2AX4A

Crystal structure of the kinase domain of human 3'-phosphoadenosine 5'-phosphosulphate synthetase 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
QAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Crystal structure of the kinase domain of PAPSS 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ax4A00
1S0UA 1W2GA 2JJ1A 3IUYA 4ERNA 1LTQA 1FUUA 4V0ME 5HKKD 4NHOA 2IT1A 3IQWA 1D5CA 1KI8A 1U0LA 4M8NE 4O2LA 4DIEA 2O0KA 2VP9A 3TLXA 1T3HA 3VHXA 1MO5A 1GRQA 1YR9A 1Z2CA 2J0UB 4BE7B 1P9RA 1OXTA 1TU3A 1RE0A 1NRJB 3X1ZA 4CEIB 3JZMA 1UEJA 2ZRDA 4B3GA 1Z0FA 2W0SA 3EIHA 1UBEA 3FDIA 3LY5A 3P4XA 2NQ2C 2ZE6A 2B6HA 4IDOA 2JASA 1ZU5A 4OJQA 5K8LA 1HYQA 4QBHA 5BN5A 4NYIQ 4LSGA 2ZSBA 2WIAA 1C1YA 2OE2A 3E1SA 2RCNA 2RGAA 2BHRA 4OK5A 1DBSA 3KQKA 2VP0A 3CZPA 4MQBA 2ZI3A 5IHPA 4A82A 5KNCA 5BN4A 4L8GA 1C4OA 4GOKA 1SVSA 3KKNA 5EZ5A 3WNCA 2QT1A 4FWIB 5FBQB 3EA5A 1Z8FA 1JR6A 3NKVA 3R9XA 3TK1A 3CW2A 1TAGA 1XFAA 3QJYA 3MWJA 4N3NA 1DVRA 4NYJR 2CK3D 2CVHA 1S1MA 4GNKA 4IVRA 1BIFA 2VL7A 3QF4A 2HYIC 4YC7A 1X3SA 4LJ6A 1ZIPA 4ITRC 4ESHA 5JS8A 3EC2A 4ZCMA 2WBLC 3ZQ6A 2WIBA 1OFUX 3DDCA 2ZM5A 2KE5A 3L82B 3BB3A 1KY3A 4E09A 5FTLA 3GLIA 3PVSA 1TEXA 2ZVQX 4RZUA 1HURA 2ZVPX 4B75A 3ZD7A 1N0WA 1P73A 4B71A 3THXB 1P72A 2EFGA 1DELA 1IONA 2CLCX 1MKYA 2X1VA 4G5QA 4Q4AA 3VFDA 1DAIA 1MOZA 421PA 2Z83A 5FUVA 1XXHA 4XOIA 1R10A 5J5CA 2WMNB 3HP1A 3TSOA 2OAQ1 2OFXA 3L0OA 3OESA 3QPWA 2WOOA 1M8PA 1SXJB 1JQLB 1OHHA 2QAGC 2WAXA 2J41A 4IVQA 4OQXA 5BWMA 1T0JB 1F48A 2QE7A 3SYKA 4KCGA 3H1TA 5AUNB 4LHWA 2FSGA 1ZNXA 3AF2A 3LVQE 1XD2B 1CR0A 4F4JA 1G16A 2AD1A 4PAOA 5EXSA 4DVGA 1AS2A 1W47A 1F2UA 1W5SA 3JVUA 4P0TA 1KO8A 2YWFA 4F4IA 4ZPXA 1XF9A 3BB1A 1VG8A 4PHHA 5FTMA 3AQ4A 1N5KA 3VR3A 4F91B 1RVDA 4NTZA 1UDXA 3T1VA 2NGRA 1GDDA 4H9GA 5EE5B 4C9BA 4KFRA 3ZH9B 2KB0A 2J7PA 3BRWD 5DI9A 1GSIA 3CPEA 4QJ4A 3TRFA 1E2KA 3IO3A 4Q00A 2E1RA 2ZR7A 3DKPA 2GCOA 1DAMA 1YZUA 2Z43A 5L3SB 2ORIA 5KUTA 2RGEA 2GZDA 1ZD9A 3U61B 2PZFA 1XJCA 1T3LA 1L7VC 3MWKA 3LFUA 4KJZA 1UBFA 3A58B 5G41A 5D3MA 2KBEA 8OHMA 1EX6A 1KK0A 2IUSA 2G1JA 2HYDA 4P33A 1OXVA 3I92A 3ICQB 2ODNA 3PEUA 2H92A 3BS4A 3QBTA 4KVGA 1GFIA 1OPXA 3U7FB 1FP7A 4OI0A 3ICEA 1L4YA 4HAWA 1R2QA 4KFSA 1E9SA 4BLPA 1G21E 2CL6X 1YE8A 2BBSA 4PZZA 2LKCA 1NVVQ 3A6PC 2O0JA 4LV6A 2JLYA 4TL6A 4DLXA 3R20A 2B92A 1OXUA 3RRZA 2C03A 4MKHA 1KKMA 3K1JA 4EPYA 4HB4A 1GAJA 1UJ2A 2QRNA 4LYHA 2YKGA 2Z6VA 4B74A 1Y63A 5FOSA 3R7WB 4BFXA 1IM2A 5KPJA 1Z22A 4JYCA 1QG2A 1GNQA 4NPHA 3K9HA 1AKYA 4G01B 2PH1A 4EPVA 1VG0B 4OQMA 2IWRA 3MGCA 5B30A 1N5JA 2C78A 4PPGA 1E2DA 3F3YA 4IJMA 1IY1A 1YZQA 4RKFA 4XWAA 2B8WA 4LV8B 4ON9A 3REGA 2XXAA 1EX7A 4JMPA 2JDID 1PZNA 3HU3A 3PQCA 4IW3B 3A1WA 3KL4A 2ZYWX 2JLWA 2V7QD 4D4KA 3D3QA 1KI6A 4LRWA 3AP1A 1E0JA 4JL6A 4A2QA 2IA5A 4LBWA 1OH6A 1A1VA 4I1SA 3SJCA 1N6LA 5JEDA 1WF3A 1KK1A 1WXQA 1MO4A 1RYFA 1VIYA 3TQCA 4UNPA 3SBEA 3IPXA 3SE0A 4XWKA 1GIAA 2IEZA 2WJGA 4P32A 2XOKD 4TWZA 4EFLA 3E70C 3O8RA 3OHMA 2FE4A 4ZDJA 3VR1A 2XEXA 3CNLA 4PXAA 5FBLB 3X1XA 1G3QA 1X1SA 2IYYA 2WHXA 4OHZA 1R0XA 3ZZUA 1NMZA 5ANRB 1WBDA 1W36B 1W4AA 4XVRA 2DFNA 2YHSA 4AK9A 1XJQA 4AG5A 1IN4A 2ZRNA 4NCJA 4DEXA 5GJBA 1VHTA 4XTCS 2WV9A 4GFDA 5FOWA 2JJ2D 1SQ5A 2PLFA 2G0NA 1KO7A 2JAQA 4DCTA 5LD2C 5FTNA 1II8A 1QHHA 2WKQA 3M1IA 3FFAA 3P20A 5EUQB 4KXFB 1XTIA 4LJ4A 2RAPA 5E95A 1PUJA 4MRNA 5K8IA 5AJZA 2B21A 2GXAA 1V43A 1DAEA 4Q02A 4WAUA 2QZ4A 4UNNA 5CB8A 1M34E 4PR0A 4FW9A 4P3YA 3VR2A 4US2R 2NZJA 5DHFA 4Q1BA 4Q01A 5B2ZA 3HYTA 1NP6A 4JLMA 4K81B 4D0LB 3PUXA 4LPSA 5FUYA 4ZCLA 3B2EA 3MUFA 1CIPA 1Q1EA 4YMVA 4CGZA 1Z5ZA 1G7CA 5DIFA 4PSVA 1W44A 4AKHA 1BYUA 4KODA 5HPYB 2MSCB 4TN1A 4WOPA 1KTVA 4MYUA 1KOFA 4POAA 5E7MA 5JRJA 2IS6A 2GEVA 3NHBA 1KDRA 3GFTA 2ZRAA 4DCSA 3GEIA 2O8FB 2GAAA 2QM8A 2VP2A 2W6ID 2EYQA 3ZS8A 5C4GB 2IS2A 2A7QA 3U7HB 4M1SA 3U3OA 1JR3E 3LQQA 3ZVNA 1GM5A 4TLBA 4HLQB 2NPFA 3Q85A 1DOAA 2QNRA 4EJSB 3SZRA 2W83A 1E9EA 3CR8A 3UIEA 1T8UA 4AI6A 4GBMA 3LDAA 3ZQJA 621PA 2AWNA 1G8YA 3PG5A 5CYPA 3TMKA 2X19A 4KAXA 4KV9A 3O8BA 2VF8A 4HDOB 3K70B 4M22A 3C14C 1C9KA 5FUXA 2ZJBA 4B2PA 1PLLA 1GVNB 1U0HC 3WYAA 2CVFA 1XMIA 3RS3A 4OHVA 4MUAA 5EUMA 1XCMA 2GTPA 1VDZA 1OFTA 1GG2A 2BDTA 3BC1A 2R8RA 4TTRA 2F1HA 3I8XA 3ASZA 1GZSA 4URUR 5E4FA 2FGJA 1E1RA 2ANCA 3QKSA 4EQ6A 5TARA 4CEJB 1OIVA 4AC9A 2RH5A 4JLAA 1S4QA 5GADl 2GCNA 1SVOA 1P75A 2AX4A 1XZQA 2R6AA 3RRNA 1KMHA 1QHXA 2QMEA 2HF9A 2X8AA 4MITA 4NYIR 3IEUA 5BW8A 2J3EA 2JJ1D 3AVUA 4C3ZA 4UNSA 1OH5A 2CK3A 4NP6A 4Q9KA 3NIBA 3U7EB 4HZUB 3SFVA 1OT3A 3U44A 4AG6A 2F3TA 1YZNA 2WICA 1JQJC 3EZ6A 4IFBA 4LBVA 4BLTA 1SVIA 2C9CA 1G7TA 3LRPA 3BAFA 1JI0A 4WBSA 4G1UC 3ADKA 3GJ7A 1E79A 2J1LA 3KKPA 5EE1A 1WP9A 2GEDA 1FW6A 4LBZA 4LJ5A 5FBVB 2EU8A 4FXPA 4LDJA 4GP6A 4X8LA 1IQPA 4RKEA 5H70A 2ONJA 3MCAA 4MGKR 2CL7X 1SULA 4PAQA 3BFVA 2GAOA 1Y3AA 2FDCA 2F43A 2G9NA 3QEOA 4NYJQ 3SHWA 2QL6A 2QTHA 3OIYA 3H4MA 2CHQA 2P67A 3ZVMA 2DR3A 5DN6D 2LWIA 4Z8XA 4MH0R 1F60A 3B1YA 1T9HA 2ZAMA 3NDPA 4B2LA 3HDTA 1OIWA 2XJ4A 3HR8A 4JVMA 3QE0A 4KFUA 4FINA 4AD8A 1COWD 4A2WA 4OKSA 3OEED 2A78A 5GJVC 4BGDA 4DBLC 3RS0A 1Z6TA 1BH2A 2BOVA 3W8RA 5AR1A 1XWIA 3C5CA 3KFXA 1JB1A 3RS2A 4NH0A 2W6JD 3SR0A 3MAAC 1NMYA 4PC3A 1U8AA 3X1DA 2EQBA 1R0YA 2P6NA 1Q0UA 1S3GA 2A5GA 4US1R 2DPXA 1XDBA 3CPHA 4I99A 1OW3B 1G41A 1VPLA 1SXJC 2NG1A 4JLOA 5EQTA 4MDEA 3LAWA 4IOJA 4JLPA 3U6BA 2GJ9A 4TT3A 4Q7KA 2J59A 2E9SA 5JMTA 2QA5A 4I4LA 1W4RA 1UKVY 3CZQA 2O8CB 3AUXA 1AS0A 4JBYA 1NKTA 2QMOA 3Q7PA 5AJXA 2H17A 1CRPA 2X77A 1HV8A 3K0CA 3PUWA 1XEXA 3DOFA 1G4UR 5DLQC 2ZR9A 1HUQA 1JPJA 1P2TA 2ZANA 1U0JA 3VMFA 3T34A 1V5WA 4UXJA 1WRBA 1DADA 2XNSA 3AM1A 1XNJA 1NVUQ 2D62A 4JLNA 1W49A 1HT1E 2V3CC 5FI1B 4YMSA 3WBKA 1P60A 2D7DA 3F5FA 1Q57A 4UQOA 1YQTA 4TMTA 2FZ4A 2OSBA 3K09C 4XTRA 1ZNYA 2V9PA 4DCNA 1DEKA 4D81A 2DWQA 2WVJA 4XSGA 1Z07A 2QENA 4Q1DA 4UXHA 4DCVA 1IBRA 1E2GA 4KI0A 2WSSA 1HQYE 2W0MA 3CNOA 3EZ7A 2P2LA 3VU9B 4BLOA 1TU4A 4Q4HA 4PZLA 3FHOA 4E22A 1NVVR 3AV0B 1ZNZA 1ZM2A 1J2JA 1E2LA 4JL5A 4TQAA 3GLGB 2AXNA 1NY6A 2XB2A 3T61A 2WWGA 4QGGA 3FMFA 3NTUA 2JDIA 2ZIAA 1GITA 1U9IA 2AFIE 2JA1A 3EZ9A 4HAZA 2BCJQ 2B8TA 1W0JA 1CULC 1HA3A 2V7QA 4A8JC 2VBCA 3GP8A 3C41J 3C16C 5TXGA 2ZJAA 3QNUA 4GOJA 4EFNA 2ZJ8A 1UF9A 2WJYA 2V1XA 2CHGA 2GK6A 1YR7A 3FWYA 4KBFA 5P21A 3P26A 4JSYA 3T5DA 5GVSA 4M21A 1NNEA 2FSHA 2XOKA 1KJWA 5JBQA 3RAPR 1Z0AA 3WY9A 5EJEA 1W1WA 2XB4A 3OEHD 3U3RA 2GK7A 5SZKB 1Z0DA 3EC1A 1NLFA 3T1TA 2V4ZA 1NVXQ 5J40A 1H8ED 1OFIA 4QM6A 1ZP6A 1GNPA 1GL9B 1TQDA 4V0NA 4Z8YA 1G17A 4GP7A 5JJLA 1IAQA 3I4LA 2ZRHA 1G291 2ECKA 3RS4A 3QXJA 3FPAA 3TAHA 5EXPA 5KNDA 3TW4A 1M7BA 4AY2A 2NO1A 3CO5A 4RJLA 2JJ2A 1O87A 4FIDA 1Q1QA 3PITA 1GRNA 3M0EA 1JXMA 3QKUA 3NBXX 5D3QA 1GOTA 3EPHA 1XEWX 1R5BA 3TUZC 3K0FA 5G3ZA 4QBIA 3KJGA 2OCPA 2ZRCA 4HAXA 1IHUA 2C96A 4O25A 1W36C 5DYIA 2VRWA 3BOSA 3RABA 3ZJYA 1WDTA 3W6PA 2EFHB 1FNNA 1M7GA 2FPLA 4GDFA 3NC0C 2FSFA 1G3MA 3VX3A 3FMIA 4P4SB 1DO2A 2I3BA 3P27A 4CVNA 1E9RA 2C8VA 2QQ0A 2RGXA 2ZSDA 3QENA 3VKHA 4HAYA 2FA9A 3EW9A 2YC4C 1EWRA 1KDTA 4B3DA 3QPVA 2HLDD 2IXFA 2IYSA 3GLHB 3NEYA 2JIZA 2ZI4A 4JSTA 2WJJA 2RHMA 2Z4RA 3U3MA 4B2IA 1R7RA 2WWIA 3RC8A 1XB2A 2D4HA 3NH6A 3THWA 3RS5A 4G5GA 4MRVA 2ORWA 2FFQA 3A1VA 1OSNA 3U3KA 4BFUA 3AVPA 4DXAA 3CRMA 2BM0A 2OHFA 2G0TA 3BWDD 2ZREA 1G8HA 1YR8A 1E9AA 1Z47A 3PEYA 2BMJA 2WWFA 4A0RA 5F9FA 1PJRA 4QXAA 1MABA 1R8QA 1SVMA 1JAIA 1ZJ6A 2HXYA 3RRMA 3LNCA 1JBKA 4HUTA 3BERA 3CWZA 4LHYA 4Q1EA 1UKYA 2OEPA 2VHUA 3B1VA 3IILA 1JAHA 5AUQA 1Z06A 2AXPA 2CJWA 2CHVA 2GESA 3SU8A 1Z0KA 3FTQA 2H57A 1SGWA 1OYYA 4B34A 3X2SA 1YZTA 2CEAA 4DUGA 2QAJA 2GBLA 2WMOB 1ZVQA 4YLGA 2REOA 1YU9A 1TMKA 3A1SA 4HYYA 3ETLA 1RYHA 4EJSC 4RFSB 3PUYA 2ORVA 1CBUA 5G3YA 5JI2E 4OHXA 5C4MA 1Q12A 3CNNA 2ZJZA 4C7OA 1Z6GA 4DHEA 2QP3A 1A4RA 4B3FX 4PX9A 1B23P 4O2RA 1N0VC 3BIFA 3RANA 3K70C 2QY9A 3SI7A 3AVOA 5EP4A 2BEKA 3KXLA 3KUCA 2ZRIA 4DKXA 1T8TA 2OO7A 3QOFA 3LBNA 1SVLA 4OHYA 2ZI6A 1Z2AA 3JVVA 5F2EA 4B3BA 4ARZA 1EXMA 3BBPA 2IXGA 4B32A 3B1WA 3OE7D 2QQEA 4RFVA 3MWYW 2JLVA 2ZROA 1Z28A 4M1TA 2JJ8A 3GJ3A 3PUVA 1LS6A 4NBSA 2EYUA 4C0QC 3HPQA 1Q3TA 3PFIA 5HCIA 3QXSA 5HCNA 3VR6A 3H0KA 1E2JA 3CWQA 1FL9A 4Q1AA 4TZ0A 1G7SA 5CLQA 1K8RA 4IHQA 3I62A 1KI4A 3CRQA 3O8CA 1TX4B 2O5VA 2CXXA 2W2XA 1CXZA 1XTRA 4OQLA 4DSUA 1E94E 1K5GA 1E2NA 3IDQA 5DN6A 1E1RD 5EXTA 4PO8A 2YWEA 3AVXA 2XNDD 5L3RA 4NCHA 1LNZA 1G20E 1COWA 3OEEA 3ZGXA 4LGMA 4EAQA 4EFMA 2RGNC 3J81k 4DSOA 2OCYC 4G5SA 3SS8A 1G6OA 1T5IA 3AKCA 4PZYA 2HJVA 5TY0A 3WNDA 2UZIR 5KO2A 4K8OA 2WJHA 3CRVA 4D4JA 3V4FA 4AYXA 4C0KA 2W6JA 5CB6A 1U8ZA 1XTQA 2ZS7A 4Z1MA 2WKPA 3R8CA 3I5XA 4AKIA 1TQ2A 1FPMA 4WIAA 3QF4B 4Q7MB 4IDHA 3K8YA 4TMWA 1TPZA 1KDPA 1E79D 4LOAA 4YQFA 4DDTA 3PR1A 1P4SA 1VIAA 4RD6A 3AKEA 1X6VA 3GLIB 4OI1A 2VSFA 4YXWD 4Q48A 1FMJA 3N70A 4ZCIA 4G0NA 1H8HA 1I2MA 1KI2A 2HUPA 1SHZA 1N25A 3WHLA 4D4LA 1HE1C 4Q4AB 3EX7C 1CF4A 3F0TA 4OBEA 4KU4A 4MRRA 1GNRA 3K0SA 1X8JA 4M53A 4QGFA 5CITA 1XXHB 4DIDA 1Z83A 2O8BA 2CCGA 2FU5C 2VA8A 1R6BX 1EWQA 4TLEA 3QI2A 3DMNA 1XTSA 3AF3A 1X8KA 1UEIA 2JATA 3C8UA 3QQ5A 4GMXA 1J70A 1EG7A 2J9RA 1IN5A 2EWVA 1EFTA 5CK5A 2H16A 4JBWA 5JLJA 2F9LA 3FHCB 4QJ5A 3GD7A 3HJNA 3G0HA 3X1WA 4LJ9A 2REXB 4KSCA 2CNWA 5LBIA 4IOMA 1HE8B 1F2UB 1ZCAA 4MGIR 3LBHA 1ZC3A 3SYNA 3RSOA 3FFBA 3ZD6A 4M1YA 1MR3F 3SFZA 4D4MA 4TT3D 2XAUA 1VCMA 3V9PA 3K9NA 5H8WA 1T4GA 3GLIE 1Z63A 2OESA 3CH5A 1D2EA 2XZOA 2GCOB 4QBFA 2HDNB 2JLUA 2OLJA 4M9XA 2H5EA 4HB0A 4JLDA 1LV7A 1WA5A 3H2YA 3GFOA 1XXHE 5D3MB 2NO7A 2GILA 1QZXA 1KAOA 2HCJB 4OK3A 5IK2D 4N0EA 1DO0A 4CW7A 3RNLA 2QTVB 1G18A 1BS1A 1KO5A 2XTNA 2J0QA 1EFRD 3HYRA 3CBQA 3OEHA 1OE0A 2J5XA 3AVTA 3I32A 2EFCB 3F8TA 1H8EA 4UJ5A 3P1JA 2DWPA 3U3JA 3I3SR 4G5RA 1XX6A 4WA7A 1D9XA 3REFA 4BFTA 1GKUB 2WSSD 2DB3A 4Y0AA 3U6KA 4FCTA 3DMDA 2SHKA 3DEFA 4II7A 2ZJOA 4L4UA 4BZQA 1KI1A 4RVCA 5KSYA 3WP1B 4LI0A 4A8JA 4KO8A 2XGJA 4TSFD 4A0GA 2QMUA 3UATA 4ZKEA 2FFHA 2P6UA 2QMHA 4QL3A 2NZ8A 2YINC 2XXAB 1UBGA 2AKAB 1W0JD 2QROA 3QKRA 1J7KA 1JECA 1Z6YA 3B13B 4JZKA 4M1OA 3SJAA 3T1OA 2WZQA 3W90A 1KI6B 3AF0A 3QY0A 2IW3A 1P2SA 2PT5A 2B7CA 2UKDA 4PTLA 1YZLA 1P2VA 2QI9C 5TV2A 1G6HA 4PHGA 2F7SA 1S1CA 4HUQA 3TNFA 2WWXA 2ZSFA 5BN3A 1E0SA 2ZSEA 5GVRA 5J4HA 4XJXA 1RFLA 2DFKB 4C0SA 4PHTA 5KYKA 3VKWA 3UWOA 4C30A 2OXCA 5JI3E 3DZDA 5BYJA 3PEWA 2O8DA 4TL8A 2GA8A 2IYZA 4DCUA 1S8FA 1IY2A 2XX3A 3B78A 1G64A 2HLDA 4M1KA 4Q9LA 5UKDA 5DE3A 2J46A 1E9FA 3SN6A 3TAUA 2GDJA 4CIDA 3SJBA 2IEYA 3Q8XB 1VHLA 3ZDQA 2VP5A 3FB4A 2P5SA 1Z6AA 2ZJYA 3R9WA 2NIPA 1XTJA 5AWFC 3AVVA 2FPMA 1LB1B 1VECA 2ODBA 4BLQA 1YVDA 2PMDA 3WYFA 1N6OA 4LJ7A 1E2PA 1UKEA 4RZ3A 1XCPA 3PEVA 2FZLA 4TMXA 1II8B 1QHHB 1TUIA 1ZD8A 2GXUA 4M9ZA 4PHFA 4A15A 2H1LA 2PEZA 1RRPA 2YYZA 1ZM3A 2VYFA 3GJXC 3IIMA 4IDQA 2YOGA 5FI0B 1US8A 4C2UA 1QHIA 1E4VA 2FPKA 2ZRFA 1NIPA 4AURA 3R8FA 4ABYA 2WSMA 2ZUCA 1OXSC 3B60A 4O3MA 3I72A 3EWSA 1N2CE 3THYA 4BFZA 1R5OA 1NBMA 4BEBA 1U99A 2ZI9A 3B9PA 4C0BA 3MSXA 1W2HA 1XEFA 2JCSA 3CX7A 4LV5B 1FQKA 1A7JA 4XIGS 2A5JA 3SQWA 4WXPA 1KK3A 2ZR0A 1FTNA 2ZE7A 1ZW6A 3HR7A 2JIZD 4I81A 2ZRGA 4TLAA 1NF3A 1XJ0A 1XZPA 3K9LA 4D2IA 3TGPA 4MKIA 2FFAA 2QBYA 4GZMA 2P3SA 1N5LA 4QG7A 1OXXK 3KFVA 3UWKA 1WB9A 5EXXA 1GKIA 2QP9X 3NBFA 5KDLA 2W00A 1SZPA 4MA4A 4XWOA 3EIQA 3OFNA 3CIOA 4YONB 5KOYA 2NTYC 2PX3A 3OE7A 4NYMQ 3V4RA 4PPFA 4M2LA 4L9SA 4OYHA 5FOVA 1GP2A 3TUJC 4QM7A 4HLUC 2QUZA 1E9BA 2A2ZA 2H7VA 2P65A 1WQ1R 1ZM9A 2Q9BA 4KFTA 3W6OA 5KSOA 1AA9A 2WPDD 1JJVA 1KSHA 2ZYUX 2NO0A 1IXRC 4WZBE 3A8TA 1II9A 4DUGD 1FX0A 3U60B 2OLKA 3D8BA 4JT2A 3EA0A 2JLXA 2RHDA 521PA 2EFDB 4JBXA 3CH4B 4Q7LA 3CF6R 3OIUA 1E99A 3I8SA 3AF4A 2XNDA 5JJKA 4OQFA 4W9MC 4BLSA 4IDPA 1UM8A 5J47A 3QKSB 3VAAA 4EQ6B 2IF2A 3RWMB 4JVLA 2REBA 1NN1A 4D0GA 4Q4JA 3U2QA 3AB3A 3P4YA 4A9AA 4B44A 3QSYA 1DAGA 1NSFA 1Z0JA 1AK2A 1KMHB 2QT0A 3C5HA 1N6IA 3QG5A 3ADCA 5CIQA 4DEYA 3JZAA 4KBGA 3FKQA 5JWRA 4TMZA 4Q47A 2C98A 3GLFA 3AP2A 1IN8A 1X86B 3ND9A 3U44B 3A36A 2V6JA 1FZQA 1QHNA 4QHSA 4CZ2A 2P0EA 5DGXA 3GQBA 3TR0A 2JLQA 3I1FA 1TQ6A 3LBIA 5KSPA 2BEJA 4TYPA 2HT6A 4URVR 2D7CA 4YXWA 1Q3HA 1TADA 1P2UA 2FSIA 4DLUA 1HY3A 1D2NA 1E2EA 4AYTA 1D2MA 5JFGA 4ZIRA 3TKLA 4DDVA 4PO1A 3OIWA 4FMDF 2YNMA 1QBKC 2F43B 2O8EA 4NCKA 4JLJA 2WM9B 3ASYA 3IHLA 4CYMA 1OH7A 4I1VA 4XVQA 4Q5IA 4AWXA 3CUEF 2XTMA 1FMLA 5JWHA 1VG9B 1U8YA 3CR7A 1XMSA 3IIKA 5FUWA 1KSGA 3RSLA 4IEIA 4ZO4A 1LY1A 4Q66C 4TTPA 4DT1A 1I2DA 4QHTA 1KNXA 5EP1A 5FPKA 2QPTA 4ACAA 4HATA 4NCNA 3K0AA 4Z1MD 2CBZA 2ZS8A 4URYR 1N6NA 1U98A 2PT7A 4HLCA 4TMVA 4S35A 4KHZA 2W58A 1CJMA 4LUCA 4JT4A 2IC5A 1KI9A 1DPFA 3KB1A 3GLFE 2RGCA 4DLYA 1Q20A 4R2HA 2F9MA 4LJAA 2H18A 4CT5A 4LCBA 1DG1G 3T1QA 1N3BA 3VTKA 1YKSA 2GJAA 4L5BA 1X1RA 3A1TA 1H8HD 1TL7C 1XPUA 2QSZA 3A4MA 3KQUA 2IHYA 1EK0A 1XPRA 2QAGA 4TTQA 2QEQA 1BKDR 1NVWQ 2O52A 4BRUA 5L3QA 1DAKA 3FYHA 3GPLA 3NVAA 2G83A 2YOHA 4OL0A 3CLVA 3DHWC 3QXCA 1VCOA 4DC9A 1XEXB 5LPNA 2DFTA 121PA 3OIVA 4NE2A 1KSFX 5IK2A 4PAMA 4HEJA 4UKDA 3UK6A 3AVWA 1SHKA 1XRJA 5DYGA 1RJ9A 2GJ8A 4LHZA 4P4TA 3ZVLA 2QPAA 1N6PA 1EFRA 1Z29A 2ZJ5A 2IYRA 4QC2A 3GMTA 4AYWA 2YV5A 4GZLA 3WMFA 4LHVA 1ZUHA 1SXJD 3EAQA 4HSEA 3MJHA 2HJGA 3UMFA 1FTSA 1RKBA 5JRZA 2CNWD 1IXZA 3BH0A 3CX8A 4PC6A 3WXMA 3S1AA 2HV8A 3MMPA 1UDWA 2ZAOA 4LYAA 3LW7A 1IOZA 3ZS9A 3FOZA 1YZGA 4Q4HB 2VSOA 3FKSD 3DOEA 2YZ2A 1W4CA 2V54A 4JVSB 4C0AC 4TSFA 2MSDB 4PFSA 4LYJA 1E9CA 1OIXA 3RVBA 1GKYA 3IPYA 1CKEA 2FEMA 2OCBA 2IWHA 1G3UA 3N2IA 1E32A 1YR6A 1MRNA 1S96A 2LKDA 2ODEA 3BH7A 1PVOA 1TF7A 2C2HA 4KSBA 1KGDA 1UPTA 5H68A 2ASEA 3LVRE 1Q21A 5E7IA 4CEHA 4BZPA 2XZPA 4DSNA 2NO6A 3HU1A 3M6AA 4E03A 2GF9A 1G5TA 3KJHA 2R9VA 4B3CA 2DWOA 1HH4A 2F3RA 1LS1A 1KO1A 2ZU0C 4ASUA 4ZDIA 1RPZA 3MRSA 3A1UA 2RB4A 4IOLA 3P32A 4XSHA 4OI4A 1CJTC 3BH6A 1OLOA 2FJUA 1L2TA 1RW4A 3PUZA 6Q21A 3MWLA 2BMDA 1S9HA 3UG7A 2XSZA 4B35A 1DAFA 1F2TA 1FFHA 1ANKA 3U4QA 2BBTA 2VHCA 5HZHA 4OHWA 4UNQA 4ZDKA 4A36A 5FL7A 5B58C 4M0LA 5DI3A 4DB2A 1WBBA 2PMKA 1ZM4A 4HLDA 2R6CA 1JNYA 3Q72A 4RD0A 2GZHA 4G3XA 4B76A 3WYGA 1E2QA 2GVDC 4Q18A 3K0FB 1CR2A 1N5IA 2WAYA 1NJGA 4R7ZA 1BO6A 4L15A 4D82A 1M2OB 5JSZA 2AKYA 4FMCF 2AFHE 1TUEA 4BQSA 4AIIA 2ZRBA 1MO6A 1BMFA 2D2FA 3O47A 3KDSE 2GJSA 4EIWA 2I1QA 1NSTA 3BB4A 1KDOA 4LC1A 3B8HA 4JIMA 3MFYA 3TBKA 2N46A 5KHOC 3E2IA 4D26A 4QRHA 2GCPA 1H65A 1M7HA 1NLZA 2H8KA 1YZKA 4CDGA 2NPIA 4RD4A 2DHRA 5J4VA 2F6RA 2QGNA 4N0DA 4GOXA 3RWOA 2ATVA 2D3WA 5C18A 5TVKA 3KTAA 3PENA 4QKQA 3AKDA 2PX0A 3W8NA 3WP0A 2OG2A 1OV4A 2MSEB 2ZPTX 2IS1A 1AGPA 2MMCA 3UKDA 2IX3A 4JKIA 5B64A 3VR5A 5JHHB 3EG5A 3THWB 2ZYTX 5DSZA 3A4NA 3B6EA 1MH1A 3LX8A 3C15C 2Q3FA 3IBYA 3WMEA 1O3YA 1OH8A 1CRQA 5CYOA 1A2KC 2DFLA 2IK8A 1KY2A 1UFQA 4LC0A 1N6KA 5FR2A 4FWTA 1W7AA 4DLZA 4HDQB 2CLSA 5LDDC 1MABB 3H84A 2WWYA 4DSTA 3TJZA 2FN4A 1OF1A 1XP8A 2QM7A 2WPDA 3SBDA 4DLRA 4ZKDA 4Q7JB 3T06B 2CJWB 4B43A 1E2MA 2VH5R 2G88A 3I61A 1NBMD 2V1UA 2HT1A 2C95A 5HZKA 4NYMR 3ZIAA 5JWOA 2VEDA 2VF7A 2W2VA 2ZITA 5AJWA 3VX4A 2KSQA 1E6CA 5KU1A 5IT5A 5KDDA 4A6XA 4DDWA 1NKSA 1ONBA 2R65A 1II0A 2IUUA 2X2EA 3UPUA 1UAAA 1NG1A 1R4AA 2QGZA 5FBRB 5DHAA 4C7OB 3QUSA 1XCGB 1XPOA 2E87A 1VYTA 3CPJB 2KWIA 4US0R 2C9OA 5JS7A 4IDNA 3BXZA 1SKYB 4RZXA 4LPKA 2OV2A 1E2IA 2ZRKA 5EE3A 2ZYVX 4R98A 5JCPA 2BV3A 4HAUA 2IYQA 4HLUA 4H1UA 1CR1A 2BWJA 3OFND 4CRWB 4TL7A 3U5ZB 3U7GA 1TEVA 2A3RA 4IKEA 1NY5A 4ARZB 3H86A 1KJZA 3L2OB 4GT1A 5K8TA 1AZSC 1L8QA 2PCLA 1Z6XA 3T12A 4BFWA 1G5RA 1S2MA 2DYKA 2VP4A 2BMEA 5FOTA 2ZRPA 5J4LA 2UVQA 2ZUDA 1E9DA 1KZGB 3C7KA 4F92B 1KHTA 2BBOA 2VIIA 2X2FA 3HPRA 4PSAA 1XBTA 1P6XA 2GWHA 2Q9CA 1GWNA 5IF9A 4KLNA 2J0UA 3KX2A 3ONWA 4MKFA 4BUJA 3NBZC 2VSXA 1IJFA 2QU8A 4S2EA 4CEIA 2OCAA 4LK2A 4MDFA 3K70D 4WZAE 3SQXA 2KI5A 3LLMA 3TE6A 1OFHA 3KJIA 3N2EA 4PQYA 4DZZA 2CCJA 1KMQA 3UANA 2B7BA 2HEIA 5L8VA 3FHTA 3L0SA 2Q0HA 3THOA 4RD3A 4PC7A 1G5PA 1ODFA 5TB5A 4XD7A 3D6TB 4A0HA 2BVNA 821PA 4ZI3A 1U81A 1SKYE 5HE9A 1W46A 1R0WA 3MG9A 3BK7A 4R2IA 4JLVA 3SYLA 1WE2A 4PC1A 4MGZR 3DM5A 2IYTA 5C1BA 4UNRA 3E5HA 2IYWA 5BQ5A 2V8OA 3RYTC 4F7WA 3QXXA 1E0KA 1GUAA 1AS3A 2C99A 4P4UA 3EZFA 3DVLA 1XMVA 3LW8A 4PC2A 4E07A 2R6FA 1OKKD 2N42A 2VTKA 4GPTA 4HB3A 2ERYA 2OBNA 4GRAA 1QDEA 5EP3A 1OYWA 3Q9LA 5KTYA 1ELOA 2CDNA 4PPQA 5GJCA 2XITA 4URZR 3TQFA 3THXA 1T91A 2O8BB 2ZETA 4YMWA 3TUIC 3QG1A 2J0SA 1E96A 3TVTA 4R71A 4A6PA 1G19A 5EP2A 4B47A 4AKEA 3TIFA 4Z54A 4EPTA 1HQCA 5SZIA 1SVKA 4EDHA 2ZI7A 5F98A 2PJZA 4IOKA 3NH9A 1MO3A 1SXJA 1P61B 4LX0A 4URWR 1FP6A 4NDZA 1F5NA 1ZD1A 4UJ3A 1XTKA 2IS4A 2CCKA 5FTKA 3W5JA 1QVAA 3A4LA 2IYVA 2PZEA 3AEZA 3K0CC 4CF7A 3FVQA 1KK2A 4FMDB 4OI2A 4C0HA 5L3VA 1XD2A 1TF2A 2NO9A 5CIWA 721PA 3FKSA 1EFCA 2KJQA 2JLRA 3I73A 1ZU4A 1NN5A 2GETA 3SHFA 1E4YA 2Q3HA 4DLTA 2J0VA 4U5XA 2GEUA 3EPKA 1PLKA 4K46A 1P9WA 3EWAA 5ELXA 1N0UA 1ZIOA 1PV4A 4CT4B 4PQFA 3QBVA 4U02A 5HE8A 5FFMA 3C4JA 5C2JB 4V0OA 4GI7A 1J8YF 5IRCD 3OF5A 5TMPA 5L3SA 1VTKA 2Q6TA 1T5LA 3K09A 1CTQA 4TYQA 2OUKA 3VNVA 1YRAA 4M1MA 3HU2A 2BBWA 3FMOB 2ZS9A 4TLDA 4JKYA 1OJLA 4Q9JA 5EZ6B 2FG5A 3CF2A 3LO5A 4KLZA 221PA 3A37A 2WKRA 3VNUA 3ZZ0A 5BXQC 4OK6A 1U9IC 4TL9A 3EASA 2GZAA 4BFYA 1S3SA 1SXJE 2OBMA 3IKJA 1CP2A 4LY6A 2AR7A 4NU0A 4C4PA 4ZV4A 3WHKA 2R62A 1FOEB 1E69A 3PV0A 1UADA 2QTFA 4W5JA 1GRRA 1P62B 4BFVA 2G77B 5F3WB 3LD9A 5FL3A 4A8JB 3R7WA 2WJIA 4B48A 4XH9B 1VMAA 1OB5A 4Q1FA 3NC1C 4EUNA 4PSKA 4QOSA 4RCYA 3QKRB 2IBMA 4KVAA 2J87A 5FPYA 4L16A 1QHGA 2NOAA 2GJKA 2QSYA 3QVUA 1XD8A 2JGNA 1W4BA 3IEVA 3DKVA 2YVUA 1ZUNB 3D31A 1EESA 4A4DA 4JJKA 1WCV1 1P9NA 2CE2X 3WBJA 3BJIC 1RC8A 4HUQB 1YJ5A 3RHFA 2J45A 2FOLA 5J4YA 4ASUD 4B3XA 1W5TA 3B5JA 4WXRA 4KITB 4B6EA 2WJVA 3BORA 1AM4D 2R6DA 2O8DB 1HT2E 4NL4H 4BECA 2PJRA 5JJIA 1LF5A 5AK0A 4P31A 1AGRA 1NI3A 4OJKA 3WMGA 4DWJA 4FN5A 3SEAA 2XSZD 3KKMA 4JS0A 4E5UA 2J7KA 2ZRMA 4MYHA 5SZJA 1Z3IX 1L4UA 2AK3A 4KYUA 1D8TA 2A5FA 1ZINA 1G4AE 3CF0A 4MUBA 3SDZA 1CJUC 1VG1A 2IXEA 3CKLA 3CM0A 3LA6A 5FL7D 1I4DD 2ZE5A 4X8MA 1CJKC 1U2RA 2BCGY 5HTKA 3BD9A 3KJEA 1JR3A 3AUYA 4F93B 2GVZC 4FCWA 1A2BA 2D74A 1ETUA 1US8B 1LFDB 1RRFA 2IYUA 4PO9A 1CLUA 2F55A 4X8OA 1BMFD 2K5UA 4DJTA 4LYFA 4V0KA 3O8DA 3LXRA 2EWWA 1JALA 1LF0A 4D6PA 2N1BA 1M74A 2YJTD 3OAAA 2Q21A 3QIAA 3T35A 3RLFA 3THYB 2YWGA 1Z0IA 2RGBA 2F1IA 4A2PA 5C46F 4TQUS 3AH8A 4HDCA 2VQSA 2RGGA 4BASA 4NONA 3DPUA 4TZ6A 2NMVA 3NHAA 2C04A 2GF0A 4BZXA 2R44A 4JJZA 5E7JA 2EFEB 4WVFA 5HR5A 2ZE8A 1I4LD 1T3SA 1MRSA 1NN3A 1XD9A 2G6BA 1UKZA 4BWYA 1P7CA 4URXR 2AD5A 2QBYB 1Q1BA 4D0NA 3ADDA 3BFXA 2Y8EA 4FMCB 1XU4A 1NN0A 4FD2A 3K53A 2O8FA 2GBLC 1E1QD 1IY0A 5TDHA 4NZYA 1ESMA 5CM9C 4TMKA 2ZTSA 2R2AA 1JJ7A 2UZ3A 2XJ9A 4HI0E 4IEEA 1R0ZA 5DNYB 4BPBA 5SZHB 2ZUBA 3AVYA 3G82C 3EXAA 4O0MA 5A4JA 2ZXUA 4W5WA 4QBGB 1R8SA 3IBGA 3G5UA 4EJSA 2RGDA 3RC3A 3GJ8A 2FFBA 5FPSA 5H1YA 5KDOA 4M4SA 5HKKA 5CK4A 2Z4SA 4BFSA 1J8MF 3ZIAD 3BE4A 1FX0B 3AP3A 1T0HB 2CE7A 3PXGA 3GJ5A 4B6FA 3AF1A 1KKLA 2V6IA 1AQYA 1NBME 2OZEA 1QG4A 3FE2A 1TQ4A 4QGAA 2FNAA 4IFEA 4YMTA 4TYWA 3WNBA 1D6JA 2EVWX 1VCIA 3NG1A 2WOJA 1W0KD 2OBLA 1G3IA 3FMPB 1KAGA 2VP6A 2I1VB 1F3OA 3KB2A 5LB2A 1EGAA 1P5ZB 4PANA 3SJZA 1GTVA 4J0QA 4Q4JB 2KBFA 4ACBA 4AKGA 3VQTA 4ZI2A 2VLIA 1HTWA 5CJ2A 4CEJA 2AN9A 1ZUIA 2IYXA 2VHTA 4N1AA 1ZM7A 3GLFB 2C77A 3SC3A 2BJVA 3DL0A 4RD1A 4V03A 4IXMA 3UG6A 5F9HA 5DISB 5CJPA 4F38A 1G3RA 2F1JA 1DAHA 5FR1A 1CR4A 4D25A 3QKTA 3TSWA 4HZUA 1KIMA 2QPOA 1G8GA 3GJ4A 4QGHA 3PJRA 2OT3B 4LJ8A 2JEOA 4MGYR 2G1KA 1OKKA 2BM1A 3ZLJA 3NXSA 3GJ6A 5G40A 2F1RA 3MLEA 1ZRHA 2PCJA 3VHLB 3DO6A 4BRWA 1U94A 1M1YE 4BLRA 2OXRA 3FGNA 4ZDWA 4ZIRB 4NKRA 3LH5A 3AGQA 5BYKA 2RGNA 1HEIA 4Q1CA 2O8EB 1FQJA 3ZVRA 4MRSA 4RD2A 1IXSB 1W48A 3WRYC 3B1XA 1AKEA 3RRYA 1UBCA 3LX5A 1IN7A 3PCRB 3DZ8A 2DCUA 1X8LA 4RCZA 2D06A 4C0JA 4XD7D 4QFMA 1GL6A 2FMXA 4L9WA 4DT1B 2O0HA 2QRZA 3TSZA 1CS4C 3QVVA 2IHBA 3CRRA 5DO9A 2Q3MA 4HZIA 1GILA 1TTTA 3B1ZA 3K0AB 1J99A 3CONA 4R9UC 3L43A 5K8UA 2PLRA 3PIRA 2A5YB 2AL7A 5LB4A 5JECA 3GEHA 3ND8A 4IXNA 5DH9A 3SOPA 2GKSA 1E2HA 2BJWA 3MJRA 3OZXA 3L8YA 4QNMA 1ZYUA 2QG6A 4LWZA 4ILEA 3ZZTA 1B0UA 3GFPA 2A30A 4ESVA 1XEWY 4XVUA 1QVRA 2ZRLA 1KJYA 4RY2A 1ZMXA 4MKGA 2P6RA 1DS6A 1K6MA 5IDVA 2DY1A 2OAP1 2QAGB 2C9YA 2VO1A 1EFUA 3QF7A 4DLWA 1FUKA 5L3QB 1EFHA 1KZ7B 3IQXA 3W34A 4YDSA 3TR5A 5A5GA 4IRUB 5E3HA 1U90A 4EPRA 2O8CA 4DLSA 1M6NA 1E3MA 1GL7A 4MRPA 3KQNA 3LXXA 1RJ9B 3KUDA 2ANBA 1RRGA 1JEEA 3UMSA 4Q03A 3KXIA 5FOXA 1IJEA 4BEJA 1BOFA 1N6HA 2DBYA 2RMKA 4Q9HA 2HCBA 1K5DA 3BFKA 1DE0A 4W5HA 1E2FA 1ZC4A 1AN0A 2FV8A 2ZRJA 3NDBB 3Q5DA 3LV8A 1VCNA 4HAVA 2ZEJA 4TYNA 1OHHD 3T5GA 4GMDA 5FH9A 4OQNA 4DLVA 1RRCA 1QHYA 4PQRA 1G8FA 3KQHA 1TF5A 4DRZA 1ZNWA 1XMJA 2C5LA 2A9KA 2QE7D 3D7MA 3IHWA 2VHJA 3S1AB 2W2TA 3NEJA 2V55B 4V02A 4U00A 2QORA 3RDPA 2YC2C 1A82A 4NMMA 1N6RA 2XZLA 2YOFA 5FOUA 3VU9A 1SKQA 3L0IB 1RIFA 2ONKA 3LLUA 1VKJA 3CB4A 1IN6A 3ADBA 1G8PA 2OM2A 4X8HA 5KSZA 3QEJA 3T15A 3GLGA 1KI7A 2J7PD 3TW8B 2GXQA 5KNBA 3Q3JB 2ZJ2A 2CL0X 4Q4LA 4RZ2A 4TLCA 4A1FA 4CEHB 3EARA 2FH5B 4Q21A 1I4TD 2BKEA 2IUTA 2FEOA 5FTJA 3SNHA 5FPHA 4FI3C 1D9ZA 1BYIA 1AQUA 1MV5A 1NMXA 1KI3A 2PEYA 3GCGA 4YDHB 2Q9AA 3AGPA 4DDUA 1QRAA 2BC9A 1CEEA 2MMGA 2ZI5A 2ZSAA 3KKOA 1ZAKA 2VHQA 4MYCA 4YMUA 3K0EA 3X1YA 2L0XA 2FWRA 1QF9A 3UXMA 4F4CA 2BMFA 5J4KA 4LBYA 3ECCA 3L0PA 4DB4A 2BIFA 3EZ2A 1AZTA 2FGKA 3GEEA 3W3AA 1F2TB 1S9DA 1AIPA 4H1VA 2Z0MA 2LCFA 2PBRA 3U4QB 2OFWA 2OILA 4G5OA 4Q9IA 4A92A 1KSJA 3TH5A 2CLDX 4JYBA 4EKDA 2IYLD 4B73A 4FMBB 3KXKA 5DI3B 5JHGB 5CM8B 2JLZA 3LWNA 2PL3A 2BKUA 2P5TB 2JLSA 1NL3A 3Q5EA 2WWWA 5AJVB 3KQLA 2I4IA 2AWOA 1G7RA 2XTZA 1AJEA 1DTSA 1F6BA 3VR4A 3M4YA 5JSZB 1J90A 2ERXA 5GJWC 5AJYA 2FF7A 3GJ0A 5KPDA 2G3YA 4QHYA 4Z51A 3GLGE 1CU1A 1RZ3A 1NLYA 1FNMA 1KNQA 2PZGA 3QPUA 1JXOA 3NBYC 2YWHA 2AHOA 2GXSA 2TMKA 4NCIA 4B33A 3Q7QA 1KO4A 4Y0VA 4RSGA 4GL2A 3VKGA 3B85A 3EPJA 3N5CA 4WW0A 2Z5FA 5AUPB 3B82A 1YHNA 1P3JA 3ZYCA 5CDFA 4MYTA 2HXSA 1Q22A 5FPTA 3KTAB 4JLKA 4U7DA 2AK2A 3AKYA 4JL8A 1JEDA 3KKQA 5LD2B 3EPLA 4P4SA 4A0FA 2HF8A 4HB2A 1DG3A 2CMKA 1ZBDA 4C2TA 3IGFA 3W5IA 4I1UA 2D2EA 1NG9A 4EPXA 4KYIB 3GLHA 2OFOA 1E1QA 2QP4A 1W36D 3KZ1E 2ODWA 4GSYA 3CRW1 1JR3D 1ESNA 2GRJA 3R9IA 2ATXA 2W6IA 4M9SA 4V0MA 3K9GA 4Q19A 3UMRA 4W7SA 4I1OA 4TYYA 1G1MA 3WRXC 4IVPA 4D80A 4EPWA 4TQ9A 2WTUA 2EW1A 1OB2A 3V00A 1Z08A 4WZ6A 4M9QA 5EE0A 1E98A 2A5DA 3RS7A 3W6NA 1Q1ZA 3OAAD 2RKOA 3B7GA 5B57C 1NJFA 1LW7A 4JLBA 4C0LA 5FBWB 5JEEA 4FCVA 3L8ZA 2IF0A 5AUOB 1QHSA 2ZQ5A 1SVWA 3NWJA 3W3ZB 3HWSA 4UXIA 3QXHA 1PUIA 3CX6A 1KYIA 1CJVC 5G53C 1W0KA 1YRBA 4QNRA 5CLLA 1TNDA 3W9YA 3IO5A 2IL1A 4QJ3A 5CDFE 1JPNA 4PPNA 4RFSA 2GNOA 4M1WA 1LVGA 1VYUA 5JCZA 1T6NA 2WWHA 1PLJA 1G9XA 4LZZA 1DARA 3LQRA 1Q44A 5EE9A 5A0FA 2GHIA 4LJYA 4V0LA 1NIJA 4JVNA 3EIEA 1MT0A 5JZVA 1R5NA 5M04A 1E0AA 1ZCBA 2R6GA 3MD0A 1WMSA 3GLHE 1A5TA 2QN6A 2ZU6A 1VYVA 2FX3A 4LHXA 3AVQA 3BGWA 3IIJA 3TVDA 3DM9B 3I5YA 3B9QA 2VPPA
chains in the Genus database with same CATH superfamily
2Z8XA 3KWMA 4C5CA 4CLEA 4A23A 2QNIA 3DJYA 3PC2A 3V4SA 3DAHA 4YRAA 2IT1A 3IQWA 1D5CA 5ECDA 1U0LA 4M8NE 1BE6A 3AY7A 4O2LA 3SHOA 2O0KA 4XDZA 1T3HA 4K9MA 1RZUA 1YQ9A 2ZWVA 1MO5A 3Q3IA 2YV1A 3RUHA 3QFSA 1HR0B 5DYTA 1P9RA 1YIDA 3L6CA 5I9SA 1EK2A 3JZMA 3TOXA 5CH3A 1ZRNA 2ZRDA 4X3CA 5EVJA 4IHKA 1RI1A 3V4ZA 3HM2A 3LY5A 3P4XA 4L5JA 5IFKA 1P4JA 2PMCA 4DFDA 3R4VA 2YCLA 2IEIA 4N7RA 3GGGA 5F7JA 3N3AC 5TGTA 1QRTA 3R75A 2D0OB 2WWVD 3E0QA 4UM5A 2GS9A 1T2AA 1TLFA 4NYIQ 3VDRA 4OHKA 1G5HA 2C2MA 4LSGA 2QUJA 2VT6A 2WIAA 2SKDA 1RHJA 3BTOA 1V2GA 1JHVA 1P74A 1RJEA 4BO6A 1PFKA 2PX2A 4OK5A 3MTJA 2VP0A 3CZPA 5E2IA 6PFKA 5I48A 2NVBA 1E2UA 3LC2O 1JBQA 2HR1A 1U3WA 2GPBA 3KKNA 4MRAA 4FWIB 1D6MA 1ADFA 5H81A 1ZN8A 2EBUA 3H3FA 4NHEA 4B7XA 1J0AA 3T7AA 4ENRA 1KF0A 3BMNB 3HSYA 3CW2A 5GTDA 3I9KA 1CY6A 3DEYX 3IODA 3OQIA 4N3NA 1WM1A 3E5MA 4NS1A 1NTOA 2NV2B 2YXDA 1RZRD 2Y1LA 4IEFB 1V7ZA 1ULSA 1BIFA 4MW2A 5I3CA 3QH4A 1UIRA 3AHFA 1M6HA 2DCMA 4QUGA 5E8RA 1C2TA 3RV4A 2X6QA 1ZIPA 3NW9A 2C2XA 4ITRC 4ESHA 5G3ZA 5HW0A 4ZCMA 3LHFA 4FT2A 1D04A 2AQHA 3QVKA 4QZVA 4PX5A 1EU1A 3BB3A 4JOCA 1NM5C 3NWOA 3PVSA 1J1IA 2ZVQX 5IH7A 2GFHA 4YAFA 1HBJA 1LVHA 3WMXA 1CYEA 1N0WA 4L5AA 1Q2UA 1Z74A 4B71A 5J58A 1P72A 2EFGA 4C6HA 3S70A 3TOCA 1IONA 3KWLA 1MKYA 1GZUA 3NPMA 4G5QA 1LQTA 4KH0A 4NU5A 4Q4AA 4WUVA 3VFDA 5JARA 2OY0A 1UWLA 1TPYA 5FUVA 4DJFC 3AY6A 3G0BA 4EYSA 1E5TA 4XQGA 3HP1A 1SB9A 2VDPB 3Q40A 2OAQ1 4KK4A 3TSOA 4DE5A 3L0OA 3QVOA 5F7OA 2F59A 2WT9A 1CY0A 1SH7A 1V1MA 2BF7A 2VXBA 3Q1LA 3HG7A 3QPWA 4K0RA 4ZC8A 5JDIC 1SXJB 3G2JA 1F9EA 4RTRA 3GF4A 3FNHA 2Q4RA 4RTMA 1PZHA 1ECLA 1GUDA 2FJ0A 3D8UA 2J41A 5IJ0B 3NIFB 3BHNA 4OQXA 3K4PA 1T0JB 4RA6B 3SYKA 4N3BA 3H1TA 5AUNB 2K6GA 3UJ9A 1T1RA 1TCVA 2NV0A 1Z4PX 4FN4A 2FVYA 5HGJA 4KXLA 1CR0A 5ER6A 2CHUA 2WB4A 3F71A 1AS2A 1EZZA 1ZZGA 4C4YA 1F51E 3H2SA 4PYLA 2AF4C 2AI3A 1OH5A 1PJSA 2EGUA 3V8RA 3IUJA 5C4IA 1F4PA 1ONPA 2X7JA 2CMGA 3AQ4A 5TPWA 3ZWAA 1RVDA 3C4VA 3NANA 4FSXA 5D1NA 5IJAA 3ZLTA 2I7TA 3GUHA 4N54A 2IOYA 1T3TA 2P77A 2J7PA 1GPLA 3GLKA 4FE7A 1Z73A 4KYTA 1SD5A 3MERA 5DI9A 3U4DA 3TRFA 1J00A 3IO3A 4Q00A 2XIQA 4Y1RB 2GCOA 4LDNA 5FDFA 1CQJB 2P4UA 3JALB 4LOKA 1PVOA 5BMVA 3TTUA 1ZD9A 3DT6A 4NJEA 1ZGCA 3USCS 1WXEA 4JA0A 1IB0A 5IVHA 5JCOA 3R7FA 3AILA 5M5BA 4QULA 1L7VC 3MWKA 2NXJA 1YC2A 3L7LA 1N0IA 1UBFA 3FLMA 4OQ4A 4DNPA 2KBEA 3JWEA 2JFZA 4O4HA 2FN8A 2G1JA 5AKXA 5EJ2A 3I92A 1B93A 1KDZA 1ZH4A 1TCBA 1IXKA 2A9JA 2D2VA 1OPXA 2QTVA 3EVAA 3QBTA 3UA3A 4DQ0A 3FLEA 1BHJA 1ZEJA 2ADMA 1R2QA 3UT0A 2A92A 2UXBB 2JGJA 1YE8A 4Y2RA 1EFPA 3JD1A 3Q7IA 4ZQHA 5NULA 2LGJA 4GICA 4L27A 1Y1KE 3EA4A 3AOGA 2B92A 1OXUA 2YUIA 2C03A 2NO5A 3CUSA 1KKMA 4MKHA 3CLRD 1QOZA 2HQOA 4FGSA 2PPVA 1GAJA 1QQBA 3A3KA 1XCJA 3AMVA 4MIKA 5DB4A 1AQNA 1MFPA 2Z6VA 4B74A 3UMGA 1Y63A 4G0PA 2CLIB 3NHKA 3FF1A 3IJ5A 3TLMA 5KPJA 4JYCA 1N8SA 3PRHA 5DTEA 5A3RA 1J7JA 2B36A 2BR5A 2I87A 3K9HA 1VLLA 2QS9A 5IT9A 1DWPA 4YUZA 1XL0A 1PZFA 5KNBD 4DR4B 3F3YA 4G5YA 4RKFA 4XWAA 3OKAA 3K5IA 1UXIA 4ON9A 2C4WA 3U13A 2XXAA 3PA6A 1EAYA 1G8JA 2C2ZA 3HU3A 2IYAA 3PXUA 3A1WA 1LCIA 2ZYWX 3HEAA 4FGJA 3ZHZA 2C2OA 4U2DA 2JLWA 5GIOE 4D4KA 4JB8A 1KA9H 3QP9A 3AP1A 3EXHC 1B41A 1PFGA 1T34A 4JL6A 4KO4S 2RKWA 2QU7A 2C9DA 1XN4A 3ZHSA 2QJOA 4JLSA 4HMQA 4YUAA 3AV3A 2OZVA 1EQ2A 4K9KA 1GKLA 1ZK3A 1RYFA 2R79A 2I4LA 1IVYA 3TQCA 4PINA 2PKQP 5ITWA 1U1FA 4LHSA 3ZV4A 4DDKA 3IPXA 1IU9A 4QNNA 4XVCA 2I91A 1NMEA 2CV2A 2Q4BA 3TQHA 3ZWKA 2WSBA 1H6CA 2IBTA 1VMDA 1BQEA 4TWAA 3C8HA 1MJNA 5C8YF 2PBFA 2O23A 3OKFA 4UFOA 1E2BA 5TNXA 5IZCA 1NC3A 3OOSA 1P3DA 2H1VA 2WHXA 1T8RA 3ADPA 1NMZA 2JFOA 2LRHA 3IAFA 5ANRB 1EP3B 4YV0A 1W4AA 4Y2PA 1IHOA 3KXPA 4RHFA 3E27A 3UJCA 2C5AA 2YHSA 4HADA 1KRHA 3O84A 2R68A 1DOHA 2OOKA 4YV1A 4NCJA 4OKNA 4IMIB 2WV9A 1U0SY 4GFDA 1SQ5A 5AO9A 2EL7A 1FLDA 1KO7A 2IRWA 2XWJI 4FQ7A 3SLGA 3HEMA 4F71A 3RNOA 4Y98A 3M1IA 5EUQB 2PSHA 2A67A 2PUVA 1YXMA 4LJ4A 4ZN6A 2RAPA 1HNNA 1XI2A 1V71A 4AZ3B 5K8IA 4RPGA 1U63A 2GPYA 1K7EB 3SAJA 1PSZA 2IEAA 1E1CA 1DAEA 1WV1A 2UZ0A 4IX9A 2QZ4A 3QYFA 1IMJA 3R5FA 1M34E 3UBMA 4PR0A 4FW9A 2XT9A 4QUDA 1QZ3A 2NZJA 2YZMA 5JXJA 3BPSA 1LDYA 5DHFA 5BQOA 3ZGVA 2RHRA 1YT5A 4JLMA 4XEHA 4D0LB 4QDZA 1WIWA 4LPSA 5JNSA 4HYTA 3BGOS 2DQKA 2C5BA 2C31A 3I01A 1MJHA 4ESOA 2QTWB 2AZMA 3TZLA 1JAXA 3TRKA 1KEEA 3DLHA 4CGZA 5B1SA 5B12A 4DA9A 3M33A 2R6R1 4ND7A 1BYUA 4ZQIA 1PF7E 2WV7A 4Z49A 3ORFA 1YF3A 2MSCB 1NGSA 4JQYA 4TN1A 5C7LO 2QPLA 3HUDA 4RY8A 3ZDEA 2O1XA 3TR6A 1WHTB 1ICIA 4G97A 1CZOA 5HF9A 3DD1A 1JEQA 2WTNA 3HB9A 1LV8A 2P78A 4JSRA 4NK4A 5ALGA 3WOVA 4AF7A 4A5OA 2O19A 1I8TA 2I67A 3WJAA 3LVFO 3QYAA 2NU6B 2VUTA 1NVAA 5C4GB 1WS6A 2A7QA 4GD3Q 4JHLA 1M2HA 3HCNA 1QC5B 3RT9A 3U3OA 1QM5A 1RXVA 3LQQA 3ZVNA 2DLCX 1J5EB 4LKRA 4DAOA 3V4OA 1VBMA 1T1EA 1YV9A 1DOAA 5E4JA 2ZTVA 2BGUA 1M1YB 1WB5A 3SZRA 4ZJPA 4Q16A 3Q8KA 1W1UA 3IA2A 5L9AA 3RG2A 3A2NA 1T8UA 2FKNA 1AHIA 2J30A 2OM6A 3ZQJA 2PY6A 1IEWA 4LKOA 2FPIB 3JCZA 3ZCUA 4RK0A 3OOYA 3PG5A 5CYPA 1ZNQO 3VAZA 4KV9A 4MVJD 2J8ZA 1KQGA 4DDHA 1AVTA 2CXOA 1IOLA 2ZJBA 5J2TA 2XGOA 1SNYA 4NCXA 2JBAB 1PLLA 4ND6A 2OFFA 1EINA 4Z4QA 3DEJA 4OHVA 4WESB 3UHJA 4OREX 1XCMA 3JD2A 3B9RA 2OV3A 5DSTA 5ARCA 5C1IA 2O7SA 2BDTA 3TZKA 1PX0A 5AFSA 3EOBI 3KQMA 1FDVA 1E1RA 1Y5IA 3R5KA 5C37A 5IASA 5IYZA 3QUQA 3JQRA 4BJ1A 1P18A 4N9WA 3D7KA 2GTIA 3IPCA 4JLAA 1S4QA 2R60A 2JFVA 3GY0A 1P75A 2AX4A 3HKCB 3TRIA 3TWOA 1EJ6A 4GSLA 5JLAA 2O2HA 3RRNA 3OLVA 3H8JA 1J2UA 3STUA 4X6YA 2J3EA 3DNFA 5G0TA 3TRJA 1EUQA 4EVQA 1NHWA 1ACLA 4NP6A 3RTDA 4N0QA 3U7EB 3RAFC 2WQ7A 4AG6A 2WICA 3CG0A 1JQJC 1Z6ZA 1C0PA 2VF4X 3EZ6A 1G7TA 4ZT3A 3EH1A 4EA8A 1B42A 3D8HA 1BD3A 4G1UC 4LF9B 5ES4B 2DHDA 4LMPA 1EDZA 4GYWA 1UEXC 4PRYA 5EHNA 4UBLA 3TLGA 3TPZA 1U0OC 4GVXA 3PKJA 4I50A 5FQOA 4LJ5A 5G02A 4CI9A 5JUWA 5FBVB 2EU8A 4YJ3B 3HZZA 2PKEA 1Y8QA 4N8SA 1IQPA 3H0EA 5H70A 3N6XA 3PQEA 2CL7X 4NECA 4MB0A 1T15A 2W6CX 1TUBB 3B6IA 4PAQA 1ENOA 4CNBA 4AQYB 1SXPA 2FDCA 1SIOA 1XF1A 2OV1A 2G9NA 1J20A 1QS0B 2AJDA 1RXYA 4NYJQ 2X5JO 4TROA 3ZKWB 4RUKA 1EM6A 1PJQA 1LU9A 1WJGA 2P67A 1DQRA 1VE6A 3A1DA 2XW6A 4R01A 2YHIB 3ZDDA 5IX8A 3B1YA 5U4XA 1R4MA 1ZO8A 4MMZB 1M8KA 3COPA 4FINA 7MDHA 2DLNA 4K6FA 4OB6A 3U4HA 5DN9A 4DIKA 1NOKA 2PWZA 3HQ4O 1CY7A 1PNQA 4FYJA 1TE2A 1OLUB 1BX3A 5EIEA 2P9FA 4D42A 5F1PA 3QSGA 2BFDB 1DQYA 1YRQA 2W2KA 4IXWA 1JB1A 5DW3A 4BS9A 4NH0A 4Q24A 1JPUA 2DUWA 4G1BA 4U7JA 4BE4A 3MAAC 4V2UA 2XUQA 4IS3A 1R0YA 3ANYB 4RHXA 2XR1A 4AZ0A 4E0BA 1TXGA 3H5RA 1BEZA 2QUBA 4TRJA 1WCIB 5CBKA 1JKJA 1XDBA 3CPHA 4I99A 4EARA 4X6XA 3EGOA 1K6EA 3KD2A 1P17A 4JLOA 5J1SB 3LAWA 4JLPA 3U6BA 4P1ZA 2DKFA 3RIMA 2YMPA 2EARA 2J59A 5JMTA 2H2AA 2XWBF 4DR6B 2QA5A 1X1DA 3OCXA 1UOPA 4TTIA 1M3SA 2E18A 2OCIA 1CR6A 1GLVA 1X9IA 1MOQA 4KNWA 5L7TA 2PL5A 5TS2A 2O8CB 5ALRA 2MCFA 3Q7PA 2OGUA 3MS7A 4DY6A 4BMZA 2W6MA 4R5MA 1EDBA 1JZQA 1Z34A 1Z7WA 4MWZA 3K0CA 2Z08A 1NUTA 1TVKB 4J29A 2I71A 2VBGA 4CUKA 2ZR9A 1HUQA 3DBLA 1P2TA 1ZW1A 3GT3A 4UCWA 1ESZA 3KVVA 3LIPA 4NBRA 1DDGA 1RACA 1W29A 2BP7B 3OX3A 5KWSA 1MVNA 1V5WA 2JK0A 3B3GA 4JDUA 4UXJA 5LP6C 4EATA 4D98A 4I4IA 2D62A 1AK1A 1W49A 4L50A 1KP9A 1HT1E 2RI6A 5E9JA 2H1OA 2V3CC 3FBTA 3WBKA 3DVRX 5LOVA 2WMDA 1P60A 1UKCA 3DH0A 3ITKA 1B73A 1KEUA 3CZ4A 4TMTA 1HWYA 3SEQA 5AXDA 4IV0A 1PEDA 4BX3A 4DMFA 4XTRA 4IPTA 2DWQA 5FX2A 3HCFA 4KWCA 1NJ1A 2G07A 2V0NA 1R12A 3LZ6A 4MUXA 4OOFA 1IBRA 2XDYA 3FWPA 1ZONA 1BA3A 4V0SA 2QTZA 3VU9B 1UOOA 3EZ7A 1QE3A 2AEMA 1OBFO 1M83A 2DAPA 3BTUA 2Q27A 3H65A 4UD6A 4H08A 3HB0A 4J2HA 4UE6A 1L5SA 2I62A 3FHOA 1NVVR 4LECA 3AV0B 3RBAA 1ZNZA 2J9FA 1QUFA 1OCEA 1P1KA 1Q15A 4IGFA 3I5MA 4TQAA 1GHTA 4JGBA 2AXNA 4J9VA 2Q2WA 4Q39A 3ZDZB 4EB0A 4YUWA 3T61A 2CN1A 2YQZA 5BP7A 3FYCA 5CLJA 3KSDO 3N7AA 1HQKA 1VIMA 5CIYA 2JDIA 4KDEA 1APBA 2JD2A 4C7VA 5JSFA 1EP1B 5B2FA 4CG3A 1HA3A 2WU8A 2AXEA 1KH2A 3C16C 5GPBA 2FX2A 4P80A 5FXMA 2GX6A 1Z4LA 2J3JA 4QFCA 4NFHA 4HF7A 1UF9A 1URPA 1V9CA 2WJYA 3G7UA 5KYWA 1Y8ZA 3D54D 4ZO7A 4KBFA 1F8XA 2QTAA 3H18A 4CM9D 4M21A 4DR2B 1U28A 4HNSA 1NNEA 2XOKA 4OU4A 4RHCA 5DGCA 5A2QA 4RGVA 3WY9A 3N8HA 2IEDA 2XB4A 4OHOA 4P34A 3M5CA 2PBZA 1UMBA 4Y6SA 5AHRA 1Z45A 1NLFA 2Y2VA 3EIOA 3W04A 4C06A 5J40A 4EW6A 3T1TA 1NU8A 4EO4A 1OFIA 4JUIA 3BKWA 4J2TA 2PQ6A 4HQ6A 4UHHA 1SCKA 2XB9A 3CRNA 4NFLA 4QXPA 4GP7A 4FNGA 1XKTA 3RSFA 4E3ZA 1ZMBA 1DX6A 1IAQA 3I4LA 2ZRHA 2ECKA 2NT3A 2XRZA 3GP5A 4Q05A 3HU5A 3NFRA 3QXJA 4WRRA 3LC7O 3BWYA 4X54A 4XFJA 3HYNA 5DYNA 1FMTA 1M7BA 4L1KA 3R0XA 1SUAA 3CO5A 3MT0A 4RJLA 4I6EA 1JWAB 4BMPB 4E51A 5ADVA 5ALYA 1Q1QA 3M82A 3AZOA 4LYYA 4NEGA 2EIXA 4NEQA 1UBHS 1TMOA 3QKUA 5ESWA 4PLTA 2X86A 1JDBB 2PK3A 3NWBA 2BI4A 1NW6A 1E1YA 5A5DA 1GOTA 5WRFA 3PSAA 3TUZC 5JMOA 1XYGA 1L7XA 1WY5A 1KYXA 1L7BA 1MB9A 1PS8A 3HKBB 1RXIA 4M6WA 4LOHA 4QBIA 1BN7A 4JNCA 1OI2A 2GPAA 2NUTA 4CXMA 2C96A 1ZLYA 1UDBA 2DECA 1LDBA 3NGMA 5DYIA 1U9YA 5BSMA 4F3YA 5AM2A 4IQ8A 4HRAA 1E4EB 1U6KA 3BYZA 4WNCA 3W6PA 4XSVA 4E6EA 5ICMA 5JAMA 1PJTA 1PWEA 5KJ6A 4GDFA 4D5EA 3FDXA 1IHDA 2OCKA 3VX3A 2GM3A 3AUSA 2QJWA 4P4SB 3ZH2A 1MP0A 1QQ6A 1ZH2A 1HORA 4AXBA 1U5AA 4WL0A 1RKQA 1M6VA 2Y9MB 4CVNA 2AG1A 1SUWA 2ZZMA 5KOJB 5CBPA 3QEMA 3LP6A 5DV9A 5JVDB 2XNHA 3RU3A 2YC4C 3OT1B 2BFBB 3WL7A 2IYSA 3NEYA 5IDQA 4FW8A 5IC6A 3RROA 3V7WA 2FYTA 2WJJA 5INTA 1KEZA 2Z4RA 4CM3A 4EMUA 4RTKA 1R7RA 3RC8A 3DBHB 1HKUA 1XB2A 1QIIA 3GLSA 6NULA 4QOIA 3X3HA 4MRVA 4Q34A 1A4UA 2LTAA 1H9AA 3EHDA 4U6NA 1L5GB 3WL6A 5KQMA 4DXAA 4WFQA 5HZGA 1YZ3A 4HG2A 2Y3IA 1IRIA 2BFWA 3BWDD 2ZREA 1G8HA 1R50A 5I5GA 3PEYA 3AB7A 5KKNB 3U09A 4FSHA 1CUZA 1F06A 2QG4A 4QXAA 5K6RA 1MABA 3C1UA 3IRVA 1R8QA 4LF8B 2GYYA 2YBDA 4HUTA 2HXYA 1OTXA 3JASB 1BN6A 3CWZA 1JV2B 3X43A 3NBAA 3S28A 4D9HA 1CUDA 2OEPA 3EMKA 3LLSA 3TL2A 1DZIA 2CJWA 2Z2XA 2ZB3A 4IDFA 1YZHA 4M46A 4MVYA 5KOHA 2H57A 1QWOA 2LIVA 1SGWA 1V5FA 3N8NA 4B34A 3KKLA 1C7QA 3CINA 4U2EA 4DUGA 2QAJA 1A9RA 4TTJA 3NBUA 3ZHTA 4B4UA 4B6QA 2WMOB 3F8WA 3SEAA 2ZDHA 3KC2A 1TMKA 4OHFA 3ETLA 1RYHA 4KC0A 3DYBA 4HDSB 4GVPA 4QO8A 3E3AA 4ZQBA 5FBHA 5KTNA 1U9CA 4FOLA 5C4MA 1Q12A 3CNNA 2JBWA 4NNJA 4RHEA 4YJ3F 4QLBA 5CVTA 3OQNA 4CQLA 1N78A 1T2DA 3H83A 2CLKB 5JDCC 1C0EA 2GN4A 5JD6A 3ZNNA 4ARCA 1D2RA 1JIQA 4OHPA 1N0VC 5FP0A 3RANA 2O2JA 2OB2A 2A5LA 2DQ4A 2QY9A 4KWIA 2XUFA 3FDZB 2AFVA 4PLYA 4CR7A 3GP3A 5M34A 4Z9FA 4YT5A 4QXOA 3KUCA 2NVUA 4RIHA 2OO7A 2JARA 1NI5A 3E9QA 2YYAA 3QOFA 1Z82A 1SVNA 2CUNA 4TV8F 1CYDA 3BJRA 3ON5A 3CQ9A 3PDUA 2ZI6A 1Z2AA 3JVVA 3RI3A 3SY8A 2D1QA 4GXRA 1FQOA 3IEPA 4MVJI 2IXGA 1XVUA 4B32A 4D3FA 2OFPA 3OE7D 2QQEA 4DSZA 2V6GA 3VZQA 3TFQA 3VHXB 4PZCA 3PUVA 4KDRA 3WYBA 5T4FA 1VL1A 4GM1A 4OQYA 5CT9A 5EHGA 4AMGA 4AJLA 2OBBA 1KOJA 4MP6A 3ZXYA 3LOUA 3SHQA 3LHSA 3VR6A 2YV2A 5I9NA 3GI1A 3CWQA 1RQXA 2A86A 1W87A 3H04A 4HDAA 3V1TC 5C81A 4MVJE 1KI4A 1Q17A 2BKAA 1X70A 3MOIA 4GNRA 2SCUB 4MPTA 2AV6A 4LTNA 1AGNA 1TX4B 2O50A 4CM5A 4DCMA 4CKCB 4KKXB 2O5VA 1JHMA 3LHKA 1POXA 2A9QA 3TF5A 4DSUA 1E94E 1K5GA 1E2NA 1Z5VA 2YXEA 1UJBA 2JHAA 3DV2A 4IIVA 3QEAZ 1E1RD 2F00A 2MHCA 3L0YA 2PUDA 3P9NA 4LVOA 1L4HA 1VI5A 4UMDA 1G20E 1COWA 3KSMA 5BN4B 3OEEA 4X20A 2YNMC 4BN5A 2CMHA 4YCAA 5ALDA 1SCAA 1Z5UA 3J81k 1GPWB 2W5UA 3OJLA 3TO5A 4C7XA 2OCYC 4PZYA 2HFKA 1ZWLA 2HJVA 1YDEA 2XMRA 2UZIR 1O96A 3T52A 3T9EA 1M2VA 2FUG1 4ZJUA 3AEQA 4J49A 3V4FA 3JQ9A 3PVCA 4FYYA 4HH0A 4C0KA 4CQMA 1U8ZA 2COKA 1XTQA 2ZS7A 4ZRNA 1AKTA 3BA6A 3KJXA 5BQFA 2D1TA 4AKIA 4PFQA 4R9VA 2VT7A 3DO8A 3QF4B 4Q7MB 2C97A 4IDHA 2OLEA 2P3OA 3TM4A 1I0IA 3WIVA 4UVDA 5JNVA 4NX2A 1Q77A 3B5IA 5EIFA 2YICA 3A9TA 3LL7A 5DXFA 2DETA 4BNLA 3GLIB 3SZMA 4OI1A 2BTQB 2ENWA 2H1WA 3UK0A 1B8PA 3GEPA 4TMYA 3L8FA 2OKGA 2H5LA 4N12A 1XMPA 1J42A 2GOYA 3EFBA 1GPMA 3REQA 5KQRA 1N25A 2BFCB 3EX7C 1CF4A 1NUUA 5K2MA 4F5WA 1FJGB 3O73A 4AP6A 1X8JA 4KXNA 4M53A 1PBTA 1SBTA 4O5AA 4M0KA 1R0CA 3PGLA 2J9YB 4X6LA 2BL4A 2H54A 1G38A 2V6MA 4TLEA 3UB2A 3DMNA 1XTSA 3AXSA 3JYLA 1VL8A 3KWFA 1EVQA 1IZ8A 4JVOA 4L4SA 2VEOA 1J70A 3EFHA 4RETA 5DASA 2WEKA 5FKJA 5KCMA 1RKVA 2VHVA 1ZN9A 3L49A 1RXCA 5JLJA 2GZ2A 3UGKA 1WXIA 2I22A 3ROEA 1QK4A 4TVKA 3T0GA 3G0HA 4GZ6A 2YTZA 3IA7A 1TJNA 4KSCA 2ZAGA 2CNWA 2W2OA 3A1EA 1VJDA 4FFVA 3TPFA 3WZ2A 4IOMA 1NBIA 1HE8B 1DJLA 1ZCAA 3NALA 5K3SA 4GYKA 4C7MA 5IHXA 1C8LA 1ZC3A 5THXA 3UFXB 3FFBA 2ZT8A 3ZWVA 4M1YA 2GUGA 2O2EA 1YB5A 4PYOA 4DVJA 5BNIA 5FULA 1SQGA 1KRXA 1VJ0A 1XRRA 3K9NA 4KTVE 5FO0A 3V9PA 1S3IA 1WXDA 1X1BA 2C42A 2JFHA 4WQMA 4QBTA 1T4GA 1BVRA 3MVEA 3CTPA 3MCTA 3QHAA 1Z63A 3CH5A 3FN4A 4WFKA 1K08A 3TQRA 5F1OA 5C51B 3EUAA 4QBFA 3M70A 3JQPA 3SSNA 3ZV3A 1BVUA 1DXOA 1WOMA 4CTJA 4DJJA 1IHXA 3H5IA 4EUKA 2H5EA 5BNZA 3TTSA 1K06A 2MSLA 4RADA 3JAMA 2VQFB 3WYDA 4CV2A 1CEQA 1E7YA 1JIVA 5DCLA 5I3ZA 5JQGA 2EC5A 5CLFA 3UUWA 3QJGA 2NO7A 3R09A 2GILA 3M81A 1QZXA 4OK3A 3AFMA 1P2BA 2IPMA 1ZESA 5GM2A 4CW7A 5B1EA 3RNLA 3ZTYA 1C3JA 1R0LA 3LCVB 4O8CA 4YWJA 4TKVA 2ZWOA 4OSOA 1OREA 3A31A 3NDIA 4RX1A 4E2ZA 1OI7A 1XWFA 1X74A 2FPGB 1OE0A 3JARA 3OEHA 2ORED 3I32A 1WXGA 2O07A 1XZCA 1NQAO 3DHVA 1ZH8A 3LPMA 1H8EA 5D01A 3S4YA 4B0PA 3ZE8A 2AJBA 3C45A 3K6KA 3PK0A 5HKAA 3QM1A 4R84A 3STTA 2JIPA 3U3JA 4CM7A 1QU3A 2FWNA 2FR8C 4MXDA 4DMLA 2WUGA 3ZK8A 3JQ6A 4IRMA 3UENA 3U6KA 3K05A 1YTLA 3ELBA 4IKOA 4II7A 1UOEA 3LT5A 2A3NA 1RYEA 3QNMA 1L6IA 1I33A 1B43A 4G86A 4L4UA 4PGFA 1JWLA 3EXG2 3MELA 5AI0A 3SICE 5KSYA 2VTDA 3VNQA 1TD9A 2I2CA 4D79A 4KO8A 4EO7A 4XR9A 7ABPA 2HGZA 3B7WA 3WKDA 4A0GA 4LCEA 1D1PA 2ES4A 4ARAA 3FNIA 5E3IA 1I2ZA 1Q91A 5CFPA 2EW2A 2V7TA 2YINC 3FOEC 1UBGA 2PO7A 4ZGGA 3L3BA 3B13B 3TGLA 1MENA 1CVRA 2HI0A 4HGQA 1ESCA 4KVZA 4N82A 3HFRA 1U2DA 3SJAA 1YUBA 3DBRA 3ZCXA 4Z6KA 2IW3A 5H3LA 4FZRA 3ND7A 1ZUNA 2Z09A 2QI9C 3VNAA 4MWOA 2F7SA 1S1CA 1DEHA 1ZR4A 2GVNA 2ZSEA 1FUIA 4XJXA 2I6GA 2FG6C 3EB9A 2DFKB 1L7RA 1O9GA 1ONNA 4L2IA 5K0CA 1P7YA 4MV0A 4YJHA 5C0OE 4DA4A 2OXCA 1YB1A 3DZDA 4G9BA 3NMUF 1NNSA 2C29D 4TL8A 4YRMA 2GA8A 2HHJA 1S8FA 2JVKA 2FZWA 3INTA 1A8UA 2PXXA 2XX3A 4B4WA 4QPJC 1JRLA 3SC6A 3VHRA 4XJTA 1YE5A 3ENQA 1JN0A 1BVHA 3VUEA 1TM5E 2I6TA 2C8LA 3EJWA 2EX0A 2C9MA 1UBOS 2C9ZA 3IC5A 4YO7A 4B40A 2ZJYA 3OIGA 1DC3A 4WKNA 5HJ7A 5DT9A 1XTJA 5AWFC 4S1VA 4F1JA 2ODBA 5CVCA 3WYFA 4ZV7A 3EVTA 3OQVA 4V1CI 3FUWA 1TFUA 1ZBQA 5JPCA 4RZ3A 1SIBE 2HX1A 4PFJA 5DOVA 3PEVA 1YMVA 4GOOD 4R54A 1II8B 1QHHB 3GUUA 1TUIA 2BDEA 2GXUA 2YWJA 1DKNA 1Q7GA 2PEZA 3HN2A 1W1IA 1CNFA 2NM0A 2YZKA 1TIKA 1NPTO 2VJQA 2VYFA 3GGJA 4IDQA 4MO2A 5I51A 1KXZA 5FI0B 1US8A 4WZBA 3WK9A 3E1KA 4E14A 1R27A 4Y6GB 2VATA 5BVGB 3O8OA 3ROQA 5A7HA 2NT4A 3B60A 4YI5A 5KTPA 1XZKA 1Q95A 2H63A 3I72A 4JP2A 2CFRA 3TLBA 1I6WA 4BFZA 3BIWA 2ZIGA 2WIJA 1U2GC 4BEBA 2ZI9A 1OC4A 2FMFA 3B9PA 1IEXA 3ABZA 3MSXA 3P0IA 2JAUA 4EM6A 1M8FA 3FTPA 3LUDA 3N75A 4QTXA 2IITA 3O82A 2UVPA 3C3XA 1XEFA 3CX7A 2WUFA 1T29A 4LV5B 4RULA 4DV6B 3EBPA 4ZICA 2EZUA 4WXPA 4ZOLB 1PD1A 2C7VA 3BXFA 3IEXA 1PJ3A 2QZPA 1OZ0A 1RWWA 4J1TC 4L6AA 1XZPA 4W99A 2P9EA 3K9LA 4D2IA 3H19A 3IE0A 4GZMA 1IM8A 4ZVTA 4QG7A 4I4NA 5J2UA 4FDMA 4KXMA 3JYHA 4MW1A 4G1MB 1SBHA 1TO1E 4NV1A 2JI7A 5KDLA 1SZPA 1UBKS 3LPLA 4MA4A 4XWOA 2X6RA 4J16C 5LQMA 1JG1A 2J9XB 3CIOA 1Q5PA 3LXUX 3OFNA 1LK5A 3RAGA 3ZCSA 3T3MB 5HOEA 3DG9A 3ODGA 5E0OA 2J6CA 5FOVA 2B9VA 4HWTA 4RGYA 3RK4A 1K6XA 4HLUC 1J06A 4PLWA 2VYVA 5KIAA 1NI4B 1ZGJA 4ZZIA 3C48A 1AA9A 1NJ2A 3DB2A 4ONEA 1KSHA 4BKRA 4H7HA 2NO0A 4X44A 3V46A 3VA7A 3L7YA 1RLTA 3SZOA 2Q6KA 4BWVA 3IVCA 1GLGA 4DUGD 5B3KA 4QG3A 5C52B 4RW0A 1DCTA 4ALIA 2EERA 2OLKA 2WKWA 2ZRQA 1JQDA 5BYBA 5EKXA 3P19A 4X7PA 3ZHOA 4QPCA 1V8OA 1Z7EA 1DFIA 1BHSA 1M67A 3D4IA 2JH8A 3HJBA 4NDNE 3CF6R 5CYFA 3QVXA 5DNDA 4G24A 1NP3A 4PZUA 2XUKA 3A70A 3EMVA 3I2IA 3JD0A 3OQ1A 3PTLA 4OQFA 3KOWA 4W9MC 4S1WA 3DQPA 2P4SA 3WYNA 2OBXA 3QKSB 4BMXA 1PQYA 1QF6A 5G0WA 5AKKA 5KWEA 1BFKA 3AB3A 3P4YA 3BRSA 4H6XA 3U2QA 3WQHA 4B44A 1Z0JA 1GU0A 4EYQA 4F6LA 1TK2A 3OVMA 4DIMA 1NZDA 2BUBA 1EB9A 3HI4A 1RHRA 2QZZA 3O94A 4IVNA 3QPCA 1AF7A 3JZAA 3R5HA 2JAWA 2WC1A 2ZYIA 1SPBS 4JXJA 4HT3B 5JWRA 3E7DA 4UTRA 2C98A 3AP2A 3M5PA 4ZGBA 5LU9A 4WK0B 3HM9A 1CY2A 1TRKA 3ND9A 4XGNA 4C22A 3A36A 3SDSA 1KS9A 2V6JA 3R6GA 3W5HA 3AT1A 4XDHA 2QRQA 1P5FA 4G2TA 5JANA 2P0EA 2V4MA 3GQBA 4JBNA 4KAJA 1IEQA 2JLQA 3ZGYA 1TQ6A 2YL2A 5K3BA 3HKEA 3D6JA 5MFZA 4X84A 1GCOA 1PL7A 3I9LA 4MHSA 2CHFA 2GBGA 4HH1A 4TYPA 4DRXA 1RYMA 1W5AA 1VP3A 2HT6A 3DAOA 2CLFB 4R9SA 2NZVG 1Q3HA 1A5BB 2FKAA 2DH6A 4YXWA 4DLUA 5IVIA 3CVVA 2Q07A 3AEKB 2ZJ3A 1JYFA 5LYJA 4EMSA 1E2EA 1FCJA 1TW3A 5SY4A 3D43A 4B7AA 1GZDA 1QORA 3ER6A 1KJJA 3NV9A 3QMPA 2FSSA 3RGGA 4PO1A 3H2HA 3OIWA 4P3XA 2F43B 4RLHA 3CFYA 1REQA 1T9BA 4ZA2A 2WM9B 4CYMA 2QM3A 2IP2A 4I1VA 4Q5IA 4XVQA 1IG3A 5CR9A 4AWXA 4D45A 1I5RA 3H5AA 4QYIA 1DBQA 1VG9B 3UVEA 3KR1A 1IN1A 3CLUC 4YP0A 3EMDA 1K2VN 1VP9A 3B89A 3C8MA 3HBJA 3K9BA 5FUWA 1UK6A 2AR9A 4YP1A 4PWZA 3RSLA 2Y2UA 3ZI7A 4UTZA 4CIVA 4Z4GA 5JAOA 4XRGA 1C0LA 3W8FA 1KNXA 1WLYA 4IV8A 2VYCA 4CU2A 3SZGA 4CQMD 4LY3A 4FUQA 4DMRA 3TDKA 3UYLA 4L28A 4L8FA 4NCNA 1A5AB 3K0AA 4I4TB 3VNSA 4O2AF 1Y8RB 4M7PA 2PT7A 3ZBQA 5IUNC 5IXYA 2GRAA 2Q7XA 2R1UA 4MHOA 1CJMA 4YQEA 3U62A 3C0KA 2OOSA 1JDTA 1FFXA 1H2XA 4LUCA 1V48A 3FGZA 1GDTA 1UFRA 1KJQA 1Q20A 2I5PO 1UMDA 3EN0A 3CEMA 3KETA 2O59A 2F9MA 4L0DA 4BLWA 3F96A 1SB8A 1N3BA 3EGXB 3QFFA 2VAPA 1NKVA 4MVWA 5CXUA 1YKSA 1TI7A 3SJUA 1SOUA 2R47A 2FLKA 2WU0A 4GX0A 3A4MA 1V11B 4TVSA 2BHLA 1QH9A 2ZLBA 5KX5B 2VNKA 2LR0A 3GNLA 1KZYC 3SZLA 4ENWA 4EG7A 2AG5A 4ZIRB 1JMVA 2QRJA 4J0JA 4MMYB 1NTRA 4X1YA 1N3YA 4QOHA 1VCOA 1XIVA 4UAVA 5HIIA 3U4AA 1KFCB 1GKKA 2DFTA 5DBEX 2OBYA 1CQWA 1EFVA 1TW2A 3OIVA 2AOVA 1FFGA 1KSFX 4CDRA 5IK2A 4OYLA 5LCXA 3UK6A 5BR4A 5IKMA 1JE1A 1XRJA 2Z30A 1RJ9A 1U1DA 2GJ8A 3Q3HA 4M0FA 1XJWA 3E5NA 4WUTA 2I55A 3VVMA 1T13A 3NHFA 2ZIXA 4K6HA 1NHGA 1SY7A 3NNDA 3JPWA 2ZJ5A 4NC9A 3DC7A 4ALNA 4ER5A 4YUXA 3GMTA 2BGWA 1NBWB 3AM5A 4RK4A 4C87A 1DJQA 3PCTA 2X8WA 1NURA 1FDTA 1V4VA 3MJHA 2ZVDA 2PSFA 4MW5A 5JRZA 1EZ4A 2CNWD 4B80A 3KPUA 5JCOC 3QYJA 3A9SA 1L5NA 1IZ9A 2FSUA 1L9KA 2QNBA 3MMPA 5T6MA