMA 3Q11A 3A28A 4G5HA 4W9NC 1DIHA 3GG2A 3ZGYA
chains in the Genus database with same CATH superfamily
5DF1A 4B7AA 2UZ0A 1C50A 1N1MA 1DJMA 4QUGA 3CURA 4XUCA 4BAZA 2IHUA 2J8ZA 4WNAA 1U3FA 4FKBA 1XQWA 4KW7A 5C5EA 4H31A 5CLIA 4W5QA 4RJLA 4LDRA 5AKXA 1Z5GA 2Z8YM 2V9ZA 3JY6A 3T15A 4QX6A 3EQ6A 3KDSE 4EYEA 1R6AA 3AF6A 3ZH2A 4CMKA 5LZ7A 1A5AB 1T8RA 121PA 1WNFA 3NWBA 4OXXA 3BEDA 2JFOA 4INAA 3KB6A 3T06B 1DX9A 1RWVA 3HLTA 1P80A 4HAOA 5ICMA 5JAPA 3DEZA 1IM2A 3TNLA 2ENWA 4A8PA 1N0HA 2QDKA 1XRMA 4TL9A 3T8YA 4H0FA 4QVGA 1QH8B 1VKNA 3NHKA 3M6VA 3WXBA 2Z57A 2WFZA 3EPJA 3TNJA 5B6PA 1V4NA 2DZDA 2PH3A 3HJCA 1EXWA 2GEVA 4AKIA 4P7FA 3RO7A 1RADA 2JFNA 4P33A 1QH1A 3LLVA 2H2HA 3P2OA 1BU8A 3UCEA 3NVKI 1R6UA 4DMMA 5I48A 2AMLA 1WY5A 2E4YA 3VBCA 2R87A 3JATB 1W34A 2GBLA 3O2QB 2Y0BA 4E46A 3I04M 5BWLA 1N2CA 2HIMA 3DMRA 4U2CA 4YV0A 1S7GA 2UAGA 2BFFA 2IXDA 3ZBTA 5JQWA 4NJOA 1NU6A 1SBQA 1V7ZA 1NXXA 3H8VA 4C4PA 5CDSA 4HQ0A 1DSSG 1TZJA 2ZBQA 4MAFA 2QJOA 3TQOA 4F38A 3AVOA 1M34A 4TTRA 1SIUA 3CSDA 3DE5X 4NABA 5G3ZA 4EQ6B 3R7WB 2OXRA 4JCOA 2V97A 5IT0A 4RH0A 1UBCA 4Q9JA 2KW5A 2NXNA 4FYYA 4YV1A 4AMZA 1W8IA 3FF1A 6YASA 1T0UA 2Z43A 2A78A 4EFLA 2G80A 3AFNA 4ZO9A 2B0JA 1YZ3A 1N8TA 1OJ7A 2QTCA 4ACAA 4MUJA 5ALLA 5TQ0A 3TL3A 1H2XA 3BJMA 1P18A 2ORED 1DOHA 1V8DA 5EN4A 1WBBA 1PWZA 1ZH2A 3UAGA 2GFIA 5BOVA 1K8YB 5J2TB 1UOPA 1NSFA 3A0RB 2DFLA 4QNRA 1WW2A 1KXZA 3BZUA 1Y4UA 3DE0X 2IP2A 1H0KA 4J0QA 4DN6A 3AVXA 2O8DA 2IS2A 1QMPA 4YQZA 2Q1YA 4IJWA 4MHTA 2J30A 3LTEA 1NBIA 2HLDA 1Y8CA 3QA9A 2V5UA 2XQKA 5KQPA 1X38A 1CUAA 2Q5HA 1F6WA 3BWMA 1EMDA 1N8SA 3W4IA 1CJVC 3EUAA 4N7BA 5FH9A 4ZTZB 1KJWA 1KP3A 2QSJA 4R1PA 2GB4A 1W88A 1E2IA 4FN5A 3TLZA 3ZVKA 5E7IA 4DC0A 2JANA 1BOFA 1FJ2A 4YT8A 3D5TA 1SBHA 1NYQA 1G8KA 4FD3A 4ND1A 2MSWA 3RAJA 3ABZA 5HCUA 2HEGA 1MP0A 2XWQA 1AGRA 4D0RA 2FW6A 4AJKA 8ADHA 3OZAA 2NN3C 1NSTA 4FOPA 5GM1A 5JAZA 1A7UA 1U9IC 3DVRX 4AWAA 1IHUA 3LBFA 4N3GA 1OD6A 2GCOA 3GGDA 2GVZC 1VB3A 3OZFA 3N2NA 2GBLC 2WFMA 3FZYA 2IYAA 3H1TA 3MCWA 4HZUB 4CM4B 5IUJC 2GUWA 4EGFA 4CM4A 1HLFA 1LCIA 3MGCA 3MYYA 5AHOA 1JDBB 1ZOLA 1UEIA 1VZ3A 4GIBA 2B94A 2QK4A 1E77A 2Z58A 1U1GA 3C4VA 4MQUA 4UHHA 4CKWA 4ENVA 7MHTA 4GDFA 1QR2A 4WSOA 5GJCA 4QBFA 2GBCA 4PCVA 3JVIA 1X1CA 3R3UA 1ATZA 1QXSA 5B12A 1IY1A 4GU5A 4UE2A 2IDMA 3GRRA 2ZRMA 1OAKA 2H4YA 3K2BA 1Z8FA 3DJFA 4PX2A 1IBSA 4M4SA 1T9AA 4XW2A 2G76A 2IP4A 1S9HA 2BRUC 2H5IA 3BS4A 2H18A 3KWFA 2ILTA 5JLJA 1SVOA 4NYJQ 2YMMA 1ISHA 1JLLA 4J94A 3AOEC 3STYA 1Y6JA 2FR1A 4BMCA 3T0FA 2REXB 3KQUA 1W94A 4WL0A 1A1VA 3AP2A 3CZ4A 2ETXA 1ZYUA 2PUBA 4NF2A 2D62A 3BXEA 4NRDA 2AZ4A 2PU5A 3C45A 2ONCA 2Z8YA 1JQ5A 1C8BA 1Z7BA 4TZTA 4JLBA 4NESA 3F1KA 4CUKA 1AQ6A 1VJDA 1JR3D 2XJ4A 3FFWA 3NW9A 3SWWA 2VUIB 4CDMA 4RDIA 1GRCA 4JBNA 1FNBA 2YW9A 2NO7A 5JAOA 4CTNA 2OV1A 1R50A 2A7XA 2BTOA 4FYMA 1U7XA 4KR3A 3I2IA 2OAQ1 1REQB 4MV0A 4TV9B 3QVWA 1G5IA 3G0BA 1KO7A 3O83A 3OBBA 4RJIA 3WO1A 1KEKA 1NW7A 1XN4A 3C6QA 3IPYA 1EFUA 3ECCA 2PBLA 4PY2A 3RTAA 4BX2A 5ITZB 2QBYB 2GQ0A 3AIMA 3DLAA 3P97A 2IWRA 3UJAA 3KKLA 1ZK1A 4TQAA 3COPA 3GJXC 3KDAA 1N7JA 4G5GA 2CDAA 4OLJA 4A15A 3I2YX 3UKJA 1C30A 1GU7A 2GAFA 4HLDA 4U2GA 4AIRA 2JIOA 3FY4A 4ZOBA 3DZJA 2POQX 3CO5A 4ZA2A 5L45A 3REOA 4LVUA 5CYFA 3UXHA 2CN1A 1SQ5A 5JAHA 1TQ6A 3ROPA 4Z1OA 1RRMA 2DTDA 2VQEB 5IFKA 1GTSA 1GN9A 4K9DA 3AR2A 1M8GA 2X8BA 2XLBA 1J0BA 3FCYA 1Q2UA 4G8JA 3ZY4A 3OQ1A 4A5OA 1BHJA 2CXOA 2GAAA 2P9QA 3CGWA 3DULA 1DC6A 1LTKA 2I7VA 1K27A 1FTYA 1XVVA 2Q6OA 3NHZA 4KQIA 4M53A 2J5XA 1FYFA 4QUJA 5FOSA 3VH1A 1VMIA 1PO7A 4E1BA 2EHJA 1VKOA 3PBKA 5G1NA 5I9LA 1QRSA 3NCTA 3U1BA 4LEIA 4AJPA 1J99A 2ZS9A 1ISJA 3TMYA 5HZKA 3L04A 2JHPA 5AM1A 2YASA 1V16A 3K2IA 3TOVA 4DMHA 4JYPA 2R5WA 4NZOA 1WJGA 2BZGA 2I2BA 4JYZA 3UMBA 2Q1TA 2BCGY 1FTSA 3UQYS 1YSCA 2MDTA 3I92A 3IQXA 8GPBA 3JD2A 3BTUA 3AY3A 2JFQA 3A1WA 2AJ8A 2Y1OA 4H60A 4OAPA 4TYYA 5IT9A 1RR6A 2PSDA 3B6MA 4I19A 1V4VA 3ODGA 4NJMB 3SJUA 1VCNA 2JGRA 5BUZA 2Z95A 4XSVA 1IHYA 1Q1BA 2OD9A 4J4HA 2GK6A 3CLUD 4NJMA 3B89A 3GLRA 4MZXA 5A7FA 1UDXA 3A9VA 4DDMA 1LBIA 2IE8A 3R0ZA 4X9XA 3WGQA 5L3SA 3C4QA 3AFMA 3IE0A 4BLVA 2OC4A 1E1NA 2OLEA 3RS8A 4K1LA 4Z49A 3HWWA 4DADA 4OUKX 2P6NA 4J16C 1AB6A 2IC5A 3G02A 3E22A 3NS7A 4IW3B 3UV7A 3OFVA 2IKQA 4ZRDA 4C4YA 3ZDBA 1M2NA 2J5BA 4UHBA 1JPUA 1WDLA 1XZFA 2IEIA 2N46A 4LYEA 3G17A 1LQUA 3AZOA 4OD0A 4W7IA 4WLFA 2H2FA 4AMUA 1IBMB 1FJGB 1E8MA 1KZYC 1XC7A 1EAYA 4OQEA 4ZD6A 4V0RA 2ZSDA 4X91A 4D44A 1JDNA 1OZHA 2EAUA 3L8DA 3A1EA 2UZ3A 3FNGA 1XCPA 1ULZA 5HZGA 1KMMA 1TI7A 2Q3JA 3GFVA 2WOOA 4OI4A 3VR5D 4CETA 3IGFA 4PHGA 1E96A 3F2VA 1RKVA 1KFCB 1RWPA 2YVKA 5IUNC 1YJXA 3L0IB 2FN9A 3KV1A 5JXIA 1CVRA 3IAS6 4ZVSA 4F1WA 3JD1A 1GRNA 2GN1A 4WOCA 3UXEA 4FWTA 3KSRA 2IPLA 3ZU2A 2PR2A 4LC9A 2HQOA 1ONOA 4F84A 4YLEA 5ADHA 1ZUNA 3ZVMA 5D85A 3AYXB 1X1BA 3N3BC 3NT5A 4GMFA 3MLEA 2OK7A 2VIIA 3PGA1 2HSWA 2OZEA 3SXUB 2Q3FA 1W4CA 4KDFA 5AR1A 3MT0A 1ID8A 2HHHB 2D2VA 4PZAA 3FNBA 1Q3TA 1EFLA 3GZTB 4P2GA 4UDOA 4X5OA 2PGJA 2O0HA 3T7SA 1WB4A 2RKWA 2VP2A 4J1GA 4MWTA 4PC7A 1MTZA 3T3OA 4MS1B 1GN8A 1Z3IX 3CFYA 2FPIB 1PS0A 1Q92A 3S7TA 3AR5A 2CV0A 4ZJZA 4MW5A 3WKCA 2P4QA 1U2DA 1MAUA 3M5WA 2UYQA 3O21A 4IMRA 1PFVA 2WUWE 4MWEA 1JG3A 2CUTA 2O1XA 3BIOA 3TW8B 3ZZNA 3UK6A 3DO5A 5LZ4A 3WICA 3OZ7A 3DZIA 1JFVA 2R97A 2H2IA 1RJEA 4LJ9A 4ZZ2A 9LDBA 2C7OA 4RK6A 3IA2A 2ZRQA 4RSHA 2Q3CA 4FK8A 5IN5A 5CLFA 2P8JA 1OHHA 1YAHA 2WFAA 5AJXA 5A06A 2W7TA 3AVYA 3I5AA 1ZU4A 1N2XA 5GMOA 2PLNA 2IUUA 2FCRA 4UAVA 2JS7A 1NLUA 2R6CA 3EC7A 1B93A 1U1EA 3H99A 4CKCA 1XGKA 2HBYA 1G2OA 5HUQA 1GLVA 3BGOS 1DTWB 2OP0A 3L49A 3M6IA 1WUIS 2PWBA 4LXHA 5LC1A 1GITA 4BQFA 2BGWA 2C92A 4TYQA 3WLQA 3VUEA 4UDXX 1XALA 4YYEA 1QSGA 3OG9A 3MTGA 4TOIA 4F6CA 1KQGA 4TYNA 4AZWA 3CKLA 4D74A 1PJRA 4K03A 3ZCQA 2VHTA 3ZPXA 4W5NA 4RA6A 1N6KA 4R6XA 1CB7A 2WSSA 3CUKA 1JKIA 1MDBA 4JKIA 4KSBA 2ATEA 4ALMA 1WABA 5TLSA 2BFNA 1NXVA 4MR7A 1L7QA 3KJHA 3TZEA 3L7YA 3PK0A 3QU5A 4DOMA 1ZJWA 3B3GA 1BWPA 4IDUA 5M04A 1RYBA 4QEZA 4QZVA 4QYSA 4CQJA 4NBTA 2DUJA 2A1TS 1C0IA 5J63A 2XD9A 3WLLA 3IHWA 4JLMA 4Y1FA 1OWNA 4C7OB 3VNQA 3GCDA 1NU8A 1T9ZA 3KUXA 1IH8A 2TS1A 3FHJA 3FGZA 4CV1A 4DCVA 2HNKA 1CR0A 2X6TA 3ZDDA 1XQ6A 1T1RA 1SZDA 1TF7A 3V1UA 2GPSA 5ADUS 3C7KA 4ISCA 1I6KA 4ZCIA 2CYAA 2XB6A 2I3AA 2CVPA 2X77A 2FZ4A 4OHVA 1QHNA 2WYVA 1XJCA 2PZJA 4O2LA 1YVPA 4HF7A 4L7VA 4Q01A 3TR0A 1DUVG 3EXIB 3FB1A 4MRMB 4K8RB 4UHDA 1Q1GA 3IP8A 3OA2A 1FL9A 4JLUA 1WHSA 4QOJA 1GPNA 4BVHA 4FW9A 3CVYA 2Y2VA 4EYOA 1RQ2A 3QJYA 1UF9A 2QLNA 2BHRA 1F06A 2CF5A 4UOEA 1YZNA 1D1PA 2JLQA 2F67A 2V0NA 3CJRA 3GUHA 5T3YA 3TRFA 4YCSA 1E3MA 3I8OA 2C2MA 4RLHA 1ZI8A 1P2FA 3W1EA 3FLMA 3E2PA 3HEMA 1YFJA 4L5CA 5TQVA 4DLKA 5JHGB 2UDPA 3KOWA 4UBJA 4DDHA 1Z0IA 3E7XA 1FBNA 2P65A 3AOEA 1DBQA 4Z9YA 3V4RA 4NU0A 3DAYA 2JI6A 1J0XO 5DK4A 4V38A 4JT2A 1Q0TA 4FDLA 2M2IA 3GT7A 5K0GA 4B6PA 3RSCA 1JHMA 3GVXA 4Y18A 3KQTA 2DG2A 2YFHA 4J0IA 4QOSA 3UM9A 4LYGA 2AMJA 5ICCA 1GPWB 2HCTA 1NQTA 2YJ3A 1P9NA 2Q3DA 1QE5A 3CONA 4UU7A 5FYQA 5JWOA 4YUVA 4R8RA 3KEOA 1VIAA 1NP6A 4X1OA 5HUHA 3HP1A 2Q21A 2BKEA 1TEXA 3O47A 4Q6BA 2JKYA 4K9MA 2OORA 3D1JA 1EE1A 3B5JA 4L15A 4ID9A 1VHTA 1HT0A 3PKJA 3ZE9A 2VCYA 3D3JA 2CNWD 1ONBA 4IHKA 4FLMA 2D06A 5KDOA 4OUDA 5ESXA 4D0LB 2VUUA 3AESA 1GSOA 1HO3A 1I01A 5A3VA 3PRKE 2B3TA 4IFTA 3SICE 1FTNA 1GXSB 1R66A 4U7GA 2O2CA 4X61A 1MX9A 5HE9A 3UW3A 4EY7A 1EFAA 1EK2A 2H4JA 2RK3A 3EVFA 1U0OC 5AI4A 3VKVA 5IK2D 1DL5A 1Y3BE 5FWAA 2X2FA 1OVMA 3WVNA 2PJDA 4QASA 1TMKA 2XW6A 3PRYA 3QTBA 4Q9HA 3EK2A 4ZRNA 3U4QA 4IKEA 1G7SA 1GL6A 1XFAA 3QXCA 4E11A 4Z7OB 5JH7A 1Z29A 4I8XA 2HW8A 2GTPA 4V0SA 2OOSA 4XSGA 5AKHA 1T26A 1C1XA 4EWLA 1HE1C 1CS0B 5ER6A 2CZGA 2YIMA 3EW7A 5H70A 4EIWA 4HGQA 5CXXA 3ZLUA 2NU9A 3K6RA 3ZCVA 1AJEA 1P6UA 1DWPA 2EEPA 1VL1A 2QU7A 4LJ4A 3DVLA 5I9TA 1JXAA 1T3SA 5HRCA 5J2UB 2B78A 2NSHA 3I83A 2IZZA 1YACA 3P0RA 5CFNA 5MGBA 1IZYA 4DLUA 3SD7A 1JQBA 3E81A 2GM3A 3FZQA 3CMMA 3KYDA 5L3SB 3H5RA 3M8KA 4NCIA 2R0QC 1ZRHA 4YLYA 2P5SA 2TYSB 3QU4A 3NVDA 4TM8A 5FTJA 2FMTA 1NQVA 3GFTA 3RFTA 3TUZC 3WA6A 3DBOB 3OZVA 4K9PA 3CZPA 1J4AA 1YIDA 2MSCB 4M7PA 5JBQA 3CRVA 3ZCXA 2PGOA 2XX3A 3Q8MA 3LUFA 3P8ZA 2VHJA 4XIGS 5AVSA 1H0RA 1UC8A 3ZV6A 2IS1A 1C7EA 1H05A 4ZU3A 5KUTA 1AKQA 1E5QA 1PJZA 2IS4A 2CK3A 1W1IA 3OUTA 1D04A 3WGZA 1SG6A 1IATA 1QGUB 1VLQA 2Q8PA 3WA7A 1FU7A 2QIPA 2F3PA 4GP9A 1SU8A 1GZ3A 1XNJA 3TTUA 1N8KA 1RCTE 2J08A 2C5BA 5ALFA 1B2LA 3EZGA 4YJ3F 1BDHA 3B51X 1OT3A 1Z5PA 3HQ4O 4KAXA 1L5RA 4QELA 5T4EA 3V8MA 5KTKA 1BIFA 2O3SA 3HUDA 3A8TA 3SJBA 1CUYA 3PT9A 3FRIA 3ZYCA 2GYVA 2YBDA 3P5BA 3H65A 1E5TA 5JQGB 5I8PA 4GC9A 3KXLA 4JI7B 2G7ZA 2I6XA 1ND6A 3H2JA 4MUBA 1PWHA 1V5EA 4FYVA 1P5RA 2ZUEA 2VNKA 1HOTA 1VYUA 3WAJA 2NSYA 3EX7C 4LDAA 4EKIA 3UAXA 1ZMRA 4HPXB 1BHSA 1F51E 4LFBB 1GPJA 1Q91A 3SMQA 13PKA 3NKFA 3PJEA 3Q6NA 3NHPA 4E07A 1SXJE 2G4CA 1VA4A 3GD5A 4H6VA 4UM5A 2JFHA 2AZTA 3H9QA 5ALRA 2AOUA 4A03A 2YFQA 3N2KB 3NBUA 1H5UA 3V8VA 1ZK2A 5KOJB 4EO4A 3N7TA 5CB4F 1L5FA 5KSOA 2XXAB 1I6LA 4RIFA 4WNCA 1SVWA 1NW9B 5EWJA 3H04A 4X3OA 3QE4A 5JH7B 3C16C 521PA 1NQWA 1PT8A 1AQIA 1EVLA 1N5KA 1WOMA 3DP7A 4CMIA 2C20A 1IM8A 1MA3A 1TZKA 1YL6A 3ESQA 4HBZA 1JKJB 5D5HA 3ZHZA 3QQPA 4XPIA 1JV2B 3KKPA 3RS2A 3UGTA 3MN1A 3DOEA 1FLNA 2A2ZA 721PA 2J0UB 3P0JA 4QU8A 3EVEA 4J75A 4XSHA 4D9HA 4YAKA 1RI2A 1B73A 2QPLA 3DZBA 4UAJA 4CZ2A 5HVNA 1CJSA 3ELUA 4M36A 1NFRA 5BQPA 1VYTA 1MC4A 1T8PA 3BB4A 4G5XA 4YACA 3KPYA 1AQLA 3G1TA 5K6AC 3VVBA 1N7IA 2ZJYA 2Z30A 4H77A 2CNNA 3N8KA 4BN5A 5L95A 1WF3A 3KXIA 4DNQA 2VBFA 1VE3A 4JH0A 1OI7A 2BKVA 2AGVA 3COZA 2ID9A 2X5NA 1XL1A 3HB4X 4LYDA 1GADO 3BBLA 4R4JA 3THYB 1Q20A 3D7LA 3EG9B 5EY5B 1YDHA 4PLZA 3F9IA 4FYXA 3Q7PA 4S0XA 4DSZA 3TKAA 4O1HA 5A4AA 4HSEA 3U9TA 4F0JA 5IBCA 1KYZA 1LBTA 4MEAA 5HTKA 1U4SA 1C3LA 2Y68A 4M8LA 3OUZA 1R37A 2PBFA 3UAOA 1P3JA 2AMFA 3LGXA 4NZPA 3FFAA 5EJ7A 1MOQA 2BCEA 4RVFA 2JH9A 1QLHA 4OSOA 3G6KA 2LRHA 4YDHB 3WGIA 1E61A 2VP6A 4HQ6A 1EGVB 5SYMA 2IVZA 3C3MA 4QYWA 1OXBB 2FWAA 4DA0A 5LMUB 4ZO7A 2CE7A 5C2JB 1SVSA 1FXWF 1ZD5A 2Y1FA 2A9OA 2HRZA 3F5FA 3H1PA 1KY3A 3LLMA 3RU3A 3R8FA 3PE4A 3T9FA 1XDGA 1YI0A 2FTKE 4EZEA 1X15A 4JJEA 2O7RA 2V9CA 3M5CA 3OCVA 2DBQA 4BWGA 5C52B 3IOYA 3UJDA 4YROA 2ZVQX 5E7JA 3K1JA 3LDUA 1MH1A 2J1LA 1Y5RA 5IVHA 2QGFA 3PWKA 1QPZA 3DV9A 5JR3A 2WNSA 3GGSA 2H1IA 3K20A 4ME6A 4UBKA 5CM9C 4DMUB 4PAWA 3EOZA 5T57A 2IY9A 4JYMA 4QGAA 1IXZA 4DXAA 2PSHA 1G6KA 1V8ZA 3SDSA 2PT7A 2XUFA 2RAFA 2D5LA 1I1HA 2FJUA 3HB0A 3JQ7A 3UFXB 4YUXA 2B5VA 4YMWA 4M1YA 5DV9A 4QFDA 1YRHA 3AESB 1CQJA 3EXFA 3E9ZA 1LUAA 2JD2A 1JHPA 3ORHA 3HZRA 4MV7A 4KPFC 1RM5A 3OT1A 3OWOA 2QJRA 1Y8QA 3DHVA 1MAVA 4URXR 2MR5A 4LGMA 1K6MA 4E3WA 1VHWA 4M98A 1S0UA 1N6OA 4R5MA 2ZIFA 4UD6A 2PQ2A 4WVFA 4U2BA 3HS3A 2KS6A 3JZFA 4URWR 3AERB 2ZRIA 5DBOA 4E5UA 3M3DA 3CR8A 3OP1A 4IEIA 1BFDA 4HV4A 1FRQA 1FQKA 5HKBA 4V0NA 1RIIA 4XTCS 3QF4B 3W2TA 3O3NB 4IHAA 1YCFA 5H80A 1ORIA 5MN5A 4RACA 3TZ6A 1U6KA 1OX4B 3ITNA 2IUSA 3TBKA 3AK4A 3I01A 4OMFG 5AD1A 3R7WA 2X0JA 3D6VA 1OLOA 4AG5A 1M0SA 4FSDA 4MVCA 4ZVQA 3MPUA 4OVKA 2O0JA 4J4BA 3AKZA 5DVZA 1FVXA 3U4GA 4DZRA 2WA1A 3UEOA 4PR3A 4IZOA 1OLSB 5TR9A 3ZVLA 3L1VA 1LZKA 2QDXA 1N8NA 4P4SA 3ZCRA 4JUIA 2Z6VA 3TUJC 1NJSA 1Q57A 5IHXA 3LL7A 4OJTA 4U0KA 5FULA 1US8B 1JR3A 1T5SA 4GNKA 4MR8A 4TTJA 4URUR 3SBDA 1PSZA 4ED9A 5ILQA 1YVEI 1US8A 2HUPA 1C4KA 2WVAA 3A1DA 1CETA 4MR8B 3UTCA 5CLJA 1U3CA 5LU9A 2XUOA 2KLBA 1SU7A 5FBWB 5G0TA 1E0DA 3OPQA 4GLOA 3HB5X 1GL9B 1GRQA 2EYQA 1R0YA 3A9SA 3IDOA 1V16B 3OCJA 4FS3A 4HFRA 4TKMA 1DXHA 2QXYA 3BK7A 1MD9A 1H2WA 3FCAA 2J31A 1QE3A 1XDBA 3KQYA 4OYLA 3VYVA 3JQRA 3QKWA 1NOKA 2MMCA 4B3HA 1G0OA 3H8SA 3LHKA 2CHEA 4LRYA 3GOHA 4ZEXA 1BKYA 1JEQB 3HXMA 4IHQA 4BNYA 3ONWA 5IJ9B 1ID1A 4DEYA 1UM9A 4ZIRB 3KHSA 3OFND 4X1KB 4BB5A 1RI5A 2XNDD 1YB6A 4BP3A 5LU8A 5AESA 3UA3A 5FL7D 5DHRA 4P22A 4IFEA 2W9XA 3DDCA 5T4HA 4E15A 3M6UA 1BDMA 3GJYA 4F06A 2RHBA 4JJIA 2QROA 1B3BA 2PZ8A 2PKRA 4LK3A 4RNDB 2UU9B 1TW2A 4FS8A 2V0GA 4AULA 3PNVA 4HAYA 4R31A 3H3FA 3LF1A 3L0ZA 4RL6A 3KZNA 3QHPA 1QG4A 3R2JA 3VHQA 4POOA 2VHUA 3PD1A 4KNVA 4RK1A 2VKQA 3Q0IA 4Y6OA 3LCRA 4WUVA 4I9NA 4C01A 3UB3A 1MB0A 1QH1B 1BU5A 4R2MA 3ZLBA 2AN4A 2ISSD 4RS4A 2ARKA 4BMOB 2I7TA 2NYRA 2X76A 3KR0A 4UU8A 3DBLB 1SRQA 3EEIA 1V43A 3S2FA 4D9IA 4DCMA 4AKHA 2PUTA 2C61A 3R09A 3RNLA 1RXIA 3G8BA 9GPBA 4JJAA 4Z1MD 2ZCUA 5BN3A 2EF1A 5AW6A 5KQMA 2DB3A 3M7IA 1UKCA 1UEJA 2ILVA 2VDWB 3PX3A 3KLPX 1HC7A 2Q0SA 2QE7A 2AUMA 2H0QA 3FGPA 2JIZD 4GH5A 3JQ8A 3LCCA 4PRYA 5EEGA 4NR0A 1AV7A 2IU3A 2RCYA 3PDUA 3T5CA 3LXMA 3GEGA 1VOTA 5LJIA 1XG5A 4I46A 1C2YA 2PX3A 4NPHA 5IYZA 3DDZX 3TZBA 1KJ8A 4H3HB 4OHZA 2HMTA 4PO1A 5TQJA 1L7RA 4F8JA 3RSLA 2JH3A 2XECA 3QPBA 4LPSA 4XUDA 4DKJA 4NULA 1ZITA 3CA8A 3COVA 1X1SA 1VJCA 3AP3A 3FCOA 4P5PA 4RQBA 4RSRA 3ZCTA 2AW3A 4EG4A 3C1UA 3NTXA 1MZPA 3HCRA 3V1LA 4I1YA 4K28A 1L5SA 4OUDB 4B6RA 3OF2A 1FSPA 3G2PA 4WX2B 3HA3A 2E4WA 1L3BA 1UDCA 4PGGA 1QO7A 3PWTA 2FSVC 4HMQA 2K4MA 2PQ0A 5HBGA 4ZEWA 5FX2A 4YIHA 2XNKA 4UJ5A 1INLA 2CY0A 2HDHA 2IXFA 5FV4A 2PWZA 3P0IA 3PLAE 1OI3A 3FKQA 3SZUA 2CXHA 1II8B 2B99A 2OK8A 3LXRA 1XRNA 3AR6A 1QHFA 3TMKA 1ZO8A 2AW5A 2UKDA 2W6JA 5JJLA 4EL5A 1COZA 1XVLA 1YB1A 2N1MA 1CJUC 3PXBA 4Z4GA 3WGMA 4G56A 3OCXA 2NXWA 3BKXA 1W7AA 4FU0A 5FQOA 3TLBA 1A2QA 4L9AA 5U1PA 4WUTA 2XHEA 1YH3A 2WTEA 2H00A 5KQGA 1O6CA 3IIIA 2VJYA 5DI9A 1LBHA 3RODA 4GKJB 3U4HA 3OKPA 1HFEL 1N2JA 4LHYA 3SX4A 4GX2A 2OTCA 1BXGB 5D5QA 1M6HA 3ZL9A 4B6OA 3M6LA 3Q7EA 4L4SA 2A9VA 3TBFA 1CEEA 3LUCA 1M1UA 2IV3A 2HT6A 2EFEB 3EIFA 5KDLA 3ZWKA 1GG2A 4M2LA 4BZZA 1RAGA 4S2UA 5SV2A 4KE9A 1SXPA 1O89A 4CTJA 1KH1A 2XT6A 3M6WA 5KKNB 2ZYHA 1LPSA 3VO8A 3FVRA 4LISA 2W2OA 4U9HS 3RWOA 3A37A 2HBQA 2H85A 3EDRA 3LPAA 3H75A 4HEHA 2P0EA 2PSSA 2JHAA 3LZ6A 3NDIA 2GAJA 4GX5A 2BZ1A 3SC3A 3WBKA 4R8VA 1CLEA 3KC2A 3QVVA 5A1TA 4Q7EA 2JGFA 1UADA 1Z0UA 4UTXA 3W7BA 4LSMA 1Y1KE 3SVLA 4IVRA 1E9EA 1SXJA 1D6SA 2DHEA 1S8FA 3OETA 4KG7A 4MEJA 3DNMA 1J6UA 3EDMA 2V7WA 3B1WA 3MJEA 3RUAA 3WLKX 3U3RA 2HK7A 4KQMA 1VECA 3RRJA 3Q12A 1AU9A 1SN7A 2WR8A 1UMDA 3UVEA 1GP2A 2X3YA 2Z4TA 5JYBA 1JWBB 1TJPB 2MT9A 4AX4A 5AI0A 1RVDA 4PYNA 3DEIA 3RSGA 4E2WA 4CXMA 4HH1A 1ABFA 1C0LA 4WW0A 3H5VA 3G2NA 5HJ5A 2B36A 1G5TA 4GQAA 4R2LA 1GCUA 1XK6A 2VBIA 2QVCA 4CTMA 1EUQA 5H3CA 1HPLA 1OYYA 1R4NB 2CJXA 2DF8A 5DTIA 2EWMA 3WNDA 1O58A 4IIJF 4LDNA 1YZKA 2I87A 2NZJA 3D8RA 1AX9A 1MR3F 4XGQA 2QLTA 5M7EA 1O95C 3QP9A 5D86A 4GBGA 3P2MA 3NJ4A 2QM3A 3V1NA 4I1RA 4LV8B 1USGA 1ZCZA 2ZJZA 5EFZA 4G4SP 3DMTC 1Y8QB 1TUIA 4WFJA 3EFBA 3F78A 1O94C 4B3IA 5E8JA 4RPCA 2WKSA 4UEWA 2B9VA 3C6XA 4RK5A 4YP9A 3IQFA 1PYGA 2AWNA 3MC1A 1UBTS 4WKNA 4CV0A 1G3MA 4MINA 5E38A 4CKBA 5JS8A 1O2DA 4ZTBA 1NTRA 4LZWA 4LYHA 1L4BA 4LF5B 4HMOA 3E61A 4RTQA 3JQ7B 1Z28A 1SXJD 4A8JA 2YJGA 4WT7A 3B9QA 1QC5A 3CF4G 4UNQA 4FXPA 4QBHA 1I7QB 1K86A 1Q7BA 3M1LA 3C24A 4XEUA 5ECYA 4MAAA 2B2XA 4RPHA 5HKOA 3MRSA 1T2CA 4EM6A 5IYZB 3P9YA 4FEYA 5BNFA 3UWSA 3M9WA 4DTIA 2UVDA 2IGTA 1QK5A 1GGNA 3D8UA 4NONA 4QDJA 2VCHA 2H59A 4XIYA 1WD5A 3BQMB 3B1JA 2CLHB 3ZOKA 1DWUA 3T3EA 3ORYA 2PUWA 4GP7A 3AVQA 3DKRA 2O5RA 2WAMA 3AVPA 1ZMXA 1Q1NA 3GNTA 3HXOA 5CCEA 4LHZA 3GLFA 3KFLA 3L0BA 3UK1A 4DLSA 4V1CI 4ZQEA 3RRNA 4E6PA 2VSNA 4DR3B 1XCOA 3Q98A 2IHNA 4ZT7A 1P2VA 2FDCA 2P7IA 1NQUA 1UBEA 5I47A 1L8XA 2B8TA 3OPNA 4HNGA 4Z0HO 3M6MD 3W5BA 1C5KA 1JNXX 4ZAXA 3Q4GA 3IP1A 1TT5A 3RLFA 4GPZA 4XOIA 1FP4B 4JA2A 1SIOA 5KYNA 2YH2A 5HQTA 1V1RA 3NC1C 4M0LA 4RTPA 4II3A 2BC9A 2XOEA 5CFLA 1K7YA 1GL7A 3M3PA 1RXYA 1R6VA 2QVGA 3EVAA 3RC1A 2BD0A 2HWYA 2WRZA 3DE4X 1P1HA 4HQNA 4MJLA 5IC6A 1JTFA 4BL5A 4DBLE 4HMPA 3OP4A 3V8NA 2VDVE 3ZD7A 1UWLA 4ZOEA 4L0CA 4BCBA 2IZ6A 3KLNA 3G2HA 1PZHA 3GC6A 5TXGA 5TS2A 3NHMA 2ZI7A 1UWKA 4CLRB 4DQUA 4TSFD 1FMLA 2XNHA 4D7AA 1K6JA 4NBRA 1ODCA 4IDEA 2ZM5A 4H16A 2B3DA 3OLQA 4G0NA 1XEWX 3RVDA 3TZLA 1XA3A 1OY1A 2NV0A 4A6XA 2H08A 2PT5A 3W2HA 5JSHA 4GRDA 1EYZA 2A35A 2PEYA 3VHXA 3A7EA 2IELA 2WD7B 2JGLA 3ZH9B 4NFYA 4WJKB 5CB6A 3LRPA 4X1YB 1YCGA 3D6NB 3BOSA 3ISTA 3RROA 3EDQA 4GKVA 3LV8A 1V9SA 4KDCA 3O90A 2XB4A 1TU3A 1U28C 1EZ1A 5D00A 4KQXA 1JU4A 3TEMA 1YDGA 3CO0S 4Q1BA 1KI1A 2ECKA 2F43A 4RF3A 5ALOA 1QU2A 1PZMA 2X3UA 3LRXA 3ZE2B 5CB0A 3NALA 4FQ8A 2VDWA 3H8WA 2R8RA 4U7JA 4MVJA 1O0CA 3C8HA 3FTQA 2A5YB 3OKAA 3QVGB 4FP9A 3V4ZA 2J3MA 1K6EA 2WV9A 1CNMA 3AIOA 5C31A 1XEXB 5CA1F 2BELA 3DW3X 5FPPA 4HDRA 4DZTA 2BJVA 1QORA 4N8EA 3U2QA 4YMVA 4LRXA 3OT5A 4KFRA 1X87A 2EQAA 3A05A 3EQ7A 2NUTB 1Q3KA 2V65A 3IV7A 3LDGA 2X6QA 4IIDA 1MC8A 1YA4A 2H9IA 3KETA 4JI2B 1HKHA 4IM7A 3HADA 5E6RB 4NECA 1FDSA 3C3CA 3L4KA 2W98A 4WLOA 4LJLA 5HIAA 3NUGA 3AEUB 2JJ8A 1GKYA 1A3CA 4MOWA 5DBFA 4J7AA 3VZPA 3OOWA 4BNHA 4BMYA 5CB4A 5JRDS 4IIJA 4UTNA 4YRCA 3HB7A 4ZYVA 3AB3A 3CX7A 5P21A 1J25A 2D4HA 3N07A 3OEED 3RM3A 4F97A 3N1UA 3GLGA 3MJ4A 2XI4A 3TD9A 4FR2A 3C6ZA 1CCWA 3FLBA 2H7YA 2QTBA 4PTYA 3SAJA 1PHPA 3PXGA 3BQNB 1ISGA 1X86B 4PXSA 2UUAB 2QAGA 2DXIA 3H2ZA 3RV4A 4FIDA 1XRPA 1DQPA 1YZUA 4CL3A 3IQWA 2OUKA 2ZVDA 2OPHA 3PIIA 5A04A 3BFPA 4DYVA 4M86A 1QVVA 1I30A 4RHTA 5KVSA 1LS6A 4LDZA 4M0CA 4AQYB 5ABPA 3M82A 2UZ1B 3PFFA 1KI7A 3EZYA 5EYPA 3QPCA 1UKBA 2ZWIA 1USUA 2IP1A 1YS2X 1NDUA 4CMGA 1S8OA 3MELA 4OMCA 3ENKA 2NVUB 4BBPA 3OJWA 4UEQA 3DZFA 4KEAA 3VZDA 1TM1E 2BEWB 3NVAA 2BMJA 3EJ6A 3KXDA 3TZQA 1V5IA 4X7RA 2TMDA 1WNTA 2Z2IA 3KR9A 3QSYA 1ADFA 3OAAA 2XIJA 3S5JA 5A0TA 1PJSA 1RYEA 1WTCA 2JCYA 3U40A 1MXHA 2QEQA 1VBFA 4UUNA 2FEMA 3BJIC 3CX8A 2XYQA 3VR0A 2GTHA 5EJ9A 2X1VA 3LZDA 5AM0A 5IWAB 4PICA 5HGJA 3HKCB 3S68A 2VF4X 2W8BB 3PHCA 4BVLA 3RDPA 4Q4AB 4TV9A 4COOA 3ZKWA 3TXAA 4GSYA 3GFBA 2EG9A 3LOUA 3MJDA 4IH4A 1ZESA 2ISCA 1DS6A 4MMZB 4MV1A 2MMGA 4IZ6A 3UJ6A 3WLTA 1UPCA 2ATXA 4H4EA 4U4AA 4WADA 5T8KA 1NNUA 4AJIA 1V25A 1SKQA 4HKTA 4RLSA 3V5NA 4CEIB 2R8OA 2GPBA 1Z4IA 4Y9UA 5A4JA 1RMYA 3UAWA 5DWDA 1SD5A 4A8TA 2B4TO 1IDN1 2ST1A 3GPDG 2UUPA 3JYNA 3NP7A 1P9OA 2KHZA 3PL1A 3N53A 3O5AA 3CLUC 5AHWA 5BXYA 4R71A 1NULA 2JA2A 4LGYA 3M2TA 1RW4A 4RKWA 3S3TA 3HDJA 4O4JA 2QW0X 1U0GA 1FU4A 2SHKA 3KELA 4BNJA 4TLAA 3VU9B 3HDHA 4BRUA 2FUCA 2V6BA 3DFKA 3JQ8B 5ALHA 3RYIA 4EFNA 4LGVA 3DKVA 4LYFA 1A82A 3J81A 4UTVA 4HUQB 1VHLA 2FG6C 1KMCA 1V1JA 2XH8A 4JA0A 3WZMA 4CL0A 3C39A 2VBGA 2IL1A 2OCDA 1W47A 4DARA 1M6NA 2Q8NA 1EFTA 4L78A 5K0NA 2EZ9A 4ZO8A 1AHPA 1IBKB 2FWMX 1XZMA 1N2BA 4NIMA 4UBLA 4BDTA 1Z6GA 4PG4A 4AC9A 4Y1RB 3AUUA 3CMCO 1R3UA 2Y93A 2W43A 4ZALA 1WXWA 2IYLD 1QS0B 2VZEA 2C5SA 3ICCA 4H7EA 1WMEA 4KQHA 3MD9A 4MQ5A 4RA9B 5CH3A 5KKAA 4CV3A 4DL9A 4ZYLA 4EJ2A 4KU4A 1A4RA 1H69A 2HMYB 3MGBA 4G1CA 4JWKA 5EWJB 1FXUA 4UVDA 4F11A 3G89A 2VOJA 3BJRA 3IDSA 3N2IA 2BR5A 2XBLA 1M73E 4A0QA 5BQ3A 1UIRA 2RHDA 2OCXA 1KEZA 1BCSB 4M1QA 4NZZA 3WGKA 4EX7A 5CEFA 2OVFA 3II6X 4WZAE 3S1AA 3BIFA 4XVRA 1G19A 1O96A 1CNFA 2NZXA 2WWFA 3ENQA 3LY9A 4FFMA 4Q5IA 4UPDA 3VNRA 2ODBA 2CEKA 3VYTB 4CQMD 3RCBA 2QR5A 4J0GA 3OD5A 4NV0A 1K4MA 3GYBA 2AYZA 4Z99A 3H4IA 4GLJA 5CT6A 2AZXA 1QHSA 4TLCA 5BMVB 5IKOA 1A9RA 5IYZF 1CDOA 2LKDA 1NC3A 5E6UA 2QMHA 1C7RA 1B00A 4MWZA 1CIJA 1YRWA 1GYRA 2X22A 4OAQA 4RHEA 3NRBA 4E08A 1J2UA 3KTOA 4G37A 2QN2A 1X6VA 1ZGCA 2A3NA 2YZKA 3BL6A 3LQQA 1GPLA 2R62A 4RD1A 3E35A 3R1IA 3TDMA 5BR8B 3O9VA 3G0OA 4N8SA 1U2RA 2O20A 5HMMA 4I6EA 1SFRA 1NT2A 1ODKA 2R96A 3PGKA 5AW5A 3ZUPA 3MJCA 1G98A 5JAUA 3ANYB 5IVKA 3T5BA 4YAIA 1JG4A 5CU7A 2VPTA 1RMQA 3GJ5A 3LRTA 1T3ZA 5EMLA 2A67A 2KI5A 1ML4A 5LJLA 3GLHE 2DBVO 1XMIA 1I13A 2RC5A 3N75A 3NIWA 3TE7A 1GKKA 4UCWA 3EOBI 2C2HA 3BF8A 1P1CA 1T4CA 1RRKA 4N49A 4F9EA 2DFPA 3ABQB 2VNJA 4KIGA 3IUPA </