1ZRHA

Crystal structure of human heparan sulfate glucosamine 3-o-sulfotransferase 1 in complex with pap
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
VAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
publication title Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zrhA00
4WAUA 3P1JA 4D4JA 1LNZA 1T8UA 2GCOA 3AF2A 3IPXA 3U3OA 2YYZA 5A5GA 3TSOA 4JZKA 4C0BA 3N5CA 2GWHA 1E2JA 3IBYA 3DO6A 3EX7C 3PFIA 2YOFA 3LVQE 1SHZA 2J45A 2J3EA 4HAWA 5F2EA 5FOVA 3ICEA 1JR3D 1Q57A 3UANA 5LDDC 4TYNA 3FOZA 3CW2A 3BORA 3QPVA 3V4RA 5KDOA 1II0A 1R5OA 5DYIA 1KI1A 4DWJA 5TB5A 4LYHA 1E2PA 1ZD1A 1L4UA 4ITRC 2J7KA 4XD7A 3U5ZB 2ODNA 2ZITA 3M0EA 3ND8A 1XTSA 1HY3A 1JEEA 5JJLA 3R9WA 1NY5A 2BM1A 3Q5EA 1MV5A 4HUTA 4F93B 4MRNA 4PO1A 3I5YA 1E1RA 2BBTA 5SZHB 1W5TA 2IS1A 2XJ4A 5GADl 2GF9A 5F9HA 5KDDA 4O2RA 4EPTA 5EE1A 4B33A 3KDSE 4IOJA 2BV3A 4RZUA 3WYAA 4BEJA 2ORIA 2VRWA 1UBEA 2QBYB 2F1HA 4DSUA 1W0JD 4JSYA 2WJHA 1NLFA 2WIAA 3JVUA 4ZDWA 3AF1A 1OB2A 3BXZA 1P75A 1TU3A 2IK8A 2Z4SA 4QHSA 1EWRA 2BEKA 2ECKA 1KJWA 3PUYA 5FBQB 3T1OA 3LLUA 1GOTA 4TMVA 2W00A 2N1BA 2V7QD 1C1YA 2CMKA 1G5PA 4DCSA 3H1TA 4OI2A 4MKFA 2EFDB 3BERA 1KK1A 3WY9A 4D0GA 4W5HA 1MABB 2OILA 5BYKA 2ZRLA 4AI6A 1KJZA 4D80A 3K0SA 4S35A 1XEXB 1JEDA 1OJLA 3LD9A 3KQNA 2GEVA 1W7AA 4CZ2A 3Q9LA 4NP6A 2F43A 2ZS9A 3VX3A 4G5GA 3CF0A 3HDTA 3CPHA 2EQBA 3OZXA 5GVRA 5ELXA 4PC7A 4Q5IA 1T3SA 4WZ6A 1G21E 3QPWA 2JLVA 4RD0A 1Z2CA 1WA5A 1XJCA 1R2QA 2B7BA 2PMDA 2XSZD 4A9AA 1CJMA 1C4OA 3AUYA 1Q1QA 1KYIA 3B60A 3CRVA 4QBIA 3CH4B 3UWKA 5FTLA 2BJWA 2Z4RA 4MQBA 4V0NA 4GBMA 4B6FA 2HDNB 4JBWA 1E2GA 4DXAA 4XWOA 5LB4A 3BAFA 1KI4A 4K81B 2IL1A 4CEHB 3VFDA 3EAQA 4LI0A 2EWVA 2DY1A 4UKDA 4RZ3A 3RS4A 4WZAE 4ZCMA 1DADA 1GILA 1N6RA 5AUPB 2HV8A 1XTIA 2XITA 4ASUA 2ZYWX 1PUJA 3CX8A 4U02A 3UG7A 4HLUA 1XCPA 4B73A 3U7HB 2PJRA 4N1AA 2Q6TA 1TX4B 1SKYB 4LWZA 1ETUA 4I99A 2G0TA 4X8MA 3BGWA 3CNNA 1AQUA 4FD2A 2AL7A 2GKSA 3FB4A 4LZZA 3RLFA 5GJBA 1XZQA 3HP1A 4FW9A 1QF9A 2QSZA 3O47A 1GNRA 5BN3A 2GDJA 4MRVA 1FX0B 1DG3A 2GAOA 3B7GA 3U2QA 4HAYA 2P6UA 4O2LA 2QRZA 2HCJB 4IDPA 2L0XA 4QJ3A 5FPKA 4IOLA 1Z22A 2QAGC 4NCHA 4JLKA 2ZJYA 2UVQA 4YLGA 4TTPA 1L4YA 2V55B 5L8VA 1TF2A 3GLGE 3LLMA 2CNWD 2DHRA 2CHQA 4PC1A 2FV8A 1QHHB 1WXQA 1KMHA 1WCV1 2AK2A 2ZRFA 5JRZA 1G8GA 2ZREA 4LOAA 1RRFA 1NBMA 4B34A 1JQJC 1N6LA 2X77A 1AN0A 1YRAA 4E09A 2IYXA 2CBZA 4EPYA 4IFEA 3QI2A 1AGRA 4B44A 4CEJB 1IY1A 3W34A 2QG6A 3P4XA 2WPDD 2J0SA 3SJCA 5AJYA 1JR3A 5CITA 3K9LA 5JI3E 3GLFE 3K0EA 4IJMA 3TSWA 3K0FA 2C2HA 1DVRA 4B3DA 2B7CA 4LYFA 1KNQA 3C5CA 5IDVA 2XXAA 1YKSA 4OQMA 3U44A 4PPGA 3C4JA 1P3JA 2OHFA 3OHMA 1G16A 2CCKA 1OH6A 1KI8A 4A36A 5EE9A 3FMPB 1HEIA 4DLWA 3RS3A 4DJTA 2K5UA 1XB2A 2F55A 2VO1A 3NH6A 5JHGB 4TYPA 3OEEA 4OK5A 3RAPR 3CNLA 2YWFA 5LPNA 3SHFA 1M7BA 2WMNB 4NKRA 1XD2A 4PSKA 2VYFA 1W0JA 4EUNA 5JEDA 1OPXA 2XTZA 1Z0FA 1YZLA 4FMDF 1OSNA 4YQFA 1YZQA 3ZD7A 1VG0B 4FMDB 2CK3A 2ZJ2A 3BC1A 2ZE7A 3PEVA 3F3YA 4TLEA 4TT3D 3U3RA 1EWQA 1N0VC 4C2TA 1F2UA 2WHXA 4OJKA 4PAOA 4DLUA 2PT7A 5BWMA 1U99A 5H68A 2QQ0A 3M4YA 1R0WA 1R10A 1U8ZA 2BMJA 4BEBA 3NBFA 4LDJA 4QGAA 4FXPA 2C99A 1Z63A 5TARA 3EIHA 4A0GA 4CDGA 1XXHB 4B47A 3TSZA 5DISB 3RANA 3PUWA 2WSMA 4UNSA 2A5FA 3SYNA 5BXQC 4PHHA 4DIEA 5HCNA 2FNAA 2EYQA 1UEJA 4KXFB 1ZNZA 2J1LA 4S2EA 3ZH9B 3AV0B 4H1UA 1F48A 2BCJQ 4G01B 5FTMA 5K8LA 3FPAA 3FDIA 3B1ZA 2J46A 5EZ5A 1GITA 2V1UA 1WMSA 5KDLA 4Y0VA 3GFTA 2XSZA 5AUQA 4YC7A 3OFNA 3VR3A 3DOFA 3KQHA 4Z51A 2V3CC 1TPZA 2ZETA 4M9XA 1UDXA 1Y63A 2R8RA 3FHCB 4W5WA 4TYYA 3N70A 2W0MA 5FL3A 4C0HA 3NKVA 4HLQB 1RFLA 4GMDA 3EIQA 4GP7A 4B71A 2HYDA 2ZRJA 1I4LD 4IVPA 4MGIR 3BOSA 2ZIAA 1GNQA 4URUR 4ZIRB 3RS5A 3BE4A 2VP5A 1LV7A 1ONBA 2Q3FA 2VPPA 4B2IA 4ZV4A 1G291 1XMIA 2QMEA 2JIZD 3B13B 3L0OA 2JGNA 5J4VA 3BFVA 3LQRA 3WP0A 3NH9A 2CVFA 5EP4A 2QP3A 1UKVY 4KBGA 1F6BA 1LS1A 2VSFA 1YVDA 4JLVA 2PX0A 1LFDB 1G3MA 1M6NA 4W7SA 1FP6A 3VMFA 3THWB 4Q00A 4QJ4A 1NG9A 4BECA 3MAAC 4KO8A 2P6RA 3UWOA 2IA5A 1N6NA 4D2IA 3EZ2A 4XVUA 2GA8A 8OHMA 4OYHA 1JJVA 5CLQA 1P9NA 2ZJZA 3SJBA 5D3MA 4ZDKA 5FOTA 2F1IA 1EGAA 4JL8A 5DHAA 3AVVA 3S1AA 4ILEA 3AF4A 3RC3A 5J47A 3FHTA 1G7TA 3NC0C 1HT2E 1IBRA 2TMKA 4RFVA 4EFLA 2AXPA 4BPBA 4TL6A 2WJGA 3TUIC 3DMDA 4F91B 3REFA 2HJGA 1D6JA 2KE5A 2WVJA 3Q3JB 4KHZA 1EX7A 5KPJA 2R6CA 3F0TA 1FOEB 1MT0A 3TQCA 2WSSD 3VR5A 2OE2A 4E03A 5LD2C 3EW9A 1RKBA 2O0HA 3RABA 2G83A 3UIEA 2WPDA 4KFTA 3U61B 3U3MA 2VEDA 3N2IA 3TUZC 5KSYA 3DOEA 3MJHA 4IFBA 3P32A 2IS4A 3QKRA 4NTZA 2JEOA 4F4CA 1UBCA 3VX4A 2VQSA 5JRJA 3Q85A 1X86B 3HR8A 1TUEA 2WTUA 3A4LA 2DWQA 4EPXA 1GVNB 4JL6A 5CIWA 2G0NA 1EFRD 4JYBA 2IXFA 3K9GA 1OKKA 1J7KA 1GFIA 5DH9A 3GJ5A 5IK2A 1G8YA 2A9KA 1IY2A 2ZAMA 4AYWA 1CP2A 3D7MA 4II7A 2ZJOA 1W46A 1MO4A 3IIMA 3KJGA 2CLSA 4KFSA 2FG5A 3T34A 1S3GA 4V0MA 4A8JC 3RWOA 4DCNA 5FPYA 2ZRAA 1ELOA 2FX3A 2BJVA 2RKOA 2ZI4A 1W5SA 1RJ9A 1U2RA 2ZJ8A 3BJIC 3LBNA 3KX2A 3RRMA 1II9A 3SDZA 3AVOA 1Z0JA 1B23P 4P0TA 2ZR0A 3PV0A 3PUXA 3OAAD 4N0DA 4LJYA 4OJQA 5EUQB 4DLZA 4DRZA 4PAQA 2YOHA 1OE0A 1X1RA 2ORWA 3PR1A 4PFSA 2HF9A 4BZXA 621PA 1TQ4A 4Q01A 1PUIA 3MGCA 2ONJA 2IYTA 3ONWA 1GP2A 1KI7A 4M53A 2OCAA 2IT1A 4BZQA 1T5IA 3V9PA 1X3SA 1Z28A 5AJZA 2IYQA 3IQXA 1G3UA 4WZBE 2J5XA 2RGGA 3X1DA 2C95A 4TLAA 3A1UA 4I1VA 4R2IA 4X8HA 3NWJA 3NXSA 1R8SA 4KFRA 5KOYA 2N46A 4JLDA 1FMJA 2WJVA 3SE0A 5E7IA 4C2UA 3F8TA 2VP4A 2PLFA 5F98A 1CTQA 3X1WA 4Q7JB 1WE2A 1KY2A 2JDIA 4ZDIA 1OW3B 2Z5FA 3IHLA 1E2EA 3PCRB 1VYUA 2B6HA 1NLZA 1S96A 1JALA 1FMLA 2RGNA 2QE7A 1OYYA 3K8YA 2OZEA 3KQUA 5AWFC 3SEAA 1L7VC 2OCBA 1VCOA 2OT3B 2O0KA 3I32A 3PXGA 2D3WA 4TMZA 4U00A 3VQTA 1DAMA 1R6BX 1VMAA 3THOA 4PX9A 4PSVA 4R7ZA 3GEHA 2KB0A 2CL0X 4IOKA 1ZRHA 3UXMA 4BLTA 1GKYA 4Q9KA 5DE3A 1BYUA 1IAQA 1NVUQ 5CYOA 2JLYA 3AEZA 3OESA 4LK2A 1OFUX 1UBFA 1G7SA 3CUEF 3U6KA 1TU4A 1XD9A 2BKEA 3R7WA 3CRQA 2BBSA 1SXJA 5SZJA 3AGPA 1G18A 4NCKA 1IY0A 1RYHA 5DI9A 5C46F 1NVVR 4RCYA 3L8YA 4TYQA 3CO5A 4URXR 5KNDA 4Q18A 1OHHD 4Q47A 4FIDA 5FI1B 4Q02A 1DE0A 2FE4A 2GNOA 1W2GA 4IVRA 4MITA 3A37A 2AR7A 1H8HA 1W36C 2G6BA 4V03A 1EG7A 2ZE6A 2EFGA 1BO6A 1UEIA 2LKDA 4HZIA 3DKPA 4MRRA 2WAXA 3C15C 1KK3A 1AM4D 5FPHA 1RRGA 5KHOC 3HYRA 2ODBA 2JLXA 1DARA 2RMKA 1ESNA 2XAUA 4JYCA 1E9AA 5TXGA 2NTYC 1IN6A 2A5JA 2PLRA 4D4KA 5LB2A 5D3QA 4EIWA 4GFDA 1FW6A 4DDTA 4HB0A 1JNYA 4E5UA 1T3LA 4YMTA 5BN4A 3GLGB 1XF9A 3TIFA 4B3BA 1ZVQA 1ZNWA 1II8B 2WM9B 4M1YA 1ZYUA 1NKSA 1G3QA 4LCBA 5TV2A 2QMUA 4BFVA 4OQLA 5FH9A 3MD0A 4BASA 1E94E 4LPSA 2P0EA 5ANRB 1D2NA 5HZHA 1BMFD 4P31A 3CBQA 2GK6A 4LJ7A 4TYWA 3WMEA 1OH8A 3EZ7A 1RC8A 1LW7A 2ZEJA 4O25A 4PQYA 2QTFA 4KSCA 3O8RA 3KKNA 3GLFB 3IBGA 1E9BA 1A4RA 1XMVA 1XU4A 4JVSB 4GZMA 5K8UA 4PC2A 4RFSB 1AQYA 2DBYA 2O5VA 3H84A 3SR0A 121PA 1W2HA 1NLYA 2Z6VA 4B2LA 1N5IA 4ABYA 3D3QA 1CF4A 4MDEA 2H17A 4LV6A 1HV8A 2XX3A 1I4DD 3M1IA 4FINA 4Q1BA 3QUSA 1EFCA 4DEXA 4KI0A 3ZZTA 2ZE8A 3GEIA 2RGEA 1IN5A 4V0OA 1JB1A 2W83A 4XWKA 3VKHA 1S0UA 2G77B 3EIEA 3HWSA 1NN0A 1E2FA 5JI2E 3H86A 1RRPA 1S3SA 1VDZA 5CM8B 3WMGA 4CEHA 2ZU6A 4QGFA 4A8JB 3BK7A 1VIYA 2V6JA 3QXHA 2Q9CA 3AKEA 2HUPA 2AWNA 2FFAA 2YVUA 3OE7A 4XSGA 1TUIA 5DN6A 1KZ7B 4C0KA 1QZXA 3KJIA 1W0KA 1E0SA 3AUXA 5F9FA 1TAGA 2CVHA 1J8MF 2ZXUA 2HLDD 3SU8A 3GQBA 2ANBA 4M1SA 2PZGA 4M21A 2IUUA 4WOPA 4JS0A 4JBXA 3A1SA 2WWGA 2O8CB 1Q1BA 3QG5A 5C1BA 2OFXA 5AR1A 4B32A 5GVSA 2GXQA 4OHVA 4DBLC 1YQTA 4V0LA 4MGKR 3SFZA 4AKHA 1NRJB 5SZKB 3VHXA 5JS8A 1GKUB 1FX0A 1XP8A 1E1QD 1VIAA 1G64A 1S1CA 3VU9B 4BGDA 4IKEA 1NIPA 5B57C 2OO7A 1T3HA 1KO7A 4YMUA 1ODFA 4FMBB 1SZPA 2Z0MA 1CU1A 4H1VA 3W6OA 3LBHA 3FGNA 2WKQA 1KSJA 2GRJA 2J0VA 4XTCS 4Q1CA 2Z83A 1E9EA 5FL7A 4ZDJA 1D8TA 3RNLA 1C9KA 1GKIA 2WWIA 2WWFA 2WJJA 1U8YA 1UJ2A 3GLHB 3FYHA 3E70C 1PZNA 2CJWA 2GHIA 1DAHA 3UPUA 2Q9BA 2QZ4A 2W58A 3QXCA 3GLIB 2AHOA 1Z83A 3I8XA 2NQ2C 3NG1A 1VG1A 1ZMXA 2YWEA 4TL9A 4CEJA 1K6MA 3T1TA 2C04A 4Q4AA 3WYGA 2O8DA 1GNPA 3AVWA 4JLPA 3IPYA 3K70C 4UJ3A 1G7RA 1XEWX 1CXZA 2PT5A 4PPNA 1NVVQ 4C0LA 1J90A 1N5LA 1QHSA 2A5GA 2ZPTX 2AD1A 2F3TA 1XJQA 2C9CA 4P3YA 3ETLA 4WBSA 1WRBA 1ZIOA 1SVLA 4D0NA 5HKKA 4DT1B 5EE5B 2X19A 3AVPA 4LBZA 1NN5A 4XJXA 2DFTA 4BRUA 3B6EA 1KTVA 1Q44A 3QNUA 2D62A 3L2OB 4LJAA 4DZZA 3PITA 1P2SA 3CIOA 1O3YA 2W6IA 2QTHA 2VH5R 4HZUB 4YONB 3IQWA 4JIMA 2R6FA 2LWIA 2DB3A 3CZQA 1NBME 4A6XA 1NMXA 2F9MA 2W6JD 4M9ZA 4NCNA 4UNNA 3BD9A 3LW7A 2OV2A 4AD8A 2BM0A 1P4SA 3R20A 4OKSA 3GJ3A 1NSFA 1HYQA 1R0XA 4XWAA 5UKDA 2O8BA 1R0YA 4E22A 2F1RA 1IJFA 2FEOA 3CPJB 2GF0A 2P67A 1IN4A 4LC1A 1JECA 1S2MA 4D6PA 3AVTA 1FQKA 1JR3E 3NEYA 3VTKA 2OESA 3I1FA 5EP2A 1QHGA 5JLJA 4NL4H 4DC9A 4KCGA 3L0SA 1N25A 3VR1A 1ZW6A 2R9VA 4LHZA 3JZMA 1XXHA 2JLUA 4JMPA 2RHMA 1OXTA 1GRRA 4HI0E 3TVDA 1NSTA 1SVSA 2GZDA 1S9HA 2B8WA 1MRSA 4K8OA 4L8GA 1MO3A 1D9XA 2AWOA 3HU3A 3SZRA 1VCMA 4PC6A 5J4HA 3AKCA 1J8YF 3WBKA 2YZ2A 1COWA 2JJ1D 4TQUS 2FSGA 4YMVA 3FFAA 5JSZB 4DCTA 3BWDD 1M8PA 2FPMA 2PZEA 2DCUA 2BMFA 4YXWA 2F3RA 3AP2A 4NYIR 5HR5A 4YMWA 4LRWA 1DBSA 2BKUA 1P9WA 1UADA 2XNDD 4GI7A 1GG2A 3GCGA 3QXJA 3ZZUA 4M9QA 1H8ED 3NVAA 5CB8A 1FFHA 4OHYA 2YHSA 2ZRBA 3AKDA 4NH0A 3SI7A 1E2KA 4IW3B 4US0R 4DVGA 3AKYA 4ZIRA 5A0FA 3SBDA 1BYIA 1T0JB 4RD4A 1A82A 2SHKA 2HLDA 1FNNA 3QXSA 4P33A 4NYMQ 3V4FA 3B8HA 3PUVA 1GDDA 4LBVA 2PCLA 4NZYA 5DI3A 2V6IA 1CJUC 5A4JA 4OQNA 3NDPA 3CX6A 1QHYA 1E0KA 3TH5A 3LAWA 3IEVA 3KB2A 1D2MA 3EC1A 3ZDQA 4ZI2A 3WNDA 1TADA 4POAA 4JVLA 5GJCA 1YJ5A 2AXNA 5E7MA 4PAMA 1GRQA 1VHTA 4TMKA 3RS0A 3QOFA 1FTSA 1XX6A 4YDHB 5KSOA 3RSOA 4B74A 2IYVA 2UKDA 3BIFA 4F7WA 1E79D 1P9RA 1ZINA 4OL0A 4A0FA 4L4UA 2QU8A 1HQCA 5DHFA 2GESA 1OFTA 2F7SA 1HE1C 1CJTC 1IJEA 1VYVA 1VG9B 4PPQA 2YOGA 4M1MA 3THXA 1WDTA 3L82B 3AVQA 3GJ0A 2QENA 1UDWA 5G3YA 4AKEA 2XZPA 4HLUC 4M8NE 1P60A 4R71A 4OHXA 1ZU5A 3KXIA 2OCPA 3DL0A 5G3ZA 4QG7A 2C77A 2QL6A 4UJ5A 1EFHA 2RCNA 3WP1B 1MRNA 1MO6A 4UXIA 1J99A 1ZU4A 1M7HA 3FTQA 3TK1A 3ZJYA 3ADCA 1F60A 5EP1A 4QXAA 5B58C 2R6AA 2FF7A 2A3RA 2J7PD 4MUBA 5CM9C 3DPUA 4H9GA 2VP6A 3GJ7A 3VHLB 2V8OA 4URZR 1RE0A 3U60B 1ZJ6A 3T12A 2ZROA 4B3XA 1U8AA 4C4PA 4DEYA 5J4LA 3PVSA 2CCGA 5KTYA 1E9SA 2ZJBA 4CT4B 4M22A 4IXMA 1G19A 3SOPA 4Q4JB 2XTMA 4A2WA 3AGQA 2DFNA 3DDCA 3SQWA 2G3YA 2FOLA 4EQ6B 3SJZA 4GL2A 1AKYA 3G0HA 3THYA 1JR6A 1AIPA 4B6EA 2NO0A 4DUGD 2JLZA 3EPLA 1XPUA 1ZC3A 3SYKA 5CK4A 3IKJA 4QFMA 1JBKA 2OUKA 2JJ2D 3R8FA 2JLSA 3PIRA 4HYYA 4QGHA 4FWTA 3NHBA 3AF3A 4M1OA 3LFUA 3OEHD 1X8JA 2HXSA 2QSYA 2WIBA 1HTWA 2EWWA 5FUVA 2GCOB 5DO9A 4CEIA 2ZRGA 1BIFA 2FWRA 1P5ZB 3FKQA 3H0KA 4TSFD 4HDCA 3CF2A 3WYFA 2V7QA 3O8CA 1E9RA 1QVRA 3UMRA 2BWJA 2IYUA 1B0UA 4KFUA 2Q3MA 1NMYA 1XPOA 1CJKC 3VNUA 4Z8YA 4PZZA 3FKSD 2AX4A 1I2MA 1R4AA 3K0AA 4V0ME 1Z6GA 2ZI9A 2JLWA 2WWWA 1ZIPA 3AF0A 3N2EA 1A2KC 1QRAA 5EE3A 1XEWY 3ZYCA 4NYIQ 3ZVNA 3ECCA 2ZQ5A 4G1UC 4JL5A 4TMWA 1N6KA 4EJSA 4FCWA 1E9DA 3FFBA 3HPQA 3RRZA 4MRSA 3BB4A 2B8TA 1TQDA 4L16A 2ASEA 1AJEA 2CLDX 1N6OA 5JCZA 4PHGA 1E4YA 2CHVA 3WMFA 2WJYA 4KJZA 5G40A 3LDAA 5CLLA 1G20E 3TW4A 1Q1EA 1X8KA 2FFHA 1JPJA 4XTRA 4LHVA 4UNRA 4YMSA 4EJSC 3QQ5A 3CWZA 3PENA 1ZCAA 2P6NA 1KY3A 2ZR7A 2ZSDA 3X1XA 3ZLJA 2QTVB 1DPFA 5FBLB 2DWPA 1KI6B 3NHAA 1LVGA 5CJ2A 2KBFA 3QF4A 2GEDA 1I2DA 3QG1A 1RPZA 3QIAA 3MMPA 2F1JA 3AB3A 3QKSB 4BFSA 2FGJA 2H92A 2J41A 3Q7PA 2QPTA 5AUNB 4Q9JA 2ZRIA 3TR5A 1UPTA 1VPLA 3MRSA 4OQXA 1X6VA 1YR8A 3HJNA 4HAZA 1E96A 1RVDA 2JLRA 4BRWA 3J81k 3SHWA 3CR8A 1NMZA 4DKXA 3NDBB 4QGGA 3CB4A 3TQFA 4QM7A 4HUQA 1W1WA 2BBOA 4RJLA 4DCVA 3TUJC 1G6OA 3W8RA 1TTTA 4JLNA 4D81A 4M9SA 4OHWA 4TLBA 4D4LA 2ZS7A 1E2NA 1P62B 1SVWA 2CE2X 3OIYA 4LJ6A 1Q21A 2J59A 2Y8EA 5HE8A 2WMOB 4DLXA 4A15A 2MSDB 3IIJA 3KKMA 4ARZB 5EP3A 4IEIA 2DWOA 1DO2A 1Z0IA 2HJVA 5BW8A 2CNWA 3KKOA 1QHNA 5HZKA 1II8A 4PSAA 1U90A 1ZNXA 4XVRA 4AC9A 2WBLC 2ZI6A 4JLOA 5KUTA 2WWYA 3UATA 1KNXA 3U3JA 3PEUA 4LC0A 3ZIAD 3A1TA 1R5BA 3H4MA 1SXJE 1NI3A 2E87A 1AZSC 2FH5B 4NBSA 1E2MA 2QAGB 3IILA 1ZD9A 3TMKA 2FMXA 5FI0B 4A92A 2NO7A 4HDOB 2PEYA 3OIVA 5HTKA 2ZRPA 1YZKA 1D2EA 3KFVA 2GEUA 2CDNA 4YDSA 1SQ5A 4N0EA 1OFHA 1ZUHA 3FWYA 1NJGA 1UBGA 5DGXA 5TVKA 4IXNA 3I4LA 5B64A 2DPXA 4URVR 5J4YA 2BDTA 4PXAA 4TTRA 1NP6A 4Q4HB 3ADBA 3MWJA 5CDFA 2NPIA 1E9CA 2NGRA 4G5SA 1ANKA 1P2TA 3E2IA 1VYTA 4LYJA 1G41A 2C9OA 2ZRCA 3MSXA 3V00A 1E2IA 1FQJA 4DB4A 2PBRA 4JT2A 1P2VA 1U81A 4QBFA 2FDCA 1NL3A 3GFOA 1KMHB 4XH9B 1U94A 2YJTD 1QVAA 4KYUA 3WBJA 721PA 3FE2A 4IDQA 5FTNA 3LH5A 5L3QB 3ADKA 3CNOA 2A5DA 1KK0A 1NIJA 3BB1A 4EPWA 5K8IA 1S4QA 1E32A 4TT3A 4M0LA 1KO4A 3RSLA 3SBEA 3I5XA 5FOXA 2PH1A 2VF7A 1MH1A 4MGZR 3D6TB 3BBPA 4C0SA 1MKYA 5KSZA 5F3WB 4LY6A 3HPRA 2VHQA 4M1WA 2OEPA 2QA5A 1IN7A 2QMHA 2VA8A 3B78A 5EXXA 4B3GA 4C7OA 2RGXA 4P32A 1TF5A 4BFUA 1KI9A 3MLEA 1EFUA 3ZQ6A 3K0FB 3KL4A 3EZ6A 4M1KA 5AK0A 1AS3A 4BFYA 2XXAB 3C41J 2NIPA 3VU9A 2FGKA 1E2DA 3U44B 2QT1A 5IHPA 4EPVA 2ZI3A 4PPFA 1UF9A 3W6NA 1IHUA 1KSFX 4Q4LA 4BLRA 4PANA 5FBVB 1UM8A 3O8DA 2FU5C 4DB2A 4B3CA 3TRFA 1U9IA 1GTVA 2C9YA 3VR4A 5JWOA 4KBFA 4GNKA 4NYJQ 4MA4A 4EFNA 4D82A 3CRRA 3F5FA 1W4RA 4RD1A 5C4MA 4TLCA 3I92A 4NCJA 1XD2B 2RAPA 1D9ZA 2ZJAA 3AVYA 1A7JA 1YZTA 3SN6A 4GT1A 3GLHA 2VIIA 1VTKA 2KSQA 1MOZA 4E07A 1D5CA 1OLOA 4NHOA 1F2TA 1F2UB 1CR2A 2JA1A 2R65A 1NN3A 3HU1A 3K1JA 3C8UA 3KTAA 4I4LA 5B2ZA 3MG9A 1GSIA 1US8A 3EPKA 1NKTA 3R9IA 4G5QA 3ZQJA 3GFPA 1EESA 1N2CE 2AFIE 3U4QA 2XOKD 3K9NA 4TLDA 1XTQA 1F3OA 1M2OB 3QE0A 4OI1A 2D4HA 1KOFA 4F4IA 2JIZA 3RYTC 1JXMA 4UNPA 4M2LA 3BB3A 1IXZA 2IYSA 4PC3A 1YR6A 2ODWA 4JLAA 1Z8FA 2ZAOA 1G17A 4MRPA 4Z1MD 4RD2A 3B2EA 3T5GA 2IW3A 2RGNC 4TWZA 4X8LA 2BOVA 3KFXA 5AJVB 4DT1A 4AG6A 3BRWD 2AN9A 1CULC 3B1VA 1Y3AA 3GJ4A 1KSGA 3DM9B 4C9BA 5DNYB 2LCFA 1N6HA 4HZUA 4WA7A 4FMCF 5FOWA 4MH0R 1ZP6A 3T1QA 4FMCB 3K09A 3ZS9A 3T06B 5JECA 3TGPA 4LBYA 1LS6A 4OBEA 2FJUA 1SVIA 1PLJA 2XTNA 4CVNA 1OIWA 5J5CA 4QOSA 3KJHA 3A6PC 3U3KA 2G9NA 2ATVA 2J0UB 1SXJC 3MWKA 2ATXA 3QEOA 1FZQA 2UZ3A 2WSSA 1IN8A 2QBYA 4LYAA 4ESVA 2D06A 3W3ZB 3B1YA 3RRYA 3GJ6A 4F92B 4MKHA 1V43A 2V9PA 1KSHA 1E99A 3K09C 3IO5A 3T15A 4IHQA 3MWLA 1ZUIA 2X1VA 4I1SA 4ZKEA 1Z6TA 2RGBA 1G5RA 3B5JA 3RS2A 1XEFA 2H7VA 1OXUA 3CRMA 1XTKA 2WV9A 1KIMA 3R8CA 4B76A 1KKLA 2EFEB 4JKYA 3O8BA 5JSZA 3AH8A 1UFQA 4GOJA 2KJQA 3CM0A 3CF6R 1KI2A 1JXOA 1EFRA 2ZYUX 4D4MA 5D3MB 2GAAA 1MABA 3EWSA 5LD2B 2GXSA 3UG6A 4D25A 4DSOA 4DSTA 2IS6A 1ZM9A 1OXXK 4AURA 3S1AB 1XEXA 5GJVC 4XD7D 5DLQC 3U7FB 1M1YE 1FP7A 2JAQA 3QVVA 2VHCA 1N3BA 2ZTSA 1JQLB 3TR0A 1E1RD 2GVZC 1ZM7A 2QT0A 4BFZA 2ZYTX 5H8WA 1SVMA 3RHFA 3FVQA 4ZKDA 3UKDA 3B1XA 4NU0A 4WXPA 3LX8A 1F5NA 2GXUA 1M7GA 1XXHE 3OAAA 2IUTA 3B9PA 5L3SB 2RHDA 3GP8A 1G4UR 3B82A 4QL3A 2QM8A 4LSGA 2O8EB 3KQLA 1JAHA 4KLZA 1NVWQ 2MMGA 2G88A 3QPUA 4B75A 1Z0KA 2WZQA 2DFLA 5JS7A 2REOA 4QHYA 4TQ9A 4HDQB 2Z43A 3KUCA 4PR0A 2P5TB 1YU9A 2MSCB 3X1YA 2B92A 4NYMR 4LUCA 4US2R 5TY0A 2WKPA 2ONKA 2QAJA 5C4GB 3WNCA 4A2PA 1U98A 2WAYA 1XFAA 1W47A 3WRXC 5J40A 1GUAA 2XGJA 3B85A 2ZSAA 2I3BA 3MUFA 1T4GA 5AUOB 2QNRA 4RVCA 5KNBA 1JPNA 2PZFA 1XNJA 5JJIA 1CRQA 2A2ZA 4KITB 1RJ9B 2KBEA 3P26A 3RRNA 1Z6XA 4URYR 5JWHA 4K46A 4AYXA 2D7CA 2JASA 1N0WA 2H1LA 2OAP1 1E0AA 4OHZA 1T9HA 2PL3A 2NO1A 3A4MA 3LBIA 2J87A 2CHGA 4LHXA 2C8VA 3RS7A 2CXXA 1N5KA 4A1FA 3MWYW 2OFWA 1QHHA 1N6IA 2I1QA 4Q48A 3SQXA 4UXJA 3A4NA 4QM6A 221PA 2GBLA 2Q9AA 2BBWA 4I1OA 1I4TD 2RGDA 2ZRHA 2A30A 4Z1MA 4AK9A 2OXRA 2PEZA 3WHKA 4PHTA 2E9SA 3I3SR 1K5DA 3A58B 5EJEA 4R9UC 2MMCA 2VHJA 5KSPA 1WB9A 1IM2A 2ZR9A 3AQ4A 4M1TA 3KUDA 4Q19A 521PA 1UKZA 3CRW1 1A1VA 2YWGA 1OHHA 2JJ8A 5CK5A 4Q9IA 2GBLC 3P20A 4Q7MB 3VKWA 4W9MC 4LJ5A 421PA 5KO2A 3QXXA 1DS6A 3LX5A 2EU8A 1KZGB 1E3MA 1Q1ZA 2ZI5A 4Z54A 1GZSA 4V02A 2REXB 2NO9A 4OI4A 4IEEA 4B3FX 3IO3A 2R2AA 4PTLA 2YKGA 2W2TA 2UZIR 3FMOB 1SGWA 2IBMA 3CWQA 2ZSBA 2ZSEA 1FPMA 1HH4A 2ZE5A 1XZPA 3AVXA 1NBMD 2W0SA 1DO0A 4LGMA 1OH7A 3B1WA 1W36B 4Q66C 4HB4A 1E0JA 2XZLA 3R9XA 1GWNA 4L9WA 5FUWA 2VP2A 5DYGA 1G8PA 3C16C 4ON9A 4LHYA 5EXTA 2IEYA 3R7WB 2WKRA 1SXJB 4L9SA 2BVNA 1BMFA 4KLNA 3IIKA 4NDZA 2FZLA 3C14C 3LA6A 4RZXA 2EFCB 2H5EA 2JLQA 3LVRE 1CR4A 5E7JA 1K5GA 1QHXA 1CRPA 1CEEA 2ZRMA 3NBXX 5AJXA 1V5WA 2CEAA 3TAHA 3MJRA 1KMQA 3PUZA 2V4ZA 2NZJA 1Q12A 3NC1C 3UMSA 3T61A 4KYIB 2EW1A 2BCGY 2IWHA 5JEEA 1J70A 4EDHA 5FOSA 1WP9A 2OG2A 3OEED 1XJ0A 3IDQA 4JKIA 2IF0A 2RGAA 4MYCA 5FBRB 2ZS8A 1E2QA 2E1RA 3MCAA 4G3XA 4HAVA 5BYJA 2LKCA 1UKEA 5JBQA 2CK3D 4KV9A 3VR6A 2X2EA 1U0JA 3W90A 2AKYA 3PG5A 4CIDA 2P5SA 2VSXA 3SYLA 1E2HA 3KB1A 4NPHA 1ZD8A 1KI6A 2V1XA 1VCNA 4Q1EA 1P61B 3LQQA 3EWAA 3VKGA 5H70A 3QKSA 1LF5A 3QENA 4JJZA 1ZM2A 5C18A 4DLYA 2HT6A 2ANCA 1R7RA 3PJRA 1G4AE 1YRBA 2VTKA 2YNMA 4BQSA 4DLRA 3I8SA 5AJWA 3THWA 2I4IA 2FFQA 4ZCLA 2H16A 5IF9A 1NVXQ 1E1QA 1DOAA 1OF1A 4ZPXA 5M04A 2QY9A 1L8QA 1G9XA 1SULA 2C03A 2ZSFA 2FSIA 1DG1G 4L5BA 5IT5A 2X8AA 3OFND 4OQFA 2WWHA 4GSYA 3L43A 2WOOA 3ND9A 1AS2A 4MKGA 2CLCX 4RZ2A 4ARZA 4Q1FA 3Q72A 5DIFA 4C0AC 3ZGXA 3OIWA 2ERYA 1TF7A 1KO8A 4R2HA 2AK3A 4Q03A 3QEJA 2QGZA 3I72A 1L2TA 2C98A 1G3RA 2NPFA 3T5DA 5HPYB 2YC2C 3EPHA 2IC5A 3W3AA 2NZ8A 3OF5A 3IHWA 1R8QA 4MKIA 2QAGA 4IVQA 4AIIA 4Q7KA 1W48A 3LXXA 2PCJA 2QI9C 4G0NA 2NG1A 2GCPA 4DDVA 2I1VB 4O0MA 1KO5A 3I73A 1E2LA 3MFYA 2OSBA 3ZD6A 1CBUA 1Z07A 5JMTA 1P73A 1W4AA 2BMDA 1NN1A 2YWHA 4MGYR 5G53C 2IHYA 2OBNA 4Q4HA 1ZBDA 3SJAA 3QBVA 4ACAA 2GJAA 2QROA 1KDTA 4JT4A 4KVGA 2BEJA 1N0UA 3AP1A 5KYKA 3I61A 4P4SB 2GJSA 4GMXA 4AG5A 4HSEA 3K70B 1XPRA 3KKQA 4BFWA 4TMXA 4TQAA 5EE0A 2CL6X 1NG1A 4F38A 1NJFA 2DFKB 1PV4A 3FMFA 4HLDA 1ESMA 5L3QA 2W6JA 5FFMA 2ZRKA 3GJ8A 2CJWB 1ZC4A 1VG8A 4NMMA 4B2PA 2ZJ5A 1YZGA 2OFOA 2IYZA 2C78A 5EXSA 4AWXA 2GJKA 3G5UA 2IHBA 3U7EB 4HB2A 4Q4AB 2O8DB 1T8TA 1BH2A 5LBIA 3ZS8A 2CCJA 2XJ9A 1GL9B 2BMEA 4RSGA 4HAXA 2OBLA 3C7KA 1HUQA 3EARA 1T6NA 1PVOA 3DMNA 3GJXC 3W6PA 1OT3A 5FTKA 3SNHA 2O8FB 3BFXA 3RVBA 1QDEA 3ASYA 3EPJA 5CDFE 2ZANA 4WIAA 3DHWC 2OXCA 1PJRA 3HYTA 1E9FA 5EZ6B 1OKKD 1ZM3A 2JJ1A 2NOAA 3GEEA 1W44A 5IK2D 3CR7A 1QHIA 4AYTA 2BC9A 1Z6YA 3NTUA 1UAAA 2CE7A 1QBKC 1EK0A 5JZVA 3TE6A 1ZM4A 3DM5A 3LO5A 1NY6A 2WJIA 5FOUA 2QQEA 2KI5A 4IDNA 1J2JA 1Q3TA 1XCMA 4JVMA 2HCBA 4XSHA 2XNDA 4KU4A 4Q9LA 2QP4A 3QJYA 2IWRA 2IUSA 4QNRA 1RYFA 3ADDA 3OIUA 4HATA 1XTJA 1H8EA 3BS4A 2O8BB 2CL7X 4FI3C 5G41A 4PO8A 4G5RA 1TNDA 5EUMA 3LRPA 4NYJR 4Q1AA 4QBGB 4RCZA 4P4TA 4BFTA 2RGCA 3KZ1E 3BH0A 2W2XA 3EASA 4Z8XA 1OXVA 5E95A 1XDBA 1CS4C 4A82A 1KK2A 2BIFA 3AM1A 1FNMA 2YV5A 2VLIA 2FFBA 3BH6A 3P4YA 1FL9A 2BHRA 3KXKA 4ACBA 3EC2A 1T91A 1XD8A 1KO1A 2A7QA 4CRWB 4FCVA 4DIDA 4NCIA 3EXAA 2FPKA 4M4SA 2GXAA 3FHOA 2YC4C 1R0ZA 4RKFA 2VHTA 5DSZA 1DAGA 1DELA 3W5JA 1VHLA 1KGDA 3D8BA 4B48A 1YZUA 4A2QA 4GP6A 5JCPA 1X8LA 4CYMA 3VR2A 3KKPA 3HR7A 1E79A 2RB4A 4D26A 2ZRDA 3GLHE 4KODA 2QM7A 5CB6A 2JDID 1DAFA 4BFXA 4OI0A 1Z5ZA 1S8FA 2F43B 2VF8A 4DSNA 1OB5A 3GLIE 1CIPA 4HAUA 3ICQB 4QHTA 4PZLA 2QE7D 3C5HA 4LX0A 4GZLA 2VHUA 4US1R 5P21A 5IRCD 3CPEA 3GMTA 1WBDA 4GDFA 3A36A 2PJZA 2G1JA 3U6BA 4Q7LA 1P72A 1XCGB 2IXEA 2J0UA 5FUYA 3U7GA 2F9LA 2GZAA 2ZVQX 3H2YA 2ZRNA 5H1YA 4IDOA 4IRUB 4KSBA 1W4CA 1S9DA 1ZAKA 2WWXA 5DI3B 5E3HA 3GLGA 4A0HA 1T0HB 1BS1A 2IYWA 4LHWA 2GILA 4B35A 1W36D 4MYUA 3QBTA 2QPOA 1G3IA 4FCTA 2GZHA 4DDUA 3TKLA 2R6DA 3EA0A 1ZUNB 1AGPA 2OM2A 4C30A 1GM5A 2ZVPX 1SXJD 4A6PA 2J9RA 2J7PA 5FPTA 4TL7A 4DDWA 2GK7A 5SZIA 4CW7A 1G6HA 1NF3A 4UQOA 3NBZC 1XMJA 4G5OA 1HQYE 3QSYA 3JZAA 1TEVA 1ZNYA 1W49A 5EXPA 4A0RA 1OV4A 6Q21A 3ZVRA 3GLFA 2OLJA 5BN5A 1H8HD 5FR1A 3QKUA 1OIXA 4RFSA 5KPDA 3EA5A 3THXB 1E4VA 1MR3F 3QY0A 3CONA 1CR0A 2W2VA 3UK6A 3G82C 3TNFA 1Z08A 3L0PA 3QKTA 4U5XA 1H65A 4P4UA 2HT1A 3GPLA 2QN6A 4DHEA 2PX3A 5FPSA 2ERXA 4R98A 4DUGA 1P7CA 5L3SA 1GAJA 2GVDC 2OBMA 3P27A 3CH5A 2GJ8A 1YE8A 2O8EA 3IEUA 4PO9A 4NONA 2C5LA 3Q5DA 5EQTA 1AS0A 2JCSA 2JJ2A 4PHFA 3DEFA 4X8OA 5FUXA 4A8JA 5KU1A 2FPLA 1GRNA 1Z6AA 3NEJA 4EFMA 1KAOA 1G8HA 1Q3HA 2QEQA 4U7DA 1OH5A 3OEHA 2QORA 2QPAA 3TVTA 1WF3A 4RY2A 4CF7A 3ZVLA 2D2EA 1W4BA 1U0HC 2R6GA 4DLTA 4TSFA 5CJPA 3TJZA 1VECA 3ZZ0A 5JJKA 3Q8XB 5FR2A 4TZ6A 4ZO4A 4N3NA 2O8CA 4ERNA 1WBBA 3RWMB 2XB4A 4JLMA 3T35A 2FSFA 3A8TA 3FKSA 1OXSC 2R44A 1CR1A 4JBYA 2FZ4A 4BLSA 4RKEA 2VBCA 3K53A 4TZ0A 1KJYA 1XBTA 2P2LA 3NBYC 3LV8A 4NE2A 3THYB 4LBWA 2DYKA 4TN1A 1G5TA 2VSOA 1E69A 1UKYA 5FBWB 1TQ2A 2G1KA 3LNCA 4GRAA 2ZU0C 3DZDA 3W8NA 3L8ZA 2NO6A 2ZI7A 1G1MA 1PLKA 3M6AA 4I1UA 3NIBA 3KXLA 4BUJA 3X1ZA 3KQKA 2AKAB 5TDHA 1AK2A 1KDOA 3OE7D 3EG5A 1XMSA 5DN6D 2V54A 4IOMA 1OYWA 5BQ5A 1W0KD 4OK3A 4F4JA 1RZ3A 4CEIB 3W9YA 3CLVA 3GLIA 5C2JB 5HCIA 1K8RA 1SKYE 2OCYC 4C0JA 4MYHA 1GL6A 3Q7QA 1U9IC 4FWIB 1IQPA 3RDPA 1TL7C 2Q3HA 1T5LA 1Z0DA 1AZTA 1XWIA 1JJ7A 1TQ6A 4JSTA 3K0AB 2NMVA 1FUUA 4BWYA 4UNQA 5J4KA 2IXGA 3A1VA 4W5JA 4XVQA 3SS8A 2HEIA 4URWR 4EJSB 4QNMA 4LJ8A 2ZM5A 1Q22A 2DR3A 4QJ5A 1E98A 4BE7B 2IEZA 4GOKA 4LJ9A 5JFGA 1EX6A 1WQ1R 1N6PA 3SFVA 4DLSA 1E6CA 1P6XA 2WICA 4XIGS 5L3RA 5JHHB 2HF8A 3LW8A 2HXYA 4DCUA 3K70D 4MYTA 3K0CA 3W5IA 1IONA 1JAIA 5FL7D 2P3SA 4MDFA 1CJVC 2A78A 3BH7A 2B21A 4MUAA 4PQFA 5TMPA 3GD7A 4PQRA 3IUYA 1VCIA 2ORVA 2ZUBA 3TAUA 4J0QA 2FEMA 1SHKA 4HEJA 3WHLA 4LV8B 2AFHE 2FSHA 4Q21A 1N5JA 4RD6A 3SC3A 3T1VA 1M34E 1IXSB 821PA 3CKLA 2VP9A 3ZIAA 4AKIA 2JATA 4Q1DA 3QF4B 2RH5A 1HURA 1Z0AA 2Q0HA 4HB3A 4DLVA 3K0CC 5GJWC 1BKDR 3WXMA 3AP3A 2GCNA 2EFHB 2F6RA 3I62A 3AVUA 4ZI3A 3QVUA 2FA9A 2PMKA 4JJKA 5HKKD 3PQCA 2D7DA 4HUQB 2XNSA 4IDHA 3VAAA 5E4FA 1FTNA 1TMKA 1LTQA 2VP0A 2ZUCA 2IX3A 2W6ID 4Y0AA 1KDRA 2H8KA 1LB1B 1YZNA 4XOIA 3A1WA 4JLBA 4LV5B 1R5NA 1YR9A 3ZVMA 1GL7A 2REBA 1SVKA 2FN4A 4BZPA 1IXRC 4QC2A 4D0LB 2GTPA 3LY5A 3JVVA 3WRYC 3DZ8A 2AD5A 4AKGA 2R62A 1U0LA 3CX7A 2C96A 2OAQ1 3BFKA 4KVAA 4OK6A 1KI3A 1QG4A 4KAXA 1O87A 3LWNA 2QRNA 2EYUA 2O0JA 4L15A 1GIAA 1CLUA 1M74A 3PEWA 4EKDA 1KKMA 2WOJA 3QKRB 1ZCBA 1LY1A 2KWIA 3TLXA 1FUKA 1Q20A 1XTRA 4QBHA 5K8TA 3E5HA 2H18A 1COWD 3EZ9A 4QRHA 2EVWX 4ZCIA 4UXHA 5JWRA 4GOXA 4C0QC 3L0IB 4AY2A 3IGFA 2IF2A 2X2FA 3ASZA 4YXWD 1A2BA 4WXRA 3B9QA 1PLLA 2IYRA 2MSEB 1JI0A 1SKQA 2QUZA 1X1SA 1Z2AA 2IS2A 4QKQA 5CYPA 1Q0UA 4BLQA 4PZYA 1KDPA 4LJ4A 1DAKA 4B43A 1Z29A 4TTQA 3TBKA 1NNEA 1RRCA 2XEXA 4JLJA 4CT5A 5B30A 3FMIA 4I81A 1G7CA 1SVOA 4WVFA 3DVLA 2GETA 4TMTA 3X2SA 3LXRA 4RD3A 1Z47A 2XZOA 2YINC 2ZYVX 1KAGA 2HYIC 4BLOA 1HA3A 3UMFA 2XOKA 3PEYA 2J0QA 5HE9A 1S1MA 4FN5A 4C7OB 5CIQA 1DAEA 4WW0A 1BOFA 2IYYA 3EZFA 1VKJA 2ZUDA 2QGNA 4CGZA 2QP9X 2Q21A 4ASUD 1YHNA 1EFTA 3QF7A 4EAQA 4Q9HA 4O3MA 1RW4A 1DTSA 2D2FA 1Z06A 2IYLD 1DEKA 4JVNA 2D74A 3E1SA 2GJ9A 5KNCA 1IOZA 1MO5A 1DAIA 3CZPA 3HU2A 2P65A 4P4SA 3DKVA 1Z3IX 5FTJA 4ESHA 2VL7A 2O52A 1QG2A 1TEXA 1EXMA 4Q4JA 3REGA 4A4DA 1AKEA 1XRJA 2XB2A 4TL8A 4EQ6A 1YR7A 1F2TB 3KTAB 1OFIA 3WNBA 3TW8B 4GPTA 1US8B 1HT1E 2ODEA 4C3ZA 4EPRA 2A5YB 3VNVA 1A5TA 4LPKA 2QMOA 4V0KA 3D31A 1G8FA 2H57A 3KJEA 4BLPA 5L3VA 3U4QB 2N42A 2OLKA 1P2UA 1KHTA 3K9HA 1RIFA 3RC8A 1OIVA 1AA9A 4HLCA 2O8FA 1LF0A 1CKEA 1HE8B
chains in the Genus database with same CATH superfamily
4OIFA 1J7JA 1OLUB 2JGDA 1KBQA 2Q27A 3VGPA 2ZZMA 1LNZA 4KQ6A 5FUMA 5J2TF 1G42A 2YYZA 2GSWA 4MJ7A 1BAPA 5A5GA 3TRIA 4WUTA 2QAIA 1ZEMA 3MAGA 3IBYA 1E2JA 2Y1CA 5K4AA 2Q3BA 3DO6A 2VTBA 4IQ8A 3LVQE 3ZZ1A 1SHZA 2J3EA 2Q5IA 1DUIA 4RTRA 1PNQA 1JR3D 2A58A 5LDDC 2P9QA 3BORA 3CW2A 5ALHA 5LMZA 3V4RA 4FFVA 1R5OA 1FXUA 3IP9A 4JP2A 2ZPAA 2HHHB 1LLQA 3JAKA 4LYHA 1E2PA 4L3WA 3C8MA 5JAOA 3U5ZB 3O7MA 2ODNA 2ZITA 1T9GS 3M0EA 3P9SA 3HCOA 2Y93A 2XQJA 3PF9A 3I5YA 2H4WA 1E1RA 2BBTA 5SZHB 1KF0A 2XJ4A 5DWQA 1G2QA 4CL3A 5GADl 1T3TA 5KDDA 1KAQA 2EBFX 4MI6A 5EWJB 1C14A 1L5LA 3RSSA 5KMGB 2Z6QA 3ZDDA 3GVXA 1UXIA 3E9DA 3KDSE 2QD2A 2HA2A 1UBEA 4LQDA 5T6MA 3VV2A 1JIJA 4H77A 4D0SA 1AHPA 4KXLA 2WJHA 1J06A 1YL6A 3KZCA 5AKIA 3UUWA 1YKGA 5LQNA 4KQ9A 4R83A 3R6TA 4MRAA 2GS9A 4MCAA 3T9DA 1LX7A 3DF9A 4KMMA 3ZDZB 5CVCA 3GHYA 3Q8KA 3RJTA 1SXQA 1X1DA 2DFVA 1DNPA 2E4AA 2VAPA 2WHQA 5GP1A 1E4EB 2CMKA 1MDFA 2Q1YA 3H1TA 4KAAA 4IRXA 1S01A 3KB6A 1H23A 3A6KA 2VPQA 2RGYA 2OILA 1OWMA 2BKAA 3ASUA 1PNTA 2IP4A 5GV7A 1GDHA 1XQWA 3NETA 5H9WA 5EIEA 1OJLA 4PE5B 2V5VA 4NP6A 2F43A 1SIWA 2JC3A 1ORDA 4G5GA 3USZA 5LMUB 3TLEA 2UZ1B 3CPHA 3HDTA 4FUQA 4RQTA 3WK8A 1Y4ZA 2E4XA 3HK2A 2Q1XA 3KEOA 4Q5IA 1O5IA 4WZ6A 3IPLA 3GJRA 3F2IA 3QPWA 2JLVA 1FYVA 3FFWA 4QBTA 5C3MA 2OV4A 1R2QA 2P90A 3GT3A 3L6UA 1WMAA 1N8TA 4DIFA 3EXIB 4GM0A 5CA0F 1CJMA 3AQIA 3DFIA 2YYYA 2RCYA 2X42A 3D59A 3GV0A 2WTMA 4DRYA 1DQPA 4TUYF 3CRVA 3FGZA 3TQTA 3F6YA 3CH4B 1V7QA 3DA8A 3OCCA 5CA1F 4TUYB 4ZVKA 2HSZA 4DXAA 2HDOA 4NNPA 1ZNQO 3O94A 1BVUA 5CA1B 2QG4A 3UKJA 4WCFB 4Z3DA 4RVOA 3ZN2A 3EAQA 1ODCA 3RS4A 3MUEA 5G1OA 1GILA 1A8QA 1N6RA 3CB2A 1Z4NA 3S2EA 3VYTB 2XITA 5IJ0A 2HHJA 2ZYWX 5B12A 1V35A 3P9NA 4HEQA 5IFLA 1ZGCA 5FWYB 1NLUA 2JH3A 2R6ZA 5KYGA 2VYVA 2VC2B 4HGPA 3O2SB 1I9CA 4X54A 1PGQA 5G0VA 1SKYB 5A3SA 3VPFA 3DNFA 4I99A 3DBLB 1BCSB 4ZVPA 4X8MA 4FD2A 1AQUA 1EGHA 1GHTA 2AL7A 1K7SN 2GTIA 3DVAB 2GPSA 3FB4A 3GWZA 3HP1A 4FW9A 2QSZA 5A71A 3RVPA 2QX6A 2WYVA 4M0EA 3V7WA 2FX5A 4IJWA 2DY0A 4KQGA 4RVGA 3WIVA 5BN3A 5AKXA 2D1QA 2H48A 4ZRMA 2QRMA 1HTTA 1X7DA 2WV7A 4Z7QB 4HAYA 3B89A 4ARVA 4UQLA 1T1IA 3V48A 4DDKA 2L0XA 3I9V1 3E48A 3WIEA 1NPTO 1YWGO 3D7KA 3K4HA 4GP9A 4O4LF 5D84A 1NQOA 5A1JA 1XRLA 5FPKA 1B8VA 4TKLA 5CLIA 2QAGC 4KLRA 4BNVA 4YRAA 4NCHA 4JLKA 3OQMA 4A23A 2UVQA 4YDQA 3J7AC 3G8YA 4TTPA 4CI0B 3GLGE 3CW9A 4HVCA 2BEUA 1YVUA 4YRPA 5A9RA 1W6UA 2CNWD 1SVUA 1NYLA 2PQMA 4PC1A 3SEZA 2FV8A 1KMHA 4R3WA 2DAPA 4G0VA 2C5HA 2FZKA 1SUPA 2VDNB 2ZREA 4LOAA 3F6BX 1TXGA 4RKRA 1UJ6A 1NBMA 4UM9B 4KUHA 5ILGA 3T5TA 2XMQA 5CIYA 3GB9A 3SHVA 1FFSA 4B34A 5LLTA 4Q3OA 1N6LA 2JHCA 1IC6A 4X1YA 2WILA 2BGIA 3VU1A 1CE8B 4R9NA 3IEPA 2FQXA 4JNKA 4B44A 4CEJB 1I4EB 2I3DA 3RBVA 3FPGA 3GR6A 5AHKA 3P4XA 2WPDD 3KLMX 1VJRA 3R41A 5EQJB 2A9JA 1JQAA 4R1MA 5CX1A 2QW0X 1EJ0A 3EPPA 3K0EA 3K4QA 1J39A 3TSWA 1JHMA 2IU6A 3K0FA 4OP2A 4B3DA 1W19A 2B7CA 1CZLA 2Z5LA 4LYFA 3RSCA 3PLAE 1P4AA 2D5AA 3WB2A 3PJGA 3ZV3A 1H2WA 4OQMA 1Z13A 4PPGA 2DETA 3KTOA 1G16A 2CCKA 3DEKA 1KI8A 3MUNA 1YJAA 5EIOA 4DA8A 4WDQA 2B4TO 1QS0A 3QU4A 4MIKA 1UPBA 1EVIA 3LWDA 4LJKA 3QWBA 4UNIA 2R97A 1XB2A 2ZBDA 4MUKA 5C1PA 1K4MA 4TOIA 5JHGB 4WUVA 4LAFA 4P80A 2YWFA 2VHYA 2FLWA 4YA6A 4NKRA 1VSVA 1IMOA 4DWVA 4OMDA 4JB0A 2PGLA 1XCJA 4UMVA 1BE0A 3NBQA 4GOMD 3WL8A 1YS7A 4FMDF 3W2IA 1P29A 4YRFA 1IVYA 3L1VA 4FMDB 2CK3A 1K7XB 3AM4A 5KKCA 1LRKA 1YH3A 1J4AA 4KREA 3AR8A 1L3BA 5IXJA 3RAEC 3GGGA 3SQOA 2WHXA 1FU8A 4UQPA 3K71B 4F21A 3ZCXA 4G2TA 1NQUA 1SKUA 3JTMA 4PLFA 5CT5A 1G21A 2P9GA 1LDBA 1U2EA 3G8DA 3NHMA 4LDJA 4OHMA 3NGXA 1K89A 4ITUA 4O3FA 4QUGA 3Q7SA 1XTBA 2OC4A 3BQMB 2QUAA 3HSKA 1I1QB 2PUHA 4WEQA 5CPBA 1M67A 5DWVA 5TARA 1Z63A 1RLJA 1PZEA 4B47A 2ZT5A 3OICA 4Y2TA 5E2BA 1EVYA 1ZGBA 2WSMA 3T7CA 3N2KA 5JYBA 4EJ0A 3CGGA 4MIYA 4ZOBA 3CF4A 1CUVA 2CV2A 1UEJA 1XUOA 1Q6ZA 1Z8NA 1L4NA 3E2PA 4HF7A 1A5AB 4P83A 2ZLBA 4S2EA 4W1SA 1M6EX 3UA4A 3ZH9B 1Q5PA 3MZ0A 4H1UA 4O8CA 3IKTA 1F48A 2IHJA 4G01B 4LWQA 4MMYB 2BGMA 2HA5A 3QX3A 4G0OA 1WW3A 1XZIA 4XI9A 1GITA 3K0BA 3ODPA 3GFTA 3U81A 1MU0A 1T6BY 2H85A 4IG4A 5AUQA 1GA1A 4EYOA 5ECYA 2ADOA 4BP8A 3KQHA 4QICA 4Z51A 3PKIA 2V3CC 4Z4IA 2AEFA 2NXJA 3DBRA 3O4HA 3IAHA 3IP5A 1TPZA 5T8KA 4PG8A 1RRKA 2R8RA 3MQ2A 2R8BA 4W5WA 5AW6A 2WSIA 1RD4A 1NA5A 2R6JA 4BXOA 3NKVA 1RFLA 4HMPA 3LF1A 4ZGGA 1YCGA 3V1KA 5B3KA 3DHNA 3RI3A 1NVKA 5BY2A 2GWRA 3BOSA 1MOSA 4XVCA 5LOVB 1ES9A 4E7OA 4RABA 3NGLA 3DYBA 3KSDO 4TVSA 4DOMA 4EELA 2Q3FA 1PYDA 4M38A 5ER9A 1KYYA 3S8EA 1G291 1XMIA 2QMEA 4MWDA 2B0JA 4DV1B 2PTHA 3K5IA 3GPCA 1Z17A 4RJJA 2HA3A 3AFNA 5H0IA 2J6IA 3WP0A 2YWCA 3MTEA 2CVFA 5TMBA 1COZA 1RPJA 2I2WA 4KBGA 4DL9A 4JLVA 2D59A 1M6NA 2P9HA 5D86A 1GQRA 3KZNA 2YASA 2Z04A 4QJ4A 3TPZA 1NG9A 3D0OA 1E5LA 5DM4A 1BGXT 4H7KA 5JTTA 1YFJA 2G9QA 2R8EA 4B46A 1DBPA 2IA5A 4ZVOA 5ICEA 2J3HA 1RZUA 4XVUA 1ZRMA 2DJIA 2VK1A 3DV0B 3GI1A 3N2ZB 3SZLA 1CY7A 3SJBA 1JFRA 1MA3A 1QTIA 3KU1A 1NLMA 1Z5UA 1EGAA 1J5PA 2JLCA 4YP7A 2GN0A 3EZLA 2CUNA 3UJDA 3I30X 3HEBA 4ILEA 3AF4A 3IVCA 4IILA 1SCJA 3H1EA 3TINA 3WSWA 1M33A 4HFMA 1G7TA 1QK5A 4JODA 1BW9B 3AJAA 1HT2E 2KHZA 4RFVA 1LDGA 2AXPA 3NGMA 3PBKA 2WJGA 3PUJA 3TUIC 2A5LA 4AJ9A 4BP1A 5JFTA 4RVHA 2NVBA 4EHKA 3BQ9A 3W4IA 4JBIA 3ZE2B 1WTAA 4FDTA 4PGAA 3G02A 3MPOA 5FLEX 3UMJA 5KPJA 2CMDA 3P0EA 1NF2A 3ZD8A 4PVDA 2ZZNA 2VT7A 2OE2A 4E03A 4EY8A 5LR6A 2VWGA 5LD2C 4G0ZA 3MERA 1V7CA 1TO1E 3PTZA 2CNDA 2ZSUA 5HK8A 3UIEA 1WM1A 2I1LA 1RI2A 4ZI5A 4M7PA 4JV5B 3TTYA 1LPMA 3TZQA 1CD5A 2DPLA 4OUDB 1LDNA 3U3MA 3DOEA 2P1RA 3ESRA 3FVVA 3OT1B 3NTXA 4K0RA 1I8TA 4PTYA 3AUKA 4JLWA 4NTZA 1DDOA 3R24A 5A1TA 4JH0A 2VQSA 3Q85A 3RVQA 3COYA 1GVNB 4JL6A 5CIWA 1X39A 2VG8A 5KYUA 3C1OA 1D7AA 3NHKA 4UEJA 1JHVA 1FTWA 2A9KA 2ZAMA 3FTPA 1CDZA 1QNLA 4U0KA 4AYWA 4BMYA 2ZJOA 5IH7A 1RQLA 1MO4A 3DE6X 1XZNA 4KFSA 3VISA 3FRHA 3T34A 5A5EA 3D1VA 1YMUA 1C1DA 4V0MA 4Z9YA 1YD7A 4CHGA 1U28A 3DEAA 3H1AA 1WKCA 4DCNA 2ZRAA 5ALGA 4X64B 4ZQBA 4LW8A 4R5MA 3AUFA 1D2AA 1IHYA 2ZJ8A 1BCRA 3BJIC 2VZ8A 4RFLA 3RRMA 2AOTA 2HRDA 3AVOA 2AOUA 5EGNA 1Z0JA 4F2PA 2G8NA 2VOEA 4P0TA 4PN3A 3IH5A 4MV9A 4ZHQA 4YTEA 4LJYA 4OJQA 3QBDA 1ZMTA 3GG9A 1NONA 2P8JA 2YOHA 3IPCA 3I9KA 3PR1A 1DKLA 4MR8A 1ZN2A 3IKVA 1TQ4A 1XZMA 1E58A 2I55A 4PX5A 2E55A 2Y71A 3CEJA 1USVA 3KU4A 3LUFA 4PBSA 4J75A 1E3DA 4KRGA 2OCAA 3F49S 3RC1A 2EKLA 2JFZA 2OHHA 2OPHA 1T5IA 4KWTA 2WP8J 3KV3O 1Z28A 1EJ2A 2AJLI 4Q05A 2OB2A 4A91A 1MAHA 4PGGA 2G5CA 3B1FA 5ALWA 4WZBE 2FMUA 3ZW7A 4NFYA 2C95A 4TLAA 1WS6A 5HTOA 4X8HA 3EYAA 4DC0A 5JNUA 3KEFA 4HWSA 3LUKA 3A4TA 3TOZA 4DBLE 5DM70 1USKA 2DT8A 3CUWA 1V3VA 4BP3A 2YBEA 3E7XA 4BJ3A 1R16A 1UXOA 4OHFA 1NTRA 2G1PA 3L05A 1NBAA 4FYKA 5AOBA 1FNSA 1CTQA 3GJYA 3RFCA 3ZKWA 3N7TA 4ARUA 1WE2A 2B5WA 4DZRA 5K0FA 3E8MA 1E2EA 1Y8RB 3IEIA 3HYNA 3PCRB 4JC0A 2B6HA 4LNUB 5ALOA 1JALA 1FMLA 1JU4A 2RGNA 1Q50A 2VJMB 2ZIXA 4Q6BA 4X3OA 5TR9A 3U7QA 3ZGVA 1OYYA 3K8YA 4J16C 5JVDF 3KQUA 2B83A 1YIOA 5AWFC 1LPBB 1L7VC 5IARA 4EH1A 4JP5A 4EG0A 2PXAA 4QQFA 4JI6B 2O0KA 3L0BA 1GPWB 3C6YA 1PZGA 2FVYA 2QVLA 3B3FA 3S68A 3TZHA 4CQLB 4D3ZA 5BVHA 4TMZA 3VQTA 1MNAA 1DAMA 2OCKA 1QZUA 4R7ZA 1SHLA 1XROA 5ES3A 4Z4GA 3VHQA 3WGTA 3UAVA 1HL7A 4U3JA 5DE3A 1JGTA 5B7GA 2VP3A 3H8JA 3A9RA 2JK1A 3DWEX 4IY1A 2JLYA 1QIHA 5FOQA 1QK3A 2J5QA 4L7VA 5CMLA 1SC9A 3R4CA 2XWJI 3CUEF 2BT4A 1A95A 1TU4A 1XD9A 4RANA 4CMIB 1R6AA 5IKPA 4OQ4A 1OXBB 3NVMB 3ZEAA 1TYDE 4ZEXA 4DTIA 4CF5A 1SWVA 4WXEA 4FT4A 3ZYZA 2IZZA 4EO9A 1E20A 1VBFA 2HIAA 4JDUA 2HO5A 3DTNA 5DI9A 3UT5B 3W79A 5A06A 4TQGA 3CO5A 5CT8A 3BDIA 3JW8A 3M5DA 1M2WA 3CNQS 1OHHD 4Q47A 2CDBA 4XWWA 3STWA 5DOVA 2ZTUA 2GNOA 1Y6FA 1FC0A 2PFGA 1C9NA 5F23A 1W29A 1Y48E 3A37A 4O2AB 5DHQA 4MV8A 1H8HA 3RTCA 1CDEA 1UWCA 1GYPA 2G6BA 2LP4Y 3CSUA 3NRJA 1YB1A 2EFGA 1J1ZA 3R44A 4U9IS 4V03A 3AY0A 1QCZA 2G08A 3GA0A 3G2IA 3OZIA 2OSVA 4KE9A 2WAXA 5JDIC 4A10A 1SIOA 2J30A 4YJFB 3HKEA 3OQIB 4UAGA 1Y3DE 5JIBA 4S1WA 1DARA 3TQSA 1V9SA 1Q91A 4HRAA 1EXWA 4CL8A 5TXGA 1IN6A 5D3QA 2H5IA 3CZMA 4U63A 5ERYA 3OLCX 3VVLA 4ADSG 1P7PA 4D9FA 2NT4A 3ITEA 3UFBA 3EOAI 3LVBA 5CLFA 3JALB 1PK7A 4B3BA 4CG2A 4YV2A 4N48A 5JH7F 2R3SA 1B0PA 2JG3A 1OWNA 2XCLA 3LCUA 1NKSA 2I22A 3JD3A 5JH7B 2Y0PA 3BL8A 3HCPA 3N3AC 5FH9A 3ME5A 2AQ8A 3MD0A 4UU8A 5HIKA 3L8DA 5EJ8A 4BASA 2ETVA 2I7VA 3NANA 3T95A 1GPAA 4L22A 2P0EA 4ZC1A 5HZHA 2JD2A 4P31A 1A9QA 3O1LA 3FA2A 4LJ7A 3RVRA 3WMEA 3NTRA 3EFOA 4OVKA 1RC8A 2PWYA 1DOZA 2RHJA 1GCGA 4O25A 2CHFA 3IULA 4L2IA 1BJRE 2QTFA 1RXCA 2GHTA 2ZIVB 4KIUA 3WLMA 1JUDA 2JHFA 4EUHA 1M6WA 2FR8C 3KKNA 4XCXA 4D92A 2IZOA 3IBGA 2N0SA 1UWVA 1P0CA 4I6JA 3E2MA 1HEUA 1XMVA 2P68A 2F8LA 3LMKA 4PC2A 2DBYA 1FY2A 1V26A 3L6DA 1K5HA 1JW9B 1NLYA 2Z6VA 4WE3A 4ABYA 3D3QA 2I9KA 1Z9BA 2Z9BA 4MDEA 2DC1A 1KEUA 3D8HA 3A2KA 4J0KA 2YTZA 3A6HA 2ECQA 3QUSA 2W6CX 5TMEA 1K3FA 2ZE8A 4GWGA 1ZPDA 2J9YB 1WDMA 3R0JA 4QYXA 5TQ0B 1VRVA 2W83A 1CVLA 1I7LA 3NLLA 1QFJA 4P4GA 2AYZA 3B6KA 3F7NA 1S0UA 1V8FA 1YMQA 2G77B 1NN0A 2WJWA 2XB6A 3EIEA 1RRPA 4LDAA 4RH3A 3VR6D 1QGUB 2OAGA 4E1VA 4B8WA 1RAEA 2AMYA 2ZATA 1MC5A 3N6VA 4M7WA 5E9JA 2R751 4B6RA 4PNZA 3UV6A 2V6JA 2W2LA 4MUMA 2Z8YM 2FFAA 3OE7A 1X1QA 1FDUA 4WKNA 5AKZA 5A0VA 1KZ7B 1SD1A 4RDHA 3H4IA 1C7RA 5ALTA 2GLXA 3NEAA 3EA4A 3TKYA 3WX0A 1RAFA 3X1KA 4LE2A 2DVMA 1K27A 3GJTA 2YWJA 1U1IA 4F2DA 3H7IA 3KQYA 3ANYB 3RTAA 4MV0A 3MJSA 2FUG1 1F0PA 3G2QA 3GELA 3P94A 2VNAA 3MCVA 5H7XA 3GQBA 3EQ9A 4M21A 2PZGA 1N1GA 2ZBRA 4OATA 3SU8A 4CF6A 5J2UA 1PR3A 5C1BA 2GEJA 4S1NA 4KK3A 5GVSA 1U0TA 2WJ4A 1KIAA 2DULA 1MCZA 4OHVA 5J23A 5E9AA 4MGKR 2FCRA 4S1PA 5JS8A 1JEJA 1RHJA 3DT8A 4JC5A 3ED1A 3PQFA 1S1CA 1T0BA 4XYLA 5K0JA 4S2UA 4FKZA 5B57C 3CUVA 4KN8A 2H0RA 4Q4DA 2WI8A 4UDYX 3RK1A 3F2VA 3HCAA 1QMGA 3KQTA 3P2YA 4YMUA 1JPUA 5HP4A 3TTTA 2Q0QA 4KSYA 4UVHA 1SZPA 3G0GA 4J03A 3W6OA 1YA8A 4H1VA 3LBHA 4GZ5A 4O1HA 3WLHA 1FYEA 2VWPA 1B42A 1H9BA 2WZBA 4TVOA 1KBZA 5KHAA 1ULSA 5K3AA 2QLJA 4LFAB 3O3MB 3M5PA 2C7OA 3BMXA 3FDZA 5AVYA 2WWIA 1G5QA 1YFKA 4G65A 3AR5A 3JATA 1N7GA 4DZTA 5EZYB 3FYHA 5KAPA 3LE8A 2AV6A 4WN9A 4RVDA 3UPUA 1D03A 2W58A 3QXCA 4IV8A 1ZCJA 2OM6A 2XXBA 1AQIA 3DE3X 1N8SA 2YWEA 3KR9A 3OIFA 4LOIA 2XWBF 5A4KA 5MDHA 3MGBA 3AF6A 3RRXA 4ZAGA 1SU7A 2O8DA 1N9GB 4NLLA 3AVWA 4FS3A 4DQVA 4UJ3A 3N87A 3ASVA 4AJKA 4MVJH 4GQAA 1XEWX 5I3CA 1NVVQ 3HVUA 3M6WA 2I87A 2R5FA 3FIJA 2A5GA 2ZPTX 3C0KA 4JASB 4XDGA 2NSLA 5I48A 4NDNE 1CY2A 1C29B 2B0CA 2BM9A 4P3YA 2I7TA 4XM1A 3ETLA 4TRMA 1WRBA 4WBSA 3ERCA 3W1VA 4DGSA 4D0NA 3U4AA 5EE5B 4FX2A 3PVZA 5H3CA 2UZ0A 3HADA 2C00A 3OFVA 3EUAA 4GBED 4U9HS 1HDYA 1Z4JA 3B6EA 3VGJA 3SBXA 4COOA 3QNUA 5HMLA 1HMPA 1S4MA 4DZZA 4YRLA 2OCXA 4K9RA 2W6IA 5AVQA 4JXKA 1QAOA 3AK4A 4EGQA 2FW6A 3IQWA 2R6FA 2DB3A 1Q11A 1FDRA 3OPYB 3CZQA 4P2BA 1ZZGA 1NBME 3OZWA 1PFKA 5DPMA 3SG0A 2PUCA 1VSTA 3PQEA 4UNNA 4NCNA 3EIOA 3ICVA 3CZAA 4FNAA 2OV2A 1A77A 4OKSA 2IKQA 2O8BA 1NSFA 1R0XA 1W88A 1W5BA 4NNJA 5UKDA 3UJ6A 2YFHA 1IJFA 4LC1A 2GF0A 2HXGA 1IN4A 4QREA 4TKVA 1JECA 1GAQA 1ULAA 2KS6A 4PU0A 5ALFA 4KGDA 5LNK1 5JSQA 3I1FA 3OCJA 1KOGA 2HWWA 1QHGA 4C07A 1VKNA 2HOQA 4NL4H 1TYEB 2NU8A 2RKBA 3L0SA 3VR1A 4DC9A 4ED9A 3JZMA 3FSRA 3RF6A 5C8DA 3U31A 1GRRA 5FI3A 3EIFA 3TVDA 1GG5A 3RRFA 5KTNA 2CFSA 4X1KA 1T4DA 2FJPA 3U4IA 3U39A 4YJ2A 1S9HA 2B8WA 4EZIA 4K8OA 2LRHA 4U7HA 3KR2A 1D9XA 4B80A 2BUAA 1X80B 1A9RA 4PC6A 2BFOA 5J4HA 1DBWA 3ANLA 1GVHA 4P3NA 3DFZA 1J8QA 3PL5A 3U4CA 4HRVA 3FFAA 3I9V6 3UO8B 3C5WP 1DIRA 3CLSD 2QRKA 1K92A 2ZYDA 3LGXA 4J0GA 1M8PA 1L6IA 1KL7A 1I7QB 1WHSA 1XVVA 4GGPA 3RW9A 4L51A 2HGZA 3JQEA 2F3RA 4ZEWA 2B94A 2ENUA 1AKTA 3DLIA 4RE5A 4J07A 4LRWA 4PLGA 3MTAA 3QFCA 4UUPA 2DLNA 1P9WA 3LDUA 1TAUA 4GI7A 1XTVA 1GV0A 4GLLA 1R15A 4H3KB 3ZZUA 5DNVA 2BGWA 3K8OE 2PS9A 3AINA 4TVKA 4Z86A 5I4BA 1RLIA 1W9HA 1HL3A 3NUQA 2ZTHA 4HP8A 4NR0A 3UENA 4DVGA 4US0R 4V38A 3DQQA 1USWA 1ZHOA 3CRNA 2O23A 3OX3A 1XVIA 4ND3A 2QE6A 1BYIA 1T0JB 4D9KA 4RD4A 1A82A 1BFDA 2HRBA 2WJZB 3DE1X 4UHFA 4NYMQ 1USUA 2BMWA 2E82A 2JLAA 2QL9A 3GGCA 3PDCA 1JIQA 4C6TB 4LZAA 1XCLA 2PA0A 2PCLA 2V9ZA 3QMPA 1FJGB 1FDVA 1GCAA 2LE0A 1VPTA 3UCEA 1C4WA 5ADHA 3AEKB 4CIVA 1BKYA 5CFOA 2COKA 4FYPA 2O6HA 1PZFA 1D2MA 4UDXX 3T7IA 3WNDA 2YMQA 3GEBA 2BTEA 2AXNA 2VI5A 2OB1A 4GMKA 3JQ7B 1D07A 1GRQA 4PAMA 4D02A 2XRFA 4FDAA 3QLVA 3RS0A 3QOFA 3U0VA 5IVKA 1XX6A 1MB0A 1Q2UA 1K88A 5M29A 4EECA 3L4BA 1E79D 4OL0A 2PX8A 2YJGA 5BWNA 1M0SA 2ZYIA 2XT0A 1C30A 3K05A 4L4UA 2JEYA 3D6NB 3DXYA 5DHFA 2WHRA 1OFTA 2F7SA 5JT1A 5DXJA 3PT9A 2IKSA 4PRKA 1SBQA 2BGUA 3IVAA 3GVCA 4C4XA 3WQSB 4RTNA 2R0QC 1SU4A 3LI2A 1QYRA 5HQ3B 3GT4A 3THXA 1L7RA 1P4RA 3E0QA 4PFQA 3GJ0A 1I3OA 4R16A 4Z53A 2JBWA 1R0SA 1BD3A 3W8DA 1XHFA 1PWXA 2R7NA 2JAWA 1BROA 1I0IA 4TM8A 2BTOA 3G23A 3DLHA 2Q5OA 4IUDS 1TCUA 3GDWA 4PCUA 4G1VA 4CQMA 4PNEA 1QGOA 2PE5A 2WIDA 4QG7A 2JAUA 5EIXA 1DDIA 4UJ5A 2Z3ZA 3WP1B 4YT4A 2QZSA 2O2CA 2R8YA 3NT5A 3IR5A 1U02A 2EJVA 4OOEA 3IDOA 4DA4A 2Q28A 4ZI7A 4QEKA 3IEMA 3FTQA 3RRBA 4JQSA 3ZJYA 1G2PA 1F60A 4YUAA 2OYCA 3KZKA 3OZTA 3DMRA 4W9NC 3IXQA 4EDFA 5B58C 1JYFA 2FF7A 5BSHA 4OYRA 3F9RA 3RTGA 1W8DA 3GJ7A 3VHLB 3JQAA 3A7DA 5SY4A 1P6UA 1YTLA 4HNAA 4N5MA 3ZY2A 3U60B 2ZROA 2WUFA 4BWGA 5KTYA 3V8VA 4ATNA 4Z1OA 4BLWA 5JY1A 2FPOA 1ISGA 3S1LA 2R6HA 4IXMA 3WYCA 5BVGA 5JXHA 1YOVB 4Q4JB 1SUDA 2XTMA 2A4MA 3D3NA 3MD9A 2P0AA 4I4CA 4J2TA 3AGQA 1QV9A 4N01A 2YV3A 4AZVA 1EDEA 3KOOA 1XZHA 2BCEA 4C6HA 1WZEA 3SJZA 2AR9A 2YXBA 4GL2A 1AKYA 4UUNA 3THYA 4CCWA 1AIPA 3F7MA 3BWEA 3USES 5CUQA 3VOSA 2G8LA 1ZC3A 1R8YA 2BGLA 2H11A 3ZHRA 4BWFB 3EH2A 4TTIA 4JXZA 1DXYA 1NNLA 1Q0RA 1PO7A 3BHMA 1E1YA 2QVYX 2OUKA 1RBMA 1RJGA 1TMGE 2PTGA 4MW0A 2XUOA 3DDSA 5DW3A 3NHBA 5E4TA 3RIXA 3U17A 2YQ4A 4M1OA 2VYQA 1EA5A 1TKCA 2PMBA 3DVSX 3K35A 1CYDA 4X20A 2RJNA 2ZWPA 1M8FA 4H7EA 1BIFA 4HFNA 2FWRA 1PR9A 1P5ZB 2CUZA 3IP8A 3UJPA 1XQ6A 4CDRA 1QFXA 1Z5NA 3DZJA 4G23A 3PGLA 1PS0A 1QVRA 2BEWB 2NV0A 1ONOA 3R5TA 3EOZA 4C1BA 4EB0A 4D3DA 2AZXA 3WL3A 3LHKA 3SQNA 3T9BA 2OENG 1R4AA 4V0ME 5ILQA 1Z6GA 1IE3A 2ZI9A 3R75A 4V0RA 4HVAA 2N3ZA 4M8SA 3ZYCA 3ZVNA 2E4WA 4H18A 4N40A 3K1AA 3WOHA 4B6JA 2AUMA 1PQ4A 4RDIA 3IHTA 3RM3A 3NM6B 3GX1A 2OLEA 3ZV5A 3FFBA 3RIMA 2WE7A 4XLLA 4E32A 1TQDA 1UC8A 5LU9A 4HQ0A 1G1AA 4Q0MA 5JCZA 2Q4EA 3GY0A 1E4YA 1WJGA 2BHSA 2C2BA 4FGJA 4IDCA 3EB9A 4JUIA 3GN1A 4K9NA 2HCTA 3NNSA 1U6KA 2HLPA 2WEKA 3B1KA 3FFXA 2FPIA 2GN2A 4M54A 1O54A 4WOBA 1Z2EA 5IH3A 5ALNA 3RSFA 3A9TA 5AKEA 1IRIA 3Q4GA 1Z36A 4UNRA 5BRAA 1ID1A 3KVVA 5EJ7A 3ORQA 1T2VA 3MS4A 3SKYA 3OKFA 2QN9A 1W9MA 3NHLA 4P4LA 1PBTA 1RMTA 2G9UA 2P6NA 4M46A 4P53A 2ZXFA 4YNBA 2ZSDA 3FNRA 2BGTA 3X1XA 5LJLA 1UXKA 2MSKA 3UMYA 1ZK3A 2Y1EA 1R9GA 4IMRA 1H05A 1N2HA 1CHDA 3WGVA 2JEZA 1LVGA 2ZWMA 2KBFA 1D1SA 2SKEA 5LP6F 4GYYA 5L40A 3QG1A 3QIAA 3I01A 2UZAA 3MCUA 3FF1A 5LP6B 3PLNA 1XFDA 1UOOA 2V74B 2J41A 3C8DA 2QPTA 3Q7PA 4R0MA 4KVZA 4HH4A 1HDZA 4Q9JA 4ZQCB 3OCUA 2ZRIA 3A6DA 3CUYA 2UYQA 4MNTA 4JU9A 5CH8A 3TQOA 1A1SA 2J67A 2A67A 4HAZA 1WNFA 4OQXA 3VTFA 1M0TA 1RVDA 3WHPA 1QP0A 3TRDA 1WSBA 3F5SA 1NMZA 3PXUA 4G4GA 5IVDA 3WKDA 4BB5A 1EFVB 4TT8A 2FQWA 3UJHA 3QHPA 3E53A 2AG0A 3W8RA 1VZ2A 1TTTA 3NHZA 3FJOA 1O0BA 4CFZA 4QU5A 1P62B 1SVWA 1UC5B 4DLAA 4ARCA 3IAS1 1FFGA 2J59A 2Y8EA 1X7YB 1Y3HA 5H02A 3KKMA 5HA5A 2BISA 4FBGA 4XA8A 5L3ZA 1CUFA 3RWBA 1V9CA 2RGUA 3M1YA 3R9KA 2HJVA 5IN5A 4A5OA 4CIXA 3BGIA 1PNVA 3JVDA 3TMAA 1X7XA 3TYXA 3NYWA 1DT5A 5L4LA 3HKBA 2BW0A 1ZNXA 2CSXA 1AKMA 2RHHA 4MVJP 2ZI6A 3ZGZA 4IHAA 3UATA 3U3JA 1TYZA 4JUAA 3SFTA 4CL2A 2NXEA 4U1RA 4QU8A 4HZGA 3SIPA 5BSWA 3P9XA 1CS0B 1RHUA 2E87A 2OHVA 3IE0A 3HBNA 4UD6A 1XZDA 3I23A 2FH5B 1EE2A 5HW0A 4L07A 2HRQA 1CRLA 3IILA 3NONA 4MCJA 3EMBA 5FI0B 2ZVDA 3HXKA 4BV8A 1YZKA 1AK1A 1RP1A 1F12A 2YHBA 1OYVA 1TGVA 1FQWA 1U0OC 4N0EA 4OQPA 1ZUHA 1AUOA 3FWYA 4BNHA 4RTMA 1Q0QA 4IXTA 5AXCA 4MQLA 1PYGA 2IXBA 4IXNA 3RO7A 3I4LA 3T8YA 5B64A 5JMOA 2DPXA 2HCFA 3KSZO 4PXAA 3I5AA 3RPEA 3ADBA 3UA3A 1E9CA 4G5SA 2BYTA 3ZU3A 3RS3A 1P2TA 3E2IA 4QVGA 4BMOB 4RV4A 5GPBA 4F0JA 2JZCA 3WRVA 2ZRCA 1HE4A 3D4PA 3L6RA 4G9GA 3ZHZA 4ZZ0A 1E2IA 1MENA 1OU0A 1P17A 2P3LA 2ZK7A 3TIXB 1XZAA 3V4SA 4RHFA 4D9GA 4E46A 1NOIA 1DKPA 2W2KB 4JT2A 1YFLA 1NL3A 2PANA 3I45A 3ZY4A 2B2CA 3O26A 5KZMB 1U94A 2YJTD 1QVAA 2PKQP 3N58A 2JAXA 4UHKA 4AMZA 3CG0A 4YRJA 721PA 3LH5A 3WKCA 4CG1A 2QTMA 5K8IA 3BB1A 4F86A 3LO8A 5KTKA 5AW2A 4DYDA 3ZE1B 1VJ0A 4CM4A 5FKJA 4QT4A 1ADGA 3LDFA 5LKRA 4I8IA 2JHAA 3SBEA 2ZBGA 1C2YA 1MH1A 1REQA 3D6TB 3R3WA 5JTUA 1YAHA 1QWSA 3E82A 3FPFA 2HMWA 3NM5A 4HY3A 2VHQA 4KAFA 4M1WA 1FJ2A 2OEPA 5EVJA 2I33A 3O2NA 3FUTA 2QMHA 5KIAA 5EPEA 4UM5A 4C7OA 1GTG1 2XVMA 3JR3A 3QE9Y 2OGZA 3PWKA 3MLEA 1PR5A 4JB3A 3X3HA 1G4HA 3EZ6A 3SNKA 2DBZA 3DMTA 1K5PA 5B3JA 1PFYA 2XXAB 2DRIA 2GAJA 4EATA 2FGKA 1E2DA 2J3QA 1NDHA 3U44B 1Q95A 1KSFX 4BVEA 4Q4LA 5CXXA 3CMCO 1T5OA 2C7BA 4AKTA 1DV2A 1PZXA 2ZJ3A 3E35A 3C6KA 1IPEA 4JEUA 1U9IA 3TRFA 4B3CA 4CTJA 1ZAYA 1TJNA 4NYJQ 5DNDA 2Q7OE 3ZEIA 4UVDA 3CRRA 4D9EA 2G09A 4RD1A 2O9JA 3NYIA 1MW9X 2OZLB 3FDXA 2DLDA 1WV1A 2ZZKA 4FUTA 4MR9B 4NV1A 3V8RA 2VNSA 1D9ZA 5KTMA 3GRCA 3KELA 1RU3A 1A7JA 1ZI8A 2FXVA 3COPA 3R9WA 4KR6A 4GT1A 3GLHA 4GW3A 4CGYA 4QU0A 5E2IA 1QIDA 2OK8A 3L46A 4DIOA 5K3DA 1PQWA 3P96A 2JA1A 3AIKA 3QV1A 2F3QA 4YV0A 2E85A 4JB2A 3EZYA 4KQJA 1RZRA 3ZQJA 1EESA 3PDIB 2IHTA 2C7QA 3CZRA 2J9FB 3P4UA 5A4DA 4RDXA 1UPAA 3K9NA 4HQKA 4TLDA 4XYGA 3SGLA 5FJJA 1M2OB 3EF0A 2CMFA 4N6OA 3UYKA 2M6KA 4OI1A 4QU9A 3L8MA 4ZZ1A 5DASA 2A9VA 1SC1A 5BWCA 2IYSA 1A8SA 1OLUA 4A7PA 4FN4A 1YR6A 1Z8FA 1JEAA 2EL9A 4MRPA 4Z1MD 4RD2A 3QX7A 4HPWA 2J4CA 2IW3A 2OCGA 4LGCA 1ZZEA 3WKAA 3GJ4A 1RVV1 3GFBA 2J3DA 2LCFA 5I4KA 5DNYB 2XWQA 2RONA 3EAGA 2WG1A 2FLKA 1KFBB 1MAVA 2ZBQA 3HJBA 5ALYA 1Q0TA 2JGRA 1N6HA 2TYSB 3CLTC 3E9CA 4WA7A 3L0YA 5FOWA 1ZP6A 2DHQA 4WJKB 5T7BA 3K09A 4JWKA 4MXDA 5ALLA 3T06B 3ICWA 2DUMA 2NU9B 4TXNA 3IUMA 4NAUA 1QGAA 2PM8A 1NUSA 2VDUE 3E03A 4QE3A 1G6KA 2G9ZA 3IUPA 4WT7A 1OIWA 5EWJA 1KHHA 4QOSA 5ALIA 8AT1A 4KWCA 3MWKA 4DMGA 2GYWA 1IJKA 1CDDA 1G9TA 3PHLA 1YB6A 1IN8A