5CIWA

Ran gdp y39a mutant monoclinic crystal form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Transcription
source organism Homo sapiens
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
total genus 69
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ciwA00
2VRWA 2GK7A 3U4QA 3O47A 4O2RA 1C9KA 1O87A 4BFVA 2I1VB 4DIEA 1S9DA 3AQ4A 3PJRA 1NVVQ 3K9HA 3UXMA 2XSZA 4D0LB 3N2IA 2OXCA 1E2LA 3R7WB 2YWHA 4HAZA 4OHVA 3L0SA 4DSUA 2DBYA 2RKOA 5AJYA 2ANCA 3C5HA 2EFCB 5KNCA 5KTYA 3F3YA 2J9RA 3QF4B 2JASA 3ZVMA 2ZVQX 2ZQ5A 4CT4B 2WPDA 3SQXA 2ZETA 3AKEA 4PHGA 3AVYA 3U6BA 2VP2A 1KDPA 1T0JB 4M4SA 4QL3A 4MDEA 2PT5A 4NP6A 2ZR0A 2G77B 2OAQ1 1M7GA 3DMNA 3DPUA 4JL8A 4AC9A 3M1IA 4LC1A 2CHGA 3DMDA 5HTKA 3UANA 2QPAA 1COWD 4WBSA 3RNLA 1BIFA 1J8MF 4MUBA 4TL8A 2O8FB 1IJFA 1OIVA 2F3TA 4QBHA 3QXCA 2QZ4A 2RGGA 5JHHB 3CW2A 4TZ0A 3ZH9B 4ZDKA 1XFAA 4LGMA 2EFDB 1AN0A 1JR3E 1VTKA 4XD7A 5IK2A 2HXYA 1N0WA 1KO4A 621PA 1G3IA 5H8WA 2JDIA 1P3JA 2Z4RA 1S1CA 2GRJA 2XB4A 2XTMA 5CDFA 2AWNA 5AWFC 3NXSA 4M21A 1E0JA 4P31A 2RGXA 3Q3JB 3A6PC 4DKXA 3A1VA 1X1SA 3TLXA 1X8LA 1W2GA 4F91B 3FOZA 3QVVA 5EZ6B 2WJGA 2AR7A 3HR8A 4Q9LA 3FE2A 3IHWA 4XTCS 1S3GA 1P61B 3DL0A 5TDHA 3L0PA 1HYQA 3N70A 5BYJA 4F92B 1FFHA 3RC8A 4R7ZA 1RYFA 2CNWD 3P4XA 3AVVA 1N6OA 2DFNA 4Q4LA 3KX2A 4XOIA 1NRJB 1IY0A 3T15A 3BRWD 2REBA 5HCNA 2W2VA 3ZVLA 1XTRA 5J4KA 4TQAA 4U5XA 5J4LA 4HLUC 3REFA 4QBGB 1S0UA 1XCMA 4DCNA 2RGNA 4M1WA 5IRCD 2QP9X 3C14C 4EPXA 4OYHA 3N2EA 4FMCB 2ODBA 1CJUC 4PC7A 1OHHD 421PA 4AY2A 1Q1EA 2UZ3A 2WJJA 4BFUA 3M0EA 4IW3B 1W7AA 4TT3D 1DOAA 4QGGA 4L15A 3W5IA 3E1SA 4N1AA 4JYCA 4D25A 4P32A 3KJEA 1VCOA 1MOZA 4NCNA 4LOAA 1H8HA 2QT1A 3GEIA 2GEVA 3LAWA 4MRVA 4Z1MA 4JVNA 2YHSA 1R8QA 1DAKA 1G5TA 2CL0X 3KB2A 4G3XA 3UIEA 3RYTC 4CW7A 1R0XA 3JZMA 4B48A 4B3FX 1TNDA 4TMZA 4XWAA 2GCOA 3QPWA 1CF4A 4UNSA 5CB6A 4UKDA 4Q7MB 1X1RA 1QVAA 2PL3A 3KFXA 1CBUA 1TU3A 3GLGB 5LD2B 4YQFA 1ZW6A 4URUR 3NC1C 1G4UR 2ZJZA 2GF9A 4LJ8A 4QXAA 2UZIR 4Q4HB 4MH0R 4HUTA 3U61B 4DLVA 4TMKA 2WOOA 4C0JA 2ZREA 3I8SA 2L0XA 5GVRA 3QKRB 2WVJA 3C41J 1W1WA 3BB1A 4D4MA 1YJ5A 5DHFA 2RMKA 4OK6A 1LW7A 4EPVA 2A5DA 3LFUA 2XZPA 1FMJA 4JT4A 3FFBA 2RGCA 3ICEA 1UBEA 3KJGA 2V4ZA 1CP2A 4RD6A 4ZI2A 1OXXK 1CIPA 1E1QD 2FPLA 3QF4A 2AK2A 5JRJA 2QL6A 4LY6A 2N1BA 4ZKEA 3C8UA 3EA5A 3SC3A 1Z08A 2OILA 2YZ2A 2FH5B 2D2EA 1JEDA 5FUYA 1CJKC 3KQLA 3W9YA 2V1UA 2PCJA 1W2HA 2VSXA 4ZI3A 2NPIA 3PCRB 3P27A 5DYGA 3V4RA 2PMDA 1W4RA 2IYXA 4W5WA 1NVUQ 2EU8A 4M9QA 1OSNA 3HR7A 4TSFA 2JA1A 1EFTA 2OLJA 4XJXA 1GRNA 1OIWA 3T1TA 1D9ZA 4LCBA 2VTKA 4UNPA 2FSGA 5DNYB 3ZD7A 1IXSB 1XBTA 1YVDA 2WSMA 1FQJA 4JJKA 5FOUA 4CVNA 2ZRIA 1CJVC 2J7PD 2RHMA 1M74A 2GWHA 3B8HA 4GP6A 5A5GA 1AK2A 1SVSA 2GZAA 2ZJ8A 1U81A 1Q3HA 2GEUA 4LC0A 2I4IA 1IN6A 3TE6A 3LLMA 1WE2A 3M6AA 1T9HA 4E22A 5DIFA 3O8CA 1CEEA 4ARZB 3KXLA 4DJTA 5K8LA 1WMSA 5CYPA 2H57A 2YWEA 1MO3A 2XX3A 1XD9A 2IYLD 4KFRA 2FFHA 2JEOA 1ZBDA 3FHTA 2JGNA 2P6RA 3FMOB 4KHZA 1G6OA 3GLHA 5TVKA 5E7JA 4NYMR 3OIVA 3OAAD 4RD3A 1SVWA 4A0RA 3RHFA 1RYHA 2CEAA 3D31A 3WP0A 3CB4A 1ZAKA 3RRZA 1KKLA 1YHNA 4BASA 1WDTA 1XXHB 4JLPA 1FP7A 4JBXA 2QE7A 3CRQA 3A1SA 2QNRA 1DO2A 1U0JA 3DZDA 1S1MA 1XB2A 1WP9A 5TY0A 1DO0A 3SJAA 4UJ3A 4Q4AB 2VHTA 3BB3A 1LV7A 4WW0A 4M53A 2Z6VA 1Z6GA 4YMSA 4C30A 3GCGA 221PA 1P2TA 4KYIB 1UKZA 5FPSA 3K0CA 4EFLA 1AIPA 4EQ6B 3I8XA 1AKEA 2G1KA 4TTPA 2DR3A 3RABA 3CKLA 3DM9B 5TV2A 1UFQA 3K0CC 4OQMA 1Q3TA 2E1RA 3WP1B 3EXAA 1XJ0A 2CDNA 2QEQA 5K8TA 2H1LA 2ECKA 3KZ1E 2FGJA 2UKDA 3IBYA 5DI9A 4PAQA 1XD8A 5JEDA 1G64A 4DDTA 5A0FA 4KLZA 3LW7A 2ZANA 4TYWA 4IDQA 3KQUA 5JWRA 5GJCA 3C7KA 2Q3HA 4A2QA 1KIMA 2HYDA 3NG1A 2ZS8A 3I1FA 1ZNZA 1VG9B 1V5WA 1ZM9A 1NBMA 2JJ2D 4RZUA 3EPJA 2IL1A 1YZLA 1TU4A 2W2TA 3FMFA 5E3HA 2Y8EA 2VL7A 1E2DA 4I1VA 4PZYA 2OCPA 3VR2A 3A1UA 4JBYA 4RD4A 3SOPA 4BFSA 2W0SA 4A92A 4NYJR 4US2R 2HCJB 3K70C 2IHYA 3GJ7A 2CHVA 1S4QA 3KB1A 1N3BA 1QZXA 2ZI7A 4AG6A 3P32A 4ESVA 4C7OA 4QHYA 4EFNA 3AV0B 2WSSD 1SXJD 1N6LA 3W5JA 2R65A 1TF5A 1KO7A 4JSYA 3AF1A 3KKMA 1KSFX 1AJEA 2DYKA 1DAMA 1AS0A 5G3YA 1D5CA 1XNJA 1ZD1A 4LK2A 1KGDA 5ANRB 2G3YA 2Z0MA 1AZTA 4JKIA 1LTQA 3KUDA 3TRFA 1P9WA 1Q12A 2NO1A 1JAIA 4JJZA 1E0SA 3RS3A 4MA4A 2MSEB 4FMDF 4ZO4A 4ZIRB 5IF9A 4KBGA 4Q1CA 4V0OA 3IUYA 1E94E 1LVGA 2O5VA 3QG5A 2A7QA 2WICA 3WBKA 1G5RA 1JQLB 1RC8A 3AP1A 1H65A 4NZYA 4LWZA 5EXXA 2G6BA 4DDVA 4ACBA 3GFPA 1Z0FA 3LQRA 2HT6A 3H84A 1II8B 3FKSD 1CTQA 4C7OB 2GF0A 1NVWQ 3CR7A 1JPJA 3GJ6A 1W46A 3LY5A 3A4LA 5K8IA 3WYFA 1E9FA 4YLGA 1ZRHA 2FNAA 1L8QA 4B6EA 4Y0AA 2V55B 1FMLA 3FB4A 4BLTA 4B35A 2IEZA 3AB3A 4AYTA 1AS3A 4HB4A 3ADKA 4JLMA 5FOVA 5J5CA 4Q5IA 3NHAA 3SS8A 5L3QB 4GSYA 3ZLJA 5CIQA 2QSYA 3KTAB 1LB1B 4PAOA 4KCGA 2VA8A 4IRUB 3AVWA 4MRNA 2AX4A 1KY3A 1NP6A 5CLLA 1QG2A 2VP6A 5BYKA 2W6ID 1BS1A 2Q9BA 1E9DA 1JQJC 3SBDA 3UG7A 1EFCA 1YZQA 2FV8A 1KTVA 4IXNA 4M9SA 4MITA 4B33A 5LDDC 1IXRC 2WMNB 3EPHA 1GTVA 2O8EB 3B82A 1TQ2A 2HYIC 3K9GA 1OXVA 2GHIA 2QSZA 4YC7A 1GSIA 3WYGA 1II0A 4QRHA 1DAFA 2N46A 4LJ7A 2CK3D 4Q1EA 3LV8A 3W6NA 3ASYA 2JLRA 1ZUNB 1J2JA 4CEIB 5F98A 1OH6A 1P75A 4ERNA 1SVMA 4JLAA 4URYR 3MRSA 5M04A 4AG5A 2ZRMA 4BLSA 3QVUA 1QBKC 1GFIA 2Q21A 3DDCA 1VDZA 1CJTC 3LX8A 1OXSC 4IEIA 3ASZA 1GP2A 1G41A 2DFTA 2X2FA 1S2MA 1M34E 1E9SA 3PEYA 5E95A 2V3CC 2HJVA 3ZVNA 1XTIA 1FUKA 3PEUA 3WHLA 2CLCX 2J0UA 5D3QA 1CR2A 5FOSA 1L4YA 4I81A 5IHPA 3LLUA 4PC2A 5L3QA 1W5SA 2GKSA 2VH5R 3E2IA 2XZLA 1N5KA 4FW9A 3LRPA 1S8FA 1VYTA 5E7MA 2OBLA 3VHXA 2IF0A 1K8RA 2BEKA 4BE7B 4DXAA 1T8UA 1KI7A 5FOWA 5AUOB 4DC9A 3T5DA 1TEVA 3BD9A 4Q4JB 1XMVA 1Z47A 2KBFA 4NU0A 2FJUA 5EE1A 5EP4A 3RS7A 3VR4A 4V0MA 1P2UA 1G1MA 2IS4A 4GRAA 1EFHA 3EX7C 4E03A 2OEPA 2XZOA 5G40A 4QNMA 4ZDJA 1Z63A 3KKNA 5DLQC 1R5OA 3RSLA 2D4HA 1XEXB 2ZYUX 1RW4A 3MFYA 3MJHA 3R8FA 1Z07A 2ZRAA 1AQUA 1KO1A 3U3KA 2P5TB 3A1TA 4YDHB 2OESA 2G0NA 4V0ME 1LF5A 3VFDA 1UAAA 1JR3D 4AKGA 1UADA 2DY1A 1HT2E 4Q4HA 1KI9A 2KI5A 2EW1A 1HQYE 1GILA 2REOA 2OO7A 4HZIA 5FTJA 3EWAA 3L82B 1GKYA 3IEUA 4UXHA 3CNOA 1P60A 5DI3A 2O0JA 1WRBA 4EAQA 4MUAA 3VR1A 4DCTA 2XITA 1Z6AA 4V0LA 5CYOA 2A5GA 3I32A 4RFVA 2JJ1A 4ZCMA 2GESA 4B74A 1M7HA 1G9XA 1II8A 4M2LA 4M1MA 3SJBA 2ZR9A 1K5GA 2NZ8A 2JLZA 2YNMA 5F2EA 3DVLA 2W6JA 5JECA 2IA5A 2Q0HA 4B6FA 4URXR 1E96A 1KDRA 2GVZC 1W4BA 2WJVA 2QRNA 1E3MA 5JCPA 3EASA 4CEJA 4B2LA 3RSOA 2IXFA 1P9RA 3EZFA 2QQ0A 2ZRLA 3I3SR 1TF7A 1T5IA 1V43A 1Y3AA 2ZRGA 2BMJA 3K0AB 4E07A 2GNOA 2BEJA 3MCAA 4G5SA 4RD1A 3W6OA 1DARA 4EDHA 3QKSA 2BJWA 2XTNA 5EE9A 1AQYA 3QPVA 4QM7A 1NMXA 2B6HA 3TNFA 1Z8FA 3NEJA 4G5QA 3RRMA 2SHKA 4TTQA 4Q1BA 3HU3A 2FFBA 1JXMA 2WWFA 1Z6TA 3MJRA 5G53C 3WHKA 4B71A 2CJWB 2J59A 4NTZA 4TMVA 4EJSC 3I62A 4CDGA 2CXXA 3CWQA 1RZ3A 2EFEB 2J45A 2FSFA 4D4JA 1U0LA 4QJ3A 1R5NA 2OBMA 1KDOA 4KSBA 3KXKA 1VHTA 3U2QA 3THWB 3TVDA 4DUGA 5LPNA 3SYKA 121PA 1P2SA 2OT3B 3RC3A 5FR1A 1GG2A 2DHRA 4HAWA 2OSBA 4U00A 4OI0A 4TWZA 1OH5A 3BFVA 3LXRA 1UDXA 5KPDA 2QMOA 4HSEA 1GDDA 2RCNA 3MLEA 1KO5A 4TLDA 4TZ6A 1XXHA 5F9HA 1KK1A 1E2HA 1HT1E 1JJVA 1D2NA 5AJZA 4FMCF 4JLDA 5CJPA 2W6JD 3U44A 2ZRHA 3LDAA 2VYFA 1ZUIA 4CEHA 3JVVA 1GAJA 3CRRA 5HCIA 3GLHE 4QHTA 5DGXA 3FWYA 3GFOA 1E4VA 3BERA 2JJ2A 2QP3A 4OJQA 5JJIA 4XWKA 4KBFA 4JLVA 4C0HA 3BB4A 2X1VA 1G8YA 1NKTA 2WIAA 4NL4H 3B1XA 1GNRA 3C16C 2J0VA 1MABA 1O3YA 3LVRE 1E79D 4Q4AA 5CJ2A 3AP3A 3QE0A 4WIAA 4X8LA 1XEFA 3DHWC 1JXOA 2NPFA 4O3MA 2P6UA 3TAHA 2IHBA 3RAPR 3SHWA 3QKTA 3OFND 4A2WA 2YJTD 3RANA 2IWRA 5C18A 3ZJYA 4RZ3A 4TTRA 3G82C 4ILEA 1NIJA 3GLIA 4Q03A 3SZRA 1XPOA 1CR1A 2QTHA 2A5YB 2GXSA 4X8OA 3K0SA 1VMAA 2Q6TA 2ZAMA 4DCVA 1N5LA 4AWXA 4OKSA 3PXGA 1SXJA 2QORA 3QSYA 4EPWA 1IQPA 4MYHA 3NH9A 2ZJBA 2FWRA 4DBLC 4GMDA 1OJLA 5C2JB 1LNZA 4QNRA 1XTSA 4M1YA 2B8WA 1XMSA 3WYAA 3IO3A 2YINC 4G01B 1F5NA 1Y63A 1KI4A 3CX8A 5CK5A 1A5TA 1XEXA 3CNNA 4HAUA 4R2HA 1G20E 4HZUB 4MYCA 2JLXA 4HUQB 5HE9A 2LCFA 4Q9IA 2FU5C 821PA 1DE0A 2J46A 4S35A 4D2IA 4IVPA 2QTFA 3H2YA 3FVQA 4NYJQ 4LBZA 2OE2A 5LBIA 5F9FA 3BAFA 2ZRJA 1KK0A 1XJCA 1KO8A 3CF2A 4Q48A 3T5GA 4BRWA 3TR5A 2JATA 4B44A 4EQ6A 2ATXA 3J81k 4ACAA 3CIOA 1BH2A 2WKQA 1SKQA 2IF2A 5KNBA 3GFTA 1XP8A 1Z28A 2CE7A 3BXZA 4NCIA 5J4HA 4EFMA 4FMBB 1EWQA 4HAYA 4EKDA 4LUCA 4NCJA 1HA3A 2IW3A 1XXHE 1A4RA 2HF8A 4HDCA 1W36B 1E9EA 4Z51A 5TMPA 4JS0A 4LJAA 1Z2AA 1WCV1 3LQQA 4CRWB 3AF4A 5B30A 2GBLA 4HB2A 2ZJOA 4HLDA 3VX3A 2GK6A 3ZS8A 4IVQA 4A8JC 2ZYTX 4ASUD 1UPTA 2H92A 4CF7A 1UJ2A 3B5JA 5IDVA 2BMEA 1E6CA 1J70A 4MQBA 4XSGA 1Q20A 1DTSA 1M8PA 1PLKA 2H7VA 5IT5A 3TMKA 5LB2A 4LYJA 3NH6A 1OH8A 2IS1A 2ANBA 1NY6A 2IYSA 1RVDA 1DS6A 1Q21A 5HZKA 1T5LA 3PUYA 1U9IC 3OESA 5B64A 5B57C 2FGKA 3X2SA 3HU1A 4LX0A 1CXZA 4PC6A 4BECA 1W0KA 2WWIA 1RIFA 2NTYC 1LFDB 3SFZA 3PEWA 2E9SA 3MWJA 2QTVB 1QHYA 1JECA 1UEIA 2B7BA 4E5UA 3CPEA 3SN6A 3F0TA 4Q1FA 4R9UC 4UQOA 4WZAE 4G1UC 3IHLA 2RH5A 4XVQA 1EFRD 1IHUA 1L4UA 4B76A 5DH9A 3TVTA 2XTZA 1NN3A 2ORVA 4TSFD 1XZQA 2CLSA 1VECA 2QAGA 1E98A 1TUEA 4P0TA 4DT1A 4NE2A 1TMKA 2CCJA 3QUSA 4QBIA 1P7CA 1X3SA 2ODWA 3X1XA 2NZJA 3K09C 2O8BA 2IYZA 2WKRA 4X8HA 4A8JA 4XVUA 3RWOA 4MRRA 1ETUA 3C4JA 2GBLC 4Q9HA 4HLQB 4O25A 1PVOA 2AKYA 1S3SA 1SGWA 2OV2A 3BIFA 3RWMB 4LBYA 3CONA 2AXNA 3LD9A 2KE5A 1W36D 1IN5A 1TEXA 2G9NA 1XTKA 3CPHA 3V4FA 4B75A 1HV8A 3Q7QA 4PXAA 4Q47A 4C4PA 2EYUA 3TBKA 4LDJA 5L3VA 1FQKA 5FI0B 3AVQA 4MGIR 4LHXA 1ZVQA 2PJZA 3PUZA 2OFWA 2QY9A 2FFQA 4V02A 3AVXA 4ARZA 1OHHA 1EXMA 3RS4A 3X1DA 3QJYA 2KSQA 1ZC3A 4BFYA 2AN9A 2JJ1D 1EFRA 2DWPA 2GAOA 2Z4SA 4HUQA 2G0TA 4LPSA 3RS2A 4BLRA 1Z0JA 3TAUA 4RJLA 1W47A 5EP2A 3U7FB 2GCOB 4BLPA 3TIFA 1E2IA 1T0HB 2ODEA 2PCLA 1PV4A 5AUQA 3WNCA 1E2FA 2WZQA 2GJ9A 1TUIA 2AD5A 3CPJB 1T3SA 1D9XA 1F2TA 3ZQ6A 4IFEA 1ZD8A 3QEJA 3AVOA 4CGZA 1TPZA 1P2VA 1DAIA 1I4LD 2NO0A 2J1LA 4F4JA 2QAGB 4MKIA 2D7CA 4ZPXA 5JMTA 2IS6A 4RCYA 1Z6YA 3QNUA 4I99A 1NNEA 1E9BA 2YWFA 3MWLA 3IQXA 2D06A 1Z29A 3VAAA 3U7GA 1ODFA 3JVUA 5BXQC 1MRSA 2IYTA 1PUJA 2B8TA 2CHQA 4W5HA 3LBIA 5HKKA 5KSZA 1OB2A 1OXUA 1NVVR 2ZROA 3EA0A 2FEMA 5J47A 5KSYA 2AD1A 1Q1QA 3IILA 4OQLA 2ZS9A 4PQYA 4LI0A 1SVOA 2N42A 2PEZA 1FZQA 4MYTA 4URVR 1GNQA 1Z5ZA 2GXAA 5CITA 1ZU5A 5JLJA 5A4JA 1N2CE 1XDBA 1ZNYA 2Z5FA 3ETLA 1OV4A 2V7QA 5EP3A 1W0KD 1EGAA 3V9PA 2JLSA 4YMTA 4DEXA 3EG5A 4PZZA 5EXTA 3VX4A 4GL2A 2QP4A 2PMKA 2Z83A 3CLVA 1AGPA 1QHHB 4GNKA 4IDHA 4O2LA 5EE3A 4P4TA 4TYYA 2R44A 2R2AA 2QPTA 1SVLA 4F4IA 3P26A 4DLYA 2CVFA 3KJHA 5D3MA 5JSZB 1US8A 5DN6D 3QOFA 4OK5A 5FTMA 1E9AA 1R4AA 5JI2E 2XGJA 1DAEA 2CCGA 1EG7A 2EWWA 1VIYA 2HCBA 2ZUDA 1OT3A 4KVAA 3NEYA 3EZ6A 2FG5A 1XX6A 3P20A 4FXPA 2GJAA 5CIWA 3PR1A 1NMZA 2ZRPA 4WXPA 2P0EA 1P73A 5BN3A 5SZIA 1AS2A 4BFWA 1ANKA 5EJEA 3PFIA 2ZS7A 1EK0A 3ZZ0A 3GLFB 4A0HA 3ICQB 2HUPA 1A2BA 4WZ6A 3TJZA 1EESA 1JR6A 1AM4D 3OAAA 4JSTA 1ZD9A 2C2HA 2DWOA 4TQUS 1ZIPA 1GIAA 2OCYC 4AKIA 4Z8XA 1U0HC 3R9WA 3U7EB 1F3OA 1KKMA 3WBJA 1HH4A 5FL7D 1L2TA 1ELOA 2VO1A 4P4SB 4LJ4A 2C9OA 5FTNA 4JT2A 4MKGA 2QGZA 4RD2A 2UVQA 1SXJE 3B85A 4DLTA 4A0FA 1NKSA 1OE0A 4DWJA 3ZYCA 1JNYA 2GCNA 3K9NA 2AHOA 1DADA 2ZI9A 3IBGA 2IS2A 1KI8A 1UKEA 5FUXA 4FN5A 4DZZA 3B78A 3IQWA 3GLIE 3LH5A 4R2IA 1HE8B 2ZJYA 1JBKA 3UWOA 5DHAA 4M1SA 1YR9A 1UBFA 4YXWA 1CRPA 4XVRA 4LJYA 4UNRA 4PX9A 4B73A 4UJ5A 2AFIE 3PV0A 1LS6A 4QJ4A 1YZNA 4HDQB 2R6AA 2A9KA 4DLRA 1P62B 2ERYA 4IOMA 2HJGA 2CMKA 4BQSA 4M22A 2IWHA 1EX7A 1G21E 3SDZA 2GZHA 2BBSA 2WV9A 1VPLA 1ZM3A 4RFSB 5GJWC 4YONB 1KHTA 2V6IA 2X2EA 2C9CA 1R6BX 3W8RA 2ZSAA 3KFVA 2ZSDA 4F4CA 3U44B 1IN7A 2D62A 1Q44A 1PLJA 1KJYA 1RKBA 2OG2A 2XOKD 2ZSEA 4DDWA 4V03A 1A82A 3TUJC 4JLKA 3WXMA 2PZGA 1ZINA 1NN0A 2GAAA 3H0KA 1I4TD 3IPYA 1BO6A 3ND8A 2WKPA 1UKYA 2IEYA 3LA6A 5FBRB 4D0GA 1JALA 4D81A 1RRPA 2ZRBA 2WAYA 2DWQA 2B21A 3MGCA 1TADA 3AP2A 4IEEA 4PZLA 2PX3A 3SBEA 4PFSA 4JIMA 4HI0E 3AVTA 1IAQA 4US0R 1P6XA 4JVLA 1E2JA 2ZI3A 2D7DA 4M1OA 2RGNC 4OHZA 3SYLA 1NG9A 2QUZA 3K1JA 2W2XA 3IIMA 3KUCA 1W48A 2C03A 1XTJA 3K8YA 1OF1A 1E2PA 2H18A 3ND9A 3FTQA 1KAGA 2RGEA 4C9BA 4Q4JA 3O8BA 1OYYA 3GLHB 3BS4A 5BWMA 4ZIRA 1G7TA 2PT7A 4A9AA 2Q9CA 1MO5A 2V1XA 4G0NA 3HU2A 4PPFA 4DRZA 4RZ2A 3VKWA 3BE4A 3SE0A 4KJZA 1U90A 3QXHA 3NKVA 4WVFA 4RCZA 1YZTA 2XNDD 2NG1A 3TSOA 1GRRA 2BDTA 4P33A 5JRZA 3I4LA 4MGKR 1QHIA 3D8BA 5FH9A 4NCKA 4DDUA 4B32A 4GFDA 4TL9A 3OEEA 4UXIA 2FPMA 3DEFA 4Q7JB 5JSZA 5EXSA 3Q85A 4DUGD 1NIPA 3A1WA 5FPYA 1N5IA 4EIWA 2D74A 2R6CA 3TW4A 2WPDD 1R2QA 2ZYVX 2K5UA 3M4YA 1XWIA 5EZ5A 3SEAA 2DPXA 3U3JA 1N6HA 1NSFA 3A8TA 2EFHB 2O0HA 1R7RA 5GJVC 4TN1A 2OZEA 4QM6A 4A82A 2XNDA 3MSXA 1W0JA 1W44A 4HYYA 3IIKA 2GA8A 4MDFA 1Q1ZA 3B9PA 2FF7A 2FA9A 4DSNA 3U6KA 4EPYA 2ZI5A 1YRBA 4IJMA 2R6DA 2YWGA 3KKOA 4GOXA 1QHXA 3QEOA 4JVMA 2ZM5A 2JLVA 2BBTA 4Q7LA 1KMQA 3N5CA 2GDJA 2IUSA 3AKYA 3GJ8A 3S1AA 4OI1A 3O8RA 1A1VA 3CF6R 3OIUA 4XD7D 5IK2D 3BC1A 5L3RA 1G3RA 2XAUA 1N0UA 1HURA 3THXB 2ZI6A 2WWGA 4OQFA 1OFIA 2REXB 1IN8A 1VYUA 3AUXA 3KL4A 4NYIQ 4HATA 5HPYB 2NO9A 5FPKA 5FTLA 2JLUA 3P1JA 2WJHA 4L9SA 4Q7KA 1KZGB 5UKDA 1D6JA 4LV8B 4NHOA 1G3MA 3B13B 1KI2A 4DLUA 4OHWA 2RGDA 2W0MA 1OPXA 3CRVA 1F2UA 5KDOA 1WQ1R 1BMFA 1NL3A 2PJRA 1II9A 3T1OA 3UK6A 4KU4A 4KVGA 4LZZA 1XU4A 4GT1A 2F43A 1VKJA 5FI1B 3I5XA 4CEHB 2W00A 4II7A 5G3ZA 5CM8B 4QC2A 5E7IA 3OIYA 4ZDWA 3QKUA 4ITRC 1KSGA 4Q02A 2ZRKA 3CZQA 3U60B 1OFUX 1NY5A 5JS7A 3IIJA 4WAUA 3CH4B 1NJGA 2QQEA 2JDID 2XXAA 1YQTA 2QMHA 4DVGA 3I5YA 3RRNA 4WA7A 1CS4C 3WMFA 1WBDA 2ZRCA 4XSHA 2ZVPX 1GKIA 1JR3A 3H86A 4LHYA 4Q21A 5AJVB 4DLSA 1OLOA 3OEHA 4PC3A 5KNDA 3KTAA 1DAGA 2GILA 4CEIA 3FYHA 3W6PA 3OHMA 1R0WA 3FHOA 1G8HA 4FCTA 3THWA 4OHYA 1XF9A 4TLAA 2FZ4A 2JJ8A 5CB8A 3U3RA 5F3WB 3THYB 1MRNA 2IT1A 2BKEA 1VIAA 3C5CA 5L3SA 2BJVA 3T1QA 3QQ5A 4NKRA 5HE8A 3QG1A 4JVSB 3L8YA 1HQCA 2QA5A 3FHCB 5AJXA 2IYUA 3F8TA 4YDSA 4PSVA 1VG8A 2FOLA 4KYUA 4Z1MD 1AGRA 4GZLA 4KFTA 2F1RA 1QDEA 4FWIB 2G83A 1H8HD 2P67A 2VSOA 1Q22A 4Q18A 4QG7A 3MMPA 3MAAC 4D0NA 1QHNA 3QKSB 2VP9A 4EPTA 1LS1A 1G19A 3SHFA 1KAOA 2QBYB 1FNNA 4IKEA 1R8SA 3R7WA 2HV8A 1W0JD 4Z54A 2FSHA 3HJNA 2OM2A 1UBCA 3R20A 4JL5A 3DOFA 2WWYA 2ORIA 2F9LA 3VKHA 1YKSA 4FCWA 4IDNA 1N6RA 3AVUA 3CX7A 3DZ8A 1Z0DA 2LKCA 1T4GA 2W58A 2GETA 4RZXA 2F7SA 2YKGA 1IBRA 4LPKA 1TX4B 2J3EA 5FOXA 2V6JA 4JYBA 1J8YF 1KJZA 2KWIA 3ZIAA 2F1JA 4M9XA 2QN6A 1IOZA 3SR0A 1KI3A 2YVUA 2C04A 1ONBA 4TMTA 1FX0B 1P9NA 2WM9B 1N6NA 4TMXA 1XPUA 1YU9A 2OBNA 4KV9A 3IPXA 5AR1A 1T8TA 5KDLA 3A36A 4ZKDA 1X8JA 1AZSC 2PBRA 1BYUA 4BFTA 1UBGA 1CR4A 1P72A 1NJFA 3OEED 1NG1A 2AKAB 3UMRA 4JKYA 2XJ9A 3EAQA 1UEJA 4D26A 3VKGA 2FDCA 4K81B 5EXPA 4OI2A 3R9XA 1WB9A 3ZQJA 3RLFA 1TQ4A 2HXSA 2X8AA 3KKQA 3NDPA 4NH0A 2HLDA 4NPHA 1E9RA 2J87A 4C3ZA 3BWDD 4M9ZA 2Z43A 1J7KA 2ASEA 2GJSA 5KSOA 2YC2C 5BQ5A 3TH5A 3PITA 1D8TA 1G7SA 1FTNA 2BWJA 2O0KA 1BMFD 2QMUA 1GZSA 2Q9AA 4B3BA 3KJIA 2O8CA 1SQ5A 2IYVA 2VBCA 3AKDA 4NYMQ 3VR3A 1T3LA 2BOVA 3MD0A 3DM5A 2P6NA 4N0EA 4OHXA 3NIBA 5FBQB 2ZRFA 2BMFA 4BEBA 1IY1A 4YXWD 1OB5A 3SI7A 2RGAA 2ZPTX 1E32A 2FEOA 3HPQA 1MV5A 3VU9B 4DIDA 1ZU4A 4A4DA 4H9GA 1XD2A 1KDTA 3BH6A 2IYYA 4UNNA 3H4MA 3NBFA 2R9VA 1P5ZB 5FBWB 3PUWA 1X6VA 1RRGA 4BLOA 1ZCBA 5AUPB 1R5BA 2C95A 2J41A 2XJ4A 4C0SA 4I1OA 1C4OA 3GJXC 5JJLA 1H8EA 4MRSA 2H8KA 4WOPA 3S1AB 4BZXA 1U9IA 1QHGA 5H68A 2X19A 3AGPA 5B2ZA 3ZD6A 2Q3MA 2D2FA 1R0ZA 1SKYB 2A3RA 3NTUA 1CRQA 5BN5A 4LBVA 4RD0A 1KI6B 2O8EA 2F1IA 3MWKA 3TSWA 1SULA 1UKVY 2JAQA 5KUTA 3VNUA 1H8ED 4P4UA 3ZIAD 3QPUA 1R0YA 2DFKB 2WBLC 2JCSA 2C8VA 4MKFA 3UG6A 5JBQA 2E87A 3X1YA 3ZGXA 1Z0AA 1KOFA 3T12A 2OHFA 2OAP1 3EIQA 2QENA 4ON9A 4PPQA 5J40A 4ASUA 5CDFE 1BYIA 3UPUA 4URZR 4KLNA 3H1TA 4HLUA 4NBSA 4QBFA 4XTRA 1E1RD 2ZUCA 2WWWA 1FW6A 2XSZD 3E70C 5LD2C 2HDNB 2ZRDA 3LW8A 2MSDB 5FBVB 4PQRA 4NYIR 1CULC 2ZYWX 2DB3A 1BOFA 1SVIA 4Q1DA 2ZITA 3LXXA 1KK2A 3GLFE 1F60A 2VHJA 3EIHA 3PIRA 3Q5EA 3SYNA 1B23P 1SHKA 2V54A 1K6MA 1W5TA 4IOKA 5E4FA 3SQWA 1E99A 1SHZA 1G8FA 1WF3A 3B1VA 2QT0A 1U99A 5AUNB 3B60A 4BUJA 4DB4A 2YC4C 1M7BA 2VF8A 2ZJ5A 2ONJA 1HUQA 2WSSA 2O52A 2IYRA 4LRWA 4KXFB 3L43A 1KNXA 1DELA 2QI9C 4YMUA 2ZSBA 3AGQA 2VP5A 4WZBE 1JJ7A 3VNVA 3K0AA 1A2KC 2A30A 3THOA 4QHSA 2VIIA 2IYQA 5JS8A 3A58B 4OBEA 3TW8B 3I92A 1E9CA 3IDQA 4PPGA 4PTLA 1SXJB 2QMEA 3QY0A 4TLBA 5KPJA 1A7JA 2RGBA 1ZNWA 5C4GB 2KB0A 4BLQA 4DEYA 4US1R 5HKKD 1ZIOA 1G5PA 3GJ5A 2D3WA 1KJWA 2OFXA 5KHOC 3IO5A 4C2UA 5FBLB 1XZPA 1ZMXA 1Z83A 1NVXQ 3BGWA 2A5JA 3GLIB 4KITB 5LB4A 3W3ZB 4R71A 2QRZA 1C1YA 2CCKA 1KI1A 1S9HA 4RSGA 4LHWA 3WMEA 3BFXA 1QF9A 1Z2CA 4A8JB 1K5DA 3UATA 5DISB 2ZRNA 3PUVA 5DI3B 3CF0A 5JZVA 3VR6A 2O8BB 4BFXA 1MABB 2BMDA 1NLYA 2H5EA 3NBYC 2EFGA 2C77A 2V9PA 1YR7A 2QG6A 1LY1A 1NN5A 1OW3B 2ZU6A 2CNWA 3L2OB 2OFOA 3HYRA 2WWXA 4B3DA 1N6PA 2AXPA 1AA9A 4NDZA 3CZPA 3QXSA 2J0SA 2YOHA 3GD7A 5K8UA 2FFAA 1FTSA 4Q00A 2VHQA 4FIDA 4JLOA 4JMPA 1E4YA 1XEWY 2P5SA 2VHCA 3EC1A 1Z0KA 4TYPA 2Q3FA 4L9WA 5BN4A 3HWSA 3SU8A 2EYQA 2AK3A 1JPNA 2GXQA 3CRMA 2OCAA 3D3QA 4TL6A 5CM9C 3VQTA 2ZXUA 2ZJAA 4N3NA 3EW9A 4B2PA 3E5HA 1JI0A 2CLDX 2A2ZA 4A36A 4KSCA 3ADCA 4JLJA 4A1FA 2IX3A 3KKPA 5FR2A 1N0VC 4TQ9A 1YZGA 4DCUA 2NO7A 3VR5A 2DCUA 1I2DA 1U98A 1HTWA 2EQBA 4L4UA 1KY2A 2RHDA 4FINA 4GOKA 2ERXA 1NN1A 4GMXA 3TQFA 2AWOA 5SZHB 4D4KA 2NOAA 4DT1B 1TAGA 1WBBA 4W9MC 4NMMA 2ZI4A 4I4LA 2F55A 1Z3IX 1MKYA 2GVDC 2QBYA 2O8DA 2P2LA 1X86B 4PSAA 4BZPA 1IY2A 2WJYA 4YMVA 4L5BA 5J4YA 1E79A 1I2MA 4PPNA 1G7RA 5G41A 1W4AA 2F3RA 5FPHA 2WOJA 4OQXA 4C0QC 3WNBA 4LV5B 1XPRA 4IXMA 2MMGA 2NGRA 3K53A 3X1WA 1IM2A 2C78A 5JEEA 1KI6A 1Q0UA 2XOKA 2NO6A 3PUXA 1G7CA 3O8DA 1MR3F 1N6KA 1KZ7B 2BM0A 4I1SA 4DLXA 5KYKA 1TQDA 2RAPA 1ESMA 1UM8A 2G88A 4BRUA 3QXJA 3ZZTA 5FOTA 1AKYA 1FL9A 3UKDA 1EWRA 5DYIA 3U7HB 3AUYA 1RJ9B 3UMFA 3KQNA 2XB2A 4D80A 1U8AA 2BC9A 2IYWA 4G5OA 3AM1A 4N0DA 4FD2A 1FPMA 3I61A 2I3BA 3MUFA 3QBVA 1OFHA 2ZE5A 5CLQA 2WIBA 3NC0C 3OF5A 1GITA 2J0QA 3EIEA 1ESNA 1CU1A 1JAHA 4OJKA 2IUUA 3BH7A 4CZ2A 1NF3A 4YMWA 1KSHA 4PQFA 4CT5A 5GADl 1SZPA 3SJZA 2TMKA 3V00A 4R98A 3SJCA 2QE7D 3G0HA 1F2UB 3IKJA 1OYWA 5KSPA 4PANA 3T34A 2HLDD 3KDSE 1PZNA 4E09A 4B3GA 2GXUA 3LO5A 2CJWA 4EUNA 4EJSA 4G5RA 1RRFA 4QOSA 2PX0A 3PENA 4CYMA 4PO9A 2IC5A 5HZHA 4C2TA 1U2RA 2ZUBA 4H1UA 1EX6A 5FFMA 4ESHA 4ZDIA 5FTKA 3B6EA 3ZDQA 5JJKA 2QM8A 1I4DD 3CWZA 4LJ6A 3EZ2A 3K09A 4L8GA 4UNQA 5FUVA 3WNDA 1KK3A 4RFSA 2GTPA 1IONA 3OE7A 4B3XA 2QAJA 5ELXA 5SZJA 3CNLA 4D6PA 2NIPA 1ZM7A 3FPAA 3JZAA 1KMHB 4U7DA 3SFVA 3EARA 3HPRA 2FMXA 1XCGB 3PG5A 4HEJA 4CEJB 1QG4A 1UDWA 4PO1A 1SVKA 4KI0A 4FI3C 1FP6A 3LX5A 4IOLA 3VHLB 3EZ9A 3W34A 3ADDA 2WAXA 2O8CB 4DLWA 4JL6A 1GOTA 4HB0A 1KYIA 3I72A 2FSIA 4QGAA 3TGPA 4H1VA 2WHXA 1G3UA 721PA 1NBMD 4KAXA 1T3HA 3EWSA 4GPTA 2BM1A 3W90A 2RB4A 3NWJA 1EFUA 4GI7A 4AIIA 1W36C 1OIXA 1TL7C 3AF3A 5FL7A 2DFLA 1R10A 4V0KA 2ORWA 3IGFA 2FX3A 2JIZA 3U3MA 1Z22A 3B2EA 4MRPA 1N6IA 4AKHA 1KNQA 4C0AC 5DE3A 1TF2A 2CVHA 1ZUHA 2PEYA 1Q57A 5TXGA 3AKCA 4OL0A 2O8FA 3WY9A 1ZP6A 1IXZA 1J90A 4W5JA 2C9YA 4M8NE 4A6XA 3GJ0A 4BEJA 4Q19A 1MT0A 1YE8A 3BJIC 1HY3A 3DOEA 2GEDA 3FKSA 3PEVA 4B34A 1FUUA 4LYHA 2NQ2C 4TLEA 4A6PA 1DVRA 1FX0A 4EJSB 2BBWA 3A37A 4QGHA 3AF2A 1XMIA 3L0IB 4MGYR 3A4MA 4LJ5A 2J5XA 3ADBA 4DLZA 1RE0A 4FCVA 1QHSA 1JB1A 1E2GA 2PLRA 1P4SA 3C15C 3BORA 2BHRA 4Q9KA 4B2IA 3NVAA 1QRAA 4LV6A 1G8GA 1E1RA 3LWNA 2W6IA 5C4MA 3BOSA 4QKQA 2GJ8A 3GJ3A 1E2QA 1NLFA 2KBEA 1HE1C 2WWHA 1NBME 1ZJ6A 3FKQA 5H1YA 4BGDA 3Q9LA 5C1BA 5DO9A 3GP8A 3BBPA 3CH5A 4XH9B 1FNMA 3D7MA 5SZKB 2H17A 2MMCA 3KQHA 2BIFA 4LHVA 1Z6XA 3R8CA 4C0KA 2EWVA 4IOJA 3LNCA 2ZE6A 1DBSA 5J4VA 1OKKD 2AL7A 5AK0A 1ZYUA 2ZAOA 2ONKA 5EUQB 2WMOB 5EQTA 1XCPA 2HF9A 2VQSA 1G4AE 4V0NA 3UMSA 4DCSA 2HT1A 2XNSA 2X77A 1HEIA 4UXJA 2GJKA 4D4LA 4HLCA 3REGA 1E2NA 5JFGA 3GLGE 3R9IA 3TKLA 1CJMA 1G3QA 2JIZD 3D6TB 1S96A 1NMYA 4PAMA 4EPRA 1E2MA 2YV5A 2CL7X 5JWOA 2GZDA 2OCBA 3BFKA 2VHUA 1U8ZA 3NHBA 4AURA 4BFZA 3QXXA 4AYXA 1GNPA 1M6NA 2OLKA 2JLWA 2QM7A 3RS0A 3EPLA 3K70B 3GLGA 2G1JA 4PR0A 3FMIA 2WJIA 5TB5A 5FPTA 4CIDA 5KO2A 2YYZA 2XXAB 4MYUA 4K8OA 3CR8A 3GJ4A 1MO4A 2CK3A 4DSOA 2C96A 1IJEA 3SNHA 4F7WA 1DG3A 4JLNA 4POAA 3VU9A 5C46F 1E1QA 4KFUA 1E0KA 4NCHA 4LSGA 3KQKA 1N5JA 5FUWA 1IN4A 3ONWA 3RDPA 4P3YA 4OQNA 4PO8A 4F38A 3GQBA 3K9LA 4ZCLA 2IUTA 4M1TA 2CL6X 4TMWA 1GL9B 1KMHA 3Q8XB 4S2EA 1F48A 1D2MA 2LKDA 4ZV4A 1PUIA 3WMGA 2ZE7A 1E2EA 1DG1G 5EE0A 4HAVA 6Q21A 5BW8A 1BKDR 1GWNA 1Q1BA 1M1YE 2ODNA 4MKHA 3K70D 1VG0B 3CX6A 3THXA 4F93B 2LWIA 2R62A 4G5GA 2QGNA 4GBMA 1GKUB 3NBZC 1COWA 4AYWA 4QGFA 1L7VC 3I73A 3TK1A 3OZXA 1W4CA 1SKYE 5GVSA 4JZKA 4OK3A 3X1ZA 2MSCB 4X8MA 1YZKA 1G6HA 2NMVA 4Q66C 4K46A 2A78A 4LBWA 1XMJA 1E69A 2J0UB 4Z8YA 1XEWX 2YOGA 2VSFA 1WXQA 3B9QA 3VTKA 1NLZA 1J99A 3BK7A 1VCIA 2QROA 3Q7PA 3T1VA 3AF0A 4ABYA 1GUAA 3OEHD 1XD2B 5JCZA 2O8DB 1VYVA 2A5FA 2XEXA 2FN4A 1KSJA 1OXTA 1JEEA 3Q72A 4LJ9A 1QHHA 3AVPA 2WTUA 5JWHA 3TR0A 1Z0IA 2QAGC 4GZMA 1F6BA 2IXGA 3K0FA 2CE2X 4B43A 3GEHA 4A2PA 5GJBA 3CM0A 1G8PA 3FGNA 4KFSA 5TARA 1ZCAA 1U8YA 2BCJQ 2P65A 1RPZA 3AH8A 1ZM2A 2BV3A 3T06B 5EP1A 2PH1A 1MO6A 1WA5A 3LBHA 3MG9A 4M0LA 4B47A 1PLLA 2W83A 5L8VA 3G5UA 4PSKA 2PZEA 2BVNA 1G291 5L3SB 1DPFA 1YZUA 2QPOA 2V8OA 2ZR7A 3QIAA 4LHZA 5KU1A 4IFBA 2ZIAA 5AJWA 2QU8A 1GL6A 3TUIC 5KOYA 1FOEB 4IVRA 2VF7A 2KJQA 4WXRA 2VPPA 2VP0A 2ZSFA 4TYNA 3U3OA 1G18A 2FE4A 1X8KA 1GVNB 1ZNXA 3RS5A 1F2TB 1DEKA 1TTTA 2B7CA 2VEDA 1N25A 2ZU0C 5D3MB 3LVQE 1VCNA 1XTQA 1B0UA 2VLIA 8OHMA 3UWKA 3B1WA 4B3CA 3EZ7A 2JLYA 4IDPA 3AEZA 4HDOB 4DB2A 3T61A 1GM5A 4GP7A 4W7SA 4AK9A 2PZFA 4O0MA 2P3SA 5EE5B 1YRAA 4TLCA 4A0GA 4GDFA 3HP1A 2F1HA 3OE7D 1E2KA 3MWYW 4PHTA 1CKEA 1VCMA 4TL7A 3RVBA 3VMFA 1SXJC 5HR5A 4RKEA 4XWOA 2R8RA 3THYA 1DAHA 3QKRA 4NONA 2IXEA 4BZQA 1PJRA 3FMPB 2ATVA 4QFMA 4AKEA 2R6GA 1QVRA 1XJQA 3HYTA 2B92A 4HB3A 4RKFA 3L0OA 2GCPA 3FFAA 4A15A 3QF7A 3ZVRA 4LYAA 4BPBA 2J7PA 4M1KA 1GRQA 3DKPA 4MGZR 1W49A 1NSTA 3B1YA 3DKVA 2JLQA 3BH0A 4C0BA 2C98A 3QI2A 4AD8A 3A4NA 3NDBB 3F5FA 4KODA 4AI6A 1XRJA 3GPLA 1Z06A 4IDOA 4KO8A 2PLFA 1VHLA 3GLFA 1D2EA 1GL7A 3ZS9A 4FMDB 4OI4A 3PQCA 3K0EA 2C5LA 3GMTA 4IHQA 1RRCA 2F43B 4PHHA 4Y0VA 3L8ZA 3W8NA 2FPKA 4C0LA 2BKUA 1G17A 1OH7A 2AFHE 3OFNA 3B7GA 1G16A 1LF0A 4Q9JA 3W3AA 3GEEA 4Q01A 4HAXA 4JBWA 4P4SA 3HDTA 4D82A 3QBTA 3CUEF 3Q5DA 3RRYA 3TSZA 3WRXC 4FWTA 3CBQA 3EC2A 1U94A 5JI3E 2ZE8A 1US8B 4QJ5A 4BWYA 4GOJA 3TUZC 1T6NA 2V7QD 3B1ZA 4J0QA 5FL3A 3DO6A 521PA 2FZLA 4TT3A 4I1UA 1MH1A 4RY2A 3QENA 1TQ6A 1RFLA 3IEVA 2BBOA 1NI3A 2I1QA 1OFTA 4DSTA 5B58C 4RVCA 4PHFA 1UF9A 1ZM4A 1RJ9A 2C99A 2VP4A 2EVWX 4URWR 4PC1A 3PVSA 5KDDA 2IBMA 5JHGB 2F6RA 2OXRA 4LYFA 3LBNA 4U02A 5EUMA 3ZZUA 3NBXX 4ZCIA 3KXIA 1CLUA 2F9MA 4DHEA 2R6FA 3K0FB 4L16A 2ZJ2A 5H70A 2HEIA 1YR6A 2IK8A 3T35A 2H16A 5DN6A 3OIWA 3EPKA 3U5ZB 2J7KA 3TQCA 1E0AA 1ZC4A 3FDIA 1M2OB 4JLBA 3CRW1 2YOFA 2ZTSA 3P4YA 5P21A 3WRYC 1VG1A 2ZEJA 5CK4A 2OUKA 1OKKA 3U4QB 4HZUA 4Q1AA 4TYQA 3ECCA 2BCGY 5DSZA 4XIGS 3CO5A 1CR0A 1YR8A 1T91A 2CBZA
chains in the Genus database with same CATH superfamily
1M34B 2CNBA 3R41A 2PKQO 3U4QA 4FC6A 3V8VA 2FAXA 4ZVPA 1HE5A 2A84A 3DCJA 3TXXA 3B9RA 5JUWA 4HVTA 3V6MA 2R7MA 1KFKB 2Y1XA 3PE6A 1D3AA 1DIOB 3ACBA 1NVVQ 3BSSA 3ZK9A 3PJRA 2XVYA 3N2IA 3L7NA 3R7WB 4EITA 2E5WA 2JFNA 3ISVA 3QBDA 3U81A 3UTCA 4EY8A 1SXQA 5AJYA 2I76A 2B4QA 4IDCA 4XGQA 4B5KA 2JI4A 2IU6A 3V6LA 1EH5A 3K16A 1Z8DA 2EBFX 3QF4B 2JCGA 3Q7SA 1UAGA 3OCJA 2ACEA 1V3QE 4IUYA 1CZKA 1N5RA 2ZQ5A 1GPLA 2ZVQX 3ND6A 3K9WA 5D6OA 1BKSB 5EKXA 4D1YA 3DBRA 3GWGA 1LNQA 2ZETA 3ABZA 5CLJA 3MTEA 5HKAA 3NU1A 1KDPA 5DULA 4IHJB 1I1HA 4M4SA 4BNDB 4EB0A 4NP6A 3D8SA 3L07A 2QZJA 4ZXPA 4RDHA 5JATA 1M1YA 5JQGF 1ODCA 2HWYA 2YMMA 5JCOA 4DV0B 3HVIA 3PPWA 4NFYA 1WCIB 1K88A 3RSGA 1QF6A 3C3YA 2D2XA 4Y30A 3UANA 4EG4A 1ZI9A 4WBSA 2IYAA 1BIFA 4O4IA 4KFCA 1Y7TA 4QICA 1LFAA 3EJ6A 3TB4A 1PV2A 3OPXA 2LV8A 3DDSA 1QIHA 2F3TA 2W98A 3T5AA 1TD1A 3KEQA 3KSZO 5FLYA 2VJKA 5IKXA 4LYYA 5JHHB 4OTZA 2AOWA 3EAFA 2XD4A 2AI2A 4IX9A 3CZAA 3HCFA 1K92A 4DADA 3GEBA 1QPBA 1DKPA 3NUZA 1HDYA 4MW4A 1VMIA 3KL2A 4JGIA 1ENYA 2FHSA 3STXA 1S1CA 3AYXB 2GRJA 2AWNA 2Q6LA 3OCVA 2X6TA 4OAOA 2IOYA 2TECE 1KOJA 1BDMA 1Y9JA 2Y1FA 1E0JA 4P31A 3Q3JB 3LBYA 3A1VA 3T7EA 2C2BA 4F91B 3OZWA 4JJ7A 3ZJVA 3ER8A 1YVRA 3FVTA 4Q9AA 2DUUA 1J49A 2WJGA 2AR7A 2RK4A 3F6YA 3KU4A 4IIXA 3UENA 1UFKA 4BBZA 4Q9LA 1RRVA 1Z39A 4XTCS 3JQAB 4WY2A 4ZVNA 1OBCA 4KGZA 3DL0A 1NV8A 3I1YA 3OZFA 1HYQA 5F9MA 3LDFA 5TDHA 1FFHA 2OOKA 1SUSA 3RC8A 2CNWD 3LPNA 1ZLXA 3U7JA 2Z4TA 4C7BA 4H2DA 2DEUA 1ZO8A 2R97A 3FAKA 3ITDA 4KK3A 1I33A 1IY0A 1V16A 3PHIA 3RD5A 1WEHA 1ZL0A 1Z33A 3BRWD 4X85A 4YRQA 1F8GA 2C8KA 2VDNB 3OHPA 2GA9A 2J9ZB 3R5KA 4S1NA 3X1MA 4LDAA 2FTKE 3C39A 3U49A 7YASA 5HIIA 4BMNA 1BXZA 1EUCA 1UZUA 3L5OA 1TT5B 4KPUA 3DE2X 3D8NA 3ZBPA 4DGQA 3O94A 1CVLA 3EYWA 4GDMA 4OSEA 5F1OA 3BMCB 1X9GA 1GGFA 2ODBA 3DDWA 5BORA 2WU3A 4PC7A 5JXWA 3HKDB 3ESXA 2R4UA 1E5TA 4RSRA 4AY6A 1DOAA 2HSDA 4MGEA 3E1SA 3RUDA 3T9FA 4EW2A 1GCUA 3C1TA 5E3JA 2ZIVB 2ZJ1A 5U9CA 3O3OB 2EZUA 3SJ7A 2WAMA 3AEUA 5LQSA 3ZWOA 3KJEA 1VCOA 2CFRA 1XTPA 4GLJA 1QSGA 2J33A 5E9AA 4W5OA 4NCNA 3NASA 2H0QA 3R2JA 2XXBA 4EG0A 1H8HA 1S01A 1I7QB 2DBQA 4MKRA 4TZTA 2XYRA 3JYPA 4Y6RA 3LAWA 2RK6A 4LJSA 2WF9A 5HSGA 2FG6C 3VVMA 3C4QA 1G5TA 2EHDA 4C04A 1NTOA 5KMGB 4XUCA 2JI7A 3JZMA 3DFZA 2DQKA 4B48A 4DABA 1J2RA 1WMEA 1KVUA 4ZPJA 4C07A 4KPEC 1M9NA 2G76A 4UNSA 1I30A 1WVIA 3I42A 3X0DA 5KC8A 1FXWF 1I94B 4P4NA 1WUYA 5BMOA 2PL3A 3L8HA 3GFGA 4RL4A 3K2QA 3SHOA 4F3TA 4R01A 4YQFA 5CIYA 2X23A 5IM4A 1JQ3A 4RLSA 2W2MA 4ID9A 4MK4A 4XZ3A 7ABPA 5HWSA 2X0KA 2CEKA 2ZJZA 4IS3A 1AG9A 1AVTA 4LJ8A 3DDUA 1J56A 3KYJB 2UZIR 4Q4HB 2I55A 2QE6A 4HUTA 3KSAC 2GDZA 4DLVA 1QGED 1X70A 3GG2A 5COQA 3T4PA 4C0JA 2MSNA 1JHUA 1XN4A 3D4NA 2BKVA 4J9UE 2ZXFA 4O1HA 4JOQA 5GVRA 1KDYA 5HIKA 1UXOA 2AUTA 3C41J 4L6IA 4G37A 2PUEA 1Z5WA 4D4MA 2PT9A 2PAAA 1CR6A 4CV3A 3DT6A 4GX2A 2X0EA 2A5DA 3R0IA 4JT4A 4NEHB 2YR0A 4BQQA 3KZVA 4FYPA 2V7UA 3SSOA 4HS9A 4RD6A 4ZI2A 1Y5IA 1W19A 3L77A 3DE5X 3QHPA 5BRAA 2O3SA 4F56A 5DXAA 1EI9A 4P58A 3QF4A 1KQNA 3DS8A 5JRJA 2N1BA 3C8UA 1JG4A 2XYPA 4F2DA 2JI9A 2OILA 5FLKA 3JTEA 3FI0A 2CXPA 4PLTA 2NPIA 1CQIB 1H2BA 1Z88A 2JCXA 3A9RA 2Q5HA 4R1SA 2Z3ZA 4LTDA 3JRNA 1NVUQ 2XVAA 1G8AA 3FGPA 3FTCA 1XALA 4MS3B 4QXPA 3F7TA 5JU6A 1DUVG 1OSNA 1B2RA 1VI2A 3QGMA 1L4EA 8AT1A 4XJXA 3G2LA 2FX2A 2WUVA 2E3JA 1D9ZA 4I9NA 5AM4A 4YB8A 2FSGA 1M34A 5L45A 1AKVA 1F1BA 2WSMA 1M1YB 1X13A 3F9IA 3KV3O 3ND5A 5FHQA 4F7DA 1CJVC 2V45A 4XWYA 3OZTA 2GWHA 4UUQA 5A5GA 3SVLA 4YT2A 1U11A 2GZAA 4WFQA 4LC0A 1A98A 3BICA 3TE6A 3ZE1B 1NUQA 1T9HA 1IK6A 2EX0A 1OBHA 2Q6IA 2VJBA 3NTQA 3UJ3X 1GQQA 1NT2A 3OQ1A 3A9TA 1WCYA 2H57A 2ZZNA 1AKQA 3ED5A 2XX3A 2IYLD 3KAJA 5IUJC 4P86A 3JRWA 1ZBDA 4MVJH 4O4LA 5LOVF 1NVAA 4PCUA 2A9VA 2K7ZA 9MHTA 3E8SA 4KHZA 2AMYA 1BXRA 4YNBA 3OE1A 4M60A 1X0VA 4NYMR 3UV7A 2GD1O 4EG1A 4G07A 1SBQA 1N3IA 3PE4A 4A0RA 4YJHB 5SICE 1CSEE 1Q0RA 2C7VA 2J3KA 2GEJA 2V6MA 4MQEB 5AHXA 4DRYA 1SIBE 1R0SA 2F17A 3IERA 3RRZA 3D0OA 4D56A 3NOOA 4BASA 3DV2A 1VQ1A 1T29A 4JBXA 3EXG1 3FZNA 1MC8A 3WJ7A 1RQPA 4CM6A 1GQYA 2AUNA 1JU4A 2P3LA 3O03A 3RF7A 1IY9A 4FHDA 3O8LA 3DZDA 4DV6B 2P0YA 4NU5A 5REQA 5E0KB 5IJ0B 3FTNA 1VJTA 1BWPA 5LM3A 1V7CA 3ROMA 1LV7A 2O14A 1EVLA 5B7PA 4G5HA 2BD0A 3GCGA 3Q3GE 3CXRA 4KYIB 1UKZA 3ZD8A 4E4YA 4EQ6B 4EFLA 3L93A 4H6PA 4FGKA 3OO1A 2XYVA 3RSFA 4OH7A 1X1BA 4TTPA 2J8ZA 1L4BA 3RABA 3V4OA 2XODA 3TRKA 5BW4A 2P9HA 1UFQA 3R4VA 4OQMA 4DG5A 1V95A 3ER9A 4OBXA 1VM6A 3NHLA 3EXAA 4XD2A 3NHRA 3KUKA 4CNBA 1K4KA 3ZY2A 2H1LA 4CV2A 2NVWA 1B42A 1R4ZA 3A9WA 5CW1A 3NW9A 2FGJA 2UKDA 2JBAA 3LBFA 1NUUA 1UP6A 4PR3A 3K6RA 2ZM6B 2BI4A 1I4WA 3PZBA 2Q41A 3QOWA 3LW7A 2ZANA 4IDQA 2EJUA 4U9IS 2PR7A 1BHSA 3C7KA 3E0QA 3NG1A 1WU8A 4A2QA 1A9XB 3GHYA 3I1FA 3QFHA 1VG9B 3VZRA 2C7RA 4KL8S 3GUZA 5ALKA 3AI2A 4W6ZA 2JJ2D 4CLRA 4ZI7F 1YZLA 5EPUA 3QTTA 4TROA 3UMBA 4A0SA 5ADUS 2OCPA 2FZ5A 4RD4A 5AM3A 3F8SA 3IAM6 4CM4A 3C3MA 3V7YA 1JQKA 3TYXA 3JWPA 4UVEA 1XVUA 2HCJB 4AP5A 1ZY2A 3VVLA 1ITZA 1JB9A 1XZJA 1W88A 5IULC 4ESVA 2V4MA 1WPXA 4C7OA 2WYHA 2YV3A 4QHYA 2H63A 4EFNA 3T95A 3DEKA 2HBQA 1N2OA 2R65A 3Q0TA 4FBLA 1ISGA 4U2FA 5FWXA 3PFHA 2FZGA 2O3JA 7GPBA 3AF1A 3AOEC 1YS9A 3C3AA 1E61A 1W25A 2C92A 5CFZA 3ADDA 4NBNA 2PGOA 3PHHA 4EUFA 1EINA 1E8MA 4MVJD 1D5CA 3A27A 3MBOA 3G1UA 1ZD1A 2BTOA 5IDYA 4IG4A 1QG6A 1OAOC 2QXTA 1AZTA 1MPTA 1D6MA 2W2OA 4PYRA 3A0RB 3AETA 5C31A 5CFLA 2J5BA 4RH3A 3W8EA 1Q12A 5IDXA 2NO1A 3E7PA 3MWEA 4I46A 2V74B 1E0SA 3P9PA 3RS3A 4MA4A 2MSEB 4FMDF 4GBJA 1YI0A 1KARA 3OX2A 3HGMA 2Q5EA 2C4KA 4ADSG 2V7GA 5D7NA 5NULA 3QG5A 5IVIA 1JQLB 4G86A 5I48A 2W6PA 2NTNA 4HPJB 4YRLA 1ODTC 4LWZA 3CJQA 4IRMA 2FKNA 2G6BA 5EXXA 2VOJA 2WMYA 3O5AA 4UUBA 2C2YA 3UOAB 5B3JC 5C1PA 1WPQA 4P3PA 3X3HA 4J0GA 4ZGWA 3L4SO 1IVSA 1TJYA 4C7OB 3RK0A 1TEZA 4TV8F 2HX1A 3RV4A 2VDMB 4HNAA 3GJ6A 1W46A 1SCKA 5E9QA 3WYFA 3LUGA 1WMFA 4V1CI 5KTRA 4Y0AA 3ZGOA 4ZVLA 5JO0A 2VR1A 2DQ4A 3I9MA 2PNJA 1VXOA 1DJPA 2IEZA 3VR3D 2OK8A 3D4OA 4Q5IA 3NHAA 4AUEA 4RABA 3DAOA 3VBEA 3ZLJA 1Z4NA 5CIQA 2QRVB 3ROXA 3RJMA 1QHEA 3SX4A 2WFMA 5IT0A 2WABA 2VA8A 4CPDA 4L0CA 2W6QA 4MRNA 3ZJTA 1MNAA 3B3GA 3O4FA 3E7DA 5BYKA 2SKEA 3OJXA 3VJMA 3DE0X 3IRVA 4EHFA 4LDPA 4G65A 4IQ8A 2Q9BA 1K5PA 3V8QA 2JFQA 1JQJC 4QO7A 1WXIA 4J1QA 3USCS 3R0XA 3WDMA 5I7EA 4W5RA 1FA9A 3ZU2A 4CIBA 2E4AA 2FR0A 4ALNA 5CLFA 4TV9F 5LDDC 3GCDA 3CLSD 4HGYA 4MKXA 4O5AA 3ZGYA 3HXQA 1YBVA 4KAAA 2B9VA 2WT8A 3BREA 2MSLA 4CCYB 1K9SA 3TOZA 5E1DA 2GHIA 1YZFA 3ZXYA 1LPPA 2QSZA 3G0DA 2HGSA 2G1PA 2VQ3A 1II0A 3L9WA 3LYLA 3RVLA 1T9DA 4LJ7A 4Q1EA 2JHCA 3ZHYA 2PMBA 3W6NA 1SU8A 4FX2A 5F98A 1IM8A 3H42B 4OM7A 4XGNA 1HG0A 1OH6A 3L6CA 4ERNA 3Q3HA 3EPRA 2MT9A 3KE9A 3ZG6A 4GM0A 1KRWA 1YMVA 2Q4TA 4PIMA 4QULA 4NU6A 5DXFA 3WDSA 2VCEA 3DDCA 3LX8A 2I3DA 1RAHA 2Z98A 1S8NA 1OXSC 3BMXA 3ZBUA 1B0ZA 1JEOA 1G41A 2CHEA 2QD5A 1S2MA 1M34E 1DQSA 1E9SA 1VL1A 1LRKA 5E9WA 3ID6C 2HMVA 3IAFA 3ZVNA 1XTIA 2RBEA 2PSHA 3PEUA 3C3DA 1E6WA 5E3IA 4RTMA 1RHUA 5IHPA 5AVWA 1HORA 1W5SA 2E37A 1EIZA 3GFBA 2XZLA 1GGJA 3K1AB 3WGUA 1S8FA 2O20A 2UYOA 3RU7A 1RWPA 1K8RA 2BEKA 4HVAA 3D2LA 3G59A 3ANSA 1IM5A 1KMNA 1ATIA 3M34A 5K2OA 3BD9A 4Q4JB 3LWBA 1CB0A 3HCBA 1RI2A 3KV1A 3NJ8A 3URMA 3DEYX 4KKXB 2HU2A 4YHBA 2JHGA 3ETGA 4PZPA 1XYVA 2PY6A 2FPOA 1P4JA 3KOXA 3M9WA 3P0IA 4N6NA 5G4LA 3TMAA 5CFPA 1H1DA 5ADHA 1LBQA 4B3RB 4QNMA 4RGYA 4G1CA 1AK1A 1UFVA 1Y5RA 3RSLA 2D4HA 3WK5A 2ZYUX 5DHRA 2WJ4A 2H08A 1AQUA 5E4TA 3RIYA 1KO1A 3U3KA 2FMTA 1CV2A 1O5OA 5LXTF 2FOIA 1UXHA 2Q99A 2OESA 1U5CA 1H3NA 3C6MA 4V0ME 1UAAA 4N18A 1JR3D 3L46A 4IXWA 4R1OA 4AKGA 3QLUA 3K8QA 1ZJYA 5ALEA 2HA2A 1XO1A 1KI9A 3BF7A 2FZWA 5IASA 2FZVA 2QLMA 2NNLD 4G4JA 5FTJA 1SC9A 5HZGA 4DCGA 3EWAA 1GPKA 2Q50A 3L82B 4YR9A 4YP6A 3EEFA 3QMVA 2IELA 5BURA 1VLHA 4YCLA 4EAQA 3EVDA 3PRYA 4MUAA 5EXEA 4DPLA 3IDOA 4IJUA 3SLRA 5DBGA 1QK3A 3HZRA 1RZRD 1QAQA 1WCWA 4B74A 5HBGA 1RAAA 3SX2A 4AF6A 5IYZF 4M1MA 2UDPA 5AKJA 3GGCA 5C80A 4OLJA 3AU9A 2YNMA 4RE6A 1LDYA 1IHYA 2JLZA 5C5DA 5E6RA 1DC5A 1JX6A 2ZUSA 4V38A 4URXR 1UP7A 4NEQA 3FX2A 1E96A 1X7GA 3DAGA 3EHEA 3EZYA 3L40A 4OUDA 1IQ0A 4XOUA 2GVZC 1YJBA 2WJVA 1OGYA 1M1NB 1N9GA 1WNFA 3DZKA 3EGVA 3N8NA 2ZR8A 3PC8C 4FEAA 1P7YA 4I7EA 4JVOA 3VYTB 1C0KA 4PYMA 4B2LA 4CEJA 3RUIA 4JWKA 1EFKA 2UZ1A 5IX8A 5AYVA 5K05A 1TF7A 4MWCA 1BJRE 1L7BA 1Y3AA 3D4PA 2ZRGA 4KWEA 5F5LA 3UPDA 4EP1A 2BMJA 4FI3F 4LRQA 4U63A 4P2GA 1Z34A 4BCCA 4E07A 1WZ2A 1MA0A 3O4JA 5COAA 4G5SA 2X0IA 2YQ4A 4EDHA 2IRWA 4QO8A 1ULZA 3NUQA 2WKWA 1PNOA 1X7DA 2PNFA 1AQYA 3BJEA 1JV2B 3L4EA 3N0TA 1GZ6A 3OCXA 4MIOA 2QK4A 3L1HA 4Z9XA 1FQOA 3NEJA 2XHEA 4BAGA 1JHAA 3W1VA 1BS2A 1CD5A 4CM8A 3ME5A 4Q1BA 3HU3A 4Q15A 2FFBA 2WWFA 3ODPA 2BH9A 2IZ0A 4UE3S 2R3SA 3V4LA 1MPXA 5DNCA 5TGTA 4EJSC 3LHKA 3IA2A 4HX5A 1VRVA 3GW8A 3IQFA 5J2TB 3OY2A 1RZ3A 2D54A 2J45A 1QGYA 1JW9B 3OTIA 5D6NA 1OREA 5BNZA 5L3ZA 2GM9A 4NMXB 4GMFA 1GPYA 3FOWA 3QP9A 4BX9A 3WGMA 3IKVA 4PICA 3FSJX 1VHTA 4I4NA 4Z0NA 3S1SA 4H6VA 3TVDA 4EGCB 3ODGA 3THWB 4E7OA 1PNVA 1QZUA 4LE1A 4UREA 3SYKA 3AM3A 4AU1A 121PA 1WB4A 3WQBA 4E13A 2JAPA 3RC3A 2AG1A 2NUTB 4CQMA 1FFDA 2BFDA 3FIUA 4MJ7A 4WN3A 5JDIA 2OSBA 3IYLW 2RGRA 2MU1A 1VA4A 4N3AA 3UYKA 4E0BA 5EMNA 3K9QO 1LDEA 1BX0A 1UDXA 4UAVA 4EJFA 2QMOA 4ZANA 5A9SA 3MLBA 4LKOA 4X24A 1KO5A 4JUIA 1Y1TA 5BYAA 4TLDA 4DLBA 3KEMA 1A27A 2HMTA 3TZHA 3D02A 3ZE0B 5AJZA 2PGAA 4JLDA 4EQZA 1KOGA 1P1CA 1L5QA 2ZRHA 4OF4A 1PR6A 1YS1X 3KT0A 3VRHA 4DHWA 4CEHA 5C7LO 3N8KA 4QAQA 3RUPA 4QHTA 3FWYA 3GFOA 3AW9A 1KWKA 1DBIA 3BERA 2Q4DA 4DCSA 2QP3A 4DJEC 2OVFA 4OJYA 1T2UA 3BB4A 5AW0A 1A97A 3E15A 2WIAA 4WESB 3PWTA 3B1XA 3C16C 2NV2B 3INRA 5E4JA 1E79D 3QE0A 2XUFA 2XIQA 2AZ4A 5AW2A 1KEPA 2FWMX 4X8LA 5TVGA 5IZ4A 2NPFA 4O3MA 5KOHB 2P6UA 2IHBA 1E8DA 1PW7A 4N39A 2C54A 4F6CA 4E30A 3AY7A 5JCJA 4GLOA 3TSCA 2HJRA 5A7GA 1MB4A 5HQ3B 4D3XA 1RWWA 4L8WB 4RZ3A 4TTRA 4JBGA 3VR6H 3GLIA 4CMKA 1THMA 1ZL2A 1JH9A 1EDZA 1FBTA 5EJ4A 1WDMA 2BGTA 1Y4AE 4KI7A 3DXFA 3N5KA 1HT3A 2ZWMA 1G63A 2RC5A 3AEQB 3EJWA 2VJPA 2CXHA 4DCVA 10MHA 4OKSA 2NYUA 3KD2A 2QORA 4KR0A 3ABRB 3HO1A 2C5GA 3AR7A 3CY6A 3NH9A 4COKA 1JPVA 1V8ZA 1NT4A 3ORQA 1OJLA 4GMDA 1HYBA 5ULLA 1KIAA 4Y1EA 3PX3A 3GZNB 5CT4A 2GSDA 2O59A 2YH2A 3U40A 3WYAA 3D7NA 2B99A 1JIJA 2VATA 1UMDA 1ARZA 1HMPA 2FQ1A 3CTPA 3BT7A 1NPDA 1ZD3A 1UK8A 4HAUA 2HSEA 3SEQA 3HCPA 5CB0A 2J08A 3JYOA 3IEXA 3UPTA 1MIOB 3EEBA 1KQOA 3QI7A 4UTPA 1KR2A 4FDUA 821PA 3UHAA 2J46A 4D2IA 4H35A 1WXEA 2QTFA 5DYNA 3A6JA 2RHGB 3FVQA 3H87A 5I7FA 3JD2A 4GLBA 5FBKA 5CCDA 2JIDA 1J07A 4H3KB 1RXYA 5LBIA 5F9FA 1IZ9A 2ZRJA 3B3FA 4HFMA 3N3AC 1XJCA 4BRWA 3JQBA 3S5UA 3JWIA 1Z0ZA 2HJ9A 2I7CA 4ACAA 5KX5A 4QYXA 1ZGGA 3R5HA 1C81A 1XNRB 4WINA 3WHPA 1XP8A 2WNHA 3U4CA 5K3AA 2Z5GA 3SICE 1R00A 1Q7GA 3QWHA 4HAYA 2A88A 1ZN9A 1E62A 4NCJA 1J9ZA 4Y67A 1HA3A 1KVRA 3DL7A 1XXHE 1A4RA 3HUDA 4HDCA 1U5BB 4LZNA 1W36B 2ZWIA 4M7PA 4EZIA 4JS0A 4LJAA 4CRWB 1JAYA 2L82A 3AF4A 2QVGA 3PQ8A 2AEJA 1X3LA 1C7FA 3PF9A 1B8NA 4HB2A 3KYBA 3ZS8A 2V0CA 2GK6A 3OFKA 4IVQA 2ZYTX 2I6QA 4QUKA 3WLMA 2XTJA 1O8CA 1OI7A 1UJ2A 3B5JA 5IDVA 3SSAA 2ZYAA 3AT1A 3EGIA 3P2JA 2BMEA 4MQBA 4JJ6A 3PE3A 1Q20A 4QXQA 3IKLA 5H80A 2H7VA 1PLKA 3UKJA 3NBUA 2X0JA 5IT5A 5LB2A 1DB3A 4OXNA 1XKLA 2ANBA 3E23A 1UP4A 1NY6A 2PMCA 2QJWA 3GJYA 4O33A 2IYSA 1DUIA 1RCTE 4F72A 1A8HA 1DS6A 4HKTA 4RAOA 1YU6A 1OQAA 3PUYA 4ER0A 5B64A 1SD2A 4TOIA 5B57C 4H7KA 2FGKA 2B0JA 3HU1A 4PC6A 4Q7EA 2YVAA 3ZNPA 4ZCSA 4ZYUA 3WGYA 1L5NA 1LFDB 3L1UA 3SFZA 3FUXA 1JECA 1BKYA 3QV1A 1NLMA 4IDEA 3F0TA 2Q5LA 4G1UC 3MMZA 3V1LA 5KYXB 4QXMA 2WA1A 3FDZB 3I5MA 5DKFA 3HBFA 1NXXA 1OFGA 3TVTA 1NN3A 4LOIA 5A5DA 3AHHA 1GUFA 4KTVE 1MHPA 1JKXA 2CLLB 1EK5A 1R88A 5AJUA 4YRGA 1KP9A 1XRPA 2Z2YA 4Y2XA 1XGKA 5CG2A 1TUEA 2FPIA 1OBFO 3L0BA 3Q0EA 3S81A 2X22A 3DOCA 5CLGA 4GLFA 1KYTA 4MYSA 3IKTA 1AV6A 5BUZA 2AZDA 2ODWA 2HMSA 3I6QA 3PFCA 3NANA 1IUKA 1THTA 2WF6A 3FWPA 3H65A 4EHNA 4X8HA 1OAAA 4M0DA 2VKQA 3SHTA 3T38A 3OJFA 3RU2A 2AKYA 4AULA 1MA3A 2IZ7A 3FFWA 3MERA 2DHEA 1EDOA 1WM1A 3BIFA 3DC2A 3KRTA 4LBYA 2AXNA 2W90A 5FOQA 5C4IA 4M54A 4FYJA 5B3KA 3A70A 1M0TA 1E3EA 4IGIA 4P7BA 3WL3A 3ZX5A 4F9TA 1W73A 4N0PA 5JISA 5CDGA 3AHFA 4N7MA 4ETIA 3DTNA 1QOQB 3I0MA 1HV8A 3NTXA 5CVJA 2AJBA 3VKFA 2HI0A 2YY7A 4LDJA 4GF5A 5L3VA 1FYVA 2AVNA 3IDAA 3R7NA 2VH1A 3KQQA 3WMWA 3BMOA 3NV9A 3RBAA 1YMUA 2OFWA 4QFBA 2QY9A 2ZSIA 4L76A 3IUMA 1T9KA 2HK8A 4V02A 5DCYA 3AVXA 2HIHA 2V0NA 3N0VA 3RS4A 5TX7A 5KBYA 3C8DA 1KAQA 2KSQA 1ZC3A 4I1YA 4H0NA 3C5EA 4X7BA 2JJ1D 4BFYA 1NVEA 3LC0A 2DWPA 3BKXA 1AMNA 1B0PA 3TXYA 2P9EA 1TIPA 4AS1A 1XE3A 1Z0JA 2LDBA 1K75A 3HKEA 4BX8A 5ALWA 3TAUA 2WVGA 3LCJA 1D07A 1N2IA 4YRJA 4ENQA 3D1LA 1E2IA 2ODEA 1C30A 2PCLA 4FR5A 5DPMA 2XCIA 5B3JA 3ZE8A 1E2FA 1TDJA 3E18A 3OE4A 4XGIA 5DLPA 2BDUA 2OHVA 1D9XA 2ARKA 3ZQ6A 2ISCA 3I23A 3QEJA 3OWHA 3AVOA 4XDYA 1R9NA 3MS7A 4B80A 1NFQA 2H48A 4WLVA 2ZUUA 4F4JA 2F00A 1S2IA 2J1LA 2NO0A 2QAGB 3N2GB 3QLJA 4KBYA 5B7NA 5C7OO 5LWHA 1J1ZA 1HZZA 1XNQB 4TKZA 3H3XA 4RCYA 5GP1A 2HRZA 2DFDA 4KN8A 2AEMA 5KQMA 4D97A 1GTZA 2X58A 3QVGB 3EFBA 1WCIA 3FCXA 1PQPA 4HRXA 5EESA 1Z73A 5TRTA 1TM2A 3OCYA 4MV5A 5BXQC 3VNBA 4OIMA 3KETA 1KFEB 1PUJA 2B8TA 3BGIA 2KM1A 1TJPB 3EQZA 4FBMA 5K3CA 5T57A 1JEQB 1NWHA 3LUFA 4INJA 2TRSB 1BDJA 1NVVR 2NZUG 3QYFA 4CLHA 2FEMA 2QVZX 1TYBE 4G5FA 4RL6A 2QPLA 2GTIA 3IOEA 1Q1QA 1U65A 3ZWBA 3I05A 3IILA 4BV8A 4EHIA 2B25A 4MYTA 4CQJA 4URVR 1Q77A 2CJXA 3LL7A 1HEUA 1PEYA 2GR9A 5CURA 3ZHRA 1BN7A 5JLJA 3QWFA 3MSCA 1GUBA 2QMYA 1J1UA 1WMAA 2PWZA 1IJKA 1MQSA 5EP3A 2J9FB 4NCAA 5JNLA 1W0KD 3EGEA 1XA0A 2V9CA 3GNTA 3PGLA 1M6WA 3G8YA 3T7JA 4PZZA 3VO2A 4X1KB 3AY0A 4WKCA 5KVQA 2NU8B 3JD3A 4BQEA 1AGPA 1SBNE 3UJ6A 3VYWA 3F90A 3PHLA 2P2CA 1NP3A 4AKTA 2IE8A 4KG7A 3M3HA 3STYA 3V46A 3WNZA 3IL2A 2OZKA 2VUIB 1U7UA 4TUYF 1SNYA 2VP3A 1MIOA 1CZOA 1KP3A 1M2HA 1LI5A 2R2AA 3DVRX 1ODSA 1GR0A 2X42A 4UM7A 1ZIYA 5EIEA 1EVJA 2WT4A 4NV3A 4QEZA 3TQSA 2CVFA 1E3JA 1V5GA 1JFSA 5FPPA 3KJHA 4CLEA 4WBNA 4OK5A 5F7ZA 2I2AA 3ZHVA 5FTMA 2XGJA 4KZKA 1CDDA 3LZCA 1EG7A 4C5CA 2HRCA 1OT3A 5TS3A 2OYSA 3ZCXA 2UVDA 3LY9A 5IAOA 1I4EB 4J94A 1S02A 3FI9A 1P73A 4PCLA 4BNMA 4JHXA 3NFYA 1ESCA 5SZIA 1VCHA 1UWVA 1RPAA 2I4OA 3K15A 3AZPA 4S04A 1O0SA 4O29A 4DS3A 4YGYA 1ZXXA 2V59A 5DM2A 4RFLA 4KWIA 1EK0A 3EMBA 3HJGA 1O08A 5FKJA 3GLFB 1A2BA 1OZHA 1NJ2A 3TJZA 1EESA 1JR6A 4RC9A 2NU6B 5LIPA 2Z6QA 1U2QA 2YRXA 4KPUB 2DWOA 3GBVA 1C3VA 1OGJA 1GIAA 1NXVA 1P5RA 2WG0A 3F5QA 3GT4A 3TDNA 3IELA 2H7XA 4GLLA 5CVUA 3FMVA 1C9MA 2D0DA 5D2CA 2PKXA 1Z7YA 1U9ZA 4YPFA 3U7EB 4E5PA 2O2JA 1LH0A 1HH4A 3HSYA 4X20B 2XRZA 2Q9UA 1STOA 3NHSA 4LJ4A 1U31A 3H9JA 4JT2A 1U0SY 3G02A 2B0CA 4MKGA 4KUEA 2CBXA 2QGZA 4RD2A 4MARA 3UA4A 2AIRA 3EMKA 1K8XB 2A1TR 2CDRA 5JARA 1Y7LA 5M5BA 2JKYA 1OE0A 3KJNA 4RA9B 3MHPA 1M1NA 1N9GB 4XM1A 1JNYA 5EUCA 1NURA 3S2GA 4DWJA 3UC5A 4C4SA 3LKDA 2ZI9A 1PQWA 3FPFA 3IBGA 3P45A 4MUNA 3PEEA 4URHA 4BQIA 3S5JA 3OD5A 3IQWA 4EAAA 3GLIE 1FFYA 3LH5A 4B6SA 4R2IA 4DJFC 1QRRA 2VBIA 3R6LA 5A1JA 4B8WA 4KRFA 1J2EA 1VIVA 3CLSC 3I2GA 4AP9A 4UNRA 3C2QA 4PX9A 4CR8A 3PUJA 1H2XA 4P7FA 3EGOA 1KVTA 2RBKA 2V5UA 3A6LA 3H11B 4UJ5A 4YWHA 3UT5B 4G9EA 4QJ4A 4RY0A 4X41A 3TIGA 2UUAB 3EHDA 4HDQB 5CW2A 1JRLA 1UDAA 2A9KA 4IOMA 4DLRA 3O73A 3UBMA 1RMYA 5F1YA 1RSZA 3EODA 1Z5VA 3S8MA 1WV1A 4H15A 1V5IA 3G2MA 2I22A 3SDZA 4JH0A 2I6GA 2TYSB 4JXZA 4CV0A 2BBSA 3PQ5A 5CXUA 3LC7O 4FT2A 1EWYA 4ZJUA 4UBIA 4YONB 4R2JA 2XECA 1RJDA 2VF4X 1N4AA 2VDWA 2X76A 4PGHA 3KFVA 2BGUA 1R27A 3U44B 3X44A 2D62A 1PYGA 4LFCB 4E4RA 1MX5A 1ACLA 4ISCA 1Q44A 3KYCA 3O91A 2ZSEA 5ALQA 2XOKD 4EW6A 3ADOA 2OGUA 1W76A 3H5LA 3VHQA 3P0HA 3DTTA 5KWVA 1RQGA 1DBVO 4JR0A 5CNJA 1NN0A 4N7JA 4G41A 1BO6A 3ND8A 4QUEA 2OHJA 4A27A 1K89A 1UKYA 3OLWA 3PNBA 3PPXA 1A5BB 4HN4B 2YBDA 2A59A 2CNKA 5BSMA 2W2QA 3G9QA 3LA6A 4QARA 5FBRB 4CM9A 4I66A 4U7HA 4ZT5A 1T6ZA 4LHSA 4OQZA 2DWQA 3C97A 1TADA 4YCJA 2QQFA 3QUBA 4CKWA 3H9EO 2IPAB 2PLAA 2PM8A 4JIMA 3WYCA 3SQMA 4YBZA 3DBLB 2NUPA 4US0R 3LT2A 1F20A 5C81A 4JVLA 1IOVA 3ZD9A 2ZI3A 2V6FA 1KR5A 1SHUX 4LS3A 4M1OA 3MBKA 2IY9A 1R12A 1KJIA 1YTUA 2G04A 3DZJA 4JR1A 1TUGA 2PKYX 4X00A 1J2YA 2F1KA 3UO8B 5LP6F 1O97D 1PWEA 3AYZB 3K1JA 3W1WA 4H1WA 3IIMA 3KUCA 1W48A 4I2NA 1UIMA 4A7PA 4DZRA 1U5AA 1THGA 2VSNA 1EQAA 1E2PA 2NVUB 3RT9A 2CYBA 3NYWA 2ZJ4A 3WIVA 1BU8A 4PNEA 2SKCA 3WLIA 2XA2A 3FYDA 4B3JA 1SWVA 5BWMA 2H1VA 3AUFA 1JQ5A 1EFVB 2RHCA 1KYXA 2G9RA 2WVHA 2J3HA 3VC3A 1DKMA 2Y71A 2ZB2A 4G0NA 5CLHA 1YB5A 1JWAB 1KKUA 2CNLA 1KZHA 2W4IA 4KJZA 4V24A 3F5DA 3QXHA 3HFSA 1EDEA 1DFGA 3NKVA 3ZHOA 3JAWA 2PSSA 4O4JF 2XNDD 1GKLA 3EH2A 1WOYA 3CKYA 3I4LA 3NB0A 1EM8B 2Q45A 1QHIA 4XEUA 3C3EA 5EKTA 1Z37A 4YQEA 5FH9A 3L79A 4OHOA 1JH8A 3RJ5A 3TZBA 4XW2A 4GFDA 4A10A 1YA4A 4UMVA 5EFOA 1B41A 4AL4A 5KYYA 3DTVD 3Q85A 3LCVB 1GT91 1NIPA 1RXUA 5FPYA 4EIWA 5K03A 5A4KA 3ZDDA 2ZYVX 1T2DA 4H27A 1SQ6A 2XMBA 1FYXA 5CXXA 3S2SA 3W5SA 2UZ0A 4DCCA 4DB2A 3SEAA 3L0YA 5EZ5A 2DPXA 2RGUA 3JQFC 5TQ2A 1RLTA 4XJSA 2F67A 4OMCA 2VFAA 3E9YA 4JB3A 2H3HA 1KZ6A 1Y82A 4A82A 5IYZA 1ADGA 1CQJB 2BDEA 1ENOA 4TVOA 1YJXA 2DGDA 3GQBB 3U3DA 2GA8A 1J25A 2WZDA 2QWXA 2FP3A 3FPJA 4Z4QA 1PK7A 1CCWA 1PR9A 1EFPB 2I3ZA 1BA3A 4IICA 4W5QA 1M33A 3QX3A 2G72A 4IJMA 3ELDA 1WHSB 1X0XA 4JVMA 3K8ZA 3Q9SA 5CNKA 1YFKA 3SXUB 3THRA 4E2YA 3HDGA 1A1VA 3QKIA 3MWDB 2IPOA 1P7WA 2XUDA 3EQ7A 3JR7A 3OIUA 5EIAA 4YR7A 3U4GA 1D1QA 5IK2D 2Q2QA 1QJCA 3CVXA 2MYNA 3THXB 2D00A 2YJNA 1QTQA 2CSXA 3BDIA 2WWGA 1FLDA 1IN8A 1B8OA 2PVPA 2Y4NA 3KL4A 3MRVA 5KYWB 5KQLA 3TTUA 2A1UA 1RC0A 3OJEA 4PZEA 4Q7KA 1PF7E 2RJOA 3OOHA 4AFNA 3MWEB 4QLOA 4LV8B 4OYYA 1E5LA 4CG2A 2QRVA 4LF6B 3K5HA 1UC8A 3B13B 4FZ3A 1U3UA 4RGBA 4H0FA 3R3HA 3ONEA 2D13A 4ANFA 1OPXA 2E85A 1WXGA 2Z56A 3CRVA 5CDSA 3T1OA 3UK6A 3EXFA 3QBEA 2F43A 3QVOA 4IMIB 4LRYA 3B6KA 4II7A 3T7TA 4BZXA 3IMKA 3QKUA 1Y6GA 1Y8RB 3RT7A 4WKOA 4I50B 4CN8A 1DFHA 4FR0A 1FTYA 2X7JA 5GAJA 5JS7A 1OWNA 2PUBA 3DKKA 4YRCA 4D9MA 5B4UA 4B7UA 1WSBA 2QQEA 3UJ8A 3R3UA 5JSFA