1ZRHA

Crystal structure of human heparan sulfate glucosamine 3-o-sulfotransferase 1 in complex with pap
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
VAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 1
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zrhA00
4QGFA 1KO4A 4MGZR 1JEEA 2EWWA 2F9LA 3NDPA 3VU9A 4KSBA 4U00A 5JSZA 2IL1A 5L3QB 1OH7A 2ATXA 2EFCB 2GJ9A 4LJ8A 5DHFA 4KO8A 4FXPA 2CCJA 2NGRA 4URVR 3EASA 1VG9B 5KSZA 1E2FA 2X2EA 3PUXA 3K53A 3K0AB 3GJ0A 3I1FA 2QE7A 3ZYCA 5TARA 4DLZA 3P32A 4B71A 3WYFA 4EIWA 2WSSA 1UKVY 1W2GA 3RDPA 4P0TA 2OAQ1 1GNPA 2FH5B 4M8NE 5KSOA 2NQ2C 1BYIA 2XJ4A 2ZRAA 4LYAA 3GMTA 1R5NA 3PV0A 2MSEB 3CLVA 2GXUA 1CKEA 2IT1A 1ZJ6A 5TV2A 5L3VA 4NDZA 5FBVB 4YMTA 1U0LA 1ZMXA 4PHHA 2VQSA 1UDXA 4BLSA 1UEIA 3UK6A 2XTNA 4D6PA 3A8TA 3WY9A 2GWHA 4IVPA 2QSYA 3BGWA 4YMVA 1OYWA 3B8HA 1W36B 4UNQA 3AP1A 5H70A 4K81B 4D4LA 3WNBA 4D4JA 3FYHA 1HY3A 2R6DA 1XPRA 5KSYA 4GZLA 5C46F 2FFQA 2RGNC 4M1WA 1EGAA 2R62A 4MRVA 4OBEA 2DB3A 1NL3A 2IYQA 3U60B 1GZSA 4N0DA 1GDDA 4V0MA 1DADA 3PEUA 1KDOA 1AN0A 4YXWA 2ZPTX 1E1QA 4Q47A 2R2AA 3QKTA 3V4RA 4LC1A 5JWOA 1E79D 3QNUA 3PVSA 2GCPA 4FD2A 4BPBA 1KY3A 2PJRA 1XXHA 1ZYUA 1OIXA 2OFXA 1A2KC 2FWRA 5AUOB 2QY9A 4OJQA 3FMPB 2QGNA 2D2EA 2ZI9A 1DAMA 4LJ7A 1U9IC 3AF2A 1E32A 3LA6A 4LDJA 2BKUA 3LBHA 2O8DB 3QEJA 821PA 4KBGA 2QRNA 2I1VB 1VMAA 3AV0B 1NLFA 1ONBA 1N6KA 4JKYA 3BOSA 2BMEA 4HAYA 1RRCA 2ZJZA 2YWGA 1E0SA 2WSSD 3OAAD 1CIPA 1OF1A 2AK2A 3BFXA 2OCAA 4JL8A 4BFVA 1J2JA 1VCNA 3CNOA 4BFZA 2WWIA 4Z1MA 4YC7A 4AI6A 3ICEA 2RMKA 3X1XA 3U7FB 1QHSA 3QKUA 4F7WA 5IRCD 1G16A 1SKYB 1OT3A 5BN5A 2ZUCA 1W46A 2CNWA 1N6NA 1W4BA 2RGCA 1VDZA 4RKEA 2NG1A 3DMDA 3L8YA 2JDIA 1XXHE 1B0UA 2CL7X 3KQLA 4DSOA 2ZVQX 3NBFA 4TYYA 5EXXA 3MAAC 1E9DA 2W00A 1DAFA 2CHGA 5E7JA 2C9OA 2R6CA 4IDNA 3W8NA 1A7JA 2WWXA 1Q3TA 3PUYA 4JLDA 4CGZA 2G9NA 3EIQA 4NCKA 4MKHA 4V0ME 3NC1C 5BW8A 1KSHA 2ANBA 3G82C 3OESA 4OHZA 2V1UA 1M2OB 4ZCMA 4NONA 3GD7A 3B1WA 1YZQA 1ZM4A 2ASEA 2C5LA 2PX0A 2PZFA 2PT5A 2WWGA 2YOGA 4RCYA 4O25A 1OB5A 2GAOA 4IJMA 4GPTA 2XX3A 3C5CA 4HB0A 4YMUA 2CHQA 1P60A 4K8OA 3PEWA 3KJEA 1E4VA 4OJKA 2BMFA 1M7BA 4JL6A 4OQNA 5K8UA 1ZNWA 3BB3A 3CW2A 4BRUA 2RGXA 2XAUA 4NCIA 4DRZA 2QBYA 4Q4AA 2YC2C 5LPNA 2QN6A 2FA9A 4P31A 5KO2A 1P72A 3MJRA 1ZM9A 2C98A 3PIRA 3RC8A 4Q1CA 3DM9B 3K0CA 1RIFA 4ZV4A 1VCMA 3E5HA 3FTQA 4A6XA 3U6KA 4HLUA 4ERNA 3BORA 4QHTA 2F1RA 4WOPA 1FUKA 3GLFB 4L9WA 2HYIC 1NJFA 2LKCA 4TQAA 4RVCA 2FMXA 4LJ6A 5DH9A 3SR0A 3ECCA 2A78A 2OLJA 1SXJC 3MWYW 3SFVA 2Q0HA 2H16A 3UMFA 3B1VA 1OXVA 1T0JB 4V02A 1N2CE 1S3GA 5JCPA 1K5DA 4CF7A 3ND9A 1T5IA 2D2FA 2W6ID 1Q21A 1EG7A 1XEFA 3QVUA 4V03A 5CM8B 5FR1A 121PA 4BZPA 4DLYA 5DISB 5HTKA 4OI0A 1EFUA 2QSZA 4UNNA 3THYB 4DLXA 4TQ9A 4W5WA 2GEUA 3CWQA 4MGYR 2W6IA 3NG1A 5CK5A 5J4KA 1NNEA 1DBSA 2OV2A 4DIEA 1KTVA 2VF7A 1RRGA 1W4RA 1Z6YA 4PC3A 2V3CC 1KO8A 1XJQA 4DUGD 3TR5A 2O8FA 1SKQA 1KAGA 2FF7A 2ZRMA 2HJGA 2PCLA 3WMEA 5JSZB 4F93B 2OEPA 4PX9A 3U3MA 1G8GA 3FE2A 3LV8A 4D4MA 2J0VA 2L0XA 3PEVA 5M04A 5CDFA 1F60A 2OZEA 1O87A 4KCGA 5TMPA 3FHTA 4FMCB 1JAHA 1GNRA 5D3QA 2JLRA 3KX2A 5E7IA 4L4UA 1Q0UA 2X1VA 1AS3A 5B58C 3U7EB 4BWYA 1PZNA 3TRFA 4D80A 5JS7A 4CEIB 4DIDA 3IBGA 1CU1A 3HR8A 1YR7A 2V7QA 4ON9A 2VP9A 5FL7D 2QZ4A 1ZM2A 3W34A 2CBZA 5HKKA 3V00A 5JHGB 4QXAA 3TJZA 4NU0A 4O2LA 1OHHA 2Q6TA 2ONJA 3UXMA 2IK8A 3MRSA 4GP6A 2F55A 4KHZA 3O47A 1I2MA 2QAGA 5E7MA 4MH0R 2Q3MA 1FNMA 1OE0A 3WXMA 1KDTA 1SVKA 2V7QD 4E22A 3KKMA 4BFSA 4DZZA 1W4AA 3C14C 3RNLA 5EXSA 2ZS7A 1FQKA 3D7MA 1U8YA 1GL7A 3A1WA 1QVAA 3IQWA 621PA 5KNCA 4C0AC 3FVQA 1G9XA 3B9QA 3PUZA 3F0TA 4Z51A 5E95A 1KI1A 1UADA 3NXSA 4KVGA 4B73A 2GCNA 4MRSA 4AKHA 3ZDQA 1E2GA 2O8BA 1E1RD 1WRBA 3H4MA 4ZDIA 4TLBA 1IXSB 1FTNA 3I3SR 2KBFA 2P67A 3AEZA 4LBZA 5CIWA 5G3ZA 5BYKA 2K5UA 3OEHA 2DFNA 2VSXA 4GT1A 1YZGA 1IM2A 2J7KA 5CM9C 4B47A 4DKXA 1S9DA 2N42A 4TN1A 1RFLA 1UDWA 1CR2A 3THXB 2VEDA 1ZVQA 1HT1E 1II8A 2RGAA 1HT2E 4DCSA 4CEIA 4GP7A 4ESVA 1Q1BA 3MLEA 4PTLA 3EC1A 1IHUA 4LBVA 3IHWA 1CJUC 1JALA 3C41J 1TQDA 3AB3A 3ZJYA 1G8FA 2XJ9A 4Q9HA 5CYOA 4ASUA 1R8QA 3VKGA 4ZDWA 1KIMA 2YWHA 1IXZA 1E6CA 4LYFA 4QRHA 4QBGB 2P65A 3K9NA 2GBLA 1U99A 5HPYB 4KXFB 4R2IA 3MWKA 2G83A 4TMWA 1V5WA 1P2TA 1E1QD 1Z6AA 5SZIA 2P6RA 1EFRA 4ZO4A 3QBTA 4A15A 1U98A 2EQBA 2HXSA 2JEOA 1ZIPA 4US2R 2O8DA 3QQ5A 2DWPA 1M34E 4P3YA 4URYR 3VX3A 4FIDA 3CPEA 1BMFD 2GZAA 2VTKA 4Q5IA 5FFMA 5G41A 4TYNA 2H57A 1JJ7A 2FSHA 2WPDD 4JS0A 3ZLJA 1M8PA 2F43B 2WMNB 3B1YA 4US0R 3DKVA 2IYLD 1SGWA 1N5LA 1TQ2A 2OFWA 4ITRC 3K0FB 3W3ZB 3Q3JB 5JZVA 4E5UA 1ZM7A 3TQCA 4C0LA 1KI6B 3FFAA 1XB2A 3RWOA 1NBME 4B44A 1W0KA 2J7PD 4C0QC 2Z0MA 2RGNA 2VHCA 2DFKB 3MCAA 1UF9A 2J0SA 1OFIA 2OESA 1HTWA 4RD0A 1X8LA 1NN3A 2FPMA 5JWRA 2A3RA 1C4OA 4HEJA 3GLHA 5LB4A 3NDBB 3ZQJA 1GM5A 2A5FA 3E70C 5L3RA 1R6BX 4CEJA 2AKAB 4KITB 1FMJA 1XRJA 5FUWA 3R8FA 2VP0A 5BXQC 3AF4A 4NCHA 2XTZA 4Q66C 3LAWA 1T3SA 2ZSDA 4DEXA 1KJWA 2GESA 2AXPA 5AUPB 4YDSA 4PPNA 3NBZC 2ZRPA 4B34A 3B1XA 4I1UA 5HE9A 1GP2A 3SHWA 2VPPA 4LOAA 2ZYTX 3SNHA 2UVQA 2BC9A 4DLRA 2NMVA 4RD4A 3T1TA 4MYTA 1GAJA 1OXUA 2WKRA 3IHLA 2F1IA 4HDQB 1E94E 3SI7A 1T3HA 2F7SA 1PUIA 1A2BA 4RZUA 5FPHA 1X8JA 1LY1A 4MGKR 5B64A 2B7BA 1GVNB 1D5CA 2VBCA 4OHWA 3QF4B 1VPLA 4E03A 1X6VA 3VR6A 2PCJA 1GRQA 2XITA 2AFHE 3MG9A 4M1SA 4D0GA 4URXR 4A4DA 1GG2A 2IYZA 3RRNA 2D3WA 2D7DA 2OXCA 3EAQA 1XX6A 2ZS8A 2ZSBA 4O3MA 4Q1BA 4Y0AA 1KY2A 2Z6VA 3IO3A 1ZRHA 2NOAA 1F48A 4IDHA 1Z06A 4B6FA 1MH1A 1IN6A 2RHDA 3S1AB 4ACBA 3KTAA 4HDCA 3WBKA 4KYUA 1II9A 1WA5A 1J8MF 2GXQA 5J4HA 1X8KA 3TSWA 4URUR 1KSJA 1M7GA 1VECA 4MUBA 2BJWA 1LNZA 1U90A 2FE4A 2IUSA 2RAPA 1N0UA 3DHWC 1FX0A 1UKZA 1Z2CA 3CR7A 3Q7PA 4OQLA 4B76A 5JHHB 3GP8A 5EE3A 1QRAA 5JI3E 4Q21A 2N46A 1XNJA 1ZP6A 2QUZA 1CS4C 4TWZA 521PA 4RKFA 5AK0A 5JMTA 4XJXA 4TZ6A 4MRNA 3HU3A 5TVKA 4TTRA 3VR1A 2VF8A 4EAQA 3UPUA 4GMXA 2ZE7A 3B9PA 1Q22A 5FTJA 3HPQA 1IN8A 4GZMA 2VP4A 1W5SA 4CEHB 3KFXA 2G1JA 4R71A 3AVOA 1TUEA 4FINA 4JLOA 1G3UA 1MT0A 1XPOA 2ZRFA 1KO5A 1S0UA 2GZDA 2WM9B 4AURA 1KYIA 5C18A 3R7WA 4PC6A 3K0CC 3UATA 1QG4A 2OBMA 2PLRA 2NZ8A 5FBWB 2FZLA 4GMDA 5EP4A 3C4JA 2W2VA 2GJKA 3BD9A 1D6JA 2AWOA 3KJIA 2REOA 2ZRJA 4B35A 1SXJA 1AQUA 4NP6A 3RWMB 3UKDA 2QP4A 3B6EA 5EZ5A 4BLPA 4GDFA 4HSEA 4RZXA 1UM8A 3R9IA 4QGAA 4TMVA 1SHZA 1SXJD 3FGNA 1AZSC 4GOKA 2CLDX 1AM4D 1F3OA 2YZ2A 4B48A 3RRMA 4M1MA 4XTCS 1KNXA 2A5JA 2WSMA 3A1SA 3Q5DA 4HLDA 4MYHA 1VIYA 3C15C 2V54A 1TF2A 4TQUS 2ZITA 1HQCA 2CE7A 3RS7A 2ZYUX 1X1RA 4C0JA 2RGBA 2YHSA 3CPJB 5KYKA 1DPFA 2NPFA 2BM0A 1TUIA 2CL6X 1G6HA 5JRZA 3VHLB 1IBRA 1VG0B 1NSTA 5DLQC 4ZDKA 1KMHB 2IXFA 3BXZA 1ZAKA 3D3QA 4UQOA 5AJXA 3IUYA 1P62B 3VR4A 1OKKA 4OHVA 4PAMA 1YE8A 4IEIA 2IYXA 1MABA 3QXSA 1N6RA 4FMBB 3ZVLA 3I5XA 3NBXX 3RC3A 1KK3A 4Q00A 2O8EB 2ZS9A 1LS6A 4S35A 3FMIA 1ZC4A 3BERA 4M53A 4C0KA 3GJ7A 1E2DA 4FCWA 1VYUA 3GJ6A 4BFXA 4CDGA 3ONWA 1Z6TA 2ODBA 3W3AA 3ADDA 4QGGA 2F3RA 2JLXA 2O52A 2JDID 4PFSA 2ZAOA 1S96A 4UXIA 4NYJQ 2DWOA 1IY0A 1RKBA 1YZNA 3FKSA 2CCGA 1CF4A 1FOEB 1NBMA 4F91B 1ZU4A 3NEJA 3KXKA 1G8HA 3A58B 5CIQA 1LFDB 2V1XA 4D81A 1NSFA 2VSOA 3A4LA 1LTQA 1XMVA 4PANA 4IVRA 4QL3A 4ZPXA 3K70B 3LWNA 2MMGA 1KSGA 5DE3A 5BQ5A 1BOFA 4LPKA 5SZKB 2IS6A 3U6BA 3KJHA 1EFCA 2ZJBA 1W2HA 3DZ8A 1DAIA 4FI3C 5FI1B 3WMGA 4GOXA 2G77B 4IFEA 1P4SA 4DVGA 3DL0A 1ZC3A 3W6NA 2IA5A 4HAVA 3LLMA 4HAUA 5CLLA 4QGHA 2CXXA 1ZD9A 4C0HA 3F5FA 4URZR 3TAUA 2ZRBA 1XMJA 2NO6A 3I4LA 2ZRLA 1Z07A 2BMDA 4MA4A 3RYTC 4DSNA 1YU9A 2A9KA 3IIMA 4OK6A 1RPZA 4Q01A 2ZJ8A 4C4PA 1KZ7B 2BM1A 1QZXA 1KO7A 1S3SA 1JQJC 4EDHA 1GTVA 2J41A 4CZ2A 3OEED 3UG7A 3LNCA 3A6PC 5H1YA 4JBXA 2PBRA 5L8VA 4BEJA 1H8ED 3DM5A 1PLKA 3X1DA 4JLVA 3MFYA 5FTKA 2R6AA 4XH9B 3WNDA 1XJ0A 1EFTA 2Q9BA 1N6PA 1EK0A 3GEEA 5H68A 5KU1A 4KFRA 2QM7A 4I1SA 4ARZB 2GZHA 1DG1G 5AUNB 8OHMA 2HYDA 3RS3A 3SYKA 3PJRA 1ZD8A 3JVVA 1OPXA 2WWWA 1T8TA 3GEHA 1ANKA 2NO7A 4HDOB 1A5TA 5G3YA 3HR7A 4NYMQ 2KE5A 2EVWX 1WDTA 3VKWA 2CDNA 4BASA 3BFVA 3AVUA 2WOJA 5J4VA 1RJ9A 3M4YA 2O0HA 5FBQB 1PJRA 3ZH9B 3H1TA 5TXGA 5KTYA 2VH5R 3RLFA 1PUJA 1YZUA 1JR3D 2AK3A 4UJ5A 4F4CA 1FX0B 3SE0A 2QNRA 4HZUB 1W0JD 4HI0E 1ZUHA 4II7A 4U5XA 3I5YA 4YMWA 2ONKA 1R8SA 1YR8A 2QT0A 4B2IA 3TR0A 3KZ1E 3N5CA 5EXPA 1P2VA 1N5KA 1M1YE 1Z28A 3IQXA 1SXJE 1GKYA 1W48A 3PCRB 4MUAA 4US1R 2WWYA 1J70A 4B3GA 1Q57A 4KODA 4TSFD 2C78A 1II0A 3LQQA 4QNMA 4DDVA 3KXLA 3K70D 2XSZA 1WBDA 1II8B 1Z2AA 4M22A 5AUQA 1OXTA 1AGRA 3QJYA 3K9GA 4IDOA 4A36A 4HAXA 4C7OA 2EW1A 2J1LA 3B60A 1JAIA 4G1UC 1QHXA 4EPYA 2O8CB 2WMOB 1HURA 1JR6A 2JGNA 3I61A 4XVQA 4DWJA 2WJGA 3JZAA 3R9XA 4TZ0A 3FKQA 5EUMA 2HT1A 2XNDD 3C7KA 2VHTA 4ABYA 1MKYA 1HQYE 4W5HA 2JLYA 2G1KA 1WE2A 3LH5A 3OIVA 3OFNA 1JXMA 1U94A 2ANCA 1G4UR 5HCNA 5FPKA 5GVSA 5K8IA 3EPKA 4PZZA 1TEVA 2JJ1D 2ZJAA 2FEOA 1YZKA 2YWFA 1SXJB 2VHUA 4XTRA 1VG8A 2B7CA 1RC8A 3T1VA 3THYA 2KJQA 5EE0A 4Q7KA 4MITA 5A5GA 1HE8B 2PMDA 1XEXA 2FOLA 2ZU6A 4NHOA 3SDZA 3AVYA 3GLIA 2BOVA 4A1FA 5EXTA 3AP3A 4JYBA 3G5UA 2ZE6A 3CX6A 4ZI3A 5DN6D 1NMZA 1MO4A 3OHMA 2GJSA 3IGFA 2XXAB 4BFYA 3EZ2A 5HKKD 1LS1A 2PZEA 4DCUA 3X1WA 3FHCB 3WHKA 1XTJA 3KDSE 4TL9A 5IK2A 3Q72A 1EFRD 1JEDA 1ZD1A 4HUQA 3IEVA 1R5OA 1UJ2A 2CCKA 1EXMA 2IEYA 2ORWA 1E9CA 2QQEA 3L2OB 1ZCAA 3WHLA 4EQ6B 4TMZA 4F92B 2O0JA 4ASUD 2V6JA 3Q8XB 2CE2X 5DI9A 5J40A 2ZETA 2QAJA 1G7CA 2H18A 2GETA 1P2SA 3B85A 4IDQA 3LVRE 1KO1A 2C03A 5A0FA 4BEBA 2JA1A 4DUGA 3NHAA 5GJCA 4WBSA 4AWXA 1QHNA 3B78A 5GJWC 2QENA 2OLKA 2NO0A 4EPTA 4LHVA 3BAFA 1LF0A 1SHKA 3CM0A 2EYUA 4UXJA 4Q9JA 1MO6A 4AIIA 5KOYA 1TADA 3EWSA 3TGPA 3B1ZA 2V4ZA 2HV8A 4XD7A 5GVRA 3U61B 1KHTA 3SJBA 4DB2A 4QFMA 5SZHB 3AKYA 2HCJB 3BJIC 4L8GA 3KB1A 2ZE5A 4XSHA 1OV4A 4IKEA 3AGQA 4HB2A 5FTMA 1SVSA 2UKDA 1XCPA 2IYTA 4ACAA 2QM8A 5GJVC 4POAA 1NN1A 3CO5A 3GLHE 3PQCA 5TDHA 2NIPA 2GA8A 4JLBA 3W6OA 1QHHB 2ZYWX 3ZD7A 4IOLA 4TTPA 4L5BA 2BBTA 3E2IA 1NI3A 2RGDA 4Z8YA 3V4FA 3ZGXA 3HWSA 2AN9A 1W0JA 2Z5FA 4DDUA 3KFVA 1CJTC 2WWHA 2IHBA 3DKPA 4RFVA 2FN4A 1E2HA 4G5QA 1F2TB 1VG1A 1GFIA 5JS8A 4HYYA 4Q19A 4KJZA 2DR3A 2A30A 5HCIA 3CH5A 2OT3B 2V55B 4B3BA 3SJCA 1OHHD 4PAOA 1Z6XA 2RB4A 3WNCA 3SQXA 4QG7A 2AHOA 2HEIA 3OZXA 4V0OA 3VNUA 1XBTA 4CYMA 5HR5A 2QP3A 4W5JA 1ELOA 3ZVMA 1SKYE 1HEIA 1XPUA 4OKSA 3Q5EA 1YRBA 2J9RA 3RANA 1PLJA 4QNRA 2J3EA 2GJ8A 2P0EA 3T34A 1EFHA 2H92A 1E2KA 2D62A 2ZSAA 1AKYA 2J45A 1IONA 4S2EA 4XVRA 3T15A 4WXRA 3EPLA 1YZTA 3NBYC 4BECA 3X1YA 1J99A 2AX4A 3Q9LA 5F98A 2Z4RA 1G7RA 3CRRA 3L43A 4IVQA 1OIVA 2QMEA 3RSLA 2A2ZA 1GRNA 3R7WB 5A4JA 3SC3A 1S8FA 1DEKA 4HZIA 3DOEA 1IJFA 2ZAMA 5IDVA 1FL9A 4BE7B 3KQHA 2QORA 3K0AA 1XTRA 3CUEF 4DC9A 2BKEA 2AR7A 4PHTA 3CF2A 3AF1A 4ZIRA 2ZXUA 5JLJA 3U7GA 1TF7A 2EFGA 4CEHA 1W36C 2W83A 2BBSA 4ZCLA 1DE0A 3REFA 1S2MA 1ZUIA 2XTMA 2FPKA 2NO9A 2ZUBA 4A2WA 2FSFA 2XNSA 3UANA 3QOFA 2YVUA 1XD2B 1RW4A 3K9HA 4A2QA 4JSTA 1GL9B 3KQKA 3BB4A 2D7CA 5FOVA 1Z47A 3P4XA 2VIIA 2B92A 2UZIR 3OAAA 4JKIA 2ZRIA 1WCV1 2V9PA 3KKOA 2BCGY 1AIPA 1T0HB 4DCVA 1KI7A 4M1KA 4NYIR 3GLIE 3KKQA 2OXRA 4FWIB 3RS5A 1E79A 3B13B 3IILA 2JLZA 4JBYA 4PPQA 2IYYA 1G19A 3CRW1 3MMPA 4I1OA 4Q48A 3GJ8A 1OFTA 2OUKA 3P26A 5G53C 3H86A 4BLRA 4PAQA 2KI5A 2JJ2D 1P61B 3A4NA 3IIKA 1XMIA 4E07A 3THWA 3ZS9A 1R2QA 1AJEA 4LX0A 2F6RA 4CW7A 1QHYA 1S9HA 2C99A 2PX3A 3IEUA 4A8JC 2IUTA 1Z5ZA 2O8EA 1NLZA 1Q3HA 1UBEA 2QMOA 1R0WA 4NH0A 2R44A 4EPXA 4LV6A 5FOXA 4D2IA 2EU8A 4OI1A 2ODWA 6Q21A 2FV8A 1DO0A 1T5LA 1KKLA 4Z8XA 3TMKA 2EFHB 2ZI5A 1OH6A 1Z0FA 1H8EA 1CJKC 4LK2A 4DT1A 3HYTA 4NMMA 2VRWA 4TT3D 1FMLA 1ZM3A 3TUJC 5FUYA 3EIHA 3O8CA 1AA9A 1FZQA 4AK9A 2OFOA 2CVHA 3A1TA 4PHGA 5JJIA 3CF0A 1DAGA 1CBUA 4HUTA 3EXAA 4HB4A 3SBDA 2I1QA 4PSKA 1Y63A 2XXAA 4TLAA 1XD2A 2I3BA 5JJKA 3U44A 5SZJA 2QMUA 1G7SA 1N6OA 3CZQA 5FUVA 2Q9AA 2IX3A 2HLDD 1F5NA 1G7TA 2QGZA 1FP7A 1G64A 3HU1A 4Q1EA 4RZ2A 1GITA 3U4QB 1CXZA 5E3HA 2NPIA 1NKTA 4LHYA 3DOFA 3CX8A 4A0HA 4B2PA 3U5ZB 3NVAA 2J0UA 1NN5A 1WBBA 1MRSA 2IXEA 3QI2A 4NYIQ 4Z1MD 4XWKA 4A2PA 4OYHA 2VHJA 5FTNA 4Q1DA 3H0KA 2ZUDA 2YWEA 2G88A 2ZROA 3BH7A 4OK3A 1T8UA 3W6PA 3P27A 2OSBA 5DGXA 4BRWA 1DO2A 3KUCA 3NTUA 1OSNA 2H5EA 4Q4JA 3KKPA 3M0EA 4DCTA 4C0BA 3K1JA 3RABA 3UG6A 1W36D 4OHXA 2W2XA 4O2RA 1EX6A 1G3IA 3QPVA 3CR8A 2RCNA 2ZIAA 4B6EA 4BLTA 2HXYA 5IHPA 4JIMA 3G0HA 1MO5A 3SN6A 3U3RA 4B3XA 2ZRCA 1A4RA 4H1VA 1YKSA 2PMKA 2ECKA 1M6NA 4G0NA 4KFTA 2WICA 2X8AA 4XOIA 1KK0A 3THXA 3R9WA 2F3TA 4HLCA 2F1JA 2WJYA 3T35A 4NTZA 1XEWY 2Z43A 4I99A 1AS2A 2WBLC 1OFHA 2QG6A 4JZKA 3LQRA 3A36A 1MR3F 3AVQA 4TMXA 5F2EA 4PSAA 1G3QA 1OJLA 2CLSA 3NHBA 2FEMA 2JIZD 1ZW6A 3BIFA 4GRAA 1UKYA 4I1VA 2YYZA 1RJ9B 1TPZA 4WW0A 1B23P 2GF9A 5EE1A 3Q7QA 4IFBA 2QPAA 3SU8A 5FBRB 1CTQA 2GVDC 1DVRA 1G4AE 4LYJA 3I8SA 1R10A 4C2UA 2FZ4A 4R2HA 3LX8A 1OFUX 2KSQA 5H8WA 4NKRA 3ADCA 4XWAA 4FMDF 4UNSA 5J47A 1YZLA 4M9QA 2C9YA 3PG5A 3QKSA 3TK1A 2Z83A 4QHYA 1N6HA 4RD2A 4NCNA 4AY2A 5F9HA 4D0NA 2AD5A 1GKUB 5EUQB 1X86B 5B30A 2W2TA 1HA3A 4DBLC 5IF9A 1Z22A 2IC5A 4JVLA 2ZJYA 4PHFA 4QHSA 4LRWA 4B74A 3AKCA 3LXRA 1KJZA 4BQSA 1UBCA 1CR1A 2O8CA 2GEDA 1R0YA 3REGA 4HZUA 4PQRA 4G5OA 4DJTA 1XZPA 1H8HD 1U0HC 1ZUNB 1N6IA 2JCSA 4XWOA 3L0OA 3X1ZA 2QAGB 2C96A 2NTYC 4LSGA 1S1MA 3GPLA 3ASZA 4C0SA 1D9XA 3AUYA 3WBJA 4ZIRB 1ZNZA 3EZ9A 3ZIAD 1LV7A 1ESNA 1SVWA 2FFHA 3DEFA 4KLNA 3GCGA 1DAHA 1F2UB 5AR1A 1ESMA 1MRNA 4YQFA 4A92A 3SBEA 2OHFA 1KAOA 2RHMA 1BIFA 3U3KA 3NH6A 1PLLA 2MMCA 2ZRKA 1A1VA 3TSOA 3QY0A 4M4SA 1MO3A 3FFBA 1IOZA 4B43A 2Q9CA 4AG6A 2VP2A 2BIFA 3D8BA 4A9AA 4PXAA 1YR6A 1XCMA 2JJ8A 2G3YA 2ZI7A 1N0WA 2PEZA 3CPHA 4JVSB 2R6GA 3SZRA 1JPNA 5F3WB 3ZVRA 1DARA 1VCOA 1KK1A 2I4IA 4IXNA 2Q21A 4IEEA 4P33A 1OH5A 3QVVA 4LUCA 5TY0A 3K09A 2XOKD 4RD3A 1XZQA 1NVVQ 1DS6A 2WJVA 2YNMA 5ELXA 4NPHA 2HF8A 1XP8A 4GNKA 2DFTA 4M9SA 3KB2A 4DHEA 1RE0A 5EP2A 3SJAA 1Z0IA 3CNLA 2VA8A 4QKQA 4ILEA 3FPAA 4OI2A 4HB3A 4B3CA 2JJ2A 4M9XA 2DWQA 1EESA 4C3ZA 3I73A 3PR1A 1GSIA 2OBLA 4V0LA 4LGMA 1KI9A 5JWHA 4K46A 4B2LA 4BGDA 2ZJ5A 4Q7MB 1DOAA 4TYPA 4JJKA 4TLCA 5JEDA 1E3MA 4DT1B 2IS4A 3B5JA 3FOZA 1FNNA 2XEXA 3O8BA 1WF3A 1ZNXA 4G5SA 4PO9A 2C8VA 5AJYA 5CDFE 4EQ6A 2GDJA 5GJBA 1IN7A 1T4GA 1U9IA 3BB1A 1CRPA 2YJTD 4JSYA 4V0KA 4DCNA 3BBPA 3WP0A 3TH5A 4G5GA 3VMFA 3AVPA 1XTSA 2HUPA 1ZU5A 2ZREA 3OIWA 4JVNA 3LD9A 1NVVR 4XVUA 3LXXA 5HE8A 3R20A 2IWHA 3QXCA 1P73A 4RJLA 2BEKA 1KSFX 3CRQA 2GXAA 2C77A 4P4TA 3DO6A 5G40A 2QA5A 4JT4A 1IQPA 5EZ6B 4EKDA 2EYQA 3OEHD 1FW6A 1E9SA 5DSZA 3THOA 5BN4A 2VP5A 3F8TA 3MJHA 5L3SB 3JVUA 3GLFA 3WRYC 1RZ3A 1NMXA 4RSGA 4B75A 5LD2B 2XSZD 4CT4B 2DBYA 3GQBA 4GFDA 3HPRA 4G01B 4YONB 4TSFA 4JT2A 1ZIOA 3GLGA 1BH2A 1E9EA 2QMHA 4NCJA 4O0MA 4CEJB 4PO8A 1L4UA 2QI9C 2DHRA 2FPLA 3P20A 4KFUA 3EIEA 1W4CA 2NO1A 4DDTA 4IOJA 4KVAA 2C04A 4EJSA 4DLWA 2ZI4A 1EWRA 2ERXA 3IO5A 4D82A 1BO6A 1VTKA 2HCBA 1F2TA 3GJ5A 4LBYA 3CNNA 3K70C 4BFTA 3QG1A 4Q9LA 3LVQE 3T1OA 3KQNA 3P1JA 2B21A 2BCJQ 3AF0A 2YV5A 3U2QA 1AGPA 4DLSA 3EWAA 1BMFA 4DSUA 4F38A 2IYSA 4A8JA 4QM7A 3OE7D 2FGJA 3MWJA 4XSGA 3ADBA 4DB4A 3LLUA 2VO1A 5EQTA 2GTPA 1WMSA 5EE9A 1Z29A 1SVIA 3H2YA 1FP6A 4NZYA 3W5JA 5KDDA 4WA7A 4HLUC 2GK6A 4HATA 1MOZA 1AS0A 5FPTA 4A82A 3W8RA 4U7DA 3EZ7A 3OE7A 1OLOA 1OH8A 3L0SA 2Z4SA 2Q3FA 5JI2E 3RSOA 3I32A 4DLUA 1KDPA 4XD7D 5KNBA 5LDDC 2JLVA 2R8RA 1U0JA 1G1MA 3ASYA 3LO5A 1XTKA 4AKEA 1NVWQ 1ZCBA 3C5HA 1D8TA 2JASA 3KQUA 3GFTA 1ZBDA 3A37A 1SULA 4JLKA 3T12A 1R0ZA 3QUSA 2ZYVX 5DHAA 4FCVA 4PQYA 1J8YF 1U81A 1P6XA 4PPGA 1JI0A 2GJAA 1F6BA 3DMNA 1SVOA 2OILA 4TTQA 4Q4LA 4MDEA 1COWD 1L4YA 3FDIA 3H84A 4MKIA 4MYCA 4DDWA 1KMQA 1Q44A 2YOFA 1CJVC 3SYNA 3VTKA 2X77A 1Z3IX 2O0KA 4Q9IA 2IF2A 4KSCA 5C1BA 2C9CA 5KPJA 5KPDA 4IHQA 2KWIA 4KYIB 3SJZA 2Q3HA 4RD6A 1Z0AA 3CF6R 3NEYA 2PEYA 4UKDA 1CR4A 1NBMD 4LC0A 5KHOC 1NY6A 2ZU0C 3AM1A 1T3LA 4LHXA 1CLUA 1I2DA 1W47A 2BBOA 2YKGA 1Z0JA 5DN6A 3RRYA 2E1RA 1US8A 3N70A 2WV9A 3T5DA 3CX7A 4UNRA 4CVNA 2QL6A 3VNVA 1E9BA 4LJ4A 5J5CA 1PV4A 2QT1A 4P4SA 4RFSA 2A5DA 3TW8B 4FMCF 2WTUA 2IYWA 5DIFA 3VAAA 1KI6A 2REXB 1XCGB 3EPHA 1JECA 1YRAA 4QJ4A 1JXOA 2W0MA 2VHQA 2JJ1A 2WVJA 5P21A 5J4LA 5KNDA 3KKNA 2ZR9A 5FL3A 4PPFA 1NVXQ 3CBQA 2QTVB 1N3BA 1S1CA 4Q1FA 1JBKA 1FPMA 4MRRA 4Q02A 1S4QA 2XNDA 5TB5A 3NWJA 1TQ4A 2QRZA 3ZS8A 3QENA 4GI7A 1KMHA 4YMSA 4M21A 1P75A 2OCPA 2WJJA 4KV9A 4NYJR 3ZVNA 1T9HA 3QE0A 4JL5A 5JBQA 2QPOA 2CNWD 2WHXA 3U4QA 2FU5C 2J59A 2KB0A 3RVBA 5IT5A 1XXHB 3TUIC 2BBWA 3TBKA 2B6HA 1L2TA 3CH4B 1VIAA 2ZQ5A 1I4DD 4WVFA 1E2JA 4RZ3A 4PC2A 1G20E 4TYWA 1R4AA 2W58A 3VX4A 1TEXA 3AUXA 2IYRA 5FOWA 1E2IA 1SVLA 1L8QA 2H8KA 2VSFA 3CIOA 5CJ2A 4D25A 4R98A 3VKHA 1G21E 2G6BA 4YDHB 3PITA 3RS2A 4EJSC 5DI3A 4RFSB 5J4YA 1W1WA 4B33A 1NRJB 3DVLA 5FOTA 1IY2A 4JLPA 1XEXB 1YR9A 3TNFA 2IUUA 4I4LA 1E99A 3C16C 2MSDB 1KOFA 1VYTA 4WZ6A 3UIEA 2OCYC 2ZJOA 2AD1A 2IF0A 3DPUA 4QM6A 4LJ9A 1QVRA 3MWLA 4A0RA 3KJGA 5FPYA 5CITA 3EPJA 2ZVPX 3B82A 3LY5A 3ZD6A 3ZQ6A 1E2NA 2GAAA 2ZANA 3TE6A 1UPTA 4LBWA 3GLFE 1E2QA 2VLIA 3A1UA 2HDNB 1GIAA 2SHKA 3QPWA 4Q4AB 5AJVB 3VQTA 5CB8A 2A7QA 5UKDA 3DDCA 4HAZA 4PZYA 3SQWA 3CONA 1E4YA 3K09C 1RRPA 4H1UA 2GRJA 1XD8A 2WZQA 2D4HA 1YHNA 2FSIA 1V43A 3AVWA 1N6LA 5B2ZA 1CR0A 2XZPA 3HYRA 1E0AA 4FCTA 4MGIR 2R65A 4B3DA 2E9SA 4A8JB 2O5VA 1PVOA 3BRWD 3L0PA 1WXQA 4DSTA 3BH0A 2WWFA 1Z83A 4WZBE 4IDPA 2A5YB 3QBVA 2CK3A 3WMFA 4PSVA 3PXGA 3K8YA 4LY6A 3SOPA 1XDBA 4MRPA 5JJLA 3BK7A 1GILA 1W44A 5KUTA 1E96A 2ZSFA 4KI0A 1XU4A 2ODEA 3BH6A 1TQ6A 4TLEA 1R7RA 1Z63A 2AXNA 5HZHA 1Q1ZA 3U44B 1GOTA 1NLYA 4A6PA 4EFMA 3ICQB 1UFQA 1P9NA 2UZ3A 3MUFA 3PFIA 2F1HA 4ESHA 3ADKA 5K8LA 4JJZA 2CK3D 4WIAA 5FOUA 1RVDA 2HJVA 2PLFA 1CJMA 1TX4B 2RKOA 3AH8A 4B32A 4CT5A 5JCZA 2Y8EA 4R9UC 1JR3A 4FW9A 4BZXA 2OE2A 3ND8A 1KGDA 4MYUA 721PA 1G3RA 1KI3A 4Q7LA 4PR0A 1E0JA 4TMKA 1NKSA 5EP1A 5CJPA 2FFBA 3PUVA 4A0GA 3PUWA 4QBIA 3T1QA 1OW3B 3QEOA 4TT3A 5KDLA 3V9PA 5LBIA 4LHWA 4M2LA 4RD1A 2J7PA 1Z6GA 4QOSA 2ZI3A 3W90A 4A0FA 2A5GA 1Q20A 5FOSA 1N0VC 4G3XA 2H7VA 4MKFA 1UBFA 1QG2A 1J7KA 3VR2A 3GEIA 1XF9A 4OL0A 4JBWA 1DTSA 3IBYA 1UKEA 4Q03A 1KNQA 4YXWD 2JLUA 1IN4A 3CRVA 5DO9A 3AKEA 3CKLA 2NZJA 3U3OA 3TIFA 2P5SA 1E9AA 2OO7A 3UWOA 4FN5A 2JATA 4OQMA 2WAXA 3A4MA 3IDQA 3VFDA 4AKGA 2QROA 4TMTA 4ZCIA 5C2JB 4ZKDA 3B7GA 3O8DA 4C2TA 5CYPA 2CMKA 3SHFA 1WQ1R 4IOMA 1OKKD 4BFWA 3KTAB 4CIDA 2XGJA 5D3MB 1FQJA 2J46A 4KLZA 2LCFA 3OIYA 4LWZA 4DXAA 1DELA 1AZTA 1K6MA 1NIPA 1NJGA 2CEAA 2JLSA 4PZLA 2C95A 1JJVA 1ODFA 4M1TA 3AGPA 3T06B 1UBGA 1O3YA 2AKYA 2CHVA 4D0LB 4EUNA 4LJYA 4X8HA 2HT6A 4N1AA 4BLQA 2RGGA 5KSPA 4AG5A 2D06A 3IKJA 3KL4A 5FTLA 4Q18A 4OQFA 4RY2A 1BYUA 4TLDA 2QBYB 2IS2A 4L9SA 4UXHA 2JLWA 3SS8A 1SVMA 4JYCA 2ZEJA 1CULC 3BFKA 3QKRA 2IS1A 3CRMA 3FB4A 1H8HA 1CP2A 1Z08A 1VKJA 1P5ZB 1GRRA 2DFLA 4JLJA 2MSCB 4EJSB 3BC1A 1G5RA 4IRUB 3QSYA 2ZRNA 3T5GA 3UWKA 3AF3A 1RYHA 1EX7A 3MGCA 3SEAA 1U8AA 1J90A 1E2LA 221PA 5CLQA 2VL7A 5EP3A 1KI8A 4QBHA 1KKMA 3GLGB 4MDFA 4DLTA 1KJYA 1QDEA 2REBA 2WKPA 3EX7C 2QTHA 3LW8A 1T6NA 4ZDJA 3AQ4A 1K8RA 4HUQB 4JMPA 4N0EA 4N3NA 1FTSA 3JZMA 3LW7A 4P32A 4E09A 3N2EA 4URWR 4H9GA 1AQYA 5C4MA 1R5BA 3THWB 5FBLB 2RGEA 5BWMA 1UAAA 4NL4H 3UMRA 1K5GA 1Q1EA 5DNYB 2R9VA 5E4FA 1IJEA 3SFZA 1L7VC 4EPVA 3E1SA 1KK2A 1EWQA 1QHHA 2IEZA 2CJWB 1E69A 1D2NA 4UJ3A 5CK4A 1NMYA 4AKIA 3HDTA 3K0FA 1HE1C 2IYUA 3GJXC 5JFGA 4Q1AA 4PO1A 4PQFA 4BUJA 2PH1A 3TAHA 4HLQB 1E98A 4X8LA 5HZKA 3LBNA 4DLVA 3NKVA 3EW9A 4IXMA 2VYFA 4ARZA 3BS4A 3EZFA 2LKDA 1SZPA 1LVGA 4DEYA 4FMDB 1P9WA 3HU2A 3QF7A 1G291 1QHIA 3K9LA 2BJVA 4GL2A 1F2UA 3TW4A 3VHXA 2FNAA 1JR3E 3IPYA 3L82B 4LV8B 3MSXA 4C7OB 3PENA 4FWTA 3GJ4A 5AWFC 1NF3A 1NN0A 3TVDA 5FUXA 2XZOA 1I4LD 1C9KA 4LV5B 1U8ZA 3AKDA 1P3JA 2CJWA 1COWA 4NYMR 5JEEA 4GOJA 4OHYA 3TQFA 1TU4A 1VCIA 3EG5A 3D6TB 4AYTA 1AKEA 1BKDR 1OXSC 3GJ3A 2J0UB 3GLHB 5DYIA 4AD8A 2IYVA 3N2IA 3NIBA 4KBFA 2XZLA 1YQTA 5FH9A 1P2UA 4B3FX 2ZRGA 4OI4A 2WJHA 4LI0A 2J0QA 4NE2A 4Q4JB 3K0SA 5ANRB 1BS1A 1G5PA 5DYGA 1NP6A 1E0KA 1VHLA 2HLDA 2YOHA 2ZE8A 4HAWA 1JNYA 1TNDA 3GLIB 1X1SA 2FG5A 3LFUA 4L15A 3F3YA 1N5IA 4X8OA 2P2LA 2IBMA 2OG2A 1Q1QA 2FJUA 4M1OA 2V6IA 3VU9B 2GK7A 1JB1A 1HUQA 2XB4A 3J81k 2ZTSA 3EC2A 2J5XA 3WYGA 5IK2D 1YVDA 2X2FA 1FFHA 2EFDB 2P6UA 2RH5A 4TL8A 1GL6A 1G41A 1RRFA 2P3SA 3TKLA 1G3MA 3QF4A 5EE5B 1WB9A 2DYKA 2D74A 4TL7A 1JPJA 3HJNA 3L0IB 2GHIA 3K0EA 2AWNA 1GKIA 5K8TA 1XTQA 3EARA 2BEJA 2IXGA 3I72A 3LBIA 3OIUA 3SYLA 1XFAA 4JLNA 2GBLC 2W6JD 4P4SB 4M9ZA 2B8WA 4RCZA 4AC9A 1NIJA 1SQ5A 4GBMA 5C4GB 3BE4A 1TAGA 2W6JA 1GUAA 1Q12A 3QXHA 2WIBA 4G5RA 3LDAA 4WZAE 5AJWA 2FX3A 1M7HA 4YLGA 1IY1A 1ZNYA 2WPDA 2ZRHA 4IW3B 3WP1B 4PC1A 2DPXA 1LW7A 3D31A 3UMSA 3LX5A 4EPRA 2G0NA 1X3SA 2ZRDA 2W0SA 4OK5A 2GCOB 3KUDA 2GILA 1W5TA 1P9RA 1W49A 1NVUQ 1P7CA 3FWYA 3AVXA 4F4IA 4P4UA 2FGKA 2GKSA 1OIWA 4W9MC 2YINC 3I62A 2B8TA 1NY5A 4C9BA 1QF9A 2F9MA 3QXJA 2JLQA 3TVTA 1XWIA 2CLCX 1G6OA 2DCUA 1R0XA 2IHYA 4QBFA 5D3MA 1CRQA 2P6NA 1KZGB 2QTFA 4BZQA 1HV8A 3DZDA 2YC4C 4QC2A 1DG3A 3M1IA 5BYJA 4UNPA 3OFND 1Z8FA 1VHTA 2WKQA 3EA5A 5AJZA 4BLOA 2HF9A 1Z0DA 1G5TA 2ZSEA 3P4YA 4TYQA 4EPWA 5FR2A 4LJAA 3FMOB 2EWVA 4MKGA 2OAP1 4WXPA 3QIAA 3ZZUA 4Z54A 1E1RA 1IAQA 1KDRA 3VR3A 2WAYA 2BDTA 3I92A 3L8ZA 1W0KD 2FFAA 2GEVA 2OCBA 1IN5A 1T91A 4LHZA 5DI3B 3T61A 5CB6A 5F9FA 4ZKEA 4Y0VA 1E9FA 2C2HA 2N1BA 1D2MA 2V8OA 2BVNA 5FL7A 1TF5A 3U7HB 1DAKA 5LB2A 3AVVA 4Q4HB 2PT7A 2BHRA 5KDOA 2ZI6A 2QQ0A 3QKRB 1G8YA 1Z0KA 2CL0X 3WYAA 4TL6A 3M6AA 2O8FB 2ZJ2A 1ZINA 4W7SA 2GCOA 2FSGA 2XOKA 3O8RA 1OB2A 2ATVA 2PJZA 4XIGS 2OM2A 1VYVA 4OQXA 3BWDD 4KU4A 4L16A 3Q85A 3RAPR 3QPUA 1KI2A 3X2SA 2G0TA 5B57C 2ODNA 2DY1A 2IW3A 3ZZ0A 5LD2C 3IIJA 2TMKA 1MABB 1D2EA 4I81A 4EFNA 3TUZC 2KBEA 2ORIA 3B2EA 1A82A 1GNQA 1HH4A 2ORVA 1U2RA 3EA0A 2CVFA 3RHFA 3W9YA 1N25A 4M0LA 1I4TD 1G8PA 4LZZA 2XB2A 3VR5A 3LRPA 4Q4HA 4EFLA 2PZGA 1QHGA 4LJ5A 2IWRA 3ZZTA 1XD9A 1OXXK 4V0NA 3OF5A 3KXIA 5JECA 3CB4A 1H65A 3MD0A 1E2MA 3CWZA 3C8UA 4QJ5A 1JQLB 5L3SA 2PL3A 3PEYA 2BWJA 2GVZC 2WIAA 1LF5A 1CEEA 3HP1A 2VP6A 1IXRC 1TMKA 3ZIAA 2BV3A 3OEEA 4R7ZA 1TU3A 3IPXA 4J0QA 3QKSB 2QE7D 4JLAA 2QEQA 2LWIA 2WJIA 1US8B 2JAQA 3CZPA 4AYWA 2J87A 2GXSA 4BFUA 4D26A 4WAUA 1AK2A 3FHOA 4MQBA 5FPSA 1FUUA 3GFOA 1TTTA 4ZI2A 2ERYA 2QU8A 1WP9A 4PC7A 3S1AA 2O8BB 4X8MA 1G18A 1UEJA 5L3QA 1MV5A 2H1LA 1TL7C 3RS4A 3EZ6A 1HYQA 1XJCA 4LCBA 1QBKC 1E9RA 3U3JA 2OBNA 1ETUA 3I8XA 3FMFA 2FDCA 2ZM5A 1NG9A 4JLMA 4AYXA 2ZR7A 2R6FA 1RYFA 4QJ3A 1D9ZA 1E2EA 4NBSA 5FI0B 1DAEA 3R8CA 1OYYA 1C1YA 1XEWX 2GF0A 1KI4A 3ETLA 3QG5A 2AFIE 3FKSD 3RS0A 1XMSA 5GADl 2QAGC 4JVMA 3TLXA 2WOOA 2GNOA 3GFPA 3W5IA 4IOKA 1G17A 2EFEB 3TSZA 2QPTA 1E2PA 1YJ5A 1LB1B 4U02A 1XTIA 1M74A 2JIZA 3A1VA 1N5JA 1Y3AA 421PA 2BMJA 4KFSA 2E87A 4LYHA 2AL7A 1W7AA 5BN3A 3QXXA 4Q9KA 3AVTA 3NC0C 4C30A 4CRWB 5JRJA 2QP9X 4GSYA 5EJEA 3RRZA 1GWNA 4M1YA 4F4JA 2ZR0A 2P5TB 3NH9A 4LPSA 3AP2A 2F43A 2H17A 1NG1A 4Q7JB 2X19A 4KAXA 3GLGE 4D4KA 3WRXC
chains in the Genus database with same CATH superfamily
4HRAA 1N7IA 1USVA 1Y1KE 3AZOA 4RPJA 2QMZA 4HXYA 4PWZA 1DFHA 2XXJA 1QU3A 3K3PA 1E18A 3MQFA 3DBLA 1TUBB 3AETB 2NUBA 4M0DA 3VU1A 1KZ4A 2EFCB 2GJ9A 4LJ8A 2YY5A 5DHFA 3UAOA 4B82A 4FXPA 4IS3A 1G66A 4URVR 1WXHA 2Q5JA 4AJ1A 1VG9B 2X2EA 3H8JA 2FYTA 2C92A 3PUXA 3BSWA 4K6CA 1L7EA 2IS1A 4Z9AA 1TMOA 1WR8A 2W6OA 1JDBB 2CVZA 4K6FA 5AMXA 3G5MA 3SE7A 3UPTA 2BFOA 2VWQA 3CUKA 3MERA 2JFQA 4IFTA 5TARA 4QVKA 4W8GA 4BVHA 5J43A 3F4BA 4OXQA 4ENWA 1UKVY 3QH4A 4UOQA 3RDPA 3O0DA 3GD5A 4FDVA 1DAPA 2OAQ1 4IVNA 4XGKA 3BWEA 1LLUA 2ZSKA 3IE2A 3GDOA 1WDKA 2MSEB 1WJGA 2R4QA 3HXLA 3TD2A 1W76A 4ZOQI 1CKEA 2XODA 3PHLA 4LQLA 4A5OA 1SQGA 4C1BA 1DQYA 1CJBA 4QYSA 3L93A 1BX1A 1Z33A 2HQ1A 4NBVA 3R3VA 3G6KA 4YT4A 3W5UA 1M2JA 4BV9A 3P9XA 4JJAA 2BFCA 7REQA 4MSUA 3QE4A 3HV2A 2TS1A 4X54A 1E6MA 1Q0ZA 4YJ3F 3KTFA 3UENA 3WY9A 5HZMA 1CF4A 4EX7A 5I5EA 2PKRA 4HY3A 5L7WA 2BFBA 3FN4A 5MFZA 1P1IA 1RAEA 4E6EA 4N8DA 5EUCA 4D4LA 3LUBA 3P5BA 2PWPA 1KHHA 1ZIXA 1HY3A 3FYHA 2VCHA 4TKVB 3GMIA 5BSGA 3EOBI 1IHPA 3IP5A 4R51A 1M73E 3VSDA 4GPZA 4LXUA 1EGAA 2R62A 2Y4NA 4H7HA 1XVIA 4M1WA 1A8SA 3Q8KA 1Z5WA 3E5MA 4MVJD 1PD0A 3KEQA 1GDDA 3MYRA 1P80A 4PYRA 3VVMA 1QCDA 5ALNA 1VDMA 5K3AA 2HCRA 4FDTA 2RK4A 5ER6A 4R6WA 4AUKA 3ZCQA 1QJ4A 3LUPA 4KKVA 1ZW1A 2WFLA 5BQPA 1SJ9A 4CHTA 2J5QA 4K6HA 4EA7A 4Q93A 5IF3A 5KWJA 3DZIA 2Q41A 2G7ZA 5L53A 5HFJA 3CLTD 2P9EA 4QPCA 3S2IA 3TQHA 3WGJA 1OIXA 1H2ZA 4DNFA 2FWRA 2P9TA 3EHDA 3PT9A 1O97C 2FWPA 3LYLA 5F23A 3FMPB 2QGNA 2ZI9A 4BQPA 1ULZA 1XAHA 1DAMA 1LNSA 1YGYA 1YNSA 4PY2A 4Q6BA 4FYWA 2BKUA 2V7VA 3N86A 4LWQA 2P1ZA 4N6GA 3B8EA 2ZKLA 5DGTA 1ORTA 1Q77A 2YHAA 1PQYA 2EFYA 2QN8A 3D0KA 2XMRA 3LYAA 5E1MA 4LVCA 5ECGC 1VCHA 1VMAA 4CM4A 1JU9A 4D1YA 5K0GA 1Y8QB 5L40A 2X8BA 3WOHA 5IZ4A 4M87A 3PZRA 3V55A 4XM1A 3RUFA 2BJHA 2BMEA 3BOSA 4N5MA 2RHHA 3WIVA 1E1KA 2WSSD 3BCUA 1PZGA 3C85A 1EFLA 5DYYA 4O63O 1KAMA 2WUVA 1J20A 4WOKA 1NUPA 1U0SY 1J2JA 1VCNA 2Q50A 1Y33E 4MCHA 3OEWA 2A86A 5F35A 4YC7A 3ICEA 5CM2Z 3G7NA 3X1XA 2NW6A 2PMFA 1U5BA 3EDYA 3ITKA 3U7FB 3QKUA 4CIVA 3OZSA 4QNNA 3WLSA 1SKYB 1OT3A 3WGTA 1G59A 2D5AA 2Z04A 5BN5A 3LSTA 2ZUCA 3KEGA 1FNCA 3BTOA 4D7AA 5IN4A 2RGCA 1FFWA 2C61A 3DMDA 5F4ZA 5TEWA 1B0UA 3NBFA 2CUZA 3MAAC 3RIYA 1E9DA 2MINB 3TM4A 2WAMA 1DAFA 2PMBA 3H3XA 3WNZA 2AMJA 1Z18A 2TSYB 3DFKA 2HW8A 3CCBA 1U3CA 2PQ0A 2R7LA 3STWA 4DMFA 4TXHA 2PXCA 4HXFB 1VLZA 3JQDA 4EUHA 1A7JA 3U4AA 2O7QA 1WDWB 2ESRA 4CGZA 3SAJA 3DFIA 1J25A 2X1HA 4MKHA 4Z0PA 4Q3DA 4D3SA 4OX9B 4BQFA 4ZQHA 4K6GA 5GTDA 5IUNC 2MT9A 3OZIA 1CNFA 4J1NA 2ANBA 4Y6OA 5C8YB 2ORED 3DV0A 3PHCA 4EYOA 3G82C 2V1UA 4WK2B 3RYCA 4JI6B 2YV4A 3B1WA 1X42A 1YZQA 1XLTC 3ENZA 3OX2A 5LMZA 2WVGA 3KAPA 1HRDA 1QH0A 1JX6A 4E7PA 5ALMA 1P5RA 2O6LA 4IJMA 2HADA 3SQOA 3C5CA 4HB0A 1E5LA 1JVNA 1P60A 4RMHA 3THSA 5MF6A 1GCAA 1JP7A 1JQAA 4XGIA 1SD5A 2BMFA 3ZW7A 4DIKA 3AFHA 3ANTA 1L5QA 3JQAB 3OX1A 4G5XA 2XAUA 4GQIA 4BRUA 3JQ9C 3GLSA 5BMVF 5LPNA 4K26A 3L7KA 1Z6ZA 2EX1A 2I6SA 1DRWA 4WFJA 3SLGA 2X58A 4P31A 1IG3A 5KO2A 4ZV9A 4K86A 3FYUB 4NIMA 3TOVA 1TJPB 3MJRA 1ZM9A 2C98A 2YW9A 3PIRA 2A6PA 2REQB 3EEFA 4KFCA 3OTQA 3O9ZA 1JEYB 1HQDA 1RIFA 3GCZA 3HKDA 2VJNA 4ER5A 4HLUA 2VS1A 2GRUA 1IEWA 3L1IA 2PRYA 5TGDA 1FUKA 3E81A 1JE1A 2XUHA 1NJFA 4QQ8A 4BGIA 3HYLA 3IKVA 3T1NA 4FIZA 2FMXA 3AJRA 1IULA 3KKLA 3W5SA 4C6SA 2OLJA 1SPBS 2Q0HA 3EXFB 2B1QA 1FYWA 4MVXA 3ZHZA 3H2BA 3EGEA 1N2CE 4OFZA 3RS9A 1XAJA 4HADA 1K5DA 1O5TA 4CF7A 1CVRA 5FR1A 1EG7A 4KXWA 4DLYA 1Y7PA 1FDWA 1FDSA 2P2ZA 4F12A 5EYPA 1A4IA 1L4LA 3ITEA 3D7RA 4GI3A 1I6KA 1A50B 3LPDA 4OHBA 4IGIA 1K68A 3CWQA 4MGYR 1O58A 2CB9A 1UK7A 1XZNA 2IIPA 2R8XA 3GVXA 4WZBB 3MC1A 4DIEA 5BSUA 1W6UA 2XVMA 2VF7A 2QX9A 2GYWA 1Z6YA 4RV9A 4DV5B 3FI9A 4HN2A 1U8UA 2QW0X 1DFGA 2Q5FA 4J0GA 2FF7A 3VOTA 2HJGA 2RAVA 1Y3CE 1B42A 2WC1A 4G89A 3WMEA 1BCSB 2OEPA 3HKEA 1LXCA 4ZCSA 4PX9A 3U3MA 4P84A 4Z0NA 1SOAA 3PWZA 3LV8A 4D4MA 4ZEMA 5KC8A 4PW0A 2BI8A 3OM1A 1PNOA 1U9ZA 1H9BA 2OC9A 3LYUA 4HNSA 1EJ6A 4LRTB 4BJ5A 2ZVDA 1O87A 4BDTA 3TIVA 2YMPA 3W5HA 3I1YA 3LT5A 4HWTA 4PCLA 5D3QA 3U37A 3HDGA 1G21A 1VMIA 1RT9A 4ENUA 3S4YA 2PUFA 1Q0UA 1VYHA 3WL4A 5DX1A 5HUJA 1B74A 1X0XA 1ORHA 3FWNA 3SIWA 5JS7A 1BQ4A 3CVYA 2QRLA 3IBGA 2BLNA 2CDAA 4B7AA 2QVGA 3EH2A 2QZ4A 3W34A 3OZEA 4K3VA 3V00A 2QDKA 3KOWA 2C7GA 4AQDA 3TJZA 2Q0SA 4KH1A 1M6EX 3VKFA 3UXMA 1JT9A 3KHSA 2P41A 2EBFX 4QPNA 5BNFA 1MAUA 3LFHA 1XLVA 4F60A 3OH8A 4TSRA 2F55A 2YCBA 3O47A 1PBNA 4G0WA 3ME5A 5DNAA 2Z56A 3TE7A 2Q3MA 1X19A 3CISA 2YFQA 4IG9A 5A62A 3ZE7A 1YJXA 2X4GA 4CPDA 2IE0A 1ZD3A 1KP3A 3NO4A 4EM6A 4E22A 4BFSA 1VJDA 2ECOA 4DZZA 2HMTA 3I1IA 5JBIA 3FVTA 3PNLA 1WV0A 3KLPX 1GQSA 2CV1A 1EGQA 2ZS7A 1CZHA 1FQKA 1ZOOA 1I32A 2AVNA 1PJLA 4RMIA 2EKDA 3UGTA 4OA8A 5CB4B 2E1PA 2PH5A 4JENA 3A1WA 3DDSA 3AEKB 3CS3A 1RM4A 1V95A 3IQWA 3M9LA 4ND8A 1W88A 4C0AC 5JW6A 1HDGO 3MMSA 4A6EA 1JKJB 3B9QA 4IJ5A 3F0TA 2CUNA 3GA0A 5E95A 1V37A 4EGAA 4IQ4A 4RTJA 1EP1B 4LAFA 5L4SA 3T4XA 4C14A 5CXQA 3V1LA 4X60A 2DQ4A 3AIMA 1EQUA 3GXBA 3KZVA 2P67A 2CHFA 2D4AA 2IKQA 4V0QA 4L2IB 4YAFA 3OEHA 4ZAGA 5BSTA 2C7OA 1JDSA 3O4VA 4IINA 1M76A 4QBTA 1GDHA 4BO4A 2ZB4A 4WI1A 1NPTO 4FGKA 1YQUA 1RFLA 5T8KC 3N1UA 3O3MB 4CN8A 1PTJC 3ZIUA 2H9AA 1HT1E 2RGAA 1HT2E 4CEIA 2FETA 2HQOA 3JWEA 4ESVA 4HDKB 4NMXB 1AKTA 2DQZA 5JCJA 2OHVA 4QELA 4LBVA 1TMGE 3A6ZA 3CKYA 2GM3A 4N40A 2V9ZA 1TQDA 2R1ZA 3C41J 3HN6A 5H4GA 1GRVA 2IU0A 2XMQA 2XHZA 4QYXA 4B4VA 2EP8A 5HUHA 5CYOA 3FNIA 4KB5A 2H63A 4UHHA 4ASUA 1R8QA 2DPYA 3OQHA 4BQIA 3HVIA 2X41A 1ECFA 3DTVA 3FDXA 3P0IA 1QRSA 1CSEE 4ESEA 4CM1A 2P65A 4HKTA 5BN4B 1PK8A 4EELA 1P2TA 1WU7A 1JSRA 1EFRA 1JZSA 2QN2A 2V3VA 3Q9UA 5F9MA 1U98A 1ABFA 2C5SA 3WMWA 1DIAA 4OAQA 4AN1A 4F9FA 2FK8A 3GUCA 3ROMA 3ENWA 4Z9FA 4HVLA 1QIIA 2DWPA 3QQ5A 1SOUA 4CEJB 3K94A 2MJLA 4Q5IA 1F0PA 5FHRA 4JBNA 3ZLJA 5HDQA 1KEUA 5HFAA 1AKVA 2YNMD 4TTAA 3B1YA 1SGWA 4ID3A 3IC5A 4UBOA 5JR3A 4ND2A 3GGJA 3PR3A 3K0FB 2EX4A 1V0JA 1K6EA 3P9QA 4ME6A 4E5UA 3CVVA 2PGOA 1KI6B 1S2NA 1S2LA 3A27A 4B44A 5JZOA 2J7PD 4PRKA 4RESA 5T64A 4CIBA 4B4UA 1PX2A 3RROA 1Y4DE 1DJPA 1ZX1A 2MYPA 2Q3EA 1OFIA 2OESA 3PCTA 4MZXA 1HTWA 3MMNA 4UU8A 3TDNA 4YRZA 4ZYLA 5C37A 1T2FA 2UUCB 1SBHA 4R54A 5FWYA 1ETHA 3EEYA 1CUEA 1ORIA 3C1UA 5ES3A 2C58A 1WNFA 3QVGB 4IIJF 1H6CA 3T7EA 3G2PA 2E6UX 1V2GA 1YRWA 4JLSA 3WB2A 3OZRA 1FMJA 2R6ZA 5FUWA 3H5IA 2A7XA 2VP0A 1GTMA 5FYQA 5BXQC 3ZCPA 1M2VA 1YD7A 4Q66C 1BGXT 3PPYA 3VC3A 2CXQA 4ZTUB 4IS2A 1Q50A 3AW9A 2AXPA 4OB8A 3ZK9A 2H2IA 2P9CA 1NNLA 1PF7E 2ZB3A 5HE9A 4I1UA 3GLVA 1ODCA 1A9TA 4D8XA 4TYMA 4GRDA 2XIQA 2ZYTX 1QF7A 2PGJA 4M9CA 4PE5B 5IASA 5AOVA 1KOGA 1MU0A 2VNHA 3I9V1 4E13A 5KYUB 1TJ5A 3T1TA 4HZGA 1GAJA 1OXUA 4U0JA 4PGHA 5EMHA 5GGYA 4XYMA 2WKRA 3IHLA 2F1IA 3B6IA 4HDQB 1FFEA 1T0PA 2P9BA 1UINA 3AK4A 4Y2UA 1MJ5A 3DDHA 3SI7A 3QEAZ 3P9NA 4R31A 1PUIA 1N1EA 2VDVE 4C20A 3WV4A 1ZVJA 4DEVA 5B64A 1ODJA 3ZKWA 4BQOA 2EJUA 3M82A 3QVTA 1X6VA 5ALFA 5J2UF 2TYSB 4M1SA 1RBQA 3G1UA 4QO8A 3QK7A 4XE5A 4D0GA 1V8BA 4UFOA 1WVMA 3QW4B 1OTXA 3VBEA 4RPLA 2PVCA 3HCWA 3EAQA 3I0NA 2NUAB 1EEHA 1KY2A 2I7VA 2OD7A 2HHJA 2XV1A 1A5AB 1ZOIA 3I01A 5A6SB 5CVTA 1QP0A 1ISIA 1HI9A 4MYSA 1F48A 2RHOA 4B6FA 5HWSA 4MKZA 5AKLA 4JQYA 2OZVA 3G23A 4M38A 4ACBA 3KTAA 4HDCA 4M46A 1II9A 1WA5A 4EGJA 3AB8A 2AG5A 1ZIDA 2XBLA 3PL5A 3MB8A 2G8LA 2YVKA 4Y2XA 3D8NA 2CMFA 1PS9A 1EVIA 1Z88A 5LQCA 5G4LA 2AOXA 3UKJA 3IOYA 1U90A 2A1UB 2P2YA 2BTQB 4HXGA 1UKZA 4OQLA 3UWMA 1Y4ZA 1UDAA 3STTA 4B4WA 1A8PA 3ON5A 4Q21A 1J9ZA 1XNJA 3RVJA 2QUZA 1CS4C 4E5DA 5FDFA 5JAIA 1RZRD 5L6MB 3NU1A 4XJXA 1YJCA 4FFLA 2IPXA 4RJTA 3EQ7A 2FZWA 4EAQA 2F4VB 2WM3A 5K03A 1XROA 1YVRA 4FYIA 2QZJA 2ZE7A 3IAM6 5FTJA 1DJMA 4NQZA 1LDMA 2E85A 2A9FA 4RMJA 3A9UA 3WYDA 4ZYZA 1GCGA 5JCOA 4JJGA 2ZYGA 1R9MA 4F3YA 2G1JA 2XMCA 4FINA 3OU7A 4JLOA 5DBHX 1JB9A 3ELBA 1MT0A 3OURA 5ITZA 2FMKA 1E59A 4NFLA 1MEOA 3SY8A 2ONZA 1QO0D 2GZDA 1Z6QA 2IQ5A 2WM9B 1AGYA 1KYIA 2IVZA 2IZ5A 4DN6A 1NA5A 2QLMA 4PC6A 4XGQA 3A0UA 1TKRA 1Z8HA 2OBMA 2PLRA 3SKYA 1N5MA 4HQRA 5B1IA 5IFLA 4KRFA 3BWVA 1GNSA 3DOIA 4FDLA 4WY2A 5F3RA 2COUA 2C9BA 1TAHA 3P71T 1XPJA 4LZJA 3T3MB 1K3TA 3PXAA 2X0FA 3O92A 3KJIA 4LF4B 2ZRJA 3WB0A 4RK5A 4NP6A 3UKDA 2O1XA 4DCOA 2N47A 3G2HA 3HI6A 4BLPA 4XEHA 5IYZF 4MR8A 3FGNA 3GGGA 2A9RA 1I7DA 2AQ8A 3EDRA 1T24A 2CLDX 2FF5A 4GOKA 4ZVTA 1T6BY 1ZKDA 1JT2A 1TUBA 2XE4A 3EF0A 3S29A 5KWVA 2YQZA 4HLDA 4ZZ2A 2I4RA 5JUWA 2E7ZA 3DV0B 4GKJB 2VDRB 4UNIA 2ZBRA 1LPPA 5C8VA 2DTDA 4ZOAA 1HQCA 1E3JA 1PR6A 2SNIE 3RAEC 5TF4A 3TQIA 4C0JA 2LBPA 4B40A 2YHSA 1XC7A 2NPFA 4N47A 1TUIA 1KIAA 4W4TA 4AZ3A 4TKZA 3ER9A 1T5BA 1U28C 1V8PA 5REQB 1NSTA 5DLQC 1QO9A 5MHTA 4ZDKA 2CD7A 1JJAA 5TMBA 4L07A 3LZCA 4UQOA 1OROA 5AJXA 3IUYA 1P62B 1OKKA 1KJNA 1TD1A 3N2KA 3JD4A 4CTKA 4MYRA 5HIMA 1NI4A 1Z4PX 4QGBA 3PE3A 2IYXA 4WSOA 5LQMA 3LZ6A 2W6CX 3CNBA 3ZVLA 5HOQA 5KNDD 3I5XA 2G5CA 2Y4OA 2ZCJA 2EDAA 3KQMA 4Q00A 1MZVA 3U7RA 3W2IA 1LS6A 1XZCA 2O20A 4BVBA 3DV2A 1ZC4A 3BERA 3I9LA 3Q2IA 3BVPA 1PZMA 1J00A 4R9NA 4HWSA 1SCQA 3L7IA 4R1LA 4KIWA 3DFZA 1C3JA 3CE9A 4FCWA 1GTZA 3GJ6A 1VKRA 3RG8A 4CDGA 5U9CA 3ONWA 4ZTZB 3MXTA 3RTDA 3OZCA 1WHTA 4MJXA 2JBHA 3ZDZB 3F6PA 5E4JA 3V4VB 3EF1A 4PFSA 1S96A 3AY0A 2PSSA 1QH8B 1S4MA 1O9BA 5F7XA 2CCGA 2H2FA 2RK6A 5FWDA 5SY9A 2Q0XA 2OC4A 3KXKA 1G8HA 2BDUA 3NEJA 3MWEA 4LDAA 5JDCC 4CF4A 3WX0A 3GC6A 2VSOA 3V1TC 2ACEA 4HH4A 4IVRA 1V6AA 3MJCA 4XCVA 5DE3A 3ANMA 4CMEA 4QATA 3G0GA 3B70A 4ZCPA 3K2BA 4R5MA 1F1BA 1XKXA 3KJHA 4J03A 3TIGA 4V1CA 5AVUA 2ZJBA 3IMCA 5LKRA 4FI3C 1V7ZA 4QARA 2G8NA 3F9IA 4GOXA 2G77B 1YR2A 1P4SA 1POWA 4IFEA 1CQPA 2I62A 1ZC3A 3W6NA 2V7PA 2IA5A 3OHPA 4HAUA 1X3LA 1F7UA 4RC9A 1HDEA 5C52B 3AUUA 1PV1A 4FYPA 1ZD9A 4C0HA 4PYJA 1SKAA 3U4IA 2UZ1B 3RHTA 4CJXA 1Y1PA 2NNLD 1P2BA 3BQMB 4J94A 1UZLA 5EZYB 1Z07A 4MA4A 4XIYA 4DSNA 1TO1E 1DKQA 2A9KA 1VSVA 4OK6A 5EMJA 2NAPA 2ZJ8A 5A5EA 5LIRA 1E8DA 2BM1A 1NZFA 1S3SA 2F3PA 4RETA 1GTVA 1PL7A 4NEQA 1W52X 3N2ZB 1JEJA 5J1TB 5IC5A 1P4RA 3DYBA 3QITA 1R0RE 4Y2QA 3E6AA 2P8SA 5JPDA 1X8XA 2J67A 4GPIB 1UH5A 4WA8A 2G72A 4CGYA 1H8ED 4D3DA 4QXPA 5J59A 3MGGA 4JLVA 1HPLA 1N9GA 2E48A 2PUJA 4DLAA 1N2JA 3PQ3A 4AECA 2AC4A 4ZT5A 1TM2A 2ZWOA 4DR2B 4RH3A 5ADVA 1E1YA 4KO3S 3NGMA 2UU9B 1M5UA 4HX5A 2AOTB 5GZ3A 2JCGA 4F2HA 4I1SA 4ARZB 2PUVA 1DG1G 2FN8A 2JAUA 5CJJA 5BYBA 3SYKA 1NMQA 3NHZA 4OXKA 4BBAA 3JVVA 3RJ5A 1U65A 4PLVA 3T5PA 1RE1A 1P3DA 3Q6NA 1HDIA 1XRLA 3F1KA 3GJSA 2ZIXB 4PYMA 3HR7A 4NYMQ 4PLCA 3UXYA 4EHFA 2KE5A 4GHWA 5CH5A 4X63A 1OWPA 2IU3A 2V96A 3IEKA 2O1WA 3L7BA 4Y9RA 3VM6A 4K40A 4P34A 5KJEA 2CDNA 3Q9SA 3LPLA 4XRGA 3Q8LA 1H4TA 3MM4A 3OUZA 1KJIA 1C4WA 5TT1A 5ALKA 4DSAA 1QG6A 2GERA 2Q5LA 3ESQA 3FWZA 3LKDA 3ZXSA 4AY5A 4UC0A 1C1HA 2Q5IA 2VH5R 4J9UE 2B0JA 2HREA 5HK8A 5B3JA 4F4CA 3WVNA 2CC2A 1FX0B 4E15A 3SE0A 3ANLA 2QNRA 3P0HA 4MIKA 3SG0A 3L46A 1W0JD 4HI0E 4DRXB 2XRFA 3ZGVA 2HU5A 4RZSA 1TKBA 3IPRA 4FT4A 1ESCA 4C4AA 1ULTA 5EXPA 5LZ7A 1K75A 1V8FA 4KQ1A 1M1YE 2Y1CA 2D6FA 1WMFA 1SXJE 2WWYA 1KEVA 1J70A 4TSFD 1VL0A 5LXTA 2AHRA 3LQQA 3C3XA 4RWEA 4X0EA 2XSZA 1Z2AA 5AOBA 3ZJVA 1XF1A 2VT2A 1Y98A 3JYHA 3ASVA 3QJYA 3K9GA 3FYUC 4JB3A 5A6SA 2H7CA 4A16A 4G9EA 1QHXA 5A4FS 4HWGA 2WMOB 3HV0A 2PVPA 2QD1A 3LT4A 4L72A 3I61A 4RF4A 2WJGA 2JD0A 2ZJFA 2YMLA 3JZAA 4WCFC 2PN1A 3L6BA 1ISSA 1O08A 4C01A 3R6TA 5B5SA 2HT1A 3CRZA 4QASA 1I7PA 2B4YA 2PHZA 1ZOSA 3O03A 3RYFB 4ABYA 1OUMA 2GPNA 3KJQA 2JLYA 5CA0B 2G1KA 2NZ2A 3L4KA 3FOBA 2P7IA 3LH5A 3H17A 3OFNA 1FS4A 1JXMA 2ANCA 3DE5X 3ETJA 4KPGA 4BNXA 2QAIA 5FPKA 3EPKA 2GM4A 4HNRA 4BB6A 2ZYDA 3VJRA 2ZJAA 1EEXB 3HS3A 4DYVA 2B7CA 1V8DA 2P3LA 1W4ZA 5EOVA 4ID9A 4Q7KA 5A2GA 1ONNA 5DU2A 5A5GA 1XLTA 3MIZA 5BOSA 2FOLA 1W5BA 2ZU6A 3DVRX 3SDZA 1Y42X 2OAGA 1RFGE 5FBHA 3NBKA 5B58T 5EXTA 2E4WA 3AP3A 1MJFA 4JYBA 1YZ3A 1LI7A 2ZE6A 3MCZA 3MEQA 4WESA 3UOAB 4ALKA 1ZHOA 4E3WA 4NJEB 2XXAB 4X1YB 2BHNA 3GZ4A 4CMCA 1SU7A 1LS1A 4J3JA 1I2BA 4QFBA 4XYGA 3TS1A 4YAGA 4H0NA 5IK2A 1EFRD 4RTNA 3QHAA 1R4MB 1ZD1A 4HUQA 4RF2A 3REQB 1NQOA 1R5OA 1T5TA 4J8PA 1NVGA 2BFFB 2QX7A 1MX1A 2QQEA 3L2OB 1I3KA 2ZXEA 3PQFA 4IDEA 1JQKA 1SBTA 2Y93A 2XT9A 3WHLA 1IIRA 4AMUA 4BNLA 1OJ7A 3IAS1 2O0JA 4ASUD 3HRKA 2E5LB 3UH0A 5ENVA 4CKXA 2PV0A 4OMCA 4IO0A 4MI6A 3ANSA 4RKQA 1M1NA 2YQ5A 3KO8A 3P9YA 1ENZA 3UWSA 1AT1A 1G7CA 4PVCA 3DT9A 2H18A 2GETA 2GN0A 2ZZKA 3ZWKA 4BL5A 1VHWA 3KTOA 4IDQA 2B8NA 3LVRE 3H6HA 1UC9A 5PNTA 3DO8A 4LSMA 4MWEA 4DUGA 4Q37A 1YUBA 3NHAA 3DMYA 4MUFA 4PZ9A 4WBSA 2WP8J 4DCGA 2OK8A 4GE3A 3M2PA 1ZRNA 4LHSA 3AJDA 2NZVG 2X8WA 1UJNA 4WXMA 3BAFA 2EARA 1LF0A 2M32A 2Z8ZA 3CM0A 3M8KA 3T54A 4YRFA 3EVNA 4LE2A 1IUKA 5LP6B 3ABRB 2HV8A 3ANNA 4AT1A 5CCXA 2UYHA 1KHTA 3FTPA 4JP3A 4E5NA 1U2GA 2IYOA 3U7QA 4DB2A 3KXPA 1QJCA 5IVIA 1ZWKA 2BL4A 2HCJB 1JH9A 4QDOA 4XSHA 4B3JA 1OV4A 2JGIA 1BOOA 1DTWA 3AGQA 3DNMA 3K8QA 4HB2A 4IKEA 5FLKA 5FTMA 3H1GA 3V4PB 5KYXB 2IYTA 1XRQA 4AZSA 2QG4A 3IE0A 4O8ZA 3PQCA 5KQGA 1O95A 3ITDA 4JLBA 3V1YA 1GKLA 3ZE6A 4D0SA 4TTPA 1RJFA 3AL0C 4ZZIA 3KOYA 3HCFA 4CKBB 2V97A 3U7JA 1E2HA 2I2XB 5EXEA 3ZQKA 4C7VA 4YDRA 1VG1A 5KOIA 1VBMA 4MKRA 2ZDHA 4L2IA 4TS1A 4HYYA 2B3DA 4Q19A 2I4TA 5ALXA 3T7JA 4LOKA 2QNBA 2R68A 3LUHA 2W4QA 3F67A 2O07A 3S7ZA 2OT3B 5CLIA 3TOXA 3BDAA 4PAOA 2RB4A 1L1RA 4FYXA 3TZHA 1HFKA 4BO0A 4C88A 5BT9A 1Y7IA 4NX2A 2AHOA 2IYPA 4NDAA 1WXGA 3DB2A 3VNUA 3E0QA 2EX0A 3C3KA 4L1KA 1JQDA 1KERA 1YZYA 2I3DA 2YV3A 2ZJ1A 1ELOA 2XQKA 1ARZA 3M3PA 4REMA 1SKYE 5B4UA 2HU7A 3ZVMA 2BKXA 4C06A 1XPUA 1JG7A 4DG5A 1BWQA 4AULA 3LCRA 2J9RA 4QNRA 2O5EA 2P0EA 1H0SA 1EFHA 1JHUA 3FZQA 1LPSA 2YMQA 4KIGA 3EPLA 1ZUD1 4JLWA 3JQGB 3KLMX 4U2GA 2ZUFA 1QZZA 1LGYA 5BWLA 4F4HA 4MMZB 4YJFB 3Q9LA 3VNBA 1Z56C 1RKXA 3PQ8A 3DCYA 1DLIA 3C2QA 5A05A 3RSLA 4XIIA 1S8FA 1CUVA 1DEKA 2ZAMA 1AG9A 4ZO9A 1FL9A 4BE7B 2X8JB 2RGUA 4NR0A 5F1YA 2ZG6A 3W8DA 4ETMA 5HM8A 1TE2A 4DC9A 2AR7A 1OGIA 1ULSA 3CF2A 3AF1A 4PM4A 4ZIRA 2ZXUA 4N48A 5DBFA 3OTHA 1XCLA 5JLJA 4GWLA 2EKBA 2EFGA 2Q1WA 1JKFA 3IDZA 3A6HA 3DLHA 3I09A 4A26A 1DE0A 2LUOA 5EHNA 5KVQA 1S2MA 1XMOB 4EZEA 2ZUBA 4LZNA 1EIWA 4WWHA 3KE8A 4RA6B 3UANA 5K3BA 4KXVA 3OPVA 2VYNA 3FPSA 2XB8A 1MAHA 1DLJA 1PG0A 3BIJA 4A2QA 3ZJUA 2NO4A 2SBTA 1VSBA 3OAAA 1DV1A 3RJTA 1W35A 1J1UA 4JKIA 2WYHA 1Q95A 2H2WA 1C2YA 3TLCA 2XUZA 4S2UA 1KI7A 4CT0A 3ZK7A 3K32A 3GLIE 2OXRA 4BV8A 3RS5A 4BNWA 1LK5A 3QNWA 5A7FA 3IILA 3DO5A 4CF6A 4MMXB 2IUFA 4R2KA 2H00A 3RIGA 3ID6C 2M6KA 4GGOA 1Q1GA 4I1OA 4PFQA 2Q1TA 1MVOA 3EK2A 5DX8A 3I04M 3OCXA 2OUKA 4ITVA 1OLSA 4JA2A 4YI3A 4DV7B 7ADHA 1D6NA 2KI5A 1P61B 1OD6A 3EMBA 5K0FA 4DILA 4OHCA 3HVKA 4GQAA 3UXEA 4E07A 3ZS9A 1R0CA 3OQIA 3DMFA 2JRCA 3COYA 2FVXA 1WCYA 3B5EA 4GECA 4LX0A 3X44A 1AKRA 2C2ZA 3IEUA 3PJEA 3O91A 3ZDAA 2FZVA 2O4UX 3I6MA 2R44A 5IWCA 2CF6A 4C0XA 5FOXA 4D2IA 4OI1A 2Q4EA 4YRSA 3T9AA 2H0QA 1DO0A 5AH0A 1JQ5A 3K35A 3WWDA 2EFHB 4G97A 4RIGA 2PD4A 2ZI5A 1TKCA 3MWGA 1Z0FA 1QONA 1XQYA 3RASA 4YP5A 4QFCA 4DT1A 1UCFA 1ZEMA 3JYPA 4TVOA 4I2NA 4RNCA 1E4EA 1UMCA 3F5MA 3A2MA 3FD8A 3WOVA 2WA1A 2VJMA 3U49A 2I2CA 3UJHA 1YS2X 1NQTA 4I2VA 5CB4A 1MHPA 2V4MA 2QYTA 3A25A 1IIBA 1YDMA 2SKCA 4OLJA 4LDPA 4PYOA 1FZQA 1EE1A 1Y1LA 2CVHA 2R00A 2YVLA 4JUCA 4L4YA 3FTNA 2XVZA 3CF0A 1TT7A 2IH5A 3PC7A 4U9IS 1CBUA 1KC1A 1TZBA 4FFDA 1SN7A 3EXAA 4G4SO 1L5VA 4IQGA 2E4UA 4D98A 5JJKA 1DQRA 2QMUA 1N6OA 5FUVA 2PU5A 4OQ4A 2O0LA 2Q9AA 2WTNA 2AYZA 4P08A 1EFPA 3HJTA 4ECEA 1FP7A 2OGUA 1Q0LA 1Q92A 4ZVLA 1T0UA 4D43A 4E11A 5LU9A 1GITA 2BP7A 2I2WA 3OFJA 4PS1A 1QB8A 1JIVA 1HOXA 3BMCB 4UAVA 3MW8A 2A1UA 3GEDA 4GU5A 1NWHA 3DOFA 3CX8A 3DT6A 4NECA 4B2PA 3U5ZB 1WSAA 2HLNA 1VGRA 4AS3A 4EGQA 3QI2A 1WBBA 1JG3A 1VKHA 2H29A 2DX7A 2HTEA 2CBGA 4NYIQ 3GDWA 4XWKA 1TTQB 3LHIA 4BN5A 4LN1A 5FTNA 5EMKA 4IKPA 1BVUA 3BH7A 4QGSA 4QJIA 5EZYA 1DCTA 1L5FA 4F21A 3KUCA 4FFPA 3G0DA 1OSNA 2DU8A 3GJTA 4Q3EA 3ILYA 4NHEA 3D2CA 5E6UA 3JAWA 3W9SA 3YASA 5TX7A 1E5VA 4YT8A 1P8AA 3KQTA 2WFMA 3EFBA 4WEQA 2PFGA 3I6QA 3UG6A 4F6LA 1G3IA 1QGDA 5I7OA 3ORRA 4IIYA 5DNVA 4JXJA 5T4HA 4PIVA 1WCWA 2F9FA 4AZWA 2QS9A 5K4GA 2Y0DA 3E1KA 1SKBA 1MO5A 3G0HA 5K6TA 3EEOA 4REQB 1X7XA 1GCIA 1XWFA 5DTJA 2BZ1A 5DYWA 2ZRCA 5KYTA 1U2PA 2XNKA 3JSAA 3PSHA 4H1VA 4QX6A 3CGWA 2PMKA 2VHYA 1QF6A 5JJIA 2GT1A 1M6NA 1QAOA 4BRZA 3GB9A 1SBIA 3R9WA 2ZAGA 5AVYA 2HQBA 3LY9A 2WJYA 2HO5A 2VBGA 4L8WB 2RHTA 4NTZA 1A5SB 2Z43A 4MW6A 4WADA 5DM2A 2RI1A 3O8QB 4J0JA 4MVJA 1SHUX 1GT91 5DBEX 1MR3F 1FTGA 3D5EA 1YQQA 5F2EA 3C3CA 4GM4A 4Z4QA 4JASB 2A0FA 2ZYIA 4FBMA 4GPAA 3HM2A 4GX2A 4WW0A 2XA9A 4BIMA 2GF9A 3UKOA 1Z2NX 4AIRA 4EW3A 2DETA 4QZVA 5AKZA 5DT9A 4LE1A 4DIUA 4YMGA 2FPPA 3NNNA 4HO1X 1DVRA 2L2QA 4IIGA 5LP1A 4QJBA 4LY9A 2BGWA 1EK1A 2XT6A 4HH0A 4C2UA 2FZ4A 3DFUA 5IYZA 4UUPA 4RELA 4FTWA 3LX8A 3QVMA 4UBIA 2WLSA 5H8WA 1JA9A 4IHJF 3ADCA 2J6BA 2Q1SA 4FOLA 4XWAA 4AICA 2DHDA 1R50A 1JA0A 5D1HA 3TK1A 4QHYA 4J49A 4JI2B 4ROTA 2AD5A 4K87A 1K4YA 3F9RA 1OBHA 2WSLA 5EUQB 1ZJZA 1E2UA 3LHSA 3M6LA 4P58A 3A2LA 1LZKA 4WKOA 3TG8A 3FW1A 4GBGA 5ESDA 4AP9A 4FOOA 1BGWA 2JI4A 4LRWA 1JLHA 1FYFA 2AC7A 2JIPA 2O8CA 1CR1A 3BRSA 3F49S 2GEDA 4JI1B 1JIKA 3ULKA 3WWPA 5BQFA 2UZ4A 4G5OA 3PC2A 4GICA 1K27A 2W7TA 2VATA 1ZUNB 1N8NA 3JR7A 3VDNB 4A27A 3G59A 3FR7A 2QW1A 4HX9A 1K66A 4KOAA 2WB4A 3W06A 1P74A 5IBPA 1O5IA 5F1OA 4UEOA 1JVSA 4L9AA 5D85A 1ZK1A 3T5TA 4C0SA 7MDHA 4N65A 4PNEA 3WIBA 2H5JA 3EZ9A 3BE8A 4V39A 4HVTA 3TSAA 3ZIAD 5K0ZA 1DJLA 1ESNA 1SVWA 1YO6A 3GBVA 3HLKA 4KLNA 3GCGA 4NFHA 5KWEA 5BV1A 3AR7A 2NSYA 3L41A 3R5KA 4A92A 3SBEA 2O9JA 1SRRA 2RHMA 3U3KA 1W94A 1O6FA 4ZAYA 1PLLA 1YC2A 1ZCZA 2YXEA 1XZGA 2OCDA 4XFDA 3OM8A 1GV1A 1A3CA 3TSOA 5BSKA 3AIKA 2B5OA 2VP2A 1M8KA 3E8XA 4Y1GA 5HGJA 3G2MA 3SZMA 2Q3DA 3HUDA 1WULS 3HKCB 2J3MA 2AFIB 1N0WA 2PEZA 3AIOA 4HFNA 4INAA 1B6SA 2R6GA 4JT8A 4LW8A 2PL5A 4UVEA 4BKPA 5BUQA 1M54A 2D0PB 2I4IA 3NIFB 3AUTA 1N3IA 2FSSA 4F9GA 3SSAA 1GTJ1 3BKXA 2IRWA 4RANA 2CDRA 1DS6A 2WJVA 1GLVA 3KV3O 5ELXA 1JHRA 1K1EA 3PNMA 5I3ZA 3BGSA 2H9IA 2HF8A 1UBOS 3N3BC 2DECA 3PD7A 1RE0A 2EC5A 1V16B 3K2EA 2YV1A 2NU7A 3SJAA 5DWVA 4B09A 5LQNA