1E7SA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE SYNTHETASE
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase/reductase
total genus 109
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7sA02
5JDIA 3VAZA 4MOWA 1WP4A 4DQUA 3S1LA 1KVTA 2H9IA 4OJNA 3QWAA 1JKIA 1LSJA 3OETA 3TZ6A 4NU6A 4WNCA 5G0UA 1ZH8A 1E1MA 2I67A 2QW8A 2P9GA 1R4MB 1LRLA 2W2KA 5EESA 2BELA 4MPDA 3KOUA 4NFSA 3ZV4A 1DLIA 4BGIA 1AXGA 4IJUA 1P1JA 2OGUA 2VQ3A 2O4CA 4OGWA 2DPGA 3LYLA 3P7MA 4WCFB 2V6MA 2O7QA 3MJCA 5TSDA 1U1IA 3UUWA 4MIEA 4L4RA 3WXBA 4DMLA 3NT5A 3H9JA 5L4NA 1PJTA 5T8KA 3BMQA 3VZRA 2X9VA 1YQXA 1I36A 1PU2A 2JHFA 4J49A 4LW8A 5FYDA 3RBVA 1ISFA 3KO8A 1BDMA 3TWOA 3OM9A 1U28A 5JW6A 2EF1A 3VOSA 4ALNA 1PQUA 2PZLA 1AE1A 3UXYA 4E5YA 1PJ4A 5ENVA 6LDHA 4L73A 1QG6A 1E7YA 5F1KA 2VHZA 4NNJA 5HA5A 2J3IA 1ZVMA 1VSVA 4P22A 3SJ7A 5TC4A 2NADA 4WECA 2QG4A 3E6AA 2EJVA 5ILGA 1WW8A 2UDPA 1NQTA 1OI7A 5L4LA 4DQVA 2Y0EA 4EBFA 4BNGA 1DRVA 3CTMA 2TMDA 1FXSA 5EMHA 2ZQZA 5DF1A 4A03A 1X0VA 2CZCA 1ADGA 4DTIA 4EGFA 5H83A 2HO5A 2VUTA 1LDNA 1ZBQA 4F6LA 4GMFA 3D0OA 1EK6A 5EINA 2DFDA 1B0AA 1GQYA 4J7UA 3K92A 4B4WA 3F5QA 3PI7A 2YV2A 3G79A 1OC4A 2JD0A 3TZCA 4GLLA 3FTNA 4PLWA 4BHTA 1P44A 2YJZA 1LRJA 4MINA 1ZSYA 1LNQA 2SCUA 4UEJA 4XIYA 2DVMA 4PLGA 2Q2WA 2EWMA 4KQXA 1PR9A 2VHYA 1PJQA 3OJLA 3TDKA 4J1NA 2O3SA 4U6QA 3RQSA 5BSHA 4PG4A 3ANLA 4R1NA 2CDAA 3RJ5A 4B3JA 4TRRA 4KWHA 3AOEC 4K28A 3ROKA 3LF1A 4IDDA 3DHYA 1A4IA 3PLNA 1QLJA 3ITKA 1IY8A 1XWFA 2I99A 4YRBA 5T57A 3WFJA 2DTXA 1CF2O 1B8PA 1V0JA 1KS9A 3S2FA 1KC3A 3ITDA 4XKJA 1P3DA 3SC6A 2CUKA 4MVJE 2YYYA 3IKTA 4J9VA 3FPLA 3HUDA 1KOLA 5A05A 3HN7A 5F21A 3WJ7A 4E2XA 4PZDA 4BNMA 2NQ8A 4O63O 5HWSA 5ENDA 5DCUA 1YO6A 3BHIA 5AXDA 2J5RA 1TLTA 2C07A 1AUPA 1RWBA 3GZNA 5TT0A 3IS3A 4CL3A 4AJOA 4P38A 4NFHA 3GA0A 3RKRA 1KVRA 1LUAA 4CM9A 4NK4A 4PLFA 1JAYA 4U0KA 2GNAA 1O95A 4E13A 2WEKA 1Z75A 3JD3A 5TIIA 4PIVA 2V7PA 2ZB3A 4GWGA 3UN1A 2HMVA 1MFZA 4Q39A 4ALKA 2PH5A 1J5PA 3FD8A 2ZTLA 3E9NA 2WD7B 4OKIA 1QP8A 2D5AA 3RC7A 5JCJD 2H5LA 1J0XO 5GZ1A 4K26A 1XU9A 4OM8A 4O59O 1XELA 2J3HA 1HF3A 2R2GA 5TJHA 1NHWA 4E2YA 5U9CA 3R3JA 3H4VA 4CMGA 4CLXA 4TZKA 4CLEA 1XYGA 1E3JA 5GZ6A 1VJTA 3ONDA 3D4NA 1LX6A 3U49A 2Q50A 4TKMA 3WFIA 5CG1A 3TZHA 3E82A 1XG5A 3TRIA 4DMMA 1ZIDA 3RBZA 5H81A 3EC7A 3SX2A 2B4TO 1GZ6A 4RZIA 5TQVA 5B4VA 1I3KA 3DTYA 3JQAD 1ZEJA 4XDYA 2HAEA 3U3XA 1QORA 1VJ0A 4J4BA 3WSWA 4O0LA 3JYOA 3GT0A 4M89A 3GAZA 4B3IA 4CR8A 5B4TA 3PFFA 1QLHA 2C2XA 4WGGA 4RVFA 3QVOA 2AG5A 4B79A 1QMGA 1ENYA 1U8XX 3TFQA 2J3KA 4ALLA 3RCBA 4CLOB 1JVSA 2HRZA 3UHAA 2DUWA 1R4MA 5AXAA 4RORA 1HWYA 4CQMB 1HE3A 2H63A 2Y99A 4AJPA 2YHIB 4YA6A 4YRDA 1IUKA 5DCYA 5C3MA 4BB6A 4J0FA 5EIOA 3WLEA 1M6WA 4Q9NA 2GF2A 3UF0A 1E3SA 1BHSA 4IXWA 5T67A 2VYVA 4BO9A 1JU9A 1QRRA 4HBGA 1Q0LA 4BNKA 5KVVA 1E6WA 3FR7A 3GEMA 2EKLA 4DBZA 1IOLA 2PD3A 3TL2A 4IQGA 4TVOA 1CRWG 1GPJA 3RUFA 1I5RA 4NIMA 4QQRA 1E5QA 1O89A 1W73A 2A94A 3KXDA 2G5CA 3O03A 2DBZA 3M6IA 4RF4A 5EJ2A 1GV0A 4XR9A 2GYYA 2JFHA 1A4UA 2XXBA 4BMSA 3P19A 1U4OA 2CVQA 2X5OA 1LDEA 1PL8A 3I4FA 3VKUA 3VDQA 2HK9A 3MOIA 3UVEA 4IM7A 4Z3KA 3U09A 1X1EA 2EIHA 4NPCA 3RC9A 2AXQA 3MJTA 4CMJA 2X22A 1LXCA 2HK8A 2C20A 4FFOA 5DCWA 4DREA 3W6ZA 3ZWCA 3DHEA 3BMNB 1PGPA 1U2DA 3ICPA 3KM0A 5G0WA 4HNHA 3WQQA 2Y05A 4PG8A 5A1TA 5JNLA 4BKUA 1ZCJA 1YL6A 4NJOA 5AQ1A 1NNUA 2D4AA 2X58A 5KTKA 1KBZA 2PGJA 3GZ4A 4ILKA 4XYEA 1WDLA 3C1TA 4YJFB 1ORRA 2BI7A 1DRWA 4I9NA 5JDCC 3GFBA 5L45A 3ZV3A 5GMOA 2YDYA 4IDBA 4Y6SA 4ZD6A 5JAMA 3G1TA 2ZCUA 3C7CB 1GYRA 2D59A 3OH8A 3TZQA 3WMXA 4DUPA 2D5CA 4JBGA 3PP8A 4HXYA 4IZIA 4PLVA 2NSDA 5COQA 1C0LA 1HSOA 3EZLA 3FN4A 2YZ7A 5ICSA 1T1RA 3LC2O 5IF3A 2NTVA 4E0BA 3VKVA 2X5KO 2EW2A 3MWEB 4XX0A 4FPXA 3IP3A 4XQEA 2PKRA 4CM7A 1I2BA 4AJHA 2V6BA 3QWFA 1QXSA 1I10A 1T2CA 3NJ8A 3OA0A 4GAEA 4WLVA 4BNYA 1LLCA 5LCXA 3GR6A 3PVZA 4WCFC 4BNHA 4J1QA 1JKJA 5A03A 1PGNA 3E8XA 3OJOA 3NAQA 4OIMA 1ISJA 1U9JA 3LK7A 2VCYA 3QW2A 4XB2A 2HCTA 2GPTA 2NU9A 5A06A 3GOHA 4XJTA 2EEZA 4JBHA 3DZHA 2EKPA 3AJRA 3LDHA 4Y9DA 5IFLA 3WG9A 1LDMA 1P1KA 3U62A 4PLCA 1WLYA 3HB5X 4UAGA 4CR7A 3ULKA 2WD7A 3DMTC 3CH6A 5I7FA 3DQPA 1X1TA 4Z0PA 1U2GA 3W4KA 2FRDA 4P4LA 4N5MA 4B4OA 3I9LA 2Z5LA 2RIRA 4RDIA 5BT9A 1ZJYA 2G1UA 4AJNA 4ALIA 3GGOA 3V1UA 4W7IA 2AA3A 1HETA 2GERA 1ZSVA 3GPDG 3JYQA 2IE0A 2GD1O 3PYXA 3NJ4A 3RUCA 1UP4A 1M67A 1JLLA 1NPYA 2PKQO 3OFSA 4UVHA 1X15A 1A27A 3FF4A 3FNGA 5CPFA 3DBVO 1EDZA 2Q3EA 1DIBA 4BO8A 4E2ZA 1AXEA 1E0DA 3BYZA 1GQQA 4MVJP 5BNTA 1SO8A 4XZ3A 1NTOA 1Z82A 4NR0A 2HMUA 3V8BA 3JD1A 8ADHA 3RROA 3X2FA 2PGLA 3VVBA 2ZYAA 3ZWYA 3F6YA 5A3JA 1UAYA 1MGOA 1H94A 1YQGA 1NVGA 3HDJA 3PQDA 3EVTA 4UUMA 4DBVO 4TROA 2RBEA 3INTA 1GTMA 1CERA 2QHXA 4JX8A 4CLOA 1EE2A 3K5PA 3NTRA 1C1DB 2VNAA 2CSUA 3CZRA 4CUZA 3WSVA 4XRGA 4HFMA 4PZCA 3T4EA 3OEWA 3IMFA 1IZ9A 2B0JA 5I7EA 1MV8A 2AMFA 1ML3A 4FFPA 2GCGA 3AU8A 3OBBA 2J3JA 4CM4A 4WOJA 3MCVA 4DYVA 1HDRA 1PS8A 1Z74A 4LVCA 2A35A 3G1UA 3L6EA 3UCEA 2OHXA 3JQ6A 3PGXA 1C0KA 1YWGO 4NDNE 4BO2A 2IRWA 3ZV5A 1YKFA 2DKNA 3HG7A 5KKAA 5CDUA 4BMVA 1S7CA 4YBZA 4H15A 4NI5A 5KNLA 3JQGB 2EW8A 4J4TA 4GH5A 4R4JA 1KVSA 2IZ0A 5L7WA 5TRTA 2O3UA 4GSKA 1HEUA 5EQFA 4L0QA 3TNLA 3D5TA 3H8VA 5K6AA 1JWAB 3KRTA 3W8DA 1R4NA 1V3TA 2RHCA 1DC4A 4WLFA 1DHRA 4MIYA 3CMMA 1VPDA 3LSYA 5T5QA 1M76A 1UUFA 3M2PA 4M86A 5I7VA 3JQ8B 1PZFA 1I0ZA 1IULA 2O3JA 1F0YA 1Y81A 4W9NA 5GZ3A 1NXQA 2NM0A 4NBUA 4TRJA 4HFRA 5B1YA 1GFSA 3GUCA 4JGBA 4RLSA 4XIJA 1E6EA 1A7AA 5A9TA 2NV6A 1LTHR 1FDUA 4L76A 1DJQA 4BUCA 1E7MA 3UAGA 3KHUA 4Q3EA 2CF5A 1H0KA 4DIOA 3NV9A 2NUAA 1SEVA 1MFPA 2QYTA 2HU2A 4IGEA 3HDYA 2C0CA 1KEVA 2QQ5A 3EDMA 3FRJA 1O0SA 4UVIA 2IODA 3SXPA 4INAA 1PWXA 4RLHA 4KUHA 4EEZA 4HFNA 4J90A 4Z3DA 1DO8A 2Y1EA 1DIAA 2PY6A 4RCVA 3TJRA 3WJAA 5IZCC 4U8GA 5IXYA 1DFHA 1PTJA 2VRCA 4CR6A 3IQDB 5B37A 1MA0A 1YJ8A 2AHRA 3E48A 3VPFA 1H6DA 4NK5A 3KYDB 1OZAA 1SB9A 1VI2A 1FDSA 3PRJA 1LDBA 3KYCB 1YOVA 4IDEA 4ZN6A 2Q1WA 1SEPA 2O3RA 3M1LA 4ESOA 3B1FA 1PEDA 3PXXA 2CFCA 4D3SA 4A27A 3Q3CA 3I6QA 4YJGB 2F00A 3WQSB 3BXXA 3VH2A 2P5YA 3PIDA 3VH1A 1NR7A 3R6DA 1HYHA 2Z95A 3ASVA 5A4DA 3BIOA 4AFNA 4IINA 1GZ4A 1NAIA 3WICA 3TFOA 3IJRA 1E6UA 3VDRA 1DBVO 1U7TA 3F46A 4G5HA 4W82A 2BLLA 2NVUA 2QX7A 5G0TA 1QR6A 4BNLA 1A9YA 2Q2VA 1PJBA 4MO2A 3UOGA 1VE9A 2X7HA 1GDHA 1MXHA 3CMCO 3NTQA 3GFGA 4FC6A 4M1QA 2A9FA 3SJUA 4GWKA 5MGBA 2DQ4A 4IJKA 1PS9A 3S2IA 4LVUA 5K6AC 4DQXA 1UDBA 1JKFA 4OQYA 1T4BA 1EMDA 1X7HA 2PK3A 1B26A 1PJSA 4QECA 5A9SB 4F46A 3DBRB 4LK3A 1KIFA 4J7XA 2BRUA 2HMSA 2I5PO 3RASA 2NVWA 2X0NA 1XKQA 3CPSA 1JA9A 3AU9A 3LF2A 3I9NA 5H82A 2OXIA 4LSMA 4LGVA 5JY1A 3QA9A 4W9NC 1UP6A 5F5LA 3OF2A 4XCVA 1R0SA 2VRBA 3DXFA 3NGLA 2HRBA 1XIVA 2AW5A 5L95A 3TOXA 1GY8A 3AI1A 2A4KA 1R15A 1U5AA 3GG2A 1EBUA 3PHIA 5F1PA 3O26A 3NDJA 3OJEA 4Z0HO 1GU7A 3LC7O 1OFGA 4ALJA 4CM9D 1ARZA 2UUPA 4K1LA 1YDEA 1KC1A 4DC0A 4IJVA 1B2LA 2B5VA 3K96A 1AHIA 2Y1GA 1D1SA 3H3FA 4PVDA 1GPDG 4IS2A 4Q3AA 3MJEA 3AUUA 2GRAA 4IJWA 2I9PA 3DAFA 4L74A 1BXGA 4YVFA 4ND1A 5A02A 3N7UA 4NQZA 1LLUA 4CMCA 2NLOA 3L0DA 3I4CA 5I9MA 3HJAA 4ZVVA 5MDHA 4BNZA 1PJ2A 2BH9A 2BI8A 1E3EA 4FB5A 4D7AA 1E1KA 1O8CA 1NPTO 4I5DA 4E21A 4GSLA 2W2LA 2YQ4A 3ZNPA 4TZTA 1HYGA 1RYEA 2GO1A 4MVJH 2VHXA 3O8QB 1NBOA 3W4JA 4CM8B 1NR1A 5JYEA 5G0SA 3GC6A 1YXMA 5BSGA 2OO5A 4HADA 1EQUA 4Y6PA 1ULUA 1T2DA 1YH3A 1LC3A 3AOEA 1UZNA 4P4GA 1A7KA 2FP4A 3FWZA 3KEQA 4PLPA 4R41A 4UVEA 1B8VA 3BMCB 5K9ZA 4YAEA 3TQHA 3SLGA 2E4AA 2D1YA 3ZHXA 1F8GA 1EFLA 1ID1A 5CP8A 2FR0A 1LSUA 1NPDA 1IE3A 1Y5RA 4XGNA 3M1AA 1EZ4A 1YBVA 4H7PA 3WGZA 4N7RA 4ND4A 3LVFO 5DT9A 1BWSA 5EN4A 3T7EA 4BOYA 5FF9A 4DWVA 3GPIA 2B83A 3KTDA 3GH3A 3ZWMA 4IDFA 3WGHA 1ULSA 1GL3A 3GF4A 3ZNNA 3VVCA 2VWQA 2IEBA 4WNIA 4CQLB 3C1OA 1LLQA 2VYVD 1DC3A 2VUSA 4C7KA 1YL5A 3AUAA 1HLDA 5THKA 1NP3A 4BO1A 2NU7A 2Z1NA 1PQWA 5IN5A 1N2SA 1R6DA 4MP6A 4I9UA 5IN4A 1T2FA 1U7HA 3I3OA 4BMNA 5FI5A 1ZXBA 5GY7A 3RU7A 3WYEA 4YEDA 2OP1A 3I9KA 4HUJA 1NX6A 3DDNA 1X7GA 1M6HA 3PJEA 3H5AA 3C7DB 3EW7A 1SNYA 3KYDA 1H5QA 1YB1A 1RPNA 3KYCA 3OSUA 1U3TA 4YT2A 2HMWA 4R01A 3TPCA 2EGGA 2P9EA 3ZZNA 1U8FO 2YDXA 4Q3DA 4E32A 3H5NA 1MB4A 4DPLA 3KLPX 2I6TA 3CE6A 4WLUA 1VJ1A 3LQFA 1M66A 5B4UA 3RJ9A 3UCXA 4GL4A 1K0UA 3IP1A 5DZSA 7MDHA 1P0FA 2G82A 4R9RA 4A7PA 5DDIP 4Q3NA 2VWHA 3RU9A 2I65A 1KY5A 4ND5A 3E9QA 4NBWA 1NQ5A 1PSDA 2XXJA 3A9WA 2FHSA 4GKVA 4IUYA 1C0PA 4BO4A 4B7CA 3DBHB 3C8MA 3WMWA 4FOOA 3AFMA 4OXKA 5ES3A 3AY7A 1UXHA 3ZWXA 3K30A 1J4AA 1EEHA 3L6DA 5G4KA 3B1KA 1V6AA 4S1VA 1UDCA 1EVZA 4LCJA 2RH4A 1DRUA 3B70A 4YB8A 3B20A 3I5MA 1I01A 2VN8A 5AXBA 1D3AA 1D7OA 5JBIA 1ZMTA 3FSRA 4MVJF 3DBRA 5BNFA 4PVCA 1X14A 4YXFA 4TRMA 1ISHA 2CNBA 4BKPA 1V9LA 3GRPA 1N7HA 2TMGA 2CF6A 2E6UX 1K6XA 1EBFA 3EVNA 5HS4A 1BW9A 4FFRA 3KEOA 3R1IA 2FMUA 3AI2A 3UH1A 5FFFA 2Y1CA 1NFFA 3ZDFA 1H6BA 3S2EA 3EHEA 1ZEMA 1EFKA 2GDZA 1P31A 1ZSNA 2PFGA 2H1SA 4B4VA 3JQEA 3RBXA 4GVLA 5L40A 4BNWA 2WWRA 4E2WA 3SC4A 4YQYA 4TVBA 1LQTA 3D7LA 3H6KA 4YJHB 1P1FA 3ZU2A 1AHHA 3D64A 3Q6IA 2DC1A 3NDRA 3AM5A 1OC2A 2Y67A 3BHJA 3GDOA 3PWZA 4LMRA 5F1OA 4ND2A 3RD5A 4E3ZA 2FPGA 1E77A 4RPGA 1GYPA 2C7VA 1JTVA 2B4QA 4L4SA 4QX6A 4YT4A 1HZJA 4R1SA 3O38A 4I08A 4Z6KA 4Z0TA 2Y93A 1H6AA 2ZQYA 1B7GO 2UVDA 3EGOA 5F5NA 5CEFA 1G6KA 1BMDA 1W8DA 1QV7A 2PZJA 3AOGA 1YONA 2EKQA 3QY9A 3DOOA 2Q4EA 1ENOA 1WZIA 4XDZA 5G0VA 1SB8A 3GG9A 3GMSA 3I83A 5LDGA 4FFMA 4XYGA 3ZI0A 3SEFA 3TZKA 3T4XA 3O4RA 2D8AA 3AY3A 2FN7A 4N5NA 1F17A 3JTMA 2HK7A 3PHJA 3ASUA 1DC5A 4BNJA 1TT5B 3F9IA 3AK4A 5JDCA 4GX1A 1TXGA 1NASA 3HE3A 2ZB4A 5COBA 4RJTA 2J6IA 4ID9A 2JAHA 1LSOA 5EERA 4XYMA 5KVCA 5BNIA 2AEFA 3UGKA 2GZ3A 3BMCA 4JN6B 4RV9A 3JQBA 3LT2A 4EYEA 1G0NA 2Q2QA 3PZBA 4YCAA 3F47A 3OICA 4BO0A 3P2YA 2VTEA 3H5RA 4AL4A 2X1HA 4IGFA 1I3LA 2PA3A 4II3A 3JQAB 1UZMA 1MXFA 5L4SA 2IYOA 1K6IA 5KVSA 1XR3A 3LT4A 3QVWA 4XRRA 1SAYA 5TT1A 4WCFA 6ADHA 4YQZA 3QVTA 1UDAA 5BSEA 2DT5A 2VWGA 4FIZA 5FI3A 1T25A 1DSSG 1VKNA 2CDCA 3DFUA 4QSMA 3KV3O 5L9AA 3K9QO 3QLJA 1N8KA 2C5EA 3UFXA 1T2EA 3GHHA 1YRLA 3E03A 3E18A 3JD2A 2V6GA 4M54A 3IL2A 1E3LA 2W98A 3IJPA 4W6ZA 1GQ2A 4UREA 4IQ8A 2VUUA 2CY0A 3A28A 3DMTA 5LDHA 4WE3A 4JQCA 1VRWA 3I52A 1U4SA 4EJ6A 4BNVA 1N5DA 4R1TA 1W6UA 4IDCA 2GSDA 3OMLA 4RDHA 3WDSA 3DBLB 4F6CA 3W1VA 5DULA 4EDFA 1NFRA 1QV6A 3IDSA 3D4OA 1LJ8A 3L6OO 2AG8A 3NDIA 4DLLA 3L07A 4D45A 3PYLA 4ZGWA 5C7IO 2NU8A 4IY1A 4ZQHA 3VTZA 5DOVA 1WDMA 1XDWA 3F4BA 1IYZA 1XLTA 4L4XA 1N1EA 3DMYA 4B7UA 3WGIA 3F5SA 2O3TA 4CL8A 4PG5A 1PX0A 5TF4A 2JD1A 4FR5A 2BFPA 4N18A 3G17A 3S2GA 4ONEA 3VPXA 4CMHA 3H9EO 4Z9XA 2NQTA 2O4UX 4E4YA 2PWZA 1WPQA 4YRAA 3D3WB 1ZO8A 2X9NA 4JXKA 4GX0A 3OIFA 2VRCD 5CPBA 3BTUA 3BTOA 4OYRA 1G0OA 1E7SA 5JAZA 5CDYA 1YJQA 4BNFA 4TQGA 3EK2A 2W90A 3CIFA 4QFDA 3JQBC 1BVRA 3HB4X 4RF3A 4RPJA 1R12A 1CQIA 4JJGA 3D3EA 4DRYA 2ZYDA 3R0IA 1C14A 2PR2A 3VH3A 2JCXA 4Y6RA 4CLHA 3MTJA 3NUGA 2G76A 2PNFA 3P2OA 1HDXA 4GI2A 4Y67A 4BGEA 2JCYA 5HBRA 2BGKA 2GGSA 1VC2A 2DPHA 3AY6A 1KY4A 1UXGA 3QP9A 2Q46A 4HNGA 3PK0A 1YE3A 3DC2A 1JVBA 4R5HA 1CETA 2ILTA 3ZW9A 2QZZA 3WYBA 4YAJA 2X0JA 5CDSA 1P1RA 4ZQEA 5CDTA 4BS9A 1QYVA 1XA0A 2ZATA 2NNLD 4EUFA 4EZBA 3BTVA 2OOSA 1Z45A 4J4HA 1P0CA 2QIOA 4CMBA 5TX7A 1P9LA 4AJ2A 4IXTA 4CODB 4LMPA 1FF9A 4CMIB 4IIVA 4XQGA 5JO9A 4E33A 2PD4A 4D0SA 3NEPX 4NHEA 1Y8QB 3KUXA 3IKVA 3WWZA 4NJMB 1NWCA 2P68A 1BTOA 3EAGA 3PHGA 4WLNA 3RAJA 4IMRA 2JHGA 1I32A 4U6SA 4IDAA 1PIWA 4BKOA 1SCUA 3FTPA 4FS3A 3G49A 3V2HA 4YAGA 1SBYA 2JFGA 4QT0A 5T64A 1TT5A 2ZB7A 3AUSA 1EK5A 2IYPA 4YT8A 2OBYA 5IZCA 3FR8A 4ZJUA 3GNSA 3VC7A 1GEGA 2E82A 5CEEA 1EVYA 3Q2IA 4I8XA 1YGYA 1G1AA 3WGQA 4AJ4A 5I9NA 4QO7A 3HHPA 4W7HA 3WB9A 3ZHZA 1B3RA 3GY0A 4UEKA 2DBRA 3QHAA 1NVMB 1A9ZA 1KETA 4CQMA 1F06A 4XB1A 3GDGA 2ET6A 1LDGA 5THQA 2YHIA 4F45A 3L9XA 5IDWA 2W2LD 3BMOB 5FEUA 1XCBA 4FD3A 3HWRA 4FGWA 5U4QA 1HKUA 2DTEA 3JQDA 3PPIA 3ZHBA 3FBTA 3DEYX 1NVTA 3JQFC 4NBRA 4PCVA 3FCOA 5U1PA 5ER6A 3FBGA 3KZVA 1K89A 3AW9A 3EY4A 3I23A 2Y68A 4KTTE 1FMCA 2C7GA 1RM5A 4A26A 5IXSA 1MP0A 1WDKA 3QWHA 1Z73A 4TMFA 2QRLA 3L77A 5CFZA 2QZ9A 2GZ1A 4R54A 5T6BA 4OL9A 3U4CA 4XEHA 3ROPA 4RF2A 4CMEA 4XR4A 3K31A 1SOWA 3PGJA 4KP7A 3ZCXA 2JJYA 1XQ1A 3QIVA 3ETDA 4Q3CA 4DIFA 5JMWA 3VHRA 3GNTA 3IUPA 5TJ9A 1QYDA 5F3RA 4BGVA 1GCUA 1CYDA 1DHTA 2R00C 3DBLA 2YV3A 5JMPA 2Z1MA 3P5SA 4P4NA 2FSSA 3CXRA 3KVOA 1KVQA 2GN6A 3INGA 1ZK0A 4R68A 2WJPA 2I76A 4BQRA 4Y98A 5KCZA 4K6FA 1ADCA 4R1UA 1VM6A 1L1FA 1I3NA 4A2CA 2BD0A 3ST7A 5CG2A 2D0IA 3E5MA 4OKNA 4XD2A 4XQCA 1MC4A 4EUEA 3BMNA 3G0OA 2W2KB 2NTJA 5ITVA 1NYTA 1NAHA 3V1YA 4R3NA 3H2SA 2GN4A 1HZZA 2HLPA 2C29D 4E6PA 1PQPA 2P5UA 2YFQA 2IXBA 1I2ZA 3K6JA 4YJFA 3RUIA 3RUDA 4EI2A 5L51A 1CWUA 1QKIA 1DFIA 4WEQA 3DAPA 1B14A 3BMQB 4WLEA 4PLYA 4GX2A 4E5MA 2VOEA 1PZEA 3GN2A 4NU5A 4KQWA 3C7AA 2E48A 3MTGA 2FZWA 1DDOA 1GADO 1GYQA 1Y7TA 4YAKA 2GLXA 3GDFA 3GVHA 5I8ZA 3JD0A 8LDHA 3RFTA 2FSVA 2CVZA 1CEQA 4G81A 2LDBA 1T4DA 4BO3A 2X6TA 2VZ0A 4EITA 4E12A 1O6ZA 1ZFNA 5FWNA 3QQPA 3RSHA 5C37A 5AYVA 1DAPA 2BFOA 4PG7A 5G4LA 2FOIA 1QYWA 5B12A 3D1LA 4NH4A 1EUCA 2HJSA 1PS0A 3OIGA 2A92A 2H6EA 2DTDA 4AJ1A 1Q7BA 3HFGA 3MOGA 4UVDA 5KJCA 2WD8A 4CM5A 2WYWA 3UCFA 1CIVA 2EJWA 2OORA 2PD6A 4R3WA 4E5PA 4CMEC 1HXHA 3EYWA 1S6YA 3WQRA 2ZCVA 4DPKA 2FZEA 4JJFA 4CLRB 2CVOA 4OSOA 4J43A 1Y8QA 1SC6A 3ZNOA 4GKBA 3EMKA 3RFVA 4NJMA 2HQ1A 2YW9A 1OOEA 4CMKA 2JKVA 4TWRA 4FQ8A 4DYDA 2ZKLA 4M8SA 1NM5A 3GGPA 1DXYA 3H9GA 2D3TA 1ZK3A 3HFSA 3VPGA 4EEXA 1XQ6A 1W4ZA 2EP5A 2JAPA 3DB2A 3V2UA 3PEFA 3ABIA 3DWFA 4WLOA 5L53A 1E5LA 4UUNA 3AFNA 1GR0A 1MG0A 3ZH2A 5ER9A 1LSSA 1Y1PA 3ZU3A 3JYPA 3VPSA 1C3VA 1FJHA 5JE8A 1EUZA 3BHMA 1T2AA 4MKZA 1EDOA 1KVUA 3GZNB 3TL3A 4KOAA 2Q99A 3PTZA 3Q1LA 1YS4A 2DAPA 4Y8VA 4BKQA 3C3XA 4KTVE 4MVJA 4W99A 4YDRA 1T1SA 1C1DA 1K2WA 3WBFA 5TGDA 4RPHA 4R69A 1Q7GA 1R66A 3ZHYA 1ZJZA 4FOSA 4O1MA 1R0KA 1GCOA 3HDHA 4BKRA 4AJIA 2DLDA 3PFWO 4CPDA 4MVJG 3WIDA 3BMOA 2Q4BA 3RKUA 4QTZA 3W8FA 4YAIA 1L7EA 2BGLA 1BGVA 2RHRA 3A06A 4U7WA 1X13A 5JC8A 1N1GA 2WDZA 5AXCA 2BKAA 4XGIA 1O9BA 2R6JA 3BA1A 4BV9A 4J1TA 1HL3A 2Y66A 4DA9A 4C7JA 1DIRA 4PFJA 3DOJA 2VHWA 3JQGA 5KJ1A 3GVIA 4H16A 4J2OA 5BSFA 3FWNA 2WM3A 1UJMA 1IPEA 4J3FA 4L75A 4ZA2A 4J1SA 1IZ0A 1E92A 4D44A 3AM4A 1ENPA 2O50A 3A1NA 1LU9A 3OQ1A 3Q11A 1UR5A 3JYNA 3L4BC 4OMUA 3LT0A 2QRJA 4QO8A 1XEAA 4PLTA 4CM3A 4ZQFA 1DEHA 1B16A 3JQ8A 1LEHA 4A73A 1MC5A 2YQ5A 1P33A 3FPCA 5JFOA 4MVJM 4GX5A 2J5KA 1HSZA 3KSDO 1PZGA 1W0CA 2IEDA 3JD4A 4OAQA 5COAA 4A5OA 1B15A 4XQ9A 1BDBA 3W4IA 4LISA 2P2SA 2PH3A 3JCZA 5DNAA 3V5NA 2AQIA 4AJEA 1OBFO 1KEWA 4E30A 1PJLA 4B8WA 3D4PA 1YBMA 4ALMA 2XAAA 3TOZA 5J23A 4AJJA 2X9GA 3X2EA 2WMDA 4ZRNA 5ICMA 1I24A 4JROA 2O23A 3QJ5A 2B5WA 3FI9A 2C54A 2BHLA 1U3UA 1V8BA 2DUUA 5HS6A 4AVYA 2Q49A 3GEGA 2WE7A 5JAQA 2G17A 3MZ0A 3VZSA 1WVGA 3U4HA 4RVDA 4TRNA 4HV4A 1JDJA 4YR9A 4OO3A 4KUEA 1ZXLA 4ZQGA 3T7CA 3DZBA 3ORFA 5L7YA 1ZK1A 2RH8A 3JQ7B 4D42A 3ANNA 3ICCA 1LQUA 2I3GA 1E7RA 1TVEA 4KZPA 3WTBA 3B1JA 1PGQA 3ZGYA 5ILOA 1U5CA 4GPD1 3S8MA 4KDFA 4CV2A 3JYLA 4R5MA 4YJGA 4BL5A 1HLPA 1HT0A 2O48X 4HY3A 5IG2A 1YB4A 1EVJA 2NVBA 4OSPA 4WKGA 2PZMA 4J2HA 3VTFA 3DTTA 3INRA 2EP7A 2OFPA 3PQEA 4Q3BA 1JQBA 1DOHA 3K73O 3HSKA 4IPTA 2JCVA 2WE8A 1GD1O 1K6JA 2NTNA 2BMAA 4GVXA 3G3EA 5LC1A 2Y1FA 1ZNQO 3B6ZA 4YYZA 2JFFA 2JD2A 4BNTA 4HKTA 1ISGA 1NQOA 4DC1A 1KYQA 3E5RA 1HDCA 3MEQA 3RC2A 2VHVA 3OA2A 1V3UA 4Z9FA 3U5TA 1E1NA 1TA4A 1WXDA 3FNHA 4FJ2A 4ZU3A 1HYEA 4IS3A 1N92A 5A9SA 1EQ2A 4CLRA 1SZJG 3CSDA 5KVQA 4II2A 4IIUA 2QRKA 3AUTA 4BO7A 5IDXA 4XWYA 3DONA 3PDJA 4BGUA 1XHLA 1HDOA 1H2HA 2E37A 2HUNA 1B3BA 2GZ2A 4HX5A 4N5LA 2Q1UA 3PJFA 1E7QA 2P9CA 2W8ZA 2EG9A 3NT2A 4BIIA 2FR8A 5JDIC 2AEMA 1VL6A 1ZKMA 1DC6A 2Q1SA 4DGSA 3QWIA 4MP3A 2BGMA 1NHGA 2VYNA 3HDQA 4CUJA 1L7DA 3MJ4A 1O94A 1N9GB 1ISIA 2O2YA 3RI3A 3ROQA 1PL6A 3E9MA 4UVGA 1JWBB 5CEJA 1N7GA 1PWZA 5IDQA 5JY6A 1IHYA 2FY8A 3QSGA 1LI4A 5A5EA 4FN4A 1BG6A 3COSA 4XYLA 4KUGA 1LC0A 5T8KC 3CZMA 4WPGA 2EGHA 3K8ZA 3DOCA 1DIHA 1U3WA 1A71A 1FK8A 2CDBA 4CV1A 1EUDA 1GUZA 1R0LA 1Q0HA 4D41A 3Q9UA 5AOVA 4CV3A 4DLAA 2J5QA 4OXYA 3RFXA 4RZHA 5C5IA 4FFLA 2X23A 4NG5A 2YFHA 2IDZA 1R16A 3PZRA 2X86A 3KSUA 3L9WA 3Q9NA 3F4LA 3PQFA 3OJFA 4ZQBA 4ND3A 4IZHA 3QV1A 2I3AA 2X5JO 1ZUD1 3O8QA 5HM8A 4CM8A 4FW8A 1MLDA 2D2IA 1WMAA 3RUAA 4KWIA 4PRKA 4EW6A 3A4VA 3AM3A 3JV7A 4FFNA 3CKYA 3KBOA 3U4IA 1F12A 1HTBA 1ONOA 5EPOA 5DOZA 4BVAA 3FNEA 1YBAA 2C5AA 2PKQP 3ZWVA 4R51A 1QYCA 1RYDA 4JLWA 5CDGA 1UP7A 4PG6A 3I9MA 3WS7A 4DIBA 4OHUA 4MDHA 1J49A 2OZPA 3JQ9A 5KIAA 3NX4A 4MJLA 1HDZA 2BF7A 5KJ6A 1E1LA 4OOFA 3H65A 1XGKA 4CQMD 4AJLA 1MG5A 1U3VA 5IDYA 3WNQA 2FR1A 1RM0A 1E3WB 3OHSX 2AQKA 1I3MA 3NT4A 3R3SA 4CMAA 2AQ8A 4GBJA 3MJSA 1PGOA 1I30A 1YDWA 5DBIA 4LN1A 2EERA 2VNSA 4L9RA 3EUWA 3ZWWA 3ZWAA 4RQUA 5BQFA 2VTDA 2ZIZA 4CQLA 4KMSA 3PJGA 3SLKA 4B4UA 1IL0A 1I2CA 2ZYGA 1Q1NA 3KLMX 5ADHA 3DFZA 4M49A 3K2EA 4D0RA 3ZN2A 3QE3A 1ZMOA 3NTOA 3CINA 1ZK2A 2Q1TA 3L4SO 2B35A 1ENZA 3AI3A 3WGOA 4CM4B 1YB5A 2AE1A 4PRLA 3KETA 2AEJA 5K0ZA 2DBQA 5JPIA 2CMDA 3PIIA 3IIEA 3F1LA 1H93A 2NU6A 1T26A 4RPKA 4JK3A 3JQ7A 1J6UA 2HJRA 1H9BA 1JW9B 3OEYA 1HE4A 1UH5A 1WAMA 2HMTA 4H3VA 4EJMA 3WGYA 1IHXA 3NKLA 4NFYA 3GGGA 4BNIA 1HE5A 2Y1OA 3H2ZA 3V1TC 1T24A 5HRUA 4I5FA 4GGOA 3UICA 4E5KA 2WSBA 1EE9A 1R4NB 1LRKA 3FNFA 5EL0A 1TT7A 3K2BA 4WOKA 4A0SA 5JCXA 4RVHA 1CQJA 3WGGA 4YJDA 3WTCA 5KKCA 4CV0A 3S55A 2BFMA 3HN2A 4LCEA 2WTBA 2X0RA 3PWKA 2V6FA 4UEOA 4FSHA 4GLOA 4J16A 4TSKA 2DU8A 3ONEA 4EJ0A 3GAFA 1XSEA 1PJCA 3DZFA 3DBHA 1H9AA 1KERA 3W6UA 3WNVA 3H3JA 4W4TA 1Z7EA 3ZNQA 3ZW8A 4DVJA 2FPIA 1ZW1A 2G0TA 5I7SA 2O3QA 3ETEA 3JQ9C 2B36A 5CHEA 3DL2A 4URFA 4NZ9A 4FGSA 4F3YA 3C85A 5IAAA 3UW3A 1PZHA 1X0XA 5G2OA 4FC7A 4BB5A 2J8ZA 3JQFA 1YVEI 1KEPA 4LRSB 3PYMA 3ADPA 3UKOA 3IAHA 5HTOA 2B69A 4UUPA 1DPGA 2P4QA 3GHYA 1YOVB 3N58A 4I9HA 4U5QA 1RM3A 2UUOA 2V65A 4I5EA 3A14A 2DFVA 1LA2A 4XA8A 5KWEA 1D8AA 1SMKA 3I1JA 2O7SA 1D1TA 4YACA 2ZTMA 3TSCA 4C4OA 1Y8RB 2EXXA 3ONFA 4YJHA 3ZWBA 1N9GA 4R9SA 2XPCA 4MIOA 1GAEO 3ON5A 4U0JA 1XU7A 1BXZA 5JLAA 5KJEA 3N74A 1OMOA 2Y0DA 1WWKA 2R00A 4J9UE 3RWBA 1WNTA 3IOYA 4BNUA 3AWDA 4RL6A 2NVUB 2RAFA 3GK3A 2QYSA 2WYUA 1V35A 4HFJA 3LZ6A 2POQX 3LU1A 4QFCA 3GMDA 3U9LA 4B7XA 4RF5A 2AQHA 3RVDA 5A3VA 7ADHA 1JAXA 1BSVA 1B8UA 4DPMA 2P91A 1VLLA 2OMEA 3GVCA 3QRWA 4JNKA 3ADOA 2YUTA 3RUHA 3U0BA 1BRMA 1Q7CA 3PDUA 4J7CA 1M2WA 2Y0CA 4FBGA 2YV1A 5JCJA 4DLBA 2HSDA 4NBTA 3M2TA 3H7AA 1RKXA 4IBOA 5KJFA 1IB6A 1UXIA 2BFAA 4CUKA 3RIHA 2I66A 3DO5A 1ZZEA 3EZYA 3PWSA 3VH4A 1D4FA 1M75A 2ZTUA 3LT1A 5IZ4A 3QWBA 1JN0A 1V3VA 3DHNA 3NYWA 4PGFA 4I5GA 4IDGA 1CJCA 4MVJD 1C1XB 9LDTA 1FDTA 3HZZA 1NFQA 4J91A 4WCDA 2XF8A 3HNPA 1E3IA 2VOJA 4RVSA 1PGJA 3F1KA 3JQAA 2PLAA 2EV9A 1E3WA 5DP2A 4QEDA 3WIEA 1HDYA 1Q0QA 3KYBA 4OOEA 4KDEA 4MKXA 2C82A 4AICA 2NACA 1WMBA 3WLFA 1A72A 5TS3A 4CM6A 1BXGB 1DLJA 4IMPA 1YL7A 3V2GA 5I9LA 3JQCA 4E31A 2C59A 1DB3A 1K5HA 3I6IA 2B4RO 5IJZA 4WUVA 3PHHA 2VWPA 3I9JA 1H2BA 3STHA 4NBVA 3WOHA 1PL7A 1VL0A 4M55A 4BO6A 3H9QA 1VSUA 1Y9AA 9LDBA 4D3FA 5TLSA 1PJ3A 3C24A 3GVXA 2OP0A 4PLZA 2JL1A 1I8TA 1SOVA 3HQ4O 4G65A 1A5ZA 2ZK7A 4RVGA 3VZPA 4A10A 2ZTVA 1GUFA 2UV8A 1EVIA 3ZV6A 5CAEA 3GUYA 2OUIA 4ITUA 4PLHA 3ZWOA 1P77A 3SBOA 3U4DA 1NWHA 1Y9EA 3BTSA 1GEEA 2Q45A 4XJSA 3NGXA 5DN9A 1AGNA 4WJZA 1UXJA 1WZEA 1KEUA 4YTEA 3WR5A 3H9UA 4G2NA 5ITWA 4OXNA 3ZU5A 1LDYA 1TI7A 4OH1A 4FJ1A 3IC5A 3W8EA 4D43A 1ONPA 4K9DA 3KB6A 2RCYA 3D3WA 2VZ9A 2VZ8A 3VZQA 4QXMA 4UULA 4XGKA 3DAGA 4B8ZA 1Y5MA 1DFGA 4D3DA 1VL8A 3F3SA 1Z6ZA 2GR9A 4O6VA 3WYCA 2W4QA 5C7LO 4N54A 4BV8A 3BZUA 4CM1A 4JCOA 4ZRMA 3WWYA 2LDXA 1HRDA 2HDHA 3TN7A 3ETGA 4CJXA 5A04A 4ROSA 3Q2KA 1O5IA 3MJVA 4FDAA 4HWKA 4S3MA 4BQPA 1NQAO 3PJDA 4I1IA 4B3HA 2PGDA 1GV1A 4JIGA 1VKOA 5JYDA 3SVTA 5DBGA 3ENKA 3DZJA 1QSGA 2X8LA 4X54A 2PZKA 5KOIA 1P45A 4K6CA 1TEHA 3GLQA 4GQAA 3RUEA 5JS6A 3QVSA 2IZ1A 2NWQA 4DXHA 2ZJ0A 2PTGA 4GGPA 2YHUA 3ROMA 2EHDA 4LRTB 4MP8A 4AJKA 5C7OO 1QYXA 1Y8RA 1X7DA 3Q0EA 5A9RA 3ZU4A 2Y1DA 3LC1O 2P4HX 3GEDA 1HE2A 1C0IA 2AE2A 2B37A 3L4BA 1I33A 3OJ0A 3QVXA 4L8VA 4TKLA 2OBNA 1ADFA 2X4GA 1H6CA 1P74A 4JP3A 2FWMX 2PV7A 3E1KA 1P1HA 3MWDB 1BXKA 2UYYA 1E7WA 1F14A 3LLVA 3O9ZA 2YY7A 4CMIA 2HKIA 5DBFA 1Z7BA 5TNXA 4ZICA 5JAIA 1GUYA 4HP8A 5JSFA 2IZZA 2GN8A 2XOXA 2DBVO 1Q2XA 2C2YA 3JSAA 5G4KB 2E49A 5A5FA 5BR7A 2VT2A 4WK6A 3VPHA 1DAOA 1LBEA 2VYND 1R37A 3DZGA 3ENNA 4JP2A 4MVJI 3OIDA 2O2SA 3GN1A 2OL4A 1RM4A 4D46A 4BNXA 4EUHA 2ZJ1A 3TF5A 2WYVA 1FDWA 3NRCA 1BW9B 4NMHA 4OQZA 1DJNA 3WGTA 1FDVA 2GASA 4J6FA 4QUKA 3C1AA 4LSWA 5AVOA 4D79A 1UXKA 3DZIA 2FPPA 4YWJA 1UAGA 1DIGA 1YQDA 3I9OA 3OQ6A 2IXAA 4YT5A 1C1XA 1PR3A 5L3ZA 1ISMA 4PN3A 5JO0A 1ONNA 3D5QA 3KSZO 5L7TA 3PHLA 3DZKA 4M87A 4RVUA 3LLSA 3WX0A 4RQTA 4DL9A 4J0EA 1HDGO 1K3TA 1IPFA 2GN9A 4YPOA 1MX3A 3PLRA 3OECA 3CEAA 3ANMA 4PZEA 1RJWA 4ZHSA 1SPXA 1Y6JA 4Z9YA 2F1KA 3IUSA 2VT3A 3OP4A 1TB4A 3WBBA 1UZLA 1GZ3A 4BNNA 4RO0A 1AN9A 3CUKA 4R16A 5JC1A 1OAAA 4WEOA 4FCCA 1F8FA 4MKRA 3GVPA 5I8WA 3FHLA 4CLDA 1BVUA 3ZWNA 1MUUA 4O5OA 4JBIA 2CD9A 4WASA 2DM6A 4XYBA 1P1IA 1ZK4A 4BO5A 4FJ0A 4P8RA 3ZWPA 4JJIA 3HADA 4RGBA 4GMGA 1ADBA 4IQ0A 1CDOA 2ZB8A 3RC1A 3DR3A 1LLDA 5JXWA 4AG3A 2X0IA 3OQBA 4UUOA 3GRKA 5EQDA 5DP1A 4RPLA 2UAGA 4E5NA 3GQVA 3BAZA 2GUGA 3GNQA
chains in the Genus database with same CATH superfamily
2FF7A 2Y4OA 3CX8A 1AXRA 1JJBA 1CY4A 3T3MB 1NBAA 3OETA 5ICGA 1Q12A 1AKNA 2G71A 3BG5A 1H65A 3MN1A 1ZH8A 2QW8A 2YASA 3IVMA 5EESA 4L95C 4EY5A 3U17A 2DB3A 4US2R 5A5DA 4QEZA 4U9HS 2OGUA 1QWSA 4YMIA 1K5DA 1C8VB 1QP4A 2DPGA 3LYLA 1K4KA 4W7SA 4NONA 3ZZMA 2D1QA 3HYLA 5TSDA 1UQUA 1T8SA 3R8FA 4L4RA 3K1YA 5SV2A 3WXBA 2GXSA 4WSOA 3U1TA 5L4NA 4GR9A 4RD6A 2FUG6 3I9V6 3V8RA 3CRMA 1JAIA 5C8XA 2X9VA 1PFVA 3ILHA 4HQFA 5AW6A 3RBVA 1UZAA 2VPIA 1IJKA 4RD2A 4WN3A 4XI9A 1JHZA 5GP1A 1UF9A 4NDZA 4ZXPA 1E5DA 2QTTA 3TWOA 4Y0NA 3UFXB 2H2WA 5LD2C 2DYKA 3G2LA 4NYMQ 3BEDA 4HYYA 1PQUA 1CSEE 3RODA 1AE1A 2OV3A 1XC7A 3S5JA 4JUIA 3BJRA 2GILA 4N7JA 1E7YA 1TO2E 1BGXT 1ZA1A 2V6IA 2XMQA 1RAHA 2FMIA 2Y4NA 4I1YA 4IIEA 5F1KA 3U7QB 2XMCA 3ZQUA 4X66B 3AVTA 5CGZA 4P22A 4WECA 4OQNA 3NKVA 2FWPA 3DLIA 4O8CA 5JJ5A 4V0OA 4N3CA 3HJHA 5DM60 3TTTA 5L4LA 3IURA 5EE3A 2Y0EA 2TMDA 1FXSA 3F9CA 4OHBA 4YRFA 1X0VA 2CZCA 1MTZA 2V5VA 1QO0D 3N28A 4XSHA 5AJXA 3MGAA 1C3XA 2XUJA 2IFTA 3HYTA 2H1LA 4KX5A 2NU8B 5EINA 3VR6A 5ECWA 2H31A 3QVGA 2CMGA 3GCGA 4J7UA 3RSCA 1WD5A 1PNOA 2HWUA 3F5QA 3MERA 3U4QA 1OC4A 3O94A 4BHTA 1C7ZA 1P44A 3LGSA 1LW6E 4H0CA 4MINA 3RJMA 3V00A 3WRVA 1ZN7A 3EIHA 1LNQA 2SCUA 4M9RA 4AMGA 2X7JA 4UTVA 4XIYA 4BLSA 4IILA 1IAVA 2DVMA 2QZ4A 3H99A 4KPEC 2Q2WA 3OAAD 3Q5GA 3GLTA 1PR1A 1PR9A 3AETB 1P6UA 1U5BA 3E2MA 1EX9A 3OJLA 4XARA 2MHCA 1EI9A 2IV3A 2OCLA 4J1NA 3QUBA 2O3SA 1CEEA 4Q1VA 3HJCA 3P32A 1KP9A 1M1YA 4PG4A 2YYAA 3ZGZA 4HWOA 4ZXFA 1AQJA 1YSCA 1DBWA 1DMRA 3JVUA 3FHTA 2X76A 1FLNA 3ROKA 2I33A 2TYSB 5JJLA 4IDDA 3DHYA 2ZJZA 1GTL1 4WZZA 1M7BA 2OCDA 2HTEA 4IV5A 1T9DA 5EUBA 2OCAA 2QP9X 3WAKA 5KOJB 2CCJA 4MMXB 1SKQA 2L69A 3ITKA 1IY8A 3D3NA 2AG6A 1O97C 1XWFA 3CRVA 5T57A 2IY9A 2JI8A 4TMTA 3K4PA 1AK9A 3KPJA 4P7FA 2A9PA 3AVYA 1GKKA 1WSAA 1XCLA 1A9OA 1A2QA 1KC3A 4TV9A 4XKJA 2H1OA 3ICQB 2J0SA 3DZDA 2CUKA 1NBWB 3W06A 4MVJE 3HL0A 4YECA 4Z51A 1E1CB 5A05A 3HN7A 2JK0A 1XRNA 1E20A 4P9NA 4O63O 5HWSA 5ENDA 4U2GA 5DCUA 1YO6A 1V96A 1GT91 1JKJB 1RT9A 5L6LB 2J5RA 2WLSA 2HXYA 4HG2A 4JHLA 4UEWA 4PNEA 4GKKB 1RWBA 1SXHA 3K1ZA 1EB9A 5TT0A 2K7ZA 4CL3A 3KZNA 1IN8A 2LPMA 2G77B 3N0WA 1S2GA 4NFHA 2XIJA 2P9YA 1QE3A 1KVRA 1TIBA 3RKRA 4QJ4A 1N0VC 3AJAA 3NHWA 1W4RA 3R7FA 3W5DA 1V6CA 2IHYA 1TM1E 4U0KA 4P86A 2YWDA 4KXNA 4L22A 1RKVA 1SHUX 1U28C 3DTVB 3O2JA 4PF1A 1OIVA 3O92A 2GESA 4E13A 5A5VA 1H23A 5ELMA 4PIVA 2V7PA 2ZB3A 5TIIA 3UN1A 1I2MA 4Q39A 4AYXA 4R2IA 2PH5A 2ZYWX 3FFAA 3CV3A 1Y7HA 5A71A 1XZEA 1DUIA 3AX6A 4JQYA 3WK7A 2OFWA 2X0FA 4MI6A 4UMDA 1YE8A 1Z2PX 4H60A 4EB8A 3OQMA 1IDN1 1KRXA 4TTSA 2V1XA 4N0QA 5CFRA 1XU9A 1XELA 3ESZA 1HF3A 3HTXA 2AB0A 1NHWA 1ZNWA 5EJ4A 1DWOA 1RIIA 2H2DA 4F2GA 5D5HA 2C0QA 3LQRA 1XYGA 3L1JA 1HLFA 3KL2A 4QPZA 4B75A 2RGRA 1VJTA 3LT5A 4C30A 3LC0A 3EQZA 3LQ2A 5JEEA 1FLAA 1LX6A 1D2CA 4YAUA 2KX7A 3FTEA 1E1RD 4DMMA 3D1VA 5H81A 1EFCA 1GZ6A 4S1PA 3Q72A 3WOVA 4Q1FA 1MRZA 5AVJA 4BYGA 2XVAA 1EJ6A 2VXCA 1JLHA 1X1QA 5CDHA 1F2TB 1N2XA 4G0WA 1C0EA 1T43A 3V4SA 1VJ0A 2ACKA 2D2FA 3EASA 1PR0A 1XZCA 3JYOA 4M89A 2PRYA 4O0LA 2WVAA 3WLSA 4YHHB 1QLHA 5A0TA 3AEQA 5AKIA 1R8JA 2C2XA 4LZNA 2O2DA 3TB4A 4RVFA 4Q7QA 2EF0A 4LYAA 2Q0QA 2W6MA 3ZXSA 4BVKA 5K8IA 1GN8A 5KPDA 2FEWB 1E0SA 1SXPA 2J3KA 1GKIA 4IEEA 1I1HA 4GZ3A 2HRZA 3H1PA 6REQA 1G8MA 4CXMA 1DG9A 3GL9A 3HKBA 4OHRA 2V3WA 2R8ZA 2PX4A 2F9FA 4D26A 2ZI7A 2HWXA 4Z0NA 1C2YA 2F1IA 2Y99A 1JSLA 4YA6A 4L6AA 5DCYA 3SFZA 5C3MA 1YMQA 2C5HA 1TUBB 5HJEA 1YIOA 2ZAGA 2HU7A 2I6XA 1C9NA 4L57A 4MS4B 1JIIA 4P82A 4M9XA 4UD6A 2F4VB 4YI3A 1PJAA 5CDFE 3DF7A 2HK6A 4JH0A 4C03A 2GF2A 3EIOA 1ILEA 2ZE6A 3RS0A 1BHSA 4EKGA 1G8KA 4OB7A 4PR0A 3FBWA 4WZBA 4NENB 1QRRA 3GLIA 1YA4A 3KOYA 5IK2D 1Y1TA 3EH2A 2EFHB 2PIDA 5ALHA 3BGOS 1D2HA 2G1KA 4B35A 1YB6A 4B6PA 5KVVA 1E6WA 1YQEA 4OJTA 1OYVA 4CF5A 5F7JA 2P6PA 1ONBA 2CHFA 2PD3A 2RGUA 1MJHA 2BE9A 3VU1A 1W1WA 4G8BA 2F2TA 2RH5A 1AKQA 4L4YA 1KQ3A 1O89A 1W73A 2A94A 4PSAA 5EJ2A 2DBZA 2G6TA 4MICA 5GONA 1XDSA 2BGGA 4QDUA 4BY9E 3EPLA 1II8A 1FS6A 4B3BA 1LDEA 1OI4A 4QODA 3VU9B 1IOZA 5DNWA 4WT7A 3UC5A 4DWOA 2YHBA 2JCGA 1K66A 4KIWA 4IM7A 1GAXA 3P0JA 1QTNA 4I1RA 2RAUA 3NH6A 4FUQA 4LOLA 1SIOA 4U2DA 3N6XA 3KYIB 2V8OA 4CMJA 1LFDB 2X0DA 1T6YA 3DT6A 4RULA 1BQ4A 4FFOA 4RCZA 4G4GA 1OWPA 1YR8A 3ZWCA 2ISCA 3KLBA 4M0UA 4MS3B 4TUYA 1Z7GA 5G0WA 2YXNA 3U7IA 3WQQA 1G6OA 3ZG6A 4CKWA 1VP9A 1ZCJA 2ATVA 3EVEA 3OMWA 5GM2A 3T7AA 1XD9A 1G8PA 2H1CA 1EWRA 2D4AA 2Z58A 4NJOA 1WETA 3AEZA 3NFRA 4ZOQI 4H6WA 4BO2A 1V11A 3BWDD 1VG8A 5SYNA 2W4MA 3C1TA 2QI9C 5F9HA 1OSNA 1ORRA 2BI7A 3RSFA 5C5DA 1ZGBA 4PRYA 2XSZD 3GFBA 4A0HA 3L0BA 4HYQA 5C31A 4IDBA 2R48A 5JAMA 3G1TA 2ZCUA 3OH8A 5JCZA 1DEXA 1UWCA 5HFJA 2WNHA 1AKVA 2IITA 4G5FA 1UJNA 2V45A 1I80A 4HXYA 2IOFA 4FWBA 3P0HA 3W9UA 2H85A 4B81A 2D6FA 4TXNA 5CFQA 2SKDA 1HSOA 1F6BA 3EZLA 4HB3A 1DKNA 5FWAA 2WHQA 3FN4A 2WHXA 3NHSA 3Q9LA 4EYGA 4EI8A 5ICSA 4CCYA 5IF3A 3TTSA 4K6HA 3HKEB 2JI6A 3CRQA 4GOJA 1O9GA 4MEAA 4Q4AB 2E5LB 3L0ZA 4N8EA 1NF9A 3HWWA 4FPXA 4GM4A 4TL7A 2GFIA 3HH8A 4CM7A 3GYBA 4AJHA 3IIIA 1FL9A 1SXGA 1T2CA 3NJ8A 4IWYA 4C5CA 3NU1A 3VNRA 3PVZA 4U3JA 4WCFC 4BNHA 4UBKA 1XNHA 2Q4TA 2NYRA 3F8TA 1JKJA 1QG2A 2BGNA 3CBQA 4P93A 3Q85A 2PPLA 3HCNA 1V9SA 2CXPA 1RTKA 2FUCA 3M6AA 2P77A 5JAUA 2V59A 3DE6X 2VA9A 4XB2A 2O59A 2HCTA 1DVRA 1M9NA 2AC2A 5A06A 5HIKA 1WSBA 3GOHA 4BXOB 4XJTA 2VBIA 4JLOA 3CF4G 2CFSA 16PKA 4GLJA 4BBAA 4CVNA 4G1CA 5E7QA 4PLCA 5K8TA 1OH5A 3QEMA 2W6ID 3PQ8A 4YASA 1K8YB 3OE4A 1OU4A 4UAGA 3T0FA 2JGNA 5L3RA 4DQKA 4U9UA 4U39A 3H9CA 1YRWA 3T9FA 1ZA2A 1K3FA 3HNOA 2FRVA 3T7SA 3MIIA 1WEHA 3AHGA 1E6KA 5H3LA 2J3QA 3W4KA 3C3MA 1GZSA 2M6RA 1YQQA 4CM9D 2P78A 3SDBA 2NNWB 4B4OA 1RNLA 2Z5LA 2RIRA 3KWMA 4TPKA 4RDIA 4PAOA 2G1UA 5CH8A 3QPBA 3DHVA 4GG1A 3WWOA 1U98A 4M8NE 1OUMA 4HVLA 2GERA 1V7CA 1HFJA 4MDYA 2ID7A 3U13A 2FPMA 3K09A 3UMRA 1RFLA 1K08A 3KJNA 3PYXA 4PYMA 4H2DA 2YCLA 1M67A 3QELB 2CHGA 2AOVA 1FRNA 3ACDA 4UVHA 5F23A 1M2VB 1WJGA 1IVSA 5CPFA 2ZYHA 3FGPA 2I6GA 2QJFA 1JG1A 3BGWA 4HH4A 1U7PA 1XLTC 3MT9A 3EOZA 4QVGA 4WOCA 3WBJA 3R5SA 1FS5A 1P7VA 1U2DC 3BYZA 3L7MA 4ATNA 2PS1A 1AZLA 2NOAA 1NTOA 3G02A 1JEYA 2B1GA 2JEOA 1Z82A 1U02A 2OILA 3DLPX 4AS1A 4NR0A 3GJ4A 1D2AA 1T0HB 2CE7A 2W00A 4N65A 3RVRA 3X2FA 4DNQA 4B6SA 3LFUA 3CX4A 4O4JF 1UAYA 1QIKA 3GPCA 1H94A 1YQGA 3HEBA 1NVGA 1UC4B 5AVXA 3HDJA 1UZUA 3P5BA 3PQDA 2ZDQA 3RB8A 1U7DA 1SXJB 1XTUA 2OG1A 3IOMA 2GJKA 3O6VA 1NW3A 4LXTA 4NNOA 4EYSA 4EM6A 3TSZA 1MB2A 4JX8A 4Q0MA 4F60A 1CZNA 3A6JA 3I9FA 1C1DB 4TKVA 2CSUA 1Q0PA 1UOPA 1X39A 2YWEA 4QJ3A 2XI4A 3W2FA 2Q8NA 1U3DA 2FFJA 3KJQA 3QYJA 3R0VA 4K0RA 3VYRB 5GV7A 4U00A 1PJRA 4BP1A 1AHPA 2B0JA 3FPFA 5BQPA 3EBOA 4CTKA 5FPKA 2VDPB 3WYGA 1ZH4A 3WGKA 4Q9LA 1CQXA 5IPFA 1W5BA 2LRHA 4O1IA 2RGEA 1LPSA 5KTMA 4CM4A 3A1FA 5TR9A 3ZTTA 4WOJA 2C83A 3FIJA 3QUQA 4NFLA 1PS8A 1NI4A 1Z74A 1SOMA 2FPUA 3IXLA 3L6EA 3IVXA 3TI9A 4M76B 1FMJA 4MYDA 3TOSA 3V33A 13PKA 1PR4A 3CF0A 5T4HA 1NDUA 2PWPA 3VNAA 3WLTA 5CDUA 2HB6A 1YRBA 4G1VA 4WQMA 4YBZA 1Z0KA 4BX0A 3FUVA 3BD7A 4KPGA 2Q41A 4J4TA 4Y9TA 3VGPA 1MZVA 2G9ZA 2RHWA 1ZUHA 4HN4B 5EHGA 1AA9A 1FRFS 3H2KA 2Z6UA 1MDFA 1Q50A 4JUBA 4L0QA 3EXIB 1AKUA 2P67A 3H8VA 2AOTB 5FULA 5KAMA 2ZIUB 3KRTA 4RH1A 5B6JA 4R1OA 2IHZA 2XTNA 2QTGA 2RHCA 1O54A 4DCTA 3LTNC 1DHRA 4MIYA 5KNDA 3L8EA 4N1AA 2CUNA 3BILA 3M2PA 1R0WA 1I0ZA 1KO7A 1L7NA 2ZT8A 3FYUC 3FGOA 1E3MA 5FPHA 4AQDA 3BWBA 1RI5A 2EG5A 1KI4A 1R74A 1FFYA 1GFSA 3GUCA 1EM8A 4REOA 2ID8A 1U2ZA 4XIJA 1CR4A 1LTHR 1FDUA 2BBSA 1VJDA 4LBYA 4LNUB 1Y9DA 4YV0A 4FI3C 1CP3A 4K7JA 4UC0A 2GHTA 3KHUA 4PGMA 3SC2B 2HBZA 2Q1XA 2CF5A 4YO8A 4B83A 4DIOA 4D4KA 5FAXA 2O19A 1W6RA 2WJAA 1KH3A 2PGOA 3LQQA 3OEHD 4TLDA 5HUHA 1G9TA 1K7CA 1IRXA 4YJ2F 3BPSA 1NY6A 6CHYA 2C0CA 1KEVA 1IQUA 1EK2A 3H1AA 1BHO1 2B25A 2V4ZA 1O0SA 3V4FA 1L7OA 1PYOA 3UO8B 5FBKA 3W3ZB 2QVGA 4EPYA 4J90A 5KYVA 2JI7A 1MMFB 3PNPA 5AH0A 4R2XA 4ZYUA 3CCFA 1NOIA 3TJRA 5IXYA 4DLXA 1PTJA 4WBXC 2Q2OA 2XE8A 4DRXB 5BYKA 5GZ3A 2C3YA 4DB2A 7GPBA 4FX5A 3LYAA 2AHRA 3E48A 1YS1X 1FBTA 1W4BA 3REFA 2WVJA 2E4VA 3A70A 3O4VA 1M5TA 3KYDB 1VI2A 3PPYA 4NK5A 1FDSA 4P81A 4B2IA 4BN4A 1O5TA 3EVFA 3TEFA 1SEPA 4L7QA 3N2YA 2O8EB 4HQ6A 4QOIA 3ABOB 4E7PA 1MO4A 4X97A 4UNQA 4ESOA 3B1FA 3PXXA 1AQNA 4KAXA 2BFCB 4KQ2A 5K3DA 4B5LA 4A27A 4YJGB 5DTQA 2WK1A 3JAMA 2R7KA 4N3AA 1XTRA 3PIDA 1Q44A 4E4RA 2XVZA 2FZ5A 1TJ4A 3H1GA 5IYZF 2QD5A 3UEOA 8AT1A 1Q17A 1BMTA 1RKBA 4H0FA 3HGQA 1A5SB 4RMNA 3BIOA 5ADUS 4TL6A 4IINA 3DT9A 2Q6IA 1CF9A 2HU5A 2COUA 4AFNA 3FOFC 4DUYB 1RS0A 3TFOA 5IT0A 3RNLA 1VDZA 4HLUC 1DBVO 1O57A 4NAHA 3BJZA 1YTLA 3SYNA 4AS2A 3AQ4A 4ICIA 4HYEA 3TSOA 3HABA 1MR3F 2PUEA 3N1UA 1G21B 1TECE 5AHKA 2PZEA 4MO2A 5JASA 3SFTA 2JW5A 1VE9A 3NP9A 3TXAA 4BXOA 1GDHA 1MXHA 2CEKA 4UTOA 3SVLA 4HNRA 1KYZA 1GT6A 2JH8A 2QN7A 4GWKA 4WCVA 1PW5A 1DDIA 2OM2A 2X14A 3BFKA 1CCWA 4DSTA 2GAJA 3QEKA 5J2TB 2YVQA 2FB9A 1X7HA 3UPDA 1QO7A 1B26A 4QECA 3EDOA 1JF8A 5FOQA 3KKLA 4LK3A 2PKYX 1KIFA 1DNPA 5KYUA 2BRUA 2PO5A 3EZ2A 4R81A 4RKFA 3KQOA 1XKQA 2C2ZA 1RKQA 1I51A 3IPCA 3AU9A 3JVDA 4MQ6A 2OCPA 3EIUA 1XWIA 2PEZA 1ESZA 1KO1A 4JYPA 2JNWA 1RHMA 4I81A 2J46A 3F7TA 3DXFA 1EX7A 2CXRA 5DI3B 5BOVA 2HRBA 3NBMA 4Z1MD 2OGSA 4GOMD 1KI2A 2C97A 3TOXA 4KACA 3QELA 4OF4A 1DG1G 1XEWX 2I8LA 2RHDA 2ZR8A 3HBFA 2R85A 5JNVA 5HOQA 3DLHA 4PC6A 5F1PA 3NDJA 4ALJA 1OFGA 1ARZA 1E4VA 2JJ2A 4K1LA 2A5JA 4LNHA 5H70A 1YDEA 3LBFA 2AG1A 3QG5A 4BDTA 3LKZA 1KARA 1GCAA 4IJVA 1L4HA 1B2LA 4KVZA 4BQQA 4JI6B 3EGDB 1AHIA 4HN2A 1D1SA 3H7IA 3MPOA 1XEFA 3GRRA 1K8QA 4W63A 1KDTA 3GA5A 1QVZA 2VYCA 3T5CA 4WV3A 5IABA 2C88A 3KXLA 2KW5A 1SPBS 1J8FA 2HRRA 3L82B 1XDUA 1A2BA 4L74A 3HZHA 2WU0A 4HN9A 4YVFA 2DLCX 3A1WA 1RBQA 3EXFA 4K46A 5MDHA 4IZ6A 3HJAA 1G4UR 4L72A 4WBNB 2BI8A 4NH0A 2QGNA 1WXHA 1X7WB 3C3EA 2IS2A 2ZSEA 4FFBA 4GSLA 3P4XA 2WFMA 4JQZA 4YIKA 3O47A 5JXIA 1CB0A 2XADA 1XZ8A 2YHSA 1O77A 3H5VA 3WIBA 3WLIA 4RNDB 5IKPA 1RYEA 4QYIA 1PFWA 1YAJA 3LSTA 1NBOA 3SD7A 3W4JA 1T5IA 1NR1A 5JYEA 4IYRA 3SDSA 2F8LA 2CXHA 1YXMA 3LY5A 3H1FA 2BVNA 3U6KA 4KMRA 4JUCA 1CUAA 1XNJA 4Y6PA 5LXTB 7AT1A 2P9QA 4BJ3A 3AWIA 1VXOA 4FR0A 1I5OA 1H2FA 2QUZA 4P4GA 4RU1A 3H1TA 3DP9A 5IT5A 2HSJA 3TQHA 2BUBA 2MWMA 2XUHA 4MUMA 4GP7A 3EXIA 4R05A 5K3FA 5CVDA 1WF3A 1LSUA 1RABA 4Z8YA 4YCMA 2JA2A 1FRVA 4XFJA 4BFLA 3M1AA 1ORDA 3AYXB 1Y48E 4QGAA 1KBOA 5D51S 4F7WA 1YBVA 4CKCB 3ER6A 1WE2A 2FPOA 3O82A 3ZK7A 2AHOA 2EIXA 2Z5VA 3IT1A 1HI9A 2QMZA 3QOXA 1WUYA 5ERGB 4M1KA 5K8JB 5KNCH 4BOYA 4U7TB 1CE8A 2LW7A 4K9SA 1QVWA 2UZ3A 3GPIA 2B83A 3GH3A 3K0EA 5J1SB 3EWIA 4XPZA 3WGHA 5FADA 1GL3A 1XV5A 5CGQB 3SXJA 4IJMA 4Z1OA 3VVCA 1XRRA 4MAAA 4PYNA 3RHSA 3E0QA 4WNIA 2VYVD 1DC3A 4ZHQA 3B52X 5DK4A 3AUAA 1HLDA 2CW5A 1NP3A 3BB4A 2NU7A 3LPAA 3I0ZA 3PNQA 2IYFA 1JQJC 4JEUA 3SYMA 4BVJA 1P6XA 3FHJA 1IOVA 3JRWA 4MP6A 2IEZA 1OCEA 3G2PA 2C8LA 4EJFA 1O58A 1AGPA 1RLOA 3GUZA 2VP5A 1T2FA 3NVDA 2JLUA 2BJWA 1ZVVA 3VR2A 2QE6A 1J0AA 4KLNA 4WZAB 5AVVA 1I4EB 4CI0B 3RU7A 4DEXA 3R5JA 2RJOA 4HUJA 4YEDA 4F4UA 2FFAA 4YUWA 4QQKA 5FORA 2BISA 3RANA 5I9LA 1RR6A 2ZYVX 4KXLA 1HYBA 3WLHA 2I4TA 2W0MA 3H5AA 2BYTA 3E9RA 1DKUA 1XMVA 3PGMA 3GRVA 3KYDA 1YB1A 3EDRA 2XMPA 4DRZA 3DNFA 1IBCA 3L0SA 3G5AA 4QLAA 1A96A 2EGGA 3KOXA 1U8FO 2IHVA 2YDXA 4JL5A 4DHEA 2ZB2A 1Y33E 4WN9B 1MB4A 5AJHA 4TZ0A 1YD7A 2JK1A 4ND6A 3EXHB 3HDGA 1WLSA 3KSMA 4WLUA 3AR9A 4JSYA 3C74A 3LQFA 4E14A 4FHGA 2OA0A 1M66A 3T3IA 4B2YA 2ZE5A 3C3CA 3OFVA 1YNOA 2NPOA 1RAIA 3A32A 3IP1A 5DZSA 5ESWA 3L7DA 4R9RA 3NBFA 2JGAA 1OU0A 2R44A 3GLKA 3LVBA 3U81A 4A7PA 3KSAC 3JRXA 4IWNA 1OB2A 2WHPB 1EM6A 2WSSD 3RU9A 2I65A 1VLVA 1P2SA 3N2LA 1KY5A 2ZRPA 3N75A 4IEFB 3L0CA 4ILEA 2ODTX 2A84A 2XXJA 3TLKA 3WSTA 1JAZA 4IUYA 2FMTA 4BO4A 2XA9A 3VI4B 5KWVA 1ECJA 2OE2A 3T7DA 3DBHB 5KKNB 1YRAA 3TR5A 4QUEA 4OXKA 4K05A 3EIXA 5HZHA 4EQ6A 2UYGA 2WTAA 4EKEA 1UCFA 2OV2A 3K30A 4IO0A 1BX1A 2PHZA 2IYRA 1U1GA 3EUAA 2R6DA 1UDCA 3ES9A 5L3SB 4LCJA 2RHTA 2DPMA 2WJGA 2X0EA 4YB8A 5CNIA 4DANA 3B20A 4D9KA 1I01A 1MCZA 1D3AA 5BNFA 4E1BA 3Q3GE 2XQKA 2B34A 4EG0A 1P2DA 1N5OX 2CNBA 2QZSA 4BKPA 3GRPA 1QUEA 3DM5A 4OGLA 4D92A 5CIYA 2Q5CA 1ZRMA 4YH1A 3I92A 1C9EA 2W2OA 3PNLA 4Z4FA 5K03A 3AL2A 3R1IA 3MQ4A 1D5CA 1T9BA 1Y89A 1GSIA 1PW7A 1RPAA 2JGJA 2Y1CA 5FR2A 3RTAA 3EHEA 1Q0TA 1H8EA 2PZFA 3CZCA 1WDWB 4OYYA 2GDZA 4I50F 3RFFA 1ZSNA 3WZLA 4A6DA 2PFGA 4DBLE 3CLTD 3RW9A 4F6RB 2F1RA 1JB1A 4US0R 3VSDA 4CKBA 2XD4A 3HY4A 4H3HB 5L40A 3V4RA 3EARA 2CVFA 3NNDA 1Y1QA 2XYVA 4YQYA 4TVBA 1U2SA 1H8HA 1ODCA 3ZU2A 1P1FA 1NW8A 2FGJA 3CC8A 4HATA 4FMDB 1RXIA 5EG5A 2OGWA 3AM5A 2OHJA 2QPOA 1KSHA 3EGDA 2B99A 3C3YA 3B36A 1E77A 5DGTA 2X40A 2C7VA 1RQGA 2HQRA 2B4QA 2OVBA 2OEPA 4KGXA 5BN4A 3SE7A 1V4VA 3H13A 2IHBA 3KIPA 3OTWA 3ZVLA 4Z6KA 3O2SB 4EAAA 3THYA 3A1TA 1CX9B 1H6AA 2ZQYA 3K0AA 3U9TA 2C61A 3V1LA 1TW2A 2IQ5A 2JIPA 3BDAA 1ZJWA 1ENOA 1WZIA 1M2EA 3CKKA 3I83A 4DV5B 2C1ZA 3A0RB 4DWWA 4DLRA 2N3ZA 2YIMA 2A58A 2Q7OE 4KLZA 2P62A 3DNMA 3C39A 1DG3A 3M3DA 5AKGA 4N5NA 1CFZA 3DKIA 3SBEA 2O5EA 2HK7A 4QIHA 4NOKA 3ASUA 4QGHA 3FW1A 3EGCA 3VPAA 1Q1BA 2AKAB 4BNJA 1T6XA 3EN0A 4PAGA 4LZLA 3H83A 3ZHOA 1GRCA 3LS2A 4GX1A 2ZPTX 3LK6A 3WRYC 1TXGA 2YWXA 4RJTA 1ZIXA 4P5PA 5ALOA 1JBQA 4OHKA 1F8XA 4UNRA 4KSYA 3USZA 2ID9A 4BATA 3VGJA 5LXTA 1HMPA 4DIMA 3RTBA 2FLVA 1N0UA 3ND7A 4XYMA 3FSEA 4N3BA 3RRNA 2AEFA 3UGKA 4MW6A 2GZ3A 2O8DB 1QNLA 4RV9A 3DYIA 3M33A 3TE6A 3UAYA 4HR7A 3JQBA 2Q2QA 4IUDS 3OWOA 4B6RA 2RE8A 4YCAA 2ZBPA 1W49A 4BO0A 2QVBA 1RP1A 4KJXA 2G0NA 3ABSB 4QASA 4A2QA 4II3A 4EP1A 4BQOA 4HSGA 2C4MA 3HBMA 4TWAA 5BOSB 5KNBD 4R98A 3CX6A 5ABPA 5L4SA 4M8LA 4UW9A 1K6IA 3D81A 2WRZA 3BD6A 1SAYA 3B53X 3BWCA 4WCFA 2XMZA 3QNWA 5TT1A 5C9ZA 5FAKA 3VOAA 4LDQA 5F7XA 1BDIA 4G4JA 1UDAA 1E6CA 4XVCA 1N36B 4UKDA 3ZBQA 2DT5A 4I1SA 2F8TA 3OLWA 2W6ZA 1WMSA 1ZOIA 1VKNA 2CDCA 3DFUA 5EEHA 4K88A 3BGSA 3K9QO 3QLJA 3U40A 3AT1A 5L3QA 4QTYA 1G38A 1SD2A 2PX6A 4MWCA 3L1IA 3N0XA 4FNAA 4RD4A 1U8TA 4KC0A 1NRIA 2CMKA 2AN4A 5FTNA 2W98A 4BLQA 1CY2A 5TVGA 4UREA 2PL5A 4WZAA 3ENQA 2BZGA 1MRNA 1O94C 2DR0A 4WE3A 4JQCA 4WESA 1L4BA 3IPAA 4G1EB 4IG4A 4EJ6A 2HDWA 2BUAA 2QRVB 3OQIB 1N5DA 3ACCA 5CYFA 4R1TA 5TY0A 5L8VA 1ZONA 1W6UA 5EJ9A 1G42A 2GSDA 3I37X 4FLFA 2IJGX 3O83A 1LJUA 3UMSA 2ZBQA 4Y9UA 2G83A 121PA 1KR5A 1IJFA 3UV7A 4HGZA 1C4KA 1NBMA 1TTHA 1F4LA 2NGRA 1DQYA 4I55A 5JVDB 4D45A 5B6IA 5T41A 1X7YA 3HS3A 3EG9B 1RWNA 2QX6A 1P9OA 4RK7A 5DOVA 1ZM2A 4NG4A 1U0RA 1XLTA 2VHCA 1AKRA 3FY4A 2D1TA 4L4XA 1WA5A 4RIHA 3NALA 5EJEA 5JMOA 1EJ2A 2QSUA 3WGIA 3F5SA 2ZP1A 3PCRB 3WIOA 4EY6A 4PG5A 1TYBE 1XA3A 2JD1A 5CA1A 3TDNA 1WOYA 1QH9A 4V1CA 3ELYA 4AT1A 3VPXA 2XKJE 3C0KA 4GPTA 4CCWA 2VBGA 4M7WA 4OM7A 4Z9XA 4YP5A 1N33B 4Y6QA 4L0DA 1QO0A 4AMUA 4E4YA 2P41A 5FCDA 2IH5A 1CUEA 1T15A 3M6WA 4HC4A 2AK3A 2I6SA 3D3WB 2V9ZA 2X9NA 4IR7A 4TV9F 1HH4A 4GX0A 4ZVMA 3WJ1A 1TNDA 1Z4OA 5DGHA 2R1TA 5LYJB 5JAZA 1M6VA 3V8EA 2X19A 2HF9A 1QKKA 2A8YA 4IG9A 4K6MA 2EGUA 2ODQA 3UQYS 4CBVA 1VBMA 4BFSA 1G9XA 4QFDA 3JX9A 3G7UA 2H07A 4NEQA 3AEUB 1R12A 2JVIA 5JZ9A 3VH3A 5KTNA 1Q16A 2PRKA 1L7XA 4EATA 1SRQA 3DEZA 1L8LA 1ST3A 1OKKD 5J47A 3N3AC 2PMBA 3MTJA 4KLRA 1VG9B 1A1VA 3M1YA 3P2OA 1Z0UA 2XNDA 3N8HA 4GPAA 2DPHA 2F3QA 1ZGGA 2Q6LA 3IBGA 4EW1A 2X9QA 3M5DA 3QP9A 1EWYA 1PF7E 3GRCA 3HA7A 3PK0A 3D2AA 3GJ6A 4HNGA 4X7BA 1ZX1A 1OX4B 4DNOA 4D9IA 3ZJ4A 2E4UA 4HB2A 2ILTA 1HNZB 4GKJB 4QJ5A 1CJMA 2QZZA 2H3HA 3WYBA 2WWTA 4GE3A 4UMVA 1V2GA 4DV4B 1GR1A 5BNWA 1JR3E 5HIIA 3SF8B 1P1RA 1SVWA 3V2IA 1S2MA 2CMHA 4ZI7F 2H4XA 5CDTA 1BN6A 3P27A 4IXMA 1WMDA 1RYMA 4M37A 2FEXA 1OLOA 9MHTA 4ZJYA 2IW1A 4YGYA 1TDJA 3EVCA 4F96A 3OEED 1U2EA 3PXEA 2CFRA 2OOSA 3V55A 4B85A 2O6LA 3BN3A 4URYR 5TX7A 1FFEA 1PQYA 4UHJA 4IXTA 3IO5A 3FYUA 1U1EA 1XTVA 4LMPA 2ACVA 2UVPB 4MB2A 4KR7A 3AF2A 4IIVA 2PWYA 3UWKA 4E33A 4TLLB 4O2AB 5F2OA 4JC4A 3TX6A 1S8NA 2GX6A 3HCFA 4D4LA 4F1WA 2C7RA 4B3GA 1M1XB 3NBYC 1NWCA 2P68A 1P1CA 4GWLA 4NPAA 3KZMA 1E89A 2NN3C 5AJVB 4MUAA 4V0LA 2IS6A 2P2ZA 3U3MA 4JJEA 3CUEF 4U6SA 3IAS6 3IV6A 1MTOA 4DYHA 4BKOA 1D0IA 4EG5A 1U63A 3T7IA 1JTEA 4YR7A 4EDHA 5AM3A 1S5PA 4FYWA 4F5WA 5T64A 3Q6NA 3OJXA 1IM5A 1X1BA 1XTBA 1LWNA 3AUSA 3MTEA 5I3ZA 2G3YA 3CURA 1ATZA 5E8RA 2PS9A 1T1JA 3NV7A 2H1RA 3FR8A 3MBKA 2FAXA 2XMRA 1O6GA 5ED0A 4YV2A 1AUOA 1TAHA 3Q2IA 4I8XA 3EX7C 1G1AA 4ECEA 2O8DA 4AJ4A 4YRNA 4AYWA 5K4HA 3OOEA 4RHYA 1EZ1A 4I6EA 1RYHA 5HQ3A 3K0SA 3AVVA 5CW1A 4TXHA 3AL3A 2EOAA 4X92A 2D0PB 4KNVA 4LTNA 3F3KA 5CLLA 5AR1A 5FLYA 1E1RA 4DEYA 1BHQ1 1DT5A 1NJ5A 3GY0A 2DBRA 3T9BA 4D3ZA 1NVMB 1N3BA 2O2IA 1KOFA 3B8EA 1I5EA 4XX1A 3QBTA 3DAYA 5LNK1 5THQA 2YHIA 4QUAA 5IDWA 3CLRC 1OFUA 2P7IA 2WF7A 3DFMA 1QBKC 4JZKA 3HXLA 2G72A 5KOYA 2B82A 3BMOB 3TQFA 2BBOA 1FRQA 4WUTA 3CE9A 3U3KA 1SH7A 4INJA 5HCNA 2O1SA 3ZHBA 3JQFC 4HX9A 4BNDB 2C7BA 4PCVA 1PG2A 1V3QE 2Y76A 3FOAA 3GRAA 4H7EA 3KZVA 5EHIA 3AW9A 2HUPA 3SIRA 1M34A 3OU2A 4LK2A 1EVQA 5THXA 4A23A 3C3JA 4A26A 1WUJS 5IXSA 3R8XA 1CEYA 3R5FA 3ZDQA 1W34A 1Z73A 5AK5A 1XQXA 3G2MA 1YV9A 3AF4A 3MGBA 5F52A 1L5YA 5T6BA 2R5FA 4HT3B 5B6PA 3VX3A 2BTOA 4XEHA 4NCAA 3BMXA 1EP2B 3WKEA 4RF2A 3OC0A 2IPMA 4DLTA 4LBZA 5GOZA 2H0RA 1SOWA 2XQGA 4XSVA 3QEAZ 1R10A 3HSYA 2JJMA 4H0NA 1XQ1A 4KP7A 3ETDA 3WLLA 3ZCXA 4DIFA 3VHRA 4F4HA 2O14A 2QRVA 1RHJA 3HV2A 5TJ9A 1GM5A 3LRTA 4QARA 4C4YA 1C29B 2Z2YA 3KJXA 3ZHSA 5REQA 3ZUGA 2Q6OA 5SY4A 4K86A 1JG4A 3E0XA 3L7LA 2WJPA 3D43A 4N5HX 1TF2A 4OXXA 5JVDA 1JDUA 3HB9A 4BX9A 5KCZA 5CCBA 4EJSC 4K6FA 4IIJF 1JU4A 2XJ9A 1L1FA 2O5RA 1PX2A 1H69A 3CUUA 3EG9A 1Z62A 2BD0A 3L93A 4L7VA 5IKEA 5KX5F 3O0TA 1QTQA 1H05A 3PA8A 3SVZA 1Z0JA 1QAOA 3ELDA 2XKBA 1IVYA 3G0OA 2WWFA 2VJAA 1XEWY 3P9NA 5IM5A 5ITVA 3FCXA 5DV9A 1SQ0A 4D4HA 2OQIA 2ILVA 4B82A 5IRCD 4AG5A 4RJIA 2F3RA 1PQPA 1PHRA 3OY7A 4YJFA 2EQBA 3DL4A 3VJLA 4DC9A 4EI2A 1RIFA 3L8CA 1CWUA 2GTIA 3BB3A 5ERXA 1XRQA 4NE2A 4WH0A 1B14A 1MVNA 3BMQB 4RV4A 3EPKA 3BWEA 1AKTA 1DS6A 3PNOA 2PMKA 1HG0A 3FE2A 4KE9A 4BE4A 1PZEA 5I4CA 2UYQA 3NUZA 5B53A 2BCJQ 3C7AA 3Q41A 1T3ZA 5AOCA 4HVAA 2LR0A 4A4DA 1ZD8A 1T0JB 3SHTA 4TV8F 4JD5A 3C7KA 4DLSA 3R6GA 4C14A 2GLXA 2PT5A 3GDFA 3JD0A 3IR7A 2XZOA 1C7FA 1TC2A 2FMXA 5IP5A 5CFNA 2CVZA 1B43A 1CEQA 3K3PA 4G81A 4I4TB 4BO3A 1E4EB 1K5PA 4DG5A 2X6TA 1GAWA 2NZWA 2VZ0A 5JD3A 5AKHA 3EF3A 3QQPA 1KYTA 5C37A 2XSZA 1WZNA 1QK3A 4PG7A 4L6IA 4AMYA 3RV4A 2H5EA 1R0XA 4OQFA 3D1LA 1MO5A 2XCOA 3JWJA 2POCA 4JSRA 3UHOA 1EUCA 3DOHA 3FWKA 3WNZA 1OX4A 2VSXA 2IIPA 3E35A 3LH5A 4UNPA 5CM2Z 4YHBA 3L5OA 3S6JA 3PVSA 3OIGA 5JFTA 3WC4A 2BTQB 4JJ4A 5FLKA 4XWGA 2C8VA 2H6EA 5FD8A 4QC2A 1A77A 2ZT6A 1YULA 2PRIA 2YV4A 1REQB 1YZTA 3X1JA 2B7LA 3C70A 1C8KA 2V7EA 3AKYA 1GSHA 3TCNA 1OVGA 3VHXB 5KJCA 1TE2A 3ZY2A 3K8OE 3U31A 1E2PA 3OZCA 3CA8A 4G1MB 4OBBA 2EJWA 5HE8A 4I8IA 1ZD1A 2ZRMA 1HXHA 3OM1A 3EYWA 1IUNA 1YZVA 2FZEA 4F5DA 3MSCA 3KB2A 3OE7D 2WY2D 3V8VA 4CIWA 3I53A 2Q2NA 4RY8A 4ZODA 4O2AA 5EMKA 4J43A 2Q3LA 1FJ2A 2I03A 3GIDA 2WTNA 5FUYA 2VUIB 2HQ1A 3UMBA 2YHAA 3ZI4A 1Q92A 3AJDA 1OOEA 4XOUA 1F38A 3VR5D 2WVGA 4FQ8A 4YMWA 1TEZA 3AFIA 2DPXA 2W6IA 2D3TA 3FMIA 1W4ZA 3DB2A 3ABZA 3P2JA 1G8SA 2HSGA 4U2EA 3WK6A 2WU3A 4ZI3A 3OOSA 4D9NA 2B94A 1WZCA 1RAGA 2GBPA 2YWBA 2IOYA 2B92A 2I78A 3HB7A 4WLOA 4D9GA 5H4GA 4JYAB 3UWOA 1GR0A 1MG0A 3CWCA 1UT8A 4MVXA 5AKEA 1LSSA 1Z47A 3RG8A 2B4KA 2VI5A 1J00A 3OU6A 3M6XA 3HGMA 3K1TA 2WSLA 1C9KA 4ZV4A 1OWLA 3TL3A 4I1VA 1KDZA 4GM0A 4MR9A 1WY5A 1YS4A 1F51E 5DRTA 5CIWA 1XNRB 3E7PA 4MVJA 1DWUA 1ZOOA 3FMFA 5H7XA 2XCRB 2D1RA 1W88B 5TMBA