5CIWA

Ran gdp y39a mutant monoclinic crystal form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 69
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ciwA00
2G3YA 1TQDA 4LPKA 1NNEA 1ODFA 2JIZA 1NN5A 2VF8A 4HSEA 4OK5A 2IS4A 4PO1A 1OFTA 4E07A 2GZDA 2YZ2A 3LO5A 5FBQB 2XJ9A 3NIBA 3IIMA 3UKDA 3CRW1 1EESA 1T4GA 2BOVA 3ZVNA 1F48A 3I4LA 4WA7A 1IM2A 4FCWA 4BECA 1G3QA 1YR9A 4M21A 5KNBA 2IK8A 4AKIA 5JSZA 2HEIA 4XWKA 3I32A 1D2MA 1OIVA 4EQ6A 2L0XA 2HLDD 2HXYA 5KSZA 2GAOA 2OCYC 2HCBA 1K5DA 1XPUA 1SXJA 3K0CC 4C0BA 2Z0MA 3AVOA 4H1UA 4G01B 2WM9B 3B82A 4D2IA 2JJ2A 4JLKA 4WOPA 1IN5A 4B44A 2XXAB 4BLPA 2O8EB 3VR2A 4PSAA 3B78A 3TAHA 1SULA 2CHVA 4KVAA 1E94E 5EP3A 3TSZA 1Z2CA 4V02A 4D80A 4YMVA 4YDSA 5F9HA 3FHTA 4A8JA 4DRZA 4MRRA 2X2FA 4NBSA 2C96A 1OE0A 2HJGA 3U5ZB 4ZCLA 5SZKB 2PH1A 2BM0A 4TMWA 2AD1A 1XMJA 4HLCA 3K0EA 1YZNA 3PEYA 2R6CA 2A5FA 3SQWA 4XOIA 4DIEA 4BEJA 4YDHB 2XJ4A 3IDQA 3NHBA 3QUSA 5EUMA 3Q5DA 4QJ3A 2OCBA 5JWRA 2EYUA 2ZXUA 4U02A 2JLWA 5L3QA 4P4UA 1X3SA 4NDZA 4HYYA 4LYAA 1VKJA 2CJWA 3OEEA 1LF5A 1KI6B 2QTFA 3MMPA 4N0DA 5KPDA 2R6AA 1AN0A 2AL7A 1U9IA 1Z0IA 2NPIA 1OT3A 4LHYA 4MGIR 3MWKA 4C0SA 3QXXA 4LGMA 1FP6A 1F6BA 4YC7A 4MRNA 1P73A 3E70C 1CR2A 1JQLB 4I1SA 1DO2A 4C0JA 1E1QA 1GRQA 2RAPA 4AG6A 5HR5A 2YJTD 4GOKA 1CS4C 2WWYA 2MSEB 1P72A 1Q12A 1HUQA 1R5NA 1E2FA 2R65A 4BFSA 3LLMA 3BOSA 4TQAA 2EWVA 3LXXA 1DVRA 1L8QA 2H8KA 1Q1ZA 1P2SA 2ZRNA 2GESA 2W6JA 1N6KA 3ZIAD 3CPEA 3SE0A 1IXSB 3CPHA 5GJBA 1UKEA 3MWYW 3K0SA 2X77A 2QAGB 1M6NA 4Q9HA 4QL3A 1PLKA 3LRPA 2CLCX 2NG1A 4LY6A 1Z8FA 2DPXA 2FWRA 5FOVA 5L8VA 4BLQA 2OBNA 4CYMA 5KNCA 1RPZA 3VHXA 1P60A 1R4AA 4ILEA 1Z0JA 5FTMA 4ZKDA 1H8HA 4FWIB 1TEVA 1UADA 5J4LA 1WB9A 1G19A 2AX4A 3U6KA 1G291 1XZPA 2AXNA 4G5SA 5B57C 2J59A 3I92A 2YINC 4MUAA 4PSVA 4Q00A 2GKSA 1W36C 3LBHA 4FCTA 4B75A 2VP0A 1UBFA 2OE2A 2Q9AA 1W5TA 3OF5A 3KKQA 1MH1A 1E9AA 4QJ4A 3AVTA 4TYWA 1D9XA 3DMDA 4NPHA 1HT1E 1UJ2A 5GVRA 2REXB 1G7SA 3SOPA 3VNVA 4ACBA 3SS8A 1X1RA 2IXFA 5JRJA 3VMFA 1Z0KA 1NY6A 2BBSA 2W58A 2QGNA 3ZGXA 5AUNB 5HZKA 4II7A 4LJAA 4ZV4A 4G1UC 1E9EA 5CITA 1XJCA 3GFPA 4ERNA 1G7RA 1KMQA 1NLFA 3CWZA 5DYIA 5EP2A 5FOWA 3EA5A 2ODWA 5J4VA 1XJQA 4JZKA 2ZVPX 2J7KA 4G3XA 4BLRA 1GOTA 3K09C 4K8OA 2ZIAA 3T5DA 5H8WA 4D6PA 2O8DB 3DMNA 5L3SB 1N3BA 3BERA 2QEQA 3CRRA 2JLYA 5FPKA 5KDLA 1XWIA 3H86A 3UG7A 2IYQA 1U0JA 1DAGA 2GVDC 3A8TA 3QENA 1XNJA 5E95A 4N0EA 4QHTA 4CEJA 1KI9A 2ZRDA 4Q7KA 4TQ9A 2HUPA 1ZNWA 4DC9A 2GHIA 2OT3B 2P5TB 2IYYA 3U6BA 1U8YA 1NY5A 4YMUA 3RRZA 1HQCA 4AK9A 3GP8A 3F5FA 2FA9A 3H0KA 4LDJA 2DFKB 5J47A 1XRJA 3CIOA 5E7IA 3GEHA 4LJ5A 1W46A 1P5ZB 1ZC3A 2DY1A 1J8YF 2WTUA 2FMXA 3K0AA 3L8ZA 3P32A 3SJCA 2GEDA 4U7DA 3ZJYA 2G77B 3DL0A 1YKSA 3IEUA 2O5VA 2AFIE 1T6NA 2ECKA 1CR1A 3LXRA 3OE7D 1E0JA 4M1WA 2O8BB 1Z0AA 3BH0A 4Z1MD 2QA5A 3OAAD 3CX8A 2WWHA 1O87A 1EXMA 3JZMA 2VP5A 2JIZD 5DYGA 2TMKA 4FMCB 3TMKA 4A2WA 4KU4A 1OFHA 1G18A 3GJ8A 3PQCA 4JLPA 4QBFA 1HTWA 1NLYA 1E79D 3U3JA 2ZRIA 2RMKA 1E1RD 5A0FA 2QAJA 1E2HA 2FZLA 1CTQA 1X6VA 4TMZA 1JALA 4RSGA 3PUWA 3ETLA 4Q1FA 2H5EA 1PUIA 2GCOA 3LH5A 1E0KA 4KFRA 1HE1C 3QY0A 5EE3A 4YMWA 4GMXA 5FUXA 2DYKA 3GJ6A 1EWQA 1KSJA 4IHQA 1H8ED 4ZPXA 3KDSE 3X1ZA 3K9NA 4CW7A 2FF7A 4HATA 5EE5B 4EJSA 1SXJD 4IXMA 1SQ5A 4EKDA 2G1JA 4BZXA 1NN0A 4AKEA 4KO8A 1H65A 2E87A 5KNDA 1XCGB 2RCNA 3RWMB 1G3RA 4FN5A 4PZZA 1AKYA 1XFAA 2GZAA 3K53A 1T5LA 2DWOA 2WJGA 2FOLA 1L2TA 4M1TA 2F1JA 3L0PA 1R8SA 3T1OA 4MRSA 4WW0A 2XEXA 1FUUA 4LI0A 5DHAA 1E2GA 3RS4A 3HPQA 3W6PA 1HURA 5G3ZA 4KBFA 3SZRA 4AWXA 4HB0A 3LV8A 3NDBB 2WHXA 4IOJA 3Q72A 1HY3A 2CVFA 3U3RA 1ZNZA 3BGWA 1TTTA 3LNCA 2R62A 1ZM3A 1N25A 2FPLA 5JLJA 5CB8A 4A8JC 1DAHA 2VHTA 2JGNA 4TYYA 3AP2A 3IIKA 4NYMR 5AJVB 2G9NA 3LX8A 2GF0A 2BMFA 2HF9A 3U3KA 3U7HB 2NPFA 3G0HA 1P9RA 1ZINA 2WJIA 3O47A 4DIDA 3TW4A 4PXAA 4AG5A 1WE2A 4JVNA 3BFXA 1E2EA 3PUYA 4DLVA 1E1QD 1TF5A 4IOLA 4PR0A 4QGHA 3KJGA 3ICQB 5IHPA 2ZAOA 5D3QA 2C98A 3THOA 1U9IC 2V1XA 2OCAA 1WCV1 1P2VA 4JBXA 1XMIA 2N42A 3K9LA 1E9BA 2BKEA 621PA 1W2GA 1DG3A 1B0UA 2VRWA 5UKDA 5GJVC 2GCNA 4HB4A 4UXJA 5DN6D 2W6JD 5AJWA 4C7OB 4DEXA 1N6OA 1CEEA 2K5UA 3R9WA 2C9OA 4D0NA 3U7EB 2ZM5A 2XTZA 4X8MA 2BJVA 4W5JA 2IS2A 3RC3A 2RH5A 3VKWA 2QI9C 1OW3B 2FFAA 1OIXA 1H8HD 3RVBA 3QKTA 3VR3A 4DLRA 3T1TA 1IN8A 2HV8A 4RY2A 2XX3A 3U60B 3GD7A 4A92A 2R8RA 2WWGA 3HP1A 4HZUB 3TR5A 1G8GA 3EC1A 4Q1BA 4HLDA 2FEOA 2X2EA 4OI4A 3I72A 4IDHA 2EW1A 3PITA 2ZU6A 1G8HA 4ZI2A 5CJ2A 3KQKA 3RSLA 4RFSB 2CE7A 3DPUA 3VU9B 4QOSA 5ANRB 1ESNA 1SVLA 2WOJA 1NF3A 4YXWA 2G0TA 3PFIA 5CLQA 2CL7X 1CF4A 4BFZA 2RGEA 5JEDA 2GJSA 1M34E 4X8OA 1OH7A 3WYFA 1W49A 821PA 3KXKA 4OJQA 1AIPA 4MGKR 3Q7PA 2OM2A 2ZQ5A 2VIIA 3X1XA 3JVUA 1D9ZA 3PG5A 2CNWA 1KJWA 4CGZA 2GXSA 1JB1A 3K8YA 4D81A 3W6OA 4LCBA 1T3HA 4QRHA 2CXXA 5C4GB 3H84A 3QXSA 5EUQB 3OFND 3BB1A 1KI4A 4PANA 2QM7A 1M1YE 2YKGA 1K5GA 2OBLA 4R2HA 1US8A 2A7QA 5B64A 1V5WA 5FTNA 4D0GA 1GL9B 1EX7A 1N5JA 2EYQA 2QG6A 2ZSFA 5C18A 2Z6VA 1E32A 1KSHA 2EQBA 2ORWA 3TQCA 1R10A 1RYFA 4KSCA 2JATA 2BCJQ 1XD9A 2FGJA 1BH2A 1DPFA 4NL4H 4NYMQ 4JJKA 4F91B 8OHMA 2A9KA 1G5PA 1E2MA 5BYKA 1EFUA 5CIWA 1QHHA 1X1SA 3T1QA 4HUQB 3LX5A 3ICEA 4LBYA 3BJIC 1Q1QA 2WAYA 2D7DA 2R9VA 1UDXA 4EAQA 1FP7A 3TUZC 4XWOA 3GLHE 3U4QA 3AVVA 3E5HA 4E5UA 2WVJA 3WYGA 3B2EA 3WYAA 4N1AA 2BEJA 2QP3A 1S8FA 4LYHA 4KODA 1UDWA 2Z4RA 4D4MA 3U44B 3GLIA 1HH4A 1TAGA 1Z6AA 1TU3A 3UG6A 5AWFC 1JXOA 2WWFA 3AV0B 3IKJA 4NONA 1PZNA 5FTJA 1W48A 1PLLA 2HLDA 5HTKA 2JLRA 2A30A 2GXAA 1AQUA 1KO8A 1JPNA 2BHRA 4LRWA 1E9DA 4PC2A 3LW8A 3NHAA 1DADA 3WNCA 2PX0A 5FPSA 1BS1A 1I4LD 4IEEA 5KSYA 4POAA 4Q9IA 2O8CB 1NBME 3PVSA 5EJEA 4US1R 4EUNA 2WWXA 3L0IB 3M0EA 5CIQA 1LW7A 3A58B 1P2UA 4JLMA 1AJEA 1I2MA 2FSGA 3GLGA 4JLOA 2XNDD 4DDTA 1W2HA 3X1DA 3O8BA 4K46A 5FTLA 3A1UA 5HZHA 1FTNA 3BFVA 2JCSA 3M6AA 4EJSC 1KI3A 2BCGY 2FPMA 5M04A 3ZVMA 3AQ4A 4D0LB 1Q20A 4Q48A 2V55B 1E6CA 1T3LA 2F55A 1E96A 2OBMA 4ITRC 4Q4HA 4LX0A 2WJHA 2CEAA 3LQQA 2J45A 4WXPA 3K1JA 3GLFE 3ZQJA 1X8JA 2NQ2C 1G1MA 4M53A 4LOAA 4RD3A 5IK2D 3CKLA 2VP9A 1JAIA 4CEHB 3PEVA 3TQFA 1SKYE 5DNYB 4PPNA 2VA8A 3B1VA 3UWKA 3WMGA 3QF4B 1A2BA 4LZZA 3FGNA 4IVQA 4JLNA 4JKIA 4MYCA 4HAXA 4XJXA 2ZUCA 3WBJA 3I62A 1ZU4A 1VCOA 1MO3A 2OEPA 2GWHA 1A4RA 1W36B 4TYPA 1G21E 4PPFA 2ZE6A 2QZ4A 3A36A 5CM8B 3B9PA 3W9YA 3ASZA 2WWWA 1FMJA 2ZE7A 3ZIAA 3THXA 4B74A 1DARA 5BQ5A 4UNPA 2J41A 1VECA 5FL7D 2GNOA 3QBVA 5FTKA 3FVQA 2BEKA 1R5OA 4FMCF 1GAJA 1HE8B 1G41A 3MAAC 4Y0VA 3DEFA 1T0HB 3TR0A 4B32A 5EXSA 1LS6A 5DIFA 3WHKA 4BLOA 3TJZA 4B48A 2IEZA 1UBEA 4PC7A 2B7CA 1GTVA 1DE0A 5AJZA 2C78A 2VPPA 2ZYWX 4Z54A 1T8TA 3LVRE 3K0FB 4QGAA 2E1RA 4BUJA 4S35A 3R9XA 4TLAA 3TNFA 1E4YA 4KFUA 4PTLA 5EE9A 4AYTA 3BORA 3SDZA 2GJAA 2YWHA 3MJRA 3GCGA 2B7BA 4MH0R 1WBDA 2QBYA 2ZR9A 1G3MA 1II8A 1L4YA 1Q1EA 4C0KA 2BC9A 1R6BX 2W6ID 1AM4D 3ADCA 4GDFA 2ZREA 1XDBA 2XB4A 1ZD9A 1ZVQA 4LPSA 3NXSA 3AH8A 1G5RA 4UXIA 1TQ2A 3EZ7A 4B34A 2QMUA 4FW9A 2G88A 1TF7A 2FG5A 2GF9A 2QT1A 3B9QA 4OQXA 3B13B 1XXHE 1A82A 3AF3A 1GUAA 1Z6TA 4D4LA 5JS7A 2JLZA 3MCAA 1YR7A 1G6HA 2GAAA 5J4KA 4B2PA 1E9RA 3AF4A 1DAKA 2QTHA 4ZDIA 1MOZA 3QKSB 1U90A 1RRGA 3ASYA 3IO5A 4TZ0A 3RS2A 2CBZA 3THWB 2XZPA 1FOEB 3QPUA 2RGNA 3THYB 2IL1A 2Q9BA 5C2JB 4XWAA 4KVGA 3KZ1E 4IJMA 2O0JA 4QG7A 4Q9KA 3NBYC 5KU1A 4B3FX 1JECA 1VTKA 1HEIA 2EFEB 2H1LA 1ZUIA 4M9XA 3SC3A 3DZDA 3EZ9A 3MLEA 4HUTA 4ON9A 3ZVLA 1SKQA 3B6EA 3RSOA 3BD9A 1U8AA 4JVMA 3BBPA 4V0OA 4MRPA 1VMAA 1IQPA 2HCJB 2QSYA 1F2UB 1EFCA 1YR8A 3AP3A 3TH5A 3AVUA 3RLFA 3NBFA 3FFBA 2P6NA 2C99A 2P6RA 4JT2A 4UJ3A 2IYRA 2OO7A 3TIFA 3OE7A 3TLXA 2VYFA 4F4CA 4CEIA 3AVPA 3SJZA 4DT1B 4NZYA 4Z1MA 3OAAA 5LD2C 1BYIA 5K8TA 5JSZB 1KI2A 3WNDA 4ZKEA 2XGJA 4TL8A 1CJTC 2ZAMA 1VIAA 1YRAA 1E79A 1PVOA 3AKYA 4FMBB 4Y0AA 4C3ZA 1E1RA 4DUGD 3EZ2A 4ARZA 1EFRD 4Q4JA 1QHIA 4GI7A 5H70A 4A0FA 4DDWA 1ETUA 2QGZA 4OHWA 4RZ2A 1JEDA 3ZH9B 3Q9LA 1VYUA 3EW9A 1L7VC 1GIAA 3SBDA 1XX6A 2VBCA 1M7GA 1DTSA 3KFVA 4OBEA 5DI3A 1H8EA 5JCZA 3O8RA 3KB2A 1PLJA 2HT6A 2YV5A 1FPMA 1FTSA 4GBMA 1W4BA 4P0TA 2ONJA 3FMPB 4O3MA 3I1FA 4ASUD 3LQRA 3W3AA 1I4DD 3UMFA 4DLSA 3ZZ0A 1C9KA 2YOGA 3MWJA 3SHFA 1AS0A 1CKEA 2BMDA 3LBNA 4IW3B 3VAAA 1FZQA 4W7SA 2CJWB 2RHDA 1E2DA 4PZLA 3T35A 2I4IA 2CCJA 3SU8A 2NOAA 2O8FB 3SNHA 3ZQ6A 3V00A 3R20A 4LBVA 5BN4A 1TMKA 4URWR 4XVQA 2FFQA 1G6OA 2BV3A 3KQNA 3U2QA 1KK1A 3ONWA 1UBCA 3RS0A 1E2NA 1KOFA 4DSTA 4GSYA 4GFDA 4NCHA 4AYWA 1XPOA 1DO0A 3JZAA 5JBQA 4M8NE 3CX7A 4KLNA 2W0MA 4F4JA 4KXFB 3T1VA 3FDIA 3G5UA 3TK1A 3LW7A 4RD0A 2ZRLA 2CVHA 3KJIA 2O8EA 4TYNA 2KBEA 2UZIR 1KI1A 4PC1A 1A7JA 3C5HA 1RRCA 4JLAA 2IWRA 4R7ZA 4QBHA 3GLIE 4DLUA 4KV9A 1YE8A 1RJ9B 3RRNA 5DN6A 4EPTA 2OCPA 3AGQA 4RD6A 4URVR 1R7RA 1W0JD 1XJ0A 3QI2A 3K70D 3CBQA 4QKQA 3IHLA 1OH8A 4M9SA 3GLHB 4C2TA 2Q3FA 4XH9B 2HF8A 1GL7A 1WXQA 1D2EA 4L9SA 4BZPA 3M1IA 2I3BA 2ZEJA 5TB5A 1UEJA 3QKUA 1IY0A 4A6PA 3LA6A 3VKHA 2HXSA 4BLSA 4Q01A 1V43A 4QGGA 3I5XA 4HAUA 4MKGA 1G7TA 3EXAA 4LK2A 2D3WA 1YZQA 1RZ3A 1JI0A 2J0UB 1DBSA 2A2ZA 1U0HC 3TGPA 1JJ7A 1OF1A 4Q47A 4TTQA 1P61B 1TL7C 2B21A 5JWHA 1RW4A 3FHOA 1E99A 4EPWA 2ZJ5A 1F5NA 1P7CA 1YQTA 2WAXA 2CE2X 4V0LA 2ERXA 4BRWA 1OYWA 4TTRA 1OSNA 1FX0B 4IVRA 3FPAA 1WBBA 1YVDA 3NH9A 1VYTA 1QHSA 4PQYA 4V0MA 5CYOA 4BFXA 4C0QC 1XPRA 1NLZA 1W0KD 3FFAA 2YNMA 2JLSA 3WHLA 1KGDA 1OLOA 2PMKA 1E0AA 1S4QA 3VR1A 1NVUQ 2OFWA 3NVAA 4CEJB 5FOTA 4CVNA 4XIGS 4C0HA 4LJYA 1IXZA 3N2EA 5SZIA 3EZ6A 4PHFA 4DJTA 1VHLA 1UM8A 3VKGA 5FOXA 1OIWA 4DBLC 5IT5A 2NO9A 4N3NA 3OFNA 2FFBA 2WPDA 2ODNA 1S9HA 2YWGA 3KKOA 3IBYA 4DLTA 1NIPA 1VPLA 2GILA 4TL9A 1NI3A 4ACAA 3GLFB 2RB4A 1VG1A 5A4JA 3AVXA 4ZIRA 5AK0A 2FPKA 1QZXA 1SKYB 5FR1A 4E09A 3TKLA 2WWIA 3QG5A 4JLVA 1YU9A 4URYR 4L9WA 4WBSA 4BFUA 4DEYA 1A1VA 2Z83A 4ZDJA 2DBYA 2QE7D 4TL6A 1I4TD 3T5GA 4LC1A 2ZSBA 1S1MA 1BIFA 1ZU5A 2VSXA 1LVGA 4EPYA 1IHUA 5FL3A 1DAIA 2AR7A 1EWRA 4OHYA 4A2QA 1F3OA 5AUOB 3WY9A 1KI7A 4TTPA 1JR3E 2KBFA 2VQSA 3CRVA 3EWAA 3PXGA 1GKIA 1OYYA 4P3YA 2IYWA 5FI0B 1RRFA 4GP7A 4IDNA 3GJ4A 3EX7C 2ASEA 3CM0A 3ZYCA 2XTNA 5DGXA 3HU3A 1GFIA 4NCNA 1XD8A 2O8DA 1FFHA 1W5SA 1F2TB 2MMGA 1EX6A 4JL8A 1Z2AA 3N5CA 4EPXA 3CZQA 4QJ5A 1JPJA 1OFIA 4QGFA 5BN5A 1OXSC 2ZJ8A 4EJSB 3P4YA 2ZITA 3KQHA 1XEXB 1ZNYA 1XB2A 4WZBE 2WICA 3EA0A 1G3UA 1UAAA 4PHHA 3IO3A 1JEEA 4V03A 1SHKA 5SZJA 1YHNA 3MG9A 3PUZA 3F3YA 1VCNA 2YYZA 3BWDD 4P4SA 1T0JB 2PX3A 5JHGB 3F0TA 3FYHA 5A5GA 3KKPA 4OHVA 2ZTSA 4A36A 3C8UA 2XNDA 2BBTA 2YVUA 4RD1A 2GK7A 5KO2A 2LKCA 1AZTA 4I1VA 4C30A 5J5CA 2O8BA 2YC2C 3IILA 4A0HA 2CCKA 1SXJC 2IHBA 4PAOA 4WXRA 2OLJA 1XXHB 4O0MA 4TMVA 4GZMA 4MGZR 2FU5C 1XCPA 1UEIA 4MKHA 4B76A 2IYLD 1KO5A 1RC8A 4TYQA 2OAP1 4TT3D 4D82A 3RS3A 4MUBA 1NMYA 1KIMA 4DSNA 1XU4A 4JLJA 2J0SA 1FQKA 4BGDA 5TV2A 2JASA 2P65A 4M1SA 1ZD8A 2GEUA 2G83A 2B92A 4JMPA 5IK2A 4G5OA 1ZIOA 2J0QA 4DVGA 1UKYA 4MYUA 2GCPA 4UNSA 1JXMA 2F6RA 1E2PA 5AJYA 1U8ZA 4DLWA 2V7QD 3DO6A 4MDFA 3HJNA 2DFTA 2ZRMA 3QJYA 5L3RA 3ADDA 5EZ6B 3PV0A 2QTVB 1WF3A 4IOMA 3D3QA 2ZJOA 3AVYA 2J46A 3OZXA 3L2OB 4NYJR 2XOKD 2IS1A 3AB3A 2C2HA 1C1YA 2REOA 1QHXA 2CL6X 2NZ8A 5JZVA 1E2LA 2AD5A 3ZDQA 4KYUA 5AUPB 4KI0A 1J8MF 3BS4A 4IOKA 3NTUA 3ADBA 1FW6A 2WIAA 1XTSA 3FKQA 3QIAA 5FL7A 5DE3A 4L8GA 5GJWC 2HYIC 5GJCA 4B3DA 2WJYA 3I61A 2CDNA 1KZ7B 2PZGA 4PC3A 4HB3A 3WRYC 1CJVC 3NKVA 1SXJE 3IPYA 3RS7A 3R7WB 2IA5A 1VDZA 1DAMA 4TWZA 1AGPA 4F92B 5SZHB 4EPVA 3GFOA 1PV4A 5F9FA 2P6UA 2F1RA 3WBKA 5E4FA 1NRJB 5G53C 4B33A 2QORA 1GZSA 1UFQA 2NZJA 2C77A 1CR0A 4Q1AA 1WMSA 1OH5A 3EARA 4NE2A 2GA8A 3QPWA 2OFOA 1E3MA 4BFYA 4RFVA 3VQTA 2W6IA 4HAWA 2DWQA 3SEAA 4LHZA 1RYHA 1NKSA 4XSGA 4Z8XA 1XTQA 2KI5A 2P67A 2QMEA 3A1TA 1NG9A 2GRJA 1JR6A 4PAMA 2N46A 1TPZA 2QP4A 1QRAA 1N6LA 3PEWA 4JYCA 4QHYA 2H57A 5AUQA 3UWOA 2ZR7A 4C7OA 1NSFA 4EFNA 1GL6A 2JJ8A 1MR3F 2G1KA 3WP1B 3PUVA 2C9YA 4KSBA 5EE0A 3SYNA 4LUCA 5KDDA 4Q03A 4RCYA 1UPTA 1TEXA 1ZM9A 3U61B 3FHCB 1ZUHA 3BC1A 3RDPA 5EP1A 5LD2B 1YR6A 4JYBA 3C41J 2HJVA 1IY1A 2JJ1D 1DG1G 3HU1A 1ZNXA 2ANCA 2WPDD 4HZUA 4XTRA 5J4YA 1A5TA 3N2IA 3U3MA 1QHHB 2ORVA 3R8CA 4A15A 1RIFA 1SVKA 2H7VA 4RFSA 3MJHA 3VU9A 2ZYVX 4PPGA 3QKRB 5FBLB 1KO7A 2VTKA 4ESHA 2NO0A 1AK2A 2CHQA 1NBMD 2GTPA 1FNMA 5H1YA 2P0EA 4PC6A 3WXMA 1SVWA 1YZUA 2FEMA 5JECA 3H4MA 1MV5A 1J90A 3W6NA 2YWEA 3CF0A 3GLIB 3RRYA 3P1JA 1QHGA 5P21A 1B23P 3DM9B 3FB4A 3A1WA 4CIDA 2GBLA 4NYJQ 2ZI7A 4O2LA 3TE6A 3IBGA 721PA 3IUYA 1P62B 3LBIA 1OV4A 1PJRA 1TQ6A 3F8TA 5DSZA 3PJRA 3LAWA 2VL7A 2NO7A 1W4AA 1P3JA 4DUGA 3PENA 1EFRA 1SZPA 1ZW6A 3SQXA 2F9LA 2OLKA 3EG5A 1P4SA 2B6HA 2ZJYA 4DDUA 2WKPA 1AS3A 1ZM7A 3MGCA 3RAPR 2KJQA 3RWOA 1G9XA 2DFNA 1AGRA 5BWMA 1E98A 4ZCMA 2FE4A 1J2JA 1W1WA 2JDID 3HDTA 1EGAA 3NEYA 1D2NA 4QBIA 3S1AB 4Q9JA 4TLBA 1AQYA 3BB4A 1KDRA 1R8QA 2IXGA 1L4UA 2BDTA 3CH5A 3NDPA 4ASUA 2OFXA 4JT4A 4BQSA 2V6IA 4RKFA 3FWYA 1AS2A 3DHWC 1NP6A 2ZR0A 4Q4HB 3QSYA 4XSHA 1MO5A 1Z6XA 121PA 5IF9A 4HDCA 1ZAKA 2PEYA 4TMXA 3AP1A 2PLRA 3CONA 1N5LA 2P5SA 1IONA 4OJKA 1P75A 2ZI9A 4TMKA 4M1YA 2QN6A 3A1VA 2JLXA 1Z08A 4H1VA 4BZQA 3U44A 3IQWA 5DISB 3KTAB 4CT5A 4E03A 4GOXA 4OI0A 3SFZA 1OB2A 2Z4SA 2NTYC 3BFKA 1G8YA 3KJHA 1ZMXA 4KYIB 1N6NA 4G5GA 4M4SA 5FOSA 4HAZA 2SHKA 2V4ZA 1T8UA 5JS8A 4GPTA 1XMVA 2A5DA 2MSCB 2GXUA 4O25A 4OI2A 4Q18A 3MRSA 2J7PA 2GJ9A 2WKRA 4LV8B 5BN3A 2OAQ1 3MWLA 4TLDA 2B8TA 2J3EA 3BK7A 3O8CA 1IBRA 4DKXA 1TUEA 2O8CA 1G4UR 1MKYA 1S9DA 3EASA 2Q0HA 3KL4A 2QPOA 2V6JA 3SFVA 3AM1A 1HA3A 2ZE5A 3BH6A 4FCVA 1E2QA 2GDJA 4JVSB 4QXAA 1MABB 4PQRA 4YONB 1FNNA 2GVZC 4PHTA 4ZDKA 1LNZA 1Q1BA 1COWD 4HEJA 1W0JA 2IT1A 4BEBA 2PBRA 4GOJA 2BIFA 4V0KA 5JHHB 3AUXA 3CPJB 2V1UA 3FTQA 5JFGA 4MYHA 3OIWA 2ZI6A 4JSYA 1D6JA 1G64A 3QVVA 2IYTA 1OXTA 3IGFA 1HYQA 1QVAA 1UF9A 5DHFA 1ZRHA 1ESMA 5B30A 4AI6A 4HLUA 2EVWX 3SN6A 1DAFA 2QBYB 4CEHA 2BVNA 1KSGA 4NP6A 2O0KA 5FUWA 3FE2A 4CDGA 4MKFA 2LCFA 4I81A 3WP0A 1GSIA 3TW8B 2W2VA 1LF0A 2DR3A 1RVDA 2DB3A 4GT1A 2VO1A 2GJKA 4F7WA 5HPYB 4Q19A 1T9HA 3EC2A 4CT4B 4QM6A 4UKDA 1KO1A 1OXVA 4DCTA 4JL5A 1LV7A 1Z0FA 3U7FB 2WIBA 1GILA 1Z6YA 1F60A 1G20E 1G3IA 2QMOA 1OHHD 2BM1A 2PCJA 4OYHA 1NVWQ 1BKDR 1OJLA 4PZYA 2ZYTX 3EPKA 5IDVA 1VYVA 3T61A 4JLDA 4A6XA 4A2PA 1W0KA 4I4LA 1KAGA 3A37A 4DLYA 4QFMA 3FMOB 5G41A 3EIEA 5KTYA 2FFHA 3R8FA 5JI2E 4DLZA 4DB4A 3I3SR 2N1BA 3RYTC 3RABA 1HV8A 3P26A 2QMHA 2XB2A 3GJ0A 2IC5A 3V4RA 2F3TA 3DOEA 3GJ3A 5C46F 1SVSA 2A5YB 4MGYR 5LDDC 4Q7JB 5B2ZA 4US2R 1MO4A 3NEJA 1QBKC 1LTQA 3A4MA 3K0FA 1Q3TA 3H2YA 1XD2B 1J7KA 3AVWA 1C4OA 5TVKA 2XAUA 4D4KA 2CL0X 3NBZC 3PEUA 4AKHA 4NU0A 1KJZA 1IY2A 3VX4A 1KMHA 4QC2A 2IW3A 4G0NA 2QROA 1MRNA 2ZI3A 5FOUA 4QHSA 5D3MB 2QE7A 3SJAA 5EXPA 5FPHA 3RS5A 5K8LA 1KDPA 4V0NA 1NN1A 1Z07A 4W5WA 4O2RA 2PT5A 2GETA 5FUYA 3A6PC 2OSBA 4K81B 1DOAA 2XITA 1M7HA 1E9CA 1G16A 4ARZB 4WVFA 3OEHD 5E7MA 2KWIA 1IJEA 2AXPA 2ZRFA 3KFXA 1XTIA 3LLUA 2WSSD 3BXZA 5F2EA 4JLBA 1VIYA 4D26A 2IYXA 3TAUA 3KQUA 5HCNA 4EQ6B 3VR5A 3REGA 1NSTA 4TLCA 3EPLA 3QKSA 1U94A 3K9GA 3EIQA 4H9GA 4UNNA 2B8WA 2KSQA 1SXJB 2PCLA 3CR8A 3Q3JB 4RVCA 5JMTA 1ZUNB 3FKSD 1IOZA 2LKDA 3THYA 4BFTA 5CDFA 3U3OA 1S96A 2D74A 1JNYA 2QM8A 4Q7LA 4IFEA 3CB4A 4OQFA 1XEFA 2QP9X 3I8SA 1R0ZA 1N0UA 4A8JB 1YZLA 3CNOA 3TUJC 3DDCA 2JEOA 3LY5A 5G3YA 4OI1A 1YZGA 3RANA 2FZ4A 5GVSA 3BB3A 4I99A 1F2UA 2RGGA 4ESVA 4Z51A 1Q0UA 2OXCA 2Q21A 5FH9A 5TARA 4NHOA 2O0HA 2IX3A 2F43A 2IYVA 4YQFA 4B6EA 4BRUA 4B3CA 4A82A 1W4RA 4P33A 4DT1A 3PIRA 2H17A 3QXHA 4Q4AA 2D4HA 5L3QB 3ZD6A 2FDCA 2XTMA 3R9IA 3DVLA 4XVRA 3CF6R 4S2EA 2VEDA 1RE0A 2WMOB 1JQJC 4TT3A 3V9PA 4HI0E 3L8YA 4EPRA 5K8IA 4WIAA 1KY3A 4LHXA 2PL3A 2QRNA 4MYTA 1ELOA 1E9FA 4FMDB 3KUCA 1Y63A 1GDDA 1R5BA 1ZCBA 3CH4B 3QBTA 1E9SA 3UANA 4P4TA 1P9NA 3QG1A 2F9MA 1GVNB 2V7QA 4ZDWA 3CRMA 2IYUA 4EFLA 2ZI5A 2AKAB 1KHTA 4PHGA 3DOFA 4UQOA 2ZRGA 5J40A 3UXMA 1G8FA 2Q6TA 2C04A 3HWSA 2J7PD 4HAVA 5E3HA 3KQLA 4PX9A 5H68A 2AWNA 2Z5FA 2AN9A 2XOKA 1BYUA 2QL6A 1Q57A 3SYLA 2D06A 1Z3IX 1SHZA 4B43A 2XXAA 1ZM2A 2Q9CA 3L0SA 4DCSA 2VLIA 4IEIA 4J0QA 4EDHA 2HDNB 4DWJA 1X8KA 4TMTA 3TSWA 3C16C 3ZZUA 2Q3MA 2YOFA 1KTVA 1Z63A 4YMSA 1N2CE 4M9ZA 1SVMA 2V54A 2R6FA 2O8FA 4B3BA 1OKKD 1Z28A 2FN4A 2IXEA 5DO9A 2OHFA 4R71A 1OXUA 3LFUA 4RD2A 2VHUA 4RKEA 4PO8A 1OB5A 4M9QA 5CM9C 1Q44A 1M2OB 1TQ4A 3J81k 2ZI4A 2QUZA 3QF7A 1I2DA 4C0LA 1FQJA 2FH5B 5HKKA 1KI6A 1DAEA 1G17A 4IDOA 2IYSA 3GFTA 4Q1CA 1SGWA 5IRCD 4NYIR 4IVPA 3K70C 1LFDB 1KZGB 3DM5A 1BMFD 3AF0A 3GLGE 4D4JA 3AKDA 4HAYA 4FWTA 1PUJA 2FJUA 3GJ5A 3X2SA 2W0SA 1FMLA 3H1TA 2NO1A 4HLUC 3QPVA 1EFHA 4M1KA 3BH7A 1M8PA 3P4XA 4HZIA 4Q02A 3CZPA 1Z83A 1W44A 3V4FA 1W36D 2BBOA 1II0A 3GMTA 1WA5A 2IEYA 1T91A 5FPYA 4ABYA 4DCVA 4CF7A 1RJ9A 2FSHA 4Q4LA 4LBZA 3SBEA 2HT1A 4HDOB 1JR3D 1Z6GA 1N6HA 3NC0C 2H16A 3IEVA 3C15C 1DELA 2QAGA 3UIEA 2X19A 4L4UA 1GM5A 4BPBA 4MDEA 1GRRA 2ZSDA 3GLHA 1U98A 4ZIRB 4OQMA 2VHQA 3GQBA 4XD7D 4GL2A 3TVDA 2P2LA 4DSOA 3I5YA 4DHEA 3LD9A 1HT2E 3CUEF 4Q9LA 4JBYA 4UJ5A 4JIMA 4ZI3A 3KXIA 4KHZA 1CJKC 1WQ1R 2EFGA 2UZ3A 1S2MA 2MSDB 5D3MA 1QDEA 1NKTA 2JJ1A 4B6FA 4LJ4A 4IFBA 4OL0A 4BFVA 4LYJA 2I1QA 2QPAA 2F1HA 2PT7A 4BASA 1NN3A 2J0UA 2XSZD 1J99A 1UKZA 3GJXC 2C9CA 4B2IA 3P27A 1Z5ZA 1ONBA 4X8HA 3K0AB 1U2RA 2VHJA 3BAFA 2PZFA 4QNMA 1M7BA 4AYXA 1NBMA 1N0VC 1KO4A 1AZSC 1FX0A 1MRSA 1P2TA 1KJYA 1KDTA 2FNAA 3W8NA 1KKMA 1UBGA 2FX3A 1NVVR 3D7MA 4GMDA 4DZZA 2DCUA 2ZETA 1TUIA 2ANBA 4GRAA 2RGNC 3IPXA 3AGPA 3I73A 1R0XA 4OHXA 2W83A 4NCIA 1KK2A 1VG8A 1E2JA 2BMJA 3B7GA 5ELXA 3B1YA 1M74A 2R44A 2ZRBA 2ZRHA 2GCOB 4LHVA 5L3SA 1LY1A 1CXZA 4G5RA 3VTKA 3A1SA 4QNRA 1GWNA 4WZAE 2IUSA 5G40A 5CYPA 4C9BA 3T15A 3GLFA 1G8PA 1CRPA 1BO6A 3QEOA 4TSFD 4XTCS 2GK6A 2ERYA 4P4SB 1KI8A 2J9RA 1DS6A 2A3RA 2ZUDA 4LJ8A 3BE4A 2PZEA 3CNLA 4OK3A 4B3XA 1ZC4A 2GJ8A 2JDIA 3SYKA 1QG4A 3BIFA 2O52A 3UPUA 2P3SA 3VHLB 2JLVA 1KKLA 1S3GA 1N6RA 1E0SA 2ODBA 5LB2A 5JI3E 1NL3A 4PFSA 3PR1A 1Z06A 2V9PA 1ANKA 1KSFX 2YHSA 3VX3A 2XZLA 3A4NA 4NCKA 2KB0A 2RGAA 3Q7QA 4PPQA 5KHOC 4LJ7A 1LB1B 4BE7B 4NYIQ 4QBGB 4F93B 3VFDA 2CLDX 1GRNA 1KK3A 1U81A 1XTJA 1ZCAA 2ZANA 2H92A 4IDPA 2C5LA 2ZROA 4PO9A 1EFTA 2Q3HA 2ZU0C 2IWHA 3REFA 1F2TA 2ATXA 2ZS8A 4UNQA 2Y8EA 1VHTA 2UKDA 2ZE8A 2GEVA 3KKNA 2ORIA 4HDQB 4G5QA 1U99A 1ZP6A 1YJ5A 2WV9A 1YRBA 3FMIA 3TRFA 5B58C 5F3WB 4GP6A 4YLGA 1LS1A 2AFHE 2IF0A 4LV5B 3QVUA 1RRPA 1Z29A 3KJEA 4LBWA 1T5IA 1XEXA 3QQ5A 4RZ3A 3JVVA 5LB4A 2JJ2D 2RGBA 4M1OA 3P20A 2H18A 3UMRA 3AKCA 2RKOA 3CF2A 4I1OA 1WDTA 3VNUA 1W7AA 4E22A 4RJLA 4TL7A 4ZCIA 1KY2A 2PLFA 3ZS8A 1CJUC 4B73A 4CRWB 1NMXA 2DWPA 3SHWA 1JBKA 1EK0A 3EZFA 4JKYA 4Q1DA 5HE9A 2I1VB 3LDAA 1E69A 3OESA 3GEIA 4PQFA 3HYTA 4HB2A 1ZIPA 3N70A 2RGDA 5FBRB 4WZ6A 5JWOA 3TVTA 2OXRA 3PCRB 3M4YA 2VSFA 4EFMA 1GITA 4JS0A 4LJ6A 4CZ2A 1R2QA 1COWA 2AK2A 1XTRA 3OEED 5CDFE 1XXHA 4DB2A 2ZYUX 3AEZA 2D2EA 3QOFA 5LBIA 4B2LA 1RFLA 3CNNA 2IUTA 1NVVQ 3EAQA 1Y3AA 2MMCA 5DLQC 5BW8A 1GG2A 4OKSA 5FR2A 3ZVRA 4DDVA 2CK3A 3UMSA 5JJLA 2F3RA 4KJZA 5HKKD 1SVOA 1XEWY 5E7JA 3CO5A 4AKGA 4X8LA 2ZJZA 2OESA 4C0AC 5HE8A 5AR1A 3U7GA 1ZJ6A 3AVQA 1CRQA 3O8DA 4TQUS 4MITA 3NH6A 3UATA 2ZRPA 1W47A 5FUVA 1OHHA 4DSUA 3RHFA 4LSGA 6Q21A 4Q21A 2A5GA 2C8VA 2W00A 3OIVA 3B85A 1OXXK 3B8HA 4OQLA 3D8BA 4PSKA 2PJZA 2R6DA 1MT0A 1IN4A 4A0RA 1E2IA 3ND8A 2CLSA 1U0LA 3GEEA 2PJRA 4AY2A 4EIWA 1GNRA 2IYZA 4RCZA 521PA 2DHRA 1OPXA 5TMPA 2VH5R 1SVIA 3B5JA 1IXRC 1IAQA 2WMNB 4LV6A 4HLQB 1P9WA 1Q22A 1YZTA 2EFHB 2QQ0A 5FFMA 4FI3C 5FBVB 2ZSEA 3PUXA 1KDOA 3RNLA 1US8B 3R7WA 5L3VA 2CMKA 2J1LA 4M1MA 2BJWA 1NVXQ 4DXAA 4Q66C 5C4MA 4FMDF 3C7KA 2EFDB 1ZD1A 2BMEA 1AKEA 2AHOA 4TN1A 3QNUA 1AA9A 2QAGC 3ADKA 4I1UA 3NWJA 4OQNA 1FL9A 3W3ZB 3EPJA 4MQBA 3AUYA 2VP2A 1XF9A 2QNRA 2F7SA 4YMTA 1QG2A 2J5XA 2WZQA 4PAQA 5TY0A 2FSFA 2ZJ2A 2VSOA 1XCMA 4IXNA 3SR0A 4C4PA 5AJXA 2V3CC 2VP6A 2X1VA 3RRMA 2NO6A 1GNPA 4BLTA 3OIYA 4DCUA 2FSIA 3CW2A 4R98A 3VR4A 5HCIA 3U4QB 2YC4C 3CLVA 4DLXA 4JL6A 3FOZA 3DKVA 1KAOA 4U00A 3TUIC 1NG1A 4RD4A 3OEHA 4B3GA 4UXHA 1O3YA 2R6GA 5EQTA 2BBWA 2WSSA 5J4HA 1E2KA 4Z8YA 4P31A 3KB1A 3LVQE 2DFLA 4IDQA 3SI7A 5FBWB 2WSMA 4RZUA 4RZXA 4LJ9A 4M22A 5JCPA 4Q7MB 5KYKA 2X8AA 3GJ7A 4NMMA 3ZZTA 3FKSA 1CR4A 5DI9A 1N5KA 4GZLA 2OUKA 1GP2A 2EU8A 4V0ME 1XMSA 2G0NA 1CLUA 2OILA 3ZLJA 3GLGB 3QKRA 2ZS9A 4JBWA 1G7CA 4FD2A 4FIDA 2C95A 4W9MC 1K8RA 5KDOA 4Q5IA 1NMZA 2ZSAA 1P6XA 1S1CA 4LWZA 3B1ZA 4DCNA 5K8UA 2GXQA 4WAUA 3K0CA 2V8OA 3HYRA 1XBTA 3A4LA 3IIJA 4HUQA 2E9SA 4F4IA 3CX6A 4IRUB 2ZPTX 1KYIA 4D25A 1UKVY 4AD8A 1HQYE 1ZM4A 3ZS9A 4LYFA 2AK3A 2ZRKA 3RC8A 2ZS7A 1R0WA 2FV8A 5KSOA 1QHYA 1XP8A 4B35A 1D5CA 4KFTA 2C03A 1G5TA 1R0YA 4W5HA 2G6BA 3MSXA 4A9AA 5JRZA 1N6PA 1Z0DA 2RHMA 2QENA 4KAXA 2RGCA 2ZUBA 5BYJA 3CWQA 3MD0A 2ZJBA 3KUDA 1WP9A 3CRQA 4GNKA 1Q21A 2YWFA 3E1SA 4MA4A 2VF7A 5CK4A 4UNRA 1X8LA 5EE1A 4Q1EA 1N6IA 4KCGA 4L16A 3FMFA 4F38A 4LC0A 3S1AA 5KUTA 3EWSA 2W2XA 2OV2A 3THXB 3E2IA 5CJPA 4A0GA 4L15A 3KKMA 4TZ6A 3WMFA 1FUKA 3K70B 3W5JA 3W8RA 2YOHA 3QXJA 1N5IA 2ATVA 5CLLA 3VR6A 2NGRA 3B1XA 1CJMA 1KNQA 2NMVA 4KFSA 1CIPA 5KSPA 3ZD7A 4KLZA 4ZO4A 1OKKA 3WNBA 2A5JA 3L0OA 1D8TA 1GKUB 2XNSA 5BXQC 5EXTA 4NCJA 5C1BA 2ODEA 4M2LA 3KX2A 1TNDA 1NJFA 1J70A 3KTAA 3EIHA 3D6TB 1NJGA 221PA 421PA 2WJVA 4URXR 1NIJA 4BWYA 5DH9A 2J87A 2R2AA 3K9HA 2FGKA 3GPLA 5FI1B 1II8B 2JLUA 1CULC 3MUFA 3EPHA 1VCIA 2CK3D 1IN6A 2IF2A 3X1WA 5JEEA 1QF9A 4M0LA 4NKRA 1KK0A 1BMFA 3NG1A 4KITB 3QF4A 2ZRJA 5EZ5A 1GKYA 1TADA 4AURA 5CB6A 2PEZA 1TF2A 1S3SA 4FXPA 1K6MA 3G82C 3SJBA 2QQEA 4B47A 3IHWA 2ZRCA 3L82B 1CP2A 2IBMA 2D2FA 1A2KC 5EP4A 3NBXX 3QE0A 2QT0A 5CK5A 3T12A 1MABA 3Q5EA 1E4VA 1Z47A 4R9UC 4R2IA 2JA1A 3W90A 3HR7A 2WBLC 3HR8A 3Q85A 4A1FA 2IHYA 1JR3A 2HYDA 5KOYA 1KNXA 2BWJA 4URUR 3WRXC 3IQXA 1QVRA 2OG2A 1XTKA 4NTZA 4MKIA 5FPTA 4XD7A 4QM7A 3AF2A 2QY9A 3D31A 4C2UA 3W5IA 3QXCA 3C14C 2QRZA 2JAQA 2CCGA 2OZEA 1IJFA 2LWIA 2QU8A 3OHMA 5JJIA 1X86B 1T3SA 3DKPA 3Q8XB 1KMHB 1RKBA 2D62A 3DZ8A 2ZVQX 2QSZA 1JAHA 3AF1A 4OK6A 1CU1A 2UVQA 2EFCB 3K09A 4US0R 5EXXA 3T34A 2XSZA 3HU2A 4YXWD 4NH0A 3W34A 1W4CA 2IS6A 1S0UA 2IUUA 1QHNA 1ZYUA 1XEWX 5KPJA 1YZKA 1BOFA 2XZOA 3KXLA 4JSTA 1JJVA 2ZRAA 2REBA 3ECCA 3X1YA 3B1WA 5F98A 4CEIB 1WRBA 2JLQA 2KE5A 4URZR 4AIIA 2CNWD 1MO6A 1Q3HA 3TBKA 3UK6A 2QPTA 4U5XA 1XZQA 2W2TA 1VG0B 4P32A 1G4AE 5JJKA 1VCMA 2GZHA 2CHGA 1EG7A 4A4DA 2BKUA 3AKEA 4KBGA 3TSOA 1OFUX 4OHZA 3BRWD 2EWWA 3T06B 1TU4A 1OH6A 2ONKA 4TLEA 3C4JA 3OIUA 3I8XA 3QEJA 2ZJAA 2A78A 4B71A 4JVLA 2J0VA 4Q4JB 1ZBDA 1GNQA 2AWOA 1IN7A 1II9A 1Z22A 2VP4A 3ND9A 4L5BA 2WOOA 2WJJA 1N0WA 2VHCA 2WKQA 4MRVA 1DEKA 3NC1C 1TX4B 3L43A 5DI3B 4TSFA 5TXGA 3WMEA 3THWA 1XD2A 5GADl 2F1IA 2RGXA 2Z43A 2D7CA 1CBUA 3MFYA 5TDHA 3HPRA 4JJZA 4BFWA 3C5CA 2PMDA 4AC9A 4IKEA 4XVUA 3CR7A 2GBLC 1VG9B 2F43B 3LWNA 4FINA 2AKYA 5LPNA 2NIPA 4Q4AB 4LHWA 3B60A
chains in the Genus database with same CATH superfamily
2G3YA 5D01A 1I1OA 1PT6A 1W1UA 4I5GA 4E6PA 4L57A 1KFEB 4INAA 4OK5A 5I8WA 2V9CA 1TEHA 1GT6A 4WECA 3JYNA 2QYHA 2YXEA 5BN4B 4Z4HA 4G84A 3MWFA 1QRTA 5DBOA 2DF8A 2RK6A 5CDYA 4X65B 5EKUA 1Y89A 4DIBA 4C4AA 1KH3A 2DTEA 4FCWA 1OB2A 3I2HA 4PLWA 1R0RE 4NU5A 5JSZA 2HEIA 5I4KA 2X8JB 3C3AA 3LCUA 5CNMA 4I9UA 1OIVA 3R5SA 2L0XA 3IUNA 2HLDD 2I62A 3QUCA 3AESB 2GAOA 1Q7CA 2HCBA 1G2OA 2HA7A 3AR6A 1XPUA 5JXHA 1SXJA 3K0CC 2Z0MA 4HHEA 4G01B 3MUOA 4OXNA 3CS3A 1Z4JA 3W79A 1Q74A 3VPDA 2JJ2A 4JLKA 1IN5A 1U0GA 2O8EB 3UHPA 1PDWA 4TSRA 1J5EB 1PR1A 1TM3E 4JI0B 1IY8A 2OC9A 1H22A 5HQ3B 3TAHA 1VE3A 4LNUB 5IKEA 1MB9A 1SULA 2OK8A 4KVAA 4ALIA 2GYWA 5DGCA 1M34B 3HSYA 3OT4A 4DANA 3NC4A 2B1JA 2OQIA 3R3VA 4ZJPA 2ZUEA 3A28A 4NBSA 2VAXA 4GYWA 4EYEA 1IB6A 1OE0A 3IEPA 3FROA 2G1AA 1TZCA 1ZHHA 1WW2A 2AD1A 4TMWA 3WNVA 3L8GA 3DBOB 4S24A 3IL2A 5JC1A 3K0EA 2FWNA 5E8JA 1K5HA 2R6CA 1SB9A 3JW8A 3C3XA 2C31A 1ZK2A 3O75A 2YIDA 1LWNA 3KT6A 5T4HA 2VQFB 5ETJA 5CHYA 3EPLA 2ZXUA 4B5LA 1J9EA 4JEIA 5L3QA 2R4TA 2ZBDA 7ABPA 4P4UA 4UM9D 4E3ZA 1Y8CA 4BP8A 2HU7A 2XBUA 2CJWA 4LYAA 3UJDA 3UXHA 1LF5A 2PO5A 4EFKA 5K3OA 2Z08A 3Q0TA 4GKAA 1K5PA 1L7BA 2R6AA 1AC5A 1XCOA 3DE3X 1Z0IA 4H77A 4LHYA 1OLSB 4N5NA 3FMGA 4NX2A 3MWKA 3R2JA 2HBZA 3HJTA 4OXQA 4C6TA 4YC7A 2NADA 1P73A 3RASA 1CR2A 4YRKA 3CC8A 1X7ZA 1EUQA 3GFSA 1RI1A 1JVNA 1T1IA 1P3DA 2VQ3A 2YJTD 3FYSA 1T1EA 1TTHA 3F8SA 2FPGA 2QOEA 1RKUA 1Q12A 1VE6A 3KSZO 1HUQA 1Y0BA 3VXKA 1SMKA 3E9QA 1U7OA 3QX7A 3ZIUA 4I08A 2P68A 5A7HA 3SQNA 2VOJA 1EU1A 1Q1ZA 5F7ZA 1P2SA 1QM5A 5DM1A 1E1KA 2I03A 3H42B 4XLTA 2YMLA 1HSOA 1O94C 4YB8A 2NP7A 1GGNA 5GWXA 1ZCZA 1UKEA 4WKPA 2X77A 3ND7A 5JVDB 1E1YA 3B48A 2CV1A 3HO1A 4QL3A 5AHOA 5JSUA 2NU9A 3LY8A 3M3HA 3LCVB 1YQXA 5TQ0B 4B4KA 4BLQA 3QUBA 4CYMA 1JI3A 3MWDA 1RPZA 4ILEA 1JKIA 3JV7A 2Q8PA 1J2UA 1PJZA 5HNKA 4FWIB 2GMWA 4R54A 3T99A 1A9TA 2QUJA 4CM1A 2G28A 4M7PA 1KQ3A 4UDNA 3NWBA 1CE8B 4P3PA 4W1RA 3W4JA 3K4PA 3IT1A 1KP2A 3BT7A 1Y4AE 2ZIVB 3C3MA 3M6WA 4PSVA 4UVEA 3GJSA 4D41A 1NU8A 2AC4A 1RYEA 2Z5LA 2VP0A 4FDVA 2OE2A 4ERXA 3KKQA 1GTL1 1E9AA 1MH1A 4P7FA 4RK5A 5ECWA 2AXQA 4ENQA 5CLFA 3AVTA 4J16A 2BKXA 4M55A 4QU0A 3MCTA 5I7FA 1EBFA 5IYZB 1HL7A 1O08A 5EZYB 1D2AA 1X1RA 4CM9A 2IZOA 4MKZA 2NVOA 2DJ5A 4CT0A 1HFEL 2G5TA 3Q15C 2ETVA 3H1FA 4X44A 3ZGXA 5AUNB 2O2YA 2AG0A 3JATB 4G1UC 1TJ3A 3HVRA 2G9QA 1E9EA 4D0RA 4U2CA 3HJAA 1UBUS 2MYPA 3HV0A 3QH4A 5BVHB 2ZYAA 1J25A 1NLFA 5DYIA 1XAIA 5FOWA 3EA5A 4DA4A 4WH0A 5LM3A 5HBGA 1YASA 5CUQA 1I2ZA 5J4VA 8LDHA 1QO0A 2J7KA 4KE7A 4TRRA 3SX0A 2XWJI 4GMFA 1LPAB 5LZ8A 3K09C 4A7PA 5EJ8A 2O8DB 3RSCA 4N0PA 3GRVA 3A4IA 4R0NA 3S68A 4BVHA 3BERA 1U0BB 1QTNA 2QEQA 2JLYA 3TX6A 2PRYA 3GRKA 3KXPA 3TTUA 3ULKA 4CNQA 1XWIA 4DV7B 1HNWB 3IJ5A 3B1KA 3HZRA 5BN5B 1RCUA 1P0FA 2A1TR 1JDUA 4U7PB 3UBTA 2QRLA 1ZLYA 3C98A 3I64A 4LJLA 3L8DA 1BX3A 2A0FA 4QLBA 4J3JA 2ZBUA 4KE8A 4ZK2A 9MHTA 4DC9A 1Y82A 4EUEA 4HVLA 1ADGA 1EYZA 4H0FA 1HQCA 4QWWA 4AK9A 1PE0A 3UK2A 1QDUA 2JFVA 3GP3A 3GP8A 3T5PA 4UU1A 5KX5B 2DFKB 1W85B 2HY7A 2ZBPA 1Q7BA 1RBQA 2E1PA 3CIOA 5L6MB 4GXRA 4L0QA 2G40A 4TVSA 3IMGA 1JTFA 4N12A 3NKLA 5IASA 5K8LA 1LX7A 4RCVA 3S2ZA 2I6UA 1WB6A 1WVMA 2FMXA 2HFKA 2ECFA 2O6HA 3SJCA 1K66A 4BZZA 2G77B 1JHRA 3DL0A 1L5FA 2PVCA 3MCWA 4MHTA 4ZVRA 1ESZA 1T6NA 2BSXA 2ECKA 2Y99A 3L8EA 3OE7D 3QPBA 4M1WA 4RPIA 2O2GA 4HDAA 1ZKMA 2QLMA 4XARA 2QA5A 3GA7A 4B4VA 2WWHA 4HXGA 3JZMA 1EXMA 2NO4A 2VP5A 5AW2A 3ABOB 3MTBA 1EFVA 1NYLA 3TMKA 3UJ8A 3A0UA 4KU4A 3D6HA 3MB5A 5AM0A 4JLPA 1AN9A 3WKDA 4EARA 3N58A 3DHNA 5CT9A 1WTCA 1IMJA 2APJA 2QM3A 3H83A 1ONOA 2P5YA 4KPUB 2LBPA 3DAHA 5L40A 2XIQA 3RVRA 1XZGA 2ZIEA 3U16A 4RPJA 1X6VA 4Z9BA 2YV2A 4TWIA 4OREX 3O1HB 2WC1A 2AJDA 3O1LA 5EE3A 1H2RS 1SAYA 3CFYA 4CMCA 4RA6B 3WJ1A 3H9QA 4XVHA 3Q6IA 1Y1SA 2PUHA 1U9ZA 4NFHA 1DKPA 5EP2A 3KDSE 3X1ZA 1BZYA 2FF7A 3IRVA 4QUJA 4EJSA 1X7XB 1EUZA 4L0CA 4E33A 2CUZA 1WBBA 4K6HA 2HMVA 1KJNA 1H65A 3DEAA 4XB1A 1EVZA 1U2ZA 1G3RA 2EX4A 2H4FA 1AKYA 1XFAA 3CUTA 1F5SA 3VR2D 3UENA 5AJHA 3VYSB 2DWOA 5KJ1A 1A1SA 4M1TA 5FB3A 1A2OA 5TF0A 1M72A 2VA9A 3JALB 4YJFB 4BJ5A 4MVJA 5HVNA 1VE5A 5TS3A 4UZSA 1I30A 1FP2A 1U7TA 2HMWA 1G2IA 4TV8F 3G2LA 3SZRA 1UMBB 1W8IA 5ECYA 1ZWLA 3CEAA 5C80A 1V3QE 1YQQA 5DHSA 3Q72A 5COBA 1N1DA 2SBTA 3SYRA 3FUTA 3U3RA 3VR6H 3BGWA 2A33A 3UT5B 1ZM3A 1N25A 4A8JC 2HQBA 3GEPA 4PIVA 4LNHA 2FQXA 3PBKA 2OCKA 2BLLA 3AP2A 1JAXA 2YY5A 2QRGA 3HKDA 4NYMR 3BDAA 3K9FC 2W9XA 3LX8A 4LYGA 1KDVA 2HF9A 3NW9A 3OJ0A 3G9XA 2G0AA 5L3ZA 2NPFA 5FNVA 2FK8A 4DIDA 3ZGVA 3GT0A 1WE2A 2AZTA 5ARBA 5CB0A 4TOIA 2AOUB 4TPKA 1A71A 3BFXA 3D6VA 1QIMA 2IZ7A 2YHAA 3PF8A 2PX4A 2PRJA 5D3QA 4WESB 2C98A 2W6MA 4NZMA 4HXFB 2XDQB 2JIOA 1WCV1 4JJFA 4MV4A 1P2VA 1JSLA 3DUFA 3GDGA 5H82A 3ZJ4A 3Q40A 4NZZA 5COQA 3QEAZ 1B0UA 5JDIA 1MAWA 1SCNE 1ZMBA 2GCNA 4C7OB 2G9UA 3KE9A 4KUGA 2VWGA 2PV0A 1BWSA 2FPPA 1CEEA 2K5UA 1RLUA 4KRXA 3TLGA 2QR2A 3HABA 1YB6A 4EG4A 2D5AA 2E49A 3ELWA 3ZWAA 2GM3A 2JAXA 2OGWA 2XTZA 1WXWA 1L4HA 3DKRA 4O2AA 2JKZA 2R85A 2G04A 3Q0IA 4PIMA 1EVLA 5H7XA 3VKWA 5ERXA 3MVEA 4MI3A 3CN7A 1IZYA 3QKTA 3QVWA 2ZIWB 4FKMA 3B9RA 3PXXA 1RWXA 3I37X 3HXKA 1HZJA 1LKZA 2R8RA 2WWGA 2Y3IA 3HP1A 6AT1A 2XUFA 4Q1BA 2JVJA 1EEHA 2JAOA 1AQLA 4C7VA 1I32A 3PNKA 2QUIA 4KO4S 3U7QB 4IDHA 2EP8A 4CKWB 4LE0A 3LDGA 5I47A 3PITA 2ZU6A 3FM9A 5B7GA 3KQKA 3RSLA 1Z0SA 4N65A 3SDBA 1VLVA 2CE7A 2XB8A 2C3YA 2QJTA 1SVLA 3FFTA 3UT0A 1SWVA 2G0TA 3FDJA 2IUYA 3TEFA 2EBFX 1CF4A 4EO9A 4LZOA 1EGVB 1H2ZA 5D1HA 2RONA 4OAQA 1KBQA 3WGVA 5FOQA 1M34E 1I10A 4C08A 1ZMRA 3DPIA 3NTQA 2Y93A 4OHCA 4R3UC 4X90A 4Z4CA 1OH7A 3FPLA 2XE7A 1JEYB 1QYRA 821PA 1B0ZA 1H94A 2HMSA 3Q7PA 2GKGA 3W5DA 3PG5A 4CGZA 1GFSA 4D81A 3W6OA 3WB1A 1NW4A 1NT2A 4R69A 2JFYA 3MMZA 5FADA 3VDNB 3HXOA 1JJIA 1PP4A 4YNBA 2FW9A 3N0WA 2G4VA 4O02B 4YN3A 3L1HA 4C4RA 3UHJA 2HPHA 2JZCA 1QRDA 1O6GA 4EKIA 2O8VA 3DV0A 2QVLA 2VCEA 5IH7A 1B14A 1K5GA 3VR0A 1RS0A 2Q1XA 4IIJF 3UV7A 3ZYCA 2DPHA 1BXRA 1H93A 1JTEA 1YRHA 3ZZNA 1VFPA 2QJFA 3FPSA 2F48A 5A6VA 2GPYA 5FTNA 4D0GA 1N5JA 2CF6A 1GVHA 2EYQA 2ZSFA 3LYUA 3R3HA 5C18A 3F6BX 1RKVA 3EDQA 3PK0A 2EG9A 4AJOA 4MCIA 1E32A 4CL0A 2EQBA 2ORWA 3AEUA 3ANMA 4JC8A 5A0VA 2C2BA 4QOJA 4K0KB 1V8FA 5C5CA 1R8XA 1V1RA 2W2OA 3GK3A 3PR2B 4UCWA 3CBGA 5D7BA 5ALZA 2UZ4A 4K9KA 3BXOA 4F91B 4OM7A 1YR3A 2EIXA 5A2GA 5CIWA 3U9LA 4HUQB 2JG3A 3LX5A 2BGNA 3DBRB 4AICA 1ULTA 1H0KA 4DMUB 3LRXA 4WJKB 3MBOA 4U63A 1FP7A 1J0BA 2EKBA 3V8NA 3V8PA 1ODKA 3QLUC 4X1KA 4XWOA 1KJ9A 3U4QA 2Q4TA 1QP0A 2QZSA 1E2BA 3B2EA 4N1AA 2BEJA 2IFTA 2WPNA 1BOOA 1S8FA 1QIFA 2Z4RA 5LOVA 1N2CA 1Z6AA 3STUA 2AF4C 1DV1A 3VSAA 1MTOA 4OM8A 4AZTA 1YS7A 4YQYA 1RI3A 1KOJA 3UG6A 3AETB 1OGYA 1S89A 3A6FA 3Q8MA 4MPJA 1ODCA 2WG0A 3OH8A 4FOSA 4WWHA 1HE4A 3B89A 4NONA 2IDKA 5KYYB 2SCUB 1UWVA 3PZBA 2HLDA 2A9JA 4LAFA 5HTKA 3WC4A 3T3NA 3ZXIA 1IHPA 5HK9A 1XNQB 2MINB 2DWUA 3MIZA 1KYYA 2P9FA 3D8HA 3DMTC 1Y8RA 2I7TA 3DZHA 3NHAA 3D02A 3ZQUA 5BN3B 1DADA 2Q8QA 3WNCA 4BNXA 1BS1A 2EJVA 1GQRA 5CCEA 3IUBA 3OC6A 4IEEA 4ZGGA 4GPEA 2GJ4A 2NPOA 2JEZA 2Z56A 3JWEA 3SSOA 1RQXA 3PVSA 5EJEA 4H0NA 1UXKA 4US1R 3VMMA 4JYMA 1AKWA 1PR4A 4OIMA 1E63A 3L0IB 4BDTA 2UYOA 1L7RA 3A58B 1P2UA 1Y8QB 4YROA 3O4VA 2IV3A 2FSGA 4ER6A 3B52X 4DDTA 1W2HA 4Y6QA 3FSRA 3X1DA 3O8BA 3FWHA 1U28A 3DVQX 1DPGA 4GX5A 5DBGA 2F3UA 3N53A 1VGVA 1A4IA 3WDKA 2DQYA 1WLYA 3G5MA 1KI3A 2W98A 1FLNA 4G9GA 5A5EA 4RTPA 4D0LB 4FNMA 1N2EA 1Q20A 1AKTA 3BZWA 4AQDA 3CJTA 1NM5A 1E6CA 2BFMA 2F55A 1E96A 5IJXA 3T4PA 2BEWA 4LX0A 4N6OA 2WJHA 2A94A 4QQNA 3FOBA 1Y7PA 2PKQP 1G63A 1YGPA 2A9VA 3INTA 4IDGA 4WXPA 3ZEAA 4BNDA 4O4IB 3OLQA 4RD3A 4LVCA 1NP3A 1F9AA 4OFZA 5IK2D 3TO5A 1JAIA 4FZRA 3PEVA 4KQGA 3EBPA 4J43A 5DNYB 1YK1A 3WMGA 4F97A 1Z4NA 1SWWA 1CVRA 5AP9A 3WWEA 4JLNA 3RTGA 1MGOA 4V3CA 4EMBA 1O4WA 3OZFA 2YY6A 1B1CA 1E8NA 3RBVA 1VCOA 4HPXB 4DG9A 4KW7A 2HQOA 3UH0A 4WGFA 3S2EA 3OIDA 4MW6A 4PPFA 1BW9A 3A36A 3OT5A 4AJEA 3KQTA 1UBLS 4KI7A 3GYBA 2ZE7A 4L7QA 5EIWA 5K6AA 3DB1A 3H4IA 3U40A 3FZGA 1SVUA 4LQ4A 1DIAA 4RIEA 4B17A 1E3WA 2J41A 3O94A 4KG7A 4KGZA 2EFJA 3V7WA 3FVQA 3K9BA 5H9WA 1NJSA 3R3ZA 4WN9A 2WUWE 2C42A 4FFOA 5TPWB 4MJXA 1DJLA 3ONVA 3RRBA 5KNCH 1Z5VA 1VRWA 2Y27A 1IZ0A 3DFKA 4HQFA 4G24A 4Q39A 3AR3A 3HDQA 5F35A 3RS8A 4A10A 2O3UA 5BWOA 5IAOA 1GTVA 1UFKA 3E22A 3ESQA 5AJZA 3S8YA 2C78A 2VPPA 3IV6A 4E70A 5FJIA 3M4JA 3LVRE 4TUYA 2BD0A 3K0FB 3PFKA 1U0TA 5C7LO 2PX6A 2EZUA 3A11A 1KP3A 2QUAA 3H2GA 4M46A 5EIBD 1DDOA 3ZX5A 3FRIA 3BSFA 2VDKB 4RPGA 3SDZA 13PKA 1WBDA 4A1OA 1TJ5A 1FPQA 1MO2A 2O3RA 4C0KA 1G3MA 3PE6A 5CD1A 1Q1EA 1ENYA 4LZLA 1NUQA 3DWGA 2B94A 3DT9A 1QQBA 2BC9A 2W6ID 3E4DA 3IUEA 4JK3A 3ADCA 1WV1A 4FK8A 4EUHA 1M0WA 1ZD9A 2WB2A 3LY7A 3NXSA 3WFZA 2XCTB 2EOAA 1YZFA 2MHCA 3D2LA 3EZ7A 4PCLA 1A9ZA 1AUPA 1GN8A 4UXIA 6REQB 4K6FA 2VPIA 2GF9A 1F2DA 3B9QA 4OATA 2DKFA 3LM8A 4R68A 3U7RA 2PXAA 1E18A 1Z6TA 1LX6A 2D1FA 5IMBA 2JLZA 1MENA 1UPCA 3MCAA 3BK1A 1VXOA 1LBHA 3GRFA 5I4IA 1N75A 1ZHFA 2GAAA 3EZLA 5J4KA 4B4DA 4B2PA 5BSUA 1E9RA 1XG5A 3T9CA 4OFWA 5L51A 1QPZA 4MQ6A 3KLMX 1QGAA 1ACMA 3H5NA 3WOHA 1MOZA 4DNQA 3P9YA 1ZSVA 1X94A 4EX7A 1BMQA 4BQFA 3KZCA 3A1DA 3O4HA 3UN1A 2CV2A 2F1OA 4TS4A 5ALSA 3QWFA 3W6UA 1JFFA 1FOEB 4UFPA 4F6RA 3THYB 2EAUA 2IL1A 1I3LA 1VHJA 1U8TA 2FG7C 1U7UA 4Y6LA 4A27A 2NVWA 3BDIA 3EODA 4LC9A 3E35A 4Q9KA 4BVGA 4DILA 4ZI7A 3MCVA 5KU1A 3EULA 4CKEA 5IJ9A 2EFEB 1OCEA 4K9RA 2J3MA 2Q5JA 1H5QA 2QRUA 3DZDA 3FSEA 1IDOA 3GR6A 3SC3A 1SKQA 1V25A 4OGFA 4C2BA 3PNMA 1UPXA 4OA8A 5BN1A 4MRPA 4XEHA 1VMAA 3AVUA 5EWMA 2OXTA 2A92A 4QJBA 1DXYA 3DLPX 2P6NA 1ZA2A 3KB6A 1DDGA 4UJ3A 2FUKA 2F1KA 5HM6A 2J33A 3OE7A 2ZTHA 4CEIA 1J0DA 1DCMA 1WCIB 2B5WA 1QMPA 5K8TA 2VPZA 1U11A 5JATA 3QEKA 4ZKEA 1TT7A 3SR3A 1W5AA 4TL8A 1M10A 4K9LA 5LXTB 3TG8A 3NIFB 1I0ZA 2ZAMA 1VIAA 4FS8A 4FMBB 4ZVSA 4ARZA 4YRZA 4Z7OB 3BJEA 1J23A 1RJDA 1TYDE 1C3OB 5B7PA 2O48X 4X62B 2VJPA 2VWQA 2OQRA 3PRKE 3HC7A 4OHWA 4OP3A 4A0FA 2EZ9A 4FHEA 3RIGA 1R4MB 4L6IA 3RC1A 5FX2A 4I55F 3MAGA 5GONA 2X5NA 1L4NA 1B43A 3HO8A 3NBAA 1GZUA 1PJAA 2A9PA 5DI3A 4C7JA 1PJ2A 3O8RA 3KB2A 5JSKA 2BSAA 3BMOB 3RQIA 3I1IA 5KQSA 1FTSA 3HGQA 1ZUNA 4GSKA 3N8DA 2IHVA 1X0VA 1YCHA 3FMPB 3I1FA 1ZXBA 2HAEA 3AEKA 3N6VA 1MQAA 1P80A 4IBOA 5KNDH 2RHTA 4TM7A 1TAQA 4DLSA 3GNSA 4HNAB 2YOGA 4EY8A 3A2MA 1R74A 3LBNA 2QX9A 1PGNA 3D8NA 4MYRA 3X2FA 3ZXSA 1GNVA 2VAPA 2YCBA 2RHWA 3H6GA 5DRTA 1E1CB 2RHDA 1D0SA 1E2DA 1ORIA 2PKXA 5JDCA 2VTBB 3RAEC 5CT8A 1NUPA 4GG1A 2CCJA 2V7BA 2OCDA 4N5DA 5TGDA 4PLCA 1VQ1A 3VZCA 5H4GA 4UAUA 3C87A 1EWKA 4LBVA 5BN4A 1KHHA 1UBJS 4XVQA 2FFQA 4PRZA 1G6OA 1OVGA 1DX4A 1QFZA 3LLSA 3KQNA 5TEVA 4JI2B 4MVJG 5E6SA 3K31A 1CY2A 3ESBA 1LQ2A 4C4OA 1E2NA 3NRCA 2X8JA 3UAYA 4NCHA 2SKCA 3EDCA 3IMCA 1X7HA 1T2NA 2BZ1A 3K3PA 1NPYA 3Q3HA 4IIBA 1H23A 1M1YB 4M8NE 3U26A 3AESA 5EZSA 4DR2B 3CX7A 4ZEMA 1PKEA 3MA0A 4KLNA 2FZGA 4G0OA 3WK4A 4PINA 1DIGA 1UXOA 4ZQIA 1YA6A 4DA9A 1NA5A 4GYYA 1HI9A 5JSHA 4RD0A 3ZY3A 1CS0A 1NW3A 2VUTA 4B45A 2O8EA 4TYNA 2KBEA 4ND4A 2UZIR 4MROA 5HQ3A 1LPPA 1VE7A 1XK7A 4LNUA 3TI9A 1X1CA 1NMEA 3WIOA 4CL3A 2QRJA 3EXG2 3HWWA 1EFKA 1SUDA 2QN7A 3KLNA 3LC0A 4N01A 2OSVA 3G68A 4TM8A 3IBTA 3SFTA 3WRYA 3GLIE 5C5DA 2VDVE 3HKEB 2UUCB 2GM5A 2Y0DA 3ELYA 4DRYA 3HRHA 1G8JA 2F00A 3K2EA 4GGOA 4JBLA 3ZDEA 4WOBA 1C2TA 3D0KA 4WK4B 2HXGA 3QI2A 3W9YA 2JCBA 1QSGA 3MT0A 2BM8A 1UIMA 3NHRA 3PUIA 4WK6A 5HMMA 5T41A 4KLCA 3ZCVA 4BXOB 3CX4A 1M6WA 1P0QA 5ALQA 1R37A 3NX4A 4M9SA 3D43A 3GLHB 4KPFC 5KWSA 3MF4A 4C2TA 3O0DA 4K6OA 3RJ9A 4LOJA 5IDXA 3S8MA 3BWXA 5AKIA 1JR4A 3FIJA 1APBA 1B3BA 1JSRA 3QOYA 3ZC3A 4BZPA 2ZEJA 1CERA 4F2HA 3QKUA 2ZXEA 2OK7A 2I4MA 3RE1A 1OLSA 2HXSA 2QW8A 3MMSA 2GS9A 1V43A 1CK4A 3B6KA 3GL9A 4YAGA 2QPLA 3EXAA 3O3CA 2W4MA 4RULA 1PSZA 2Z5VA 1PWHA 2J4FA 2RGUA 2IZZA 1KGSA 2KYRA 4TTQA 4DM4A 4UQLA 1WMDA 3EIWA 2Q1SA 1RW4A 3MRVA 4W6ZA 1HXHA 3RV4A 4BGIA 4D9EA 5LMCA 2R4QA 2J0EA 1F5NA 3IJEB 4OIFA 3JYOA 3RU7A 5DX8A 2WAXA 4EK9A 4ETIA 2I2BA 3GA0A 4M0MA 3ZBUA 4POOA 3OECA 4MV0A 1HNZB 2MYTA 3NH9A 1RZUA 1VYTA 3L07A 1WKCA 3AJDA 4WFIA 4TXMA 4BIIA 1NBHA 4ZPJA 4H31A 4C0QC 1SHUX 2CZQA 2WZDA 3WGHA 3GARA 1XPRA 2UUAB 3PI7A 4Y67A 2JGMA 5JVDA 1TLLA 2FB9A 1E0AA 1S4QA 1FE8A 1VB3A 5HQJA 3VR1A 3P9XA 1NBWB 5TQ0A 4G5HA 3BGVA 4XD2A 4LJYA 2IE8A 5EGNA 1CB0A 2CLOB 1CUWA 1CUGA 1PFKA 3N2EA 3RC9A 3RIEA 3B5EA 2VBIA 3HN6A 5FOXA 1L7DA 4DBLC 5HUQA 2J6HA 5KINB 2FFBA 2WPDA 3T3EA 3ZPXA 3Q3VA 2XMZA 1PGOA 3QMPA 4RZHA 1NIPA 4C21A 3GLFB 1J00A 4G0MA 3TDMA 1ISRA 3HB4X 5A4JA 7MHTA 3AM4A 3ONDA 4AF6A 1QZXA 2X23A 4FE4A 2JD0A 3DB2A 1AZWA 1U6KA 4N39A 3TDKA 3T3IA 1F0YA 3ZCPA 5IYZA 4FLEA 2OMKA 1QZ3A 4RF3A 5EZYA 1XSEA 5BR8B 3TKLA 2CT8A 3EY9A 3G8DA 3QG5A 1FDTA 1YU9A 3RSGA 4L9WA 2NVUB 4LSZA 3LZ6A 1WXIA 1JZTA 3JATA 1B8VA 1UL1X 4OFXA 3KQOA 4ZDJA 2V0NA 3DTNA 4PYNA 4C5AA 5JFOA 4LC1A 2ZSBA 4FE3A 1D2CA 1Q6ZA 4CLOB 1AKVA 1SUIA 1E58A 1JFRA 3ANLA 4OHYA 2G1UA 5BVHA 1F3OA 1JHMA 3A1CA 1E61A 2UXDB 1IWBB 1Q7GA 1OFGA 4G56A 3LVFO 2WJZB 2CV0A 1U2DA 3PXGA 3WK7A 1GKIA 4JQZA 2XT6A 2IKQA 4GP7A 3BMQB 3GJ4A 1TKRA 1EM6A 1ORVA 2X9GA 4GI3A 4L7VA 5DGXA 3M3DA 2Z8XA 4Q0MA 1ZN7A 4GIBA 4BB5A 2VDNB 5KWVA 2O8DA 1F2TB 1VA4A 4NU8X 4YUAA 1FU7A 4QJ5A 1BVYF 1QPBA 4N5MA 5BN5A 1OXSC 2GZ2A 1T9ZA 4QUEA 3OCZA 4ZJYA 1XCLA 2VH1A 3T7TA 3PXEA 4QU5A 3E8MA 1QFSA 2Z2ZA 3EE6A 2PR7A 3RT7A 1SURA 1CVIA 4IUBS 2X3YA 3D1LA 1ZKDA 4RO0A 5KX5A 2YFKA 4DV1B 4NV1A 4QLOA 2QTTA 5I5GA 1W85A 3I9FA 5SZJA 4GWGA 2G8NA 1VCNA 2YYZA 2H9YA 3F96A 3RU9A 2HRZA 3PCXA 5JHGB 1ZOIA 4AZSA 1G2PA 3KKPA 4URHA 1QGUB 1A9PA 1GQSA 3UQYS 3W3AD 3ZCRA 5KO2A 4JI4B 4GECA 3KVRA 5J5CA 2H4WA 2YC2C 5ADVA 3FCXA 3R5XA 1MOPA 5IT9A 1ZVMA 1YRQA 3NUZA 2PR2A 3WFJA 5HP4A 1N7JA 2VDMB 3HG7A 2QJRA 1SC1A 3LX4A 4YR9A 4PAOA 4WXRA 5BURA 1VHDA 2YS7A 4GZMA 4TMVA 1XCPA 4B76A 2IYLD 2JK0A 1LU9A 2OAP1 4TT3D 3NEPX 4D82A 2UXBB 4RTKA 3FVRA 2AF3C 2JK1A 1UJNA 1XU4A 2FWIA 4KPUA 3DAOA 2VJDA 5TV2A 5IAAA 2J0SA 3ERCA 2JASA 3F73A 1ZD8A 3F6SA 3HL4A 3WHIA 1IFXA 2W43A 2O3TA 5IK2A 1U2EA 2GERA 1ZIOA 2AZMA 1UKYA 3BTVA 4UNSA 1JXMA 2IYEA 1E2PA 3E9CA 2M1ZA 2O7SA 3I76A 3QJYA 2ZRMA 3G2MA 4RA6A 1Q1NA 3OZAA 4MAAA 4N54A 4Z4EA 2CSXA 1PJ8A 1ISPA 1SK8A 1YWGO 2QTVB 3PV0A 5AVXA 3PC8C 1OXMA 3D3QA 3W05A 1Q77A 2ID8A 4ZJUA 1SKBA 1U1IA 1X7XA 2AQHA 2O2SA 5A0TA 2IS1A 2NSYA 3I53A 4F1WA 2UYHA 2B36A 3Q7EA 2AGVA 3VKVA 3NV9A 2GI4A 5IEJA 3G79A 3ZDRA 1QHXA 3GHYA 4TTAA 1RPAA 1NT4A 2V03A 5CH3A 5JALA 3JWJA 4I9FA 4MUEA 3RWBA 1XYYA 1ULHA 2O2EA 3ACCA 3BS4A 1EDZA 3H4VA 3JALA 4YJFA 1JLKA 5IW8A 3UJPA 3EK2A 1N5OX 4DIFA 4EP1A 1XTSA 3FKQA 4FFPA 3SBOA 4YV7A 1VSQA 4EYKA 3GLUA 4LN1A 5K8CA 2HYIC 1EDEA 1ESCA 1G38A 2D1SA 2IV7A 1ONPA 1S3FA 3DJYA 1E6LA 2OG1A 1I7QB 1EK6A 1P0MA 3TQSA 5K0NA 1EXNA 1W4ZA 1TTPB 3GUUA 3IAAA 5AKGA 2XVZA 4G85A 3UT5A 4BGVA 5BSWA 4P3KA 5F7JA 4YIHA 3FPKA 1CD5A 1FSSA 1T9DA 2J32A 2W6CX 3TPCA 1ZY2A 4IGIA 1CY8A 2EDCA 4TWZA 1BFKA 1AGPA 1YQEA 4UAVA 3P0IA 4K6KA 4KQ6A 3H3FA 5SZHB 2D13A 1T5DX 5AI9A 5SYNA 2F1RA 2GTHA 5E4FA 1NRJB 1RXYA 1JHUA 1V4NA 2MSLA 1UFQA 2AOUA 3U3XA 5B3JA 1W6RA 4TS9A 1XE3A 2YWCA 1GGFA 3SXUB 3KYCA 3EARA 2HO4A 1EZ1A 1P2GA 4FGKA 4NE2A 4P4GA 3RBXA 4L6CA 5JCJD 4Q4DA 2G67A 1IUOA 1UWLA 1VI5A 2DM6A 3OCJA 3R0ZA 4WESA 2W6IA 3GXOA 3SEAA 1S3IA 2XDQA 5MN5A 3R4VA 3ADOA 1FJ2A 1SRQA 3M9LA 3G23A 2QMEA 4AFNA 4EW3A 9ABPA 5LMUB 4DKJA 4PAMA 1NG9A 3EBLA 3MS4A 3ZK8A 1QRAA 1N6LA 3D5TA 2XCSB 5KQPA 1V5FA 4RNDB 5IX8A 4OX9Y 4C7OA 1SC6A 2W2MA 4WGGA 2HMTA 4WCFA 1MR3F 1W1IA 3DNPA 3WP1B 3PUVA 2UVDA 5A9SB 5DM70 4LUCA 1H66A 1MLDA 4Q03A 3ELBA 3EH1A 1EVYA 4RCYA 2NTJA 3LUGA 3U61B 1VJDA 4RLSA 1ZUHA 2Q6LA 3JQAB 3V4LA 4BNMA 1ISSA 1EQAA 3K20A 3RDPA 3CQ9A 4D9KA 1JHAA 2OBBA 2YNMC 4ZP1A 2HJVA 1IY1A 2JJ1D 4J7XA 4D46A 5JAOA 2QYOA 1A5TA 4LS3A 3SC6A 2W70A 3N2IA 4ND6A 1N2ZA 1Z8NA 1RWNA 2H4XA 4QREA 3U7QA 3IVRA 4M99A 4LA4A 4AIRA 4CKWA 4YFYA 5K0GA 4PZ0A 2O5RA 4BVKA 4F5WA 1Q3KA 5FQNA 2FPOA 1RQLA 2EIHA 1F06A 5BSEA 5IN5A 3HXTA 4OKIA 1WPRA 3N07A 1Z74A 3QKRB 4RXMA 1KO7A 3TGLA 3F4BA 1VLLA 5CFMA 3IVXA 3KKEA 3PTLA 2CBGA 3R6WA 4FXOA 4UHJA 5KTRA 2FWMX 1V96A 1SVWA 3TJMA 4NENB 2RJOA 1L8OA 3H4MA 3HSSA 3QVSA 3FOWA 4BP1A 1J90A 3TFOA 1JEYA 1WUHS 2PUTA 2DLCX 3LA8A 4HFRA 1MX3A 4XQ9A 1EK2A 3DG9A 1CZOA 4DTCA 1M1NB 1YRYE 3A1WA 4N8SA 3QWIA 1T5OA 4MWEA 2XBMA 4ZC1A 4RKRA 3N87A 2LUOA 2W11A 5D86A 5L9AA 3ONNA 3LBIA 1P62B 1J33A 1MW9X 1OAOA 1V6AA 4BN4A 5KQMA 3PDJA 1LSUA 3PJRA 1GXSA 1RBZA 2X8BA 1D7OA 2AX3A 1W4AA 3G9UA 3LBAA 3EQZA 1EBUA 4JI3B 1SG6A 1ZW6A 4INPA 4DDMA 1J22A 3SQXA 1FEZA 1JEOA 1MIHA 2IEBA 4UVDA 4MUKA 1L5GB 1I33A 3CLTC 4YP9A 3WIEA 4AUKA 1YRWA 1F0NA 3WLEA 5LP6F 3JX9A 2QMZA 4DJAA 2FF5A 1O1YA 1N8NA 3BMXA 3D2CA 5CFRA 1E98A 3JAMA 2FE4A 1W1WA 2JDID 5JSFA 4MPRA 1ULUA 1JGTA 3HDTA 3LKDA 1KY4A 4QBIA 4ZAGA 2CLLB 1K98A 3OKAA 3AHGA 4W6QA 2VNSA 4FFRA 1TC2A 3FHJA 2IXGA 4U6SA 3CH5A 2H85A 2VAMA 4Q3BA 1O95D 3BRCA 4QE3A 3OZBA 5CVCA 2PKCA 3ZTYA 4AP5A 2V6IA 1K2VN 3AT1A 3LTNC 1ZD2P 3I5MA 3PPVA 5AI5A 1AS2A 3DHWC 4BMCA 4Q4HB 5LZ5A 5DTQA 2VNJA 2GF2A 3UOGA 1M2JA 4KXQA 3WLKX 1RI4A 10MHA 2A0XA 3CONA 1AB5A 1U63A 4HCJA 3CY6A 3LIPA 1WHTB 3BE5A 1VBKA 4CMHA 4UPVA 4I5EA 1P75A 4QTZA 4TMKA 4M1YA 4R9VA 2JLXA 3VPAA 1Z08A 1UJ4A 4H1VA 4PG6A 1UP4A 5FULA 3IQWA 3KHTA 2X7JA 3SIRA 2WD8A 4KVZA 2Z4SA 3BFKA 2VYCA 3KJHA 3U39A 1TAHA 1ZMXA 2CNNA 2Z2XA 2A0YA 2Q41A 3AETA 4G5GA 1THMA 4DMLA 2HUNA 1L9XA 1T8UA 3EPPA 4QUHA 5AM5A 2EL7A 1KVTA 3OPYI 2MSCB 3TSCA 5CDSA 2PE5A 4OXRA 3MRSA 3BQMB 3IEIA 4X45A 2PUGA 1V26A 2GJ9A 2WKRA 3JQRA 2SKEA 4M60A 3HDVA 5JCOA 2OAQ1 5T67A 4TLDA 4G4JA 3P9CA 4GOOD 2NUAB 4AT1A 3FYUA 4XCXA 1CY4A 3WG9A 3S2FA 3QE2A 4JB0A 1N4DA 3JQEA 1G4UR 3QFTA 4EYOA 2H59A 4E7OA 1S9DA 3KXDA 3R40A 4A16A 4F3YA 1M73E 4GM0A 2V6JA 3NVDA 3T7CA 3AM1A 1LLCA 3LT1A 1BDMA 3SX4A 1HBJA 2VDUE 2OP0A 3UWSA 4FYIA 2YTZA 2NT3A 4UTPA 3C5VA 1D03A 1Y8AA 1T4CB 4QPNA 1CJSA 2P27A 2WDPA 4YAEA 3SGLA 3F6PA 3OWOA 5EWLB 3WLHA 5BW6B 1FNNA 4BWFB 5DLDA 1BWPA 3P96A 3R0QA 4GPAA 4QTTB 5BSTA 5I9SA 1RWBA 4OPMA 4N7BA 4UEKA 5HKLA 2IT1A 3BDVA 3PFGA