2AX4A

Crystal structure of the kinase domain of human 3'-phosphoadenosine 5'-phosphosulphate synthetase 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
QAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Crystal structure of the kinase domain of PAPSS 2
rcsb
source organism Homo sapiens
total genus 70
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ax4A00
4FMBB 1BOFA 5B30A 4Q48A 5J4YA 2B92A 1TUEA 4L5BA 1IN8A 2AN9A 3CONA 4MYTA 1E4VA 4AY2A 4JLPA 1PLJA 3IEVA 1G291 1G19A 4B74A 2QZ4A 3AEZA 3Q7PA 2O5VA 5DHAA 4EAQA 3K0SA 4GL2A 2NZJA 3V00A 2QORA 1UKEA 2WSMA 3DEFA 3QXCA 4PSAA 2QG6A 5J40A 3PJRA 1ZIPA 3OHMA 2XX3A 2ZR7A 2GA8A 1D9XA 1VYUA 4A2WA 2C9YA 4LV5B 3LFUA 3ZVMA 1JEEA 3AQ4A 4LJ6A 3OEHD 2WV9A 3THXA 4A0FA 3OFND 4B3DA 3E1SA 2QBYB 3GEIA 3IUYA 4QXAA 2YWFA 2ANCA 3AKCA 3M4YA 1VG9B 1S3GA 1OIVA 1RJ9A 2DFNA 3EIEA 1HYQA 3OIWA 3RYTC 4GBMA 1VCMA 2RGCA 1CS4C 5FUYA 2X8AA 4FMDB 4JZKA 1US8B 2ZYTX 3KKMA 3ADBA 1DEKA 5UKDA 4BLSA 1M7GA 4PO1A 3NEJA 1K8RA 4BLTA 1G1MA 1N6OA 3WP0A 4MKHA 4PAQA 5L3SA 2XJ9A 2MSCB 1QHGA 1E2DA 1E9SA 2EFGA 3QVUA 1HUQA 4DDTA 3PFIA 4BGDA 3HPQA 1ZNYA 1KK3A 4ZDIA 3TGPA 4HAVA 1T6NA 2REBA 3KKQA 1R4AA 3ZH9B 1ZRHA 2X1VA 3QSYA 3OE7D 3AH8A 5KNCA 2QRZA 1NVWQ 3CRW1 4ASUD 1IAQA 4MGYR 4D4JA 4IOKA 5JS7A 2WSSA 3N2EA 4RD6A 1P6XA 1G41A 2P65A 2R8RA 1H65A 3U61B 3WMEA 4N3NA 1CR2A 3ZGXA 1EFCA 3UG7A 2XXAB 5BN3A 3AVOA 2JATA 4W5HA 1TU4A 4RSGA 5G3ZA 2LKDA 2JGNA 2OAP1 3N2IA 4B34A 1E79A 3CPEA 3QEOA 4LJ7A 5AJYA 3B1YA 5AUPB 1T91A 1O3YA 1SGWA 2Q9CA 3KJEA 521PA 2FMXA 4JSTA 2A5YB 2GNOA 3K8YA 3RRZA 3EPLA 2DB3A 3T12A 1D6JA 1F6BA 2QE7A 1A5TA 2UKDA 4TLDA 1G3MA 5JI3E 4FCTA 1OH5A 721PA 1FX0A 1A82A 1XP8A 2CL7X 2HJVA 1Q3HA 1AGPA 1CR1A 1E3MA 5H70A 1N6NA 3IBYA 3CO5A 1W0KA 4I81A 3GJ0A 1OPXA 1P75A 2XJ4A 3GLGE 4L15A 2ODNA 1KDTA 2CLDX 1Q3TA 3DM5A 4IHQA 5CB6A 3V9PA 4OQMA 1HE8B 4XJXA 5G53C 1T0JB 1DAIA 4Q7KA 1ZM4A 1QVRA 5FBQB 4RZUA 1IM2A 2D2EA 1XTSA 4L9SA 1JBKA 1XMJA 3IGFA 2CL6X 4URUR 1NN3A 1P9NA 3PVSA 4PR0A 3EPJA 2X19A 4HAWA 3S1AA 2GCNA 3MJHA 4JLVA 5J4VA 3QY0A 4NYMQ 4TTPA 4V0OA 4X8HA 1TPZA 1TMKA 1WDTA 4TMKA 3RS5A 1M7HA 2QGZA 5EUQB 1IXRC 1GSIA 4LK2A 1K5DA 2W83A 4ZDKA 1T3LA 2O8DB 4PHGA 3ZQ6A 3BOSA 5DLQC 1ANKA 3NBFA 2CE7A 4HUQB 1ZM3A 2QI9C 2JDID 2XSZA 3R9WA 1NN5A 4AK9A 2DBYA 2IBMA 2YKGA 1N6IA 4C0BA 4LGMA 4MH0R 2NO0A 4Q1EA 4DCVA 4IW3B 3C41J 2QENA 4NCKA 2DFKB 4IJMA 4OHXA 2DWPA 2VLIA 5HZKA 1ZC3A 2ORWA 1XCPA 1IXZA 4LHWA 3OEEA 1T9HA 221PA 2KJQA 4RKFA 4MRPA 2FGKA 4NYIR 5FI0B 3RS0A 4JL5A 4LBWA 1XD8A 1KI2A 2DY1A 1E9BA 2ZI4A 3A1UA 2C77A 3R8CA 3V4FA 4JBXA 4TSFA 4NTZA 1LNZA 1T3HA 2ZSBA 1N6RA 3W6NA 1QHSA 4Z1MA 1ZM7A 2QEQA 4BLRA 5CK5A 4YMWA 1W47A 4AKHA 3PUYA 1JXMA 4W7SA 1FUUA 1E0SA 1Q12A 4TQUS 2HLDA 3BC1A 3RS2A 4BZPA 4IVRA 4JKYA 2WWFA 4R71A 2QP9X 4ZIRB 1XWIA 2ZAMA 2FE4A 4DZZA 1NRJB 1TEXA 5AUQA 1Q1EA 4KHZA 4LYHA 1HT2E 4OQLA 2ZXUA 3BORA 3LBIA 2RGNC 2V1UA 1QHHB 2AK3A 3OAAA 5H8WA 2J7PA 3RC8A 3HR8A 4B2PA 1T3SA 2DHRA 4IDQA 2GCOA 2R6DA 2VTKA 3VKWA 4CZ2A 1UPTA 3DL0A 1NF3A 3ONWA 3ZZTA 1P60A 2A3RA 1BMFD 3FPAA 3CLVA 4ZCMA 1UAAA 4A36A 4RJLA 3EZ7A 3A8TA 3R7WB 1NLZA 5CJ2A 2CNWD 2ZRMA 3ASZA 3JVUA 5JRJA 3JVVA 3ASYA 2GXQA 5DHFA 5C46F 3LQRA 3AVXA 1XXHA 4M9QA 1W36B 3NDBB 2REXB 4LI0A 2UZ3A 1R6BX 2GXUA 1UKVY 2MMCA 3FDIA 5BW8A 4EJSB 3OIYA 4RD3A 2ZI5A 3X1ZA 4MDEA 1GWNA 1U90A 4C0SA 1G4AE 5F2EA 1M74A 3TVTA 2NG1A 1E0KA 5GJCA 3BGWA 2FEMA 2JLRA 1RE0A 4G3XA 4X8OA 1YZGA 4Q9KA 2CJWA 1XEWX 2ERXA 4TYNA 2BJVA 1AKEA 4UKDA 4DT1A 4HZIA 5G41A 2WKRA 4QBGB 4B43A 3V4RA 2RH5A 4BFVA 3X1YA 2QU8A 2F1HA 1E96A 2LWIA 3NEYA 1OE0A 4Z8YA 3JZMA 4C2UA 3QPVA 4YQFA 2GJ8A 3FOZA 1VKJA 4BLQA 3SHFA 3UMSA 4TYYA 2EWWA 2J59A 2D62A 5TXGA 4OHZA 3T06B 2CCGA 1CLUA 1E69A 3K0AA 3FFAA 5FTLA 2XOKA 5HPYB 4DIDA 3L8ZA 3D3QA 3THYB 3KL4A 2IS6A 4C4PA 1U2RA 5JHHB 1ZUIA 5GJWC 3A58B 3PEWA 1E2GA 1T8UA 4M1OA 1KY2A 3TK1A 5AJXA 1AS3A 2Z4SA 1LB1B 5JWOA 1TU3A 4FN5A 1E2FA 2QT1A 2NPIA 3DMDA 3GJ5A 1E2KA 3RRYA 3U6KA 1RW4A 4EFLA 3THWA 1OXTA 4H1VA 4ZCLA 3RANA 2QROA 1U9IC 1JNYA 1VG0B 1ZUHA 2GHIA 1F5NA 1U8YA 1W2GA 1Z22A 2QPOA 1Y63A 2AK2A 3DO6A 1U81A 4ARZB 3ZQJA 1YJ5A 1GKUB 4TZ0A 3K9HA 3CKLA 3QBTA 1PVOA 2RGBA 2V6JA 3ZJYA 1W4AA 121PA 5D3MB 2ZJYA 4A0GA 2C03A 2ZJ2A 4KAXA 2OLJA 3P4XA 4GMXA 4QRHA 5FTNA 4ZI3A 2PZFA 2QPTA 4IKEA 3T61A 3SJBA 2C2HA 3X1DA 3BH0A 1ZUNB 2ATXA 4GDFA 1GNPA 4MUAA 3QXXA 2QMUA 3SJZA 1KNQA 4DB4A 4P4UA 2O0HA 2OFOA 1ZW6A 1GITA 2GJAA 2F7SA 3B7GA 1VMAA 3GFPA 1BO6A 4DKXA 2CMKA 1MKYA 3O47A 3VMFA 3LQQA 4EIWA 2QBYA 2ERYA 4O0MA 1L2TA 2ZREA 4DWJA 4OQXA 2ZRKA 5FL7D 1EK0A 5FH9A 2B6HA 3FMPB 1XMVA 5EUMA 1G3UA 1GL7A 3CRVA 3VKGA 4QHTA 5FBRB 1US8A 2VH5R 3LDAA 3BB3A 4AG5A 4JLMA 1XZQA 1XFAA 5EE0A 1DG1G 1QHYA 1T8TA 3KJGA 1NY5A 2Q3MA 3EA0A 2F1JA 3TRFA 4EUNA 5JBQA 1P73A 4OI2A 4YLGA 3QKRB 4Q4JB 1AGRA 4BZXA 3W90A 2IWRA 2ZJZA 5KU1A 4JVLA 2EFHB 3R8FA 3KFXA 1FPMA 2VP0A 2E1RA 3CUEF 4B35A 1KMHB 3LRPA 1HV8A 4MYHA 4R9UC 5LDDC 2CEAA 4M1WA 5FPTA 4OQFA 3AP2A 5CLLA 4DSNA 2EFEB 1I4DD 1E9FA 5KSZA 3Q9LA 1W36C 1PLLA 3QBVA 2VBCA 1XX6A 5G3YA 4M1SA 1IY2A 1D9ZA 4P32A 2JLYA 1Z63A 3QF7A 3EC2A 1SVOA 5EP1A 4I1VA 5DI9A 2BBSA 2CCJA 1G8YA 1JR3D 2XXAA 4ERNA 5LPNA 4BFSA 1KO7A 4LRWA 5FPYA 4F91B 4JMPA 1ZNXA 1N0UA 3ETLA 2IC5A 4LWZA 1FL9A 3QOFA 4MGIR 2ZUCA 1TF2A 2FPLA 3K9LA 5HE9A 4Q4AB 4ZCIA 3U44A 1OH7A 1AZTA 4LOAA 3IIKA 4UXJA 2WKPA 2F6RA 2VHTA 4WAUA 3H4MA 3KZ1E 3GFOA 3ZDQA 2WVJA 1QG2A 2ZJ5A 5EE9A 3EWAA 1K6MA 5G40A 4G1UC 5EZ5A 4B71A 2WMNB 3F0TA 1DTSA 4RY2A 4U00A 2J1LA 2F9MA 5F9HA 4Q9IA 4FMDF 1KI7A 4XWAA 1M2OB 5TY0A 2OAQ1 5CM8B 1Z2CA 5HE8A 3VAAA 4ON9A 1W48A 1P4SA 1OKKD 1WBDA 5KNBA 1TF7A 5P21A 3IILA 4QBFA 1GP2A 2AHOA 5HKKD 2AFIE 1CEEA 2BBWA 2L0XA 4JL8A 1W5TA 5A5GA 5CB8A 2XZLA 1P5ZB 1TAGA 4V03A 3TW4A 3U7GA 1T5LA 1Z07A 3FVQA 3Q7QA 5GVRA 3I8XA 1NMXA 1FMLA 1QVAA 3MAAC 3MWLA 3ZS9A 5KPJA 2VSXA 1E98A 3WYAA 1DVRA 2ZRCA 3FYHA 3F5FA 4PZZA 2JLXA 1NKSA 1Z0JA 1M8PA 4TLAA 4FWTA 4ZPXA 3AF3A 4D80A 4ZO4A 5DH9A 2VHQA 4PO9A 4HB2A 2YC2C 1UBEA 2HXYA 3I4LA 3T1TA 2BHRA 4N0EA 1EFRD 1NSFA 3QPWA 3EZ9A 4HI0E 1M1YE 4NCJA 4BEBA 3GLIE 2OBLA 3FMOB 3T1OA 3EPKA 1EESA 4DLUA 2PMDA 1YRBA 4TTRA 1U9IA 3N5CA 3I72A 1VCNA 2O8DA 4M4SA 5E7MA 2Q0HA 2GETA 4HUQA 5KTYA 1KGDA 1XRJA 4Q00A 2JJ2A 4EDHA 2JCSA 2ZE5A 3BS4A 4KLZA 2GTPA 1IY0A 1UKYA 3NXSA 1KZGB 1LTQA 2Z6VA 2VSOA 5HCIA 1FZQA 1X6VA 2P5SA 1NG1A 1I4TD 1NVXQ 2GEUA 2GDJA 4BUJA 2Q3FA 3E5HA 2IYRA 3LW7A 2IWHA 2WAYA 4JJKA 2JJ8A 1DG3A 4P0TA 1XTIA 4DLXA 4A1FA 3K70B 1BIFA 1YU9A 3CH5A 4KV9A 1ZIOA 4O2LA 2GEVA 3G0HA 821PA 1ESNA 2R6AA 4BWYA 1L4UA 2BBTA 1IOZA 2OUKA 5IK2A 2IYTA 3A1WA 5JHGB 3IO3A 1GIAA 4V0LA 2Z0MA 1X8JA 2CHQA 2BIFA 4LV8B 5AUNB 3VNVA 3RC3A 4O2RA 1CULC 2EWVA 2ZUDA 4LY6A 5BWMA 2AL7A 2JLZA 1IHUA 1MRNA 2IYVA 3LV8A 3P27A 4G0NA 1R8SA 4IOJA 1VIAA 2GF0A 4TMWA 3GLIA 2LKCA 1AKYA 1G18A 4C9BA 3ZZ0A 3QEJA 3KQHA 2F3RA 2GJKA 3Q5DA 5FOXA 5EXPA 1I2DA 2C98A 4NKRA 5TB5A 1QHHA 1KNXA 1FNNA 1CJUC 2ORVA 5KSPA 3KQUA 4HLCA 1OSNA 1P9WA 2E9SA 2WZQA 3FKSD 1KSJA 3R7WA 4LZZA 3H2YA 1DAKA 2A5GA 3T5DA 1DARA 2WPDA 4DCNA 5JCPA 1UDWA 2VP9A 4Q1DA 1G8GA 5JJLA 3C14C 3GEHA 2JJ1A 2PLRA 4OYHA 4DUGA 3KTAB 4AYWA 5JZVA 4AYTA 3B8HA 1E2NA 3QUSA 4TT3D 4DC9A 4CF7A 1JJVA 1GRRA 2CXXA 2KBEA 2NO9A 2WBLC 3CW2A 1D2NA 2ONKA 3SE0A 2W0MA 4D4KA 4PFSA 4LV6A 4R98A 3FMIA 1IJEA 3TAHA 1OH6A 1N0VC 1F2TB 1YR7A 1H8EA 2IYWA 3VTKA 5EP2A 1B0UA 2H7VA 5H68A 1OHHA 2BWJA 4PQRA 1EFUA 4D0NA 2FOLA 3KQKA 2WWWA 3U5ZB 1G16A 1ZMXA 1N2CE 2K5UA 2IXFA 4K46A 3SJAA 3K70D 4QNRA 1JR6A 2IXGA 4EPVA 5KDLA 1W1WA 3B60A 3B82A 1MH1A 2BCJQ 3C5HA 3CNNA 2H57A 5A0FA 2FGJA 3RSOA 4US1R 3C5CA 2JLVA 4XVUA 4BFWA 4PQYA 1IJFA 3IPYA 1KK1A 4AI6A 2EYQA 1XCGB 1N5KA 2VP5A 2ZEJA 4RKEA 5BN4A 1GOTA 1ZCAA 4ZDWA 4QBHA 3SYKA 1U0HC 1KAOA 4POAA 3FWYA 1MOZA 4Y0AA 4DHEA 3THYA 3L0OA 3CBQA 5JSZB 4NYMR 3H1TA 5C18A 1VCOA 1IN4A 2QTHA 5E7JA 3HPRA 1ZYUA 3C8UA 3ZD7A 3O8BA 4KBGA 4L4UA 4H9GA 3SHWA 1XPUA 3REFA 4TQ9A 2WMOB 3UATA 2IK8A 1VIYA 3P26A 3CPHA 1AJEA 2A5FA 3A1VA 3GLHE 4B2IA 1LS1A 1W44A 2B8WA 3RS3A 4DDWA 1COWA 4OL0A 4ARZA 2QPAA 1KKMA 4Q1CA 3U7HB 1QDEA 3LAWA 4LPKA 5DO9A 2NTYC 4GSYA 4WXPA 4Z8XA 3WYFA 3LVQE 3AVYA 2XNDD 3WHLA 4PTLA 1DADA 5D3MA 2OCAA 4OI1A 2YINC 2NQ2C 4L16A 3D7MA 3ZS8A 2C78A 2MSDB 3NC1C 4PANA 3OESA 2NGRA 1U0LA 4Q7JB 5J5CA 3BFXA 4LBVA 6Q21A 4UJ5A 1NVVR 2IEZA 2W2VA 3WNDA 4GFDA 1PUIA 1Z3IX 3SQXA 4EKDA 2C99A 1CXZA 4P33A 2EQBA 4EPWA 4PC2A 1XD2A 1XJ0A 1E6CA 3A1TA 2FFHA 4D0LB 5L3QB 1SXJB 4JT4A 1M34E 1G20E 2W6JA 3GJ7A 3IIMA 3AGQA 4LBZA 3T15A 1Z6XA 5B58C 2C5LA 1FNMA 4HEJA 5JFGA 2VP2A 3L43A 1YQTA 1JALA 1EFTA 2QGNA 3BE4A 4OHVA 1Z5ZA 2I4IA 3VHLB 4KI0A 2DWQA 2QL6A 5FPSA 2BCGY 3T34A 3WXMA 2J45A 2ZI3A 5J4LA 4XOIA 1N3BA 1CTQA 2QRNA 3EA5A 3GLHA 4YONB 4C0KA 4LUCA 4IEIA 3PUVA 3MGCA 1UFQA 3GLFE 1XEFA 3KDSE 3C16C 5FI1B 3GCGA 3DZ8A 4B32A 4XSHA 3VR5A 3ZZUA 3UANA 5C2JB 1UKZA 2FWRA 1ZBDA 1AZSC 1KMHA 3CIOA 4V02A 5CJPA 4B3CA 5TDHA 4F7WA 4QGHA 1W46A 4ZDJA 3KQLA 4NONA 2FV8A 5J47A 1P61B 4CEHB 4Q19A 3AVWA 4OK6A 2JEOA 4A9AA 2FZLA 1X8LA 1VHLA 4MUBA 1LF0A 1CBUA 4PSKA 4LYAA 2Q6TA 4BEJA 1MO5A 2HJGA 3PQCA 4BQSA 4IDOA 2QQ0A 3TR0A 5DN6D 3DHWC 2P6UA 1VG1A 5DYGA 5DYIA 3WBKA 4I99A 1R5OA 5BYKA 1XF9A 3QKTA 4ZV4A 3O8CA 3B1XA 1J2JA 3CNOA 4Q4AA 3TQCA 2G6BA 5HZHA 2XAUA 4TYPA 2REOA 2VEDA 4JL6A 2A5JA 2HCJB 3RWOA 1TEVA 4B75A 4N0DA 5SZJA 4P3YA 1E1QD 3B1VA 1GILA 1N5LA 2AXPA 1GL6A 1ELOA 1F2UB 1X1RA 1SXJD 2G1JA 3C7KA 4LHXA 4DSUA 2I1QA 4DB2A 4DCUA 3I92A 2QM7A 4ZKEA 3PITA 1N6KA 2H92A 2W6IA 3GLFA 4PAOA 3QG5A 5C4GB 3W8RA 1N6PA 4HZUB 4KXFB 4NPHA 1AA9A 1E2QA 1E94E 1UADA 2NOAA 4XWOA 2IUTA 5DNYB 3THOA 4UQOA 2GK7A 1NSTA 4NMMA 4KFTA 4D6PA 4D81A 2MSEB 3P1JA 2WHXA 3R20A 3RLFA 1JPNA 3HYTA 3L2OB 2FSHA 1OB2A 3QXHA 1HE1C 4QM6A 3LBNA 1Q0UA 2IUSA 2J0UB 2AD1A 1G7TA 4XD7A 1P2UA 1KTVA 3VX4A 4JBYA 2ZIAA 1YVDA 4QGFA 3QKSB 4O25A 3A4NA 3K0CC 3NTUA 4KSBA 5JCZA 5JJKA 4DDVA 1GUAA 2BMFA 2KB0A 1UM8A 2YNMA 5EXTA 4B3XA 4MGZR 1XJCA 2FPKA 1KI1A 5HCNA 2QMEA 4C0LA 4Q9HA 5EJEA 4IVPA 1E2PA 4JLDA 2JLQA 1U0JA 4X8MA 2IW3A 2WIBA 1NJFA 1SKQA 2V54A 3KKNA 4HDOB 2C96A 1II8B 2JIZD 3U3OA 1XXHE 4CDGA 1YHNA 3CF0A 3P20A 4US0R 2D7CA 5JJIA 2XZOA 1XDBA 3F8TA 1X86B 4II7A 2P2LA 2ZRDA 2CDNA 3PUZA 1OFUX 2R2AA 4RZ3A 3X2SA 4HSEA 4D25A 3EWSA 4J0QA 4TT3A 3PXGA 3EAQA 4B76A 2CK3D 1P9RA 3B1ZA 5K8TA 1PJRA 3Q85A 2HDNB 1EG7A 1RRGA 2CHGA 2VQSA 1KYIA 2OCBA 1IY1A 2R44A 5KHOC 2YOHA 1KO1A 4PX9A 2YYZA 2VO1A 3HYRA 3DPUA 1XEWY 2IYYA 4F4JA 1R0YA 2ASEA 3IDQA 3TR5A 2J87A 4QBIA 1TQ6A 2QT0A 3HU2A 2PZEA 3ZVRA 2ZAOA 3O8RA 2IYUA 3M0EA 4CVNA 4E09A 2HT6A 1OH8A 3L0SA 3K0FB 1JQJC 4KVGA 5EP4A 3BXZA 1LV7A 3RVBA 4NDZA 1MO4A 4G5SA 1FTSA 3SYLA 1QHXA 3Q3JB 3MRSA 3I5XA 3L8YA 3B5JA 4C7OB 3BB4A 4GNKA 3ICEA 4IDPA 1J8MF 1SVIA 1W4BA 2G3YA 2V7QA 3ND9A 2ZSFA 3A4MA 1NIJA 2PT7A 4HLQB 1VDZA 3AP3A 1NP6A 2ZU0C 1GRQA 3LBHA 4Q9JA 4R2IA 3JZAA 1HURA 3SYNA 3ECCA 3DKVA 3T1VA 1RFLA 3QF4B 2R6GA 1HQYE 1I4LD 3ADCA 1WRBA 4W5WA 4G5OA 1V43A 3VR2A 3X1WA 3LX5A 2O8FB 2OHFA 1VPLA 4PPFA 1GG2A 3SBDA 3W34A 1VYVA 4DLSA 4JLNA 3I32A 3NBYC 3U3MA 4GI7A 4M1KA 4JKIA 3IQXA 2F9LA 1L4YA 1OXSC 4F4CA 1G4UR 3OEHA 4JVMA 4MKIA 2BEKA 1RRCA 1XCMA 1XD9A 1E2JA 2D06A 3W3AA 3KXLA 4DDUA 2Q9AA 4JYCA 2FF7A 2ZI7A 3KTAA 3OFNA 3G82C 4UJ3A 1GL9B 5C4MA 2EU8A 1KJZA 2I3BA 3AKDA 1VCIA 5JMTA 4M1TA 1XTKA 3MWKA 1RVDA 4RD2A 5AWFC 4MKFA 1W49A 3TQFA 4RD4A 3EZFA 2YV5A 4GZLA 4MGKR 1KDOA 1NL3A 1WCV1 1EFHA 1R8QA 4WOPA 5E7IA 4DJTA 2VSFA 1KAGA 3B9PA 1NN0A 1P3JA 4HDQB 1V5WA 2GZHA 1PV4A 4TLEA 1MT0A 1KHTA 2J3EA 2R62A 3D6TB 3QI2A 4DCSA 4PZYA 4FMCF 2PJZA 2F1IA 5CITA 2GZDA 3WNCA 4JYBA 1ESMA 1P2VA 3SN6A 1BH2A 3CRQA 2FPMA 3BB1A 3OIUA 4EQ6B 4AKIA 1W7AA 2JAQA 2HF8A 1S8FA 5AJVB 2ZETA 1XPOA 4PAMA 3N70A 3I62A 2ZRAA 2GAOA 3H0KA 1DO2A 1JB1A 3OE7A 4PZLA 2G83A 1GKYA 2Q9BA 3AV0B 2GXAA 4D4LA 1Z29A 4ASUA 1UJ2A 4CEJB 3RDPA 4NU0A 4IDNA 3TSOA 5FBLB 3GMTA 4AD8A 1FOEB 1TX4B 2CBZA 1IN7A 2IF2A 5JSZA 1XNJA 2XB4A 2ZR0A 3FB4A 1OXXK 2EFCB 3R9IA 2BMEA 3FE2A 4IVQA 3ZIAD 1CJKC 4A0RA 1NBMD 3P32A 2V8OA 4YMTA 4B3BA 2ZRBA 1ZC4A 5L3VA 4TYQA 1RYFA 3K09C 4QGAA 4R7ZA 4S2EA 4FD2A 2C9CA 2J9RA 1E1RD 3BFKA 3UK6A 4LBYA 3K0CA 5IF9A 2ZE6A 2D3WA 4BE7B 3CNLA 3AF4A 3THXB 1KI4A 4CIDA 3SBEA 1N5JA 4YXWD 3AUXA 1Z0AA 4FI3C 4B3FX 1WP9A 3AGPA 4FWIB 2VF8A 5BQ5A 1H8HD 3W5IA 2J0VA 2YOGA 2ZS9A 3ADKA 2WTUA 5F9FA 2A9KA 1RJ9B 1CR4A 3SS8A 4TMXA 5EE1A 4PHHA 3U60B 1E2MA 4V0KA 4ZI2A 3KX2A 2XZPA 3OF5A 1E2HA 3EW9A 3ND8A 4Q4LA 3LW8A 3KXKA 2YOFA 1DE0A 2G77B 2UZIR 4LJYA 1F48A 5L3QA 3KB2A 3RS7A 4O3MA 4V0NA 2V55B 4KFSA 4AYXA 3SI7A 1WA5A 2VIIA 5GADl 1XTJA 1NMZA 4GP6A 4UNQA 1PLKA 1N0WA 2BKUA 2H18A 1OXUA 1U98A 3CF6R 4LJ9A 4RCYA 3C4JA 4FCWA 2VPPA 3NDPA 2CVHA 1E0AA 2ZM5A 1HH4A 2QY9A 5FOVA 2O0JA 4PC3A 3EPHA 1CJVC 1TADA 2WOJA 4PC6A 1OYWA 3H86A 3IHWA 3SFVA 4QOSA 1Q44A 4S35A 2FA9A 2XGJA 3PEYA 5CYOA 1Y3AA 5DSZA 3AB3A 2G1KA 4EJSC 5JLJA 1KKLA 4LJAA 1YZLA 4PPGA 4R2HA 4G01B 2YWEA 4CW7A 5FTKA 3AVVA 2R65A 3QE0A 2H5EA 4BFUA 3BD9A 1FFHA 2QA5A 4MYUA 1Q1ZA 4UNRA 2JDIA 4DLZA 1GZSA 2RGEA 3BBPA 4XTCS 1RKBA 1KZ7B 2GXSA 3LXRA 1KK2A 3RABA 3WP1B 4BRUA 4EPRA 4CEHA 1CRQA 4B33A 1KK0A 3BRWD 4KLNA 4U7DA 1TQ4A 5AUOB 3LX8A 3NHBA 4DRZA 2AKYA 1CIPA 1E0JA 1QBKC 1LVGA 2WWGA 3MFYA 2WOOA 3EARA 2P0EA 2ZS8A 4GOXA 1OF1A 2WWIA 5F98A 4KFUA 1S9HA 2DCUA 2GVZC 4OHYA 5SZIA 2GKSA 1UBGA 1XU4A 4Q1FA 2IS4A 1AN0A 4DSTA 3DDCA 3DKPA 2F43B 4AG6A 2P6RA 4TLCA 2B8TA 3REGA 4IOMA 2IT1A 1TQ2A 1AS2A 2YVUA 3AVQA 1G3RA 1F2UA 3CR8A 3VKHA 1Z83A 5EXSA 3GJ6A 1FQJA 1SKYB 4KO8A 3KFVA 1KIMA 2VHJA 2ANBA 3CH4B 3S1AB 1MR3F 2AWNA 4HZUA 4FW9A 3W9YA 4LJ5A 2KBFA 2V1XA 1G6OA 4DCTA 1ZJ6A 2FZ4A 2WSSD 4DLTA 3VX3A 4F93B 4PO8A 3SC3A 1S4QA 2Y8EA 1BMFA 1OB5A 1R0ZA 2H8KA 5C1BA 2CNWA 2YC4C 1A7JA 2ZJAA 2N46A 2ODEA 4K8OA 2NO7A 5FBVB 3TBKA 3GPLA 4JLKA 5M04A 3I3SR 2FFQA 2PMKA 2J0UA 3D8BA 2IX3A 3LLMA 1E79D 4ABYA 1KI8A 4RFSB 3B6EA 4URVR 1U99A 1G7CA 3W6OA 2IF0A 4NCIA 1ZD1A 2J46A 1MO3A 3TLXA 2AD5A 3GLGB 3K09A 3BH7A 3IBGA 1XJQA 2R9VA 2XEXA 4CRWB 1N6HA 2WWXA 2QAJA 2QE7D 4LX0A 4C3ZA 2WJVA 3NWJA 3LH5A 3C15C 3TSZA 4XWKA 1A4RA 4OHWA 2XB2A 3SDZA 3T35A 2HYIC 2FH5B 4YMVA 3SQWA 5LB2A 2OT3B 5AJZA 3WNBA 4E5UA 2BV3A 1W0KD 2GAAA 4FMCB 2QTVB 4HLUC 2IHYA 4LJ4A 4NCHA 1OYYA 3U2QA 1FP6A 1UBCA 1K5GA 4V0ME 5KO2A 2A7QA 4Q02A 4URYR 5KDDA 2J0QA 3FHCB 5ELXA 2NO1A 1KSHA 1IONA 2J41A 4ESVA 2QUZA 4JSYA 1WE2A 4C0QC 4I1SA 1G8PA 4Q21A 5B2ZA 5LD2B 3GQBA 3TVDA 1JI0A 4URWR 4BLPA 3UWOA 4F92B 2PCJA 1SVWA 3IPXA 3FTQA 4IOLA 3IO5A 4ZIRA 4EPTA 3RRNA 4JVSB 3VU9B 3QVVA 3E70C 3PV0A 4BFZA 5JWHA 3EIQA 3K0FA 1RIFA 2PZGA 4XIGS 3I5YA 2GCOB 2ZITA 1ODFA 3MUFA 1KO5A 1TTTA 3W3ZB 1ZNWA 4PHTA 2Q3HA 2WAXA 2BJWA 4TQAA 1ZINA 2JLSA 4PHFA 4E22A 2O8BB 2FJUA 2ODBA 5DISB 2Q21A 3HU3A 4M0LA 4Q4HB 1U8ZA 3BERA 1UEIA 4NE2A 3MD0A 3CZPA 2XSZD 1ZVQA 2DFLA 4PC7A 3J81k 4H1UA 4KBFA 4CYMA 2WWHA 4NL4H 2ZJ8A 4U5XA 4EJSA 5IDVA 3QF4A 1T4GA 3RSLA 2WWYA 4GP7A 4Q47A 1TQDA 3EIHA 1P62B 4IDHA 2O8FA 4V0MA 4MA4A 1YZUA 4A6XA 3OEED 2RMKA 1RZ3A 1GNRA 1JR3E 2X77A 4I4LA 1D5CA 1S0UA 4I1UA 1OXVA 4NYJQ 3ZVNA 2ZUBA 4P4TA 1YZQA 5LBIA 4W5JA 1ZD8A 4RZXA 1N25A 1ZP6A 3WMGA 5KSOA 4A92A 2ZRNA 4TSFD 5BXQC 4Z1MD 3FFBA 5FL7A 1NG9A 3PEUA 2D4HA 3TJZA 2QMOA 2H1LA 1XTRA 2ZE8A 4RFVA 1YR8A 4QNMA 4PXAA 3MSXA 2GWHA 4Q66C 2HLDD 4BZQA 2VA8A 2IL1A 1ZCBA 3KXIA 5FL3A 4YMUA 4Q7MB 3UG6A 1CU1A 1XBTA 1ZNZA 4JLAA 4B3GA 2FN4A 2IS1A 3BFVA 2PX3A 4URXR 2Z83A 3QQ5A 1ZM2A 2HCBA 5FUVA 4UXIA 4TWZA 4A82A 1F3OA 1KJWA 2PEYA 2BMDA 3IQWA 3OAAD 2J7PD 1NLYA 2R6FA 1R10A 1WMSA 2V4ZA 2RHMA 1YZKA 4OQNA 5TV2A 2NZ8A 4OK3A 2AR7A 2O52A 2ZRIA 2ZR9A 1NKTA 3U7FB 5JEEA 1RPZA 3QJYA 5CIWA 2H16A 4CEJA 2ORIA 2G88A 1DS6A 1UDXA 1HY3A 1MABB 1OV4A 4JJZA 3X1XA 4C0HA 4CEIB 4TTQA 1SVMA 1JR3A 5TARA 3SU8A 1I2MA 1P2SA 2PLFA 3UMRA 4A2QA 4G5QA 1QHNA 1Z6TA 3AKYA 2BMJA 1O87A 3AP1A 1UBFA 4KU4A 1E2LA 3NG1A 4LHZA 3GEEA 3AF2A 2FSFA 3NH6A 4LCBA 4Y0VA 1A1VA 1U8AA 2RHDA 3W5JA 2HXSA 2B21A 2BM0A 3A6PC 2OCYC 621PA 5AJWA 2GZAA 2OM2A 2ZSAA 4CT5A 3K70C 4L9WA 1PZNA 4HAZA 1CRPA 2OXCA 3ZLJA 1IBRA 4A8JB 4EPYA 1DBSA 3CM0A 4GRAA 2PH1A 3DZDA 2GJSA 3G5UA 4DEXA 4A15A 4KODA 2ZYVX 4M1YA 2XTMA 4DLVA 4X8LA 1ZD9A 1XEXB 3L82B 4E07A 3MCAA 5FBWB 1WF3A 1F60A 4QJ5A 2WJIA 3TSWA 5CIQA 4M8NE 2W00A 2Z4RA 2ZJBA 5LD2C 2ZSDA 1OKKA 4NZYA 1TNDA 2HEIA 2AFHE 2CLSA 5HKKA 2H17A 4HLUA 2XOKD 4HB3A 4KFRA 3ZVLA 2NMVA 2UVQA 3DMNA 3QKRA 4Q4JA 2AWOA 3GFTA 5FUWA 4US2R 1N6LA 4M9ZA 5JI2E 1C9KA 1BYUA 2J7KA 1KI3A 1T0HB 3GD7A 1EGAA 1YR9A 1YZNA 3U4QB 4M22A 2NO6A 2OXRA 4XH9B 4HYYA 1CR0A 1J7KA 2ECKA 2RGAA 3DM9B 3QXJA 4JLBA 3SNHA 2CCKA 1FMJA 4LPSA 4M1MA 4HB4A 4TZ6A 1EX7A 1YKSA 2O8EB 1EFRA 2DYKA 4BFTA 2ONJA 2OBMA 1OFHA 2IS2A 4TN1A 3E2IA 2VHUA 3QG1A 4A2PA 1Z0DA 1SKYE 1GVNB 4URZR 2BVNA 3OIVA 1II9A 1OIXA 1RRPA 4YC7A 4EFNA 1RYHA 2PEZA 2IUUA 4A6PA 1R2QA 8OHMA 3BAFA 4MQBA 3U44B 1IN5A 4IXMA 1EWRA 4HUTA 2W2TA 1FP7A 4IFBA 5EP3A 3PENA 4EPXA 2ZE7A 1SHZA 4QHYA 3CR7A 4DLRA 1CP2A 1YE8A 2R6CA 4QC2A 3HR7A 2A78A 3A4LA 4E03A 2HV8A 4MYCA 1AK2A 4UNSA 2FFAA 3VR1A 1E32A 5JEDA 3SR0A 5FTMA 5J4KA 1XPRA 1SQ5A 2MMGA 2ZRJA 1MO6A 5CLQA 3BIFA 3I8SA 3NVAA 3L0PA 2PJRA 4WVFA 2OCPA 4UNPA 3RHFA 3GJXC 2LCFA 3B9QA 4ESHA 4P4SB 3KKPA 2G9NA 1G17A 2F43A 4M2LA 4D0GA 1U94A 3K1JA 2VL7A 4NH0A 1GM5A 2WJYA 2GILA 2ZVQX 4QL3A 4JT2A 1KO4A 2RGGA 3IHLA 3WYGA 1D2MA 2IYLD 3VQTA 4XTRA 1HTWA 5JS8A 5AR1A 4A0HA 4JS0A 3VR6A 4LC1A 2KSQA 2A5DA 2YWHA 1J90A 3DOFA 4G5GA 4XVRA 3LWNA 4LC0A 421PA 4OI0A 3RRMA 2GBLC 1G64A 2HT1A 1BS1A 1Q1QA 4B6FA 2QMHA 3TH5A 2GK6A 4JLJA 4F38A 3LD9A 3NHAA 3FKSA 1S1MA 1NNEA 3I61A 1G5TA 1KI9A 2XITA 1QRAA 5E95A 5E3HA 3AVTA 2O8CB 3LA6A 4P31A 4Q9LA 1QHIA 4LDJA 3CB4A 4FIDA 1HQCA 2BOVA 1Z0FA 2BM1A 3PR1A 4OKSA 3HU1A 1TF5A 2JLUA 1ETUA 2HUPA 4GOJA 4RFSA 2KE5A 2RB4A 1Z08A 2AX4A 4OBEA 5D3QA 3VR4A 1JEDA 3GJ3A 1II0A 1OFIA 1E2EA 1FUKA 4DLWA 3L0IB 4UNNA 3T1QA 1A2KC 4A8JC 1SXJC 3ICQB 1JAIA 3KUDA 3MJRA 3GLGA 1YZTA 1KOFA 1G5RA 2X2EA 3CRMA 2CHVA 2QAGB 2OSBA 4TLBA 1DO0A 2VYFA 2ZVPX 1W2HA 4AIIA 2RKOA 2QN6A 2RGXA 1NVVQ 1QF9A 1G8FA 2FFBA 3F3YA 4HATA 1S3SA 4QM7A 1AIPA 4ILEA 3RWMB 3WY9A 1X3SA 5BYJA 1YR6A 1VYTA 3CWQA 1G9XA 3A1SA 4C0AC 4MRSA 4AWXA 2AKAB 1NIPA 4JBWA 4Q7LA 1D2EA 2IYQA 3FKQA 4HB0A 5FOSA 3U7EB 5HR5A 3GLIB 1G3QA 2ZYWX 4RVCA 3WRYC 2FSGA 2OFWA 1E99A 2PT5A 2YWGA 3Q72A 1G3IA 3VU9A 1TUIA 2FX3A 4QFMA 4B48A 3PCRB 3PUWA 5FFMA 2BBOA 3WHKA 2HF9A 2B7CA 5JRZA 4DXAA 3CF2A 3UMFA 3CPJB 3BWDD 3IIJA 4DIEA 1EXMA 1G6HA 4OJQA 1WB9A 4BECA 2VHCA 4PPQA 4IRUB 3EC1A 2EW1A 2O8BA 2GCPA 4G5RA 1RC8A 2XTNA 4MRNA 4Q4HA 1DOAA 2ZANA 5LB4A 2SHKA 1NVUQ 2J0SA 2CE2X 2JJ2D 3EX7C 1J70A 4KYIB 1GFIA 2GRJA 2O0KA 2XNDA 3MG9A 4WZ6A 4KSCA 2NPFA 5HTKA 2ZRPA 2EFDB 1NLFA 1W4CA 3CX8A 4BFXA 1MV5A 2D7DA 4M21A 3CZQA 1KI6B 1SULA 5DI3B 3GJ4A 1XZPA 3U3RA 1NI3A 2RCNA 1F2TA 1C4OA 3NH9A 1P72A 4RD0A 2OV2A 4BRWA 2WJJA 3SOPA 2KI5A 1CJMA 3NBZC 4W9MC 1A2BA 4YDSA 4DLYA 1DELA 3QENA 1ONBA 1NJGA 2V9PA 4BLOA 1L7VC 3H84A 1E9RA 3CX6A 5ANRB 1Q20A 5IK2D 4B6EA 1E9DA 1XMSA 3AKEA 5J4HA 2D74A 2C8VA 2V3CC 3QIAA 4D26A 1S96A 2PX0A 1G7RA 2OLKA 2F3TA 4WBSA 5IRCD 1CJTC 1JPJA 1OFTA 5EZ6B 2P3SA 1XB2A 1SXJE 2RGDA 3CRRA 4L8GA 4KVAA 2X2FA 5DGXA 4M53A 2Z5FA 4QJ3A 3HWSA 4MDFA 2PL3A 4MITA 3FHOA 4NBSA 3ADDA 2DFTA 1GAJA 4PC1A 2QQEA 3ZYCA 3IKJA 5BN5A 1W0JD 4XVQA 4TL7A 5CDFE 1ZU4A 2BKEA 2GJ9A 4M9XA 4KITB 4F4IA 5FR2A 4C30A 3CWZA 2AXNA 3RAPR 5IT5A 3AVUA 1S2MA 1SVSA 2WPDD 1T5IA 1Q22A 2GBLA 2ZRGA 1Z6AA 2JJ1D 4MRRA 3I73A 3AUYA 1W36D 2N42A 4DUGD 1J8YF 4CGZA 1MABA 2PBRA 3PEVA 2IA5A 4TL6A 4CEIA 5B57C 2N1BA 2IYSA 4OI4A 1WQ1R 1HEIA 4BASA 4CT4B 5DN6A 4B2LA 5CK4A 1JAHA 4LSGA 3TMKA 3NIBA 1FQKA 2ATVA 1UEJA 5FR1A 5FPKA 3NC0C 2B7BA 1IN6A 1H8ED 5DE3A 2VP4A 4A4DA 2QAGC 3UWKA 2OO7A 5EE5B 4ZKDA 3FHTA 2FG5A 1OHHD 4QG7A 4NYIQ 1XD2B 2DPXA 3UPUA 3UXMA 4TL9A 3KKOA 3Q5EA 1E1QA 5L3RA 4NCNA 2IHBA 5L3SB 5KUTA 4DEYA 2XTZA 4A8JA 3I1FA 4AURA 1SXJA 2Z43A 3TE6A 3K9NA 5F3WB 3NKVA 3RS4A 2ZI9A 2PCLA 4WZAE 1Z8FA 2WJGA 1XEXA 3M1IA 4FINA 2ODWA 4D2IA 1UF9A 1E4YA 1SZPA 2C95A 5SZKB 1Z06A 5FTJA 4IEEA 5EE3A 5JWRA 1GRNA 3UIEA 1E9CA 1Q1BA 5CDFA 3GLHB 3Q8XB 3B13B 1DAGA 3FGNA 1KJYA 1R0WA 3AVPA 1KO8A 1E9AA 4LYJA 3T5GA 1DAHA 4XSGA 2OILA 1VG8A 3WMFA 1OW3B 4OK5A 4NP6A 5H1YA 3RNLA 2VP6A 3LNCA 3TUZC 3U4QA 1KSFX 2IYZA 2C04A 1L8QA 2NIPA 3QNUA 2OE2A 4Q18A 4AKEA 1QZXA 3D31A 4DSOA 5FOWA 2RGNA 2WIAA 2TMKA 4TMTA 1LFDB 3B85A 1P2TA 1COWD 2F1RA 2JIZA 3UKDA 4BFYA 4Z54A 1GKIA 2HYDA 4AKGA 1Z47A 2O8EA 4MRVA 2P67A 1JJ7A 3HP1A 3TUIC 1KY3A 2JASA 3LLUA 3LO5A 1FX0B 4NHOA 1W5SA 4C0JA 2IXEA 3WBJA 3MMPA 4K81B 2GESA 4JVNA 5GJBA 3KQNA 4NYJR 1M6NA 3W8NA 4I1OA 4PPNA 3MWYW 2CK3A 2BDTA 2CVFA 2GVDC 3W6PA 2YHSA 3LY5A 2WKQA 1ZAKA 5KSYA 1BYIA 2ZRHA 2CL0X 2W6JD 4HLDA 1G21E 4DVGA 1HA3A 3LXXA 5FOUA 3GLFB 1Q21A 2ZQ5A 4LYFA 2RAPA 2OG2A 1JQLB 3TNFA 1NY6A 1EX6A 1R5BA 3M6AA 1C1YA 4UXHA 1AM4D 4QHSA 4RZ2A 5K8UA 4LJ8A 1YRAA 4KYUA 1J99A 1AQYA 2OFXA 4B44A 1LW7A 2G0NA 4P4SA 2V6IA 2BEJA 4HAUA 3A36A 1EWQA 2QM8A 3BH6A 4TYWA 5EQTA 2QNRA 2KWIA 2I1VB 1WBBA 1Z6YA 2P6NA 1AS0A 5B64A 2FU5C 4M9SA 5IHPA 1E2IA 1SHKA 3AF1A 5DIFA 4B73A 3DOEA 2QSZA 4GT1A 5AK0A 3GP8A 5K8LA 3EG5A 1GDDA 4TL8A 1CF4A 1FW6A 3QKSA 4WIAA 4KCGA 4Q1BA 5KYKA 2IYXA 2OESA 1X1SA 4FXPA 1LF5A 1NMYA 3KB1A 3K9GA 4HDCA 3U3KA 1XMIA 2OEPA 4Q5IA 4DBLC 5GVSA 1XTQA 2QSYA 1P7CA 2WM9B 1II8A 2FEOA 3NBXX 1ZM9A 2VF7A 4HAYA 4WW0A 4WXRA 4IXNA 4EFMA 2F55A 3P4YA 2ZJOA 2P5TB 3ZD6A 2J5XA 2O8CA 3KJHA 2W0SA 2YZ2A 2QTFA 1JXOA 1MRSA 1NBME 2ZROA 2JLWA 1BKDR 2GF9A 4AC9A 1IQPA 4Q01A 2ZSEA 1KSGA 4BPBA 3HJNA 5A4JA 1VECA 2EVWX 3LVRE 4YDHB 4ACAA 2GEDA 4QKQA 3K0EA 1G5PA 3K53A 1R5NA 1VHTA 3OZXA 4QJ4A 2WICA 5FPHA 1Q57A 1S1CA 1KMQA 1WXQA 3QXSA 4TMZA 2QP4A 3U6BA 2QAGA 1Z0IA 2W6ID 4QGGA 2OZEA 1LS6A 3VHXA 1OLOA 3AF0A 1Z2AA 3TW8B 4OJKA 3TIFA 3BK7A 2A2ZA 2JA1A 2CLCX 1HT1E 4GZMA 3BJIC 4MKGA 4N1AA 5FOTA 1DAEA 5L8VA 5KOYA 5TVKA 3IEUA 4Q03A 3FMFA 1M7BA 3A37A 3SEAA 3MWJA 3GJ8A 4C7OA 1FTNA 4D82A 1XXHB 1G8HA 3VR3A 5CM9C 4XD7D 2QP3A 3WRXC 3EZ6A 4WA7A 4Z51A 3VNUA 3TUJC 1R7RA 3EZ2A 2ZU6A 1IXSB 1OT3A 3O8DA 1W4RA 4YMSA 2FDCA 4B47A 2ZYUX 1PUJA 1X8KA 2ZRFA 4LHVA 1LY1A 4ITRC 3ZIAA 5EXXA 1TL7C 2ZI6A 1NBMA 3SFZA 3TKLA 1CKEA 1DAFA 2VRWA 1W0JA 1GTVA 1ZU5A 2G0TA 3B1WA 2IEYA 4GMDA 4D4MA 2YJTD 2CJWB 1E1RA 2DR3A 1R0XA 3KJIA 4DT1B 2FSIA 5TMPA 1OIWA 2BC9A 2ZRLA 5GJVC 1JECA 1QG4A 3HDTA 4YXWA 4FCVA 5JECA 4WZBE 5SZHB 1G7SA 3U3JA 1Z6GA 1NN1A 1RRFA 1H8HA 1DPFA 2OBNA 2ZTSA 4HAXA 1Z0KA 3CX7A 5FUXA 5K8IA 4JLOA 4TMVA 4Q1AA 1S9DA 4PQFA 1E9EA 1DAMA 3R9XA 1KI6A 1D8TA 5KNDA 4C2TA 5DI3A 3K0AB 2ZS7A 1SVLA 3PG5A 5KDOA 3KUCA 1AQUA 3B2EA 4RD1A 4RCZA 3TAUA 3EXAA 2W2XA 2D2FA 2E87A 4PSVA 2A30A 4GOKA 1OJLA 2ZPTX 4JIMA 3SJCA 3SZRA 1SVKA 4U02A 3VFDA 2W58A 5CYPA 4GPTA 1KDPA 1GNQA 3QKUA 5KPDA 2XNSA 1Z28A 3PIRA 3PUXA 4EQ6A 1VTKA 4LHYA 2DWOA 3MLEA 3AM1A 2WJHA 4KJZA 3THWB 1B23P 4ACBA 3EASA 1KDRA 2C9OA 2EYUA 3DVLA 4IFEA 2V7QD 3B78A 5E4FA 3QPUA 2FNAA 1N5IA
chains in the Genus database with same CATH superfamily
1X3LA 4H4CA 3PVCA 4Q48A 5J4YA 2YZ7A 3IUJA 3IVXA 4ZU3A 4J1SA 1TUEA 2WKSA 1CQZA 2QX8A 1PLJA 3SEQA 2EJCA 3B1KA 1LJLA 1BCRA 2EZUA 2N0SA 2XZTA 3LQFA 3Q7TA 4IIGA 1VHDA 3T9BA 3K0SA 4Q39A 3SZLA 3DEFA 1QR6A 3C8DA 3VR2D 4PSAA 2PXAA 4ODIA 3EZYA 3PJRA 4JUIA 2C07A 3HCFA 1A7UA 1CY7A 1NFQA 4KQ9A 5DJ5A 4YN3A 4OQQA 3OLZA 2Q7XA 2ZR7A 2GA8A 1RWQA 1WQ4A 1FSZA 1NNSA 1NF9A 1PEKE 2C9YA 3N07A 4LTMA 4QLAA 1P5FA 3AQ4A 3EAFA 4LJ6A 1U5AA 4EI8A 5L4LA 1NURA 5FB3A 5TF0A 1F0KA 2Y68A 3GHYA 4QSMA 3U48A 1FXWF 5LJLA 3Q8MA 4OBXA 4L4YA 4B3DA 3E1SA 4C4ZA 1JHUA 4E21A 1JSCA 1DQYA 1EDZA 5AXBA 5TNXA 3WIEA 5ED4A 4Z3OA 1V3TA 2YWFA 3AKCA 3WAJA 3L02A 5GGYA 2I3AA 1VI2A 2DFNA 3EIEA 3KVVA 3S2SA 5I9IA 2XHEA 3REQB 1CS4C 4RAOA 3LQ2A 2QRJA 4ZVLA 4JBHA 1WD5A 1X7ZB 1S2GA 4BEWA 3HZOA 4KEAA 3VHRA 4WNAA 2I54A 4U2KA 1M7GA 3OETA 8AT1A 3DZFA 3EJ6A 1T36A 3FSJX 1LXCA 2Q5LA 4K6GA 4AP9A 5AIBA 3DZGA 1ZCZA 3D2AA 1N6OA 3OM1A 3RG8A 2YIVX 4V0SA 2IZ1A 5HHTA 3UICA 1RWKA 1Z5GA 3PQ3A 2HPVA 4MKHA 4V3CA 5L3SA 1GZ4A 3I01A 3K96A 5IWAB 1G8KA 4K86A 4R40A 1E9SA 2AVDA 4F2HA 5LQRA 3BWBA 3ITEA 2DC1A 3HPQA 1X0VA 2YL2A 4FPXA 4P8RA 1Z6ZA 1T6NA 4FDAA 3WWYA 2DKOA 1PZHA 2IIQA 3MTBA 3OE7D 5E4JA 4TN5A 4UEJA 5KNCA 2QRZA 1NVWQ 3DEZA 3PNSA 1RYDA 4D4JA 5ENVA 3N2EA 1X1QA 2CUKA 4J1NA 4RD6A 4RHTA 5F33A 2F3SA 2P8SA 4L0DA 4LOLA 3IP5A 4AQDA 4DLBA 4YT4A 1H65A 2WYHA 3TZ6A 2VA9A 3WMEA 4F3KA 4UM9B 4HDRA 2JATA 1RI3A 1TU4A 2GDZA 2HMVA 4GMGA 1L3BA 1QGED 5AM0A 2LCIA 4K9LA 4YAIA 5ABPA 1DCKA 2C4NA 3N2IA 5CVUA 1SK9A 2ENUA 2PV0A 2HWUA 1V95A 3LHKA 4L51A 4LJ7A 2L17A 5AJYA 3ZQ4A 1MNAA 4UBJA 3B1YA 3F78A 1T91A 4I08A 2P3QA 1ZD4A 2Q3EA 5IYZA 4WEOA 5EIEA 3KB8A 4PIVA 3WMXA 3ONNA 4LAFA 2R97A 1C4KA 3RRZA 1CQIA 1KR5A 1MJFA 1J97A 4HXEB 1LA2A 2CV2A 2K7ZA 4Z4EA 2BFEB 3W04A 5G1OA 4EGCB 1G3MA 5T5QA 4MVJM 1OH5A 1A82A 3NZEA 1ZK0A 1F6DA 2CL7X 3AESA 3H9CA 3Q5GA 2Q6IA 4NQRA 4YTEA 3STYA 3TBFA 3NNSA 4CQJA 2ZIVB 3CJRA 2HEGA 3MOSA 2CHEA 2WNSA 3QMPA 1FVHA 4I81A 4ESOA 3DLTA 3JY6A 4O4IF 1P75A 3G7NA 1BKYA 3LDHA 3QK7A 4YDRA 5FCDA 2CLDX 2G06A 1K7EB 1MPTA 1WW2A 2JFOA 1Q1NA 1G4HA 1TKAA 3D6HA 5AKHA 3OCUA 4OQMA 3EZNA 3B36A 5G53C 5CX4A 5C8YB 1DAIA 5AI8A 1MOSA 5GV8A 5J1SB 5FBQB 3RD5A 4CLEA 1DQSA 4PU0A 4CKWA 3HCDA 1QJ4A 4PYJA 2J09A 3PHLA 1V5EA 4ZN6A 1Y3IA 5BXYA 4BDSA 1K86A 3QXGA 1UBHS 4MUEA 2C7QA 3A6FA 2V7WA 2WB4A 1M66A 2C5EA 1GFSA 3N0WA 2GCNA 3GPIA 4JLVA 1KEZA 1RBMA 1FP4B 4V0OA 4Z9YA 2OORA 3F3SA 1TMKA 4TMKA 3ZNQA 7REQA 1C3OA 4HNHA 3RS5A 1PAUA 4OIFA 5CTJA 3TXYA 4Q3AA 1IXRC 1GSIA 2OL4A 2XVMA 1SHLA 4BV8A 5KJ6A 4UM9D 5C7IO 1BVHA 1Z4KA 4ER3A 3D1LA 3IP6A 2WSIA 3EGIA 4ZVNA 4ZDKA 2Y71A 3Q6IA 1CY2A 4H7EA 1LTKA 1DC5A 5DASA 3LLVA 5CNJA 4E5KA 3FCOA 2NUTB 5LMZA 2BFDB 1WXFA 3PGKA 2W11A 1MVLA 4HRXA 3F7TA 4XGRA 2W48A 1WUYA 2IBMA 3IESA 1IZZA 1ZVKA 2VT3A 1N6IA 3HABA 3QH4A 3FI0A 4YRJA 4AJ9A 1I1QB 5EZYA 3WA6A 1WX1A 2DFKB 4IJMA 4OHXA 3VVBA 1V4BA 1YZVA 2QLTA 2JFWA 1DMSA 1I1NA 2YV1A 3MOGA 2D6FA 1ZXLA 1TRKA 1GQRA 5GOTA 3LT0A 1XHFA 2KJQA 4UUAA 4PXSA 2QSJA 1KPHA 1R0LA 3ONVA 2GM3A 1SZCA 3G0BA 1G6KA 4UU1A 1JG3A 1XD8A 2FUKA 2IY8A 4RK0A 1GJRA 4C89A 2DJIA 2WA1A 3MRVA 3BYZA 4JBXA 1A5SB 4JI2B 1Z33A 2BE7A 3BFJA 3OUTA 4NTZA 4F4UA 7GPBA 1LPAB 3O82A 4ZOBA 5IF3A 1JZTA 2XGMA 5CK5A 2QR5A 1ISMA 4C4OA 2C20A 2E0IA 4Q15A 1H2YA 2XNHA 3K94A 3PYLA 1KF0A 3H4VA 4IQFA 1H0HA 1OVGA 3DT9A 4G1EB 2HLDA 3EBPA 2CFCA 2HC9A 4TQUS 4UCWA 3RVQA 2WWFA 3NBQA 4R71A 4UOEA 1XWIA 2ZAMA 3IBFA 5EPOA 2JGIA 1HFJA 3RUPA 1LDEA 4OM7A 1NRJB 4CGYA 4DZZA 2CJPA 1UFVA 2I8AA 4MDHA 3FNFA 4BRSA 5CVDA 1R16A 1ZHOA 3ADCA 1KH1A 3QUCA 2F62A 3C3WA 3I6ZA 3E58A 4I46A 3SYTA 4MVJH 3SS9X 2QX7A 4G81A 5DBIA 4LHEA 4K7JA 3E3MA 1DRJA 2VTKA 4CZ2A 3F8SA 2FCRA 1X1EA 3ZZTA 1P60A 1BMFD 3G1UA 3CLVA 4HXYA 3ZHSA 1NUHA 1RJWA 3EZ7A 4RVUA 1ORWA 5CTAA 2HNKA 5CJ2A 3ASZA 5ITVA 3JVUA 3IT3A 4IMPA 1BHQ1 2QNBA 4LFCB 1TYEB 5JAUA 3ECAA 3I58A 4IF6A 5DHFA 5C46F 4ARUA 5I9NA 3EXHC 3NDBB 1JLLB 1HLGA 2XWQA 3MERA 2A4KA 4RKRA 4AN0A 2HSEA 2VVTA 2C4UA 2GXUA 2W6MA 1I24A 1H2HA 2CXRA 3JRWA 1CSEE 4MDEA 3P2KA 1F12A 4YO7A 3K6JA 3IA2A 3PI6A 1DXOA 5KQRA 1DP4A 4FGJA 3PYXA 3FTCA 2YDXA 4YJ2B 4MLPA 4GE3A 4L5AA 4OMDA 3GELA 2VT6A 3PA8A 1T6ZA 2ERXA 2BJVA 2JI6A 3M5CA 3SHVA 1NRWA 4H31A 3FNGA 2YZNA 2WKRA 4QBGB 1WHSB 3A4TA 1B8PA 2J3HA 2RH5A 3E53A 3RGGA 3SS7X 4BFVA 4K9MA 4XZ3A 3L1JA 1WTAA 1AMOA 1FDWA 1Q6YA 1U1EA 4GM1A 4YRPA 2LWIA 3G2QA 1L5WA 1YDFA 3PPIA 3LQ4A 5IKOA 4EZIA 1WVGA 2P40A 1E5LA 2YIDA 3V5NA 4C2UA 1DCMA 5C3UA 4YQFA 5DEIA 3FOZA 1M6EX 4FHDA 3UN1A 1VKJA 3WLRA 3UMSA 1QQAA 2EWWA 2J59A 5REQA 2E5WA 1O96B 3RUIA 1XU9A 4JOBA 3C5VA 3IKVA 1ATZA 3S7ZA 4E5MA 4RF3A 5HPYB 3DBLA 4MS4B 1JQEA 5DKFA 1SBIA 3UWMA 2H00A 2PUCA 3BKXA 5CHYA 1CNFA 1X13A 1ZJJA 2BM8A 5JHHB 5GJWC 3L8DA 2Y1XA 3QELA 5CVCA 1T8UA 2AIRA 1WKCA 5AJXA 5CXUA 1AS3A 1W76A 2AYXA 1CDOA 4U2BA 2I6XA 5I4IA 2FLWA 5BV7A 1NA5A 1WU8A 4KZPA 2BGWA 1CUYA 1P1KA 3D54D 2PLAA 3QE2A 4OGFA 1TAHA 2GAFA 2QT1A 2RH4A 5AOCA 4BX3A 4BOYA 4UPEA 1RW4A 3RFFA 5E4YA 1FTGA 1PR4A 4HMQA 4ZCLA 2PFSA 1UP6A 2QROA 1U9IC 1JNYA 2P7IA 5C9ZA 8ADHA 1ICEA 1ZH0A 2QPOA 1HYBA 3WBFA 2JGFA 4OKIA 2F4VB 2WP0A 1K3FA 3OUZA 2G5CA 2C3UA 1U9JA 5JLAA 3ZQJA 3HI4A 3L79A 1PVOA 3K72B 5CLFA 2IU3A 2H4ZA 4YHBA 2J8ZA 4INZA 1JQ5A 3A7EA 1BXGB 4UTPA 4KLAA 5LIRA 1TVCA 1A7AA 4KO1S 1BX3A 2WJAA 4YJDA 5AICA 5LDGA 2MYTA 2QPTA 4JXKA 1F51E 3FUWA 3SJBA 5TJHA 2YRXA 3CNHA 1ZJZA 3QMWA 1OWOA 4GDFA 1BN6A 2ROQA 3NHRA 4DB4A 4G86A 3R0XA 3RSFA 2FW6A 1RWPA 1DFHA 2ID4A 1JN0A 2D59A 4MYSA 3UJHA 4KVZA 2IZZA 1TYAE 1D2CA 2PS0A 2QQGA 3PT5A 3TQRA 3FPSA 1B6GA 2GBPA 2V59A 3BSFA 5FD8A 1DCTA 4WXHA 4JB3A 2F7SA 4EHNA 3DEKA 2OD9A 2Y1WA 4O02B 4HDAA 4MCHA 4DKXA 1DUVG 5BP7A 2WLTA 3VMFA 3JU3A 4R2JA 2PT6A 2GI4A 2JH9A 3VU8A 3DEHA 3M6IA 4OMFG 4DWJA 1N2EA 3H8JA 4FS3A 4GQBA 4L72A 2P6PA 4P22A 3LZ6A 5BW5A 4OXKA 5H3LA 3NIWA 2J9GA 2WYVA 2H7YA 1GL7A 3CRVA 4KDRA 1CUAA 3NC4A 1U7UA 3IOBA 4I3GA 4X94A 4QDTA 2O5EA 1DRVA 1PUXA 3K6SB 1BFKA 1EQAA 3MM4A 4DOMA 4EMSA 1QYVA 1NY5A 5KOJA 3BMOB 1QTNA 2XWPA 1P73A 3OEYA 1X1CA 1CYEA 5ERXA 5B37A 4EP1A 4KXVA 1D07A 4IIVA 3EGEA 4RIEA 3WLHA 1P2BA 3EGOA 3FCXA 4ALIA 3CO0S 5IH7A 2EFHB 3KFXA 2IELA 4FB5A 1ILEA 3CUEF 1WXIA 3IJPA 3FOEC 4Y6PA 4N7RA 3OZCA 4B35A 1KMHB 4LXIA 1RLMA 3H1GA 4HF7A 5LSAA 1F3LA 2CEAA 5AMXA 3H6HA 1E2BA 3AP2A 3AHHA 3UT5B 2V6GA 2EFEB 3MINA 1E9FA 1G2QA 5DMHA 5BMVF 5KSZA 3M3PA 3RTCA 3QBVA 5KB3A 2VBCA 5JQGF 1RQ7A 5CLHA 5G3YA 2FI1A 4P32A 3VZPA 5HF9A 3RYCB 3BWCA 3QLTA 3EC2A 2JFUA 3W6ZA 2BBSA 1G8YA 1H0KA 4XAQA 2FQWA 4LYGA 1JR3D 1JF8A 2G4CA 1ZEMA 4ERNA 4ND1A 5LPNA 4EB3A 2BFFB 2R8OA 3E22B 2OR3A 2RHOA 4LY9A 5JJBA 1MJNA 2XNCA 2I4LA 3R24A 5IAOA 4MGIR 3CUSA 1DT5A 3EXHA 1HYEA 3FKJA 4JLWA 3JQPA 3WWOA 1RPTA 1KYYA 2BAGA 4B6PA 3KETA 1OH7A 4FSDA 3HYNA 4I3FA 5LCXA 4B83A 2WKPA 3FRIA 2F6RA 2VHTA 4DIMA 1L9XA 4R9VA 3OZGA 1NJ2A 4G9EA 4KH0A 3JCZA 1ML4A 1BHO1 4KVFA 4QTXA 2XIJA 5K3CA 3L7DA 4UM5A 4BMCA 1P4GA 1YZYA 2X0JA 4W7HA 4DRXB 1I3KA 3PGLA 3EK2A 4M8KA 2C7GA 4B71A 1N8SA 4WFQA 1ZI9A 3FYTA 1DTSA 3VDMA 2WFLB 4I9NA 3G9TA 2VSYA 1G2PA 2J1LA 3GEDA 4XYEA 3T8YA 3NORA 4IGEA 4Q9IA 1YE5A 3EGDB 4EGAA 3AR6A 3FUVA 4I1YA 5TY0A 4FYVA 4KO2S 5DM60 3UPTA 5CM8B 1Z2CA 1C7QA 3WVNA 4PX3A 4CTNA 5MDHA 2HLPA 4RF5A 4KWHA 1NF2A 1FDVA 1TF7A 4WBNF 3SKYA 2EOAA 3SK0A 3K9CA 1CEEA 1DXQA 5GWXA 5A5GA 3LSTA 3V4ZA 1P5ZB 2ZWAA 1POWA 4NBWA 2QN2A 3FMGA 3EFHA 4M88A 1XYVA 2ZBGA 4PW0A 1QVAA 3MAAC 4XR9A 2GOYA 4KMMA 1NTOA 1K7CA 2W4QA 2VSXA 1XLTC 5EGNA 3ZCXA 5KPJA 3F5FA 1L7DA 4DR1B 4YJ3F 4NXNB 1D0IA 2OV4A 3C6QA 1E60A 3PE6A 4C05A 4X54A 3JWGA 2JGRA 1X42A 4FWTA 4Q37A 4MWZA 4OG2A 5CB0A 2VHQA 4PO9A 2WF6A 1R50A 2VF5X 1BCSB 3PD1A 4R5MA 4BV9A 2BR4A 2VKTA 2O48X 2RBKA 1MXHA 2QTGA 4JC4A 3VGJA 2X3YA 4B6SA 3I4LA 1EHIA 5HDQA 1E3SA 2BHRA 2XBMA 1FZTA 1NSFA 3I6QA 3V4PB 4V2UA 3W05A 3EZ9A 4HI0E 2G9VA 4I9FA 4ALKA 4MVJI 3FMOB 3EPKA 2FWMX 4DLUA 2WM2A 1AV7A 3UM9A 4CIAA 1U9IA 4P1ZA 4DQXA 3I72A 2XQGA 3OZFA 1JQBA 1N7IA 1QDLB 4U6NA 5E7MA 2GETA 4A6DA 4F9EA 3DYIA 2I4TA 1XRJA 1QQ5A 2JJ2A 3PWTA 1A9XB 3DXFA 1P19A 1TMOA 1PFQA 4V24A 1GADO 3IAM6 4KLZA 1UC4B 5LZ7A 3AY6A 2GTPA 1UKYA 2Z6VA 4LMBA 1XU7A 3V4LA 5EJGA 3GLUA 4C0XA 2ZJ4A 3OM0A 1NVXQ 2PX5A 4J9UE 3H8SA 2Q6KA 5HFNA 3U9TA 2P8JA 4X6LA 5ECYA 5F7OA 4DV7B 2IYRA 3C1UA 3LW7A 3RV3A 4GLFA 4KI7A 2WAYA 1DGQA 5I9BA 1DG3A 1BXRA 3OBBA 2DFPA 3V8EA 3K70B 4A1FA 1BIFA 3QFFA 2NZWA 3EHEA 3CH5A 2O7RA 2WHPB 1I3OA 4HEQA 1OZGA 2GEVA 3P52A 3DOOA 3DDSA 3MMNA 4GOMD 2WG2A 3G0HA 1J2UA 3QBJA 2NU9B 4NOJA 3ZWBA 2JPDA 4RENA 3N8IA 2IYTA 4RMGA 5KCZA 4KTTE 4BS9A 5H7XA 3U17A 4ZJUA 2BIFA 4RMJA 5AUNB 3RC3A 1EFPA 2V7EA 2Y3IA 1MVOA 1CULC 2PKYX 2ZUDA 1W59A 3FNIA 4L7QA 4P93A 5KQPA 2AL7A 2JKVA 1GAEO 2B5WA 1U1CA 2IKSA 1U3TA 1FRVA 2DHCA 3P27A 4KO4S 3A3NA 4G0NA 4OTZA 4IOJA 4TSRA 3DMYA 1EUCB 3LF2A 3KALA 4F3CA 3G0DA 1YFKA 4EG0A 2GN9A 3KQHA 1AKRA 2F3RA 2GJKA 2WEKA 1V71A 2Z3VA 3Q5DA 5FOXA 4FFBB 3U81A 1IK6A 5ES4B 1GN8A 3PXBA 4QOFA 3S8EA 5CPFA 2C98A 2V7XA 3ROTA 4JOSA 4QUBA 2I78A 4WCVA 1QIEA 3RS8A 1PEDA 5C80A 4P0QB 1WWKA 5K0SA 3PP8A 3LHSA 4HYEA 1DL5A 8MHTA 1C8LA 1WUKS 4HLCA 3PFGA 2QYHA 4FYJA 1DV1A 2I7TA 2EG9A 1ONNA 3H2YA 4NMHA 4NBLA 4DCNA 3RH0A 4N9QA 4CQLB 1ACLA 3T7JA 3DULA 1IXYA 1NW8A 2Z8YM 4QREA 2BFMA 4PX5A 3S44A 2DM6A 5DNCA 2PLRA 5JNVA 1YMUA 3RU9A 3SLKA 4DUGA 5KTTA 2FR1A 3KTAB 4AYWA 5JZVA 4AYTA 3PDHA 3B8HA 1LU9A 2C29D 4KACA 1SCQA 4DC9A 1YS6A 2Q5HA 2KBEA 2NO9A 2O07A 2Y1GA 2WBLC 4IMJB 4A03A 3MS4A 4K9NA 1V5GA 3T1NA 4FOTA 4RTOA 2H2GA 1TI7A 4EFDA 2QN9A 3TB4A 4LV6A 2WD8A 4R98A 3FMIA 3CUYA 2JAUA 3IAUA 1YR7A 1F2TB 5JCJD 1OLUA 1OH6A 2PD4A 2XQJA 1QYXA 2FDXA 2XNKA 5EP2A 1Z0UA 1OHHA 2OHXA 4QPDA 4BCDA 1U4NA 4XGQA 1K6JA 2WWWA 1WPXA 2G28A 2HFJA 3H6GA 3PFBA 4QPPA 4NU6A 3WNVA 1G16A 1H42A 2Q5OA 4K46A 4MVJD 3SJAA 3K70D 2YV2A 1E59A 1NDHA 1U8TA 2EJVA 3G3EA 4PBRA 4QSHA 4EPVA 1ISSA 2O06A 5B5SA 1MH1A 2BCJQ 1EXWA 1J5XA 4B3TB 1EK1A 2QG9A 1Y6GA 1BW9B 1K9VF 2FGJA 3RSOA 4D8WA 2OV3A 3H5TA 3CY6A 4S1TA 5DBOA 2HIGA 4MYRA 4IXDA 1RAEA 4PQYA 3ISVA 3NQ41 3ABZA 5BN1A 3L8HA 1GTJ1 1N5KA 1XCGB 1XGKA 3IQGX 3M2TA 3E05A 4RKEA 1GOTA 4IL5A 5BN4A 2JGLA 3C85A 4XOUA 5CDUA 1ZCAA 3BMCB 1VB3A 4WMLA 3OBIA 4FZJA 1U0HC 2YH2A 1U0NA 4POAA 3ZHYA 4WJLA 4DHEA 2BPOA 1ORTA 1XWFA 3L0OA 4BNFA 2YNMC 3H1TA 4ML3A 3R4VA 5DZSA 2N47A 4ETMA 5E1OA 2NW6A 3I4FA 3GI1A 4FOLA 1HE5A 1PP4A 4GE0A 4BMPB 2VPTA 4LFAB 1ZYUA 2IXDA 2JHGA 3O8BA 5ESDA 5I7AA 4IIYA 3HMKA 1XPUA 2WU4A 3GG9A 3HA7A 1IZ7A 2IPXA 1L6IA 1XLTA 1RQPA 4LCJA 4YAJA 4AJ1A 3L8FA 1UK7A 2K4MA 4LMAA 2IPLA 1USIA 2W9XA 5TT0A 4B2IA 2J6BA 1FSPA 3I6IA 3O1HB 4RWZA 2C9ZA 3RS3A 1QSGA 3FSGD 3FYUC 2DPGA 4OL0A 4ARZA 2ILTA 2O2EA 5JAZA 1GXSA 2FSPA 3GJZA 4LPKA 1RMQA 4RA9B 4WXPA 3UC9A 3WYFA 3KE8A 4PTLA 1YIOA 3GVXA 4IBOA 4HWPA 3E3LA 3CZ9A 4LF8B 5J5CA 3NC1C 4PANA 1TO6A 4Q7JB 5A71A 2PX2A 4L07A 2FZVA 3BFXA 5ECGC 1AK9A 3PWKA 4YJFB 2PSDA 5G0VA 5AXCA 4D43A 3VDQA 5K2OA 4UJ5A 3QVWA 4HNAB 2W2VA 1ZUNA 3WNDA 3B48A 4GFDA 3G68A 2C99A 1NVGA 1R6TA 2OBXA 5CH8A 3ZV7A 5LXTF 2EQBA 2HA5A 3G49A 3ILYA 4EPWA 2PRZA 4PC2A 5TC4A 5AW4A 4DV5B 2UVPB 3NFRA 3H0EA 1X74A 4X3CA 3WGZA 1GU1A 2W6JA 3GJ7A 2FZKA 3N28A 4LBZA 4X44A 2I3ZA 4YBZA 1OCEA 2SBTA 2ZCVA 3EXIB 1IWPB 3EPPA 3HB5X 2VP2A 3AJAA 4TQGA 3S2ZA 4EA9A 1JALA 3BE4A 2EX1A 4OHVA 3ESAA 3A6JA 2NXJA 2QUBA 3VHLB 4BO8A 1U3UA 2PZBA 3LWDA 3N2KB 5DBHX 2NXWA 5DCUA 5BQPA 1ODTC 3E5MA 4G0OA 3RR2A 2HBZA 3H5RA 3OQPA 1N3BA 1CTQA 3EA5A 3O2QB 3P71T 3PKJA 3SDSA 2UYOA 1GYPA 4LUCA 3GUYA 2TECE 3A32A 4EUKA 3AEXA 1BMDA 4KPFC 3KS9A 2DBVO 1R9MA 4F2GA 1H2WA 1HORA 4BXOA 3RIEA 1AZLA 3A1FA 3DD5A 3EULA 1M2VB 1SHUX 3I64A 1ZBDA 1T2AA 1ITZA 3DWEX 3AR5A 2BN4A 3LM8A 5AKKA 3H5OA 4PIPA 5CJPA 2ALJA 2I7VA 2GKOA 2CB0A 2PPVA 4I50B 4F7WA 1W46A 3VDNB 4MJXA 1P61B 3GEGA 3WGHA 3WO1A 2C4WA 4CEHB 3O1JC 4B6JA 3I2FA 4Q19A 4RL6A 3AVWA 5JRDS 1WMFA 1WXGA 3A6DA 3HVIA 4L1KA 4A9AA 3HVKA 3PNLA 4U2DA 5K99A 1CBUA 4PSKA 1O7JA 4FILA 1PSZA 1ACJA 4NBUA 4F71A 4BQSA 1WNFA 2PV7A 3TR0A 4MEAA 3DHWC 7MDHA 2WWTA 1LPSA 1SELA 2NX2A 3R3UA 5DOZA 3WBKA 1XF9A 3QKTA 3KSAC 3SF8B 4ZV4A 1PDOA 4WZAB 3O8CA 2NADA 4XX0A 3G8AA 2PFKA 4H18A 1N77A 1QRRA 2XAUA 1QB8A 4FFMA 1Y3HA 1UWVA 3RWOA 3JD2A 1SOMA 3CSDA 2R66A 3VC3A 1AA6A 5SZJA 4H7IA 4NJEB 1E1QD 4GAEA 1GUZA 5KCMA 2AFHA 2FZCA 5DULA 3Q7RA 1RC0A 2G09A 1BE0A 1ELOA 1GL6A 1Z4LA 3NNDA 4EGSA 5HVNA 4XLTA 3N74A 1SWWA 4LHXA 4LNAA 1E1KA 3CEAA 4HXGA 4LSMA 4ZCSA 3RTAA 4DCUA 4DB2A 5AOBA 4ENSA 1N6KA 2SICE 2QL7A 1E7QA 2W6IA 2PSEA 3BMNB 3OQIB 4KJXA 1Q92A 1UMKA 4KXFB 1A3CA 1AA9A 3M4JA 3MWDB 2R84A 3CVUA 3F2IA 3EODA 3LWZA 3VGPA 2LPMA 2D0PB 4TGLA 4YRFA 4ZODA 2EARA 1P8AA 4DGSA 1QAMA 3DDNA 1CLEA 1XRQA 1YZ3A 1NSTA 4NMMA 4KFTA 1EFDN 4NNPA 4D6PA 5I9MA 4DREA 2OC9A 3U09A 4NE7A 3R20A 2WHXA 3IAAA 3VV2A 2VH2A 2FSHA 1HG0A 2WIKA 4EYSA 2C54A 4NEGA 3LPNA 4QM6A 1FFYA 2X2OA 3V80A 3OQMA 1W1UA 1G7TA 2AD1A 2HH9A 3KG2A 4N6OA 1P2UA 3KPJA 1NR5A 4JBYA 1J33A 1RQLA 4QGFA 1H1TA 1QWSA 3UAYA 3HTXA 1TJ3A 2JJMA 1EUQA 5JJKA 4DDVA 1YB4A 2YNMA 2B8NA 1XJCA 4DA4A 4YI3A 1QHFA 1PNOA 4L3WA 3GA5A 4ZVTA 3TBHA 3F4KA 1NQVA 2AJTA 2JLQA 1W87A 1CRWG 3KKNA 1NJFA 4FFWA 1GPJA 1Z8NA 3KSRA 2JIZD 1IWOA 3ILHA 1B0ZA 2CNLA 3EN0A 4UOQA 4CDGA 3EOZA 3CF0A 3MJCA 3HK2A 1MORA 2D7CA 3SY8A 1SBHA 1W93A 5JJIA 1XHEA 3TFOA 1G8MA 3LC1O 1KP9A 1OT5A 4E88A 5JALA 4DGQA 2ZRDA 2UYHA 1A69A 1OFUX 3NT5A 2XUZA 4NF2A 3ZJ5A 4D25A 3FYUA 3EWSA 4TT3A 1J8QA 1Q0HA 3PXGA 3EAQA 2AYZA 5K8TA 2DRIA 3Q85A 3KJQA 2HDNB 2CHGA 2VQSA 2ZIXB 4B09A 1NUQA 3MPOA 4QECA 3AFHA 1KYIA 4Y9RA 4ZVSA 3DFUA 4NU5A 2OYRA 3U4MA 5KHOC 3S0JA 2TRSB 2QTTA 1XTUA 1HE3A 2VO1A 3HYRA 3N6VA 3ANSA 3CMMA 1DBVO 2IYYA 4KGVA 4IH9A 5ERGB 4FR0A 3L77A 2YIJA 4L0CA 3EG9B 2J87A 1TQ6A 1IMJA 1FU8A 4KX5A 1EM6A 2PZEA 4Q3BA 2J85A 2Q0QA 1UOQA 1NUPA 2IYUA 2VK1A 3OWOA 4OQZA 1BD3A 1YB7A 4O2AF 5I8WA 3L0SA 3K0FB 4KQCA 4I5GA 3K9BA 4BMZA 5EP4A 5LKRA 1EYZA 1VE6A 1HSZA 1LV7A 3PF9A 3MWEB 3FXAA 1F9AA 2PKXA 1PFGA 1EE9A 3PNOA 4G1CA 4IDAA 3E8XA 3GFGA 2IFTA 3EMBA 3GAZA 4HGQA 2CDBA 1E5VA 5IAKA 1KFKB 1WXWA 3QNMA 2P7HA 3D4BA 3FF4A 1NR1A 1RXIA 2DLNA 2WU8A 3MBIA 3MRSA 3KD3A 4WNIA 5FLKA 4AT1A 3BB4A 3O4GA 1Y9ZA 3ICEA 1O9BA 3A6LA 3ZW8A 1SVIA 1UL1X 2V7QA 3C8ZA 3G85A 4ID9A 3UH1A 4DMRA 4DR5B 3HE3A 4I1IA 2PT7A 4O4LB 5IUNC 2ZZKA 1U0SY 3P4UA 1UOPA 4CKBA 4W63A 2GS9A 2XF2A 3TFWA 1VLJA 5IDQA 1N33B 4R2IA 3FJYA 1HURA 2PX4A 1P91A 3LP5A 1NXQA 3L5KA 1CPYA 2FETA 3DKVA 1U1IA 2VBGA 5IG2A 3GPBA 5DMXA 2RAVA 3ZVKA 4HLNA 1QVZA 4XEUA 3VR2A 3X1WA 2AJ8A 1L3CA 3QYFA 5IM4A 1RTKA 1S2OA 1VPLA 2OHFA 3DCIA 3O4JA 3I0ZA 4XYMA 4LXHA 3W34A 4RA6B 2XE8A 3I32A 3NBYC 3QIVA 4GI7A 4M1KA 2YY5A 4BNWA 3DR5A 1Y82A 1G8AA 1JJFA 2QV7A 3IXLA 4CODB 4I9GA 1JJAA 1G4UR 1K6XA 4MKIA 5EXEA 1L1EA 4JJIA 2DAPA 4XIJA 1RRCA 1XD9A 1E2JA 4KNWA 2IZ6A 3KXLA 2G40A 4JUFA 1KR2A 5DT9A 2C2MA 3HVJA 1GL9B 5EESA 2ZIWB 2D5CA 2G7ZA 3AR8A 2MSWA 1KVQA 1DU4A 3TQFA 4JB2A 1RKUA 4AG3A 4WCDA 3HB9A 2V03A 2PUBA 1KDOA 5K6RA 3STUA 1NBAA 5EIOA 3V3KA 3VJMA 1WCV1 1EFHA 2XCQA 5DTRA 4D9EA 4R8SA 4F1WA 1I36A 4ZMSA 3E9YA 4HPXB 1N4DA 5J23A 2UXCB 1NJSA 2ZTVA 2D0IA 3OWXA 4HDQB 1V5WA 4ZVVA 3MGBA 4PLYA 5BQFA 5ESWA 4E33A 3M70A 3NVMB 1BX1A 2X13A 1KHTA 1JYFA 2NZVG 3B5EA 3KUKA 3OECA 4YUYA 1JIUA 1U02A 2J3EA 4GKKB 5CITA 1PJQA 2F1IA 3BMQB 4CF3A 4KQFA 3X1KA 3FUTA 2RC6A 4LQDA 2FJ0A 2PUHA 2SCUB 3DZIA 3SN6A 3OCXA 3HXMA 2IDMA 4DSZA 4A8HA 2XUAA 3TMYA 1S8FA 1PL8A 1ISJA 1XPOA 3E84A 5ALEA 1M6WA 1FA9A 1O6FA 1RIIA 3H0KA 1DO2A 3KU1A 3OE7A 3PFHA 1C9DB 1WG8A 2G83A 3I9V6 2DUWA 4RK5A 2YICA 1FUIA 5HIIA 1UJ2A 3IOCA 3NM6B 4CEJB 1DX6A 2VXOA 1XEAA 3TSOA 3CGGA 1EUDB 3OSZA 1SCUA 3QA9A 5AYVA 4AD8A 1MBZA 4DYDA 3GNLA 1YCDA 3DTNA 5FKJA 1E1LA 5JSZA 3KOYA 3E7FA 2YBEA 4JJFA 4KXMA 2EFCB 5TQ0B 3L7MA 1JQKA 3FE2A 4YV1A 1CJKC 1GY8A 3CN7A 1K4YA 1VLQA 4KKXB 4CG3A 3ZCVA 3K09C 5I51A 1NGSA 4MB6A 3VSBA 1M5TA 4QDUA 1KAMA 4IHKA 1BQEA 3IVGA 5LLDA 2XKKA 3KFLA 1PJAA 3DOCA 3UK6A 1JFFA 4RTLA 2ZM6B 1K66A 1K9SA 4Y1FA 4Z5XA 1F7VA 2QJFA 2QW8A 5CGQB 2OHVA 4MPJA 1CZLA 3AUXA 4L50A 1LH0A 1Z26A 2VJOA 5BQ5A 2M6RA 3BTVA 5LZ9A 1M72A 2O2ZA 4YRLA 2YBDA 1KE2A 2WT8A 3ADKA 4RKWA 5TPWB 5ISMA 3SM3A 1XRMA 2QYOA 5EE1A 1U8EA 4PHHA 3H19A 3JD4A 3K1AB 1R37A 3BWMA 3OX4A 2A84A 2X14A 2AMYA 5EMMA 1KJNA 2WABA 3KX2A 4EY6A 3ORFA 1IHXA 1X7ZA 4AY4A 1CIJA 2PG3A 2PTHA 4Q4LA 3DDOA 1U7HA 3KXKA 2NV0A 3L7JA 3SSOA 4HWTA 1BD4A 2G77B 2UZIR 3TDKA 2B4QA 5J2TB 4OQEA 5L3QA 2FMTA 3D8UA 1H0SA 2ZFUA 4O3MA 3H9JA 2V55B 2FEWB 2H7CA 2GBIA 3D4LA 4GP6A 1PLKA 2O57A 1O6ZA 1NW3A 1NU8A 2POQX 3O75A 3CF6R 3ROPA 3IC5A 3CLSD 1DO8A 4GX2A 1Z8HA 3EZGA 3P97A 5EVJA 4TWRA 2CVHA 3K16A 2ZM5A 4MR8A 3EB9A 4PC3A 1UKAA 1CJVC 3L93A 1TADA 2WOJA 4PC6A 3BG5A 1CUIA 2P9JA 3PWSA 4RSHA 3IHWA 4OCZA 1VPDA 4AJPA 1Q44A 1E5QA 2XGJA 5EJ9A 3PS9A 3VV3A 1W30A 2FPOA 5CYOA 4E2WA 4DYVA 3FR7A 1G55A 2XTAA 5JLJA 1KKLA 2IGBA 5FNVB 5BQOA 5H80A 4MV0A 1YZLA 4PPGA 4AMYA 1D09A 2YWEA 4QFDA 5FTKA 3C3BA 3D3JA 3DLIA 1FLNA 2H5EA 2IPAB 3BD9A 3IDZA 1C7RA 5DGDA 2Q29A 1SB9A 3T5MA 3TZQA 1JEYA 3RVNA 2MSLA 1PKEA 3TLYA 1MTOA 3PXAA 2BTQA 4HG2A 3O94A 3LXRA 4L0QA 2FLKA 2WFZA 4KE6A 3WP1B 4EHHA 3QJ5A 4BRUA 1TCVA 4EPRA 1PT9A 1YUMA 2JF0A 1HNZB 3BRWD 4KLNA 4Y2SA 2C4HA 1WDMA 4J03A 1RAFA 3NHBA 4DRZA 4NXMB 2AKYA 3EGCA 1CIPA 3ZWMA 4D9JA 3QPCA 5ADVA 1QBKC 4UEKA 3MBOA 1BVUA 4KXXA 2YFYA 4KQKA 4MR9B 4C6HA 3WLFA 1NUUA 2XE7A 3MJ4A 1CJCA 1L4MA 1XRLA 4GOXA 2VPWA 1JL3A 1ONSA 9ABPA 2YXDA 5DHRA 5JV5A 4CR7A 2KS6A 1PQPA 1W5BA 5EJIA 3PBKA 3HJTA 4OB7A 2PIDA 1U6KA 1C4WA 1UZLA 3D7NA 4IJ6A 5B36A 3V34A 4UQLA 1XZLA 1JB9A 2MYUA 2AMJA 4GF5A 2UUPA 5ALTA 3QU5A 5CCBA 3GJRA 4RELA 3HFRA 2IE0A 2G80A 1CVIA 3FPHA 5F1YA 4DNXA 3S2GA 2A59A 4ENWA 1C9YA 2R8XA 1UJ5A 4KQ6A 1BJKA 5AXDA 4JI0B 2IT1A 4A5SA 3PUIA 1J2YA 1AS2A 3DMGA 3AVQA 4ID3A 4WN9B 1C2YA 3NGLA 4CNBA 1RXUA 1U4OA 2JFZA 5EYPB 5EXSA 1KFJB 1CR6A 2Y0EA 4BNZA 1M0TA 4ARVA 3VKFA 3SNKA 3WQQA 3CH4B 1UWKA 4ZV9A 3EGWA 2AWNA 5FADA 3NR2A 4PBSA 3L1IA 4I5IA 5EKDA 3RKSA 2KBFA 2V1XA 3O2JA 2CWDA 3RVJA 4MWDA 1QC5B 4P98A 5SY4A 1ZJ6A 4W9RA 3VX3A