1ZRHA

Crystal structure of human heparan sulfate glucosamine 3-o-sulfotransferase 1 in complex with pap
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
VAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zrhA00
2VBCA 3VR3A 3ZVMA 4FWTA 2IEYA 4LOAA 4PSKA 5L3SB 4ZKEA 4LV5B 2VF7A 1P2VA 2WWHA 4IXNA 1X8KA 3AVVA 4Z54A 2HJGA 4M9SA 4BZQA 2HYIC 3N70A 4Q4JB 1P2SA 4MRVA 2JJ1D 3GLIE 2N46A 4LPSA 3W90A 4QBHA 2QMEA 3SEAA 5C2JB 3GJXC 3CRRA 1TTTA 2CL7X 2NOAA 1DAMA 4WIAA 4BFXA 4HB4A 2KSQA 2NO9A 5E7MA 2ZUDA 1VECA 1UF9A 5C1BA 4C0KA 4ZIRA 3U6KA 2CE7A 4C0AC 4MITA 1E99A 5FFMA 3KKOA 1E2EA 2OFWA 1MH1A 2VLIA 3LQRA 2AKYA 1E2IA 2RHDA 3WHKA 1FP7A 1TMKA 4EQ6A 1GWNA 3F8TA 1E79D 4F92B 3BOSA 4UXJA 1Z0FA 2VHUA 2G0NA 2HXSA 3IBGA 4LYHA 3WMFA 1VG9B 1ZIOA 1YJ5A 4ZDKA 2KJQA 4JYCA 4BFSA 2ZE8A 4AYXA 1Y3AA 5AJYA 3EPJA 5M04A 2CNWD 1J70A 1BS1A 2P0EA 3LVRE 1NVWQ 3SFVA 1OXTA 4M9QA 2PT5A 5EQTA 4MDEA 2OAQ1 1MABA 3I8XA 2QM7A 5JWHA 3KXIA 4M9ZA 1P2TA 2MMCA 3AUYA 3U3OA 2XTZA 1RVDA 2AR7A 1SXJD 3RWMB 4EQ6B 1TX4B 1LNZA 5TDHA 1HE8B 3R20A 1XCPA 1FP6A 2QMHA 2IA5A 4NHOA 5CIQA 3FMPB 1TEVA 1P75A 2GETA 1XZQA 3C8UA 1XPOA 4OJKA 4OI0A 2O8EA 1O87A 1W5TA 2DWOA 5ANRB 821PA 3M1IA 4B2LA 3PEWA 1GM5A 3CONA 2ZUCA 3BAFA 1MO6A 2F3TA 2WKRA 3RANA 2R62A 4JBWA 2MSDB 1Z6YA 2VPPA 3QUSA 2YOGA 4UJ5A 521PA 3VKGA 2BV3A 3IQWA 2QP9X 4YLGA 2DYKA 3FOZA 4E22A 4N1AA 1GFIA 2XNDA 5KSPA 2IHYA 5A5GA 4EFNA 1GDDA 1YRBA 2JCSA 3A4LA 3OE7A 3GEHA 4PTLA 3CNOA 5TARA 4JZKA 4DLYA 1N0UA 3LD9A 3MRSA 4WA7A 5DI9A 1H65A 2QZ4A 3I5YA 1U99A 5FUWA 2GZDA 3H4MA 3RSLA 2J1LA 1JNYA 4D2IA 2ZRJA 4HLDA 4JLPA 2QP4A 3ZQ6A 3ADKA 4M8NE 4HAXA 3MD0A 4OQXA 1Q3TA 5CJ2A 1CR1A 4URWR 4QC2A 4BQSA 4BEJA 2BBTA 2RGCA 3FGNA 4B35A 1XXHA 4PC1A 3ICQB 3MWYW 2ZRLA 4DEXA 4Q7MB 2WOJA 4P3YA 3I92A 1SVWA 1NVVQ 3W5JA 3THYB 3WNCA 2QORA 4C3ZA 1W36D 4HAVA 4RZ3A 1MO4A 3QXJA 1XEXB 1GP2A 3LLUA 3U4QB 4DDVA 3LWNA 5FBLB 4DLRA 3IEUA 4KYIB 3GLFE 3PCRB 2J0UB 2O0HA 4PQRA 4LJ4A 2NMVA 4US0R 2L0XA 3HPQA 4LC1A 1D2NA 2XITA 1YZGA 1GNRA 4OHYA 1OH5A 2GEVA 1B0UA 1XPUA 2QPAA 3K0FB 1GRRA 4KSBA 2ZPTX 1DOAA 1IONA 1B23P 1UBGA 2E87A 3RRMA 4EFLA 2W6ID 1DE0A 1R6BX 2P2LA 2HCJB 2A78A 3PVSA 3ETLA 5CB6A 4XH9B 3EA5A 3BRWD 3HDTA 4BRUA 1KZ7B 1U8YA 2BKUA 1KKLA 3X1DA 5B2ZA 2Q6TA 3L8YA 4POAA 4C0JA 4YMUA 1OFUX 1VKJA 2CBZA 3A37A 3VX4A 4BWYA 1OE0A 1RRGA 1XEWY 2QTFA 2WJJA 4KAXA 1U9IA 3PJRA 2PBRA 2GJ9A 3B13B 2BM0A 3BERA 3SNHA 1RE0A 4DEYA 1VG0B 4JVNA 1Q1QA 4P4SA 4HATA 1KOFA 2ZI6A 2N42A 3OEEA 5BYKA 5JJLA 4IDOA 2EYUA 1PV4A 3QEJA 121PA 3E2IA 4QHYA 2C04A 1XMJA 1NBMD 5EXSA 3WYFA 1G4UR 4HB0A 1TQ2A 4AKEA 1KI1A 1LY1A 4QG7A 5J4LA 3L2OB 1IAQA 2FF7A 1CRPA 2OCPA 2P3SA 1E9SA 5GVRA 1UKVY 1KO5A 2IXFA 3VAAA 5KUTA 3W8RA 4HUQA 4PO1A 4TQ9A 1DAGA 4JLJA 4W5WA 1G7TA 3SJCA 1W2GA 4QGFA 1VYTA 3PENA 5LB4A 5FPSA 3UKDA 4DLVA 5KPDA 4G5QA 3Q5EA 3VKHA 5EP1A 1M34E 1TU4A 3N2IA 5JS7A 3IHLA 3NC0C 4CIDA 5L3RA 1XMSA 2I4IA 2IYYA 2ZAOA 4OKSA 5E7IA 5LDDC 2WJIA 1JAIA 2GXAA 1CF4A 1KI6A 2J0QA 1FX0A 1HTWA 4IDPA 1G20E 1T3LA 4GOXA 2XJ4A 2RGBA 2OG2A 1ZM4A 4D0LB 1BYIA 1E79A 3KKNA 1RJ9B 3DOEA 4F93B 3QXHA 4PR0A 1FNMA 2HEIA 1YRAA 4NMMA 3RS7A 1US8A 2O8CA 3MLEA 1P9WA 3VR4A 4GMDA 4TQAA 2H16A 1G17A 2QAGC 4B3DA 1ZVQA 1S9HA 1TQDA 4RKFA 3SJAA 4C0QC 4NTZA 3SN6A 2IWHA 4F91B 1KI6B 2EU8A 1IY0A 2JAQA 2QQ0A 2OCYC 3AVPA 2ZSFA 4HB2A 4A2QA 4AC9A 3ZS9A 3MUFA 4NDZA 4PHHA 3SR0A 4R2HA 2JIZD 1JJ7A 1D9ZA 2CXXA 3QBVA 1JB1A 1RC8A 2JLWA 2ZI3A 2Q21A 2V1XA 2PCJA 5FOTA 1T8UA 4BFZA 4QBGB 3IIJA 2BM1A 3JZMA 1DADA 3G0HA 2B7BA 3RSOA 3TNFA 2ZS9A 3Q72A 3KQHA 4LGMA 4EJSB 1OFTA 1OFIA 4DCSA 4DT1A 2ZJZA 3OIYA 1FMJA 4Q47A 4BLOA 4Q03A 5BN4A 4FCWA 3GEEA 2V3CC 2WVJA 5JCPA 5F9FA 2GVDC 1M7BA 1G8FA 3GFOA 1KDOA 3QF4A 4URXR 2C2HA 3LBIA 2AX4A 2FSHA 3EA0A 3U61B 2FFAA 1E9BA 3CZQA 2HF8A 4UJ3A 2C03A 4ESVA 1Z6AA 5DE3A 621PA 3WNBA 2CE2X 4EPWA 1S96A 5AK0A 1KI9A 1UM8A 5E7JA 3RRYA 4NBSA 4C30A 3GJ0A 1YZNA 2EFHB 3LRPA 4IVQA 1MV5A 1T0HB 4E09A 2CL6X 3KKQA 4YDHB 1ESNA 3KKMA 4F38A 2A2ZA 4PO8A 3QF4B 4B74A 1IJFA 3CPJB 3Q9LA 3ADBA 3K70B 4WAUA 3AVUA 2VP4A 4LHYA 3ZVLA 5F3WB 1GRNA 3LV8A 4FMCF 2ZSAA 1QZXA 4QM7A 1FW6A 2CLSA 2FFHA 1YKSA 2IWRA 2ASEA 1JPJA 4S35A 5SZIA 3B9PA 1UEIA 2PLFA 5HCIA 1N6NA 2WAYA 4B3FX 1OFHA 2QNRA 1SXJC 5EE3A 1G4AE 1KHTA 3KX2A 2O0JA 4Q19A 2IYTA 3I32A 2HT6A 3CF0A 3NBZC 5IHPA 4HLUC 2J7KA 1G18A 4BRWA 4Y0VA 3LH5A 1ETUA 4TYYA 2P6NA 1Z6GA 1HQYE 3GJ8A 1W36B 2GJKA 1G7RA 1QHXA 2VF8A 3SDZA 5JWOA 4DSUA 3SHFA 1R10A 4HDCA 1N5KA 1WA5A 4FCVA 3GJ6A 3Q7PA 3R7WB 3VKWA 1E9RA 1RKBA 2OILA 2WWIA 4TL6A 4EKDA 4QRHA 4BLPA 1M1YE 4I4LA 1SHZA 4PX9A 4I81A 4TMWA 4B71A 3S1AB 4ZDJA 3CB4A 4TSFA 2GCPA 3PV0A 4HUQB 5TV2A 4MRSA 3A1UA 1E2QA 4JIMA 4LUCA 3QNUA 3X1ZA 3VFDA 2ONKA 1FQKA 3V4RA 4ZO4A 5GJBA 4FMBB 5CDFA 4M0LA 3RRZA 1G1MA 1HURA 2JA1A 2I1VB 2B7CA 4TYQA 4BASA 2JGNA 3BXZA 3LO5A 2ZI9A 5FOSA 1JALA 2RHMA 1VTKA 3DO6A 4JVLA 1CBUA 1XZPA 2C99A 2ZANA 5FOVA 4EPTA 1NLYA 1IN6A 1QBKC 1PLLA 1R8SA 1TL7C 4MUAA 5FPHA 4DWJA 3THYA 3LY5A 2O8BB 1Z2CA 2RMKA 5CB8A 3OAAA 1GKUB 4QGAA 1JBKA 1L2TA 4NCKA 5HR5A 4ON9A 4XJXA 1DG1G 1IN8A 2W83A 3EARA 4B3CA 2CLCX 2MSCB 3D7MA 2IUUA 1W4BA 2BHRA 3FPAA 2FDCA 1T8TA 2VTKA 2XZLA 4MRRA 5DH9A 2ZRAA 1KDRA 4Z1MA 2YYZA 2J0UA 1R7RA 2WM9B 5BWMA 3WRXC 4N3NA 2ZE7A 4OI4A 2X2FA 1ZRHA 3QXSA 1XJ0A 1ZYUA 4L8GA 5B58C 4D81A 3WY9A 3FMFA 3CRVA 4PAMA 3AGPA 1COWA 3KQLA 4KU4A 4RZ2A 3LW8A 3T5GA 2OXCA 2ODEA 3FFBA 4KXFB 4IDHA 2I3BA 4PQYA 3HYTA 2D2EA 4B6EA 2Z43A 3AVTA 3QBTA 4AG5A 3GLGE 1T9HA 4ASUD 3RS4A 3ZH9B 3DM5A 4B44A 3F0TA 3GMTA 2OO7A 2ATVA 5HKKD 5DYGA 1PZNA 3AKYA 1II8B 3QF7A 3RYTC 3ZGXA 1NKTA 1E0AA 4L9WA 3OFND 5FBVB 4RD3A 4ESHA 2B21A 4TZ6A 4YXWD 1DEKA 2A3RA 4KYUA 5G53C 1N6HA 1T0JB 1T3SA 3H2YA 2CHVA 2GRJA 2PJZA 3KUDA 4UNNA 1N6OA 2V7QA 5EE5B 3T5DA 2F9MA 1G3MA 3K53A 4B75A 4TTQA 3GCGA 2OLJA 4PANA 4W7SA 2FMXA 2JJ8A 4JBYA 2VP5A 4DIDA 2W00A 3SQXA 3NWJA 1S1CA 4Z8YA 4NYJR 4I1UA 4HAYA 1NIPA 1HYQA 3EZ2A 1SXJE 1E2KA 4IKEA 4A6XA 4Q00A 5KSZA 1Z0IA 2IYWA 3DKPA 1E4VA 4QBIA 1HA3A 2VP9A 1W48A 4L16A 4S2EA 3TVDA 4AIIA 3U6BA 2ECKA 3GEIA 2ZS7A 5FL3A 1N0WA 1RRFA 1ZD1A 4XVQA 2Z6VA 4U00A 5L3VA 2GILA 2VEDA 1US8B 4LCBA 2ZRCA 1Z8FA 4XSGA 1ZUNB 3K9HA 5C4GB 5CDFE 2QEQA 1D2EA 1OKKA 5DIFA 2D7DA 1W46A 1IOZA 3C14C 1KGDA 1XEFA 5H8WA 4ARZB 3A4MA 2FPKA 2PT7A 2YWGA 3CF2A 2DFTA 4BFVA 5AUPB 3C15C 1GIAA 4P31A 4Q1EA 3IKJA 3ZVNA 4K8OA 1FMLA 3GLIA 3OEED 1OXXK 1XBTA 1SULA 4V02A 4QNMA 2YNMA 2OESA 1QRAA 3HR8A 3CX6A 1A7JA 3TK1A 3IEVA 1FFHA 1KYIA 1F3OA 1JJVA 1DAFA 1ZC4A 1JQJC 2IUTA 2AKAB 1DVRA 4P32A 2GZAA 4L4UA 4MA4A 5JJKA 1KY3A 1A1VA 5F9HA 2RGNC 3KB1A 3EAQA 3F5FA 4C7OA 1QVAA 2ERYA 4ZPXA 2NO7A 4EJSC 1A5TA 2FSFA 5G40A 4ZCLA 2XZOA 5DISB 5TY0A 5HTKA 1XJQA 2DY1A 1NSFA 4IOKA 4Q7LA 1EWQA 4DT1B 3U3JA 1RPZA 4URUR 1NLZA 4LHXA 1U90A 1XD9A 2GJAA 3Q5DA 2O8BA 1E94E 1JR3A 1KI8A 1VCOA 3L0OA 1H8ED 2GK6A 2OAP1 4CRWB 2VSFA 3TQFA 5DNYB 4HAUA 1TF2A 4LJYA 3KKPA 1KO1A 1NVVR 4FMDB 4JYBA 2Z5FA 4Q02A 4RCZA 4V0KA 2GEUA 1KJZA 5CM9C 3O47A 2FH5B 2JLYA 2GF9A 4TT3A 1CP2A 3E1SA 3CIOA 5FTJA 4MUBA 2D7CA 2GAOA 1UAAA 4PC3A 4Q1DA 2IX3A 2BWJA 5JFGA 2CJWA 1CIPA 1XEXA 1E9CA 3QKTA 4QXAA 2NIPA 4DSTA 4KFTA 4OHWA 4B2IA 1J90A 2NG1A 3BORA 4GOKA 1P61B 4TL7A 4DB4A 2DCUA 1HV8A 1YR8A 2R6GA 1L4YA 3VNUA 1R0YA 4LYAA 1E6CA 1I2DA 3K0FA 2FEMA 3F3YA 1KI4A 2YWFA 3IO5A 2YV5A 2ZR7A 1I4TD 4TZ0A 5JSZB 2K5UA 3B1YA 3LDAA 4KFSA 5L3QA 1P2UA 1ZM7A 3HYRA 1GNQA 1GRQA 3QJYA 1WBBA 4BE7B 4ACBA 4Q1BA 1Q44A 3TGPA 8OHMA 2EFEB 2ZAMA 2KI5A 2GVZC 4DZZA 5KNCA 2RGXA 2ANBA 1G8GA 1KMHA 4Q66C 3A4NA 3QKUA 5JEEA 3R7WA 1HT1E 5FTKA 4LSGA 4FIDA 5BQ5A 1W0KD 3VNVA 2H92A 4OK5A 1JR3D 3SBEA 4RCYA 1ZM2A 2R9VA 2KBFA 4X8MA 4BLQA 3UANA 3UMSA 2WJYA 1AIPA 4Q9IA 2GHIA 5CJPA 3TE6A 1TF7A 2HXYA 2WSSA 1ZCBA 4FW9A 1NY5A 3VU9A 3RWOA 2WAXA 3DZDA 4MQBA 2AFIE 3TLXA 1HE1C 4E03A 1HT2E 3EPKA 5KO2A 1N0VC 4HLUA 1DBSA 4KJZA 2C9CA 1ZNXA 3PFIA 2ZRGA 4A4DA 4LDJA 3DEFA 3CH4B 4RD1A 4K46A 1TADA 4EPYA 3RS5A 2IS1A 4Q1FA 2IYSA 1YR6A 3UMRA 3BJIC 3GLGA 2KWIA 3SYKA 2CHQA 2LKCA 2GF0A 2QPTA 1O3YA 2GJSA 4US1R 1P7CA 1E0SA 3ZIAD 1DAIA 1OB2A 3ADCA 5KPJA 1P72A 1KK2A 5SZKB 1G5RA 1RZ3A 4C9BA 2H5EA 2ZI4A 4BECA 3TSWA 3FWYA 3GJ4A 3P4YA 1VCMA 2Q3MA 2J0SA 2VSOA 3IBYA 4WOPA 3TRFA 5FBWB 4JSYA 1ZNZA 4TLBA 2AK3A 2WOOA 4IFEA 1RIFA 3BS4A 4LHZA 1WMSA 4GP6A 3WXMA 2WWFA 1OF1A 1TEXA 3TUZC 2GXQA 4LV8B 3W8NA 1GL9B 3IHWA 2ZETA 1AGPA 2BJWA 1I4DD 2FFQA 1EX7A 2QE7A 4FWIB 2NO6A 3SYNA 4KVGA 1YZTA 1QDEA 2ZS8A 3RS0A 2FG5A 1Z0JA 3AF1A 1G19A 1XTIA 3U4QA 1X1RA 2J0VA 1YU9A 2YZ2A 1LFDB 2YJTD 5SZHB 1HQCA 1GILA 4W5JA 3IPYA 2YVUA 4G0NA 3DOFA 1E2HA 2C96A 1ZMXA 2ODWA 3Q7QA 4ZCMA 2D4HA 3VHXA 3R8FA 3IDQA 4AD8A 3ZIAA 1OH6A 5HE8A 1ANKA 4YMVA 2GNOA 4NONA 1ZINA 2Z83A 4PC2A 2QG6A 1W44A 3VR6A 2VP0A 4IJMA 4KVAA 1UDXA 2ODBA 1S8FA 1ZNYA 2MMGA 1XD2A 1ZUHA 4DHEA 4TMTA 5JRJA 1AS3A 4A9AA 4NCJA 1OH7A 2GDJA 3VR5A 1G3UA 3JVUA 1N5LA 3A8TA 1SKYE 4UNQA 4CT5A 4YMTA 2RAPA 1YZQA 2KE5A 2IYUA 2H17A 3WNDA 4P0TA 1A4RA 1YVDA 1RFLA 3AGQA 3L0IB 4JLOA 3QI2A 3OHMA 5LPNA 1G5PA 3FHOA 2Z0MA 2Z4RA 1NRJB 4NPHA 1KY2A 3HJNA 4HAZA 4TN1A 1T5IA 4US2R 4XD7A 1QHNA 5DSZA 5HZHA 2GJ8A 5AWFC 3MWKA 4TTRA 1E9FA 1E2GA 3M0EA 1T5LA 1W0KA 4NE2A 3TIFA 5KYKA 4RD6A 2WSMA 2CK3A 2REXB 1QVRA 3NHAA 4HSEA 1E0KA 1PLKA 1KI2A 4U02A 4CEIA 1SGWA 2GWHA 3A6PC 2ZRFA 3KJHA 2YKGA 4LHWA 1Q21A 3I4LA 3PEVA 4IFBA 2BJVA 4DB2A 1Z47A 3PITA 2R44A 2UZIR 1BYUA 2BBOA 4RY2A 2Q0HA 2V4ZA 3QIAA 1Z6XA 2WPDD 4MKGA 4LJ6A 2CMKA 1R5BA 2IUSA 3FVQA 4HZUA 5FR2A 1S9DA 3GFTA 5AJWA 1VCNA 3RDPA 1G5TA 2XXAB 4CVNA 5EXPA 4A0RA 1K5DA 3R9XA 1D5CA 1UEJA 2WBLC 2XTMA 1KMHB 4MRPA 4KO8A 4D4JA 3WP1B 3O8BA 2ZREA 1J7KA 1EFHA 2OZEA 1Z06A 3GLIB 1W7AA 4OL0A 2W2VA 1DELA 2ZROA 1AZTA 1SVLA 2DFLA 1P3JA 2H18A 1JI0A 3AH8A 3NXSA 4KITB 3KB2A 1OXSC 4JLKA 3SU8A 1E1RD 4FMDF 4LJAA 5JWRA 2EQBA 2C78A 1W0JA 2P5SA 4WBSA 4IEIA 1G9XA 3RRNA 2HUPA 5JJIA 5J4VA 1XFAA 3CH5A 2QN6A 2PZFA 1GOTA 3QPUA 2DFKB 4GFDA 4OI1A 1W47A 3C4JA 4LJ8A 3LXXA 1QHGA 4NYIR 3DMNA 1E2JA 3MAAC 3QXXA 1FNNA 1EGAA 4TSFD 5FI0B 3THWA 1UKZA 2LCFA 1U9IC 1UKEA 4V0OA 4EPRA 4HUTA 2VHTA 2A5GA 2X77A 2MSEB 2ANCA 3GJ3A 3U3MA 4CEHA 3HWSA 4GZMA 4C7OB 1ZUIA 1VHTA 1XTQA 1XTSA 3PQCA 1KJYA 5CM8B 5EP4A 1VCIA 1HEIA 5FPTA 1F2TB 4E5UA 4MGIR 4NU0A 1S2MA 4LJ5A 3ZDQA 2KBEA 2QMUA 5TXGA 2JLQA 1QG2A 2P67A 4YC7A 2HYDA 4A8JB 4DLSA 2F1HA 3A36A 3K8YA 4ACAA 1YZUA 3THWB 5E3HA 4IOJA 4DJTA 5EZ6B 3U7FB 1MKYA 2JEOA 2WJHA 1CU1A 2HLDD 2J59A 1GAJA 2FZLA 4G1UC 4IVRA 4E07A 1E3MA 1KJWA 3WMGA 1VMAA 3CR8A 3FYHA 2XSZA 4GBMA 4EFMA 2IK8A 2GESA 2ZRPA 2YOFA 3LX5A 3QEOA 4KODA 2CEAA 2ZR9A 2CCJA 2ZU0C 4MKHA 1N5IA 2ZRMA 4I1SA 4B34A 1U2RA 1T3HA 1VYUA 2H1LA 3AQ4A 2OBMA 3A1WA 1ZD9A 3SYLA 3L43A 1OB5A 4G3XA 2RGGA 1XD8A 2A7QA 4WVFA 1E2DA 5KDDA 4J0QA 1XDBA 4A0FA 1C4OA 3KJGA 4TMXA 3W34A 4A1FA 2B8WA 2W0MA 1EXMA 1WB9A 3V00A 1E1QA 3AP3A 3KJIA 3EZ9A 1FTNA 1CXZA 1BIFA 4JLBA 1NL3A 4GT1A 4M21A 2FSGA 3BC1A 1R5NA 4FI3C 1AS0A 2V8OA 3L0PA 3NIBA 4YONB 3RS3A 5AR1A 5K8LA 2XOKA 2QRZA 4JS0A 5L8VA 2ZJYA 1ZAKA 2D2FA 2PEYA 4PQFA 3UXMA 3ONWA 3EXAA 3AVXA 3P32A 2B8TA 2LKDA 1QHHB 1Z63A 2ZJ8A 4I99A 4XSHA 3TVTA 1LW7A 2R8RA 4U7DA 3O8CA 2JLUA 4Q01A 2OBNA 3OIVA 3QG5A 3CRQA 3TAUA 3LW7A 5GJWC 4AKGA 1JXOA 4Q5IA 4B32A 5KSYA 1MO3A 1U0JA 1QG4A 1F6BA 4HZIA 4OQNA 1PUIA 3H1TA 5FI1B 1FPMA 3VHLB 2H8KA 2JIZA 4Q48A 2AL7A 3GJ5A 1PLJA 3GD7A 3ASZA 2BMFA 3NHBA 3ECCA 1XPRA 2A5YB 2J45A 4W9MC 3I61A 1IBRA 4TMZA 721PA 1NSTA 4FCTA 3V4FA 5DO9A 4BFUA 4RVCA 2IYQA 3Q8XB 5DYIA 5FL7A 4NL4H 2BOVA 2WHXA 2G1JA 3A1VA 4D6PA 3E70C 5EUMA 1D2MA 2AD5A 3P4XA 3I73A 3P1JA 3RC3A 5EZ5A 2VA8A 1JECA 3SZRA 1X8JA 1QHSA 2GBLC 1M2OB 3FKQA 4CEJB 2HCBA 2WMOB 1VG1A 2AD1A 4Q4HA 1GNPA 4R71A 4UNPA 1OH8A 3T34A 3T1OA 2GCOA 1II0A 1AKYA 2IHBA 2AHOA 5FOUA 3SQWA 3FHTA 3GLHA 4DC9A 1Z07A 3R9WA 3CPHA 4P33A 4QFMA 3W6PA 4PSVA 1Z22A 2OHFA 4KBGA 3UPUA 1AQUA 4Q4LA 3NBFA 2P65A 1KMQA 5FPYA 4Q9KA 2BIFA 4I1OA 4DDWA 2ZRDA 3CR7A 5F98A 5JI3E 1WQ1R 2XNSA 3PR1A 1XTJA 3KDSE 3R9IA 4V0LA 1XF9A 3SS8A 1CKEA 4Q7JB 3T1TA 1V43A 2LWIA 1I4LD 2R65A 5EXXA 1R8QA 3WP0A 1R2QA 2DPXA 4PPNA 3GPLA 3U7EB 2IT1A 1ZP6A 2W2TA 4NZYA 1UFQA 4M2LA 1R0XA 4BUJA 5HPYB 5HZKA 1U81A 3AF4A 1NBMA 2C9YA 2ZE6A 1NLFA 2XSZD 2FPLA 4L15A 1UBEA 1NKSA 1ZC3A 4TYWA 3WBJA 5HCNA 4ZI3A 2ZEJA 1CLUA 3OESA 4DLWA 2JDIA 1X6VA 1UBFA 421PA 4C2TA 4H1VA 4OYHA 3QKSB 4LPKA 1IN5A 1TNDA 2NPIA 3BFVA 2VHQA 2QM8A 2WMNB 2EVWX 2QAGB 3B7GA 4PPFA 3FKSD 4CF7A 2C77A 4KBFA 1W2HA 1J2JA 1FQJA 4OQFA 5AJXA 3IIKA 2ERXA 2VHCA 4ZDIA 2F55A 4PHFA 2QENA 3NTUA 2WV9A 4NYMQ 1GL6A 3VTKA 2IL1A 2GZHA 5BYJA 5IK2A 3AKCA 4OI2A 2ZE5A 1YHNA 5EE9A 1NIJA 2Q9BA 3MSXA 1R5OA 4RJLA 4PC6A 3K0CA 2ZI5A 4TLEA 1Q1BA 3U7HB 2RCNA 4M4SA 4RFSB 5DHFA 2QAGA 5IT5A 2C9OA 3C41J 2IF0A 1CJKC 1L4UA 3SBDA 2F7SA 3BIFA 1D8TA 1I2MA 2PX3A 5CIWA 1FUKA 2G77B 1ODFA 2O8FA 5KHOC 1G8HA 1D9XA 2IYVA 3FE2A 2Q9AA 4C0SA 5A4JA 1TF5A 4FN5A 1J8MF 1VIYA 4WW0A 1C9KA 2UKDA 1KKMA 4O2LA 1WE2A 3TBKA 1OLOA 2PL3A 3ICEA 3NBYC 4WZ6A 4IHQA 3TSZA 1BMFD 2O5VA 4ZV4A 2QROA 1FUUA 1SHKA 3IO3A 1NP6A 3LVQE 2WIAA 4JL8A 5FBQB 3WBKA 3WYGA 4K81B 4PPGA 4IRUB 1JR6A 5KSOA 2VRWA 3CF6R 3AVYA 3CNLA 4JLAA 4PHGA 3D3QA 1YR7A 4UXHA 1EESA 3D31A 4QGGA 1V5WA 5AJVB 1GUAA 4BPBA 4PPQA 1Z0AA 3QKRA 4BZPA 1CRQA 4PHTA 1G7CA 3B60A 4TL9A 1G3IA 4QHTA 2OLKA 4GPTA 4ZI2A 1Q57A 2WWWA 2VL7A 4BLTA 4DUGA 2ZJOA 4DKXA 5EP3A 2XNDD 5BN3A 4D0NA 3AV0B 3UG7A 2O0KA 4DUGD 3FDIA 1CJTC 3N2EA 1DAHA 2PLRA 2WKQA 1DO0A 3G5UA 3HU2A 1MO5A 1J99A 3DMDA 5UKDA 2YWHA 3B78A 2ZYWX 2GEDA 1N6RA 1WF3A 4JLVA 3V9PA 4V0MA 4TLCA 2QP3A 1N6KA 1P5ZB 3K9GA 4URVR 4G01B 4YMWA 1Q20A 1ZU5A 2IYXA 3EWAA 4A36A 1RRPA 3BGWA 3RHFA 4D26A 3PUYA 5BXQC 4MKFA 4HI0E 3C5HA 4XWKA 3U44A 3LX8A 4KV9A 4R98A 4NCHA 1R0WA 1XXHB 2A5JA 1UBCA 4BLSA 3REGA 1UJ2A 1AGRA 2O52A 3B8HA 1RJ9A 3W3AA 3U5ZB 2QUZA 3X1YA 1TUIA 4W5HA 4Q1AA 1OW3B 2YC2C 4OHXA 3Q3JB 2B6HA 3DPUA 3QPVA 2QTVB 4PFSA 2A30A 4ZDWA 3ZD6A 2O8CB 5B57C 1BO6A 3I72A 2ZI7A 3SI7A 4C4PA 2RGEA 1YR9A 5KNDA 4EAQA 4IOLA 3K1JA 4TLDA 3THOA 1AKEA 1E9EA 4LBVA 3KQKA 3PUVA 4IEEA 2CJWB 2JASA 1G6HA 4RZUA 3QOFA 1S3GA 4OQLA 2NPFA 2G9NA 5TMPA 4A92A 1ZNWA 3B5JA 1II8A 5H1YA 2G3YA 4B3GA 4FMCB 2GBLA 1OYYA 5JEDA 4WZBE 1E2NA 4AYTA 3CX8A 2BDTA 1KI7A 1II9A 1ZM3A 5EE1A 2EFDB 3ZS8A 1JEDA 2JDID 4LZZA 4PAOA 1GL7A 2OM2A 4BLRA 2IYLD 4C0LA 4XWOA 5L3QB 4GSYA 3KJEA 4IDNA 3A1TA 1A2KC 1E9AA 2AN9A 3H0KA 1C1YA 4KFRA 3UATA 3LBNA 4A82A 4BZXA 4LBYA 2XX3A 2VHJA 1XMIA 2BC9A 1S3SA 1BKDR 4IXMA 1T4GA 4MRNA 5D3MB 3IGFA 4IOMA 4B3BA 2QQEA 1CJMA 3UK6A 1RYHA 5J40A 4ZCIA 4C0BA 1VDZA 3EW9A 2JJ2D 4D4LA 3EX7C 3M4YA 5J4KA 3I5XA 1Z3IX 2IS6A 2ZUBA 3MMPA 1SVOA 4LBWA 1SZPA 3VU9B 4Q4AA 4FXPA 1F2UA 4CEIB 1R4AA 2DHRA 2DR3A 2QSYA 3T12A 2XTNA 4PZZA 1GKYA 3ADDA 5A0FA 5DI3A 1YQTA 5EE0A 3TQCA 2XZPA 2ZXUA 3OEHA 1P9RA 4WZAE 4BFYA 4GNKA 2QPOA 3I3SR 3AKEA 1Z6TA 2CVFA 5TVKA 3EZ6A 4C0HA 3BE4A 4OK6A 1IN7A 5CYPA 1KO4A 3K0AA 2RKOA 4LX0A 2EFGA 1VHLA 4EIWA 2ATXA 1W4CA 4M1KA 4Q4AB 1UADA 3PEUA 5FTLA 1F60A 2R2AA 3AF0A 4KCGA 5JS8A 2BCGY 2HV8A 3RAPR 2IS2A 4RZXA 1EG7A 4B73A 1PVOA 5G3ZA 3T15A 2HDNB 2FNAA 3TUJC 5DI3B 3K0SA 3ZJYA 4UKDA 2F3RA 3QKRB 2FOLA 4GMXA 3TMKA 4A6PA 2OXRA 2ZTSA 5J4YA 5EXTA 3PXGA 3AF2A 3DL0A 1ESMA 2QU8A 1J8YF 3EC2A 3BD9A 3CO5A 1FOEB 3EZ7A 4DDUA 1OJLA 5K8IA 1AQYA 2ZVQX 3JZAA 3I8SA 1KK3A 4KLZA 2ZSEA 4BEBA 1NMYA 3U3KA 3CUEF 2O8EB 1E2LA 1SQ5A 2P6UA 3ND8A 3PUWA 3FKSA 2AXNA 2D06A 3RC8A 3VR2A 1IXZA 1M7GA 2YOHA 3N5CA 4OHVA 3B1WA 1OT3A 2REBA 3ZYCA 3SHWA 4Q9HA 1P60A 1G64A 4GZLA 1IXRC 3GQBA 3B6EA 1GVNB 2Z4SA 2ZJ2A 3UIEA 4Z51A 4DCUA 4HLCA 2BMDA 1UDWA 2NO1A 3QKSA 1W5SA 3B1XA 2REOA 4L9SA 1SVIA 5CK4A 4G5GA 4GOJA 1LS6A 4AK9A 4JT2A 4RFVA 2QSZA 4A8JA 1ZU4A 2QL6A 1W4AA 4UQOA 5K8UA 1OKKD 1QHYA 3GLFA 4Z8XA 1HY3A 5DGXA 1NMXA 4PO9A 3OF5A 4OHZA 2PZEA 2JLRA 1K8RA 4DDTA 4PAQA 1SXJA 5FUYA 1NN1A 5J5CA 1XCMA 2ZIAA 1OYWA 2DB3A 4X8LA 5K8TA 3BBPA 4LJ9A 2VYFA 1M74A 1XTRA 2FPMA 4JSTA 2R6CA 2FGJA 4RFSA 4XVUA 5IF9A 2SHKA 1KK0A 4O25A 1G291 1U8ZA 1LS1A 1OIVA 2CNWA 1KSJA 3K09A 5G41A 1IY2A 3DHWC 3GLFB 2FN4A 1KAGA 1E2PA 2UVQA 3H86A 3ZLJA 1G21E 1VYVA 4QHSA 2C8VA 2UZ3A 4B2PA 2XGJA 4C2UA 4TWZA 2XEXA 4V0NA 2OFOA 1FTSA 1EX6A 1DS6A 2Q9CA 3IIMA 3Q85A 1AK2A 2R6FA 2EW1A 4TL8A 3KXKA 5DN6A 4TMVA 3U60B 1M7HA 3AP2A 3G82C 2FEOA 4WXRA 4QOSA 2CLDX 2V7QD 2HF9A 4D0GA 1XXHE 3FB4A 3ZVRA 2ORVA 2EWWA 3A1SA 3CKLA 2BCJQ 1JR3E 1F5NA 3DDCA 3HPRA 1IHUA 3WYAA 1OHHA 2YHSA 3ZD7A 5P21A 1IY1A 3B82A 2QA5A 1KSFX 2AFHE 4HLQB 5JHGB 1CR4A 4M1SA 5HKKA 1KTVA 3RS2A 1FL9A 1Z0KA 4V03A 3T1VA 2AK2A 4CT4B 4KSCA 3EIQA 2ORWA 3VX3A 3QSYA 5C18A 1IJEA 2CDNA 2YC4C 1Q12A 1X86B 2TMKA 1DAEA 4JKYA 4P4SB 1SKYB 2QRNA 4A2PA 1A82A 2ZYTX 4BFWA 5B30A 3TKLA 1YZKA 4JL5A 1W0JD 1M6NA 3QVUA 3OIUA 1COWD 5CYOA 4QJ4A 3AF3A 3L8ZA 4JLNA 2XOKD 3LNCA 4NKRA 4AURA 4MKIA 3U44B 1N25A 4PZLA 4LBZA 4KHZA 4MDFA 2HT1A 3LQQA 2G0TA 2ZVPX 2CVHA 2DWPA 1XTKA 3VMFA 3NDBB 1MRSA 3TW8B 2DWQA 4NYJQ 2XAUA 2F9LA 2Q3FA 4PC7A 2ONJA 1G41A 2PX0A 3LXRA 4TMKA 3TAHA 1JXMA 3OIWA 2PJRA 1QHIA 1W4RA 2ZJBA 1X3SA 4Q9LA 3TW4A 2FA9A 3H84A 3WMEA 4ASUA 3GLHE 2X1VA 3DKVA 4M22A 4NYIQ 4ARZA 2R6AA 3GLHB 6Q21A 3GP8A 3BB3A 1FX0B 5H68A 1D6JA 1N6PA 1Z08A 3EG5A 2BKEA 2FZ4A 4HB3A 4ERNA 3CW2A 3WHLA 2G88A 2VH5R 3THXA 2IF2A 1SVMA 4MYTA 4N0EA 3SE0A 3KL4A 2A9KA 2OCBA 2CK3D 2YINC 4QBFA 4NP6A 3X1WA 4AWXA 1SVSA 1LF0A 3KZ1E 4B6FA 4DBLC 3U7GA 2HLDA 2VO1A 3OEHD 2JLSA 1P9NA 1Q0UA 3IPXA 4A0HA 1MOZA 3J81k 3L82B 3LA6A 2G83A 2OFXA 3A58B 1LB1B 2J7PA 2F1IA 2IEZA 3HU1A 1AJEA 4MYCA 5TB5A 2GA8A 1RW4A 1NMZA 1EFUA 3OAAD 1EK0A 4JJKA 3TH5A 1SKQA 1IXSB 1E2FA 2QGZA 2V6IA 3BB4A 3FHCB 2BMJA 4F7WA 4UNRA 3PUZA 5JCZA 4CW7A 4LYJA 3B1VA 1DPFA 1E2MA 1OXUA 4DCVA 5BW8A 4JT4A 1XJCA 1OSNA 3D8BA 1CS4C 5FOWA 3P26A 2W6JD 5AUQA 1AM4D 1AA9A 2F6RA 1Q1EA 1S0UA 2GKSA 2IXEA 4URYR 4Y0AA 2OUKA 3TR5A 4P4UA 1Q1ZA 1DG3A 1JAHA 2O8DB 1EWRA 5GVSA 3T1QA 4Q21A 1CULC 1X1SA 1N6LA 1Z83A 1Z28A 2ODNA 2A5DA 2BEJA 5AUNB 4HAWA 1MR3F 1L7VC 1E69A 2J46A 4HDOB 5J4HA 3L0SA 4F4IA 3QENA 4EPVA 4Q18A 3PG5A 2WJGA 2DFNA 2JATA 2PMKA 3CLVA 1NBME 5J47A 1KAOA 4OK3A 1P62B 3U2QA 2J9RA 3AVQA 5GJCA 2ZM5A 3K0AB 3W5IA 4D25A 2ZR0A 2WICA 5IRCD 1IM2A 4I1VA 4M9XA 1T6NA 2IC5A 1XRJA 4QJ3A 1Q22A 4Q9JA 1ELOA 1KDTA 3UMFA 3ZQJA 1S1MA 4DSNA 1MABB 3UWOA 4YDSA 3B85A 4EUNA 1Q3HA 1U0LA 3CRW1 4RD0A 3C16C 3SJZA 3SFZA 4AKHA 1UPTA 2CCGA 2E1RA 3T35A 5IDVA 1VG8A 4IVPA 4XVRA 2AWNA 2R6DA 1W49A 3EZFA 4Q4HB 2VP2A 1G8PA 4TQUS 4OJQA 4N0DA 4UNSA 4QKQA 4AKIA 2W58A 4QM6A 2OE2A 3DZ8A 3IILA 1NG9A 2BEKA 4DIEA 3MWLA 3C5CA 1H8HD 1CEEA 4L5BA 3PIRA 3QXCA 5GADl 3BB1A 4UXIA 4G5RA 5LBIA 2ORIA 1A2BA 5EJEA 1NJFA 3RNLA 1MRNA 4O2RA 4URZR 3SC3A 3AM1A 5C4MA 1NN3A 3QPWA 2WTUA 4EDHA 1QF9A 3IQXA 4O3MA 4GP7A 2QTHA 1YZLA 2V55B 3AVOA 1LTQA 1VPLA 1XWIA 2FGKA 3KTAB 5ELXA 3VR1A 5CITA 1E32A 3NC1C 4TYNA 3HR7A 5G3YA 1BMFA 5FBRB 1HH4A 1ZCAA 5AJZA 4AYWA 3FMIA 3NDPA 1K5GA 4CDGA 3KUCA 1OV4A 3MFYA 4RKEA 2A5FA 1IQPA 4EPXA 4TTPA 3CZPA 3M6AA 3B1ZA 3NG1A 4X8OA 3K0CC 2WWYA 2C5LA 4F4CA 4JLMA 3X2SA 1Y63A 2NZJA 2QMOA 2QT0A 4JMPA 3NBXX 2VSXA 4DLXA 5JBQA 2PH1A 3ND9A 3K70C 2YWEA 4JBXA 4KLNA 3MJRA 5CLLA 2FV8A 3QVVA 4NYMR 1LF5A 4DVGA 2JLXA 3KFXA 5IK2D 1NNEA 3K70D 2WWXA 4IDQA 4G5SA 1KI3A 2GXUA 3SJBA 2QE7D 2ZYVX 2BBSA 1KSGA 1CR2A 1NI3A 4TLAA 4A15A 3W9YA 2H57A 1G3QA 1PJRA 5JLJA 1JEEA 5FH9A 1RYFA 4AI6A 1K6MA 1KIMA 2PCLA 3I62A 2FFBA 4B76A 4XTRA 1XNJA 2JLZA 2NZ8A 4FINA 4ITRC 1P73A 1U94A 3VQTA 1NVUQ 5D3QA 2V9PA 2GCNA 1EFTA 3AEZA 2BVNA 3QE0A 1BOFA 4KFUA 5H70A 1T91A 1NVXQ 3NEJA 4NCIA 1XD2B 1G3RA 2PZGA 4TYPA 1G6OA 2CHGA 1TQ4A 1TQ6A 3TSOA 2RGAA 4GL2A 4LYFA 1G8YA 2P6RA 4B47A 2X8AA 2E9SA 4MYUA 4XWAA 4DCTA 5B64A 1AS2A 3LFUA 3CWQA 4M1MA 2OEPA 2OT3B 2VIIA 2C98A 2FJUA 3AB3A 4D82A 4IW3B 4HYYA 3C7KA 2QBYB 4Q4JA 5JRZA 3EPLA 2O8DA 2B92A 2VP6A 1YE8A 2WSSD 4V0ME 1KZGB 2QAJA 5KOYA 4LK2A 3B9QA 4DLZA 2ZRIA 3BWDD 1OXVA 4OBEA 1Z2AA 1IN4A 2ZYUX 3HU3A 4HDQB 1WXQA 4P4TA 2IBMA 5D3MA 2AXPA 4AY2A 1L8QA 1TPZA 2G6BA 3OZXA 2H7VA 1WRBA 2QY9A 3MWJA 3RABA 4CEJA 2QT1A 3O8DA 4HEJA 1U98A 2ZRNA 1F2UB 4PZYA 5SZJA 5AUOB 1N2CE 2GCOB 2V54A 4RD2A 3O8RA 3W6OA 2ZJ5A 1KO7A 1N6IA 4ZKDA 4FD2A 3CBQA 4M1YA 2D62A 2FSIA 4JVMA 4CYMA 2GAAA 3BH6A 3LLMA 4LWZA 4QL3A 1NN0A 2WZQA 4QGHA 3GJ7A 3PUXA 3T61A 3DVLA 2OSBA 4M1OA 3EPHA 3LAWA 4MGKR 3BH0A 4RD4A 2J87A 1AZSC 1XMVA 3SOPA 5FPKA 2NO0A 3EC1A 4R2IA 2F1RA 2D3WA 3P27A 2N1BA 3MGCA 4MYHA 4YMSA 4JVSB 4DLTA 4LY6A 5JMTA 4R7ZA 3UWKA 1DTSA 2W6IA 4II7A 1VIAA 1XB2A 3THXB 1XX6A 2EYQA 3FMOB 1KNXA 4D80A 4TT3D 2IXGA 3FFAA 4DSOA 2J41A 2IS4A 1KSHA 2WIBA 1F48A 3EASA 5FL7D 1WP9A 3RLFA 1H8EA 1E96A 3KXLA 3ASYA 1TU3A 1P6XA 2J5XA 3AKDA 2Q3HA 3QY0A 1NG1A 4QNRA 4D4KA 4CEHB 1ZM9A 4PSAA 3OFNA 4GDFA 2C95A 2D74A 2V6JA 4G5OA 1AN0A 5EP2A 1F2TA 1ZW6A 1GKIA 2CL0X 2XB2A 5EUQB 5JHHB 1OHHD 5DHAA 4O0MA 2ZRBA 1X8LA 4A0GA 1TUEA 4XIGS 3AUXA 2CCKA 1U8AA 5FTNA 1H8HA 2ZQ5A 3T06B 5JI2E 2FX3A 2I1QA 2VQSA 3CRMA 1N3BA 2IYRA 3K9NA 4JKIA 5DN6D 3K0EA 5L3SA 3FTQA 1G7SA 3OE7D 1N5JA 3CX7A 2RGDA 1OPXA 2O8FB 1WDTA 2F1JA 4JJZA 4PXAA 5BN5A 3TUIC 3K9LA 1JQLB 1SXJB 1WBDA 2HJVA 1E0JA 3NEYA 5JECA 2RH5A 5C46F 2X19A 4DRZA 2GXSA 5LD2C 4R9UC 3EWSA 3KQUA 4Z1MD 3RVBA 1E1QD 1GSIA 4WXPA 4ZIRB 4JL6A 2Y8EA 1CTQA 3NKVA 4HZUB 4U5XA 5E95A 1KO8A 2IW3A 3AP1A 4XOIA 1S4QA 2ZJAA 2ZITA 4BFTA 3CWZA 4QJ5A 2XXAA 3B2EA 2JJ1A 4Q7KA 4H9GA 4M1TA 4NH0A 2QGNA 2ZRHA 4M53A 3E5HA 3TJZA 5KU1A 3REFA 3P20A 5KNBA 4GI7A 4D4MA 1JPNA 1LVGA 1W36C 5FR1A 5DLQC 3KQNA 5JSZA 2W2XA 1GZSA 1WCV1 5CK5A 5CLQA 2RGNA 1M8PA 1GITA 4ILEA 2KB0A 1Z0DA 4MH0R 3NH6A 2WKPA 2QBYA 3TR0A 1CJVC 1SVKA 3PEYA 2F43A 2P5TB 5LB2A 1EFRD 2BMEA 1QHHA 5E4FA 1OIXA 4B3XA 2W6JA 2NGRA 4JLDA 1ONBA 3ZZTA 4GRAA 1KNQA 1P4SA 1E1RA 2ZRKA 3S1AA 3X1XA 4A2WA 1KK1A 2FE4A 1NN5A 2BBWA 4B48A 1ZIPA 4KI0A 1XP8A 5FUVA 3LBHA 4YQFA 2WJVA 4YXWA 3AVWA 2GK7A 5KDOA 2V1UA 2DBYA 2F43B 3QG1A 3MCAA 3BK7A 2FWRA 2J7PD 3WRYC 3KTAA 4LHVA 4ABYA 4B43A 1U0HC 3JVVA 1GTVA 1DO2A 4Q1CA 3CNNA 5HE9A 5F2EA 2JLVA 3DM9B 2ZSBA 2XB4A 3W3ZB 4F4JA 3I1FA 5FOXA 2OV2A 1HUQA 3CM0A 3GLGB 3IUYA 4B33A 1TAGA 4LC0A 2FU5C 2EWVA 1ZJ6A 2J3EA 4NCNA 3BFXA 1EFCA 1R0ZA 3U3RA 3BFKA 3MG9A 4LRWA 2OBLA 3ZZ0A 4DXAA 2IYZA 1Z5ZA 1E4YA 3EIHA 3R8CA 4CZ2A 3KFVA 2NTYC 5KTYA 3K09C 1XEWX 1FZQA 1CR0A 1XCGB 4M1WA 3NH9A 1LV7A 4MGZR 3ZZUA 1OIWA 1PUJA 2GTPA 2ZU6A 4XD7D 1BH2A 5GJVC 1DARA 2W0SA 4MGYR 4BGDA 1XU4A 3UG6A 5LD2B 221PA 1W1WA 2G1KA 2PMDA 2RB4A 5KDLA 4RSGA 2XJ9A 3NVAA 4AG6A 3CPEA 5FTMA 2QI9C 1NY6A 4XTCS 2ZSDA 2JJ2A 1CJUC 4A8JC 2NQ2C 2WPDA 1MT0A 4LJ7A 4DLUA 1RRCA 1NF3A 3HP1A 3MJHA 1G16A 1DAKA 4LV6A 5JZVA 1E98A 3QQ5A 3GFPA 4OQMA 4CGZA 4EJSA 2PEZA 1GG2A 1ZBDA 3W6NA 3D6TB 2X2EA 2WWGA 2OCAA 4X8HA 3EIEA 4LI0A 2EFCB 1EFRA 5FUXA 1Z29A 4DCNA 2AWOA 1NJGA 1UKYA 3BH7A 1ZD8A 1KDPA 1E9DA 4H1UA
chains in the Genus database with same CATH superfamily
1PX2A 2BMAA 4QWMA 2ZT6A 3PL1A 5F35A 4HEA6 4BO8A 2HHCA 4LOAA 2ZIZA 3KG2A 3ONDA 4PSKA 1WY7A 3OJOA 5FQNA 2NN3C 4B3JA 4EA8A 3Q15C 2XCSB 3I9V1 1P2VA 4IXNA 2HRQA 2HPZA 3VKFA 3AVVA 3CLRD 3I9V6 5LA6B 5HJ7A 2HYIC 1QSGA 2F00A 3N70A 2Y1LA 5A02A 2JI4A 5CH5A 1H69A 2OQ2A 3D6HA 1ECLA 1PR4A 4LPSA 1B6GA 1E64A 1BX3A 1FA9A 2EXXA 2QMEA 3D1JA 5C2JB 3CRRA 3H6GA 5JZOA 2CL7X 2VWHA 2NOAA 1T2DA 3NBQA 2QZ9A 4HB4A 2KSQA 5J5AA 1V4VA 3IAEA 3DOCA 4CMEC 1I6KA 4NBWA 5FIUA 1HMPA 4BHTA 4FYKA 1BG6A 1NM5C 4TWIA 3H2HA 3BTUA 3M6VA 1FSSA 3RC9A 1MZPA 1MAUA 3VR6D 3EZYA 1H0RA 2DBVO 4GKAA 3X2FA 5I3ZA 5HNKA 4PU0A 1E2EA 2VLIA 4I0WB 4K9PA 4FNOA 4YNBA 5ARCA 2ZT7A 2J30A 2AKYA 4ECAA 1BRTA 3WHKA 4EY5A 5K6RA 4OU4A 5DX8A 4UPDA 1GWNA 2XV1A 4R3WA 3BOSA 4YP6A 3DE0X 4UXJA 1Z0FA 2V97A 5JLAA 3ZY3A 2PRYA 2QD4A 4LYHA 2M2IA 3O7MA 2BHTA 1YJ5A 1VSQA 2B2CA 4BZZA 4Z0PA 2V3WA 2CNWD 1BS1A 2P0EA 1NVWQ 1KMNA 5EQTA 1WUIS 1PDWA 2WG1A 4ZI5A 4ETIA 2OAQ1 4MDEA 2VAPA 1IOLA 2GQ0A 1J2TA 2QM7A 3LL4A 3N8GA 5JWHA 2OGTA 4M9ZA 4HY3A 4GR9A 3RUCA 1ODKA 4ZQBA 2Y92A 1TX4B 1AD2A 1LNZA 1YQEA 3HDVA 2K87A 2CD7A 2X7XA 3GV0A 4O4IB 4WFIA 2Q3JA 2QMHA 2GD1O 5GWXA 3L6UA 3VR0A 2G76A 2NAPA 1O6BA 1LC0A 3C8UA 3EA4A 3GPDG 3OQ6A 4QDZA 5HUJA 5ALVA 3EPRA 1P31A 1XZIA 4KP7A 4H17A 3CONA 4DARA 2CY0A 3ZBPA 5COBA 2F3TA 2WKRA 2DQYA 1WZCA 2AG0A 5DGHA 5C1DA 1NRXA 2QX9A 1VKOA 2H0RA 2MSDB 3D7KA 3MEQA 1TYAE 1GQSA 2VPPA 3MLBA 3KUXA 4KPFC 4Y6QA 521PA 3VKGA 4EL0A 4NXMB 2GO1A 3EN0A 1GFIA 3VPDA 1PW7A 4AVYA 2HB6A 5I3CA 2DRIA 3RSZA 3K20A 3CNOA 4PTLA 4IS3A 4ZAFA 5TARA 2AZDA 2PSSA 1C5KA 3SAJA 2K2QB 5KQLA 1THGA 3CT6A 3HB0A 3H4MA 2FZKA 1SCBA 1QIDA 2P91A 3KOOA 4NBRA 4R81A 3ZQ6A 4X0EA 2B4TO 1Q2XA 4DLKA 4OQXA 4F7DA 4ZAGA 4OGWA 3SQLA 4R2WA 1K5PA 4ALMA 4BXOB 2RCYA 3K6SB 3BD8A 2R8EA 2Q5QA 3IQZA 2RGCA 3N2ZB 3FGNA 4DQ0A 3U19A 4JWTA 1CY1A 1JFRA 2ZRLA 4Q7MB 1VPWA 4P3YA 3NPMA 1XTPA 3I92A 3L8FA 4IXTA 4G4SO 4GPD1 5AKLA 2XDQB 4QQNA 5DTJA 5FO1A 3TLJA 5KYUB 4B3BA 1MC5A 1EUDB 2VOJA 3OCCA 4JP1A 3LLUA 3U4QB 2AR9A 3LWNA 4RH0A 3DAPA 1YB1A 3IEUA 3P9CA 2GPTA 3I52A 2ACVA 2HY7A 3JD0A 1NXSA 1SA0B 3IP8A 4ZT5A 2CC2A 4LC1A 4JELA 1YZGA 1GTL1 1N1MA 4Y2GA 2CXNA 4JC4A 4DCCA 1I1QB 1O54A 3Q0IA 2ZG6A 2P30A 4Z49A 3CNEA 4REMA 1JDVA 2JGKA 3CS3A 4WN3A 2C2WA 1WMAA 1E7RA 2W6ID 3TTXA 5CA1F 1DE0A 2BW0A 3K8ZA 1XELA 3HADA 2GK3A 3LP6A 2A78A 2P41A 5CHEA 1SC4A 3H6HA 3V4PB 4GDMA 1A9RA 2BEVB 3TQHA 3DCNA 4LF4B 2MOKA 3B3GA 4EY4A 3NOVA 4XE5A 2K7ZA 3HJFA 4M3NA 3O8OA 4S24A 3W5HA 1PW5A 3QMMA 4BQEA 1GNSA 1E6UA 5EA2A 3MTQA 4YRJA 1OFUX 1BCRB 1TVEA 1VKJA 3GZTB 4GPEA 2CEKA 3A37A 5EZYF 2QTLA 1KMMA 4LXTA 1U9IA 2WP8J 3QK7A 2QG9A 2ERCA 2C4VA 1QWOA 4WD3A 3I9OA 3E4CA 1J2UA 1N5OX 1ZQ9A 2NT3A 3KEMA 4HNHA 4RZQA 3CNBA 3DT6A 2DC1A 2P9TA 3OLXA 4P4SA 4HATA 4HP8A 1KOFA 3UW1A 3ZNOA 5EESA 1WEKA 3MCZA 4MI1A 4MGHA 5IEBA 1NR7A 1EAYA 2FYTA 2C04A 4MQ4A 4M99A 3T3MB 4JXZA 1CERA 4K9MA 4F9GA 4PTZA 1M2JA 1J24A 4TRJA 5IJ9A 1Y4UA 4QG7A 3R3UA 1YOVA 1VBKA 2RARA 2OCPA 1OLXA 3ETEA 1E9SA 3F4KA 4LXIA 1UKVY 4OBXA 4BOYA 4EMUA 3VAAA 5KUTA 4XYEA 3W8RA 4PO1A 3SJCA 3WLAA 1W2GA 1JIXA 1EUZA 3DG9A 7MHTA 1I10A 1WOMA 3C6ZA 2PZLA 4JWKA 3UKDA 3I9MA 4N40A 3EG9A 3R0VA 3U4AA 3IIIA 1MXFA 4GF5A 2HJHA 1DKQA 2PD4A 4NBNA 1LWNA 1TU4A 3N2IA 1K7SN 4BNHA 4YYZA 3IHLA 1PJSA 3NC0C 1QR6A 4JD5A 3UWDA 1XMSA 2IYYA 5E7IA 2VVTA 4OKSA 1ZO8A 3CSUA 2C4KA 3HO8A 4Y1EA 3BEDA 1V37A 2GXAA 3I05A 1UC9A 1KI6A 3NI2A 3C3WA 3DDUA 4BQPA 2P2NA 1ML3A 3HHPA 4QUEA 2OG2A 2VKTA 4D0LB 1C3VA 1ZOPA 1RJ9B 3DOEA 4TVBA 2W9XA 5CM2Z 2BGNA 2YJNA 5BT9A 4JV5B 1O6CA 3RVJA 3SE7A 2O8CA 3MLEA 1P9WA 4L8LA 4P86A 1OWOA 2YVLA 3K15A 1EUCA 3LUBA 3QBDA 2H16A 5E9JA 2P9JA 4YB8A 1G17A 3U1TA 2QAGC 1N2EA 1O95A 4B7ZA 3PQ8A 3GW8A 1S9HA 3FI0A 1QV7A 1L7MA 1W85B 4D43A 3W4KA 1U5BB 2Q5JA 5AXCA 5LWHA 2PUHA 3CE6A 1Q19A 3U13A 3G89A 4HB2A 3G9QA 2OZPA 2B2XA 3D59A 4A2QA 4AC9A 6REQB 2HPAA 4W1QA 3SM3A 4CM3A 3R74A 4PIPA 1TVKB 2XR1A 4U2DA 3MUFA 2B94A 1O6GA 5BVHA 1WLYA 3NATA 2JIZD 4TS1A 1D9ZA 2CXXA 1I1OA 2ZI3A 5CVTA 2HAEA 2C8LA 2B1IA 2HGSA 1TMYA 1DC5A 2ZS9A 2II6A 1EXNA 3KQHA 3DB2A 4C78A 1WETA 3OIYA 3HL0A 1KEEA 2F62A 4Q47A 3OLYA 5HQ3A 1THZA 5IANA 4ENVA 4CL2A 1WDWB 5IKEA 1ADYA 1O0CA 5AM3A 3I4CA 5GIOE 1G8FA 4DCJA 1C3JA 1UFVA 1NXTA 2PUTA 3R41A 2C2HA 4FBLA 2AX4A 4P98A 5GM1A 2R8OA 3K4QA 4RGYA 3FVVA 2GNPA 3T4PA 1PHPA 1WB5A 5K03A 2CF5A 1E9BA 4B4OA 3AY7A 1LJUA 5DE3A 621PA 4MB0A 4BGVA 5HM6A 1F1JA 5JSFA 1QCCA 3AOGA 4Z1OA 4XQ0A 5EHXA 1V3QE 5COQA 1DQZA 5IJXA 3RRYA 5EJAA 4GI1A 4EG4A 2BUBA 3SJUA 2EFHB 3GA0A 1PEKE 3LC0A 4WKBA 6ADHA 1PYGA 2YVQA 1RADA 4K6HA 1RHQA 2OXIA 5KX5A 4INPA 1L5MA 1UM9B 3FNHA 2A2ZA 4Q93A 3I2YX 5EKXA 1Z5GA 1MA3A 2GHRA 1WJGA 1ZIDA 4K40A 3Q9LA 2NLOA 3IUEA 3V2IA 3WK4A 1MQAA 2VDNB 4KQHA 2ZB2A 3SXJA 4WAUA 3ZHQA 2H9AA 4CUZA 5K09A 1AB5A 3AVUA 4O4HA 4MMXB 1JU9A 1R37A 3EOBI 1PR9A 1GRNA 2OBYA 3LV8A 2ZSAA 5KQSA 4NPCA 2I2XB 1RVV1 2B8JA 3D8NA 1FW6A 3PPXA 3HRKA 4YACA 5AOCA 3ZE0B 2IVFA 1QQBA 1Y81A 3QNMA 1X1TA 1JVSA 1JPJA 5KYXB 4S35A 3M81A 4Q15A 2XCUA 5DDIP 5BPHA 4LFBB 5HCIA 2GTHA 3JSAA 1O58A 2QNRA 3VPAA 1SXJC 4QWWA 4P08A 5C37A 3KYBA 3V1YA 3QOWA 4G8BA 4R2XA 3PC7A 4RA6A 4W6QA 4PICA 3UMYA 1G18A 3Q0TA 4Y0VA 4RIEA 3SHOA 1JJAA 4TYYA 4KNWA 1VRVA 3A26A 2OFFA 2X6TA 3UICA 2Y4NA 1VFPA 2A6PA 1HDEA 3GJ8A 4BBPA 1WABA 4E5NA 2V7WA 3ACCA 4K6CA 2VF8A 1G7RA 3HVRA 3NGMA 4MHSA 2VJOA 3JARA 3PDHA 1R10A 3WIVA 1N5KA 2V6MA 3LUHA 3LFHA 3Q7PA 1NULA 3BGVA 3F4LA 3R7WB 1EDZA 4FFNA 3AHCA 3D02A 2QOEA 1EIZA 4CL0A 1M1YE 2VK2A 4GRDA 4I4LA 1KVSA 4MVJM 4TS9A 3TBFA 4BVEA 5ARBA 1CUDA 4LFCB 2GZ1A 2O3QA 3EK2A 2GCPA 2GN4A 3PKZA 1U2EA 3PV0A 5TV2A 3E3LA 3IKMB 1MJ5A 3X1ZA 3QNUA 2JIRA 2F64A 2I6QA 3N3AC 3FX2A 1EBUA 3RKSA 4D8TA 4MA5A 4ZO4A 4DG5A 1X7XB 3I6QA 1U0FA 4JJ4A 4N54A 2WTMA 5K3EA 2A1TS 5GJBA 4XWTA 5F5LA 1TQHA 4M0LA 2YVKA 4MVJA 3RRZA 3RUFA 2HNKA 2I1VB 2JGNA 4Q34A 3KTFA 1VI6A 5FOSA 2B83A 5HQJA 1ZGJA 1L8AA 2PX2A 3N8KA 4MRMB 1CBUA 1ZI9A 4MLZA 4RADA 3RJ9A 3CGWA 2FJPA 5K0SA 2IFTA 3V97A 2AFRA 3WI7A 1IN6A 1R8SA 1TL7C 4ML3A 4MUAA 2XKJE 3KV1A 2D5AA 4BNFA 4DWJA 3THYA 3GF4A 2FG6C 4B9EA 2PUEA 4M7OA 3FWHA 1XRQA 2DR0A 5TMBA 3OAAA 1GKUB 4QGAA 4EENA 5BUQA 1T9GR 3UWPA 4UOEA 1L2TA 3LQKA 4NCKA 5HR5A 1XN4A 1ONPA 1R9JA 4IHAA 4ND6A 4PGGA 4B3CA 3RRJA 2CLCX 2RSLA 3L77A 2O3SA 1HQDA 2BHRA 1QVZA 1TJYA 3AUUA 1KKUA 5DH9A 4L50A 4KAAA 2ZRAA 4KQIA 2J0UA 4LQDA 4G0OA 5IAGA 3FHJA 3FZEA 3PPVA 1S89A 1VL8A 2FFJA 1TM4E 3HEMA 4FWBA 3Q6NA 3V7WA 4N3NA 4S2UA 4D97A 2ZE7A 5HBRA 4D3FA 2PUWA 5DMHA 1ZRHA 4HDMB 3B36A 1ZYUA 4ARSA 1KZ9A 4D81A 4J0DA 4FZJA 3FMFA 4JGIA 3TW0A 1H9CA 3AGPA 4BMNA 4KU4A 4ZVSA 3WJAA 5KNCH 3DDNA 2RG7A 4IMPA 1UJBA 2QD3A 3LW8A 4MAFA 4XQ9A 3GVXA 3IRVA 1ISMA 2X4IA 1Y8ZA 3HYTA 3HN6A 3MRVA 4MW5A 4TV9B 3RW9A 1JHVA 2JS7A 4AY4A 3QJ5A 2WK1A 4YCDA 3RS4A 3GMTA 1B00A 1WZEA 2YXBA 5A71A 2ATVA 2ORED 5A7GA 4FE4A 2B36A 2CJYA 5DYGA 4EYGA 1II8B 3ZGXA 2AQKA 1AGNA 2MSWA 3H5AA 4L9WA 3OFND 1JKXA 2A1UB 3UCEA 5CVVA 3WA7A 4DR3B 4EO7A 1QFYA 2C29D 3E1KA 3QVSA 4G23A 1WIWA 2QN9A 4TZ6A 3HVHA 4YRIA 3CJQA 1EGQA 3KE8A 4L27A 5G53C 5B1DA 1T3SA 2IDMA 8GPBA 1YB4A 2CHVA 2V1UA 2O3RA 1GPDG 2CNKA 2ODPA 2DP4E 1U02A 3K53A 1SUCA 4TTQA 2FRDA 2Y99A 5LKAA 3AKZA 3L02A 4G5FA 2QX4A 3GCGA 2I6UA 2OLJA 2VK1A 3NONA 4WCFB 3G9TA 3UK0A 1M76A 4OQEA 4QTUB 1N8TA 1ZOLA 1PBNA 3HN7A 4G8JA 3SQXA 4Z8YA 4NYJR 4Z9FA 4MS1B 5K3FB 4MQFA 2WHEA 1HYQA 4C6TB 3L79A 1E1LA 1UR5A 2M6SA 2YDXA 4H1UA 3BXHA 5JTUA 3ZCQA 3GVIA 4OHOA 4YAUA 4PYIA 5IVPA 4A6XA 3U0VA 1ORDA 1YHYA 5LYJA 1QM5A 4X24A 4MUYA 3A10A 4REOA 2J07A 5JNWA 3ABZA 2PVCA 4RU1A 2CVPA 3WX0A 4ZODA 2R00C 2SKCA 1W48A 4UE6A 4ZMSA 4JQCA 1C14A 2FW7A 1WHSB 4U2KA 2GBGA 2EARA 1RRFA 3W5CA 3NHZA 2Z6VA 4N76A 2F4VB 4JH0A 2GILA 2VEDA 3T7IA 5CDFE 2PUVA 2WU8A 4EY7A 2HFKA 2QEQA 3VVMA 3R24A 2QV7A 2XCIA 5D84A 5DIFA 1ILEA 1W46A 1FVHA 2IHUA 5HZMA 4ARZB 3AOEC 5TRTA 2C5GA 2WIFA 1VA4A 2PT7A 2IIVA 2H5LA 2DFTA 4BFVA 1ZESA 5AUPB 2JI6A 2YV1A 4P31A 1E1DA 3ZVNA 1EFLA 2HQSA 4I4TA 4K8OA 2ZYIA 2OGZA 4HDSA 4C29A 3KETA 4Q39A 3GLIA 1OXXK 1QQ7A 1XBTA 3OX2A 3QU5A 4KXUA 2YNMA 1QTRA 2LIPA 4S05A 4OLJA 3N2KB 1QRAA 5AW6A 4X97A 1Z25A 1HDGO 3TK1A 4OHCA 4Y1RB 1Z15A 4UM7A 5BOVA 4Y2SA 4WPGA 2Z9BA 1JQJC 1FW8A 2I6XA 1WD5A 1B8OA 2WIGA 3CLRC 1ZDMA 3GNLA 3LC1O 1DVRA 1BDIA 2GPJA 3C87A 2FZVA 3UJCA 2QYTA 2XQKA 3PTLA 5DWQA 1KR5A 3KKLA 5F1OA 4YGXB 4JUAA 2XF8A 1PFQA 3GT3A 1EP1B 2NO7A 3EFBA 4ZPXA 1A5TA 2FSFA 1A76A 1PFGA 4IXDA 4BVLA 2P4HX 3BBLA 3PPYA 3TLKA 1V7CA 2DY1A 2YXDA 5DGTA 4IOKA 3F1KA 5FI3A 2XRMA 4TQGA 5E9AA 1RPZA 3DTVA 4LHXA 2PUGA 4KNYA 1Q7CA 4CF4A 5A3JA 2J32A 5SYAA 4MW9A 3RHTA 4MW0A 2V58A 1NU8A 4CRWB 4DV1B 1EVLA 5DNYB 2YWJA 5KKAA 1A27A 4QUJA 1U5CA 3TS1A 2UZ0A 4J1NA 3B3FA 4NQZA 4KIGA 1RTKA 3W5AA 5ALZA 3O47A 1MQ9A 1UPXA 2A94A 2JLYA 1NVTA 2X0NA 1CP2A 3DVQX 1T2AA 3WQQA 3OZRA 3T8YA 3L4KA 2H7CA 2IX3A 1DCTA 2XGGA 3Q9UA 3P94A 3BCUA 2AOUA 1RAIA 1Z36A 4GO1A 3TB6A 1R4NB 1XEXA 3VNQA 2NIPA 1R9MA 5IKOA 5KX5B 4TV8B 1U9JA 4OHWA 3QX9A 2Z56A 2YWCA 4TL7A 4DB4A 2EQ5A 1HV8A 4CFSA 1DTEA 3KZCA 5JQGB 4FFBA 1ZSYA 2Z5LA 3F1LA 3MIZA 4EJ6A 5HOQA 1L4YA 2OG1A 1R0YA 1LK5A 3O83A 3K0FA 2J3MA 2WKSA 4JB0A 1NMQA 3KKKA 1ZFNA 2Z8XA 3UK1A 2WT4A 4KIUA 3AI7A 1UAYA 3PQ3A 1S7GA 1VP3A 2A9QA 1CE8A 1QG6A 5EVCA 4TZ0A 2BFEA 5CBPA 3TRHA 1OBFO 3LDAA 1I3CA 2V9ZA 2G9UA 5EJ5A 4CMKA 1ZM7A 3UH1A 4RHTA 4E5MA 2J08A 3D1LA 3T5TA 5L4SA 4ACBA 4JYZA 3BHMA 3D0RA 3QBEA 1E5QA 2OHOA 2ZJ3A 1KP2A 2O7VA 3LUJA 1FPQA 2C20A 1HGXA 2RGXA 3KEOA 4DWWA 3CRZA 1AURA 4FZ3A 2UDPA 2OYCA 3JVEA 4NXNB 1YASA 1U3WA 4AJNA 2XXBA 3QA3E 4FIDA 4R51A 4RACA 5KTRA 1ULBA 5IZCC 1OZGA 3FDZA 1N2GA 1EEXB 1ZM2A 3VU3A 2ENUA 1PT5A 4X8MA 1DFGA 5K1ZA 4BLQA 4JFAA 5CLHA 1WXFA 1KFKB 1Z39A 4Q9IA 4CF5A 1TF7A 2HXYA 1KU0A 5BQXA 5SYNA 1OGIA 2WSSA 5L45A 3F97A 1ZCBA 4FW9A 5LOVB 1T0BA 2FEWB 4JNKA 4ALLA 3IH5A 2EFYA 4MQBA 4E03A 1WSWA 4YRLA 3SEZA 1VA5A 3TM4A 1DUIA 1HE3A 3AQIA 2IU6A 3IV7A 4HLUA 4KJZA 1AN9A 4N8EA 1ZNXA 2RAFA 3EDCA 1S01A 2L2QA 3CH4B 3F98A 3RS5A 4CODB 2EKLA 1HQKA 1JFSA 2IYSA 3GLGA 1TKBA 2KWIA 3SYKA 4NU6A 1HL3A 4RHUA 2QHXA 1MIOB 2HH9A 4L3OA 1HM5A 1P7CA 2QVGA 1E0SA 2PX5A 4HMQA 3ZIAD 3ADCA 5KPJA 1G8SA 1P72A 3GRVA 2OHJA 5EIXA 3T4UA 2HTFA 2IXTA 5AI6A 3OM9A 1MC1A 2ZI4A 5GZ1A 3KSAC 1TM2A 2TECE 2VF4X 4X61A 4ADSG 4UUQA 1IM5A 3GJ4A 1VCMA 1VRWA 1RZUA 2VSOA 4WOPA 1U6KA 4JSYA 4WLVA 3ZZNA 3ZDEA 4CPDA 1M2NA 3BE6A 2MTBA 2YYYA 4COKA 2QE6A 2WAAA 2QTVA 5GGXA 1WMSA 3O3NB 4MWCA 4PXYA 1K5HA 4RK6A 2WWFA 3O9MA 2WIDA 4PPYA 4UTVA 5I4CA 2PSHA 4GLOA 3ROPA 2GXQA 3W8NA 1A4XA 4EG5A 3IHWA 5B53A 2ZETA 1AGPA 2QE7A 2FFQA 3C4QA 1EX7A 1KJQA 3K92A 2PZMA 2WW8A 3EFOB 3PQ6A 5ALIA 5THXA 3SYNA 4MJXA 3WL8A 4GR5A 2EKQA 3O2SB 1SZDA 1Z0JA 4RS4A 4WNAA 3E7DA 5JD4A 1JPVA 1VLJA 2DJIA 4MV4A 2WD9A 1TO2E 1G0OA 1PKXA 1Y7LA 2OZKA 1X1RA 2YZ2A 1YU9A 2QSJA 1LFDB 2YJTD 1P3DA 1CHDA 4X1KA 3THRA 3ZHUA 1P4GA 3DOFA 5BMVA 1ZMXA 2ODWA 2YY6A 1VLZA 2D4HA 4U2GA 2IV3A 5T4HA 3IDQA 2AB0A 3DVAB 4UCFA 5C1PA 1OH6A 1CS0A 4QRDA 2V45A 2GNOA 1ZINA 3VR6A 4IJ6A 3DYIA 2IBSA 4G25A 1QKIA 1RXYA 1JTVA 1D09A 4DA8A 1IHPA 2ODBA 1EH5A 2FZ5A 4HNGA 3DOJA 4R0VA 3LK6A 3A2LA 5JRJA 1AS3A 5TQ2B 1OR8A 1GXSB 1ST3A 4C6SA 1JFVA 4YRGA 2MHCA 2PYZA 2GDJA 3C48A 2Q07A 4JQSA 3AHJA 1F2VA 4JJIA 3GRKA 3C3MA 1C3EA 1UXIA 3OJFA 3CEMA 1NXQA 4YMTA 2Q50A 3MWEB 1NBHA 1FLAA 3LKZA 3BCRA 1ODIA 1ZVKA 1LQ2A 2IYUA 1OLUA 5LBUA 2X7JA 4XAQA 4X1IB 1A4RA 1YVDA 3TXAA 2QI9F 3OHMA 3C4VA 3JWPA 1QWSA 4KIFA 5EZYA 2Z4RA 3DF9A 2C9BA 1L7QA 2VJBA 5EJ2A 3HJNA 3CBGA 4ZO6A 5HSGA 4TTRA 3TIFA 1N78A 5KYKA 1IK6A 5BOSB 5TS3A 4EW6A 3ROFA 1ZBQA 1ZPDA 4L2IA 4HNVA 1NSYA 5AESA 2WE8A 1GUFA 3M34A 4YT4A 1J2YA 3A6PC 3Q3VA 2XNKA 4LHWA 1BD3A 4BP1A 3H7AA 4LXGA 1QTNA 1DWUA 3M6WA 4I5FA 1N75A 4TKLA 1O8CA 4NU8X 3NCTA 1IBSA 4L6IA 3TLCA 2JZNA 3QIAA 3ROKA 2AN3A 5DEOA 2VZ8A 5B1HA 2XADA 1X0XA 2P2DA 3DOUA 3TLYA 4BU1A 4LJ6A 1LV8A 3F6RA 4HZUA 4PSCA 5DYWA 2COUA 5CVDA 2ASVA 1FTGA 1JHPA 1K2VN 4K0RA 1QXSA 1EGHA 3G0CA 1MB4A 3PUJA 1I7PA 3WJ1A 5IZ4A 2XXAB 5KAPA 1AUPA 2W4MA 1GTG1 1AO3A 2V0CA 2WBLC 1I5EA 3DE6X 2XPCA 3D5QA 2C3YA 4NFLA 5L6LB 3V8NA 1JVBA 5JPDA 1R74A 3I6YA 4HQ0A 4FGJA 1EFHA 4RJJA 2BD0A 2GT1A 2P2CA 1T6BY 3IUJA 3LCVB 3LY9A 3IYLW 1Y4DE 4LDAA 4CKCA 4YMHA 3K96A 3EDYA 1K97A 3VZBA 1U0RA 1AZTA 1QIEA 2DFLA 3NXSA 4RGQA 1JI0A 3AH8A 4JLKA 4K9LA 1RHJA 4BQQA 3PNBA 4HWTA 3U37A 3GD5A 5F7ZA 3ZXIA 1G9XA 1EX9A 1B8PA 2ZUVA 3IKVA 3K2BA 4IH9A 2Q0XA 4FHDA 2C59A 3AU9A 3LPDA 4ZQHA 1NNSA 5HDQA 4XWWA 5KVCA 1V16B 3PQDA 2QN6A 1L4GA 1MGPA 2YV3A 2DFKB 4GFDA 3KK0A 4Q3LA 4X6XA 4XDYA 5CX1B 4AJPA 4EMSA 1XTVA 3C4JA 1YFKA 3LXXA 1QHGA 1M73E 2FZEA 2IYPA 2VEOA 1RHUA 1XWWA 3O4FA 4MVXA 2DUNA 1FNNA 2ZTHA 1VL6A 3N2GA 4TSFD 3ZX5A 3WLEA 1B16A 4IIEA 1NVFA 4D9JA 5A5FA 2QYSA 3GU3A 4QSMA 3WOVA 3V2HA 3G6KA 2VHTA 1Q17A 3SBOA 2M32A 2ANCA 4PZEA 4UPEA 3MGBA 3W1WA 1XTQA 3ZEIA 2QAIA 5EP4A 1PU2A 3DONA 4RQBA 1W4ZA 2CLEB 4MGIR 2FPPB 2O2JA 4NU0A 4KOEC 2ZQYA 3KCQA 5HX7A 1OFVA 1GQ2A 4ZP1A 4AUKA 4AUMA 1ZJZA 4ZJPA 2P67A 3IBCA 4FUTA 2HYDA 4YC7A 4A8JB 3K8YA 5LSAA 1EWTA 1RI1A 2CXTA 3W2TA 2GPBA 1NW6A 5E3HA 1JE0A 2EWMA 3DMTC 4JB2A 4ZAVA 5K6AA 1MKYA 2O23A 1J39A 1YQDA 2H9IA 4JFRA 5HF6A 4Y1GA 1CU1A 2J59A 3DQPA 1GAJA 1NBEA 4E07A 3S40A 3OJEA 5BN1A 3WMGA 4IH4A 1OLSB 2C2GA 5HGXA 1Y8CA 5JD6A 2XSZA 4GBMA 3ABOB 2GESA 3GL9A 2PNFA 3OPYI 4DQLA 1NASA 4NFSA 4YROA 1LC3A 3UXYA 1PE0A 4OXXA 3CUSA 3QE4A 4M0DA 5DBOA 4DA4A 3JASA 3RRXA 4BKOA 1N5IA 4W4TA 4I1SA 3JVIA 5AM1A 3WGNA 3WRXA 1OB5A 1ZD9A 1S2LA 1ZD4A 2PANA 4G3XA 3BILA 3VPSA 2RGGA 1XD8A 4KZPA 5HZKA 4P0QB 4OLAA 1ZK3A 3COVA 4WACA 5COAA 3VPHA 3QPDA 2ZJFA 3SNKA 4J0QA 3LQ4A 1C4OA 3KJGA 3CA8A 3LHIA 4M6WA 4A1FA 4BVFA 4AMVA 5JAMA 1RAEA 5AJHA 5K0GA 3H2BA 1C8LA 2JBHA 4M8IA 3AP3A 3U4DA 3M6IA 1C9YA 2DSNA 5CYGA 3JQ9A 3EEIA 2ZUFA 4D0RA 3C39A 5K0EA 4CMGA 2I66A 2HR1A 2V8OA 2PM8A 3M1LA 4HDRA 5B5SA 2JFWA 3U7IA 1QF6A 2XGSA 4XUGB 5CU7A 4B4DA 3OOWA 4F3NA 5AR1A 3SIRA 3TXYA 5GTDA 1VHDA 1WR8A 5K8LA 1GAXA 1FJHA 3ZCRA 4MLCA 4JS0A 1EVZA 4P3XA 3QVGB 1K63A 4PQFA 2HMUA 3ONWA 3RHZA 5JADA 1G20A 1N5RA 3R23A 5LOVA 3CT4A 1YB5A 1KH3A 1IB0A 1QHHB 2LKDA 3I0ZA 3RYCB 1Z63A 2ENWA 3SSMA 4F97A 1LW7A 3QP9A 5HF9A 2XE6A 3D8UA 3MAJA 3NHWA 4MV3A 4OFZA 5H80A 4C01A 3QG5A 3UMJA 5I9NA 1JIIA 5G0UA 3DEAA 3LW7A 4D8YA 3U17A 1CETA 1JXOA 4G85A 5A4IS 1NQOA 2O57A 3WIOA 8MHTA 3A6FA 5LA6F 4Y6SA 5F33A 4BO7A 1BXZA 3WSVA 4CLHA 1PUIA 4QQFA 3EJWA 4I1YA 4FGWA 2BUCA 4YXFA 4BKMA 3MAGA 4Q48A 1HKHA 2GB4A 3BQ9A 3H18A 5IC4A 1I2CA 3KPJA 2G9QA 4D7AA 4L08A 3HV0A 3ICCA 1A97A 2BMFA 5I7EA 1Z35A 3ECCA 1YT5A 5L7TA 4AP6A 3VHQA 1I80A 1IBRA 1BCSB 1NSTA 3DQZA 5KYVA 5DO9A 2DLNA 2I9PA 2B4KA 5DYIA 5FL7A 4YUYA 4NL4H 2RJOA 2BOVA 2NWQA 3A1VA 1H05A 3FJ1A 4YT5A 4AQ7A 4MTCA 4LYDA 3ERCA 1YKFA 2Q29A 1KY5A 3TN7A 4KQWA 4H60A 4YAJA 1QHSA 2VDUE 3MBIA 2QJWA 2E21A 1DJQA 1E1CB 2HCBA 2WMOB 2WQ7A 4QOFA 4CEJB 2NTNA 3D9QX 1V3UA 2COKA 4FFRA 5EGNA 5JVDB 5FWXB 3G9XA 4HTFB 1RRVA 2VSNA 3GBVA 2IHBA 4OOFA 2IPNA 4HF7A 4NH4A 1L6IA 5FOUA 4LOKA 2AW3A 3R9WA 3RAFC 4IJWA 2PKQP 3HA7A 4CI0B 2QZJA 2P9CA 2RJNA 1DQYA 2OHFA 2JZCA 4KBGA 1AQUA 2MYTA 4Q4LA 2FAXA 4WL0A 5KC8A 2WU0A 4I1OA 2AX3A 1TLLA 2XMCA 2GERA 2OP1A 4DWOA 2B5OA 2Y1DA 2IW1A 1C1DA 1QOPB 3DEHA 2E82A 1WQ1R 2XNSA 3HFRA 3PR1A 3OZBA 4C87A 1CQIA 1PNOA 2XBLA 2CXRA 3IJPA 1ZVMA 4RIFA 4C4YA 4NFYA 1XLVA 1CKEA 2H4JA 1KEZA 5KYWB 3CY6A 3A9VA 4RGVA 1NDHA 1N33B 1E7MA 2L42A 3UV6A 4DIBA 2DPXA 3OMXA 1ZUWA 3GPLA 2JI9A 3F3KA 5LQCA 1W19A 3I09A 2Y0DA 3U7EB 3W5BA 2IT1A 2QL9A 2D5BA 4H3KB 3ISVA 3WRYA 3VHXB 4OYLA 1UFQA 2WJ6A 1R0XA 4M2LA 3V33A 5HPYB 4FOOA 1KXJA 2RHGB 3U1BA 1L7EA 4INZA 4UW9A 1EGMB 2XSZD 4K6OA 3GVCA 4R9SA 4KQ1A 3J81A 1QYVA 2XECA 5HCNA 1DXQA 2ZEJA 3UVEA 4KPUA 3I12A 2F3PA 2JDIA 1GV1A 5I45A 4JHLA 4M88A 4H1VA 1GXSA 4LPKA 1JSLA 3KQTA 1IN5A 2NPIA 3EY4A 3EZNA 2NVUA 1JEJA 3HUTA 2WMNB 2RGUA 3OICA 1KQNA 1QPGA 3B7GA 3ENQA 3JQ7B 3RQIA 4FX2A 4CF7A 1LNSA 5AJXA 1J2JA 1EFVB 3TTUA 4BX0A 5DSXA 4EA6A 3EGDB 3TQRA 3KLOA 3WDMA 2Q4OA 4HX9A 1GZVA 5K45A 1FDVA 1XZDA 2IL1A 3QVLA 2QMZA 2Y0EA 5DF1A 1OUMA 2NACA 1L7DA 5DBGA 3O2QB 4L4SA 5H83A 3S70A 4EB3A 4QU9A 1I01A 4PC6A 3K0CA 5BYBA 1Q1BA 2JFGA 1A77A 2P6PA 4M4SA 4I1PA 1SA0A 4LMBA 3MNFA 4EUSA 2QAGA 4DMRA 2WD7A 4V3CA 5IT5A 3BMNB 4XPIB 3WGIA 3C41J 2VRCA 2ZSJA 1L4UA 3JR7A 4IAOA 5ALGA 5EJGA 5FWYB 4EG0A 3HDQA 5K0NA 1M8JA 3HBNA 2G77B 1ODFA 2B20A 2BAGA 4BJHB 1E6WA 2ILTA 3FE2A 4X7RA 1J8MF 2C4MA 3BMOA 4WW0A 4O2LA 1K1EA 3OMWA 2WFLA 1FS5A 3G2OA 3AHGA 1OLOA 5HHTA 3OKCA 4D92A 1AE1A 4ZVRA 2FR0A 3S2YA 2QROA 1FUUA 8AT1A 3VU8A 2X2PA 2E4UA 1F6DA 4JIGA 3LVQE 4XRGA 4X65B 1TO6A 2WIAA 4JL8A 3NIFB 4BDSA 1ZGAA 3WYGA 3V9AA 1Z8NA 4RTSA 2JF0A 3ENKA 5KSOA 1X92A 4RIHA 3CF6R 1W8IA 1D6SA 4YQZA 4PAGA 2QZPA 3GXOA 1X94A 3LP8A 1L4NA 3M5DA 2O5EA 1PJ2A 2YJZA 1VSUA 5FD8A 4Q1VA 2WF8A 4QGGA 1V5WA 1J0DA 3FDFA 3QU4A 2QUKA 3W1VA 2HL6A 5CDSA 2NQ8A 2YFKA 5KTPA 1V3VA 5HMMA 2WI8A 3GEGA 4PHTA 1PR3A 2OLKA 4G0ZA 1R1DA 2XGMA 4BLTA 8ATCA 4LHEA 4TTJA 3W7BA 1ZD2P 4AP9A 1FYVA 1KE1A 4L4ZA 1T5SA 3E61A 3NHPA 3O4JA 3AV0B 1U65A 1S8AA 1IU9A 1GT6A 2Q8PA 1GEGA 1A1SA 3AESA 3GGDA 2PLRA 3IXQA 3HU2A 3VDRA 4TUYB 1J99A 2JGDB 1TJPB 2NNWB 1ZN2A 4BQFA 1SCAA 3G49A 4KACA 1G4HA 1DG9A 1HYEA 3V9PA 4TLCA 2J9FB 2R7NA 2QP3A 1N6KA 1NR5A 1P5ZB 4XOUA 1ZI8A 1Z0UA 3KOYA 5H4GA 1H4TA 3OJLA 5B58T 1Q20A 3H8WA 2AGVA 4EKIA 4L8WB 3RC7A 3F6CA 1SCNE 1T36B 2G5CA 2HQBA 2P2YA 2PA3A 2VYVA 4HI0E 5H16A 1OAOA 3SEFA 3FTPA 1OY1A 2YN2A 2WV7A 2NYUA 1N1EA 4RMHA 1VJGA 3ZJ4A 3LX8A 2IPXA 1PD1A 1BWQA 5LU9A 2BGIA 2CKDA 1ND5A 2Q6LA 3ED5A 3JYLA 2A5JA 4F5YA 2AC4A 3DA8A 2ETVA 2A86A 1E66A 5H3HA 2WYWA 1KRXA 1SUBA 2D3TA 1SCIA 2O52A 3OLWA 3OI7A 4ZJYA 4H35A 5ITZB 4P92A 2B4RO 4B1FA 2UZ4A 4Q1AA 4DIMA 4TVOA 4OHXA 1BA3A 1KZYC 3Q3JB 1BXGA 1P18A 1V7QA 2A30A 2VDRB 3GAMA 4M0PA 4PFSA 2GEKA 4UU7A 4B3IA 3ZHYA 3I72A 3ZXUB 5B57C 5KMGB 4DTCA 4LRSB 4NAHA 4C4OA 3QWFA 5LDGA 4CMIB 1F8YA 3IVRA 1IUOA 5LLSA 4IOLA 3EVNA 1QONA 3K1JA 3D4BA 1AKEA 2DKNA 2OPHA 3SCZA 5B3LA 5EEHA 4XUCA 1ZJJA 2A67A 1I7NA 1LLFA 3KQKA