1ZRHA

Crystal structure of human heparan sulfate glucosamine 3-o-sulfotransferase 1 in complex with pap
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
VAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
publication title Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
rcsb
source organism Homo sapiens
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zrhA00
3C7KA 4JLNA 4KSBA 1RFLA 2ORVA 4PO1A 3RLFA 5IHPA 3K1JA 5CYOA 1CEEA 4S35A 5EE9A 1KMHB 2CL0X 2GJKA 4EPXA 4DBLC 1XMIA 3BOSA 3U4QA 2GJ9A 1N6IA 3NHBA 1N5IA 4ZCMA 4YMUA 5SZIA 3BXZA 1E2DA 1OHHD 1W48A 1QHHA 5J47A 3K70C 3NXSA 4JLOA 5GVRA 3WY9A 1RC8A 1JB1A 1FX0A 1NKTA 4V0LA 4A2PA 1XMSA 1RJ9A 4BPBA 4YC7A 3VU9A 2BVNA 4C0JA 1L7VC 4M9SA 5LB4A 5FH9A 2W6IA 5KSPA 3C15C 4QBIA 2HT1A 1SXJB 4TQ9A 2O8DA 2XAUA 3X1XA 3HDTA 1U9IC 4KLZA 4JL5A 2FGKA 2N42A 4BFWA 3T5GA 3O8BA 2WAXA 1HV8A 1W36C 1KK0A 2OFWA 4CEIA 4YDHB 4EIWA 2ZJBA 4YMVA 4M1KA 1VPLA 3LBHA 1M74A 5EZ6B 3Q8XB 5K8TA 1G8YA 1OXUA 3X1WA 1E9FA 4LJ7A 3W90A 5AJWA 4URVR 1C1YA 1P73A 3LDAA 4LY6A 2XNDA 1E96A 3Q5EA 4PX9A 1AK2A 1P7CA 1P9WA 3TH5A 3CF6R 2IC5A 4LRWA 1CLUA 4N0DA 2D74A 3WMFA 2V6JA 2BBWA 5JZVA 1JAHA 1VG9B 1T3LA 4PQFA 4RFVA 3TKLA 2GEDA 2JLYA 1XJCA 1LNZA 1WF3A 1NBMA 4Q4JA 3VHLB 1P9RA 4HAXA 1H65A 2GESA 4N1AA 3GLGE 3GLIE 4TYWA 1VKJA 2B92A 2AD1A 2WMOB 1NVUQ 4NP6A 1D2NA 2OBNA 3UK6A 1SQ5A 2BCGY 1MO4A 1R0YA 3ZGXA 4NYMQ 1KI7A 5JI3E 4QBGB 2LKCA 3R8CA 4A4DA 1N6KA 4O3MA 2FMXA 2VLIA 2ECKA 4A0HA 2IL1A 821PA 3D6TB 4I99A 3RWMB 3SC3A 4DCNA 1I4DD 1R4AA 3NEJA 1FP7A 4HB3A 3FMIA 1OJLA 2ZRMA 4PC3A 3TE6A 4H1UA 4NCJA 5F2EA 1VYTA 2YWEA 3X1ZA 2QPAA 4LJ5A 4BFSA 2XZLA 2ZREA 5D3MA 2V1XA 5ELXA 4ILEA 2LWIA 4ASUD 3LBIA 2JIZA 4JLAA 5FOUA 5DE3A 3SHWA 4KLNA 3G0HA 2OSBA 4US2R 3EW9A 3BFXA 2HUPA 3W5IA 3W34A 1G19A 3RABA 2A7QA 3SE0A 4MUBA 4B3BA 4GSYA 5KDOA 2R62A 1IN7A 4PHGA 1K5DA 4HAUA 2BJWA 2H1LA 3KUDA 1QDEA 2I1VB 1ELOA 1PUJA 2XB4A 2Z4SA 5AUNB 5EUMA 5DH9A 3QPWA 3ZD7A 2HJGA 3PUVA 1ZP6A 1VG8A 1QHNA 4DT1A 3HP1A 4F93B 4BZXA 3ZH9B 3B1WA 1XEXA 4BFVA 3ZVLA 1GKUB 3QF7A 3KJHA 5GVSA 1A82A 4BQSA 4DSNA 3RNLA 2OAQ1 1N25A 1HY3A 4UNNA 2XJ9A 2YNMA 1KJZA 1OLOA 3GJ7A 3C5HA 4KYUA 4B32A 1HQYE 3LH5A 4E5UA 4C7OA 1KK2A 3CWQA 3CX8A 4OYHA 4G5SA 5IK2A 2ZRJA 4XH9B 4Z8YA 4IFEA 2ZITA 1DS6A 1Z07A 3CX6A 3ZZ0A 2D2EA 1MABB 2F1JA 2J45A 2V8OA 1E0SA 3AGPA 5FBWB 3L8YA 3LW7A 5EP1A 5TVKA 3BK7A 1Z2AA 1AN0A 4GT1A 4OQXA 4M21A 1ZM9A 621PA 5EE5B 2O5VA 3WP0A 2W6JD 4IOLA 3R7WB 3T35A 3A1WA 1IAQA 1RKBA 5FOSA 2IXFA 3AKDA 1GM5A 3Q7QA 3CRQA 2OHFA 1KIMA 4AKHA 3CPHA 4L5BA 2QZ4A 1CR1A 2QSYA 4JZKA 2YZ2A 1ZU4A 3D31A 5G53C 1G20E 4E09A 3BIFA 3NVAA 3CR7A 1GZSA 4JBWA 4IFBA 4QL3A 1ZMXA 4PPFA 4CT4B 5J4VA 4O0MA 5FPSA 1GP2A 2CMKA 1CIPA 1SVWA 2QEQA 2RMKA 4XWAA 4B33A 3EZ7A 4BLOA 3OZXA 1KY3A 3B1XA 4ZDWA 1TU4A 4TTPA 4HATA 4IJMA 4LHXA 5FFMA 2J7PA 4AG5A 4U7DA 4F4JA 1US8A 4URXR 4KITB 3BE4A 1ZM7A 1NN0A 2X2FA 2ZIAA 1BS1A 2OAP1 2EFEB 1E2LA 1N6NA 5AJVB 5JEDA 4OBEA 1GRRA 1RRCA 2JA1A 3MAAC 4Q9HA 1W46A 1BMFD 1Z47A 3HPRA 4FMCF 1IONA 1TQ4A 5CDFA 5KTYA 5J4KA 2QE7A 4TLDA 4Q7MB 1LW7A 2QAJA 2IF2A 1N0WA 4YDSA 1S96A 3V4RA 3NBFA 5DISB 1MT0A 1E2MA 3WXMA 2PZGA 1EFRA 3P4XA 4HI0E 1UEIA 2ZJ2A 4KBFA 2ERYA 3BFKA 4L9WA 4OL0A 1G9XA 4M1SA 1QRAA 1OH6A 2WWGA 2OCBA 4LV5B 4C2UA 2DHRA 4NE2A 1M1YE 5EXSA 1TQ6A 3OHMA 2HXYA 1ZC4A 4K81B 5JWHA 4QOSA 3B82A 3WHKA 1T8UA 1I4TD 1U0JA 6Q21A 1NG9A 1VYVA 5EXXA 5J5CA 1U0HC 1KOFA 5SZHB 3GLIB 1FZQA 4TLAA 2QMUA 3S1AB 2QGZA 4KFSA 3CLVA 3HR7A 1F48A 1T5IA 2RGAA 4PPQA 2BMFA 2VSOA 3G82C 4V02A 5C1BA 5TXGA 3X1YA 2B7BA 2C78A 5JECA 4MRRA 5G41A 1Z6AA 1GAJA 4H1VA 1Q44A 1G16A 2VHCA 4GMXA 5IDVA 2CDNA 4S2EA 3FMPB 2BHRA 5KPJA 3B5JA 2ZR0A 2ZSDA 3AVQA 1C4OA 4M22A 1KKLA 1E2HA 1GRQA 3M1IA 1OYWA 5CM8B 1NP6A 1MRNA 1P2VA 1HTWA 5EE0A 5C4MA 3LWNA 2DPXA 1UEJA 4G5OA 1XEFA 5A4JA 4GP6A 2GF0A 3CKLA 1TQ2A 1U81A 5KO2A 2J59A 2JJ1A 1G7SA 1FMJA 5DI9A 2FNAA 4F38A 1E79D 1X8KA 3LQQA 1S3GA 2QUZA 3QG5A 3E1SA 4PQYA 2O8FB 5FPTA 2G83A 3CRMA 2C2HA 3B1ZA 3UMFA 2J0VA 5FBRB 3P32A 3GFPA 3UG6A 3IHWA 2ZI7A 3PG5A 3I8XA 1IQPA 4TQAA 1T3HA 5FI0B 4HLCA 4MYHA 5KYKA 4LHZA 1P2TA 3BS4A 1NY6A 5FOXA 4DC9A 4C0AC 2QSZA 3OIUA 3R9XA 4LX0A 1XZPA 3LV8A 5DN6A 5SZKB 1ZNZA 4LDJA 1ZNYA 4MGZR 5TARA 1OXXK 3CRRA 4MRSA 5FTNA 4I4LA 4BLSA 2IS1A 1UDXA 2ZR9A 3P20A 4O2LA 3WHLA 4IHQA 1E1QA 1Z22A 3K0CC 5FR1A 4B2LA 3ZD6A 2G0TA 4TMKA 1VIYA 2DFLA 4B71A 1G8GA 2A5FA 1ZINA 2V4ZA 5JSZA 1E2FA 2IBMA 1TF5A 1E2IA 2GXUA 4RZ3A 1XNJA 2WJYA 2RHMA 1FNMA 1F60A 1G4AE 1FUUA 2IXEA 1MO5A 4ZPXA 1XTSA 2EYQA 1P62B 3SBDA 3PUZA 4FIDA 1KY2A 3IO5A 3X1DA 2C77A 3TMKA 1W47A 2GK7A 4YMWA 4CEJB 2ASEA 4MH0R 1CR4A 1NLYA 4M1WA 3TNFA 4MDEA 2REXB 1COWA 2W00A 4HAWA 1SVKA 3MJRA 1R0ZA 4I1UA 2Q3FA 5GJBA 1KO4A 3IPYA 2V3CC 4Q4LA 4A2QA 4WXRA 3R9WA 1UKZA 1D6JA 4R2IA 5TY0A 3TK1A 3WYAA 1Q1ZA 3MFYA 1G8FA 1W4CA 3BB1A 4NCHA 1SXJD 2FDCA 2BM1A 3I1FA 2VQSA 2RGXA 2WWXA 2O0JA 2ZRAA 3VKGA 3DHWC 2QP3A 1KZGB 3B9PA 4KXFB 5KNDA 1UM8A 4POAA 4DEYA 2P3SA 1CJKC 5LD2B 4ESVA 2YC4C 2R6DA 4TL8A 5A5GA 2WVJA 4YXWD 4GZMA 3RS3A 1Z0DA 3IPXA 1DO2A 2PLFA 2I4IA 1F2UB 2ZRIA 4RY2A 1SVSA 3WBKA 2XX3A 3W3AA 2O8CA 1P6XA 1Z3IX 1A4RA 3GQBA 4BFTA 1X1SA 3AVVA 4US0R 1B23P 1II8B 2WSSA 4OHYA 4TTRA 1SVOA 2FV8A 1UBGA 2IS2A 2IEYA 3TQCA 2FPKA 1IM2A 2HF8A 1IXRC 2B6HA 4O25A 2R6CA 1RW4A 2Q9AA 1OFTA 1Z08A 5CB6A 4LJ9A 2BJVA 2J0SA 3PQCA 3LBNA 3LA6A 4Q1AA 1CJTC 3BH0A 1BKDR 1WCV1 1IXSB 3CF0A 2VH5R 4WAUA 4EJSA 2XTMA 2WWWA 1KYIA 2RAPA 4FMDB 5HCNA 4BZPA 4NCKA 3LY5A 1L2TA 1GKIA 2IA5A 4JLVA 5E7MA 3QF4B 2HEIA 3MCAA 1II9A 2ZXUA 1EESA 4RVCA 3THYA 1VCNA 1G8HA 1Z6TA 1AS0A 2GCNA 3IIKA 3W9YA 1XTJA 1NLZA 4W9MC 2GNOA 4JLKA 5LBIA 2OZEA 5H70A 3PEUA 3RAPR 2GF9A 1W44A 1BH2A 2FSHA 4TMXA 1N0VC 2XXAB 1ZNXA 3KJGA 3KFVA 1W4AA 2FEOA 1WP9A 3BC1A 5KPDA 2O8BA 1A2BA 4LBZA 5FUYA 1WB9A 1BIFA 2ODWA 2GETA 2RGNA 2ZRCA 3A36A 2C9CA 2ORIA 3IIMA 3SYKA 3VR2A 4DSTA 5BW8A 2A2ZA 1SKQA 2FA9A 3L2OB 3UWKA 4ZI2A 1ZUNB 4RCYA 3GLFA 2R2AA 2WJVA 4A0GA 1G5TA 4D6PA 3AVYA 1RVDA 3EARA 1LTQA 4JVNA 1XP8A 3O8RA 2ZJ5A 1GITA 4QG7A 2J41A 1I4LD 3SS8A 1CF4A 3N2IA 4ARZA 2GBLA 3G5UA 3Q9LA 4AG6A 4IXMA 1KSHA 1GRNA 5J4YA 1Z29A 1MOZA 3SJCA 3SOPA 4DXAA 2FEMA 1ZM4A 3U60B 3MRSA 1YU9A 2WPDD 1N5KA 1NL3A 3QBTA 4MA4A 4XTRA 4XVRA 3KZ1E 1OFIA 3O47A 1FL9A 1LS1A 4PAOA 4FCWA 4HLDA 4YMSA 2YOFA 5TMPA 2EVWX 2CL6X 1LY1A 5FBQB 4D4LA 3FYHA 3WP1B 4K46A 3LXXA 3EA5A 1N6HA 1W0JD 1FMLA 2PMKA 4I1SA 1XMJA 4KV9A 4TLEA 3MLEA 3H4MA 2DFKB 5BQ5A 1JEDA 1FOEB 1NIJA 1Q57A 1ZC3A 2ZI9A 1K6MA 4PSKA 1Z0IA 1AJEA 4X8LA 4CEHB 1II0A 4V0MA 3A8TA 4Q02A 4AK9A 1YQTA 1DAMA 1KSGA 2H8KA 3V4FA 5KUTA 2QRNA 1WBDA 3M4YA 2W2TA 2GK6A 3CB4A 4HAYA 4P4SA 3L0SA 2VHJA 1FQJA 1YRAA 2GEVA 1CRPA 3KL4A 1Z8FA 1JQJC 4TYNA 2YWHA 1R0XA 3QIAA 2FSFA 3FFBA 4NMMA 4ZIRA 5HR5A 2W0SA 4LZZA 1DPFA 4WZBE 2FN4A 3EZ6A 4TMTA 3U3JA 2XJ4A 2V6IA 1GILA 4NDZA 4DLWA 1Z63A 4QNMA 2FE4A 2KB0A 1Z28A 4Q4AB 1N6LA 5DLQC 4QGAA 4IKEA 3WBJA 3KKPA 4DLTA 2GWHA 2GVZC 3EIEA 1DBSA 4KSCA 2XZOA 3K53A 3KFXA 3RRZA 1GIAA 3SZRA 1NVXQ 2H57A 4JJKA 4NPHA 1R5OA 3KTAB 2WM9B 1KMQA 4AD8A 1M7HA 2OLJA 3F5FA 4KU4A 3RC3A 4Q7LA 1FTNA 1JXMA 2ZRNA 4TSFD 4EPYA 3ND8A 5K8UA 2NPIA 1G3RA 1RRGA 1T8TA 3ZQJA 2IYQA 2O0KA 1IJEA 2QQ0A 3SHFA 3QXCA 1XPRA 2B7CA 1JR3A 1Z5ZA 3PJRA 2PMDA 3THWA 1UJ2A 2IYSA 4ZDKA 5EP4A 1OFHA 2OM2A 2GRJA 5CJ2A 2D7DA 4U5XA 3AM1A 2PZFA 4GZLA 4Z1MD 3ZJYA 2RGCA 1QBKC 1I2MA 1S1CA 2AXPA 3EX7C 4EKDA 4URWR 1DVRA 1NY5A 1HQCA 2ZPTX 5TB5A 2PEYA 3I8SA 1GNRA 2IUSA 1M7BA 1FW6A 4PTLA 2GA8A 1S4QA 3HJNA 1QHYA 1KJWA 3AF0A 5K8LA 1T0JB 1NJGA 2YINC 4C0LA 4CT5A 3DOFA 3EC2A 4R71A 5IT5A 5L3SA 4M8NE 5FL7D 3A6PC 3FHCB 4GRAA 3KQNA 4LHYA 2QT1A 4AI6A 1E2GA 1L4UA 1OKKA 4MGIR 4DSOA 3A58B 2QRZA 1GDDA 1XTRA 4KFTA 2UZ3A 4CF7A 3E70C 2JGNA 2QAGA 4HDQB 3KKOA 5M04A 1VG0B 4PZLA 1CJMA 3B2EA 5TV2A 2AR7A 4OHVA 3AV0B 2VSFA 2OCAA 2IYTA 3N70A 1D8TA 2DB3A 1J70A 2VP9A 3GFOA 2QENA 1G64A 2G77B 4Q9JA 1IN4A 1AGRA 1LV7A 2E87A 3K70B 3AUYA 1DADA 2IS6A 2AK3A 2QU8A 2Z0MA 3PUYA 2VHUA 5FUWA 3T15A 3QNUA 2XNSA 4N0EA 1HT2E 4P31A 4DDVA 3AB3A 1XXHA 3KKNA 4FMBB 3A1UA 2ZYUX 4EJSC 4TT3A 3U3MA 2BBTA 1J8YF 1MV5A 3GLHA 4XJXA 3RRNA 1MKYA 3PV0A 4CZ2A 1VDZA 4IVQA 2BC9A 1YKSA 1WQ1R 2QY9A 2Z5FA 4Q18A 1VECA 4TMZA 5H68A 5DYIA 2NO6A 3FVQA 3CRVA 4DCUA 3VR4A 1RYFA 3MGCA 2OUKA 1X8LA 3TVDA 3UKDA 4X8MA 2IUTA 3GFTA 2OLKA 2MMCA 4NU0A 3BWDD 2GXQA 1F2TA 1Q3HA 4LWZA 1DELA 2ZRBA 3U7HB 5FTJA 1MR3F 3PUXA 4HZUA 1M6NA 4J0QA 4M9ZA 4B76A 4Y0AA 3DM9B 1Z06A 1T91A 2RGNC 5DO9A 3NWJA 1ZM3A 2P6NA 1G18A 1NI3A 1GL7A 1ZNWA 1DEKA 2VEDA 3OEEA 4ZDIA 4UNPA 4NL4H 5KSZA 1CULC 2Q21A 2O8EB 1SXJC 1M8PA 2IF0A 1Z0KA 1FP6A 2CHVA 2NO7A 2YJTD 1AKYA 3GPLA 3VQTA 1KI1A 3CPEA 4BLRA 1DAEA 2GBLC 2HDNB 3VR3A 1OPXA 2F43B 4MRVA 1YZNA 3GLGA 1P61B 5FOWA 3FKSD 4XD7D 2RKOA 3DMNA 3W6NA 2HLDD 3K9HA 1TTTA 4U00A 3IHLA 3JVUA 2H17A 1TL7C 1MO3A 3OIVA 4LJYA 1KNXA 4IXNA 1UADA 4LCBA 1W0KD 2EFCB 3NH9A 5SZJA 2QTHA 1VMAA 3KB1A 3THXA 1HEIA 2J0QA 3OE7A 2G0NA 4G3XA 2G88A 1QVRA 1NBME 3QKRB 1AQUA 1ZBDA 5D3QA 2RB4A 5JRJA 4RFSA 4URUR 2FZ4A 4L4UA 1XJQA 4PHTA 1E0KA 3W8RA 3I61A 4MDFA 4LJ6A 2P6RA 2KJQA 2ZU0C 2VHTA 2IT1A 4I1OA 2GJ8A 2WWIA 1WA5A 3QXHA 5GJWC 1XTKA 3MWYW 2IHYA 2IWRA 2ZE5A 5JBQA 2QA5A 1ZJ6A 1ZVQA 3AKYA 1BYUA 5E4FA 1E2JA 4NCIA 3K9NA 1OHHA 2A3RA 2H92A 3GEEA 1VCMA 4MKHA 2QTVB 3MUFA 4ZIRB 1ODFA 3NBYC 2EWWA 3QQ5A 1ETUA 1P75A 2JLXA 3K0AA 3I92A 3K0FA 1YVDA 4EQ6B 4JL6A 3TR5A 2ANBA 1OIVA 2GCOB 1CJVC 3K0CA 5HPYB 1N2CE 2R8RA 4C3ZA 1G7TA 3U61B 3THOA 1AZTA 1OXTA 1GKYA 1QHSA 3EPJA 3KJIA 3L43A 5DI3B 4P3YA 2ZUCA 1DG1G 2XTNA 2F1HA 4KBGA 5FR2A 3TUIC 3E2IA 2XTZA 2D62A 3BAFA 3DM5A 1XJ0A 4IDPA 4NKRA 2YHSA 4LYAA 4EPWA 4OJKA 4BUJA 4ZDJA 3L0OA 3CZQA 3TRFA 4CRWB 2NG1A 3U7FB 4WXPA 3VFDA 2Z43A 4DUGD 1EWRA 4ITRC 4DCSA 2GZHA 4QBFA 4RD4A 4DKXA 3CM0A 3UWOA 4F4IA 3NBXX 5AJZA 2WBLC 3KX2A 4G0NA 5K8IA 1TQDA 3QUSA 1JBKA 1NIPA 2A5DA 3KQUA 1E99A 3P27A 3I62A 4B2IA 2P6UA 3A4MA 2W58A 2L0XA 3QVVA 4DLSA 1Q12A 1N6OA 2QE7D 2REBA 1YZLA 3VR5A 5JRZA 1DAKA 5JJIA 4C0QC 3R9IA 5UKDA 3SQXA 1G21E 5FI1B 3NTUA 2AKAB 4CDGA 3F8TA 1SULA 5EQTA 1M34E 5H8WA 5CLLA 4QJ5A 1G3MA 4DWJA 4PANA 4ZKDA 1KAOA 4M1MA 3SJBA 1AGPA 4TZ0A 2ZRFA 1P60A 2QORA 2Q9BA 4DIEA 2C98A 3EPHA 2KE5A 2MSDB 2WWHA 4H9GA 4BRUA 4OQFA 5TDHA 5JS7A 2NIPA 1OB5A 1LB1B 1OIWA 1VTKA 2HXSA 4W5WA 3P26A 4ASUA 2OESA 1P72A 2BIFA 1HURA 1E6CA 3IILA 3WNBA 3NEYA 2QAGC 3ZS9A 2A78A 1JNYA 4JYCA 2OV2A 1IN8A 4K8OA 5EXPA 3T1QA 1CP2A 1KI4A 3MWLA 4MKFA 3U4QB 1XD9A 3HU2A 221PA 1QG2A 5CIQA 2JJ2D 2FPMA 4B34A 1OFUX 4Q47A 1QHHB 3IBGA 1XPOA 4EPRA 1FX0B 4OK6A 4WVFA 3U44A 1RJ9B 4QHTA 4AWXA 3VU9B 1DOAA 3GLHB 2GHIA 4OK5A 1S0UA 1GTVA 1XD8A 3CX7A 2O8DB 1JECA 1G5PA 4Q4HA 1OYYA 3TSOA 3KQKA 1KI9A 2WJHA 4RD6A 3CNNA 3ZIAD 1W5TA 4NBSA 3UPUA 5L3QA 3Q5DA 4PSVA 5EE1A 4CEIB 2XSZD 4XTCS 5JLJA 1RZ3A 2CCGA 1Z0FA 1S9DA 4DB2A 5CDFE 1P2UA 5BWMA 3SFZA 3AKCA 4V0OA 2ZAOA 5JI2E 1EXMA 3MWJA 3U3RA 4EFNA 4BLPA 5KNCA 1CRQA 1F6BA 1XMVA 3ZVMA 1NNEA 1KI6A 2D2FA 3EZ2A 4YMTA 2ZJOA 1YHNA 3KQLA 4XWOA 1XU4A 4JSYA 1W5SA 3HPQA 3KUCA 2W6JA 4WIAA 3RC8A 3FOZA 3MG9A 4Q4JB 2ZRDA 3ADBA 2F6RA 5DYGA 2NGRA 3T1TA 2WAYA 3K0SA 2YYZA 3AVTA 4QM7A 2QPTA 4HUQA 3GCGA 1KK1A 1A1VA 3VR1A 2IEZA 1E9BA 1WMSA 4A1FA 3BERA 3M6AA 1DARA 4GOXA 2CK3D 1Z6XA 2F55A 2X1VA 2CLCX 2W2XA 1TU3A 1JEEA 2AFHE 2FFQA 2KI5A 4LPKA 4ZV4A 3EIHA 1E9EA 2ATXA 2NMVA 1Z83A 1EX6A 4A15A 3IQXA 4P0TA 2GVDC 4HLQB 4I81A 3I3SR 3RS4A 2I3BA 4ON9A 1EX7A 3FB4A 3BJIC 2PX3A 1J2JA 1O3YA 5EZ5A 1T5LA 3D8BA 4RD2A 3FFAA 2ANCA 5D3MB 2BEJA 1KKMA 1UF9A 3LFUA 2BKEA 3UG7A 4D4JA 2GZDA 3AH8A 3OF5A 2MSCB 4LJAA 5KDLA 3F0TA 5CB8A 1BMFA 3NKVA 4GFDA 1W4BA 4IOMA 4HB4A 3P1JA 5G40A 1F3OA 3AEZA 1JQLB 3AVXA 2R9VA 4Q00A 5KNBA 3OAAD 2YWFA 4XWKA 2GAOA 2JLVA 3QXSA 4QGHA 4B2PA 4C4PA 3BBPA 3IQWA 5JMTA 2QBYA 4KVGA 4URZR 1E1RD 4D0LB 3H2YA 5FTLA 4PR0A 4M1YA 2ZJAA 2J0UA 2VYFA 3QXJA 4DT1B 1XEXB 2DCUA 1IXZA 5FL3A 4XVQA 3RYTC 3NH6A 1UBFA 4XOIA 3X2SA 3QKSA 3PVSA 4UQOA 2C8VA 2CJWA 3K70D 1OXSC 3VKHA 5JCPA 2OILA 2Z83A 5EUQB 2LKDA 2GDJA 1G6HA 5KDDA 4RD0A 1AS3A 1X8JA 3NDBB 4DLXA 1XD2A 4U02A 4DZZA 1D5CA 1LF5A 4FN5A 4OHZA 3UMSA 2HJVA 3CPJB 3WMGA 5JFGA 4TYYA 4MKGA 4RZ2A 2IYVA 1V5WA 1EFHA 3QKTA 4MGYR 2ZU6A 2J7KA 1ZW6A 3AVWA 3IEUA 3IDQA 3IKJA 4IDHA 2X77A 5E7JA 3EAQA 4PZZA 1ZRHA 5KU1A 2EFDB 2CE7A 1R10A 3I73A 5CLQA 4A92A 2DWOA 4CEJA 3MJHA 1KSJA 2QM8A 1CR2A 4MKIA 1ZU5A 1H8HD 2NZJA 2P65A 4AURA 1J90A 1R2QA 3DZDA 3BORA 3FE2A 4KODA 4CYMA 3LVRE 1KHTA 3H84A 4ZCLA 3UXMA 4G1UC 2UZIR 3Q72A 4NTZA 4LI0A 4Q7KA 2WKPA 1PUIA 2OCYC 4B3XA 1BOFA 2BV3A 3K09C 2F9LA 5J4LA 3W3ZB 2F3TA 1D9XA 1YR9A 2ZE8A 5AUOB 2XB2A 2FG5A 3KJEA 1EFCA 3E5HA 1E79A 1CU1A 3OFND 4QGFA 2QN6A 2XGJA 3EC1A 4LC1A 2YOHA 3W8NA 1H8ED 4OKSA 4RZXA 1X1RA 5BYKA 2PCJA 3SU8A 2ERXA 4Q03A 3Q7PA 3NC1C 4FMDF 4JT2A 3ND9A 4LPSA 3EPLA 2IX3A 4TL7A 4F92B 1JALA 3B60A 2RGBA 4M9XA 5AWFC 4Q48A 1US8B 2ZRPA 4CVNA 1C9KA 5LD2C 5LDDC 3GJ5A 4A8JA 1CS4C 1UBEA 4PO8A 3I5YA 3T61A 3HU1A 3KKMA 3B9QA 2JDID 4AC9A 2KSQA 1G5RA 1YR7A 3SNHA 2AXNA 3MMPA 2V7QD 3FGNA 3SI7A 4Q19A 2JJ8A 3IIJA 4URYR 3TLXA 5CYPA 4ZCIA 1WE2A 4XVUA 1HYQA 4HB2A 5C4GB 4R2HA 1ZD9A 4WZ6A 3LNCA 1XTQA 2ZS9A 4PO9A 4DLVA 5FBVB 1KI3A 4JKYA 1RRPA 2C9YA 4KFUA 5E3HA 3AP2A 721PA 3FHTA 3VNUA 4TLBA 4B6FA 3WNDA 1KMHA 2BM0A 3RS7A 3T12A 4GOJA 4CGZA 2ZJYA 5B30A 1NMYA 4IDNA 2Q0HA 3LXRA 2WV9A 1IBRA 4TL9A 4B3FX 1U90A 1XTIA 5KHOC 4AYXA 2JLSA 2JLQA 4V0NA 1FFHA 1R8SA 2KBEA 3D7MA 4D0NA 2G6BA 2WWYA 1KO8A 1SXJA 4GP7A 5L3RA 1NVWQ 2CNWD 1TNDA 2W83A 4JBYA 3U3OA 3U7GA 4QM6A 1DE0A 3PENA 1QZXA 5LPNA 4QNRA 3M0EA 3VX3A 3VNVA 4QC2A 4G5GA 4PHHA 1S8FA 3PXGA 1TUIA 2EFHB 2ZI4A 3DO6A 2C03A 5CIWA 4LGMA 5H1YA 1SHZA 5KSYA 3K0EA 4UKDA 5BN5A 1GNQA 3TBKA 1W7AA 4MYUA 3GLFE 2AFIE 2VBCA 4QHSA 4YXWA 3GJ6A 5FOVA 2WTUA 3SBEA 1YZKA 4EFMA 4XIGS 5DGXA 2DY1A 4RD3A 4HUQB 1J99A 4LK2A 1GVNB 2VL7A 1SZPA 4Q9LA 3OEHD 3VKWA 4GBMA 5BYJA 2Z4RA 4D0GA 1IHUA 3EXAA 1Z6YA 2SHKA 5BN3A 1VCOA 2QM7A 2GJSA 3MSXA 1V43A 4LOAA 3RS2A 2AWOA 2WJIA 1AIPA 2FX3A 1N5JA 4Q9IA 1G6OA 4BLQA 3AP1A 2KBFA 2RGEA 3ZDQA 5HE8A 1JJVA 1D2MA 2G3YA 2OEPA 4C9BA 2WICA 2XOKD 4W5HA 2YKGA 4IOKA 4NONA 1Q1EA 2MSEB 1NN1A 1TAGA 2ZVPX 3AGQA 1B0UA 3PEVA 4OJQA 4ABYA 4Q66C 3ZZTA 3AF1A 2P5SA 4V0ME 5HKKD 1TMKA 2IYYA 4II7A 1LVGA 3QXXA 1D2EA 2BMEA 4HLUC 4PSAA 2AK2A 4DDWA 4OI4A 4WZAE 2DFTA 1RE0A 2NZ8A 3QY0A 1NSFA 2PJRA 2FPLA 1E9CA 4KFRA 1Q20A 4DCVA 2UVQA 4I1VA 3VX4A 2ATVA 5CJPA 1G3UA 2HCJB 1Q22A 4UXJA 2NO0A 4AYTA 3FPAA 2GXSA 3WNCA 4C0KA 2H5EA 5JSZB 4P33A 1OB2A 4MRPA 1SVLA 2YWGA 2WJJA 3UANA 1IY2A 2H16A 2QPOA 3EIQA 3JZAA 2PZEA 2N1BA 3SFVA 1QF9A 4WW0A 5A0FA 2C9OA 3CRW1 3HU3A 3LLUA 5FPHA 3TIFA 5AR1A 4JJZA 1TPZA 2WOOA 3BH7A 3GD7A 1TF2A 2R6AA 4PXAA 3BH6A 3GEHA 2VP6A 3TR0A 4G5RA 4D26A 1GL9B 1N6PA 4TQUS 4PAMA 1Y63A 2OO7A 1GUAA 2ONKA 2W6ID 5CITA 2WPDA 3U7EB 5JS8A 1U94A 2DR3A 2OFXA 5EXTA 2AWNA 4QRHA 1AS2A 4MYCA 1SVMA 2VTKA 4HB0A 4RKFA 1DO0A 2GILA 2JLZA 2QROA 4KJZA 2GTPA 3QENA 4BFZA 1G3IA 1W0JA 2D3WA 4HYYA 4NYJR 4BFXA 4AKIA 3N2EA 1AQYA 2P2LA 4KVAA 1JR3E 2J3EA 1KAGA 2HYIC 1KO7A 1FQKA 2WOJA 3ZVRA 3GP8A 1S2MA 4TLCA 2DWQA 2D4HA 1KDOA 1NJFA 3RS0A 2XNDD 1MABA 3RANA 1NRJB 1BYIA 2O8CB 4IDOA 4Q21A 1RRFA 5EP3A 1XBTA 5JEEA 2FOLA 4TWZA 4A82A 1E2NA 1F5NA 4FW9A 3QPVA 4PZYA 3SYNA 1KO5A 3AVUA 4PC7A 5JHHB 1NMZA 1X6VA 3R7WA 3RSLA 4FI3C 4Q1FA 2ZUDA 2NOAA 1NBMD 2FZLA 4OQMA 1K8RA 2NPFA 5BXQC 2ZS8A 1E69A 4KHZA 4D4KA 1HUQA 5L8VA 1DAIA 1T0HB 2G1KA 2BWJA 1CTQA 2ODBA 4UJ3A 2NO1A 1LF0A 1P5ZB 4WBSA 2ZYVX 4JKIA 2ZYTX 3GMTA 5CM9C 3TW4A 1JPNA 4EJSB 2UKDA 4C0HA 4JLPA 2ODNA 1BO6A 1NVVR 1OW3B 3I4LA 1XDBA 5J40A 2DFNA 3VR6A 4D82A 2OT3B 2OXRA 4B3GA 3CNOA 3TQFA 4A8JC 4FINA 4JSTA 3DVLA 1NMXA 5G3YA 3THYB 1ZM2A 1ONBA 2XZPA 4GMDA 1OSNA 1CR0A 1DTSA 1FTSA 1RPZA 1HH4A 1W2GA 1W36B 2H18A 1E0JA 4M1TA 1YJ5A 2YV5A 4M2LA 4TSFA 2GKSA 1CKEA 2D06A 4A6PA 1E98A 4EPTA 2AL7A 3TSWA 3QE0A 5KSOA 2HF9A 2IUUA 1XXHE 2E9SA 3SDZA 3W5JA 5B58C 2JIZD 4TL6A 1XEWX 4B35A 2O8BB 2GXAA 3GJ0A 3CZPA 3GLHE 2OG2A 4LJ4A 2WWFA 4LV8B 2F9MA 4OHXA 3GLFB 3DL0A 1RYHA 1GSIA 1T6NA 1YZGA 5B57C 2QMEA 2V9PA 3ADDA 4JT4A 2WSMA 3D3QA 4LBWA 4Z1MA 3QG1A 4ARZB 3ASYA 3Q85A 1ZD1A 4JLJA 4C7OB 1U8AA 1ESNA 2ZTSA 4DLRA 3EASA 4QFMA 3GJ8A 1Q1BA 2QP4A 4Q5IA 3GJ4A 2IK8A 4Q1CA 1U8ZA 1U98A 3FMFA 1WDTA 5F98A 4M53A 4XSHA 4MGKR 1A5TA 2ZVQX 3GLIA 1YZTA 3TAHA 3S1AA 3CNLA 5FL7A 2IYLD 2OBMA 2ZM5A 5E7IA 4JVLA 1ZIPA 2BBOA 5CK5A 1LS6A 2F1IA 3GEIA 3HYRA 5IK2D 3BRWD 3R20A 2OFOA 3RDPA 3ASZA 5FOTA 4N3NA 4FD2A 2XEXA 2F7SA 4BRWA 2JLUA 4O2RA 2P5TB 4Z54A 2CEAA 1YE8A 8OHMA 4GL2A 1UKYA 1KI2A 2BEKA 3A1SA 1Q1QA 1U2RA 4P4SB 4AKEA 3KXLA 2P67A 1KO1A 1TADA 2Z6VA 3REFA 2VF7A 2VA8A 1IJFA 3Q3JB 1E4YA 1A7JA 1W1WA 1GFIA 4RSGA 1X86B 3C41J 5JWRA 4B74A 2WKQA 1YZUA 3JVVA 3LQRA 4MUAA 5JHGB 5JWOA 1OH7A 2JASA 4LYJA 3VMFA 3SJZA 4BFYA 1L4YA 4FCVA 1G8PA 4DLYA 3AF2A 4M9QA 2JCSA 3U3KA 4A0RA 2O8FA 4DSUA 1CBUA 5FUXA 4D81A 5L3VA 4IVRA 4MYTA 1NG1A 2IXGA 3U2QA 4QHYA 2I1QA 3IGFA 4ACAA 4IRUB 1JI0A 2ONJA 3B85A 2O0HA 1Z0AA 1OF1A 4QGGA 2EYUA 3QEJA 1EFTA 2J7PD 3PITA 5EP2A 4W5JA 4IEEA 3QOFA 2ZQ5A 4C30A 3UMRA 4DHEA 3QSYA 1OH5A 3OESA 1QVAA 1XCPA 2FU5C 4A36A 2CXXA 4HSEA 4D25A 3UATA 1LFDB 4QJ3A 1QG4A 2E1RA 2FJUA 3C8UA 3CO5A 3EZFA 1XPUA 3EA0A 2PLRA 3R8FA 4C0SA 3THWB 1UKVY 2QNRA 1GNPA 1G17A 5B2ZA 1I2DA 2IW3A 3DMDA 2PT5A 1EFRD 4A6XA 4IDQA 1EWQA 1VG1A 3CWZA 4PPGA 2OE2A 4TZ6A 3FKSA 4XD7A 5FTKA 1ZUIA 3DZ8A 4MITA 1OXVA 3DOEA 3RS5A 3GJ3A 4JL8A 3TVTA 1GWNA 5FBLB 2DBYA 2HLDA 2FF7A 4GNKA 3K09A 4NYIQ 2Q3MA 3B78A 1FUKA 2MMGA 1W0KA 2ZRHA 3DDCA 2WKRA 4KAXA 1PVOA 4LUCA 3QI2A 4FXPA 5L3SB 4JVMA 2ZSFA 3NDPA 3N5CA 4NYMR 3ZYCA 1E2QA 2R6GA 1R7RA 4TMVA 4EFLA 1P4SA 4EPVA 4HAZA 4Q01A 1QHXA 2RHDA 2QAGB 4Q9KA 3PEWA 1N0UA 3LX5A 4DDTA 4MQBA 4HDOB 4M4SA 4DIDA 4RD1A 1HA3A 4BFUA 4RJLA 5DHAA 1JAIA 2RGGA 1PZNA 2ZSEA 4QBHA 5FUVA 3TUJC 1F2UA 2BOVA 4UNQA 2CE2X 2HV8A 4LBYA 2ZETA 2O52A 4LHWA 2YC2C 2CVFA 1TUEA 1E9AA 1J7KA 5AUQA 5EJEA 4TMWA 1II8A 2VO1A 5IRCD 1OH8A 1WRBA 1UBCA 3U6KA 1XXHB 2W2VA 3SJAA 4AKGA 1UKEA 4NHOA 2PT7A 5JCZA 3DEFA 4JIMA 2ZUBA 2JJ1D 2CHGA 2QI9C 4A0FA 2A30A 4C0BA 4YLGA 4TTQA 1M2OB 2ZI3A 1E9DA 3MWKA 2JLWA 3A4NA 4ACBA 2C95A 5JJKA 2VP2A 4DUGA 4F7WA 4F4CA 3PUWA 2J87A 4ZI3A 2BCJQ 2REOA 3NHAA 3ZQ6A 2ZYWX 3CUEF 4BLTA 5HCIA 1QHIA 2PEZA 5JJLA 1G1MA 1S1MA 3F3YA 4EAQA 3REGA 5BN4A 4DVGA 3QF4A 3RRMA 4TYQA 1F2TB 1U99A 3AF3A 4LYHA 1HE1C 3VAAA 3ZZUA 1VCIA 4HZUB 4LYFA 1XF9A 3LD9A 5DN6D 3IEVA 3EG5A 4JLDA 4NYIR 2VPPA 3LLMA 2XXAA 4BE7B 3WMEA 4Q1DA 1E1QD 1TF7A 5GJVC 4FMCB 5AJXA 3AP3A 2EWVA 4OI2A 1XEWY 3FKQA 2B8TA 3IUYA 3P4YA 1KDRA 1E94E 3NC0C 2VP0A 5G3ZA 3B1VA 5C18A 1XZQA 3H0KA 2OCPA 3DKVA 4B75A 3TGPA 1ESMA 1NF3A 1EG7A 4A9AA 3GLGB 4BZQA 1EFUA 1ZYUA 3KXKA 5EE3A 3B1YA 1GG2A 2ZI5A 2ZE7A 2N46A 2ZEJA 1NKSA 2A5JA 3AQ4A 1COWD 1XCGB 3QKUA 5AK0A 1YZQA 3SQWA 4E07A 3A1VA 3OIYA 4DCTA 3THXB 2PBRA 3WRXC 1ZUHA 2Y8EA 4HZIA 1U8YA 1SHKA 1N3BA 2ZJ8A 4RFSB 1YR8A 3W6OA 1MRSA 3O8DA 4B48A 4EDHA 1E9RA 1SKYE 3QPUA 3TJZA 1IY1A 3NG1A 5F3WB 4WOPA 1G7RA 4JS0A 1KTVA 3JZMA 2CCKA 5DNYB 4ZKEA 2AX4A 4HLUA 1N6RA 2FH5B 4Z51A 1NN5A 3CH4B 2JJ2A 3EWAA 3V00A 2IHBA 3IBYA 3U6BA 4CEHA 4DLUA 4L16A 2PH1A 1SGWA 3TSZA 3A4LA 3CBQA 3K0AB 3K0FB 3H86A 2Q9CA 1E0AA 3I5XA 1A2KC 1O87A 1TX4B 1KGDA 3QEOA 3ICQB 2H7VA 2WSSD 3SYLA 521PA 5HE9A 1RIFA 1ZIOA 3ZIAA 2DYKA 3O8CA 3C14C 1S9HA 3MD0A 1E9SA 3LW8A 4DRZA 3L0PA 2XSZA 2IYXA 1P2SA 4TN1A 4AYWA 4BEJA 1FNNA 1DAFA 2BDTA 1XCMA 3K9LA 2B21A 4Q4AA 2GCPA 2BBSA 2ZJZA 1KDTA 3VTKA 1D9ZA 3FHOA 1Z0JA 4PC2A 4B3CA 2GEUA 4OHWA 421PA 4NH0A 2JLRA 2JEOA 4QXAA 5HZKA 2ZR7A 1YR6A 1JJ7A 4P4TA 3TAUA 4V03A 1JXOA 2QQEA 3KTAA 3PIRA 1E4VA 1K5GA 4IOJA 4Q7JB 4A2WA 3TUZC 2FSGA 1W36D 3ZLJA 3BGWA 1PLJA 2QT0A 4YQFA 1PV4A 4JBXA 2QP9X 5FPYA 2FGJA 2EFGA 1IY0A 3FTQA 4CIDA 3A37A 1OIXA 4IW3B 4D80A 3CW2A 5F9FA 3KXIA 2IS4A 2ZAMA 2CK3A 2ZRLA 4FWTA 2QMHA 1XB2A 4LJ8A 2ODEA 4HUTA 2FFBA 4LHVA 2V1UA 1TEVA 3K9GA 1FPMA 2CL7X 2R44A 3RSOA 1G7CA 4C2TA 3WYGA 1G4UR 2VP5A 1AM4D 4B43A 2NQ2C 1PLLA 1W2HA 4BGDA 2FFAA 4F91B 4RKEA 1GL6A 2PX0A 2JATA 3RRYA 3EZ9A 1Q21A 3L82B 3ONWA 2R65A 4LSGA 2IYZA 2IYUA 3LO5A 2W0MA 1E2KA 1QHGA 4JYBA 4L8GA 1NSTA 3WRYC 5B64A 1UAAA 2QGNA 3ZS8A 4QKQA 3C5CA 1IN6A 3GJXC 2IWHA 1J8MF 2BKUA 2QTFA 2RH5A 3IO3A 4HEJA 4US1R 2XITA 4R98A 2WZQA 3OAAA 5IF9A 4HAVA 1NLFA 3B8HA 4LV6A 5AJYA 2EW1A 1U0LA 1VHLA 3ZVNA 3U44B 1E1RA 2HT6A 3OIWA 2VSXA 1CXZA 2C96A 2ZS7A 4X8OA 1KZ7B 2G1JA 2BMDA 2CLDX 4KCGA 1KK3A 5GADl 1GOTA 4OQNA 2A5YB 2VP4A 1E2PA 4Q4HB 2VHQA 2CCJA 4ERNA 3NIBA 5AUPB 1ZCAA 3EWSA 4QJ4A 2P0EA 2X2EA 4ZO4A 4DDUA 4PFSA 2QL6A 4M1OA 5L3QB 1MH1A 2WHXA 1YRBA 4IEIA 3LAWA 4OI0A 2D7CA 5HTKA 3LVQE 1U9IA 2JAQA 4NZYA 4RCZA 1OV4A 3A1TA 3AKEA 3FWYA 1T9HA 2YVUA 3AUXA 1Q3TA 5J4HA 3KDSE 3I72A 5GJCA 1VIAA 2ORWA 4PC6A 4B73A 1H8HA 1KI6B 1Z2CA 4PAQA 3KQHA 2V55B 1SVIA 5KOYA 3H1TA 1R5BA 1P9NA 3DPUA 2HCBA 1M7GA 1XRJA 4PC1A 4GDFA 3BFVA 3CR8A 1EGAA 4JVSB 2QMOA 5DHFA 5C46F 1T4GA 1UDWA 3HYTA 1VYUA 3CF2A 4Q1EA 1SXJE 3V9PA 1SKYB 2KWIA 3HR8A 2WIAA 3I32A 3W6PA 2OBLA 2ZSAA 1WBBA 4FWIB 4DEXA 2A9KA 1HT1E 3L0IB 2R6FA 4DB4A 1IN5A 3B7GA 4E22A 1PLKA 2FFHA 3QVUA 1T3SA 1E2EA 3OFNA 4FCTA 2O8EA 4L9SA 1JR3D 3ADKA 2X19A 4R7ZA 2J46A 1DG3A 1P3JA 3AVOA 4NYJQ 4XSGA 1H8EA 1R8QA 3TW8B 3B6EA 3T5DA 4LBVA 3WYFA 4B47A 4GOKA 2AD5A 4Y0VA 1DAGA 4B44A 2F43A 2IYRA 2Q3HA 4E03A 4PHFA 1JPJA 2NO9A 1R0WA 1L8QA 3L8ZA 3PEYA 3J81k 2PJZA 4V0KA 4AIIA 5DIFA 1W49A 3HWSA 5ANRB 4RZUA 2VRWA 4DLZA 4ESHA 2TMKA 4OK3A 2GAAA 2JDIA 2PCLA 2ZANA 4G5QA 3VHXA 2C04A 2OXCA 2QG6A 4JMPA 4R9UC 4BWYA 2V7QA 1EK0A 1DAHA 2G9NA 4IVPA 4KO8A 3NBZC 3CH5A 4KI0A 3QKRA 3PFIA 3QBVA 1VHTA 1MO6A 4PQRA 2BMJA 3UIEA 5F9HA 1OKKD 3FMOB 4Z8XA 2GZAA 1ANKA 3EPKA 1KSFX 2QBYB 2CVHA 1N5LA 2DWPA 5HZHA 1NVVQ 4EUNA 1PJRA 2J0UB 2IYWA 4B6EA 4LC0A 2ZRKA 2J1LA 3PCRB 1UPTA 2WMNB 1ZAKA 3QKSB 4EQ6A 2CJWB 3BD9A 2GCOA 3SR0A 2VF8A 3T1VA 2ZSBA 3KKQA 3ICEA 4Q1BA 4AY2A 1Y3AA 2CNWA 1E3MA 4UNRA 1XD2B 4UXIA 2HYDA 5DI3A 2ZI6A 1AZSC 3ADCA 4BASA 2C5LA 121PA 2Q6TA 2EQBA 1AKEA 1KJYA 3B13B 3C16C 3FDIA 3KB2A 1G3QA 2GJAA 1R5NA 4HDCA 4JLMA 4TT3D 4X8HA 4BEBA 3SEAA 2K5UA 5CK4A 4B3DA 4D4MA 2V54A 5LB2A 3DKPA 1KNQA 3QJYA 1Z6GA 4P4UA 2AHOA 1TEXA 4UXHA 1HE8B 2EU8A 2YOGA 3T1OA 2J5XA 2X8AA 2AN9A 2PL3A 4W7SA 3C4JA 1XX6A 3OEHA 4M0LA 1KDPA 2FSIA 4MRNA 2B8WA 3LRPA 2WIBA 1ZCBA 3K8YA 1E32A 2CBZA 1W4RA 2VIIA 2RGDA 3AF4A 3ETLA 4OI1A 5FTMA 1UFQA 3ECCA 1ZD8A 1KI8A 2FWRA 4BECA 2LCFA 1X3SA 5FPKA 1OE0A 5E95A 4CW7A 2CHQA 2CLSA 3T06B 3RHFA 1G41A 3OEED 2ZROA 4PPNA 4D2IA 4DJTA 2XOKA 2WJGA 1IOZA 2AKYA 5P21A 1G291 1S3SA 3BB4A 3SN6A 5HKKA 4UNSA 3T34A 2NTYC 2J9RA 2RCNA 5C2JB 3AVPA 4KYIB 3RWOA 4NCNA 1NN3A 4L15A 1OT3A 1CJUC 4JLBA 4TYPA 3LX8A 2ZE6A 3CONA 4P32A 2F1RA 1Q0UA 1WXQA 4A8JB 2A5GA 4YONB 3PR1A 3RVBA 2ZRGA 4UJ5A 4OQLA 1XFAA 4WA7A 3BB3A 1XWIA 1JR6A 1R6BX 3OE7D 4GPTA 2C99A 4GI7A 4G01B 3U5ZB 3CIOA 1AA9A 2F3RA 5DSZA
chains in the Genus database with same CATH superfamily
4U7WA 1IQRA 4P92A 1QSGA 3RLFA 3VTZA 2QD3A 1ZCFA 4PRKA 1Q7CA 5EE9A 3VC2A 3JAMA 2W98A 4QOIA 3QFFA 5T8KC 1ITZA 1PTKA 3Q7RA 4XGQA 4YNBA 2HN9A 4ZI5A 1X7HA 4LN1A 4A3SA 1N6IA 1Y9EA 3NHBA 5JRDS 3JSXA 2G5PA 1Z17A 2Q29A 3MYRA 1W48A 1QHHA 1Y8AA 2WDPA 3GCWA 1RC8A 4U7JA 1FX0A 1ZXXA 1NKTA 1T9GS 3H1BA 1XMSA 3IT2A 4V0LA 1YMUA 1ZJYA 3TJMA 4A2PA 3NIFB 2O5RA 4X6LA 3WICA 5HEKA 1RC1A 1T0BA 1L7VC 1USUA 3DT8A 4UZSA 5K4GA 1U6IA 2AF4C 3C15C 3FNIA 3FOFC 3BIOA 4L50A 2DP4E 3BDAA 1DQYA 4LJKA 2HT1A 2CB0A 1VPWA 3TLBA 4L95C 1V1MB 3LM8A 1U9IC 1YE3A 3I2IA 4JL5A 4OCZA 3T5GA 1IBSA 2DVMA 4MV8A 3O8BA 2WAXA 2ES4A 1HNZB 2HGZA 4M98A 5KVQA 3UICA 2BN4A 2ZJBA 2GSDA 3IJ5A 4NFYA 3ROEA 1VPLA 2Y4OA 5BN5B 5EZ6B 4UBOA 1G8YA 1BNCA 4BCDA 1P73A 3IMEA 4B3RB 1JDTA 1JLMA 3LDUA 3Q5EA 4Q34A 2W4IA 3PDWA 2H2GA 2YN0A 2FUG1 5CLGA 3TH5A 1N2JA 2ZTUA 4K7JA 4UCWA 3W5DA 1T8WA 4Y2TA 2ZG6A 2R7KA 3CNBA 1XRNA 2J6BA 1IK6A 1XHLA 1JTVA 3KOWA 3VZDA 4CF3A 5JDIA 3KE9A 3BKWA 2A0FA 1ZGHA 2PQ2A 4HQ6A 1U11A 1YAHA 2GEDA 1JKMA 1MW9X 3TKLA 1WHSA 5KWEA 1BKSB 1XJCA 4UE2A 4BWVA 3CR3C 5ELMA 3M4XA 3VR5D 1L4HA 2QNBA 1NBMA 2G9QA 4FFPA 5G0SA 4Q4JA 3P0FA 2HPHA 1NV8A 4HAXA 3GLIE 2B3TA 4KQKA 1X74A 2AD1A 2WMOB 1NVUQ 3AU9A 3QSGA 3PQ2A 4AP6A 4DE5A 1Z2DA 1DXOA 1OLXA 2QRVA 3E53A 2F3UA 3NJ8A 1NOIA 2VKQA 2XYGA 1Z2NX 2CHFA 1U3FA 2LKCA 3O6VA 4QBGB 1QQAA 1PS0A 4I3HA 2VLIA 2ECKA 3W8EA 3SQLA 1E1DA 1TM4E 2EW8A 3JQBA 1F2VA 4I99A 5FFNA 1XVVA 4Q4DA 1PK8A 1PNOA 3RWMB 3SC3A 3VYVA 3DZGA 5THXA 1PEKE 3I9FA 1KEEB 1VSTA 1R4AA 1FP7A 2G09A 1DIOB 2IVFA 4NF2A 4RA6A 4BEWA 3TE6A 3P9CA 3DCIA 4I6EA 1MX3A 1X1EA 3H9BA 2PA3A 3IURA 2ZVJA 4OGLA 4C88A 3EY9A 5B6JA 2JFZA 4HN2A 5FO1A 4BFSA 1HLDA 3AM3A 3ZE0B 3LBIA 2D5BA 1YCHA 3PHBE 5BSVA 3AEYA 4M8SA 3G0HA 2LV8A 3CGGA 4UOZA 3BTVA 4US2R 1R16A 2OXEA 1QH1A 3ANYB 3E7PA 3GJQA 4ZHSA 2HUPA 3LZ6A 4WKBA 5KQRA 2O54A 3HRIA 4FR0A 4GW3A 3I53A 3L06A 1T3TA 3OQIA 4X9XA 2IBSA 1N77A 3SE0A 4GRDA 4HKTA 5EA2A 1O03A 5CLHA 4FZVA 1MC4A 2V6FA 3ICOA 2R62A 3VI4B 1IN7A 4GI3A 1XKXA 2AFRA 4HAUA 4YQEA 1TFUA 2XB4A 1SUWA 2GF2A 3IBTA 5M5BA 5EUMA 1XQXA 1USIA 2J3HA 2XLCA 2XQVA 3ZOZA 3ZD7A 5CG2A 3WB2A 4DT1A 4ZZIA 4A16A 4F93B 3M83A 1XEXA 4GPAA 1YFLA 2GEFA 4KAAA 4WV3A 3B9RA 2WFMA 4R1TA 3QF7A 3B70A 3KJHA 1YRLA 2PRIA 1A82A 2DQYA 3NBKA 2QUAA 2Q49A 3KJQA 2QVCA 4FKBA 1N25A 1HY3A 3UXHA 3V3TA 5LZ8A 1MB2A 1EK1A 1N75A 1V16B 2G08A 3BXHA 3EIOA 4A0QA 5D01A 2XJ9A 2YNMA 3KLBA 3EG9B 2HA7A 4FBLA 1T29A 2NUTA 3BGOS 1ZONA 1ZNQO 1BE0A 4IIDA 1UL1X 2H5JA 3CWQA 3WLPA 3CX8A 1EUDB 5IK2A 2ZRJA 1QZZA 2IDZA 3C8MA 4XH9B 2OO5A 4D44A 1CIJA 1FY2A 4RY8A 3CX6A 4QEKA 5TR9A 2IHJA 2F1JA 2J45A 2WP8J 4N6OA 3L8YA 5EP1A 3PDHA 4PAGA 1ADGA 2ST1A 3BK7A 4HX9A 1KZHA 3PWKA 3WNQA 2BGKA 4OQXA 1ACJA 2CFOA 1TLLA 1GPYA 2Z09A 621PA 2O2IA 4PCVA 5EE5B 5HBGA 3NALA 2VEOA 4IOLA 5MN5A 1U8CB 3AIMA 2IHTA 4L28A 3VNAA 1C4XA 1ZOIA 1XVTA 4FYWA 3TB6A 4F3RA 4TV8A 1UBUS 1DNPA 3D31A 1EB8A 2JHCA 4AG3A 1QGUB 5ISMA 3ELUA 1NXXA 4RQAA 5K6TA 1G20E 1DC8A 3AJAA 4BBJA 4DUPA 3LC0A 3CR7A 3M6UA 2YFKA 3H0CA 1GZSA 1SO8A 2WYOA 4EUSA 4HFRA 4IPTA 1K7XB 2Q1SA 3OHPA 3MS4A 4CT4B 5J4VA 1B2RA 4AO8A 4DGQA 1Q19A 4Y8VA 1TT5A 1K98A 1SVWA 2RMKA 3EZ7A 3O93A 1GAQA 5EESA 1KY3A 4ZDWA 1TU4A 3VAZA 2UXBB 4RC9A 4HATA 3WK4A 4K0KB 4LHXA 4LXUA 3SWWA 2LDXA 3ICPA 5AVJA 4URXR 4BVLA 4P5EA 2WYUA 1NF2A 4G41A 3BE4A 5JARA 5IABA 1U8XX 4G5XA 1NN0A 2ZIAA 1ECLA 2GD1O 4P08A 3S55A 2LGJA 1BJTA 2BGRA 3GFQA 4QGBA 2WHPA 5EKUA 4OBEA 3V42A 4BKOA 3A6ZA 3KR0A 4CG2A 1BN6A 3VI3B 3HYNA 5JXJA 5ALQA 5BXYA 4B6GA 4BKMA 3OLWA 1WR8A 1YAJA 1Z47A 2ATCA 4N65A 4MQFB 3TE7A 1IONA 1XYVA 4FPXA 1UK6A 5CDFA 2Z1MA 4BP3A 4Y6SA 2DF8A 5K5EA 3S1SA 5JS6A 3OECA 2C5FA 4J03A 3G6KA 1E2MA 4EMUA 1AUPA 1DRVA 2I3AA 1EFRA 2QB5A 2X0RA 4HX2A 5T7BA 2QLJA 1C3OA 2ERYA 3BFKA 3USES 2OYSA 1QRAA 2WWGA 4LV5B 2FQYA 1DDGA 2XNKA 4OFZA 2NADA 3VNBA 5K0TA 1TCAA 3IQGX 4I6GA 1NF9A 2DHRA 3ZLVA 5F33A 1H2AS 3R3SA 4S0XA 3TVYA 5CB4A 4K81B 4RLSA 3BPSA 3R5TA 3QGMA 3WHKA 3E9DA 1I4TD 4FEYA 5E9JA 6LDHA 4ZI7A 1OUMA 1QONA 2JFXA 1U0HC 1XKQA 5SZHB 2V5AA 1QIIA 4ZMSA 1N57A 2ZJ1A 4MTCA 4OUDA 1XPUA 2QGZA 4KFSA 2C3MA 2JFQA 3WGUA 2H11A 1PBNA 2RGAA 1E5XA 2V03A 3O38A 3V32A 4OHKA 5F9MA 3V46A 3PRKE 3G82C 5JC8A 5EIAA 5TXGA 1G6Q1 4HXGA 2B7BA 4JWTA 1WIWA 2EHDA 5JECA 3ZNPA 4NU5A 3KS9A 1GAJA 2AFHA 3S5UA 3O9VA 5EVCA 2VHCA 4MPPA 5IDVA 1CX9B 1EDDA 1ZESA 1UM9B 3HKDB 3N59A 1T6ZA 2BHRA 1XTTA 5AH0A 2RD2A 4MVCA 5DGDA 5KQPA 4DXDA 3O7WA 4PN3A 1BHSA 1KKLA 3HUDA 4OMDA 1SXPA 2F1KA 1NP6A 2YN4A 4REQB 1MRNA 4C01A 1M0WA 5EE0A 4ARSA 1VE7A 4DV1B 2EX0A 1ZISA 1YVPA 4KXUA 5F7OA 1VSQA 4BQEA 1UEJA 4G5OA 1XEFA 4EBBA 4P86A 5EWJB 3CKLA 3DDZX 4FR2A 4JNKA 1U81A 4LJSA 4XCQA 4IQ8A 5KO2A 1K75A 5TQVA 3EF3A 1J8DA 2QM0A 3SBXA 5IH7A 2A88A 3IBSA 1FMJA 5DI9A 2E21A 2BUBA 1ULHA 5AVWA 3M70A 3KR9A 2FNAA 1LBQA 4BP8A 3HB0A 4LZWA 1PD1A 4P34A 5C81A 3SBOA 1UK8A 2HQBA 5B7GA 5AESA 2X5NA 2O8FB 2GLXA 1Y48E 3R3HA 1SOMA 4O4LB 3TSAA 3CRMA 3MPUA 4N48A 1CNFA 4YYZA 2AG1A 1A8HA 3L6BA 4PYJA 1X7YB 1LLFA 4J4BA 1K7FB 5JPIA 1PR3A 4TQAA 4HLCA 4DQUA 4WLFA 4LHZA 1C9MA 2K87A 2X8JA 3CINA 1JHDA 3CQ9A 5IXSA 4AUKA 1GRVA 3FGOA 3NO4A 5CRIA 3WRVA 3C98A 1CFZA 3MRXA 2HRQA 5SZKB 4KMRA 5EC8A 1HDYA 5F5LA 4BLSA 1UDXA 2ZR9A 3P20A 1R9JA 5DTIA 4IHQA 3RPEA 5C8XA 4Y2UA 1GPWB 1EVYA 4HJRA 4TMKA 5ALSA 3FOWA 3V1TC 2Q1YA 2V3VA 5F5NA 1L5YA 2W6OA 2HIMA 1XNJA 2RHMA 3ZXXA 3OPNA 1PJ8A 4GOND 2IXEA 3F8SA 1E92A 2HL6A 1UC8A 4OYYA 3SF0A 4MWBA 4Y98A 5EWMB 3AZQA 1ECGA 3L04A 4CEJB 3U4CA 4J94A 3H97A 1Z8HA 4MH0R 3IC5A 4UBMA 4CU2A 3LL4A 4TV9A 1ECCA 2ACEA 3UCEA 5GJBA 3IPYA 2PZLA 1IUOA 1FFBA 1NWCA 3QVJA 1H2EA 4Q4LA 1RYMA 5J5AA 5TY0A 1D6JA 3UYKA 4A2QA 3L6OO 3WYAA 2PBLA 2EF1A 4G25A 4ZU3A 4U2CA 3F6PA 2YIVX 1W4CA 1UBHS 3BB1A 2FDCA 2WA2A 3ESAA 4I8DA 4ZREA 4JNCA 2WWXA 3V8BA 1Y0BA 5HKOA 4W9NC 4CKCA 4AP9A 3OT5A 4XAQA 5KNDA 1GUBA 1KQNA 3FFWA 3ZV5A 5AVXA 2BMAA 3GUZA 2IP2A 2QX8A 4PYMA 2IPMA 1BWSA 1JFTA 2P3SA 1CJKC 3WQBA 1PAUA 3QX8A 2NP6A 2VH1A 2WT4A 2GD0A 5L7WA 3Q87B 2WVJA 4NCAA 4GZMA 4REOA 2YMQA 4H35A 3SF8A 2OGZA 4BX0A 5AVTA 1F2UB 1M2GA 1XQ6A 3PD7A 4H15A 3PC3A 4N9QA 1JIJA 1FLAA 1SVSA 1VXRA 3WBKA 2PQ6A 1I1OA 4RKYA 2XX3A 2XMZA 3W3AA 5ECWA 4E32A 3FSJX 2CD9A 1X1SA 4EHAA 1BE1A 4UUQA 1E63A 1DRJA 1FBTA 1WNTA 2P2SA 2WSSA 5CA0A 2IS2A 1ICIA 3TQCA 1K5PA 2HF8A 2OV3A 3CUUA 1W6RA 4PRYA 4DCGA 5BQFA 2R6CA 3H5AA 4QXOA 4OFXA 3ZNNA 5B12A 1RW4A 5E8RA 3KHKA 5CB6A 2YJ6A 2P9HA 2PO7A 4YUYA 3X0DA 2BJHA 1P0PA 1N0HA 2J6CA 3OH8A 1CJTC 2P9ZA 4Z49A 1IXSB 4EJSA 2VH5R 1O0SA 1KYIA 2RAPA 4LZLA 2QJTA 5DGHA 3HCRA 5SYMA 4BZPA 4EGJA 4L6AA 1XV5A 2OBBA 3ENVA 1MGOA 2VK4A 3LY5A 4P5PA 5CR9A 1NRXA 4DSZA 1DQRA 4Y1RA 3MBIA 4PGFA 4DBLE 3D2BA 1M1YB 2ZXUA 3L5OA 4UHKA 1TAQA 3QNWA 1WLSA 4ZO9A 5FB3A 3BT7A 4H0FA 3BUSA 4FGWA 4Q6BA 1YB6A 2W5UA 3M6LA 3ZHUA 2KX7A 1L3CA 1B14A 4OHMA 2XYQA 4I55A 4R2JA 4TTSA 1KE1A 4DA7A 4K9OA 1E6LA 2JFGA 1C9YA 5FF9A 2GF9A 1ZG3A 2PUHA 1J1ZA 2FSHA 1BH2A 4RDIA 2PE5A 4B4VA 2XXAB 2BSXA 4ZVNA 1RBZA 1ZH4A 1USKA 4R41A 3KJGA 4WJKB 2YV4A 3BC1A 1WP9A 4NV1A 4ZRDA 5JW6A 2QZJA 1IHOA 5LQNA 2NZVG 1A2BA 3GRUA 3DE4X 4XGRA 4KQHA 4M89A 5EYPB 1BIFA 2ODWA 3BMQB 5FUYA 5YASA 5A04A 3A36A 1SKBA 2C9CA 2ORIA 4IXDA 3VR2A 1JLLA 1T3GA 3ELBA 4IIHA 4X1KA 1SKQA 3UWKA 1YRQA 2PMEA 1Y5LA 1ZUNB 4IDAA 4RCYA 5I9BA 3LOPA 5IVDA 2QTBA 3A4IA 3CUSA 4D6PA 3VBCA 3AVYA 1RVDA 2P2NA 1LTQA 3EARA 1XP8A 4JVNA 3O8RA 2J41A 1I4LD 1ZD2P 2ZAGA 1GZ6A 4LYGA 4F85A 1CF4A 1JHXA 3PC8A 2R1VB 3Q9LA 1WMEA 4GNRA 3JYLA 4KMOA 1Z6PA 1Z29A 1K1EA 2JNWA 3O9ZA 1MOZA 1QIEA 3GRPA 3SJCA 1FBNA 2FEMA 1PRYA 2J5QA 1VL1A 2Y93A 3EDCA 1YNOA 3ILXA 4INOA 3RRXA 4H31A 3V6LA 4CMHA 5E1MA 4EMSA 1RWBA 4R3WA 1GTG1 3AI1A 2C3UA 4MB6A 1FL9A 2DPMA 3ICCA 4YECA 3TTTA 1ODLA 3LZCA 4DSNA 2JIBA 4QZVA 5JV5A 5TMPA 5CLFA 4MWDA 3DO5A 4WESB 4MCJA 4C0LA 2PYIA 4Y6GB 4LDPA 3FYHA 4K46A 1QP7A 2OZLB 2IHKA 3W05A 2INGX 1N6HA 1FMLA 3WYDA 2Q0SA 4LY3A 1MAUA 2DR2A 1H2YA 3JPWA 5FX2A 1XA4A 2EJTA 1FOEB 1C1HA 1Q57A 3O8LA 5BQ5A 3MT0A 3UCFA 5JY6A 4PGAA 3DBLB 3V8NA 4NK4A 4HWTA 4AO7A 4RHTA 5DHTA 5CA1A 2Z6UA 4ND4A 2AH5A 5FWXB 4IP0A 1ORVA 3T8YA 1DAMA 4HEHA 4MCAA 4M99A 1GCGA 1LXCA 1TO1E 3GVIA 1NVBA 5LU9A 1BX0A 3VJRA 1ZH6A 4GLLA 2WVHA 1L5SA 3DS8A 1PJLA 4HG2A 1N4DA 3L0SA 2HK6A 1X80B 2JIOA 3KT0A 2IHNA 4HEA1 2H0AA 3ZGNA 4FGJA 3UOAB 4BNFA 1L5LA 2JH9A 5EJ2A 4BJ6A 2IPOA 3AYZB 3SQMA 1O8CA 1JQKA 1MJ5A 2FSFA 4IF6A 5KC8A 1VJ1A 2BEWB 4K9MA 4DJEC 4E2ZA 3R0VA 3EXFB 3OIDA 3U3JA 2V6IA 2QIOA 3A9CA 1R12A 2R11A 4NDZA 1Z63A 5IBRA 4QNMA 3KOZA 4J7AA 2W2PA 3K0HA 4FOPA 4KPUB 1N6LA 2ZTMA 1CDOA 4Q4AB 4XFDA 4IX1A 1UZNA 4QGAA 1KJJA 1EHYA 5AD1A 3HGQA 3BKXA 4FC6A 4CCYB 3SD7A 2XUHA 3NU1A 2X0FA 2EIHA 3PQ5A 1ZVVA 3PFGA 2H0QA 3JVEA 1M8GA 2VTBB 1PBTA 1U9ZA 3KFXA 1X1QA 2NSLA 3FRHA 3MXTA 2C7BA 2XQGA 2DECA 4NPHA 6REQB 1R5OA 3I9OA 3KTAB 1FK8A 1WOYA 1KMQA 1QUFA 2O8VA 3CUKA 3O90A 1QNFA 2G7MC 4N18A 3VKVA 2Q0XA 2C7GA 3QLVC 3CZAA 2IEGA 3FNHA 1Y1KE 1JXMA 2ZRNA 2WIFA 1S2IA 3ND8A 2BSAA 1QP8A 2NPIA 4M0DA 1F4PA 1SG9A 4RTSA 1MAAA 1U3DA 2VG8A 3R6WA 2OD2A 1UBLS 3N2KB 1FTGA 1EUQA 2O0KA 3GZJA 4FI3F 5IS2A 3LPNA 3DBHB 2CYCA 3GP3A 1V7PC 4E94A 3TD9A 1Z5ZA 3BDIA 4RYLA 3PJRA 3MINA 4J7XA 5EI5A 1U9YA 2QTWB 4JFAA 3N53A 2OTCA 3RYFB 3TKYA 3ZWPA 2C7OA 1ZWLA 2NXCA 1RDFA 4K87A 4AAYA 2D7DA 3AM1A 1GG5A 3RSZA 2PV7A 2XPCA 3C3EA 3OZCA 1VGQA 2AXPA 1I3KA 2E0IA 3EX7C 5CLJA 4ZYZA 4URWR 4IF4A 3TPCA 4UFPA 1NY5A 1PFYA 3DV2A 5LA6A 3SCZA 4F5YA 4Z0NA 2VJOA 5EUCA 4TMYA 4X20B 1Q0LA 4FOSA 4PTLA 4MIYA 4NAUA 1KYYA 3HJNA 4RIEA 5LM3A 4U0KA 3AF0A 3HXMA 2YINC 5IT5A 3DOFA 1HSZA 2VPIA 5KX5F 3F49S 3KLOA 5BSFA 3KQNA 1UCFA 2WU4A 3ERCA 1KRXA 3TQRA 1UP6A 1E2GA 1JU9A 1L4UA 1YC2A 3PHIA 5EXEA 3SM3A 3SY8A 4BAZA 4Q3EA 2QRZA 1O5IA 1GDDA 2IOFA 4CF7A 2OCKA 2QAGA 3PNOA 2Q6OA 4FN4A 1VG0B 1U2PA 1CJMA 3FOCA 3D4NA 1PZMA 3ZHXA 5DM4A 5JUWA 3O03A 1KERA 3HZRA 4ZP1A 1J70A 2PX8A 1AQ6A 4TTJA 2NXJA 4N7RA 1ACLA 4Q3OA 3E9YA 3A4TA 5A5FA 1AGRA 2FN3A 5ETJA 3TZ6A 3VO2A 2CNNA 2IITA 1JEYB 1J06A 2FRVA 5H3LA 2IS6A 5EMMA 4MVJH 2AK3A 1T2VA 2VQDA 5AVZA 5GZ3A 3PUYA 5DYYA 5HHTA 3CZMA 3HABA 2VHUA 2AOVA 5FUWA 1N34B 1H6CA 1VM6A 2OV8A 1FLNA 1RXEA 2PAAA 1L9KA 3A1UA 4M46A 2ZYUX 2B2CA 4Z4IA 4LDQA 3RRNA 1MV5A 2GYWA 4XJXA 4BMOB 2WVGA 2Q3CA 1YQDA 1KYWA 2C4WA 2FZWA 3PV0A 5AVYA 1A98A 1V1RB 3L0CA 4CZ2A 1VDZA 4IVQA 2WK1A 3CT6A 5ALGA 1ADFA 4GOMD 4BMXA 4YA6A 3GDOA 4N47A 3SS9X 5KI6A 2VYNA 4NNPA 4TMZA 5ALNA 4HWOA 1UMBA 2NO6A 4CKEA 2BH2A 1QFJA 1N2HA 2O4UX 3MGCA 5COBA 4HPXB 4RY9A 3TVDA 1RXCA 2EQ5A 3GFTA 1JE0A 3HXKA 3ML1A 1XK7A 1JKJB 4MZDA 3TCXB 1MA0A 3A1FA 2I6SA 3NYQA 3CSSA 4OB8A 4LWZA 4EG8A 3UGQA 1MR3F 2RGUA 4A6DA 4B31A 3HSSA 4M9ZA 1NUTA 1M33A 4Y0AA 2NZXA 1RPJA 1T91A 2AXEA 4PCAA 3LUJA 3KB8A 4R05A 4XVCA 3O3MB 1ZM3A 1ULTA 2Z5LA 1NI3A 3F96A 2QSUA 4V1CI 5FA8A 1JT2A 5FV7A 3KOUA 5LYYA 2QLTA 1EP2B 3C3JA 1Y80A 5CJJA 4E31A 4NL4H 5KSZA 4QVIA 2VSYA 1CULC 3WC4A 4BY9E 1LSJA 5BMVB 3OOEA 2IF0A 1R0LA 1S2DA 1AKYA 3KE8A 5BNTA 5D2CA 1LZLA 1CP3A 4UAVA 3VQTA 3QVWA 1R18A 4FYMA 4QXMA 1FVOA 1DAEA 4QNNA 3SYTA 4X54A 3VR3A 1H4VB 1FNBA 4F5EA 4MRVA 3WISA 4CLHA 2ZIXA 4IGKA 4GC9A 5FOWA 3FKSD 3LKBA 3KQVA 3DMNA 4H3HB 3HXLA 2JB9A 3PQ4A 1IBLB 2ZBRA 1TTTA 4DIMA 2SBTA 2X0IA 1AUVA 3IHLA 1TL7C 5F23A 6NULA 4LJYA 3DGEC 4BMCA 3OCCA 1UADA 3OTOB 3IDSA 2EBUA 3NH9A 4F9GA 2QTHA 3JW8A 3H8JA 2C31A 4G3XA 1J2RA 3C8HA 4HUJA 4NFSA 4I50F 1UBNA 5D3QA 2RB4A 2ZJFA 1B42A 5JRJA 2O2ZA 1B8UA 4RFSA 2CJYA 4PHTA 1Q0TA 2BRUC 1CVIA 3GLQA 4AXBA 1HRDA 4LECA 1CY0A 2VHTA 1EAYA 5AM3A 4HTFB 2EKQA 5DEOA 4Y2GA 3ZTWA 5GJWC 1KJIA 1XTKA 3IBCA 4R8RA 1BHJA 3ROKA 3ZWOA 4ER6A 1F06A 3RVDA 2QA5A 2OYRA 2BDEA 1ZVQA 5LZ7A 2BZSA 3IODA 4AL4A 4EG0A 1E2JA 3LYLA 1K88A 2DFPA 3UT6A 1U02A 4RTQA 3DL2A 2H92A 5ICMA 4ZIRB 1VCMA 1LBEA 1PQYA 1X2BA 3KAKA 4ETNA 2VTEA 3NBYC 3T1HB 1R8JA 2E5FA 4I4TF 1JHQA 1UJ4A 3K0AA 4ZQIA 3K0FA 4QLAA 4RORA 3FI9A 4P7JA 4DZTA 4JL6A 2C5SA 2ANBA 1OIVA 2CVZA 2GCOB 5FHQA 1U1DA 1U4SA 2AQIA 1OXTA 3SNKA 1LBTA 4H60A 1QHSA 3AETB 3TLKA 4CM3A 4X97A 1GFZA 5E1BA 5CBKA 4DG8A 4DXHA 4P3YA 4KBGA 1DG1G 3G9QA 3EYAA 3V8EA 2BI4A 1Q0SA 3DKKA 1Y6QA 2DHCA 3GGGA 4IH9A 1GTL1 2GRUA 1UBMS 2ZUUA 2NO5A 2EDAA 4LYAA 4OV6B 5BUZA 1A5AB 1P39A 3L0OA 3CZQA 3R3WA 4XJSA 4PM4A 5K0GA 1GZ5A 4CRWB 2NG1A 4PXYA 5BR7A 3G8CA 5CEEA 3KV1A 3TRIA 1PG5A 2JI8A 1QS0A 2TMYA 1YHZA 3R8XA 4ZICA 2D0DA 4NBVA 4QPJC 3TCNA 4E13A 2MOKA 3CM0A 5AJZA 1C0LA 3MLBA 4U9IS 1JBKA 1NIPA 4ND8B 3GZ4A 2A5DA 1SC6A 4IJ5A 2IIVA 4GMKA 1E99A 3FZGA 4UOQA 5HTOA 3E9CA 3ORSA 1J33A 3TQSA 3HN2A 3ZHVA 4I5GA 1WZ2A 1TCVA 3WL3A 2HXGA 3QVVA 3WGQA 4XOUA 1IEVA 1Q12A 4DLSA 4JI2B 4UUPA 1ZK1A 3U4IA 3OOWA 2B99A 2VTDA 4PR3A 5KVSA 1YRWA 1AXEA 3PLNA 5LKRA 2PX5A 4UTNA 2I1WA 2C88A 2YWRA 2W6QA 1GKLA 2IU6A 4FYYA 4B85A 4JU9A 3TLGA 2VTVA 2VCYA 3JV7A 2BT4A 1P7ZA 1M34E 1X9HA 3EULA 3PUKA 4XYMA 3WYNA 1O5OA 1R9GA 4O5AA 6PFKA 4DWJA 4ZKDA 4IIJB 5JCOA 1BVUA 2CNOA 1KAOA 1VB3A 4MP3A 1NP3A 3EQZA 3KQYA 5FEMA 4JA2A 4R1NA 4X0EA 5C52B 1UUFA 2ZRFA 3JYNA 4CXMA 4P54A 5EEGA 3LI2A 1H5UA 2OZVA 3H5RA 3JAKB 4E6PA 4UPDA 5AOBA 1KY4A 1PHPA 1HNXB 3A14A 1KYTA 4ENSA 4F9FA 1H0KA 4LQCA 3VPHA 1SCUA 3HCOA 5EJGA 3PYLA 1S89A 4D92A 5EMLA 3I9MA 2OESA 5BQ3A 1W4ZA 7GPBA 5HJEA 2BIFA 1HURA 3AR3A 3L07A 1H69A 4OHPA 3ROFA 1JNYA 4JYCA 4BVKA 5L40A 5AI6A 2YMLA 5KOHA 5AKGA 3N2YA 3EVGA 1UMDB 3UAZA 3VR4H 3U4QB 2YIDA 1J9ZA 221PA 1QG2A 4KOAA 3C2QA 5CIQA 5JXIA 5MN6A 1KFJB 3CLTC 3TLCA 2D7JA 4G9EA 3O2JA 4RPIA 1BTOA 1DB3A 3AEXA 1RJ9B 3U44A 3QE9Y 3HK2A 1R3DA 3JASA 1KC3A 3U7QB 3GLHB 2GHIA 4H18A 4P7BA 3NCTA 1XTUA 4DDKA 1HNWB 4OQQA 1S0UA 1GTVA 1XD8A 2Z3WA 3FF4A 5KTTA 3DTNA 3U7IA 1JECA 1G5PA 4HNUA 1OYYA 3KQKA 3P0JA 1CZRA 3AILA 1SHTX 1RWOA 2E2WA 3FFXA 1T36B 2QF7A 3PF8A 4IS3A 2BE7A 2VDMB 4TT8A 3NJ4A 4XR9A 4NFLA 3G5MA 1I6MA 5ESXA 3ZWQA 4CNBA 3AXSA 3UPUA 1PQPA 3Q5DA 3EPRA 1JHPA 1WABA 4CEIB 3JARA 2LTAA 1V5GA 1RZ3A 3QEMA 5FLEX 5KKCA 2C42A 4NICA 4HY3A 2HU2A 3RH0A 4DB2A 4MPJA 4ZEXA 5HF6A 3PS9A 1DJQA 3OOSA 2BSQA 4KG7A 3SFZA 3J7TA 2VPXA 4WPGA 3MLAA 3TD6A 3WFZA 2V9ZA 4PNPA 3PE4A 2V7XA 3U3RA 5KNCA 2A1TR 2EX4A 2CNBA 2HTFA 5A06A 3ZVMA 4GBGA 3WG9A 3OQHA 3CW8X 4C14A 3W9UA 1ESDA 4PFQA 1WW8A 2H1SA 4MW1A 3T3DA 4PYNA 2FR1A 1ECJA 1PZHA 2AOUB 2W6JA 3DF7A 4MR7A 4OLHA 4XCVA 1JHZA 4MB0A 2EG5A 3RD5A 1EWVA 2BPOA 3Q9SA 1C7JA 2NGRA 2WAYA 3TLJA 1RPNA 3R41A 3QLUC 4H4CA 4BAUA 1EWTA 2C1XA 2IEZA 4XWTA 3PFNA 4YUZA 1ND6A 2PKRA 3I2KA 2WE8A 1ZVMA 1VFNA 3BE6A 3JWPA 2F55A 5T6MA 2GLUA 5K0BA 5KTSA 2UUAB 5JCJD 2PKWA 3C3DA 3JWJA 1YT5A 2NTVA 5ALJA 5ES3A 2Y99A 2FFQA 5G0UA 4C78A 3HJTA 3C97A 3FDFA 4CG1A 1XK6A 3L40A 4KB5A 3ID6C 1XLTC 2ZBVA 3Q9UA 3Q8KA 4YY3B 1EX6A 4BNVA 3IH5A 1TDJA 3PDCA 1KYXA 4HLQB 4JOQA 1EXVA 3TNLA 1FP2A 3RS4A 4J3JA 3HY6A 4IRMA 4JGGA 1L7RA 1W59A 3FB4A 3BJIC 5H16A 2RHCA 2O2CA 2HK7A 2FMUA 4O0LA 2XMCA 4FLEA 1SCKA 2BEJA 4JT9A 1UF9A 3A3YA 3PC4A 1O95D 4ZHQF 5ESWA 1RMYA 2NQTA 2GZDA 2R47A 2XE8A 3BZWA 3CNEA 4IZIA 2GZRA 3SZGA 3KR2A 3GN1A 2AF3C 4ZTUB 4AVYA 2ONZA 4YP0A 3CN9A 3QVXA 1SCJA 2A0WA 3CWCA 3NVKI 3P1JA 3S6JA 1JAYA 3V2IA 3AVXA 5KNBA 3OAAD 2FTKE 1KJ9A 4IHJA 4WQMA 1QO7A 3QLJA 3UJPA 3E9MA 3ZX5A 1OBFO 3IQWA 2FLKA 3FAZA 4KVGA 1K4MA 4MVXA 4WADA 1E1RD 4HH3C 1JQDA 1O8BA 2O2GA 1ENOA 2RJOA 3DAYA 3E58A 3QLVA 3R9KA 2EXXA 1J0DA 5CT4A 2P30A 2ZJAA 2VYFA 2G28A 2CXPA 4GR9A 5H3CA 3TS1A 1VOTA 4WECA 1U28A 3SC6A 2DCUA 5I5GA 4IMJB 1L5QA 1NU6A 3L9XA 1JKIA 1RHUA 1YGYA 1Z34A 2ZAYA 4OQYA 3PVSA 4RGQA 4UQOA 5HILA 1VJCA 5JFTA 4F72A 4HXYA 2OR3A 2LKDA 5EUQB 2GDJA 1A77A 3SG0A 5KDDA 1OAKA 1VBNA 4J1SA 1AS3A 1DC4A 4RJIA 3ZW8A 1XD2A 4DLXA 5BV7A 1C3JA 3NDBB 5F2KA 3FNEA 1G21B 3ENKA 4FN5A 4BNDA 3WMGA 5I48A 4TYYA 1RAIA 3RYIB 1D2GA 2UZ0A 3GFVA 1EFHA 1ZD5A 3QKTA 2ZU6A 4MGYR 1T3ZA 5EKXA 3IDQA 2IYOA 3H8SA 5E7JA 3AVWA 1AF7A 2CE7A 4IG9A 2PUTA 2DFVA 4JI5B 1SBYA 5CLQA 3EWIA 2VR1A 3G7UA 3LQ4A 4G9BA 4B6SA 4FFBB 1F12A 1VJGA 2XQJA 3HSYA 1RPAA 4X6XA 5BVGB 4UTOA 1CPYA 3IKTA 4Z9YA 4MKIA 5LVAA 1QIFA 2JFFA 3FPLA 2XT6A 5EKTA 3BORA 4KODA 5EOVA 5LNK1 1XAHA 4CYMA 2OFFA 1CRLA 3ZGVA 1KHTA 3H84A 2VWQA 4G1UC 3A0RB 1ONPA 2HHAA 2YJ5A 3AEUA 4OBWA 1TZBA 2A4KA 2QLNA 4HC4A 3RK0A 3PLAE 2WKPA 3KBBA 4Q24A 3B51X 4PYRA 2OCYC 3AL0C 4B80A 3M5CA 3OUZA 4P38A 1AUXA 3KYIB 2BV3A 2FZGA 4WWHA 4RVOA 1Y8RB 2LCQA 5HP4A 1S02A 4OJTA 1D9XA 1RAAA 2XB2A 3JQFC 4O08A 2OGWA 2FG5A 2YVQA 2GBCA 3QE3A 3KJEA 4IYJA 4AMBA 1E79A 4DC1A 4L73A 3K73O 4ZARA 3DBVO 3ZKWB 2IPAB 2QN6A 4F9EA 1W52X 2E89A 1V8PA 2Q9UA 3ANXA 4OKSA 1A2OA 4LK3A 3OX4A 5BYKA 1JHVA 1EVKA 4QATA 1R27A 3Q7PA 4KO4S 3HLTA 1ZH0A 1SD1A 1DC6A 1ZX1A 4GSLA 4LPSA 4OA5A 3VPGA 1JG7A 3I34X 2EFJA 2RAFA 2RGBA 4M9XA 3UWSA 2HX1A 2DAPA 4TRNA 8MHTA 1NONA 2PL5A 5LDDC 1L5KA 4MZXA 2PN1A 1E7MA 3Q1LA 3T61A 4D3SA 3HVHA 3K8QA 3HBLA 4GYWA 4R2MA 5IAKA 2X6QA 1U0SY 1NE2A 1OTXA 2AOWA 2KSQA 3PXUA 4F4UA 1Y6JA 4D45A 3PT5A 1P45A 2L82A 4FGUA 3IIJA 1RJEA 2V6GA 1GPAA 4MMZB 1NBHA 2I1LA 2QL7A 3CRNA 3FVWA 5CYPA 4DMHA 5K0JA 2RONA 3KQSA 5KAPA 1ZD9A 2BELA 2FOIA 5A6SB 3T4UA 2V7TA 2JBWA 3CLRD 1RRPA 1KDZA 1SUBA 2C9YA 4L3WA 4LDAA 2E4UA 2OD7A 1QOPB 1E59A 1M0EA 3FHTA 4NDNE 4IR7A 4TLBA 3WNDA 4FFWA 4IHKA 9GPBA 3RS7A 4D0LB 4ZGBA 4FKZA 4H2DA 1WKCA 1QX4A 3BWBA 2BHTA 5K20A 4TL9A 1IBRA 3K1AB 2OKCA 3RREA 3T94A 4ARAA 4YROA 4G2NA 5C7LO 1XTIA 4O8ZA 5K6RA 1NTRA 1PJSA 4U4AA 4AYXA 4BO8A 1EVIA 4KIGA 2JCVA 1CLEA 1A0OA 1K7YA 4QBTA 1FFHA 1YJXA 2G6BA 3O74A 2VNIA 3UVEA 3GELA 4MUEA 1Z6ZA 3O0TA 4E7PA 5L3RA 2W83A 3D6UA 4YAEA 1V1MA 3W8DA 4QNRA 3TQTA 4EB8A 1BCRB 5LPNA 3VNVA 1WXWA 3C0KA 4G5GA 1SIOA 3U80A 1S8FA 5HFAA 2XCLA 1TUIA 2ZYGA 4NH4A 3PXGA 5C31A 4O4JF 3EOZA 1JSLA 2C03A 3L77A 1JHUA 4R40A 1UDBA 1J25A 5AK3A 1U0OC 5BN5A 2P91A 3FYUB 5KVCA 1W7AA 2X5XA 4H3VA 3RYHA 3GLFE 2AFIE 4YXWA 1C7ZA 5FOVA 4FYXA 2FN9A 3RRBA 5AOVA 1W581 2H5LA 5DGXA 2DY1A 3E03A 4H27A 3R6LA 3PNPA 3UJ7A 4B4UA 5HK9A 5GIOE 3WV4A 1YB5A 2UXDB 1JILA 3W2FA 2VL7A 3IIEA 3ITKA 5BYJA 2Z4RA 2ZBGA 4D0GA 1IHUA 5A9TA 4G8BA 2JZOA 1KRWA 2BRUA 2OHGA 3REQB 3SVTA 4QXRA 2AWOA 3GG2A 2LP4Y 2LUOA 3PNQA 3UTCA 3OA0A 1Z4NA 2C5E