5CIWA

Ran gdp y39a mutant monoclinic crystal form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ciwA00
4HB2A 1CTQA 1OIXA 1MRSA 2IUSA 4HLUC 4QG7A 5L3SB 4OI0A 3B85A 2WKQA 1OF1A 3X1ZA 2MMGA 5IK2A 3EZ9A 1GRRA 1KI7A 3GCGA 1M6NA 1GRNA 5A5GA 5JI3E 4O3MA 4BPBA 5CJPA 4BRWA 1XBTA 1CR4A 3O47A 1VDZA 2AK2A 2O8EA 5FOXA 1RRGA 4F38A 4K81B 4PC6A 3O8RA 2YV5A 3JVVA 4OHWA 2WJHA 2IUUA 4J0QA 5GJWC 4MH0R 3ASYA 2ZU0C 5EUQB 5FBVB 3L0PA 1EX7A 4G5OA 2QQEA 2ZM5A 1N0VC 3AV0B 1K5GA 1IY0A 2VPPA 1UKVY 2DB3A 1G18A 2DYKA 2BMDA 4IXMA 4NE2A 1UBCA 1M1YE 1E32A 3BBPA 3ZVNA 3X1XA 1IOZA 2UZ3A 2LKCA 1FUUA 3H0KA 1GIAA 3UPUA 1VIAA 2JLSA 2D74A 3VAAA 1OYYA 1OYWA 4K46A 4Q4HB 1E1RD 5KHOC 4JVMA 4O0MA 4TYQA 1S4QA 4D0GA 1QDEA 4JL6A 4TZ0A 4MA4A 1GVNB 2BMEA 1V5WA 4HYYA 3AVUA 5FTKA 3THOA 4IRUB 4AKHA 1BYIA 1KMQA 1A82A 1KOFA 2AD5A 3BERA 5TV2A 1G291 3LD9A 3U2QA 4D26A 1DE0A 1M2OB 3KUDA 4LSGA 4BLTA 3THWA 3C15C 2QTFA 1S96A 4B73A 2XSZD 3KQKA 1OFTA 2ZRJA 4LX0A 3DZDA 4DLYA 1R8QA 2J41A 4JVSB 1AK2A 4RKEA 2QAGA 3K0AA 4WAUA 5FPHA 4HLCA 3DKPA 3QXSA 4NYJQ 3AF4A 4C4PA 3IQWA 4CZ2A 4WOPA 2O8CB 2QQ0A 2GJAA 1GFIA 1GL9B 1JAHA 4CEJB 1J99A 4LC0A 4KVAA 1WBBA 2ZJ2A 3VX3A 4BZXA 3PUXA 1K8RA 1P60A 2ZI4A 4D4KA 3VMFA 2C98A 4D82A 1CJMA 1W47A 4URWR 2MMCA 2JDIA 4UNSA 3EZ7A 4DSUA 3R7WA 3S1AA 4EJSB 1AGPA 1G4UR 2GXAA 4TLEA 4JKIA 1EGAA 5GJVC 3KFVA 5C4GB 2PL3A 4BEBA 4BLQA 2OCPA 4KI0A 5EE5B 3GJ6A 3NKVA 1C1YA 1W5SA 5JWOA 2DFLA 3DPUA 4D81A 1MO5A 1S2MA 4PPFA 1NI3A 3AKCA 3P4XA 4BQSA 2ZRIA 2V6JA 1KSGA 1NBMD 4EFNA 1N6RA 1DEKA 2ZE6A 3FDIA 2EFDB 2NPIA 1E9RA 3TR5A 5CM9C 3IEVA 4M53A 4PTLA 3T06B 4PFSA 1IXZA 1SHKA 3WNDA 1NSFA 2VHTA 2IS1A 1HUQA 3MWKA 4RD6A 4DXAA 2RGDA 1AS0A 5E7IA 3B13B 1QG2A 4DDVA 3K0EA 2G77B 3CWQA 4LOAA 3RWMB 4DLWA 4E07A 2W0SA 1CR1A 2FPLA 4NKRA 4PZZA 1TAGA 5CIQA 1GL6A 2GK7A 4LUCA 5JECA 4IOMA 2OLKA 1TF7A 1E2PA 4XJXA 4P31A 5B2ZA 2ZS9A 5FI1B 2DFTA 2XEXA 4IDOA 4QM7A 2XXAA 1J90A 4Q9JA 2VEDA 4TLCA 3QXJA 4G5SA 3GEIA 2BHRA 4ZDWA 4KYIB 3E2IA 3LO5A 4L16A 2FPMA 2J0VA 3QKRA 4KFRA 4V0KA 1RRPA 3GD7A 2IYXA 1KNQA 1NNEA 1ZM7A 1U8YA 3QVUA 5IRCD 1HH4A 2NPFA 1CU1A 5CK4A 1XTKA 4QBFA 2Z0MA 3K9LA 3GJ7A 3KDSE 1XZQA 3OE7A 3KQHA 1NN0A 2J46A 4MKGA 1JNYA 3MAAC 4JYBA 4M9QA 2JLZA 2QAJA 1J7KA 1ZW6A 3THYB 4DT1A 2PEYA 3WYFA 1DAMA 3QENA 1WP9A 2QNRA 2GVZC 2JLVA 5DISB 2Y8EA 3CRMA 1XNJA 5GVRA 3VTKA 4C2TA 2ZREA 5JLJA 5E3HA 5CLQA 2H57A 4C0QC 4HI0E 4RVCA 5C1BA 4PAQA 1Z0JA 2BM1A 2E87A 2WICA 4GFDA 2GRJA 2BCGY 5SZIA 2D7CA 4P0TA 1XEXB 4CVNA 4OK6A 4ERNA 3GLIB 1YRAA 3QY0A 5DLQC 2WWHA 1G5TA 4US1R 4KFUA 4OQLA 4A4DA 1QZXA 4YDSA 4RFSB 2ONKA 4PHHA 3RLFA 3H86A 5EJEA 4B35A 4LV8B 3KJGA 3O8DA 5FOVA 4JJKA 3RVBA 3SYLA 4Z51A 2EQBA 4ACBA 1UBGA 1G8HA 2FSHA 4ESHA 1ZP6A 2EYUA 3RS0A 5FTMA 1R0ZA 1II9A 4HAYA 1F2UA 1TF2A 3AGPA 4K8OA 1RRFA 3LWNA 4OJKA 4CT5A 5FPKA 2WMOB 4LZZA 4A0RA 4RY2A 4PSVA 4HLQB 4XVUA 3TUJC 4ZI2A 1W36C 1L8QA 4URVR 3J81k 1CR2A 3PUWA 3BS4A 4AIIA 2NO9A 1R6BX 1P5ZB 2FOLA 4M21A 2V55B 1SVSA 4MYCA 4OK3A 5HTKA 2GZDA 3U5ZB 2J1LA 2CLSA 3JZAA 3ZIAA 2AWOA 4GZMA 4BLPA 2ZS7A 1NRJB 3DL0A 3REGA 1NG9A 3C5HA 4XH9B 2EFCB 4DBLC 1N6LA 1Z8FA 2WWIA 2HDNB 2ZE7A 1Q21A 3IGFA 1N6OA 2KI5A 5K8UA 1JBKA 1NN5A 1SVMA 4EKDA 3A58B 4KSCA 5G53C 3TRFA 1ZBDA 4MYHA 1BH2A 3LBNA 4GMDA 1VIYA 4U00A 4R9UC 4D0NA 4ZDKA 1E0SA 4CF7A 4IVPA 5EE9A 4IDHA 1WF3A 4D6PA 1VHLA 1Z6YA 3BD9A 1COWA 4IDPA 1SKYB 3K0CA 1BOFA 4YONB 1LW7A 1RC8A 1ZC3A 1NSTA 1U0LA 4Q1DA 5FUYA 2L0XA 5CDFE 2BEJA 3NEYA 1QG4A 3OF5A 3A1SA 4JLJA 2Z5FA 3WNCA 1IJFA 1KSJA 1DAGA 1VECA 4QBIA 1CJKC 3LX8A 4P4SB 4X8HA 5FUWA 4DCTA 4BFTA 3RS7A 1IAQA 2FF7A 2JGNA 1IM2A 4RKFA 4F7WA 1BYUA 2HYDA 3D31A 3UK6A 3VU9B 2YOGA 2ZVPX 1HEIA 2W6IA 4ESVA 2WOJA 4URXR 2DR3A 2CCKA 2ZAOA 3WMEA 4PC3A 1X1RA 4LHYA 5JEEA 2FJUA 3MMPA 5FUVA 4C30A 4B3DA 2HJVA 2VTKA 2Z83A 1HYQA 1DS6A 1SQ5A 4I1SA 4C0AC 3Q3JB 4GRAA 3ZD7A 1N2CE 2GA8A 3LQRA 5LB2A 3DKVA 4YMVA 4C2UA 4Q1CA 4RSGA 3CWZA 4TTRA 1P72A 1R0WA 2ODWA 1TUEA 2Q3HA 4QBHA 2IBMA 5J4VA 5KNCA 2FG5A 2O8FB 4TL9A 3OEEA 2FFAA 2H16A 1WB9A 1K5DA 1E69A 1F2TA 1VG8A 4V0OA 1G3QA 3LW7A 4U7DA 1GITA 4YDHB 4V03A 2D7DA 2GK6A 1KDOA 3TVDA 2QSZA 1CS4C 5JCZA 2CEAA 5EQTA 1XU4A 3QF7A 5AUQA 1TU3A 2OSBA 2RGBA 2IYWA 4V02A 1U2RA 1ZIPA 1LF5A 1OFIA 3EIEA 4S35A 3W3ZB 1SKQA 1AIPA 4H9GA 3UKDA 3TW8B 1G20E 3NIBA 3KZ1E 1I2DA 1VG0B 1UFQA 2R6FA 2ZRLA 4LRWA 4AYTA 3C41J 2BJVA 3AF1A 3VFDA 4FMDF 3T1VA 1KKLA 1Z28A 3OEHD 4TLDA 3X1YA 4BFZA 2JAQA 5HE9A 3OIYA 4BUJA 4KBGA 1MRNA 1XXHE 3B1ZA 1IY2A 1Q57A 2YWHA 4GPTA 4AI6A 2ODEA 2PBRA 3TAHA 3VKHA 4TMZA 3TH5A 2BEKA 1ZM4A 3F3YA 3C14C 4JLDA 2ZJYA 1SXJC 3CRVA 5TDHA 3TSWA 2QBYB 2OILA 1O87A 1XD2B 4JJZA 4ZIRA 1CJTC 2RGEA 4DEYA 4HZUA 1CRQA 2WVJA 3BK7A 2A5DA 3BORA 3GLGA 4DSOA 2XB4A 4DLUA 2GTPA 2QT1A 2WJYA 4XD7A 5JHGB 2IT1A 1Z2AA 4I81A 1W0KD 3P20A 1M74A 3CRRA 1TX4B 3FHOA 4GL2A 1G8YA 2YWGA 2YVUA 3ADCA 2AWNA 1NN3A 2GDJA 4KJZA 4TTPA 3SHWA 1N6IA 3BH0A 3LW8A 1XEWX 3GLHB 4XSGA 2WIAA 3E5HA 3QSYA 1UF9A 3GJ3A 2Q9AA 4M1SA 3I8SA 1G4AE 4TT3D 5CB8A 2CHQA 1DAHA 2C2HA 2REBA 3QBVA 3CPEA 2CL7X 2ZUBA 3WRYC 4AWXA 1UJ2A 1E1QA 1MABB 2FPKA 4JIMA 2AL7A 1CULC 2OO7A 1AQUA 2FMXA 3ECCA 4MRNA 2Q9CA 4WXRA 5LPNA 2ZRAA 3L43A 1GOTA 4XIGS 4Z54A 2ZRHA 3SDZA 2WZQA 3BH6A 2OCAA 3VR1A 3CONA 5KPJA 1E9DA 5FBRB 3BFKA 3HWSA 3K70D 4HUTA 1MKYA 4GOXA 2W0MA 2YWEA 1W2GA 2ODBA 4ZCLA 1YU9A 2WPDD 5DI3B 1MO3A 3QXCA 3RS2A 4OHZA 3TAUA 2R2AA 1JR3A 4BZQA 5CIWA 2R6AA 4B75A 1GUAA 4Q4JB 2WSSA 1AZSC 4AG5A 2RGXA 2P6UA 5DN6D 3OAAA 4G5RA 1AS2A 1F48A 1W5TA 3B60A 4IXNA 2A78A 1EX6A 2XOKD 1E9BA 4O2LA 3N5CA 4DIEA 1U90A 1TQ4A 3ND8A 2FZ4A 5FL3A 2RB4A 2W6JA 4XWAA 3R9IA 3W9YA 2OEPA 1Z0AA 1UKEA 1XTSA 2NIPA 2IA5A 3A8TA 3KQNA 4Q7MB 4PPGA 4QXAA 3P27A 2PX0A 4Q4HA 1LFDB 2CL0X 2J0QA 4Q21A 1N6NA 4JSYA 5C46F 1XDBA 3T5DA 5IK2D 5FPTA 2BKUA 3BRWD 4B3GA 3T1QA 5HCIA 3AVWA 1I4DD 2Q3FA 2ZUCA 3AF3A 3LNCA 2IYZA 1Q44A 4HAWA 2AR7A 5B57C 5FTNA 2F1RA 1NMZA 2ZYTX 1FQJA 3MG9A 4ZKEA 1A5TA 2RCNA 3W8NA 5BXQC 4E09A 3SOPA 1YR7A 2B7CA 3SI7A 1NLYA 4BASA 4OHYA 2C9CA 4B71A 2GCOA 4A92A 2Z43A 2CMKA 3EARA 1OKKA 2GF0A 1KMHB 1J2JA 5AUNB 3QF4A 3F8TA 4PO9A 3QE0A 3SYNA 1II8B 2VRWA 1OH7A 1HT2E 1WQ1R 2O8CA 1KHTA 1GNRA 3DEFA 3DHWC 4CEJA 2NGRA 1GG2A 2ZI7A 1X8JA 3HJNA 1YR9A 3L0SA 4JL8A 4M0LA 5AJVB 5A0FA 4TMWA 4BECA 1R5NA 1XZPA 4C0LA 3ADBA 4HUQA 4QHSA 3BFXA 4TL7A 4BFXA 5KSYA 1Z3IX 5UKDA 2ZUDA 2OV2A 3EPHA 4W5WA 3NBFA 5L3VA 1F60A 1Z06A 1X6VA 1OHHA 3MD0A 4EPWA 1RJ9B 2ZRFA 3MWLA 5G40A 4EJSA 1IN4A 3LDAA 2VYFA 2ORIA 3Q72A 2IYYA 2ZU6A 5JS7A 3GP8A 3MGCA 1E4YA 3L82B 4I99A 4MKHA 4ZKDA 1FP6A 4B6FA 3O8CA 3PEVA 1NJGA 3SQXA 3ZQJA 1ODFA 5KOYA 1LF0A 1EWRA 821PA 4LPKA 4TYYA 1EFTA 5JFGA 3KTAA 2AKAB 1GKIA 1Q1BA 1N0WA 3FE2A 2ZYUX 4WZBE 4LHVA 3OFND 1UDXA 3EAQA 3BH7A 3EZ6A 1ZD1A 2QTHA 1NL3A 2H8KA 3FGNA 3ONWA 1G21E 3ASZA 1DO0A 3TVTA 4HB0A 5TMPA 5M04A 3U6KA 5KNDA 5SZJA 1T91A 4ZCMA 5JJIA 5EXXA 2VHCA 5L3QB 5J4YA 1U9IA 2YZ2A 1XMIA 3CPJB 3LBIA 1ZNYA 4AURA 4PC2A 4X8OA 2ZR0A 3R8CA 3AQ4A 1OXTA 2C03A 3CB4A 1H65A 4ARZB 2CHGA 2ZR7A 3HPRA 3Q7PA 1G7SA 4DLSA 2D3WA 4JLVA 4Q48A 3W3AA 3THXB 1AA9A 2WM9B 2ZROA 3HYRA 1ZVQA 2QENA 1TQDA 2WKPA 3QIAA 4QJ3A 2Q3MA 3TK1A 4I1VA 5EZ6B 5EE3A 1T6NA 3LFUA 5E7JA 1VCOA 1S3SA 2KBFA 3KB1A 1P2UA 3SQWA 1A4RA 3GQBA 1HQYE 2D2EA 2CE7A 4JLAA 4M1KA 4D4MA 1FZQA 4RD2A 1US8A 4M1YA 4C7OB 5JHHB 3NHBA 3REFA 3WHLA 3K9GA 3KKNA 3CO5A 2RKOA 3OHMA 1LY1A 3FFBA 4FN5A 2C77A 1KJYA 4TL6A 1Z6GA 5A4JA 5HKKA 2QE7A 3A4LA 2WJGA 3EW9A 4OHXA 1P61B 2X19A 1M7BA 2D2FA 2IYRA 1S9HA 3V4FA 4V0NA 1G5PA 2R8RA 4Q00A 4RD3A 5H70A 4LV5B 5DHFA 4RD1A 3ZDQA 3SN6A 3E70C 4DWJA 4AD8A 1OXSC 1Z08A 2ZIAA 1NF3A 3I1FA 4Y0AA 3NC0C 1OXVA 4LJ9A 2IL1A 1G6HA 4IFEA 5JZVA 2OT3B 4UXHA 2VP0A 3QKSB 1FQKA 4TN1A 3WXMA 1G1MA 1OFUX 3QG5A 1EG7A 2NQ2C 1EXMA 4IVRA 4MGZR 1A1VA 3EX7C 1R0XA 1E2KA 4BFVA 4US2R 4HEJA 5JJLA 2ZJ5A 1NG1A 2PJRA 2ZSFA 1ANKA 1DELA 1J70A 3FMOB 2D06A 2QROA 2ZPTX 4JVLA 4KV9A 4JLOA 3GJ0A 4RFSA 2GAOA 2IYSA 3OE7D 2IS4A 2B92A 1R5OA 1QHGA 3SS8A 5L8VA 1KZ7B 2EFGA 3L8ZA 1EFRD 1P4SA 1OE0A 2QN6A 1R4AA 1KSHA 1YVDA 4PHFA 5J47A 1PLJA 4FWTA 2WAYA 4KBFA 5J40A 2WWGA 1Z5ZA 4PO1A 4JBWA 3TNFA 2GVDC 4F4JA 4P3YA 1XF9A 1SHZA 2J0UA 3NBXX 4M2LA 3W6PA 3RSOA 1XEFA 4WBSA 2HT6A 1ZU4A 4C0BA 221PA 3LY5A 1VG1A 2O0JA 1DAIA 3JZMA 4AYWA 1Z22A 5J4LA 5CLLA 1IY1A 3ZVMA 3WYAA 1CRPA 1IHUA 2F9MA 1AS3A 1KDPA 2PZFA 3LXRA 1EFCA 1GWNA 1G3UA 3K9HA 5FR2A 4EQ6A 2VSXA 5EP3A 3WNBA 4NTZA 3VR4A 2CK3D 2FGKA 2C95A 1GZSA 2RGCA 2GEDA 2WV9A 1YJ5A 2ANCA 5CB6A 3CR8A 1WMSA 2HXYA 2JEOA 3KKQA 2FSIA 4GT1A 4DLRA 3K1JA 1TL7C 3BXZA 1PLLA 1XX6A 3L0IB 3NC1C 3LLMA 3A1UA 5KUTA 1FTNA 1JJVA 4LBVA 3ZS8A 2AKYA 4A0FA 5DYIA 5BQ5A 1O3YA 2ZTSA 5F98A 2IW3A 3UXMA 3FPAA 5GJCA 1VYTA 4PQYA 2UZIR 1DBSA 5EXPA 1II0A 3FMPB 1KKMA 4LJAA 3ZIAD 1U94A 4JLMA 4B3CA 2XITA 3VX4A 2CCJA 4P4SA 4XTRA 4BFUA 4BEJA 5D3MB 2JATA 1KJZA 3SU8A 1TADA 1HA3A 1RE0A 1KDTA 1Z6TA 2JJ1A 3VU9A 2ZI3A 1UPTA 1OIVA 2IXEA 2PJZA 4GOJA 4PC7A 4GMXA 3SFVA 1NY6A 3IHLA 3MFYA 5F3WB 3TSZA 5CM8B 2G83A 5EUMA 2ZJOA 3K0CC 3IIKA 3SJCA 3FFAA 3SJZA 2OE2A 4TLBA 3TGPA 3TUZC 1YZKA 3U4QB 5JSZA 3NHAA 2ZR9A 4EPVA 1F3OA 3KFXA 4TYNA 1W0JA 2O8FA 3I72A 4TYPA 1ZJ6A 2VSOA 2QMEA 4JVNA 4CYMA 1VCIA 3UG7A 1G16A 2C8VA 2QRNA 1A7JA 2B6HA 4MDEA 1JR6A 1JEDA 1XPRA 1E2HA 3PQCA 4NCKA 1VCMA 4YMTA 3AVTA 2QL6A 2V54A 2ATVA 2NO0A 3FYHA 2JLRA 3EC2A 4B3FX 1MOZA 2P5SA 4DCSA 4F92B 3CH4B 2QSYA 2W6ID 2FEOA 1E2JA 1FPMA 5CDFA 4EDHA 4JL5A 2I4IA 3CPHA 4WIAA 3T35A 1JQJC 1Z0FA 4M9SA 1W1WA 1ZM2A 2OAQ1 4L9SA 2EFEB 4PAMA 3GLIE 2BJWA 1FNMA 4CEHB 1GL7A 3PEWA 5J5CA 1B23P 4NCNA 1KTVA 2ZRNA 3B1YA 1SVIA 3BE4A 4FCVA 1T8TA 3U44A 4B43A 2Z6VA 4JLKA 3LV8A 1CP2A 4QHTA 1FX0B 2RHDA 3OEED 2YHSA 1Y3AA 1I2MA 3FOZA 2FFHA 4I4LA 2PEZA 1QBKC 1XD2A 4QGHA 1UADA 3LA6A 2R44A 5ELXA 1W4BA 3D3QA 2D4HA 4BWYA 3K0SA 2KBEA 3WMGA 1E94E 4ACAA 3K70B 1G6OA 1W46A 4V0ME 4QGGA 5JWRA 3NBZC 2XAUA 2WKRA 5KYKA 2ZJBA 4WZ6A 3EWAA 2CE2X 3NVAA 4QC2A 1E3MA 4ILEA 3U3KA 1E9FA 2ZJZA 3KJHA 3QEOA 4B76A 3B9PA 2HCJB 3TJZA 4DIDA 2MSCB 1T5IA 3AP1A 3MRSA 4FMCF 5HCNA 1DO2A 3HU3A 1FMLA 2A5GA 4F91B 4NYIR 3Q5EA 2Z4SA 4TL8A 4CW7A 2YOHA 1KGDA 4Q1FA 1MABA 3B1XA 1T3HA 3RRNA 3LVRE 4XVRA 3SBDA 2NO1A 4DUGA 1XFAA 2HLDD 3RABA 3WP1B 3CZPA 2QZ4A 2EFHB 1XXHA 4LDJA 2LCFA 1X1SA 4XD7D 1JECA 3AKDA 5DI3A 3TBKA 1E0KA 1SKYE 1U81A 4B44A 4R98A 3B82A 4XWKA 2YINC 2CBZA 4NP6A 4AYXA 2GETA 3EPLA 1CBUA 2ZITA 4D4LA 1YZGA 3P1JA 3ZD6A 3QPUA 1H8EA 4X8MA 4GP6A 3RNLA 2LWIA 4MITA 1T9HA 1G8FA 2BWJA 2CJWA 2FSGA 2X1VA 3IQXA 2VP9A 3SC3A 2BBOA 1ETUA 5IDVA 2XNDD 3K53A 3TIFA 2EU8A 1W36D 5AWFC 1E1QD 1P9NA 1HE8B 4MUAA 2IWRA 4D25A 3TR0A 4ASUD 2QPAA 4TQUS 4TQAA 2GJ9A 2I1QA 5JI2E 4L15A 2VP5A 4D4JA 4OK5A 4BGDA 1T3SA 2VF7A 1R8SA 2VP6A 4MDFA 1HE1C 1DPFA 1OLOA 3QKUA 1MO4A 1XMJA 5B30A 1JAIA 5F2EA 1JR3D 4UNRA 3QNUA 5LD2B 4R2IA 1T3LA 4CRWB 3EG5A 1D6JA 3AF2A 2OLJA 4Q4AA 5JWHA 2NMVA 2H92A 1SVWA 3OAAD 4QJ4A 2PT5A 4PSKA 4Q01A 2F43A 3AB3A 5H1YA 2W2XA 5L3RA 4BFYA 5DYGA 4F4CA 4W7SA 2ZAMA 4OQNA 1FUKA 2WJJA 5LBIA 3RHFA 2JLWA 2OCYC 1FOEB 2QAGB 1KI2A 5FI0B 4A2WA 1KMHA 3WYGA 4C0HA 4HB3A 2OZEA 4HB4A 1II8A 2KE5A 2J0SA 4B33A 4LJ4A 1JQLB 2ZRMA 3CX8A 4KODA 2V9PA 2QGNA 4TSFA 1QHHA 4O25A 2G6BA 4HDCA 4FWIB 2MSEB 4NU0A 2ZANA 3A6PC 2PMKA 4B2LA 3BFVA 4M1OA 5KU1A 1E2NA 1LTQA 1VKJA 2P6NA 5C2JB 4NYMQ 2GHIA 2GEVA 2W83A 1QHXA 8OHMA 4YLGA 2ERXA 5LDDC 1GTVA 2GXUA 1KZGB 2UKDA 2VHUA 2VL7A 4KO8A 3R9WA 1XWIA 3V4RA 2BBWA 2BMFA 2QP3A 3F5FA 4MYUA 5CK5A 1RJ9A 5AJZA 5FTJA 1PZNA 1E79A 3KB2A 3S1AB 3TKLA 4QJ5A 4MRVA 3VR6A 3QVVA 2IWHA 2ZYVX 1XTRA 4QBGB 2F3RA 2IYVA 1OKKD 4A6PA 3DZ8A 4BZPA 3TQFA 1AKYA 3FKSA 2H17A 4QNMA 4WVFA 4JT2A 4D80A 2FDCA 4LI0A 5KTYA 2YNMA 3EXAA 2VHJA 3GLHE 4JMPA 2D62A 2O5VA 2KSQA 3BB1A 1RYFA 4CDGA 2DFNA 4A1FA 2FSFA 2J5XA 1J8MF 3Q7QA 2BC9A 2FNAA 4A8JA 2VP2A 4M1TA 1X86B 1E2EA 1MR3F 2OXCA 2R65A 4AC9A 4EJSC 4WW0A 3U3JA 2DY1A 2VQSA 5BYKA 1BMFD 1UM8A 2W2VA 4TMXA 3PEYA 1P2SA 1OHHD 3M1IA 2VIIA 4Q03A 2RH5A 2C9YA 3MJHA 5BYJA 2HV8A 4IFBA 2JIZA 1KO8A 1KYIA 5AUPB 1KAGA 1YRBA 5EXSA 4IOLA 4N3NA 3BGWA 3CW2A 4QNRA 4TMTA 2DWPA 3LH5A 1UKYA 3RANA 2DCUA 1N5LA 3R9XA 4PPQA 3FHTA 3CR7A 4ON9A 1IQPA 4JLBA 2A7QA 1HT1E 3BJIC 1SXJD 4LC1A 4PZYA 3EPJA 4N1AA 3TUIC 1N6HA 4DVGA 2JJ8A 4FIDA 4DB4A 4M22A 3CUEF 1LS1A 4E03A 4C7OA 1U9IC 2AXNA 3QKRB 1TQ6A 2Q0HA 4YMSA 2HYIC 4LK2A 1ZCBA 3N70A 2GF9A 2MSDB 4TQ9A 2NZ8A 4OQFA 1AN0A 3Q85A 1UBEA 3MWJA 4P32A 3FKQA 2O8DA 3GFOA 5H8WA 3TSOA 4ABYA 4EPYA 3ZZ0A 1QHYA 1TUIA 1ZM9A 4DKXA 2VA8A 2IUTA 2HXSA 2EYQA 1D2EA 4Q19A 4DDUA 5HZKA 2V7QA 4B47A 3GJ4A 3NTUA 3QKSA 2PH1A 4FMBB 4NHOA 4C0JA 2XGJA 2WWXA 1XJQA 3Q8XB 4GOKA 3PUYA 4R2HA 2BV3A 3BOSA 5L3SA 3A1TA 4YXWD 1NVXQ 4GI7A 3K0FB 2ODNA 3CBQA 2RGNC 3CRQA 1UEIA 1W4CA 2QMHA 3EASA 5FUXA 3SYKA 5BN4A 3C5CA 2CXXA 3IUYA 2R9VA 4N0DA 1GNQA 2WWWA 2JLXA 2QG6A 4LBYA 2OHFA 1GRQA 5HKKD 1JB1A 1L4UA 2QE7D 3RRMA 2VLIA 5KDDA 2BMJA 2FGJA 1ZM3A 2GKSA 4ZPXA 1KI6B 2GXSA 2JLYA 1WCV1 3GPLA 1TPZA 4NCJA 3WMFA 1Z83A 3VNUA 3RYTC 4OHVA 1C9KA 1MT0A 3GFTA 2OFXA 3LQQA 1FFHA 5FTLA 4UXJA 1NBME 3SNHA 5FBQB 2ZI6A 2B7BA 2ZE5A 1ZCAA 5F9FA 1ZNWA 1U0HC 2BBTA 3EZFA 1DTSA 1F5NA 2ANBA 3HYTA 1U0JA 4L8GA 2FA9A 3P26A 3A1VA 3RC3A 1UEJA 5G3YA 1YZTA 4QRHA 4V0LA 1R2QA 1OV4A 5TB5A 1ELOA 4MGYR 4D0LB 3PUVA 4FW9A 5J4KA 4U02A 4MRSA 3C8UA 1A2KC 3KXKA 5C18A 4S2EA 1QHIA 1YZQA 4QOSA 1G5RA 1RKBA 4DDWA 4M9ZA 2OBNA 1JJ7A 1P9RA 4E5UA 2NO6A 4P33A 3UMRA 1HURA 3ICQB 1WXQA 1GSIA 3NDPA 4PQFA 1AJEA 3IBGA 4IEEA 1G3MA 4IKEA 5EZ5A 2WIBA 2WWFA 4JBXA 3IIJA 1W44A 2FFBA 1IN8A 3AVPA 2C99A 1TQ2A 4UKDA 3DVLA 4IJMA 2OESA 4G0NA 4EFLA 1HV8A 3AVOA 4XSHA 3AF0A 3QJYA 4FINA 3RSLA 5FL7A 1R7RA 1Z6XA 4PXAA 3SHFA 4DSTA 3A4NA 2A30A 2NOAA 2BOVA 2QU8A 5HPYB 3QI2A 3EIHA 4DSNA 1W48A 4ITRC 4PX9A 1G19A 1GM5A 3W8RA 4Q7LA 2XZOA 2JLUA 3BIFA 4EAQA 2H1LA 2CDNA 4NYMR 1T4GA 2V4ZA 1PVOA 1OXXK 1AGRA 1W49A 3SEAA 1BKDR 3CRW1 1XPUA 5TXGA 5JBQA 1OPXA 2P0EA 2GJSA 1OSNA 2A5YB 4CT4B 3D7MA 2IX3A 1DARA 5B58C 1U8ZA 3OESA 3W90A 4CIDA 1VG9B 1OB5A 1VYVA 1P6XA 5EE1A 4OI4A 4Q1BA 1KI9A 4KU4A 2FX3A 4RZ2A 3P32A 3K09A 5EP2A 3U4QA 2VP4A 3ND9A 1FL9A 4MKIA 5FR1A 1E2IA 2NTYC 5AR1A 3CM0A 1VPLA 3V9PA 2GILA 1RZ3A 1QF9A 3WP0A 2GZAA 2A5FA 1F2TB 3Q9LA 2JDID 1MV5A 3TMKA 1Z0IA 3GLFE 2HCBA 1A2BA 4Q4LA 2QY9A 3U7GA 4H1VA 1Z47A 4RFVA 4WA7A 2JJ1D 1E9CA 2G9NA 4CEIB 1DG3A 1XMVA 4P4UA 2J7PA 3H84A 4IDQA 1DAFA 2DBYA 3O8BA 1ZAKA 1UBFA 2Z4RA 3BB3A 1W0KA 3I4LA 3TW4A 4A0GA 1KO4A 2HF9A 2IHYA 2N46A 3TE6A 2WSMA 4C9BA 1KK1A 5EP1A 1OIWA 4LV6A 2C04A 5DH9A 1G7CA 1ZIOA 3EWSA 2B8TA 4IEIA 3IBYA 4KXFB 2F6RA 2IF2A 4TT3A 1BO6A 1W0JD 3DMDA 1Q20A 2I3BA 2V6IA 2R62A 3ZS9A 2QGZA 2NZJA 3FWYA 1FX0A 4X8LA 3OIVA 3X1DA 3ZZTA 3C7KA 3FTQA 2RGNA 4RCYA 1NVVQ 3CIOA 2GCNA 1Q22A 2ASEA 2GWHA 3RC8A 1T0HB 2CVFA 1CXZA 4RJLA 3LBHA 2XZPA 5GADl 4RZ3A 3NWJA 4NCIA 2QPOA 4RD4A 3GLGB 4NYIQ 1LNZA 2OBLA 3THYA 4IOKA 1E6CA 1NJFA 1OXUA 2WPDA 4UQOA 2BCJQ 4LHXA 2IXFA 2AK3A 4KFSA 4DLVA 2DHRA 3GLFB 4O2RA 3T34A 2QRZA 4ZCIA 1XMSA 1VTKA 2F1IA 2VSFA 3X2SA 4PSAA 1FMJA 5DN6A 4FCWA 5DI9A 4OQXA 4G01B 4DJTA 2FU5C 5HZHA 3B2EA 4HZIA 3SE0A 2F3TA 2XOKA 3EC1A 1CF4A 2YC4C 2ZEJA 2V1XA 1XEXA 4PHTA 3I62A 5BW8A 4XOIA 1W36B 3SFZA 3GLIA 2V1UA 4AKIA 3HU1A 4OBEA 1NLZA 2FV8A 3I92A 3UMSA 4OKSA 1R10A 5HR5A 3LVQE 4UJ3A 2IYTA 5CYPA 1ZYUA 1EFHA 2FWRA 4ZI3A 3AM1A 3OIWA 1P2TA 2GCPA 1TU4A 3A4MA 5BN3A 2C9OA 2XX3A 5KNBA 3KXIA 1EK0A 3BB4A 3AVVA 3U3OA 5FFMA 5F9HA 1RPZA 5J4HA 1XCMA 2CL6X 2KB0A 3B78A 1T8UA 3QOFA 4OQMA 3MWYW 1N5KA 3HR7A 4GNKA 2JJ2A 2BVNA 4V0MA 2K5UA 1VMAA 3DOFA 4A2PA 2DFKB 4DB2A 5JS8A 6Q21A 5E4FA 4LCBA 3FHCB 3VHLB 1KK0A 2PCJA 2GNOA 2QUZA 4MGIR 1KI4A 2ZSEA 3U7HB 1T0JB 4IVQA 3UANA 1IONA 2G3YA 4DUGD 4Q9HA 3HP1A 4LYHA 2FZLA 4TTQA 3ZVRA 3FMIA 5AUOB 1HQCA 1OFHA 2ECKA 3DMNA 4FMDB 2GBLA 3G5UA 5JCPA 4ZDJA 1P7CA 1NVWQ 3M0EA 2GXQA 3IO3A 4LGMA 2Q21A 1Z63A 1Q0UA 1WA5A 1CIPA 1LB1B 3W5JA 1JALA 3KUCA 121PA 3AH8A 3CNOA 3D6TB 4F4IA 2P6RA 2PCLA 2GJ8A 3EA0A 2LKDA 2XB2A 3HPQA 2KJQA 1H8ED 1IBRA 2J45A 3I32A 2ORVA 2HT1A 4R71A 5FPSA 4KCGA 3PENA 2J87A 4LHZA 2BDTA 1OH8A 1CJUC 1SXJE 4Q9KA 2C78A 1PLKA 1Y63A 2BM0A 3U7FB 2GCOB 2ZRPA 3MSXA 3WBKA 1JXOA 2RAPA 2ZSAA 3GFPA 3PUZA 3QF4B 1AM4D 3AVQA 4C3ZA 1N5JA 4PAOA 1Q3HA 3LLUA 1TEVA 2QA5A 4AG6A 2J7KA 4C0KA 1T5LA 2VBCA 4Q02A 1P73A 3VR2A 1H8HA 3OFNA 4LJ7A 2ZJAA 4KLZA 4BFWA 4E22A 4HUQB 4BE7B 1GKUB 2X2FA 4A6XA 3KQLA 3L0OA 2CNWA 4A36A 1CEEA 4JKYA 621PA 2AD1A 5DNYB 4Z1MA 5TVKA 1M7HA 3BWDD 4ZDIA 1ESNA 4DCVA 2OG2A 2P2LA 4LYFA 1COWD 1DOAA 4Q1EA 1D9ZA 5IT5A 3RWOA 4A0HA 1QHNA 3PFIA 4M8NE 4UNNA 2EVWX 3A1WA 1G17A 1RYHA 3QEJA 4FXPA 2ZI5A 2R6DA 3B8HA 1KI3A 2HF8A 1V43A 4FCTA 1N25A 3BAFA 1E9EA 3UIEA 3VKGA 1W7AA 1YR6A 2ZQ5A 2QPTA 5GVSA 1KNXA 3FVQA 1S9DA 1YZLA 3U61B 3U6BA 1U98A 3KTAB 1SXJB 4TSFD 2FH5B 1BS1A 3EZ2A 4HDQB 2RMKA 2RGGA 3B9QA 3CX6A 4HATA 2PZGA 1X3SA 1KO1A 1P2VA 3IDQA 1AKEA 2QM8A 5KO2A 1ZC4A 1HY3A 2XTMA 1D8TA 3L8YA 5ANRB 2AN9A 2VHQA 5C4MA 1E79D 4DHEA 1R5BA 2G88A 3GJXC 3PXGA 4LWZA 5DHAA 2Q6TA 4LHWA 4DDTA 1E2DA 1U8AA 2I1VB 2F9LA 2YJTD 3AP3A 5KSOA 2QBYA 1WE2A 2G1KA 3FKSD 3PEUA 1JPJA 1Z29A 2OAP1 4HAUA 1XTIA 1KK3A 1GKYA 1U99A 5FH9A 3QXXA 2J9RA 1N6KA 3WBJA 1VHTA 4LYAA 5EP4A 3IKJA 4WXPA 4A8JC 4PC1A 1G8PA 4RD0A 2V3CC 1I4TD 2XJ4A 3CF0A 3M6AA 4YC7A 3UG6A 2BKEA 1US8B 4HLUA 1OJLA 1ZMXA 5DE3A 1NVVR 2A5JA 2QP4A 4KSBA 4DC9A 4OL0A 3GLHA 2YYZA 1Z0DA 2OCBA 3NBYC 5CJ2A 4WZAE 4GBMA 4M9XA 2JIZD 2ORWA 721PA 1C4OA 1SVKA 3AVYA 2FE4A 1EFRA 4Z8XA 3QPWA 1PUIA 3AP2A 5SZHB 1GNPA 3UMFA 3GEEA 3D8BA 2W2TA 3ZGXA 1EESA 2EWVA 2O8BB 3C4JA 4NH0A 4YMWA 5AK0A 1JEEA 3PV0A 3OIUA 3V00A 2ONJA 3K9NA 1W4RA 1M7GA 5SZKB 4A2QA 4XWOA 3ETLA 4F93B 2WOOA 3I5YA 2QI9C 3K0FA 2REXB 1CR0A 3NH6A 4LYJA 1E1RA 1L4YA 4JLPA 1E96A 4Q4JA 3KKMA 3DM9B 2F1JA 2PT7A 4EFMA 3PG5A 2IYLD 1XP8A 2FN4A 3RS5A 3NH9A 2O8EB 2ZRGA 1G3RA 2E9SA 5EXTA 3ZH9B 2CK3A 2CLCX 3SR0A 1KI6A 3VR3A 1KJWA 2XSZA 4OI2A 3ICEA 4EPTA 1KSFX 1XCGB 3OZXA 4US0R 2WJIA 1TF5A 1XTQA 3W34A 4I1OA 2OM2A 5KDOA 4HSEA 4A82A 1DAKA 3QKTA 1XD9A 2V7QD 3ZVLA 2EWWA 1KI1A 1ZRHA 5FOSA 3U60B 2J0UB 1CJVC 3FMFA 3KQUA 1G7TA 2ZRBA 4POAA 3GMTA 2OFOA 4KITB 5KDLA 5AJXA 5K8IA 1OW3B 3WRXC 2JLQA 4NL4H 1E2GA 4CGZA 3AKYA 1Q12A 3T15A 1SULA 2WSSD 1WRBA 4D2IA 2IS6A 2YOFA 2ZETA 4EQ6B 2X77A 3QBTA 1N6PA 5BWMA 5TARA 4YMUA 1G9XA 3THWB 2RHMA 4KVGA 1IN7A 4DEXA 3A36A 1S1CA 2XNSA 4GSYA 2W6JD 1IN6A 3PIRA 1WDTA 3DO6A 4EUNA 3K0AB 3N2IA 3PR1A 1XCPA 4MKFA 1E2FA 3LRPA 1CKEA 3WHKA 4EIWA 1R0YA 4NDZA 2J59A 1Z2CA 4NPHA 1NBMA 4FI3C 3E1SA 2O52A 4URYR 4NMMA 2GAAA 1E9SA 2H18A 1E0AA 3TQCA 1UAAA 3KXLA 5FBLB 5FBWB 3LX5A 3ADDA 4B2PA 2VF8A 4LPSA 5GJBA 3L2OB 1YR8A 2QP9X 1Q3TA 4YQFA 3SBEA 3U3RA 1EFUA 4LBZA 4NYJR 4BLOA 2O0HA 4MUBA 5CYOA 4B74A 4Q7JB 2TMKA 3R8FA 3R7WB 4QGAA 2CLDX 5DGXA 1MO6A 1DAEA 1N5IA 4DLXA 3HU2A 1GDDA 1JPNA 2EW1A 2P3SA 3UWOA 4IW3B 4BLRA 3EPKA 1XEWY 1RVDA 1L7VC 3P4YA 4DRZA 3N2EA 1NY5A 2ZI9A 4URUR 5E7MA 4OJQA 1JXMA 3CX7A 1YZNA 2G0TA 4G5GA 3MCAA 5KSZA 4TZ6A 3IHWA 2ZE8A 3HDTA 2OFWA 2H5EA 3X1WA 3G82C 5FL7D 5JSZB 3AUXA 1E9AA 1IXRC 2UVQA 5G41A 3VR5A 2H7VA 4Q18A 1KY3A 4QKQA 2B8WA 2IHBA 3UWKA 5L3QA 3QXHA 2JCSA 2NO7A 1YHNA 4B3XA 1Q1QA 4PQRA 1XJ0A 1KY2A 4ARZA 4I1UA 2AFIE 2ZSBA 1BIFA 1DVRA 2Q9BA 4CEIA 3VKWA 4LJ5A 3T1TA 2PLFA 2ZRKA 4W9MC 4RZXA 3THXA 1EWQA 1DG1G 1NKSA 3T12A 2FEMA 3UATA 1JI0A 5JEDA 2QT0A 1OB2A 1IJEA 4QGFA 5K8TA 3K09C 4B3BA 5HE8A 4DLTA 2QM7A 3AKEA 1PUJA 1ZUIA 2XXAB 2P5TB 4QFMA 4Z8YA 3GJ8A 4TLAA 3CNLA 2IF0A 1KO5A 2WAXA 1NLFA 1G8GA 3U44B 1L2TA 1RIFA 5FOUA 5EE0A 4II7A 1OT3A 1XPOA 3RRYA 1TMKA 1E2QA 2FFQA 1NIPA 3ZLJA 3B5JA 3B1VA 5D3QA 2A9KA 2DWQA 1RRCA 2HLDA 3T61A 2CCGA 3FB4A 4RCZA 4NBSA 4LY6A 4QHYA 1S3GA 4Q5IA 3ZJYA 2J7PD 1UDWA 3IEUA 3KJIA 3AVXA 4DT1B 5E95A 1S8FA 3CKLA 2HEIA 1MH1A 4JLNA 4MYTA 3AEZA 1ZUHA 3GLFA 5B64A 2NG1A 1N0UA 1OH5A 2WHXA 5AJYA 2E1RA 1RFLA 2R6GA 2PZEA 2QMUA 4KLNA 4HAXA 4NONA 2B21A 2JA1A 2PMDA 2BIFA 4ZO4A 1Q1EA 2XNDA 4C0SA 1PJRA 2IYQA 3KX2A 4B32A 2GEUA 1ZUNB 2J3EA 2O0KA 3CZQA 3QQ5A 1AQYA 4L4UA 4A9AA 3CH5A 4XTCS 4ASUA 5FPYA 3K70C 1E99A 1QVAA 4LJYA 2AXPA 2QORA 4GZLA 2YKGA 4M1MA 1PV4A 3BC1A 1ESMA 1ZD8A 2BBSA 2F1HA 3QG1A 1TTTA 1XXHB 3T5GA 2XTNA 4MRPA 1ZINA 5G3ZA 1QHSA 3H2YA 4UJ5A 1QRAA 1SZPA 2GESA 4IDNA 1J8YF 4M1WA 1GAJA 2OUKA 1Q1ZA 4IOJA 4EPXA 1G64A 1NP6A 4HAZA 1KIMA 3T1OA 2R6CA 4KFTA 1F2UB 4Q9LA 4Q7KA 5LB4A 4PANA 1P3JA 3PVSA 1FW6A 3LAWA 1P9WA 1X8LA 2CHVA 4OI1A 3CF2A 3RDPA 2IK8A 4HAVA 3IPYA 2CJWB 2N1BA 3PCRB 5DIFA 1QVRA 4ZV4A 1N3BA 1RW4A 3GJ5A 1KAOA 4EPRA 1NKTA 4LBWA 3RRZA 3TLXA 2ZJ8A 1NVUQ 4G3XA 1D2MA 2IYUA 5TY0A 3EA5A 1SVOA 4AKGA 3KKOA 4KAXA 1XD8A 1ZNXA 2F55A 521PA 2GJKA 4PHGA 1SVLA 1E0JA 4URZR 3VHXA 2REOA 1X8KA 2IC5A 2AFHE 3B6EA 4M4SA 4Q66C 3H1TA 5JRZA 4TMVA 3A37A 4Q9IA 4TWZA 4W5JA 5JRJA 3SJAA 2VH5R 3IIMA 4Q4AB 3SZRA 3MLEA 2JJ2D 1NMXA 3I8XA 4L5BA 4NCHA 3MUFA 1XTJA 3W6OA 2F43B 4W5HA 1Z07A 3CF6R 2IXGA 3ADKA 2ZSDA 3GEHA 5KPDA 2ZRDA 3NG1A 1HTWA 2WJVA 3RS3A 4G1UC 2ZRCA 4DCUA 4GP7A 2DWOA 2QMOA 3VQTA 3DM5A 4U5XA 1AZTA 4AK9A 2GBLC 5D3MA 3B7GA 3NXSA 3IO5A 3CLVA 2OBMA 5LD2C 4IHQA 2P67A 1QHHB 2SHKA 2ERYA 4Y0VA 3DDCA 1P62B 4Q47A 1NMYA 4QL3A 4JSTA 2VO1A 4FMCB 2HUPA 2HJGA 4DCNA 2RGAA 4AKEA 2QTVB 1GILA 2F7SA 2XTZA 3PITA 3IPXA 5P21A 1KO7A 1F6BA 3MJRA 5K8LA 3AGQA 5FOTA 1ZU5A 1BMFA 1D2NA 4JBYA 4A15A 3OEHA 4B48A 4JZKA 2XZLA 1K6MA 2QAGC 1CLUA 3RAPR 3JVUA 3F0TA 4UNPA 1G3IA 1ONBA 3CNNA 2AX4A 1UKZA 3RS4A 1VYUA 4TYWA 1IN5A 1GP2A 3GLGE 4L9WA 3NEJA 3I73A 2AHOA 3K8YA 4LJ8A 4Q1AA 3PJRA 1KDRA 3QPVA 3SJBA 4H1UA 1FP7A 2IEYA 2N42A 2IS2A 1YKSA 5FOWA 2PLRA 2XJ9A 1NIJA 4OYHA 1WBDA 1Z6AA 4XVQA 4LJ6A 5AJWA 421PA 2DPXA 1SXJA 2A3RA 2IEZA 2V8OA 3NDBB 2WBLC 3WY9A 1H8HD 4KYUA 2PX3A 3W6NA 2YC2C 2C96A 1KI8A 4B2IA 4A8JB 1ZD9A 4NZYA 4AY2A 2CNWD 3R20A 4JYCA 3M4YA 1YQTA 4B34A 2WWYA 4Z1MD 1XB2A 1SGWA 3I5XA 1XJCA 3KL4A 1E2LA 4BLSA 4CEHA 3C16C 1DADA 1VCNA 3KKPA 1TEXA 3I61A 1NN1A 3EIQA 1TNDA 4KHZA 5IF9A 4RZUA 1B0UA 4BFSA 1FTSA 4BRUA 2CVHA 2X8AA 3U3MA 2X2EA 3G0HA 1IXSB 1E4VA 5KSPA 1LV7A 2ATXA 4TMKA 1JR3E 2WTUA 4ZIRB 1LVGA 2W58A 2ZS8A 4JS0A 3W5IA 4B6EA 4MRRA 4HZUB 1S0UA 1ZNZA 3AUYA 4P4TA 1YE8A 1M8PA 4HLDA 4MQBA 2KWIA 5DO9A 3ZZUA 4DZZA 2ZXUA 3LXXA 1P75A 2P65A 4JT4A 2W00A 4YXWA 1KK2A 1W2HA 2WMNB 2ZVQX 4HDOB 5JMTA 4MGKR 1E2MA 3ZQ6A 4N0EA 4FD2A 3U7EB 1I4LD 5H68A 4PPNA 3Q5DA 4PZLA 4DLZA 1W4AA 2G0NA 3QUSA 4PO8A 3KJEA 2ZYWX 2O8DB 5JJKA 2QEQA 4R7ZA 1G7RA 1LS6A 1Z0KA 4UNQA 5BN5A 4GDFA 4QM6A 5IHPA 1OH6A 1D9XA 1FNNA 2C5LA 2JASA 3DOEA 3IILA 1YZUA 5CITA 2O8BA 2A2ZA 1M34E 2G1JA 4G5QA 2GZHA 3H4MA 5DSZA 3VNVA 1E98A 2YWFA 3B1WA 1G41A 1D5CA 3HR8A 3I3SR 4UXIA 3ZYCA 4PR0A 1S1MA 2OXRA 1XRJA
chains in the Genus database with same CATH superfamily
4N18A 2IUSA 2O4CA 4IV0A 2JH9A 5BORA 3KVOA 3RUAA 1SU7A 3M81A 4WOBA 2YWCA 3D3KA 3X1ZA 5IK2A 3S5UA 1HRKA 1Z3CA 4O3MA 4Q3CA 3D2BA 5BN4B 1I7QB 1XBTA 3D3WB 1CR4A 3GFSA 3LXMA 3O47A 3VZRA 2JCVA 2E2WA 2O8EA 2QRHA 1QHEA 1N9GB 1X38A 5FOXA 2RJNA 1YGPA 3O8RA 1TC1A 4L4XA 3AF6A 2IUUA 2WJHA 2P4QA 1RI3A 4J0QA 5AHOA 4MH0R 1BEEA 1KH2A 5FBVB 5KNLA 3GD5A 4G5OA 4WN9A 3T4PA 1NW7A 1LSJA 3LT2A 2ZTVA 3BJZA 3DHYA 2ZPAA 3STWA 3ZD9A 1BWQA 3WJAA 1KJNA 1SBIA 2BR3A 2NT4A 1UBCA 1M1YE 3OTQA 3K2BA 3BBPA 1O1YA 5LBTA 4WZAA 3IVRA 3MXOA 4UUOA 2QZPA 4KXYA 3CEHA 4JVOA 1T29A 4HNUA 3BXFA 3O4JA 2JLSA 2IKQA 2ISCA 4J0HA 3VAAA 4Z5XA 4HMQA 4K46A 4Q4HB 4YQYA 1C29B 3UHFA 4AB1A 1ADGA 4H7JA 5REQB 1S4QA 5B2EA 1QDEA 2YHUA 2P27A 3BD8A 1DWPA 2ZBEA 4O4JA 1WABA 2WYHA 3L7BA 4BVJA 1V5WA 3JASB 4NJEA 4HYYA 4LAFA 2IV7A 3G02A 3THOA 4IRUB 2O6LA 3A4YA 4QIHA 3COVA 4KXUA 2AD5A 3QPAA 4E5NA 2DAPA 1G291 3KVNA 1KAEA 2VJYA 4U3JB 3Q7EA 1M2OB 1P81A 1O03A 4UMDA 1RYDA 3UUEA 2NSJA 3THWA 2ONYA 3KZOA 5F76A 1PKEA 2VDUE 2AI3A 1OFTA 3QMMA 4O4HF 1VI5A 3DZDA 1DKPA 3FPBA 3OOYA 1VI6A 4UTXA 1MGOA 1XLUA 3GF4A 2O3TA 1I7SB 4L5IA 3R9XA 3K0AA 1TW3A 3VR6H 5FPHA 3WO1A 1CUDA 4TTSA 1V8OA 2V6GA 4HLCA 3T0IA 3L4BC 1T35A 2KQUA 3W5BA 3NS7A 3V5NA 4KK3A 2P35A 2QD5A 1JWAB 3ZNQA 2Q2WA 2V5UA 1J99A 2XQIA 4PYRA 4WBNB 1RAFA 2ZJ2A 3TQTA 2YFKA 4QREA 1K8RA 4BJHB 2OA0A 4D4KA 1V37A 5ETJA 2R0QC 2WU4A 4NDNE 1UJ4A 4CL0A 5CT8A 3GZTB 4ZVQA 1RACA 4JB8A 3MJEA 1PO7A 1OYOA 1FLNA 4KO3S 4DC1A 5JAOA 1PWHA 2UZ1A 1VL0A 4GVXA 2JDIA 4C6HA 4QQ8A 4EHLA 3DW3X 1N5MA 3S1AA 2X7JA 1H5NA 4Z0HO 2H8GA 3VM6A 5A3RA 1DDIA 4QPNA 2BFCA 4ZO8A 2GXAA 1M1ZA 2D1RA 4IH9A 4GH5A 4JKIA 1D2AA 2DETA 1FYVA 1NJ5A 1Q77A 3KFVA 3N9IA 4LKRA 4HVTA 4B09A 1XSEA 4X60A 2W7TA 4FBLA 4MZDA 4PY2A 1XP5A 3E0QA 4WQMA 1S89A 2DGDA 1S2OA 4JUAA 3H8SA 2A0XA 4S2UA 2B8EA 2BEVB 4BJ6A 5DX8A 4D81A 3W04A 3TNLA 1MO5A 3NHMA 4MUGA 2CZGA 4HYTA 1EXDA 1I5EA 2Y0BA 2FEPA 1M2FA 4G5HA 4HAIA 3EQ9A 5HUHA 1RHUA 1NBMD 1DWQA 1U2DA 1MFPA 1E6MA 1NOKA 4NG4A 3WAKA 4QOEA 1F2DA 1K8QA 1K06A 3GOHA 3H19A 3TR5A 3TZQA 4D9MA 3O4HA 4UBIA 1QYXA 3SAJA 2GOYA 4IO0A 4BX2A 3Q0EA 3T06B 1U3DA 1T1EA 1THZA 2VWQA 4NF2A 4LF5B 5B4VA 1SHKA 5JIBA 2ZT7A 1JIXA 1NSFA 3G2QA 4MVJA 2VHTA 3G13A 1O6ZA 2IS1A 3AF5A 5DV9A 5E7IA 3W5HA 4FK8A 2E4YA 2Q8NA 4DDVA 1OWOA 3T5CA 4DLWA 3FXAA 4E07A 2W0SA 4Y2VA 4D8TA 3ZWCA 1CYDA 3I9MA 4IFIA 3UUWA 2WYUA 5DWVA 5C52B 2GK7A 4AS1A 1H3EA 4JI1B 2OLKA 5TPZD 1EFAA 1EU1A 3D0KA 3LG2A 2Q2VA 4OKNA 1DRVA 4I4TB 4QM7A 2XEXA 4GBJA 4A2CA 4G6ZA 1YMQA 1JDZA 4HT3B 3QXJA 3C0KA 4MV5A 1BHSA 3GEIA 2FEWB 3GQBB 3ZV4A 3QE2A 1OWLA 4LYYA 3ETNA 1L4NA 1D4AA 3CUTA 4A23A 4ZDWA 4V0KA 4AO6A 2HC9A 4GDMA 4LVOA 4KFRA 3U16A 1M6EX 1UOPA 3JAKB 5E6RB 4WPGA 2K4MA 4A03A 1JSRA 4PWYA 4ZT3A 4XB2A 1CHDA 5AM3A 4RHFA 2IY7A 1JRLA 1CU1A 2OBBA 3GVXA 5CK4A 1SWVA 2Z0MA 5EMLA 4NX2A 3D3JA 4OX9B 5MN6A 2QZZA 3JTEA 1JNYA 3AIMA 3MAAC 1JIVA 4ICIA 2QAJA 2I67A 1Z68A 2OOKA 3FNFA 1HNWB 1J7KA 1OTHA 2C3MA 2YHAA 1DAMA 3A0UA 3QENA 1EAYA 4Y9SA 1ONSA 5HG0A 4BGIA 2CNBA 2GVZC 5E4JA 1BXZA 2JLVA 1P6QA 2LNDA 5J59A 1UAYA 1XNJA 3EGIA 5E3HA 5CLQA 1JKXA 1XHFA 2JAHA 1RP7A 3H5VA 4RVCA 3IUPA 2GEFA 4PAQA 5EY5B 4EABA 2EJVA 2DP4E 1WUKS 3G8AA 3WISA 5IJ9A 1OXKB 1AK9A 2WICA 1GQFA 3AX6A 3OTWA 3H04A 4DLNA 5BRAA 3JQAD 2QW0X 2H4FA 2AJLI 3B1FA 3H5IA 2PVCA 3W05A 3SEZA 4R8MA 3GLIB 4X1IB 4CMGA 5IC5A 4N5IX 1E59A 3AG5A 3F6EX 3L6RA 1B8NA 3R44A 4OBXA 4TS9A 3G5TA 2P4UA 4IS3A 2FHSA 4US1R 4YDSA 4A4DA 1NUPA 3A3PA 5I8PA 4RFSB 3RLFA 4JQSA 2HY7A 2ZIEA 4LV8B 5HVNA 1Z62A 3O8DA 1PI3A 3L7KA 2EQBA 4ACBA 1UDAA 4YRCA 1AKUA 4H6WA 4YPVA 1HPLA 1I4EB 1K9SA 3GH1A 2RK3A 1VPVA 4FE7A 1TGVA 1QYVA 1V1MA 1ZP6A 4FS8A 5IANA 2EYUA 1L7PA 4OYLA 1KEEA 1NI4B 1T26A 1R0ZA 2I99A 4K8OA 5JTTA 2AIRA 3I05A 4PZ9A 5IC4A 3KKLA 3FR8A 1NASA 3OLWA 2WMOB 4LZZA 4BN0A 3EMDA 4RY2A 2FW0A 3UJBA 5E8RA 2BGLA 4HLQB 2BFEA 1HE5A 2I54A 1P2GA 4Q3OA 3TRIA 3O26A 5CCEA 3KVYA 1CR2A 2JK1A 1L4KA 2R84A 3BS4A 3EDMA 3QWIA 4GPEA 1P5ZB 4D9IA 3VUFA 3SY8A 4U2FA 1SVSA 4YJFA 3KKKA 3U5ZB 2QVZX 2I1WA 4Y7CA 2J1LA 2WP8J 2ACKA 2Q5JA 1I94B 4X61A 4Q3DA 4EPWA 2AWOA 3I4FA 1O95C 2EZUA 3AW8A 4BLPA 1Y3IA 3DL0A 1NG9A 4HGRA 4IKOA 4JDUA 4FDTA 4DFDA 2HWWA 2EFCB 1RYMA 1N6LA 1Q21A 2C57A 1ZITA 3IGFA 1N6OA 4Z0TA 3I5XA 1ZO8A 4F5EA 3Q4GA 3RTGA 5K8UA 3PI6A 3AIIA 5A3JA 3CRNA 1M1XB 3RFFA 3W6UA 5LMNB 1VLHA 1FB5A 2AOTA 3R0JA 1QFJA 5JBIA 1E4EA 2IYAA 4GMDA 2JFVA 4ZDKA 3TCXB 3FTCA 3UQZA 3AEXA 4IVPA 1M33A 4QXQA 4YJ3F 5SYMA 1WF3A 3BD9A 3PRYA 4BNZA 1R6DA 4W9NA 1DRUA 3K0CA 5EJFA 1IEXA 1LRJA 1LTKA 1LW7A 2G63A 4RE6A 1A8IA 1AQJA 3MUNA 4XYGA 1O96B 4Q1DA 1ZJWA 3WIVA 2ZYDA 1V4NA 2O5EA 3HA3A 1I8TA 4I9UA 4BQIA 5JSHA 1KJQA 2BGRA 2ZYAA 1CT9A 3V3KA 2AXQA 4J7UA 1DAGA 2I6QA 1QOZA 5TMDA 3W9SA 1T6YA 1BVHA 5K20A 2ZSUA 3DV0A 3U13A 3FYDA 1U1EA 4BO2A 4QT4A 1JHUA 2YOGA 1HEIA 2W6IA 4RK0A 2DBZA 2VN8A 3OM0A 2ZB8A 2CCKA 2IYPA 2ZAOA 3MIIA 2JI7A 4NR0A 5KTOA 5JEEA 2J9YB 3NRBA 4C30A 3NASA 2YJ6A 1WUIS 3WGIA 1BX0A 3WWOA 1SQ5A 4JCCA 1GFWA 5F78A 2HLPA 3CCCA 1N2CE 1T1RA 3ZWOA 5CVCA 3OQHA 3WWZA 3DKVA 3PA8A 4HVLA 1UJMA 4TV8F 2AFHA 2BFPA 3NHRA 4V0SA 1ZY2A 1VL5A 3HP4A 3CWZA 4Q1CA 4ZVUA 5J4VA 5IPFA 4WXEA 2O8FB 1ABFA 4JGGA 4WL0A 3A9TA 4H31A 3A4IA 1M67A 3VSCA 1K5DA 2EQ5A 3FPHA 1I6LA 4P7JA 1KOLA 1RPJA 3KQMA 1G3QA 1GUZA 2WTMA 1W35A 1K75A 2UVDA 3JZFA 2G8LA 3BWBA 3LW7A 3V4VB 4YO7A 5LQDA 2D7DA 3F1KA 4DIKA 5ALFA 3DS8A 4IIJA 3R40A 1WD5A 1ZN9A 4JI6B 1U0NA 2WB2A 2BEWA 3FZGA 3I9OA 3LDGA 4OJMX 4YAJA 2MYUA 2OWEA 3CVUA 1SFRA 1XU4A 1OC2A 3QF7A 4HJRA 4J6EA 5AUQA 1XZBA 5FFFA 5I9TA 4A6EA 4YX9A 1W96A 3V1YA 1SKQA 3WV4A 1N3IA 5IDXA 1M5UA 3LL4A 4AO7A 1PGJA 4JLWA 1UFQA 3WSTA 5HDQA 5AHKA 1KPHA 1T4DA 1LLCA 2MWMA 3DDWA 4KDCA 1RADA 3AF1A 1EJBA 1TO2E 3IMKA 4U7GA 4AYTA 5AFSA 3VA7A 2HMUA 3DNFA 1KKLA 4I8DA 4MV9A 2JAQA 1VMIA 1NJ1A 4XEUA 1I0LA 4KBGA 3IXLA 2BZSA 4MIEA 4XGIA 1AKNA 3LC0A 1XXHE 1Y6FA 2VK4A 4KQ9A 4GPTA 4RIHA 4AZ0A 3TAHA 1ZM4A 3LO8A 1HLGA 3MUEA 4PR3A 3CRVA 1Z2PX 1XD2B 5HSGA 1L1RA 3TXYA 3URKA 1HL3A 3KPJA 5JDCA 2WVJA 1UMBA 3L7OA 3QV2A 5F73A 2A5DA 1WHSA 1SNYA 3BORA 3VOBA 3GLGA 3U0BA 2WJYA 2ZCVA 4YACA 1V8BA 2QJWA 1W0KD 4K03A 1RHQA 1Y4ZA 2YVUA 2GDJA 1NN3A 4TTPA 3TLEA 2YL2A 1N6IA 5H81A 1N1EA 4BO0A 4DQVA 4BX0A 2NV0A 2NN3C 3GLHB 4KN9S 2ZR8A 2XWPA 1DDGA 1UF9A 4D41A 3QSYA 4W5NA 4OQPA 5DK4A 1Y1TA 3J80A 4IS2A 4KIGA 5IAAA 1TM1E 1Z5GA 3PHHA 3QBVA 4PV7A 4FPXA 4YJGB 4DJFC 3MRXA 5LLSA 5KX5B 3INYA 4XUGB 1L7EA 1XTTA 4AWXA 2QRLA 4AW9A 2FPKA 4JIMA 3FOWA 1GZ5A 3CSUA 3RUFA 4LG1A 1H1LA 2Q9CA 3ROKA 5AM5A 4X24A 3GZNA 3LKVA 4XIGS 1FRVA 3BH6A 3CONA 1I4WA 1YRHA 3U1BA 4ENWA 4GOXA 1CZRA 4XJSA 1YU9A 4CT0A 4LRUA 1F6WA 3BSYA 4R2LA 3HBJA 4HTAA 1TUBA 2A9OA 1XTZA 1DG9A 1K3TA 1KYYA 3EIWA 1ISSA 3ZWPA 1UPCA 5IH7A 3BSSA 1FW8A 5DM0A 3T7EA 3Q2OA 3C3XA 4QDJA 2XB9A 3UWPA 3WL5A 5KAPA 4UPDA 5CTJA 2P6UA 3BFPA 4IIXA 5JQWA 1O9GA 1AS2A 1F48A 1Q0QA 2I3AA 4G5RA 4NMHA 3JR7A 4G0WA 3I6BA 4IXNA 1E9BA 3N5CA 4IQGA 5TGTA 1NUQA 4YBRA 2DM6A 4X92A 3JWIA 1ZA2A 5EWMA 4HH1A 3R7LA 1B7GO 1NC3A 1VI2A 1TZJA 3RNOA 3QLEA 4W6ZA 4F1WA 1MOPA 5D5PA 5FOQA 1UKEA 4LZOA 5A02A 4ZVSA 2HA6A 3A8TA 4Y2YA 1TFUA 1TO1E 2QIOA 5JCJA 4GXTA 3UAVA 1GPUA 3ETGA 3P27A 4FFVA 5ALUA 3LPMA 1YQDA 5KNBD 2CL0X 3L3BA 4Q21A 1ZVKA 4DE5A 1N6NA 2HHJA 2P78A 2WUGA 1XDBA 3OFSA 2FK8A 3KXDA 4YRDA 1PJSA 2DBRA 4ND2A 2ZAIA 1FU7A 3BRWD 5KVAA 1HLDA 3T1QA 3AVWA 2C82A 1G6Q1 2V03A 4Z9BA 3U19A 4S0XA 1I4DD 4HRYA 2GVNA 1U2SA 4GGMX 4O2BB 1PGQA 3LNCA 1ABEA 2F64A 3QVTA 4RMHA 4U0JA 1VB3A 5AK5A 1Q44A 4QPCA 3N8GA 4NDAA 4XX0A 5A05A 2F1RA 3CNQS 3NHUA 4ZKEA 1XLTA 4MVJI 1A5TA 2FR1A 2RCNA 2XWBF 3BCUA 3HWWA 3IDOA 2DLNA 3SSAA 3W8NA 5BXQC 4YRRA 3PC6A 5I4IA 2O7QA 5D85A 1NLYA 4BASA 4TWIA 2C42A 4N01A 2O2DA 3HR4A 4P4NA 4A92A 1OKKA 3E3AA 2XKKA 4I19A 4PO9A 2HWUA 3ESAA 3F78A 3SYNA 1II8B 2Q4DA 5IM4A 1NVFA 1HT2E 1X80B 2O8CA 5M2QA 4OLBA 1ZIYA 3DEFA 3DHWC 5K3AA 5JD6A 5FRDA 4I4CA 1GG2A 3MTGA 3L0SA 2K7FA 1XYGA 4JL8A 2I4LA 4TMWA 4C0LA 1U28C 3FCOA 4OU5A 3WFZA 3OBIA 5DHPA 3BYZA 4DANA 1JMVA 4O29A 1YK1A 3QU4A 2X23A 3PIDA 4W5WA 1MO2A 4EHIA 1F60A 1NE2A 1X6VA 1OLSA 2RI6A 2X58A 2ZUWA 2DQSA 3AHCA 3MD0A 3MQ4A 2ZRFA 1JDJA 3MWLA 5G40A 1IN4A 1NQAO 5JO9A 3U1TA 5K5EA 2VYFA 2ORIA 1X70A 1VPEA 2IYYA 3Q72A 4ZO6A 3FYCA 3L82B 1KZ6A 1VGQA 4N40A 3U2QA 5AXDA 4F7DA 1JHRA 2AEMA 3QQPA 1O94C 3QFHA 4B40A 2I2XB 3ZE9A 4B6FA 2CWDA 4H60A 2AG8A 4OQQA 5FNVB 2C97A 3ZQJA 5ECDA 1EE1A 2ZB3A 3FNRA 4O1IA 5KOYA 3JD4A 1BHQ1 1O94D 2IXBA 4XASA 4C01A 2FR0A 4Z7QB 1WULS 1EFTA 3A7DA 1LFAA 3KTAA 4KX3A 5JFGA 2ZZNA 5IUKC 1STOA 4EYSA 2DKNA 1F7UA 1FMTA 5IKMA 1C7RA 1E6KA 1F9EA 1UDXA 3ICWA 2F90A 2PL9A 1G21E 1ZK3A 4PX2A 4E12A 3QA3E 4YR7A 3RPEA 5HIKA 5AM2A 2UVPB 2WVAA 3H9JA 5AKXA 3IP1A 8ADHA 1YH3A 3DCIA 1AB5A 3HYNA 3PDIA 2ET6A 3NGLA 4ENSA 2BL4A 1E9VA 5T3UA 3CPJB 4WNAB 3LBIA 1ZNYA 1XZGA 3O3MB 4PC2A 3GEGA 3ASVA 3AQ4A 2V58A 2C84A 2OCLA 2VZEA 2EATA 3HPRA 3P9SA 1KMNA 4P82A 4JC0A 1LV8A 2D3WA 1VJRA 5LCXA 1A1SA 3AHFA 4EY3A 5A4IS 2IZ5A 3GO4A 1D5WA 2C2OA 1TQDA 3SPXA 1RPNA 1XXLA 2NQ8A 3ZLVA 6LDHA 2DTDA 4RC9A 3HI4A 3TK1A 4RTLA 4I1VA 3N58A 3FJOA 1T6NA 3LFUA 4F9TA 5KWJA 1M2KA 2DCMA 4A27A 3GEPA 4WFIA 4R1TA 4P83A 2YXDA 4BNVA 3SJUA 3O90A 4E2WA 2HKIA 1AKVA 1XT6A 2EZ4A 1J8VA 1HQYE 4W8GA 1NVEA 2CE7A 2XCUA 3NQ41 4EJFA 4IF4A 1US8A 2ZBRA 3GRFA 1P3Y1 2EEPA 4M1YA 3NHBA 4RD2A 5G0UA 4CU5A 2QQGA 1RWMA 3K92A 2BFMA 1UJ5A 2EG5A 3EPRA 3K9GA 3KKNA 1GUDA 2JK0A 4G0XA 5A4JA 2C7OA 4TL6A 4TOIA 5DHTA 1X1CA 2VNHA 1CD5A 3E4DA 3KE9A 3EGWA 4Q93A 2X19A 1QLWA 4MW6A 3V4FA 4ERNA 5TPWA 1G21B 3ZDQA 5H70A 2WM3A 1NU8A 4ZEVA 1R9NA 2AZTA 1RBMA 3UFXA 4YUXA 1OXSC 1Z08A 3CC8A 1HMYA 3PS9A 4PG4A 3EK2A 3IUEA 3NC0C 1OXVA 4G4SP 1NFRA 1UZUA 1MC5A 3I76A 4RJJA 5I48A 3HHPA 2E5LB 2BYTA 3QKSB 1FQKA 1LEHA 3UJNA 2EZTA 1PNTA 1F38A 1G1MA 2HIMA 3QG5A 3LS2A 3NC4A 5AKJA 3PYXA 1BC5A 1K8ZB 1NULA 2RH8A 2RHWA 3BGDA 3BMXA 4QDUA 2BEUA 1C1XB 3EVCA 3F6YA 3U0VA 4AZTA 1EXMA 1UBRS 4LKOA 5LN1A 3LF1A 4X66B 1R0XA 1QYIA 3VC2A 4ENTA 2RD2A 4QYSA 4MRMA 2I9PA 5EIHA 1ZSVA 4PCAA 2PS3A 5KOJA 4E4TA 1ZD2P 3DLBA 3O2NA 4EB6A 2ZGVA 4DCCA 1KMCA 5L3ZA 5BMVA 4ZAVA 1HDOA 1L5LA 1C3XA 3QZUA 1Y5IA 5TMEA 3DOJA 4WUVA 1KZ7B 3OMLA 4CKXA 1EFRD 1FVHA 3TF5A 3FRHA 5KSWB 3BGOS 1PFGA 1YVDA 2WQZA 2X9NA 5JMWA 3U4MA 2JCYA 2A33A 3QE3A 4KBFA 5J40A 1C3VA 2H65A 3DAHA 1Z5ZA 3PDUA 2PZJA 3L7JA 4P6VF 2ILTA 2A84A 4P3YA 2HZBA 2H4XA 2V96A 4IV8A 3NBXX 1WETA 2HK8A 3FJ1A 1JU3A 4TLLB 3H2KA 5AJUA 4PAGA 4E6PA 3LWZA 3QX8A 4YCMA 3RSOA 4WBSA 3ZQKA 1JIQA 3P9CA 1TUGA 2ADFA 3BXEA 2FK7A 1KVUA 1SN7A 3F4LA 3ME5A 3BWVA 4OUKX 3UVEA 5IEBA 4M98A 5B3JC 5KTNA 4JYZA 4M7PA 3LY5A 3DEHA 1TJYA 4O33A 1QRSA 2OHGA 5J43A 1NOJA 5EI5A 2PY6A 3V1MA 3HO8A 3WYAA 5FADA 1V9CA 3M3HA 1V16B 4V0QA 2PZFA 1Y8RB 4GKJB 1PQWA 2VSXA 4J75A 3SLKA 4D9CA 1WNFA 3ANYB 5DRYA 1FJXA 2BI4A 3PF9A 2HRRA 3PNOA 5BNZA 5HRCA 3CT4A 2FGKA 2PYDA 5D7NA 1HSZA 1KEKA 4HWPA 4GZ6A 1CUCA 5B1EA 1AE1A 1TTHA 3MS2A 5IU6A 1ZD3A 2PAAA 2GEDA 2Q5QA 1T9AA 3CCFA 3DVSX 1YJ5A 2X4IA 4JQYA 4JXJA 4L27A 3WGOA 1WMSA 2HXYA 4JDPA 4O4LA 3IA2A 1DBWA 2W48A 3KOOA 3PQ3A 1B41A 1COZA 3HNPA 1KMMA 3BSFA 1RXYA 5AKIA 4Z0PA 3LLMA 3M89A 5C1PA 1TZCA 1QQTA 2EBHX 5A9RA 3ELBA 5DYIA 2XBUA 5MFZA 2NLOA 3I9LA 4HL6A 4GQIA 5A1TA 3GU3A 1Y8QB 1YQQA 4XDHA 2ZVJA 3UXMA 3LHIA 2PX5A 2Z09A 4HO1X 4UAGA 5GJCA 5B1DA 4B9AA 2X40A 4PNEA 1FY2A 4MQMA 4TWJA 5EHQA 4IIHA 1YS4A 4PQYA 5KOHA 3DGEC 3A32A 4GL4A 2UYCA 1II0A 3QIVA 3ML1A 3DE1X 3S1SA 4LXHA 1PJ2A 3BWCA 3ZIAD 2Z9DA 2QB5A 4JLMA 1MAWA 4F71A 1SUFA 4PYOA 4RK7A 3VX4A 5AVKA 1XMOB 4P4SA 4XTRA 4Y2QA 3WICA 4BFUA 1W75A 3E84A 3JALB 4DGSA 1EJ6A 3UKOA 1TADA 2CVQA 2EV9A 2JVJA 1DRWA 1RE0A 2FW1A 2ZBDA 3GVHA 2PKEA 5I8ZA 1HM5A 1MAAA 3JD0A 1BFUA 1CB0A 1UPTA 4UM9D 2OTCA 3WBFA 1DKLA 2PJZA 4YH1A 4GOJA 1DZIA 2P9YA 3SQLA 1X7HA 3W1WA 5L45A 2R87A 1T1SA 3C1TA 2F62A 2G83A 3WLTA 1PX0A 1DQPA 3DL2A 2ZJOA 3HVIA 3IIKA 3FFAA 3QMPA 1K7XB 3WLEA 1BGVA 3GWGA 4PLPA 4ZAFA 3SQOA 1ZXLA 2ZWPA 4RGQA 7YASA 1Y9AA 4UFOA 4B7CA 2OY0A 5CFNA 1CUSA 3ANSA 3FMVA 3MGKA 3MRVA 4NE9A 3FRIA 3QELB 3U4QB 3FNEA 3KFXA 1E61A 3V48A 3TVYA 3OCJA 3LK7A 1GCOA 1TMYA 3G8DA 3I72A 4TYPA 4WKBA 4Z4IA 1VSVA 4BQPA 4FB4A 2BGGA 4CYMA 1SUBA 1SIBE 1VCIA 4MDEA 2B6HA 7REQA 4DV2B 2C4UA 4KO1S 1XPRA 3LC7O 4NS1A 1R15A 2QL6A 4EY6A 5D00A 2JGDB 2ATVA 1WDKA 2RC6A 3FYHA 3PQ8A 4B3FX 1MOZA 4RHEA 5E9JA 3ZV5A 1Y0BA 3RVKA 2POQX 4Y1RB 3WQRA 1E2JA 1EP1B 2FEOA 4B7XA 4BLUA 4L6CA 4JL5A 3CPHA 3ELUA 2FZVA 4L8LA 2WU8A 2Y71A 1Z0FA 4UU1A 2VYQA 4W1PA 3RYFA 2C2GA 1T36B 4KXMA 1LJUA 1JLLB 2BJWA 1G6KA 1JG4A 4OBBA 4YWHA 2FPWA 4QDXA 3GV0A 3KWJA 3UT5A 4CEHB 2R25B 4QVKA 4DWVA 1M8FA 3MMZA 1B73A 1YT5A 4KWIA 4UBLA 4RF5A 3NBMA 1GY8A 4JLKA 5KNCD 3WAGA 4PNHA 1CP2A 1RQRA 5IT9A 2J5RA 1WPQA 2G7ZA 3PHGA 4FDAA 3RARA 3SVZA 3U7QB 1I2MA 4RM3A 2FFHA 4I4LA 3USES 2NUAB 2XOXA 4NPAA 4G65A 5ELXA 2C8LA 2QL5A 1KC1A 2D4HA 1JHDA 2HU5A 5A5EA 3COSA 2KBEA 3WMGA 3I9V1 3T94A 4N0MA 3ZDBA 1K3UB 5CA0A 5IDYA 3PX3A 3TN7A 1X7XA 5JWRA 4I66A 3SLGA 1H6DA 3NGMA 2XAUA 3ZGLA 4Z7JA 4LE0A 1ODTC 5A3SA 2WV7A 5T6BA 5MDHA 4TVOA 4S3MA 2SKDA 2RI1A 3EWAA 3NVAA 3II6X 1E3MA 1J0EA 4ILEA 5ADUS 4P5PA 4DIDA 5DYWA 5BQFA 2XMGA 3TJZA 3K5IA 2QRMA 1T5IA 2A5GA 4X6YA 1T8PA 3QLUC 2Z4SA 2Q46A 3HA2A 3L0ZA 4RK5A 4CW7A 4F2GA 1G20A 3DV2A 1J20A 3EUWA 3DUFB 4G86A 3CG4A 4X3PA 4HDNA 1SCDA 3OZIA 2WD9A 2YS6A 2NUPB 2XRYA 4GPIB 3WLIA 4N39A 2X0KA 2NO1A 1GV1A 2QS9A 2SKCA 1V6SA 3RABA 1I01A 1VLMA 3T1HB 1KAHA 2EFHB 1MEEA 2D5AA 4D46A 4BTVA 1F6DA 4XD7D 1OXMA 5H5JA 2I2BA 2J85A 1DEHA 1R9MA 1YRLA 2XDAA 3UAOA 1C3OA 2IJGX 4EGFA 4B44A 4F6LA 2WE8A 1EFLA 3ST7A 5ICEA 1R0BA 3ENKA 1Q7GA 1CY7A 3BIOA 4FHCA 4KQ1A 2CBZA 4X94A 2IV3A 3M6MD 1SD2A 4EB3A 3ED1A 4AX8A 1DFHA 1E89A 1W8DA 3R76A 5BO5A 1K89A 2FPSA 4GP6A 1WXFA 3H6GA 5DNVA 1T9HA 3I6MA 4FKBA 2FSGA 1MX3A 2YZKA 3SC3A 2VP9A 3BN3A 2BBOA 5IABA 3E48A 1FJGB 3A2MA 3DT6A 2EU8A 4WN9B 1NDHA 1VKHA 3G3EA 5AWFC 4X3OA 1E1QD 4TS3A 1P9NA 2BGJA 1HE8B 4MUAA 3I2IA 4U2KA 3TR0A 1Q7EA 1ZD4A 3KQQA 3KAKA 3ONEA 4G24A 4ALJA 4QICA 4D3ZA 2CUZA 1YQWA 5KKAA 4I0WB 3K1TA 3WHIA 3HXMA 4KACA 3LE8A 4GIBA 1BA2A 2VDKB 2X41A 3EG9B 1R8SA 1GNSA 2VP6A 3MZ0A 4EH1A 1HE1C 1QO0A 3RUHA 1XAJA 3TRKA 3WSWA 1XMJA 5B30A 4NH4A 5F2EA 4FDUA 1JR3D 1RI5A 3CQ9A 4U7FA 4S1NA 3EG5A 3RBVA 2BKAA 2YIMA 3QMWA 1LC0A 2ACEA 1D6JA 4LCEA 2H1WA 4Q4AA 5G2OA 5JWHA 3LBFA 3RVOA 1SVWA 4QJ4A 4NZPA 1CVIA 2F43A 5L3RA 4D74A 4BKMA 4I50A 3NYIA 1E3EA 4RW0A 4UPEA 2WMDA 3PNBA 4ZI7F 1WW3A 2ORYA 3F7MA 4OQNA 3RTEA 2OCYC 3QVKA 3HM9A 1PZHA 4C78A 3PQ2A 4Z4CA 4XB6B 1QKKA 4P5DA 1RBZA 1E5VA 2OZEA 4MS3B 5AXAA 3FETA 3SX0A 3JQ9C 4LJ4A 4OAQA 3M34A 4FOTA 1V2GA 4ZYYA 3Q40A 2V9PA 4INAA 3PPYA 5H80A 4NU0A 4IWXA 1NGSA 2PMKA 1XR3A 5DEOA 3VU1A 3OA0A 2CMDA 4JNKA 1I7DA 1JIJA 1E2NA 3JAWA 2P6NA 3KLMX 3AR3A 3O1IC 2GHIA 2VKQA 4QE3A 4WADA 5CT6A 3WDLA 4ZOQI 1SKAA 3VO8A 1CFZA 2BE9A 4RLSA 3A1CA 5DGIA 2GXUA 3WKAA 2C20A 1TD9A 2V8BA 4PTZA 4PLCA 4BX3A 3GARA 4MYUA 4W82A 2UZ1B 2UYYA 3A6ZA 2OB2A 3KAJA 4RLHA 2A88A 2XDWA 3KFLA 5CK5A 5FTJA 3MWDB 3O91A 4JB2A 3S1AB 4B6QA 4GW3A 5CPFA 3TXXA 4QJ5A 5DP1A 5CIYA 1OGJA 1Y9DA 2ZYVX 2KLHA 4AUEA 3TECE 3LQFA 4QBGB 2F3RA 3LUPA 1E77A 2GNPA 2IYVA 3EIFA 1U7XA 2QX4A 1JLKA 1LKZA 4BZPA 3TQFA 1M5RA 2LCIA 2BR4A 2H17A 2P8SA 4JT2A 2XMRA 4D80A 1LSSA 2B37A 3Q6MA 4KRXA 2OVFA 2X15A 2HIGA 4O8CA 4H7DA 4WCFA 4YI5A 4JP3A 1Y6QA 2WM8A 3EXAA 5BR4A 3ETJA 4JMPA 2ZWOA 5H02A 4P98A 2QVBA 3FTPA 3HACA 2DFNA 2XE7A 5DX1A 1L6RA 2W37A 3GGDA 2J5XA 1J8MF 3Q7QA 2BC9A 1GSAA 1E2EA 1MR3F 4LS3A 3LQYA 4WW0A 2P9JA 3U3JA 3QEMA 4HYEA 4W8HA 3A70A 2VQSA 4RGBA 2A7XA 1BMFD 1UM8A 3S8EA 2ZTHA 1M8KA 4J7AA 2V7WA 1LPMA 2VIIA 2O8VA 2RH5A 2C9YA 1ZOOA 3AZOA 3DZCA 1F3LA 3ED5A 3GRUA 3PX2A 1KDYA 3ZJ5A 3WK5A 3CZCA 4HF7A 1H2EA 4MWEA 1A88A 2IDJA 2HJRA 1EB8A 5AUPB 1BTOA 4C87A 2WYIA 3BGSA 3C2QA 4Q16A 4Q1VA 1X13A 3OPVA 3H0EA 3M82A 5EXSA 1H1TA 1MIHA 1GXSA 3AONB 3CW2A 1DQRA 3GDOA 3GJSA 3C5VA 4UDOA 4XM0A 5FJIA 5ERGB 1JHYA 4JJGA 1P1CA 1K5PA 1N5LA 2M1XA 4K9PA 1P1RA 1J5XA 2PSJA 2BRUA 3MK31 5E9WA 3S70A 5ALXA 1EQUA 3M33A 2A7QA 1HT1E 3UXEA 4RANA 4N1AA 3KLBA 3CVOA 4I4NA 3F6RA 4EITA 3N2GA 4P34A 4X9XA 4RX1A 1U9IC 1YQXA 2AXNA 1WV0A 3WQBA 4K6CA 5EOVA 2NTVA 3AM5A 1TQ6A 3IAS1 3BCSA 4CM4A 1NVKA 1SXPA 4P0PB 2Z2JA 2R8BA 1U2GC 4MUEA 2WABA 2MSDB 4JJAA 4ESOA 2EHDA 3O8OB 4OQFA 1Y7PA 3C45A 2ON6A 3Q85A 4OEHA 1NBWB 3C3KA 2NQTA 1OQAA 2OGZA 2YY5A 3A2KA 3K2EA 4K9KA 4QPPA 4ABYA 2I4OA 1ZM9A 1HYEA 4IINA 4DKXA 5COQA 1PR1A 2IUTA 2HXSA 1Z6ZA 5KYWB 2EYQA 3TD9A 1S7GA 2OGUA 2OKGA 2V7QA 3GJ4A 4B47A 2HFJA 2PH1A 4NHOA 4DDUA 5KINB 1VBKA 2H06A 4ENUA 1IN1A 1P2BA 4QQNA 5DK6A 1TCCA 3Q8XB 4LWPA 4NOMA 5LQSA 2O3JA 4KYVA 1XRQA 5DBHX 3BOSA 5HRAA 4MA0A 4YXWD 3DBHA 4N47A 5HFAA 2HIHA 1I5OA 1GCAA 5ALZA 5BQOA 3OSZA 1PDVA 2RGNC 1JILA 3CRQA 4YP1A 3I04A 2YY6A 3C5CA 2CXXA 3FCCA 3NIDB 3D7KA 1ZSNA 4H08A 5BSKA 2BHLA 2E82A 2XA1A 1Z4OA 4IDCA 4TXHA 3WRXA 1K4YA 1Q2UA 3A3OA 3AFMA 2QE7D 3L0YA 1B16A 2VLIA 4MAAA 5KDDA 4MK4A 2BMJA 1LCIA 1RJEA 2FGJA 1A9YA 2GKSA 3LYHA 2JLYA 1KI6B 5AVOA 3MVEA 1ESCA 3F73A 3VNUA 1CERA 3RYTC 1C9KA 1Z26A 1D07A 3TG2A 4ZO9A 2PQ2A 1PYOA 2NT3A 2YIDA 3FBWA 4EEKA 4I55F 5FBQB 2C9BA 2B7BA 4ARUA 1ZCAA 3N0RA 4PHCA 3T5AA 1S2GA 4YJ2A 3PE3A 4Q82A 5EPUA 2ANBA 3TOCA 2C1XA 5JAPA 3DXFA 4CKEA 3HYTA 3C3BA 2QMYA 4LNHA 1U0JA 1Z7BA 3P26A 4PYKA 5AI9A 3A1VA 5K0NA 3LUJA 3O31A 4MQFA 3RC3A 5HUQA 5JRDS 2Q5LA 2GAJA 1YZTA 4X97A 4CJXA 1I3KA 1R2QA 2PAFA 1RS0A 5HZMA 1ELOA 1MOQA 1SOAA 4R0NA 2IU6A 3PUVA 4OYYA 4L07A 4CTJA 4D0LB 4CM7A 3C7CB 4I3FA 5IKEA 1KARA 4EAAA 4U02A 4MRSA 3C8UA 3GJRA 1J1UA 1L5FA 5T5QA 3KXKA 4NFLA 4Y9RA 1OX6A 1YFKA 3IHTA 4RUKA 1GT91 4XDGA 2PPVA 4KPYA 4QOSA 1G5RA 4FB5A 3PDWA 3KETA 1P9RA 2XVZA 2NO6A 4RPLA 1SJ9A 3IP8A 2VS1A 3ISTA 3EQ8A 1EK2A 1KPGA 3L8CA 2UUOA 2QRJA 1ECBA 3NDPA 4LDRA 4R0VA 1AJEA 1G3MA 3CUWA 4IKEA 4MVXA 2UU9B 2WIBA 2AOTB 1Y1SA 3AZPA 4FSXA 3R5HA 4LY3A 1E4EB 2FFBA 4GKVA 2CXOA 1IN8A 2AHRA 1QORA 3AVPA 3IE2A 3INTA 4UKDA 2A67A 1CY0A 2NYRA 2OESA 5F2NA 2AR9A