2AX4A

Crystal structure of the kinase domain of human 3'-phosphoadenosine 5'-phosphosulphate synthetase 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
QAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Crystal structure of the kinase domain of PAPSS 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ax4A00
3AKCA 1UBCA 2AWOA 2Z6VA 4RY2A 3CF6R 5JJIA 4DLVA 1DOAA 4ACBA 2PJRA 2VP4A 4TLCA 3HWSA 1JAHA 5F98A 2FU5C 2HXSA 4URZR 5DN6A 1SVWA 4NL4H 3QIAA 5EP1A 4PTLA 1OIWA 1T3SA 4KO8A 3VKWA 3AVUA 1W36D 4BECA 4IHQA 2GVDC 1NI3A 3NHBA 4HB3A 3SJAA 4C0LA 3K9GA 3NHAA 1P5ZB 2FX3A 3PJRA 5CIQA 1SQ5A 3OIYA 1S9HA 4M53A 5JSZB 2O52A 1ZIPA 1KDTA 5C46F 2DFLA 2WJHA 4LPKA 3T1OA 4CVNA 4RZXA 3LWNA 4ZO4A 2RGAA 3LQQA 3NH9A 2D74A 5GVRA 4E5UA 3K0CC 3QJYA 2ZIAA 4W9MC 4ZDKA 1KZ7B 2ZJBA 3F5FA 3PQCA 4GT1A 1M2OB 3PCRB 3SI7A 5JCZA 4G0NA 2RHMA 1EWRA 1KYIA 3TH5A 4JT2A 3FHTA 3RS5A 4JZKA 1D8TA 2ANCA 3NG1A 2HLDD 2YHSA 1MRNA 1Z28A 2REOA 2YOHA 1IXRC 2P5SA 3U3MA 4URYR 5G40A 2FZ4A 4PQYA 2C98A 2NZJA 3OEHD 1FP7A 3B82A 1F2TB 3UG6A 2YC2C 3IILA 2A5FA 3A36A 3MJRA 3QXHA 1OHHD 1KI8A 4LJ4A 1CTQA 2FA9A 2NQ2C 1AQYA 4HLDA 4CIDA 3T61A 3CONA 4I1OA 1XEXB 4B2IA 4IDNA 2QRZA 2OAQ1 2EFDB 2FFAA 3GLIE 4R71A 2O8DA 4Z54A 1IY0A 3CNLA 2R44A 3TQCA 5F2EA 4L9SA 2DPXA 3DDCA 4KLZA 3FMFA 4TMXA 4V02A 4DSNA 5FPKA 3I61A 2IWHA 4Q48A 2VSFA 4JBXA 1OIVA 2NO9A 4A82A 1QHIA 2FWRA 3QPVA 3LFUA 4BLOA 4OQMA 3RHFA 2ZU0C 2WICA 1GWNA 3D8BA 4C30A 4IFBA 4IVQA 3K9NA 4QC2A 3VTKA 1HURA 3ICEA 1N5KA 5TB5A 5KOYA 4DSUA 2ZJAA 4EJSB 3L2OB 4NCKA 4QBFA 5KNCA 5CJPA 1YHNA 2FEMA 2BEJA 3CR7A 1ZM9A 5DNYB 4DCUA 1ZUHA 1P72A 2CJWB 4AYXA 3QI2A 3SFZA 2W6JD 5LPNA 5AUQA 2G0TA 3TE6A 5EXXA 1Q21A 2ZR7A 4GP6A 3RRYA 2W00A 5CB6A 3IIMA 5ANRB 4KFRA 1YZTA 1XMIA 4CGZA 3QPUA 4QKQA 1FL9A 4WW0A 4B33A 1HT2E 1NVXQ 4ZCLA 1D2MA 2FH5B 4I4LA 2I4IA 1CP2A 2GDJA 4F38A 2XJ9A 2XTZA 1E79D 1XZPA 1Q22A 4PC6A 4FD2A 1ZM7A 2RHDA 1QRAA 4AYWA 2ZU6A 4TYYA 2AN9A 4NU0A 2VP2A 3U60B 1NVVQ 3EXAA 2RGNC 2CE7A 2ZS8A 2QP4A 3FE2A 3B1WA 2AFHE 1YR8A 2P6NA 3I32A 1W1WA 4Q1BA 2BKUA 5DE3A 1VIYA 1PJRA 1NF3A 3FFAA 4ILEA 3UIEA 1ZU4A 1GKYA 3IDQA 3IBGA 2GXSA 3U2QA 4HAWA 3LH5A 3AGPA 4PPFA 2ZRLA 2DY1A 2WPDD 2R9VA 1A82A 4DC9A 2GXAA 4TQ9A 4J0QA 1OF1A 3FTQA 2FSGA 4EQ6B 3GEHA 2AKAB 1FW6A 1NL3A 1UM8A 2WVJA 2G3YA 4TT3D 4CEJB 4FW9A 3L0SA 4M9XA 1KSJA 4RZUA 3WRXC 4E03A 5JS7A 2R8RA 1YJ5A 3AP2A 4PSVA 3EARA 2ODNA 2O8FB 1XTSA 1E2JA 1Z5ZA 4U00A 1OXSC 4U02A 4UNRA 2DYKA 3OE7A 5C4MA 4II7A 2J0QA 4PHHA 3O8DA 1U9IA 3KJGA 4DSOA 1EGAA 3HYTA 1KI9A 3CB4A 2ZS7A 2ORVA 3NKVA 4GOJA 4K81B 2QN6A 4HB2A 4A6PA 3KKPA 521PA 3ZGXA 1CU1A 1UKYA 1KDRA 3K0AA 4QBHA 3SU8A 1D9ZA 5JWRA 1KK3A 4IXNA 3D6TB 3WY9A 1TUEA 1T5IA 4US1R 1GL9B 2RGCA 3PENA 4LZZA 5JLJA 2IS4A 2R65A 2H1LA 3EC1A 4PAOA 2WMOB 3MFYA 3LBHA 3WHKA 3U7EB 5GADl 1ZNZA 1Q44A 1FX0B 1TL7C 2C78A 2CLSA 2QROA 2BHRA 4WIAA 4N3NA 4C2TA 1CXZA 1KDOA 2RGEA 3GLHA 5FUWA 3NXSA 1G4UR 4NBSA 2HCBA 4C0KA 621PA 4TQUS 2WIBA 1SVKA 6Q21A 1Z0JA 5KSZA 4V03A 2WOJA 4GSYA 2FPMA 4HUQA 1OFIA 3V00A 1YR9A 1X8JA 4BFZA 1II9A 2ZEJA 1HV8A 1KI2A 1OB5A 1S9DA 1GITA 3IQWA 4Q66C 2CNWA 3GJ6A 3SN6A 4JIMA 2V7QA 2W0SA 1MABB 3PVSA 2HV8A 4V0OA 4FMCB 1GAJA 3FVQA 3SQWA 5CJ2A 1OH6A 5JZVA 4YQFA 2AD1A 3N70A 5E7MA 3GFTA 2J7PD 1CR2A 1ZCBA 4A8JB 5GJVC 2EFCB 4NMMA 2HF8A 3NEJA 3AKEA 4PC2A 3QF7A 2VIIA 2W6ID 1QHSA 4H1VA 4PC3A 3QE0A 4FN5A 1W7AA 2A9KA 1GVNB 3QF4A 3Q3JB 1NY5A 3MCAA 2QRNA 3QSYA 3WRYC 3RS3A 3MMPA 3K9HA 2PT7A 3P20A 4JVLA 1NVVR 1FTSA 4P0TA 2YNMA 4IOJA 2ZJOA 4E07A 4RFSB 4U7DA 3UXMA 2Z83A 4C7OB 4LYHA 1KGDA 1XXHE 2FFBA 4TZ0A 2Q9BA 3EZFA 4OYHA 3R8FA 2NO0A 721PA 3AF0A 5GJBA 5EP3A 1ZP6A 3GLGB 3KZ1E 3QUSA 4Z1MA 2R62A 3MWKA 3PEVA 4Q03A 3D7MA 3WMEA 4IDOA 1TEXA 4TWZA 4FINA 4FMBB 3EAQA 5DYGA 2V1XA 5DO9A 1F2UB 1Z6YA 3GQBA 5EE9A 2CCKA 1NSFA 4QM6A 2H57A 5JRJA 2X1VA 4EFMA 3CF2A 4LCBA 5CK5A 3A1UA 1NBMD 1ESMA 1WMSA 1YR6A 1G8PA 2AXPA 4XSGA 1GOTA 5B58C 5JJLA 1V43A 5KNDA 3KJEA 3ZYCA 1E1QA 1AS3A 2QTHA 1G291 1P7CA 4LYAA 4A2QA 1G41A 3CPHA 1RRCA 4TSFA 2YV5A 2IYQA 1XMJA 2FN4A 4FXPA 4XH9B 1X1SA 4PSAA 4DWJA 1NLYA 2WKRA 2BEKA 1P2TA 3GJ5A 3HP1A 4PHFA 4TTPA 2FPKA 2LCFA 1VHTA 3KTAB 4V0LA 1KZGB 1CRPA 3ND8A 2YZ2A 2IS1A 3N5CA 1IY2A 2GEDA 2G77B 1T3HA 1FMJA 1D2EA 1Q1ZA 2ODEA 5G3YA 3K70B 3FMPB 5JFGA 3TKLA 2VP9A 1XTQA 1ZVQA 4TMKA 4CDGA 3QVVA 2OEPA 4HB4A 1OFHA 1A5TA 2ZRIA 2WAYA 4G5RA 1U90A 1ZAKA 4B3CA 4QJ3A 5JI2E 3A1TA 4DLRA 4CW7A 4E22A 2QL6A 3MWJA 3VAAA 5CM9C 2ZI3A 1P3JA 2F1IA 1T6NA 3AVQA 5CYPA 2O8CB 2H7VA 2VF7A 1KKLA 1ESNA 4LI0A 2IYWA 3OEHA 2JJ2A 1ZNYA 1FMLA 2GBLC 4RD4A 4Q9IA 1UPTA 1LY1A 1NMYA 1G3QA 3T15A 4WZAE 2IYXA 4R2IA 1KI1A 3KFXA 1GG2A 2FE4A 1JR6A 2IK8A 2ZAMA 1XTJA 1CJVC 3TW4A 2WTUA 3AF1A 1SKQA 4PAMA 3AVVA 3BXZA 3W9YA 4IFEA 2OCPA 2FDCA 1NLZA 1KNXA 1W4CA 2CK3A 4LV6A 5FPYA 1QHXA 3EIEA 2IX3A 1ZU5A 4NPHA 1QHHB 3VR1A 5CLLA 3BAFA 4BLSA 4B71A 5FH9A 1JQLB 3AB3A 2ZYUX 4IVPA 2K5UA 4U5XA 1OH5A 5LD2B 4OHXA 3NBYC 3RSLA 5E95A 1VTKA 5EJEA 3IIJA 4B73A 3AVTA 5IT5A 1SKYB 3N2EA 1AS2A 3DMDA 4LHXA 821PA 3K9LA 2VSXA 4Q7LA 1P2UA 3AUYA 5FTNA 3HPRA 3KJHA 4OKSA 1Q1QA 1X3SA 2NOAA 1P4SA 5KNBA 4F93B 3QVUA 3VX4A 5CYOA 2DWQA 1NNEA 1JJVA 3LAWA 3LLMA 2OO7A 4C0AC 3W8NA 4D4LA 3K0EA 1SGWA 3S1AA 2PJZA 1W47A 1ZIOA 3DM9B 5HCNA 5FBQB 1NMXA 2Q3MA 3EX7C 5EUQB 2EQBA 4QXAA 2QAGA 2C5LA 3SOPA 4NHOA 3P26A 4KXFB 2VO1A 1VMAA 1A2BA 1TQDA 2RB4A 2Z43A 1YZKA 1JBKA 1TF5A 4HI0E 3RS0A 3AVYA 1C9KA 4XVRA 2BJVA 4X8LA 1VCMA 3I5XA 3AQ4A 3CH4B 5E7JA 4AKEA 1CKEA 5EZ6B 4TTRA 1RE0A 1NIJA 1XPUA 2V8OA 1R5BA 3CX6A 1OKKA 4FMCF 1IM2A 2AX4A 4PAQA 2KJQA 4ZPXA 4UXJA 2F43A 2VYFA 3THYA 1TU4A 1A4RA 3SYKA 3NC1C 1P2SA 2QA5A 3E70C 2ZROA 3H2YA 1E2EA 3C15C 1ZNXA 2CLCX 4JL6A 4MDEA 2FGJA 4QNRA 1ZC3A 3HU3A 1M74A 1E99A 1G21E 2AK2A 3T1QA 3VR5A 2HUPA 1XJQA 1KDPA 2QNRA 4B3XA 2O8EB 3W8RA 4MRNA 1W5TA 2CL7X 4JVMA 4QOSA 2IYYA 2QPAA 2G83A 5JECA 2VH5R 2YINC 4GRAA 1G5RA 1NRJB 2GKSA 1TQ4A 1QHGA 2QT0A 4CEHA 1WA5A 3ADDA 5EE3A 4DIEA 1R8QA 2PX0A 1G6OA 2ASEA 2YWHA 2NIPA 1HYQA 1II0A 3BERA 3WP0A 1TX4B 1Z0IA 1TNDA 4JSYA 1T8UA 4C2UA 4I81A 1OE0A 2YWFA 1M1YE 3F3YA 4OQFA 4QL3A 2ZPTX 2NO1A 2QMOA 3VFDA 3C16C 5FOSA 1SVSA 3RS4A 4NCNA 3K1JA 4NZYA 2W58A 1OYYA 3A8TA 3A6PC 3DO6A 2VQSA 1KTVA 2ZSDA 2C04A 4IEEA 1U98A 3LXXA 2DFNA 3Q85A 1LB1B 2CVFA 2FJUA 3OE7D 4QBGB 4TLBA 1RJ9B 4Q1FA 1WB9A 1HY3A 4M8NE 3I3SR 1E9CA 1NMZA 2WOOA 4P33A 4LJAA 2FOLA 5KYKA 4KBGA 3OIWA 5FOVA 3SE0A 2Q6TA 1D2NA 4DB2A 5FR2A 3L8ZA 1TMKA 1EFTA 2J41A 2NPFA 1HA3A 4KFUA 1QDEA 2ZJ8A 3WYAA 2X2FA 2WAXA 1KO5A 1G4AE 1MR3F 3H86A 1UADA 3BWDD 3CX7A 3DZ8A 4HZUA 4BFUA 4XIGS 1OH8A 3RVBA 2PH1A 2VHCA 3U4QB 1PVOA 3T1TA 1DAKA 1NVUQ 4LJ7A 3UWOA 2XZLA 2OESA 1T0HB 2PEYA 1XFAA 3Q8XB 3QKUA 3K70C 2OCBA 1KOFA 2PL3A 3H0KA 1UFQA 3FPAA 1DS6A 5DIFA 4NYJQ 2C96A 2ATVA 2FEOA 5FOXA 5F9FA 421PA 2JASA 2ZJYA 3SR0A 2ZQ5A 3VX3A 2C03A 2H5EA 3GLFE 1UEJA 1XF9A 1DBSA 4M1KA 2ZITA 3MWLA 2CNWD 4MRPA 4MUBA 2V7QD 4GI7A 4GOKA 1XMSA 1SXJB 4NH0A 1ELOA 1JXMA 2ANBA 3OESA 4B75A 2IYZA 5EXSA 4Q1EA 3TUIC 1IN4A 2QUZA 3I4LA 4KSCA 1DAMA 1ZD1A 3QEOA 3QXCA 3VNUA 1J90A 4UQOA 4R98A 5HPYB 1BS1A 1HUQA 5EE0A 2GCOB 2VPPA 2XNSA 2YVUA 5SZKB 3CWZA 4NONA 1T3LA 3CIOA 1R4AA 3NDBB 5JSZA 2ZRNA 2J5XA 1N5JA 2NZ8A 3KQNA 5LD2C 5FPHA 1M7BA 4MKHA 2GF9A 4ZIRB 1I2DA 2GK6A 3SNHA 2JCSA 3AGQA 1KK0A 1LS1A 1US8A 3ETLA 4JLOA 3FB4A 5FUYA 2ZSEA 2GEUA 1XWIA 4DT1A 3KXIA 4KYUA 4E09A 4Z1MD 1CR1A 4ZDJA 1W36C 1F2TA 1VCNA 1NLFA 1RRGA 4L5BA 1T4GA 1GP2A 2OUKA 4A36A 1M8PA 5DHFA 4IVRA 2G88A 3FMOB 4PSKA 5AJWA 3GJ0A 1TTTA 3DOFA 4QFMA 3K0SA 4GFDA 4HB0A 4M1YA 1NBME 3THXB 2IEYA 1XEXA 2WWGA 3IIKA 1A7JA 3CZPA 5FL7A 5FFMA 4KU4A 4W5WA 1E1QD 4MGKR 3GJ4A 3SJZA 2ORWA 3ZJYA 1Z06A 4TMWA 4C0QC 2TMKA 4TSFD 4YMSA 2B8TA 1GL7A 3T12A 4B6FA 1QVRA 4B3FX 3SC3A 2P5TB 5DI3B 2D3WA 1S1CA 1KY3A 2DBYA 3VU9B 4LHZA 3DM5A 4PC1A 5AJVB 2XX3A 4JLVA 4LV5B 1EX7A 3UK6A 3REFA 4DIDA 2YOGA 1W0KA 2OBLA 1JEDA 3CNNA 4LV8B 3ZDQA 1QF9A 2ZRHA 2IC5A 3A4MA 5A0FA 1OLOA 2Q0HA 5FBRB 4WBSA 4DB4A 4EJSA 1FUKA 1MOZA 4JLKA 1E2KA 4DLUA 2ZRDA 4EIWA 1FP6A 1VIAA 4H9GA 4X8OA 3R9XA 2OXRA 1YU9A 3LVRE 4HEJA 4NE2A 4Z8YA 3PXGA 1GKIA 3P4YA 2CJWA 2WWXA 1S3GA 4KYIB 1S3SA 4F91B 5J4YA 5CLQA 3TAUA 4HLUA 1G7RA 1R8SA 3LQRA 1NVWQ 4HDCA 1SHZA 4FCVA 1JR3A 1G18A 1OFUX 3REGA 4C0JA 5IDVA 4OQNA 3T06B 1R10A 2E9SA 3QKTA 4GPTA 2JJ2D 1K8RA 2GK7A 2GVZC 3EW9A 1G8GA 4GZMA 3U7GA 5HZHA 2HXYA 3PUWA 1IONA 4A2WA 1RRFA 3AV0B 1F60A 4B32A 2A30A 4L9WA 1FOEB 3MLEA 3A4LA 1UBGA 1RYFA 2CK3D 1XD9A 3IHWA 4XSHA 5EUMA 2GJ8A 3P4XA 3SYLA 5CITA 1EWQA 1EFRA 1JQJC 2ZR0A 2HDNB 2BMEA 4V0NA 2BMFA 4YLGA 4JBWA 5D3MB 5SZHB 3HJNA 1YZQA 1FTNA 3CR8A 4Q4HB 4DCNA 5B64A 1S1MA 2IXGA 1XCPA 3KXLA 4B34A 3FKSA 2O8BA 1N2CE 5KDDA 1JEEA 3V9PA 3CBQA 1NJGA 2GTPA 4IOLA 4XVUA 1OT3A 4BWYA 4LOAA 5SZJA 3QOFA 1J8YF 1X8KA 2EYUA 4LGMA 2F7SA 1P6XA 4LBYA 4EQ6A 4ON9A 3I72A 1XZQA 4CEJA 1G16A 4RCZA 4A92A 1PV4A 2DFKB 4ZKEA 4EPYA 5IRCD 3A58B 1GNRA 4G5GA 2IYTA 3RANA 2O8FA 2G9NA 2XOKA 4M9SA 1RRPA 2OAP1 4JYBA 5FUVA 3KKQA 4LK2A 4M1SA 3H1TA 3GJ3A 2IWRA 2OSBA 3BORA 1P62B 1X86B 3G82C 4DCVA 1MV5A 3TVTA 3GFPA 4AIIA 3B9QA 1WBDA 2J1LA 2F1HA 2VSOA 1P60A 4F4JA 4D4KA 2C99A 1SXJC 1CJUC 1U2RA 5KTYA 3NBXX 1X1RA 3IBYA 3TQFA 1I4LD 1OSNA 3TMKA 2WWFA 1OXTA 2NMVA 3PITA 3B1ZA 1KSGA 2CHGA 3EPLA 3DHWC 3QKSB 4P4UA 4AYTA 4B2PA 1OKKD 2J0VA 4BFVA 2DB3A 2ZI7A 1FX0A 1YVDA 1KHTA 2LWIA 2R2AA 3ZZUA 1N0WA 1PLJA 4FMDF 3U7HB 1Q3HA 3H84A 4Q01A 4NDZA 1OH7A 2VHUA 4DDUA 1G3UA 3IQXA 2OBMA 1VHLA 2P67A 5FPTA 1EXMA 3GLIB 1L2TA 2MMGA 1DPFA 3U44B 4PFSA 4TYWA 3QXJA 4TL9A 1Q12A 5KUTA 4WA7A 4Y0VA 4HLCA 3SEAA 1MABA 3VKHA 3BBPA 1DAEA 5L3RA 4RZ3A 3VHLB 1Z6TA 1BMFA 1VYVA 3AVOA 2ONJA 1Z08A 2JLZA 3LW8A 4AI6A 5EE1A 2JDIA 2CCJA 4A8JA 2NGRA 2QQEA 4O3MA 3QG1A 2KE5A 3CUEF 5CM8B 2G0NA 3HR7A 2OCAA 5LBIA 1N3BA 4M1MA 2UVQA 3QY0A 1MO3A 5CK4A 1CF4A 5G3ZA 1MO5A 1VG1A 1NG9A 2OFOA 5H68A 4CF7A 2ZE5A 4AWXA 2GWHA 3L43A 4L15A 3B1XA 4WOPA 2EW1A 4YMWA 3WMGA 3U61B 1CJKC 4N0DA 4IKEA 1RW4A 1H65A 4S35A 3VMFA 1HQCA 5FTMA 5FBWB 2REXB 4UXHA 4EPRA 1S8FA 3I92A 1GNQA 1XRJA 3N2IA 3SHWA 2MSCB 2O0KA 3DPUA 3LY5A 4RFSA 4Z8XA 4C7OA 2F9MA 1EX6A 3JVVA 1OB2A 4TYPA 4Q9JA 2I3BA 3GCGA 5SZIA 1Z6XA 2A5JA 5A5GA 3UWKA 4IXMA 2VRWA 3GLGA 3IPYA 4L16A 2ZM5A 2NTYC 2XTNA 2BKEA 3VNVA 2ZE7A 3SJCA 3M1IA 3QNUA 5AUNB 4M1TA 2FMXA 1KMHB 1ANKA 1ZM3A 3GPLA 2GXUA 5TY0A 2G6BA 3GLHE 1F2UA 2BCJQ 2WSMA 2GEVA 3RDPA 1EFUA 4TYQA 3RWMB 1P9WA 2ZXUA 3W34A 1U0HC 4JLBA 3MJHA 3SS8A 3ASYA 3DL0A 5BWMA 2J3EA 2KSQA 2JJ1A 4GZLA 5J4LA 3KB2A 3V4FA 4JT4A 3G5UA 3K0FB 2CLDX 4C4PA 2XITA 5DYIA 2KBEA 2XXAB 4OL0A 2QSYA 3E5HA 1MH1A 4UNPA 3QENA 4JVNA 3AVXA 1UDXA 2GJAA 3HR8A 2OILA 3L82B 5JRZA 4K46A 3KTAA 1D5CA 4QJ4A 4KVAA 1HTWA 1XPRA 3R9WA 1S0UA 3CZQA 1BIFA 4RJLA 3UANA 8OHMA 1F3OA 3UG7A 3LNCA 2D2EA 1U0LA 5E7IA 1A1VA 4OJKA 2XZOA 3DKPA 1VPLA 3LBNA 1QVAA 2IEZA 3OF5A 4ARZB 1OYWA 1JECA 3ADCA 2A3RA 3K53A 1YZLA 2DCUA 1QHNA 3T5GA 3AUXA 1G7SA 3U44A 2P2LA 3JVUA 2Z4RA 1ZUIA 2GAOA 2ZS9A 5AUPB 2OT3B 2J59A 2RGDA 4GNKA 4DLYA 4Q7KA 2IYRA 2P0EA 5KU1A 3FFBA 3DEFA 4R2HA 2JGNA 4LUCA 5LDDC 3T35A 2O8CA 2BMJA 1T0JB 5LB4A 3OAAA 1RC8A 4DSTA 3K0AB 4OI0A 3CO5A 2ZJZA 1KK1A 2CHVA 2J9RA 3ADKA 1NN5A 4HLQB 3BB4A 1SULA 5FI0B 3U5ZB 1FZQA 3AH8A 1YR7A 1E2MA 2F1RA 2ERXA 3HU1A 3K09A 1NKSA 3X1XA 3ZZTA 1RPZA 2XSZA 4AG5A 4MA4A 3PEUA 1XCMA 2ZE8A 3WHLA 3OHMA 2BC9A 3B60A 1WCV1 2CBZA 1WE2A 3CM0A 3RLFA 4JL5A 3T34A 3CF0A 2P3SA 1QHHA 1GNPA 4LX0A 3U3RA 4NYMQ 3BC1A 4IEIA 4F7WA 4NTZA 4JSTA 4W7SA 5FL7D 1IHUA 4A0GA 4RD1A 1OXVA 1OFTA 1Z0AA 4LBVA 3R7WB 3T5DA 5IK2D 4O2LA 3A37A 5C1BA 2FG5A 4QG7A 3B13B 1GSIA 3GMTA 2ZE6A 3O8CA 4LC0A 3ZQJA 1ZRHA 3G0HA 4JJZA 3ZD6A 1LTQA 4B74A 3I73A 2D62A 1N25A 5J4HA 5BXQC 2NO6A 3AEZA 1QHYA 1K6MA 1W0KD 3WMFA 2IYSA 3MAAC 2HT1A 3QQ5A 2KB0A 1UBEA 2JLSA 2BCGY 4M0LA 1I4TD 2A78A 1IJFA 3RAPR 1VECA 2GNOA 1CBUA 5L3SB 4D0LB 2ZRMA 1AGPA 3UKDA 5JS8A 3GEEA 3H4MA 1F48A 2ZRGA 2I1VB 3ZS8A 4QHYA 5TV2A 1GM5A 3TGPA 1Q0UA 5BN4A 1NN0A 1R7RA 4RFVA 2QBYB 3L0OA 4ZCIA 1E2IA 3KKMA 3BH6A 1DO0A 1XXHB 2IL1A 2PMKA 1JR3D 1YE8A 1ZNWA 2WJVA 2ZI9A 1GFIA 3I8XA 4A9AA 1KNQA 3D31A 1CLUA 2E87A 2HYDA 4OK6A 4JLDA 5M04A 3BD9A 4D81A 3FDIA 5AK0A 1MT0A 2VL7A 3QEJA 5FL3A 4BQSA 3Q5DA 4A6XA 4BRWA 2XGJA 3B1VA 4TMTA 5EXPA 3CPEA 4MRSA 3QKRB 1E4VA 4G5OA 4XWKA 1W46A 5L8VA 3R20A 4OHWA 1R0ZA 4ZDIA 1KAOA 3KUCA 4Q4AB 1VG0B 2CEAA 1OXUA 1T9HA 4Q9HA 2IF0A 4A1FA 3W6OA 4D0GA 4RKFA 3JZMA 3VR6A 1G8FA 1EFRD 3K0CA 4WXRA 1LV7A 3ZVMA 5A4JA 1I2MA 3Q7QA 2O0HA 1A2KC 5L3QB 2O8EA 3KFVA 4YMTA 2FNAA 2EYQA 1E2LA 3RRNA 1Z07A 1AZTA 3CRVA 2IBMA 2CXXA 4Q1DA 3FKSD 2JEOA 2H8KA 1KI6B 2GA8A 4GP7A 2LKDA 1TU3A 3BB1A 3TLXA 5JJKA 1H8HA 5IHPA 3TW8B 1W36B 2V54A 4CEIB 2B6HA 5ELXA 1XNJA 1DTSA 5J47A 1XEWY 3NBZC 4URWR 1TQ6A 4D80A 1CIPA 4EPVA 2XOKD 4G3XA 4RVCA 1UF9A 3ZVNA 2ZUBA 3AF4A 1E2GA 1RJ9A 2IYUA 4P4SB 4Z51A 3FOZA 2OV2A 2C9OA 1X6VA 4CYMA 3X1ZA 4CZ2A 4DEXA 3A1WA 3LX8A 2NG1A 2BBSA 3B85A 4PPQA 3QG5A 2AXNA 4NYMR 3WNCA 2GZAA 1NY6A 4TLEA 3I8SA 3C5CA 3SDZA 4JBYA 4F4IA 3TR0A 2ONKA 2C95A 4MDFA 2ODWA 1QG4A 3BH7A 4P4TA 4B76A 4D6PA 4NKRA 2F1JA 3U4QA 4PZYA 4RD0A 2GF0A 3KXKA 1IXSB 1AA9A 4Q1CA 1Z0KA 4LYJA 4RD2A 1ZBDA 4ZI2A 4UXIA 2F55A 5B2ZA 5P21A 3F0TA 3THWB 1OJLA 2QMEA 1WF3A 4D4JA 1NG1A 3B5JA 3FYHA 5FTJA 2V6JA 4TL7A 2BV3A 1U9IC 4P32A 2WMNB 3U7FB 2FFHA 4PO8A 4DLTA 1I4DD 221PA 3VR4A 1P9RA 4M9ZA 4LJ8A 2QSZA 1XEFA 2IHBA 4URXR 4TYNA 4Q18A 1G19A 1BMFD 4V0MA 5JI3E 4AKGA 3T1VA 4LBZA 1PUJA 4NYIQ 1ETUA 1AIPA 2DFTA 1KI4A 4RSGA 4KI0A 2JDID 2WWWA 4Q47A 2D7DA 1C4OA 2JIZA 4YXWA 2J87A 1DG3A 1G64A 2GCOA 3AF3A 5JHGB 2GJ9A 3PV0A 1II8B 1AZSC 3OFNA 1IQPA 4M1WA 5KPJA 4IRUB 4FCWA 3O47A 3DMNA 1E0JA 1N6PA 2RGNA 1HH4A 2IYLD 5JEDA 4D26A 2YWEA 3BGWA 4QHSA 1GIAA 2C9YA 5K8IA 2UZIR 2HEIA 1UKVY 3SYNA 2RMKA 4ZIRA 3W5JA 4MUAA 1E9DA 3KB1A 2PMDA 1AK2A 4WAUA 2DR3A 1W4AA 1ZCAA 4MRVA 4ESVA 3TRFA 1WP9A 1MRSA 1E98A 3BOSA 3CRQA 4LJYA 3U3KA 1TPZA 4BLRA 1PUIA 2ATXA 2W83A 1D6JA 4LY6A 5JWHA 4ESHA 4PX9A 1N5IA 2V55B 5CB8A 3TJZA 1MKYA 5EZ5A 2D4HA 1N6NA 1S2MA 4PZLA 3KL4A 2XTMA 4HAUA 2V4ZA 5E4FA 4MYUA 5HE8A 3ZLJA 1IJEA 1E0SA 5GJWC 1NKTA 2GJKA 3MG9A 3PUVA 1P73A 3SZRA 1ZC4A 5D3QA 1N6HA 4C0BA 4PZZA 3WNDA 3THXA 2CMKA 3DKVA 2UKDA 1VCIA 3A1VA 4PO1A 1TADA 1OV4A 3NH6A 5FTLA 2JJ1D 3QXSA 3BS4A 2F6RA 4K8OA 3EA5A 4B3BA 4ZI3A 2Z0MA 1W49A 3X1WA 3RC3A 2QEQA 4JLNA 4MYTA 4POAA 1TEVA 4FI3C 4IDQA 4WZ6A 1C1YA 4Q7MB 3ZS9A 4Q4JB 3RABA 4C0SA 4LJ9A 1N6LA 5DI3A 4M9QA 3VU9A 4L8GA 2PZEA 2JLYA 3U6BA 4Q21A 4EFNA 3F8TA 2DWOA 1E94E 5TARA 1L7VC 2BMDA 2J46A 4XD7A 3QBVA 4AK9A 1E32A 3TBKA 1EK0A 2Q9AA 4UNSA 2WJYA 4S2EA 1PLLA 2ZRCA 3QBTA 3K70D 5F3WB 4CT5A 3IEVA 4EUNA 4UJ3A 4C9BA 5DH9A 1E2DA 2ZYWX 4LHWA 2OG2A 1KKMA 2NO7A 5HR5A 1W4RA 1UEIA 2YOFA 4QRHA 5AWFC 1YKSA 1XD2B 3I62A 2ODBA 2ZRBA 1U8YA 3UMSA 1SVLA 1G5TA 2QGNA 2ZAOA 3E2IA 2GZHA 2QM7A 2ZJ5A 1FUUA 2D2FA 2R6AA 2YC4C 2IT1A 2ZJ2A 2IUSA 1NIPA 3OAAD 3W6PA 1XEWX 3ZVLA 3PUYA 1E96A 3KQKA 2W2XA 5TMPA 1ZINA 2IXEA 2WV9A 3HYRA 3Q72A 2Q9CA 5DI9A 2KWIA 4AD8A 4XWOA 3W5IA 3ICQB 1COWA 3LW7A 2XSZD 4TTQA 1Z2CA 2C9CA 4MITA 5TVKA 1E69A 1DEKA 5FTKA 1LF5A 2RH5A 4DLSA 3O8BA 4YMVA 2QMUA 4OHYA 1MO6A 1G1MA 4L4UA 3GD7A 1RIFA 3ZD7A 2Q3FA 3A1SA 5CDFA 2VA8A 5BYKA 1AQUA 2HYIC 5IK2A 3GLFB 4NCHA 2J45A 4XJXA 1VDZA 5D3MA 2XAUA 2OXCA 2H17A 3TUJC 4Q4HA 4G5SA 3FKQA 4QGGA 3FMIA 3IEUA 2PZFA 1E0KA 3X1YA 2PT5A 5FOTA 3MRSA 4BFTA 1CULC 1U99A 2JLQA 1PZNA 3ADBA 3D3QA 4ZKDA 3B1YA 4JYCA 2CCGA 2RGXA 1DAIA 1S4QA 1SHKA 2OCYC 1KJZA 2AK3A 3EZ9A 1AJEA 1NN3A 3EZ6A 4DDTA 1CR4A 3B2EA 4LC1A 2BDTA 1EFHA 1K5DA 5EP4A 1AM4D 4NYJR 5HE9A 2OE2A 5EP2A 2Z4SA 2AD5A 3AP3A 3KJIA 4AURA 3VHXA 4MGIR 3M4YA 5FR1A 4XTRA 2VTKA 2WJJA 4RKEA 3RS2A 1JR3E 4KFTA 3WBKA 4G5QA 3KDSE 1W44A 3WYGA 3AF2A 1KI7A 1XU4A 1Z0DA 2CVHA 2J0UB 1O87A 1F5NA 1CRQA 2SHKA 2XB2A 4FIDA 1VYTA 3VQTA 1TF7A 3A4NA 4M4SA 2B21A 1US8B 1YQTA 2GJSA 4UNNA 2A5YB 5KHOC 2VP6A 1NJFA 2JATA 4KV9A 2GCNA 2ZI4A 2BWJA 3QKSA 1P61B 2X19A 4I1SA 4DT1B 1N0UA 1ONBA 4DCSA 2BBTA 3CKLA 3B6EA 1Q3TA 3KKNA 3O8RA 4IOKA 1XDBA 2CL6X 5KDLA 3HDTA 4A2PA 4BPBA 2FSHA 2GHIA 1G3MA 2XJ4A 2OBNA 1E9AA 3LO5A 3AKYA 4M1OA 3BFXA 2FGKA 2ZANA 1KI3A 3TAHA 3NC0C 3KQHA 5F9HA 4DUGA 1N6RA 1FQJA 2QAGC 4Q5IA 1ZMXA 2EVWX 4QHTA 3VR2A 5L3VA 3GLIA 1KY2A 2ECKA 4A4DA 4QJ5A 1Z8FA 2GBLA 1G17A 2AHOA 1Q20A 1GL6A 4BZQA 3ZIAA 1H8HD 4Q4LA 4W5JA 1VG9B 4BZXA 4IW3B 4A0HA 2XEXA 2QTFA 2C77A 2QAJA 5AJYA 2QMHA 3M0EA 4N1AA 3SJBA 3UMFA 4G1UC 4RCYA 4KODA 4PO9A 2QQ0A 5AR1A 4B44A 2A5DA 1B23P 2EWWA 1KJYA 5HTKA 1RYHA 4KVGA 5JBQA 2XNDA 4HAXA 2QORA 4KHZA 1QZXA 3LBIA 4ASUA 1XBTA 5C2JB 2GZDA 5B57C 3FHCB 2RGGA 4FCTA 2WWHA 1VCOA 1CR0A 2QTVB 3C8UA 1XJCA 1Z2AA 3BH0A 4WVFA 2YJTD 5KSYA 3B7GA 1GZSA 5C4GB 4BRUA 2W2TA 1KSHA 1WQ1R 5J5CA 4JL8A 1S96A 2IF2A 4PQRA 3RYTC 2BM0A 2R6GA 1W0JA 1ZM2A 2EWVA 4TLDA 3NEYA 1M7HA 2PBRA 4US0R 1RFLA 1N0VC 2BBOA 4MKGA 3QXXA 3Q9LA 2QE7A 4OQLA 3QPWA 2ORIA 3J81k 1FNNA 3NDPA 3WNBA 3UATA 1M7GA 1KMHA 3E1SA 2BIFA 2REBA 5GJCA 1MO4A 4HUTA 4ZCMA 5K8LA 2IYVA 2ZVQX 3BB3A 4QGHA 1E9BA 2JLXA 2WIAA 4B2LA 1KK2A 2D06A 4YC7A 2AL7A 1UJ2A 4QBIA 1G3IA 2ZETA 4Q7JB 2IXFA 2LKCA 1DO2A 1SVOA 2O8DB 2QI9C 4W5HA 5HKKA 4BFSA 4FWTA 4EFLA 3K0FA 2CDNA 4Q02A 1SXJD 3ZQ6A 1JXOA 1E9EA 2QP3A 2XXAA 2O8BB 3R9IA 1FFHA 4DLXA 1KMQA 4D0NA 4LHVA 2ZRJA 1JNYA 1Z6AA 4EAQA 4C0HA 3THOA 2JIZD 1N6KA 1LVGA 4A0RA 4ACAA 4YXWD 2WWIA 2AWNA 1KO1A 4BLQA 4PR0A 4OI4A 3OFND 1RVDA 3HU2A 2VF8A 2GESA 4BUJA 3PUXA 3DZDA 1QBKC 3ASZA 4MQBA 5B30A 4QNMA 4ARZA 5AUOB 4GMDA 4OHZA 3Q7PA 5J4KA 3LDAA 4URUR 1N5LA 4JLPA 5G53C 2R6CA 1JJ7A 3FWYA 2ZREA 3IKJA 4PANA 1J7KA 3TSZA 5H8WA 4GMXA 4HDOB 1VKJA 4KCGA 5BN3A 3CX8A 2W0MA 1ZM4A 1G3RA 3RRZA 4DXAA 4BLPA 2QM8A 3GLGE 4LWZA 1JI0A 4DVGA 1DE0A 2V1UA 3DOEA 2A5GA 2PCJA 1UBFA 4P31A 3SBEA 3IO5A 2WBLC 1W4BA 4XVQA 3EPJA 2OFWA 1E3MA 5BN5A 2JLVA 4DLWA 1H8ED 1NN1A 1AKYA 1R0WA 1Z83A 1JB1A 3HPQA 4D2IA 1HT1E 4DLZA 2CL0X 1DAFA 5G41A 3SBDA 5IF9A 5EE5B 2GRJA 3NVAA 3PEWA 1QG2A 4MRRA 4CT4B 3NWJA 4TZ6A 3R7WA 3TIFA 1OW3B 2AR7A 3ND9A 3CNOA 2WWYA 1XTKA 3EWSA 3WYFA 5KSOA 1R2QA 3BRWD 2VBCA 3WXMA 2PCLA 4KFSA 1IN7A 2JLRA 4WXPA 4ERNA 3AVPA 4MGZR 3RRMA 3L0IB 1DADA 3AKDA 2QENA 1TQ2A 3EWAA 4CRWB 3LV8A 4NCJA 5EQTA 3BFKA 4KSBA 2YYZA 4XD7D 4GL2A 4GDFA 4R9UC 1HQYE 4A0FA 5L3SA 4NCIA 4NP6A 2WSSA 5DLQC 4AC9A 3TSOA 1O3YA 1GUAA 4I1VA 2JAQA 1G8HA 3OIVA 1P9NA 2QBYA 3EASA 2JLUA 2ZSAA 4B48A 4AKHA 1XXHA 1SVMA 5J40A 4PQFA 1WDTA 1J8MF 1CJMA 3I5YA 2BBWA 2PX3A 4LDJA 1DVRA 2QU8A 2RCNA 4HYYA 4P3YA 3ECCA 5K8TA 4LHYA 1J2JA 4OI1A 1FQKA 4B43A 3VKGA 3LVQE 3QKRA 2PLRA 1IAQA 1K5GA 4YDHB 1COWD 2ZYTX 4Q4AA 1E2QA 3GLHB 2QG6A 2WZQA 3EZ7A 4M2LA 3DVLA 5BW8A 1P75A 3AVWA 2RGBA 3EA0A 3LLUA 1ZYUA 1E4YA 1LNZA 1IBRA 1YZGA 4N0EA 2J0SA 4EJSC 4D82A 4HUQB 3NBFA 3OEEA 4Q9LA 3P1JA 1Z47A 1LF0A 2ZSFA 4ITRC 3UMRA 5JWOA 2N42A 2P6UA 5L3QA 3ZVRA 1T8TA 4DZZA 2KBFA 5E3HA 2DWPA 4PXAA 4MH0R 1BOFA 1E1RA 2AKYA 4HLUC 1BYIA 4OK3A 5DISB 1BYUA 3OIUA 4X8HA 2R6DA 1KI6A 1SKYE 4EPTA 2ZR9A 2GAAA 1ZD9A 2EFHB 3R8CA 3OZXA 2RKOA 1BH2A 3WP1B 4JKIA 4O0MA 2F3RA 3TNFA 3TUZC 2MSDB 1DAHA 1DG1G 1CJTC 2E1RA 4CEIA 4WZBE 4Q9KA 1VG8A 4XOIA 5DN6D 1F6BA 1FPMA 2IS6A 2OFXA 2CE2X 2QGZA 1U8AA 2EU8A 1GILA 1LS6A 3BK7A 3LX5A 2PZGA 3CRMA 2HJVA 3CRRA 2EFEB 3QF4B 1YZNA 2JLWA 2FV8A 3PEYA 1G5PA 3ONWA 4P4SA 4TL6A 1E2NA 5DGXA 5C18A 4F92B 1KO4A 3P32A 4AKIA 1X8LA 4M22A 2ZI5A 5KO2A 2BOVA 3LXRA 5GVSA 2IUTA 3IHLA 3I1FA 4EPXA 2PLFA 3CWQA 1U94A 2ZRPA 1GRNA 1E9RA 2Q3HA 2VEDA 2G1JA 1AGRA 2IHYA 3NTUA 5KPDA 2HLDA 3BJIC 3WBJA 1ZD8A 1AKEA 3FHOA 4PPGA 2ERYA 4PPNA 4BFYA 3EZ2A 4QM7A 1G20E 5K8UA 3C41J 2QP9X 4EPWA 4HATA 1GDDA 4LJ6A 4YDSA 3KQLA 4BFWA 3KX2A 2H92A 3EIHA 5JEEA 1ODFA 2FSIA 1OHHA 5FBLB 4HAZA 2BVNA 4JJKA 1L4YA 4BZPA 2NPIA 2QPOA 4MGYR 4JVSB 1LW7A 1KO8A 5TXGA 3L0PA 1E2FA 2HCJB 4DHEA 3THWA 3B8HA 1KO7A 3ZH9B 1WRBA 1XCGB 2DHRA 4I1UA 3K8YA 1T91A 4HAYA 1ZJ6A 2C8VA 1XB2A 4DUGD 2F9LA 1JPNA 5FOWA 1M34E 1W48A 2KI5A 1E2PA 4IOMA 2VHJA 2ZTSA 4BEJA 3SQXA 1Z6GA 1SZPA 1YZUA 2J7KA 4YMUA 3W90A 2V6IA 3X1DA 4GBMA 1JAIA 3BFVA 3LA6A 2B7CA 3TR5A 3ZIAD 4B35A 3UPUA 1TF2A 3C14C 3TSWA 2ZI6A 2OZEA 1G8YA 2GETA 5DHAA 5BQ5A 4Y0AA 1DARA 4H1UA 4IDHA 3PIRA 2YKGA 4AY2A 1WBBA 4Q19A 5FUXA 2D7CA 1II8A 1XP8A 2QY9A 4Q00A 4LSGA 2XNDD 1Y63A 1G9XA 1UKZA 2FPLA 4URVR 1Z3IX 4ASUD 4BEBA 2VHQA 1PLKA 2QPTA 4IJMA 3RS7A 3CRW1 1G7CA 4GOXA 1E2HA 2W6JA 4RD3A 2FFQA 4KJZA 3GFOA 1R5OA 5H1YA 3B9PA 1UAAA 5J4VA 4X8MA 2R6FA 4TL8A 5KSPA 3X2SA 1G6HA 1JALA 1VYUA 4LYFA 5BYJA 1OXXK 2GCPA 1W0JD 4UJ5A 1T5LA 5EXTA 4TMVA 3MSXA 4US2R 1J99A 2FZLA 1OPXA 1EESA 4DBLC 4B3DA 1UDWA 3EG5A 3W3ZB 4EKDA 3AM1A 5JHHB 3U3JA 1E79A 2QE7D 4JLAA 4A8JC 5KDOA 4KLNA 2IW3A 4TQAA 2VP5A 2I1QA 2OM2A 4YONB 3EC2A 4KITB 2OLJA 2P6RA 1IN8A 2IUUA 1ZUNB 4B47A 5FOUA 1KAGA 4V0KA 1Z63A 1EG7A 4KBFA 4PHTA 2B7BA 1U0JA 3MGCA 1XTIA 2JA1A 4PHGA 4DRZA 2O5VA 1SXJA 1XD8A 2QZ4A 3MUFA 1XMVA 2ZRFA 5FI1B 1SVIA 3RNLA 2AFIE 1D9XA 5HKKD 2WPDA 2ZVPX 3W6NA 4B6EA 1SXJE 4JS0A 4M21A 1NSTA 3EPKA 4UNQA 3V4RA 2WHXA 2WKPA 4R7ZA 1B0UA 2MSEB 2QT1A 3KKOA 4OK5A 4Q4JA 4V0ME 2L0XA 2WM9B 1HE8B 2X2EA 4TT3A 4IDPA 5HZKA 1TUIA 1EFCA 3IUYA 4HSEA 4LPSA 4QGAA 2F3TA 2RAPA 5JCPA 2ZSBA 3NIBA 3L8YA 1RZ3A 4JMPA 4ABYA 4JLJA 2GILA 3S1AB 3GP8A 3U3OA 4OBEA 3JZAA 3LD9A 5AJXA 4OI2A 1IOZA 1HE1C 1E6CA 2H18A 4KAXA 4OHVA 2P65A 2QAGB 2YWGA 1OIXA 3PG5A 4D25A 3MD0A 3CW2A 2CHQA 1XD2A 1Q1BA 1V5WA 4UKDA 1YRBA 4DEYA 1KSFX 1GTVA 3BIFA 5HCIA 4BASA 3B78A 1GKUB 4LJ5A 1WXQA 2VLIA 1N6OA 2HF9A 4RD6A 2V3CC 4TN1A 5FBVB 2ZRKA 4O2RA 1AN0A 4LBWA 5LB2A 1U8ZA 4XTCS 3RC8A 3CPJB 3GJ8A 3RWOA 1XX6A 3P27A 1E9SA 4JLMA 1Z29A 1L4UA 4DDVA 1H8EA 1G7TA 1N6IA 2F43B 3THYB 4EDHA 2VHTA 2OLKA 3Q5EA 2FF7A 5TDHA 1TAGA 2ZUDA 4MYHA 3LRPA 3EIQA 4C3ZA 4TMZA 4AG6A 3GLFA 4OQXA 1J70A 1IN5A 1FNMA 2ZUCA 1R0XA 3KUDA 2X8AA 4DKXA 4LRWA 2PEZA 4CEHB 1NP6A 4XWAA 1L8QA 3U6KA 1R5NA 1DAGA 2Z5FA 2BJWA 3VR3A 2V9PA 3GJXC 1E0AA 4BLTA 2XB4A 1CS4C 2Y8EA 3BE4A 4B3GA 2G1KA 2C2HA 2GXQA 2J7PA 4Q1AA 1W5SA 1YRAA 2B92A 4FWIB 4PC7A 4BFXA 3C7KA 4F4CA 3AP1A 1CEEA 4HZIA 4HAVA 3ZZ0A 2A7QA 2W6IA 3K09C 4FMDB 3MWYW 1UKEA 4JKYA 2UZ3A 2ZYVX 5H70A 1KJWA 3PUZA 4DDWA 2X77A 3GJ7A 2H16A 4BE7B 3PFIA 4I99A 2WSSD 1XJ0A 1DELA 2FSFA 1W2HA 3W3AA 1XPOA 2MMCA 2OHFA 2IS2A 121PA 4RZ2A 1R0YA 2WKQA 3IGFA 2Q21A 4OJQA 3KQUA 2HJGA 1BO6A 1HEIA 1IY1A 4A15A 4O25A 3PR1A 5UKDA 1W2GA 1BKDR 2WJIA 2XZPA 4DCTA 1M6NA 1Z0FA 2J0UA 5AJZA 4ZV4A 2N1BA 3CH5A 2BM1A 4NYIR 5DSZA 3TK1A 2EFGA 2WJGA 3M6AA 4HZUB 4D4MA 1IXZA 4MYCA 2ZRAA 3TVDA 2O0JA 1KIMA 2W2VA 1U81A 2N46A 2A2ZA 5FPSA 4TLAA 4ZDWA 3IPXA 4DJTA 1ZW6A 3C5HA 1GRRA 4MKFA 4BGDA 1P2VA 1LFDB 1JPJA 1E9FA 1IN6A 1RKBA 3C4JA 2B8WA 1GRQA 3CLVA 4MKIA 1NBMA 3GEIA 3IO3A 3OEED 1R6BX 5CIWA 5CDFE 5JMTA 1Q1EA 1AS0A 4G01B 4QGFA 1XTRA 3RSOA 2HT6A 2IA5A 3EPHA 1Y3AA 1Z22A 1Q57A 2VP0A 3FGNA 2JJ8A 1E1RD 4HDQB 3SHFA 3SFVA
chains in the Genus database with same CATH superfamily
5AKGA 3CF6R 4R81A 4GG1A 3TMYA 1D2CA 1YV9A 5ENZA 2I4RA 2YXEA 1EFVB 4FMPA 3UWMA 3ZU2A 1SOMA 3G0GA 3OJXA 2R4UA 2VAXA 5K3CA 5F98A 2HXSA 3CF4A 1PW7A 3QIAA 5AJHA 4TWJA 4EB6A 5DHSA 2AX3A 4WBNF 4BECA 3G5AA 2BEWB 2J67A 4O2BA 3TZHA 4OH1A 4C0LA 3ZGNA 4TMFA 3NHAA 3ICWA 1GJRA 1WS6A 2H4HA 4UREA 3PJRA 5JVDB 2QYHA 4QU5A 3P94A 1RFGE 3SIWA 1YQXA 3AF5A 1ZIPA 1LJLA 3KOMA 3R77A 1RLJA 2WJHA 3AU9A 2AE2A 4TKLA 3D6JA 4RZXA 3HJCA 3TBHA 4PGGA 1PT8A 1CUXA 1DDIA 2RGAA 4RY8A 4ZO4A 4II2A 2I2XB 3KOYA 2O2XA 4Y1RA 2R00C 4E5UA 1H1LB 1XTVA 4PINA 1GNTA 1K8QA 3F5FA 2ZJBA 3QP9A 3VC2A 2AC4A 2GEJA 3BHMA 3R3YA 2GMWA 5B3JA 3G2QA 2AQKA 3DAOA 4CFZA 3RS5A 2WWRA 3R3JA 3NG1A 2EQAA 2HLDD 2YHSA 5KO2A 4H08A 1O5OA 1Z28A 2AMVA 2HRQA 4FX5A 3TIVA 3FROA 2YOHA 3T41A 2DQKA 4YAGA 3WWOA 1W5BA 4L78A 1U6JA 2FZ4A 4IUCS 1FP7A 4E11A 1F2TB 3Q87B 3F78A 5C32A 4M1EA 1EWKA 2VPTA 3IILA 2A5FA 1EX9A 4W8OA 2R6HA 5BNFA 4BVHA 2PZAA 1GZ4A 4GVLA 2H00A 1QBGA 4FK8A 4ROSA 3C8HA 3WDMA 2FA9A 3NCHA 4QFCA 3HZRA 1P0FA 4BP3A 1CNMA 4HAIA 2PJUA 3CONA 3AERB 4OQPA 3VU1A 1MT3A 1XEXB 2WTAA 4HKTA 4B2IA 1ISPA 1WB6A 5IAKA 3F4LA 3GJZA 2GM5A 2EFDB 1P80A 1UPCA 2FFAA 2VH1A 5LUBA 2P9HA 4E7PA 5K8VA 2E21A 4K6GA 1ZITA 3FLAA 5JAPA 3A4VA 4ZYUA 1IY0A 1U1FA 4LZWA 3IURA 5F2EA 2DPXA 4DSNA 1NX6A 3FMFA 1YR1A 2BY4A 2IWHA 4JBXA 1OIVA 1Z7BA 2NO9A 1DRJA 3NM6B 4H4DA 4MR9B 1QAMA 3C7TA 1UBTS 1Z15A 1Z2PX 4HH4A 1CE8B 1CUIA 1G0NA 3HVHA 3AK4A 3QHPA 4L3OA 4OQMA 2PZKA 4QSMA 3K6SA 2I91A 4IFBA 4IVQA 1BWPA 3K9NA 1V6AA 4LNAA 3T0FA 3TZCA 5AVWA 4GZ6A 3UQYS 3IIEA 5K0GA 5KOYA 2ZJAA 4X85A 3OPNA 3ORFA 4X92A 4EJSB 3L2OB 1D7OA 1IOLA 4QBFA 5HK9A 1YHNA 1BXKA 4BGEA 3I4CA 1R9MA 3ONFA 3T7RA 2I8CA 1W30A 5BORA 4L02A 1TK3A 2TECE 3QI2A 2O2YA 3R0IA 4JOQA 4QPZA 5ALMA 3SFZA 5AUQA 5KAMA 1APBA 4MK4A 3OJEA 2UUOA 3RRYA 1N9KA 2GASA 2D1TA 2W00A 2P6OA 1U65A 3EQZA 4H7EA 5DW0A 3SKXA 2LR0A 3LUHA 3KHSA 4KFRA 1KEVA 2Q8PA 2FRDC 5IMBA 2ZJ4A 1PYDA 1JLKA 3H0CA 3K72B 1XMIA 4OIMA 2VDUE 3GJQA 3VU3A 4GM1A 1FL9A 4PEVA 1F2DA 1VSVA 4WW0A 3S7ZA 4B33A 4D41A 1HT2E 1NVXQ 2OVBA 3AJDA 4DHWA 3E5RA 4CG1A 3S3TA 3JQAB 1K08A 2EW2A 2GDJA 1ZD3A 4E51A 4F38A 4LJRA 1E1YA 2ZCVA 2O1WA 1E79D 1XZPA 1Q22A 4V2UA 2CDBA 2RHOA 2Q2NA 3RIMA 3QHQA 4D8UA 1O8CA 1UAGA 2RKWA 2WYOA 4LOJA 4NU0A 2I7VA 4WXHA 2ZWIA 1J33A 4PF1A 3D81A 5E9AA 3TD2A 4X64B 4LXXA 3T9FA 2PL9A 1B93A 1THMA 1DB3A 1LPMA 1PUXA 1F5SA 3LK7A 5D01A 1AUOA 2A0UA 2HH9A 4K9NA 3TF5A 1I2ZA 3B1WA 5KKCA 4Z4IA 5IYZB 4ENVA 1W1WA 2HIMA 3PCTA 4ILEA 5JFOA 3DNFA 3GT3A 3IDQA 3LP8A 3U2QA 4HAWA 3DBLB 2JHCA 3GT4A 4RY9A 4DC9A 2CUZA 3QWHA 4ND8B 2QD5A 2R9VA 5IJZA 2GXAA 4TQ9A 1JVSA 4J0QA 1OF1A 4FHZA 2ZBDA 1NQUA 2FSGA 4EGFA 2H2FA 2QI9F 4CDRA 1O5IA 4E08A 1PS0A 3QKIA 4KX5A 2MYPA 4QYSA 1QO7A 5ALLA 1HYGA 4JP8A 3F67A 3L0SA 1J0CA 1KSJA 4ND7A 4RZUA 5K4HA 3ZI0A 4CMCA 2OENG 1DRWA 4C06A 4Z4EA 1UOQA 2ZGVA 5CNKA 4I9UA 1P39A 2NSHA 1XTSA 3HA2A 4U02A 4XR4A 3ANTA 2DYKA 3I23A 5F12A 1H6DA 2WYVA 3R5XA 4RK5A 4TRNA 4UM9B 2EX0A 2HREA 3GGOA 2H9IA 3EIFA 3L40A 3CB4A 1YULA 5KOIA 2ORVA 4A6PA 2FW9A 2QN6A 2VP3A 3KKPA 1KEWA 3OZWA 4K3VA 521PA 3ZGXA 4EHDA 4O6VA 3AKZA 4CMIB 4ZTUB 4HNRA 3GOHA 3GUZA 2QDKA 5I7AA 5IH7A 2DX7A 3FR8A 4R2JA 3DPIA 1NU8A 4NBLA 3SU8A 4GPAA 4JLWA 3N07A 1F7VA 2I71A 4N65A 3EH2A 1TUEA 3WY9A 3GVHA 4US1R 4Z86A 1GL9B 1H0HA 3KQTA 4WEQA 4EEZA 3BIJA 5JLJA 3BPSA 1XPJA 3D1JA 3EC1A 5BSWA 1BE0A 1U7XA 2BGIA 3C87A 3TLZA 4XIYA 2W42A 1HT3A 3WHKA 2RHBA 4DYDA 1V45E 4P4GA 2NSYA 4CLXA 3IRVA 1Q44A 5HW0A 1TL7C 1ZMRA 2C78A 2CLSA 3MHPA 4S1WA 1NRIA 2HGSA 1KFJB 3GLHA 5FUWA 1UQTA 2DGDA 3CZRA 4PYMA 4Y98A 1HLFA 3CNQS 3IAHA 3PHBE 1L7EA 2Q0SA 1NFFA 1Z0JA 3H2BA 3PQ7A 4GC9A 4M7WA 4MUNA 2WOJA 2F3PA 4CMKA 1SBCA 4J76A 3R9KA 4Z9YA 2Y0PA 2EF0A 3VYTB 1O96B 1OB5A 3R3SA 4RH0A 1S9DA 3GAFA 2YQZA 3U39A 2PE5A 4O1IA 1WXGA 2Q4TA 3D2CA 5EESA 2XCQA 3DB2A 1KAEA 1C7QA 4CR6A 4EVIA 5K6RA 4LZJA 3A3NA 2NWQA 3OQIA 4I9NA 1FRQA 1MGPA 2VI5A 4UD2A 1TCBA 3FVQA 1GAQA 3GNLA 4OREX 5CJ2A 3SQWA 2GFQA 2Q3EA 4ISCA 5BYBA 1OGIA 1WCWA 2PDAA 5EZYA 5JZVA 1YT5A 1KS9A 2EJVA 3N70A 3V6LA 4C3UA 1DIAA 1F0YA 4KNVA 2EFCB 2PQMA 4PCAA 1B6GA 1OX5A 4FDMA 5KWIA 1RM0A 2HRRA 2HF8A 1QCZA 1WUKS 2E18A 1NF9A 1SXPA 3UV6A 4MR7A 4CI9A 3AKEA 3QF7A 5CG1A 1XZLA 4P22A 1ONNA 4H1VA 2X0KA 3ZY2A 3DLCA 3PRHA 3UOWA 3RTDA 2A58A 4I9GA 9LDTA 4MROA 2A9KA 2QUKA 3MJSA 5J63A 4L73A 4B1FA 4DWOA 1QLWA 3VV3A 3JATA 2JBWA 4JVLA 2MWMA 4FR0A 1AUXA 1SOWA 1F51E 1FTSA 2OHOA 3AIOA 2IZ6A 1P1BA 4QGBA 1EJ0A 3ONNA 3KB8A 4P0TA 1N5MA 2ZJOA 1GCIA 3AR7A 2FWIA 4MMZB 2Z83A 1DU4A 1GEGA 1KGDA 2Z95A 1ADGA 1NP3A 4PNEA 4TZ0A 5KTTA 1OPRA 4CCSA 1I7QB 2YWBA 2BFAA 3R8FA 3ACCA 3AF0A 2WM2A 1AKNA 3FF4A 3PZRA 4U0KA 1GPLA 1ZP6A 5HKLA 5TS3A 1ETHA 3TIGA 3H5IA 1PR6A 3VPDA 3QUSA 4HDNA 2IU4A 3OZVA 1DTWB 3MWKA 3RT9A 3ZV4A 1IH8A 4BQIA 5C5EA 4N6GA 1TEXA 1RRMA 2WUEA 2EXXA 3EAQA 2CNDA 2C57A 1L5VA 1Z6YA 3OI7A 1TW3A 3NZEA 2OOKA 4UE2A 1F9AA 3R23A 4G4IA 2Z2KA 3K2EA 1M1NB 3L05A 5G0VA 3WA7A 3WMRA 1SQ0A 2H57A 3MS4A 3Q88A 4KYTA 1JJFA 4HGOA 5CYFA 5CK5A 5JRJA 2HQSA 3GJRA 4DA8A 2O1XA 4AMYA 1ESMA 1YR6A 1FFGA 1G8PA 1YZ3A 2G72A 4UTPA 5ES4B 4UAJA 5KNDA 3I04A 2ZQZA 3TNLA 4IH9A 4OHRA 1NC3A 2QTHA 1MVOA 1V0JA 3P9NA 1QLHA 5F5LA 3PPWA 1P18A 1UKAA 2VXOA 1GAEO 3TW8A 3S2SA 4BMPB 5CHEA 3U31A 4RTJA 4EKEA 4CXMA 2AV6A 2OY0A 3EUWA 1SRRA 2Y05A 3NI2A 3HP1A 5FOSA 3GJ5A 1TRHA 3ITNA 3EODA 1OXKB 2LCFA 3SIRA 4HWRA 2GN1A 4S12A 4V0LA 1KZGB 1J20A 1UP4A 1LU9A 4WUTA 2K2WA 5T4HA 1T13A 1IY2A 3FDXA 1X13A 2E4VA 2QUBA 1EAYA 2XYVA 3N5CA 2Q6LA 4OHCA 3TLKA 2VXYA 5G1OA 3H97A 1FMJA 4JNCA 1CY6A 1WUYA 4Q3CA 1VPDA 4JWTA 4XSVA 4EG3A 1ADJA 3HUEA 1NVEA 5G3YA 2R79A 1ADCA 4EGSA 1XTQA 2CZCA 3CA8A 2ZIXA 4WHMA 1LVHA 2OEPA 1OFHA 1A5TA 2IELA 2WAYA 4NZMA 4UAVA 5AKHA 4Z2YA 4G07A 4QJ3A 5JRDS 1PE0A 4DLRA 1BHQ1 3WTBA 4JT8A 3MWJA 1PWYE 5COAA 1M2FA 1W59A 2ZI3A 3EOBI 3SEFA 1TLFA 3CINA 4XQGA 3VKUA 2O8CB 1T34A 5JS6A 2DUUA 2WABA 4XB2A 4ZAGA 4MPTA 5MHTA 1KKLA 1SCUB 3C1UA 4LI0A 5FRDA 1NRXA 1MEEA 3SGLA 4ZVSA 1GGEA 1FMLA 2GBLC 4PXYA 5AM3A 4PXSA 1R8XA 2QMYA 4LNUA 1T5HX 4D45A 3PGMA 2GK3A 1WHSA 1Z75A 1KI1A 2IYXA 1XGKA 3CUVA 3KFLA 3PA8A 3OM9A 4PAWA 2HRBA 3RYFB 3A6ZA 1JR6A 1PK7A 2HSZA 1NOKA 3H99A 3JSAA 3RD5A 3AF1A 4LN1A 3RUPA 5E1OA 5BMOA 5F33A 1MQSA 2AW5A 1BCSA 4IFEA 2OCPA 2FDCA 2A6PA 3IB6A 4GU5A 3WGJA 2J30A 2G71A 3EIEA 4GKKB 1GYPA 4G36A 3AOEC 4BMXA 2NZ2A 3LKDA 5C1IA 1YACA 2HBYA 2RCYA 5A6SB 3LL4A 4CMBA 2LVBA 1ZZEA 4OQ4A 4GBGA 3F6SA 4KGVA 3UYKA 3GAZA 3SSNA 4YRCA 1O8BA 4DB2A 3NBYC 5ICCA 5EJEA 1LUAA 2YIMA 2BGMA 4OJMX 1AQLA 4IJKA 4B73A 5AVXA 1R6XA 1W1IA 2PZLA 5FX2A 2G28A 3N2EA 3CLTD 1P29A 3LBAA 3EY9A 2DKNA 3HPRA 4OKSA 5PNTA 2I67A 3K35A 2NOAA 1D0VA 5B2EA 1O97C 3U0VA 2FX5A 1T8YA 1WWKA 5CYOA 2F8TA 1NNEA 3OZCA 1JJVA 1KMMA 1KR5A 1PR2A 2IEDA 1NW7A 4N6OA 4BGUA 2D1FA 3RBVA 3BJMA 5H0IA 2SNIE 5JC1A 3C3BA 4EF6A 2DM6A 3IL2A 4WN9B 1QH0A 3K0EA 3VYRB 3JVEA 3JYPA 3EAGA 5CDUA 4ETWA 1SCAA 5DGTA 4C21A 2J0EA 2PJZA 2ATCA 5HMMA 1DIRA 4BDTA 4EFKA 5IT9A 3D64A 4OFBA 4TX1A 4D9HA 4ED9A 1T5SA 4I66A 4EZBA 5AW4A 4DUYB 1FMFA 2Q3MA 2BMAA 3EX7C 5EUQB 3VPAA 4H31A 2L42A 4OGGA 4HH1A 2C5LA 5HDQA 4HNHA 3SOPA 3A7EA 3JQ7B 2Y67A 1WBJB 1RNLA 3P26A 2GK4A 4KXFB 4FM9A 4UMVA 1A2BA 1YWGO 3A2NA 2RB4A 3MGKA 5AICA 4FVTA 1RS0A 4E1AA 1Z2OX 4OU4A 4HI0E 1V4NA 4XGIA 5EWJB 3AVYA 4WEOA 4GR9A 1C9KA 3OE5A 4XVRA 2QXTA 4OMCA 1G20B 4I4CA 4BNDA 4OY3A 4PG8A 1W85B 4UFPA 3DDOA 3V3TA 2Z8XA 1GGHA 2O20A 4HVAA 3T3MB 3K71B 2BEUA 2VZEA 1EUCA 1NIJA 3KAQA 4LSZA 3ROGA 3F73A 4Z53A 1RHMA 2YJGA 3E6AA 1IM2A 1DIOB 4FMCF 5MN6A 2C59A 1H4QA 1U7HA 1QH8A 2DRIA 2PBLA 4PZUA 4U6NA 2F43A 2V7GA 5HIKA 3RAFC 3SYKA 2XRZA 2DFPA 1W75A 3CF4G 2QA5A 3UT5A 1CQJA 3FTNA 2JRCA 3H2YA 4E88A 5KYNA 4KR3A 2J3HA 4MDEA 2FGJA 2AHRA 4KLCA 4OL9A 3HU3A 1FJ2A 3W2TA 2AK2A 1UPXA 3BTUA 3U4IA 4K9MA 4M1ZA 3T1QA 3VR5A 1WZ2A 4B3XA 2O8EB 1ZLXA 4IG4A 3H6KA 4JVMA 2Z57A 2Z1DA 2QPAA 5JECA 2YINC 3H11B 1OUMA 2ZBRA 4ZP1A 1G5RA 2W2OA 2GKSA 1TQ4A 3HBFA 5CCXA 1JG3A 3OKPA 3DCNA 5CXSA 4UVHA 2OYRA 4DIEA 4RW0A 1X1TA 1G6OA 5D86A 3MTGA 3QFFA 4O08A 1D09A 1SD1A 4NNPA 5FV7A 5B4UA 1TNDA 4YUYA 3H5WA 2C8KA 3PYXA 4I4TA 5DTIA 2ETXA 1Q16A 1M1YE 1M76A 2GM3A 4OQFA 3AF6A 2ZPTX 1B0AA 3M89A 2Y1OA 2H2HA 2QM3A 1T2VA 1X7XB 1O7JA 3C16C 3DMGA 3F71A 3K1JA 1GZ3A 3A8TA 4NCNA 4NZYA 1GTL1 2DBQA 3DO6A 4LXIA 2ZSDA 4X84A 2R3SA 4BNWA 2FMTA 2I87A 3A9RA 4IEEA 5E6RB 1QCDA 4II3A 4B6PA 3RK1A 3NM4A 8ATCA 2CVFA 1TLTA 2FJUA 4LS3A 4TLBA 1RJ9B 2DHQA 4PWZA 5BRJA 4HBZA 1KWGA 1HY3A 1LEHA 3BVPA 3SZLA 2XE7A 5IFLA 1AMOA 4MB2A 2VF2A 1CUZA 3B53X 2FOLA 5KYKA 4CM4B 5ENVA 3GIDA 5KS2A 2WVAA 2IY9A 3C4VA 3FUUA 4FILA 3QYJA 1OFVA 1VBMA 2OKGA 2QGFA 4FGUA 3MK31 4PNZA 5HBGA 1U6KA 2XYQA 3L8ZA 3OHPA 2HNAA 4P86A 1EFTA 2NPFA 1HA3A 3IE2A 1QDEA 5JG7A 2Q1YA 4G8CA 4MULA 4AO6A 3KL2A 1V3TA 2WAXA 4CMGA 1G4AE 1MR3F 1V1RB 1UADA 2GLXA 1BMTA 2I2CA 2VYQA 3BWDD 3CX7A 1WAMA 3DZ8A 3OLVA 3QYAA 3C45A 4J6EA 4MWGA 4XIGS 5TF4A 4DMKA 2Y27A 1NVUQ 4ZI7F 1N7HA 5B7GA 1X7ZB 1UAYA 3UWOA 1CJSA 2PEYA 1T0HB 2WM3A 1XFAA 3R6LA 4JD5A 3I1YA 3LLVA 2ZWMA 5CPBA 3QKUA 5DLEA 3GGPA 5HQTA 3TXYA 2PBZA 1RCUA 2X22A 4REOA 3PFCA 1UFQA 3ELUA 1DS6A 1WZNA 4WNAA 2C96A 2ATVA 1HDIA 2VK2A 4GE0A 2XMPA 3A9CA 4X91A 5AH0A 2BFEA 2C03A 2H5EA 1UEJA 1XF9A 5IKOA 5KTMA 1RM5A 1RACA 3HY3A 2ZITA 4CKWB 4FNMA 3MWLA 4YCSA 5BUSA 3RU9A 4Q3KA 1QDUA 3PPXA 2FK7A 4MUBA 5ED4A 1XMSA 1SXJB 7REQB 1I6WA 3LCVB 2PA0A 2MSWA 2YMPA 5EXSA 5IC6A 4Q1EA 2CFIA 1FNBA 1MENA 1H9AA 2X8JB 2XYPA 1R4MB 1OASA 4N39A 2QUZA 1UC8A 3GAMA 1GR0A 4LHSA 3M83A 3QEOA 4KSCA 1Y8QB 1J90A 4UQOA 2FETA 3G2OA 3MW8A 4NARA 3SZOA 3VNUA 3H04A 5HPYB 1EHYA 5EE0A 2FLWA 2BEWA 1J8QA 1QFMA 4RENA 5C7OO 1MB0A 3WV4A 2D5IA 3ZY6A 4EW1A 5J2UF 4NONA 4DMFA 2IV2X 5JVDA 3OCZA 1BC5A 3NETA 2RHWA 1TKRA 2ES4A 2BFBB 1N5JA 3FYCA 2F00A 4GDMA 5FADA 5LD2C 2AN3A 2FXIA 3R3WA 1H1LA 1M7BA 1NE7A 2IP2A 3N7UA 4R9VA 2FSUA 2UZ4A 1PV1A 4RXUA 1RJGA 4ZIRB 2DHEA 1ZJ5A 5HMLA 4XUEA 4DIOA 2QX4A 2AEMA 2FPOA 4B7CA 4CQJA 3M6IA 2ZWPA 3GRYA 3AGQA 4F5YA 1ZN2A 3HBJA 1QP7A 4EECA 1KK0A 1T8SA 4OMDA 1A5ZA 5FUYA 4HEA1 5D6NA 1YB1A 2ZSEA 4NBUA 4J16A 1XWIA 4M9CA 5D2CA 4DT1A 1ORHA 1GG5A 1SOVA 5LZ2A 2H7YA 1QPZA 3E53A 3KXIA 4E09A 4PFQA 4X7PA 2QMZA 3ZD9A 2P79A 1CR1A 4CKXA 3IP6A 1W36C 1F2TA 3P96A 1IE3A 2NO5A 3M82A 4FOTA 4L5BA 1T4GA 4KUGA 4KXVA 5C5CA 1P3Y1 3E8MA 5F76A 3SYRA 1JGTA 2OGSA 2Q4BA 3FMOB 1SU4A 1TUBB 5EIFA 4C5BA 4WK4B 3KZNA 3PICA 1EAMA 4RV5A 5HZMA 1PSWA 4JZYA 5AVRA 1A2OA 1B8VA 1GSAA 2IEYA 1XEXA 2WWGA 2FN3A 3AERA 1A7JA 3IIKA 1TPYA 4JEMA 4C5CA 1P1JA 3N2KB 5CLGA 3A9TA 3WRYA 2F3SA 2R7KA 3LS2A 4EJFA 1QXSA 4B6RA 4ZVLA 2R60A 3GJ4A 3SJZA 3DZFA 3STYA 3VZQA 3ZJYA 1Z06A 3E9DA 3PSAA 2TMKA 4IRXA 1CY0A 1GQ2A 5JCOA 1K8ZB 2B8TA 2V5UA 3NHMA 4BZWA 3UUWA 5KTSA 3OLWA 1GL7A 2ZR8A 4E2FA 4JR1A 2NN3C 2D3WA 1S1CA 1ZXBA 3IQZA 4OJYA 2DBYA 4ZU6X 4YUWA 3VU9B 4MR9A 4JLVA 4Z3DA 1V9CA 1I4OA 3H19A 2Q6VA 4C4SA 4QD3A 3CNNA 1CE8A 1MNQA 4AKSA 3A4MA 5A0FA 2GBPA 1ESCA 1YD7A 1OLOA 4RMJA 4JLKA 4EJSA 1G0OA 1AMNA 3IXLA 5E4YA 3KAJA 2XODA 2OXRA 4HFRA 1P5FA 1H9CA 1M6WA 1U4OA 2ADFA 4IV5A 3P4YA 1S3GA 2A92A 4KYIB 4LZAA 1YA4A 3JQCA 4U9UA 4YAKA 5J4YA 4CR8A 2Q8NA 3TNJA 3LQRA 3CIFA 1NVWQ 4IQGA 1A98A 1WW8A 3DWGA 1JA0A 1WX1A 1G18A 2JGEA 3HDVA 1OFUX 2SICE 3REGA 3RTBA 1C81A 1YAJA 1TI7A 1XZEA 1XDUA 4L0MA 1OBOA 1R10A 3DYIA 4H15A 3S2EA 1IXYA 2GK7A 2Q7DA 2D54A 3EW9A 3P9RA 3Q12A 1BQEA 1L3CA 3TEMA 4EG1A 4ZREA 2AJ8A 4ZU1X 4W63A 3NGXA 4KQEA 4IJ6A 3NOQA 2WP0A 1RRFA 2EKZA 3AV0B 1F60A 4B32A 5I3ZA 5KWSA 1WG8A 2A30A 3CT4A 1UKCA 4NV0A 3BTVA 2WUFA 4HN9A 4U3JA 4ZOAA 2EFYA 2Q07A 2XDAA 1UBGA 3A3OA 4Y2RA 4XSHA 4ZAYA 1WM1A 1DMSA 4COKA 3NGMA 4PYLA 2DUMA 1JQJC 5DNDA 2HDNB 2WHYA 3FCEA 2WNHA 4H3VA 4IGAA 4WERA 3TI9A 3HJNA 4JENA 3GX1A 5IYZA 2CFSA 1UBKS 2PKXA 3D4OA 3HLTA 1AQ6A 5B64A 3AV3A 4TV9B 4MGHA 2BKVA 4PLTA 1GGJA 1XCPA 5IVKA 3TX2A 4PX5A 4B34A 3DBLA 2QD2A 4ND8A 4QQKA 2Y1CA 1XNGA 4XVUA 2JFBA 5D6OA 1LX7A 1NXSA 5I4KA 1USIA 3QOFA 5F4BA 3W1WA 4CV0A 1J8YF 3JQPA 3OKFA 1O54A 5KREA 4XYBA 3UJ9A 1LRKA 4HGPA 3OD1A 1EDZA 2C4NA 1G16A 3HACA 4A92A 1B3BA 5DWQA 4HR7A 2VHXA 1FFXB 3A58B 1GNRA 4L4RA 2HRZA 3A6DA 1I9CA 2IYTA 2QX7A 3W8EA 3HCBA 4I2VA 2G9NA 4AB1A 2DUWA 4CN8A 1B6SA 1RRPA 2DECA 4M9SA 1Y6QA 5DCYA 2FN7A 3K7EA 3KKQA 4UBMA 4M1SA 4AY3A 2HEGA 3M5CA 2JAUA 4OO3A 4QYWA 2KS6A 3BORA 4XCVA 3L7JA 2C7QA 1X86B 3D6NB 3S1LA 4FLMA 3B9QA 4D9JA 3VHXB 2J1LA 2VSOA 1P60A 2CV2A 3CRNA 2XUOA 2C99A 2HA6A 3RAJA 1WKVA 4CMIA 3HCEA 1U2RA 1XWWA 4GEKA 3NBXX 1GG8A 1X1RA 1EDOA 4C6TB 1UIRA 4KR9A 1WVMA 1ZBQA 3TQFA 4EMTA 1TM2A 3SZ3A 1TGYA 4ZV9A 1OXTA 2OV3A 1ZUD1 1U3WA 3NIGB 2FCRA 3OO0A 4CM3A 1IHOA 3I53A 3PFKA 3T1YB 5GM2A 3WC4A 1HETA 3PA6A 1UK8A 3DHWC 4AZWA 3DW3X 1QAOA 1OKKD 2J0VA 3UCXA 3UAYA 5BNTA 2DB3A 1KETA 1PI3A 1IQUA 2ZI7A 4FHGA 3G02A 1KIFA 3D3NA 4BP1A 2Q3DA 4WZZA 3ZZUA 5HA5A 4JWKA 3HJFA 4YO8A 4JQYA 4IZIA 1OH7A 2CMHA 4C5AA 3LOPA 4FU0A 4J4HA 1JAYA 4DDUA 2Y4NA 4MCIA 5LQSA 2VQ6A 3IQXA 4EVRA 5D7NA 4G8DA 1QIGA 1YTUA 3RVMA 3WBBA 3QUQA 3K94A 4LXTA 2P67A 1SC3A 1KTIA 5LL6P 1K4YA 1O96A 2PZJA 2MMGA 3PQFA 5E3JA 3DZCA 3RSGA 1GYQA 4ESEA 4BO6A 2H4JA 4KQJA 4TYWA 4JASB 4MW2A 2BDEA 4EX7A 4G0YA 1M1ZA 2D0PB 2W2QA 2O8NA 2WINI 1WVIA 1ZGJA 1DAEA 4KOAA 4RZ3A 4ZOQI 2OA0A 4MV0A 5B7PA 1TKAA 3PNPA 1K4KA 2P2CA 3WG9A 3LW8A 2JLZA 4XIIA 5EE1A 5FO1A 4PO3X 3SXPA 3V1TC 4B3RB 1NYTA 2B4YA 3B3QA 4O3MA 3QG1A 2KE5A 1MJGA 4ZT6A 2G0NA 3ROPA 3LWDA 4C04A 1TJ4A 1N3BA 2O5EA 4M1MA 2GVNA 1L1FA 1MO3A 2J9XB 3WGLA 1JSRA 3WYCA 4O3FA 2NUAB 1B41A 4WFQA 1W29A 3T9BA 3HO1A 3CNBA 5U4QA 1NG9A 3AR2A 4ZHQB 2ZE5A 2AQHA 2ISCA 1YKGA 2X42A 3B1XA 4V0RA 1W9MA 2ONYA 2PANA 1W34A 2EW1A 3CJTA 4P3OA 4DJ5X 3U61B 2Z8YM 3LQ4A 4AN4A 3M6XA 3BHNA 1H65A 1D1QA 4E1VA 1QQAA 3CZ4A 2REXB 1HRDA 1R66A 4UXHA 4EPRA 4V24A 5ADVA 2D00A 3LF2A 3ZD8A 3AW9A 3NBUA 1EX6A 2NM0A 5E8JA 5A5VA 4TYPA 4Q9JA 1R18A 1GO2A 2HI0A 4FZVA 5AHXA 5DASA 1C7IA 5FYDA 5EMMA 1ZR4A 3UAXA 2JIMA 1QANA 3MELA 2HA3A 4D42A 3C43A 4S24A 2PWYA 5A5GA 4HOYA 2UZ1B 1SUIA 4IXMA 4BMOB 2VRWA 1KA9H 4L75A 3FJOA 3QTLA 2OXIA 2NNLD 4BNJA 3EEOA 2BKEA 2W2LA 4EDFA 1QKIA 1DTWA 2XTJA 3ZPXA 4NZZA 3K5HA 5CA1B 3PK0A 4M1TA 1AF7A 1IEQA 1ANKA 4KMMA 4WY8A 5IAJA 3RU7A 3DLAA 3W9UA 2K6GA 1KZ6A 2Q41A 4MLPA 3HDQA 3RDPA 5AIBA 1N0IA 2W6QA 1M1NA 1IB0A 3C3AA 3ODGA 3QE4A 4P83A 4YVFA 2ZXUA 1L8XA 1XUOA 5BVHB 2B2CA 4CGYA 2RBGA 3MJHA 1UL1X 3SS8A 3ASYA 2QRPA 4MEJA 3HCRA 4RDXA 4CMHA 1YBMA 3L5OA 3KZVA 2I6UA 4D98A 1KYXA 4D6XA 3V3KA 2OGUA 4GZLA 4ITUA 3KB2A 3UMGA 3V4FA 5A5EA 1JDVA 2NX2A 1R64A 3NDIA 1OI4A 2D8AA 2CLDX 3TPZA 3I8OA 3SF8B 1FJXA 1YR3A 2KBEA 5DYIA 1RAFA 4KG7A 2G1UA 2QSYA 3E5HA 3KALA 3ZU5A 4PN3A 4D8TA 2AEEA 4BX0A 1GDTA 4UNPA 4UULA 2E37A 4HNAB 3HK2A 3ONEA 3ESAA 3GIWA 4OV6B 3L82B 4IMIB 2JG3A 4KR6A 2WTXA 2WLSA 5JXWA 1HTWA 4EHNA 3AXSA 4M55A 3V4LA 4BX8A 4D5EA 1JN0A 1S0UA 4IF4A 2AMLA 3G89A 1DCMA 3KVRA 1U0LA 4LMAA 1CDEA 4N9WA 3DKPA 1VPLA 4TS3A 1CDDA 1DINA 1HQDA 1QVAA 5F35A 4C3OB 3DD5A 5DHTA 2A3RA 1U9ZA 2JGAA 3KJQA 4IL5A 4NECA 1IG3A 3EJWA 1BA3A 2VRBA 5ECYA 1M6VB 3U44A 2CHUA 3MT9A 2ZS9A 4N54A 4P34A 5AUPB 2VUIB 2O57A 4B09A 1VJGA 2QVLA 3HVUA 1TYCA 4GNKA 4Q7KA 4OAPA 3X1MA 1QRDA 5TT1A 1IQ0A 2O8CA 5LDDC 3ZN2A 1VL8A 1ISIA 2FSSA 4H0FA 5LB4A 3FVRA 3G9ZA 3HN2A 2CXOA 5KQSA 1SCUA 4M9RA 4OAQA 5JTTA 3CO5A 4IIUA 3K6RA 3MJ4A 1QRUA 2Z98A 2ZJZA 1GUFA 3WO0A 2EG9A 3ADKA 4HLQB 3BB4A 3KEGA 1FZQA 1SXHA 4ZO7A 3RYFA 4V3CA 2H7CA 3ELBA 1NQ5A 2Y0EA 3IBCA 4AG5A 3REFA 3QYPA 2FAXA 3ETDA 2Q6OA 1XCMA 4PGMA 2QZSA 1QLJA 1A72A 4P3PA 5JZSA 3KE9A 1YL5A 3B60A 1MX3A 5BN5B 1OAAA 2W6CX 2HPVA 2FUEA 3CF0A 3NFRA 1MAWA 1GNPA 2KQUA 3NRBA 5A6SA 4E5DA 4LK3A 4ZT4A 3D43A 1WY7A 2PVSA 3VC3A 2GPBA 4F7WA 4F4FA 4JSTA 1SEVA 4XASA 5FL7D 2BELA 3OM8A 1MTZA 1WQ3A 5BSMA 5JS1A 1A0OA 4RA9B 4ZCSA 3R7WB 4OQEA 4RO0A 4O2LA 4EVSA 4XVCA 1GNSA 5B3JC 3IDSA 4G23A 2OG1A 3B13B 3F5DA 1GSIA 4O5OA 2P2YA 2VK8A 2B69A 3QFCA 3EQ6A 4CV3A 4TVBA 4PV7A 1ABFA 2D5CA 5A4KA 1E4OA 1KOGA 4B74A 2D62A 4IZOA 4BQFA 2VNIA 3AEZA 2RD2A 3UJBA 1K6MA 4DDMA 1MJHA 1SKAA 4F1KA 2V6FA 3QQ5A 1NNI1 4E3ZA 2KB0A 1PNTA 2JLSA 2VHYA 2AYYA 4I50F 3IVRA 3LHFA 2VDWB 1ILEA 3ZWAA 4GI5A 3RAPR 1T26A 7AT1A 4D0LB 3E9NA 3GH1A 4DR2B 3NUZA 5GWXA 3RBAA 3UKDA 1F8YA 3BDIA 1U7OA 4L0CA 3QELB 3UHJA 4ES6A 3ZW9A 4FW8A 1DKNA 4YN3A 2WI8A 4MI3A 1NN0A 1R7RA 5CNMA 3DC7A 2AG8A 4DV2B 1L5FA 1GADO 1HKUA 3JQ7A 1J56A 1GU1A 1JTEA 2PMKA 1Z33A 1JR3D 1KNQA 3D31A 4EBBA 2E87A 5EJ7A 5M04A 3AVVA 5TSDA 2P35A 4UU0A 5EWJA 4D81A 3FDIA 5AK0A 4MCJA 1RYYA 3SSAA 1J0AA 1G20A 3Q0IA 3IAUA 1W85A 2Z5GA 2K2QB 3UXEA 1WQ4A 2F3QA 2H1OA 4S0ZA 3N0VA 1U2EA 5DOZA 1JILA 2B25A 2O7SA 2WDZA 2Z08A 4A0QA 4B81A 4C7VA 2ORED 3QKRB 1JQAA 2AJTA 2PV0A 3OIDA 4RK7A 2ACKA 2DWCA 5L8VA 3BMOB 5ED0A 5BRNA 3IEKA 1R0ZA 3G0OA 4ZDIA 3MMNA 1YHYA 3EA4A 5I01A 1TOAA 3FB1A 2JRLA 4RSMA 3P0FA 2HKIA 1SBQA 4IIDA 1E3IA 2VDRB 3W6OA 4W1QA 4D0GA 1UM9B 1G8FA 1LH0A 1R27A 2GF2A 2Q4DA 3ABIA 3K0CA 1UBJS 4WXRA 4BKQA 2HUNA 3PD7A 1Y3DE 2Y1FA 4REQB 4X5OA 4EGQA 3Q7QA 5CR9A 2O0HA 1LK0A 5L3QB 2O8EA 1TQ8A 2X9GA 2HSWA 2EYQA 3G68A 2C82A 1E2LA 3RRNA 1AZTA 5HRAA 1NT4A 3H11A 3JX9A 2CXXA 5JY6A 1GGMA 4RETA 1SWWA 1ZGGA 2JEOA 1L1QA 2DUJA 4GP7A 4L27A 3RKUA 4LY0A 4Z3KA 3BAZA 1EXNA 3EY4A 3MQ4A 5ERGB 3LTNC 2IYOA 3LPDA 4Z7NB 3B51X 5CW2A 3WO1A 4E2YA 1G1AA 2I3ZA 4HMPA 1IMJA 4BO7A 1X14A 1RXEA 3KSZO 2JNWA 2W43A 1BXGA 1FEZA 2B6HA 4WMLA 1M8GA 4J7UA 4ZWNA 1X7XA 3KHUA 1I7NA 4RL6A 5DMHA 2MSKA 4RPLA 5J47A 1MC5A 1A7KA 2EEZA 3AZOA 4CLHA 3W5DA 2MDTA 5E6RA 3WLLA 1CIPA 2RK3A 2XOKD 4GYWA 4RVCA 1UF9A 2PMEA 2ZUBA 4MB0A 3V7UA 3VV2A 4DZRA 1RJ9A 3ZW8A 2XDQB 4XYEA 4Z51A 3EXEB 3PT5A 2C9OA 2DVMA 1X6VA 2AT1A 2XUAA 4QO7A 3RPEA 2A33A 3I01A 4GPBA 4HLNA 2XAAA 1TIKA 4PM4A 2QYOA 2BBSA 1TK9A 1ZONA 3JYQA 3SS9X 5LLDA 3EZLA 4MJXA 2ECFA 4CM4A 2X5JO 3QG5A 4K6OA 3W2EA 3WTCA 3WNCA 4U2BA 2GZAA 1SHUX 1MCZA 3WISA 3M7IA 3ONDA 4MVJA 3I8SA 5F52A 2AZ4A 3MTQA 3C5CA 5LZ7A 1JSCA 1PT5A 4JBYA 2BGGA 3QMWA 4J4TA 2E4AA 4ARBA 1U3TA 3KPWA 1PW5A 2R2GA 2O2GA 4JEHA 4K86A 1V1RA