5CIWA

Ran gdp y39a mutant monoclinic crystal form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords GTP-binding nuclear protein Ran
total genus 69
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ciwA00
3RRMA 2PLFA 2WVJA 2QZ4A 2D2EA 5KDDA 1UEIA 4TTQA 2A9KA 1J2JA 3S1AB 3GP8A 3TRFA 4LCBA 3EG5A 1IJEA 3QE0A 4CRWB 4C30A 1TX4B 5FPKA 4OQNA 2J7PA 3EAQA 2H17A 1XXHB 3B1WA 4LZZA 1WMSA 5FUYA 4LYJA 4DT1B 4WBSA 3PR1A 2JLUA 3AVQA 5HE8A 4D4MA 4TZ6A 1XB2A 4NYJQ 1TADA 3OESA 3FMPB 3X2SA 2ZRKA 4BZQA 1JALA 3DHWC 2O8EA 1UADA 3K53A 4YDSA 4JVLA 1S3SA 3QXJA 1Z29A 5EP1A 3AVOA 2C98A 1HV8A 4AY2A 3BGWA 5A4JA 1H8ED 2IS4A 2P65A 3WRXC 4JLMA 3X1WA 1GIAA 1GTVA 2Z83A 4V0MA 1WRBA 3LXRA 1G1MA 5FPYA 2QAJA 2SHKA 4ZKDA 2BWJA 3QKSA 4B6FA 2AKAB 4U00A 3BIFA 621PA 3R8FA 1IN6A 5DIFA 3A58B 4EPRA 2GXUA 1NSTA 4DIDA 3FHTA 1VCOA 4HLUC 4M1KA 1P3JA 4AKHA 4P31A 2QPAA 3PQCA 5F98A 1KMHB 5JSZB 4LBWA 1GRQA 4JVNA 1OW3B 1JR3E 1QHNA 1JJVA 3F0TA 1UDWA 1ZM7A 4G5OA 4DDTA 4OQXA 2ZRDA 4LOAA 3D6TB 4RKFA 1E1QD 4FIDA 4DDUA 2D74A 1KMQA 4LJ5A 4D25A 1AA9A 1AZSC 3ND8A 4B2IA 4TMXA 4I99A 4Q1AA 3EZ9A 3W9YA 3AF4A 3BBPA 4ARZA 4G5RA 3CNLA 2EVWX 4JSYA 5DSZA 4QGFA 3LX5A 2OHFA 1EFRD 2CK3A 1E2GA 1F2UB 1S9HA 2QMOA 4JLOA 4MYCA 1B23P 1II8A 1T5LA 1E98A 2NO9A 5CB6A 3BB4A 2ZE7A 4LHYA 1YR9A 4DLZA 3CM0A 3B78A 1P5ZB 4MKHA 1XWIA 1KO4A 5JWOA 5CJ2A 1U2RA 1ESMA 2AR7A 5FUXA 4N1AA 1Q3TA 2GTPA 3X1ZA 2WICA 2ZR7A 1JR3A 1KZ7B 1KZGB 3U3KA 2GEVA 2ZU0C 4FCVA 4OBEA 4Q9IA 2JAQA 2ONJA 2BBTA 1MO5A 1NVXQ 1OHHD 1XTJA 4N3NA 5L3SA 4LJYA 3MLEA 2IW3A 4L15A 4AC9A 2V7QA 4P4TA 4HSEA 4RFSA 4C0SA 3T61A 2AFHE 3DOFA 4IVQA 1N6PA 1W0KA 4HDQB 3W8RA 2N46A 1E0SA 5ANRB 4TYNA 5CLQA 5EXXA 2Q21A 2PT5A 2QAGC 4BASA 4B3FX 2AK3A 4PAMA 4V0ME 1P9NA 1HEIA 5J4HA 2QI9C 4KBGA 2W6IA 1ZUNB 1OXUA 2VBCA 4LHZA 5HKKD 1FL9A 4TLCA 3HPRA 3CRQA 2YWHA 1TTTA 4Q7JB 3OF5A 2J0QA 1LNZA 2ZETA 3BFKA 2WPDD 2ZRNA 3QEJA 1VG0B 1Z2AA 2H92A 2ZJ8A 4AG5A 2PZGA 4DLWA 1S0UA 4NYIR 2WWYA 2QU8A 1I4TD 1R0WA 2N42A 4OHWA 3WYFA 1ZAKA 1JPJA 2JIZA 3GJ3A 4ACAA 2ZQ5A 1ZM2A 1OKKA 2AXPA 2RGNA 4JT4A 3FWYA 3SI7A 1P61B 1NG9A 1M8PA 4OKSA 1ZD1A 4LSGA 3R9XA 2BC9A 3LDAA 3P27A 3LXXA 5D3QA 1ZU4A 2V8OA 3MJRA 1IXZA 3SYLA 2ZIAA 2ZE6A 1XEXA 5TMPA 4LGMA 2JEOA 2E9SA 2B8TA 1Z0IA 3NVAA 5UKDA 1KI6B 2FH5B 2PL3A 4MITA 1UM8A 4CEHA 1Z08A 3MJHA 4II7A 2RGEA 4P3YA 5B58C 3B85A 2J59A 2B92A 4CVNA 3QUSA 4H9GA 5KSYA 3AVUA 3LNCA 3DVLA 2QTVB 3CZPA 2FSHA 1BYIA 3LBHA 3WP0A 1OXXK 1IJFA 2A3RA 2J0VA 3ZZUA 3ASYA 3BORA 1F2TA 2GXQA 2QSZA 1S3GA 4P32A 4ZDIA 1EWQA 3EZ6A 1H8EA 3H4MA 1ZUHA 2J87A 2ODEA 2KBEA 1N5IA 1F60A 2JLVA 1JXMA 1D5CA 4ESHA 5K8TA 4H1VA 2ZJOA 1XEXB 4Q1BA 2BBWA 3AP2A 3LO5A 4Q4HA 2HT1A 5EXTA 2ZI5A 5E95A 1E2JA 3VX4A 1OXVA 1GG2A 4IFEA 3I61A 3W5JA 3MWLA 4UQOA 4PO1A 2FPLA 4Q48A 3QQ5A 4DCVA 4DDWA 2HCBA 4YC7A 2IHBA 3ZVRA 4UKDA 1TF7A 3UMSA 3W6PA 1HT1E 3UWOA 5JJIA 3RLFA 3AF0A 1J70A 2RB4A 1Q0UA 4O0MA 2Z5FA 2I1QA 2IBMA 4GP7A 4GT1A 4PQFA 1FNMA 1XEWY 1Z3IX 2O8DA 5LB2A 4OI4A 4L9WA 3GJ5A 5SZHB 1JEDA 3UANA 1U81A 3W3ZB 2DFLA 3KQNA 2JA1A 3W5IA 4A8JA 2QE7D 1E99A 1W49A 4P0TA 3U60B 4ZIRB 5DYGA 4NU0A 4UNRA 4L4UA 2GCOA 4F7WA 1BMFD 4D0LB 1G18A 3CF0A 2J45A 1TQ4A 1N0WA 3PUZA 1XRJA 1W44A 1YRAA 3MD0A 2ZUDA 4F91B 1G4AE 2V54A 1EESA 4PAQA 5GJBA 1AGPA 2J9RA 3K0EA 4PSAA 3UIEA 1OFIA 2EFCB 4LC1A 1CU1A 2XTNA 3UPUA 5JS7A 2HF9A 4EQ6A 2BV3A 1WXQA 1US8A 2Q0HA 3OFNA 3W90A 1Z22A 2XXAA 3EIEA 3N70A 3C14C 5CIQA 4FW9A 4Z8YA 1BH2A 2Q6TA 5JHGB 3BFXA 3A36A 1FZQA 3C15C 4Z51A 1L7VC 2H16A 3CKLA 2QY9A 2BCGY 1G17A 2JLSA 3KX2A 2F1RA 2CL0X 2OESA 3DZ8A 4Q5IA 5D3MB 3Q85A 4OHXA 3QBVA 1HTWA 1FFHA 2P2LA 4DB4A 1ZP6A 3GLIE 1W4CA 2FA9A 1W36D 1E4VA 1CBUA 4DLSA 2IYQA 2BKEA 3I32A 2FJUA 2C9CA 4MYHA 2DPXA 4DEYA 3CR8A 3QKRB 1F2UA 2J5XA 3ADKA 3PEUA 5G40A 4AKIA 2C5LA 2VF7A 1A4RA 4KFRA 2GCNA 4LRWA 2V1UA 4DCSA 1D2EA 1SVWA 2IWRA 3AGQA 2BDTA 5FI1B 4EQ6B 4IOKA 1KAOA 1CEEA 3RANA 1KSHA 2FEMA 2CEAA 3P4XA 2R6FA 1COWD 1N0UA 3B1ZA 2GAAA 2RKOA 2ZRLA 4DLTA 1UBEA 2VSOA 4ZKEA 3TW8B 2FSFA 2DWQA 3ECCA 1ZM9A 3OIWA 4ACBA 5DH9A 2ZYVX 3LV8A 4MYTA 4ZCMA 5KHOC 1F3OA 1XTIA 4F4CA 1E79A 2R2AA 3EZ2A 1NG1A 3SQWA 1HT2E 4JLJA 1KDPA 1HE1C 3KUDA 4HAWA 3QSYA 2H57A 1GM5A 4X8MA 3BH7A 4M9ZA 3RRNA 1OKKD 1L2TA 3LA6A 3QKSB 5JWHA 2FV8A 4BLOA 2P3SA 4DWJA 2BMFA 3U44A 4FMBB 4IKEA 3WY9A 4PC1A 4BEBA 2FFAA 3K9GA 3U6KA 4EJSA 1FTNA 1GL9B 3NBXX 4OJKA 3LLMA 1NIPA 2QORA 3RNLA 4IOLA 1CRQA 3TBKA 3CX7A 1SVSA 2OBNA 4W5WA 3AVWA 1VG9B 2WKRA 2HLDA 5IDVA 4HDOB 4UXHA 1KJZA 3K9LA 2NZ8A 4U7DA 2UKDA 1GOTA 1VMAA 4LYFA 1MRSA 3A4NA 3TUJC 1E9RA 3KKPA 2ZSEA 3U3MA 3TIFA 1GRRA 2FZLA 4B2PA 4ARZB 4A15A 4Q4HB 5HCNA 2KWIA 4TT3D 4X8HA 1II0A 2VP5A 3GJXC 3M1IA 3EARA 3FHOA 4R2IA 2WSSA 5DHFA 5DGXA 1S8FA 3BK7A 4TQAA 4DB2A 1MO6A 4IDHA 3GLGE 3CH5A 4KVGA 3A1TA 3GPLA 1G9XA 5BYJA 4Q9JA 4V0KA 4RZUA 4PTLA 3NDPA 1XTKA 2WIAA 4WA7A 1NVUQ 2VIIA 3CX8A 2DBYA 1AS0A 2GJKA 4IHQA 2ORWA 5CB8A 2ZRPA 2V7QD 1W5TA 1A82A 1IXSB 1JR3D 2QG6A 1PVOA 3FB4A 2YWEA 2CE2X 2RAPA 1MRNA 2UZ3A 1XPOA 3BAFA 4HZIA 4NYJR 1XZPA 4MRNA 4D80A 4D26A 3B82A 1LVGA 5A5GA 1U99A 5EQTA 2HT6A 2F1JA 3B1VA 2F3RA 4C9BA 2BCJQ 4JMPA 2WBLC 3QVUA 1E9CA 1SXJE 1GNPA 2ZRBA 2YYZA 3EA5A 1UJ2A 3AKDA 1VDZA 1WA5A 2IYVA 4XVUA 5LDDC 1Z47A 1RE0A 2DR3A 5HCIA 1OYWA 3SJZA 1NJFA 2GCPA 4B48A 5FBQB 1Z6XA 4W9MC 4EFMA 2GVDC 5CM9C 1E0KA 3LX8A 2O8CA 2VP4A 4US1R 2A78A 2BKUA 5JBQA 1XD9A 2VRWA 3IIMA 1O87A 2QTFA 4Q03A 1Z0FA 2JIZD 3JZMA 1KK1A 3A4MA 2QGZA 3FMOB 3QKUA 1XZQA 2XAUA 3HR8A 3T1VA 5KU1A 4PO8A 2V6JA 3KKMA 4EPYA 5TV2A 5JS8A 4E09A 5AJZA 5BN3A 1E2FA 5FOSA 2Q3MA 3D3QA 1Z06A 2WWIA 1Q3HA 4LYAA 3V9PA 3ZQJA 3VHXA 5JRZA 1FMJA 1UKYA 1NY5A 3WNDA 1FTSA 5K8IA 2GDJA 3PV0A 2EFGA 4Y0VA 5B30A 3GJ7A 1R7RA 2GETA 5E7JA 1ZNZA 3SBEA 3KXIA 1NBME 2ZJ2A 4XD7D 4D82A 1R8SA 2CLSA 2IYWA 4Z1MA 2OG2A 4ZI2A 5FBVB 2XB2A 3BE4A 4Q18A 1ELOA 3PIRA 1T6NA 4Q4LA 3NBZC 1FX0A 2QMEA 1AS2A 4GZLA 1KSGA 3IUYA 1NKSA 1E6CA 1JQJC 2IYTA 3HWSA 4ASUA 3ZVNA 3KZ1E 4GFDA 2IYSA 3GLFE 3ZGXA 3QF4B 4TLAA 5L3QB 4CEIB 1G5RA 3I62A 1DADA 3DEFA 3VMFA 3BS4A 1YE8A 3C5HA 3SS8A 5GJVC 1QHSA 1YZTA 3Q7PA 521PA 4IJMA 3ADDA 3TMKA 4MGYR 4Q1EA 1RW4A 4JLKA 4HUQA 1TU3A 2PLRA 4HLQB 4RFSB 2B21A 2J1LA 3KB1A 1NRJB 1TPZA 3L0PA 3U7HB 1CR0A 1KHTA 4ZV4A 2WWHA 4A0FA 2OO7A 1F2TB 3R7WA 4FD2A 2EWWA 2XTMA 3Q3JB 4DRZA 1XMIA 2PX0A 2XITA 2BHRA 4JL6A 2ASEA 3TKLA 4M8NE 4IDNA 4XVRA 4A0RA 4BWYA 1UF9A 4KHZA 1RC8A 2XNDA 3I3SR 2FX3A 3HU1A 3QXXA 1UAAA 3CBQA 3ZVMA 1ZRHA 2HUPA 4I1SA 4V0LA 4G01B 5IK2A 4JS0A 4B43A 2RGXA 2RCNA 4AKGA 5EE9A 1N5JA 1ZU5A 2OBMA 4PZLA 3VQTA 4ZI3A 4YLGA 1EK0A 3HU2A 1OFTA 1VKJA 2WHXA 4RKEA 5HZKA 3NBFA 1QHGA 2Q9AA 2G0NA 2FE4A 3DM5A 4FCTA 4NPHA 1GILA 2J7KA 2P67A 2WJIA 2WPDA 1NN0A 1XD2A 4V02A 3THXB 1ZINA 5HR5A 4QGHA 3ZS9A 1UKZA 1W36C 2NO6A 1W2GA 2G77B 4L5BA 1E9BA 5JRJA 2QBYB 2AWOA 2OXRA 3FKSA 2IC5A 2ATXA 4M9XA 3AF2A 2IYXA 2JLYA 4BLTA 4D4JA 1X6VA 2VP6A 1PZNA 1Z8FA 4FMDF 2ZJBA 1AIPA 2CL7X 2FDCA 3LH5A 3MUFA 4ASUD 3I92A 5G41A 1G4UR 5TY0A 1N6OA 4MKFA 3SFVA 4TMKA 1Z2CA 3IEUA 5JMTA 3CNOA 5CIWA 3JVUA 1SVLA 4WW0A 3HYRA 1IM2A 1JAHA 1KDTA 4NHOA 5IHPA 4TLEA 1J8YF 1P7CA 1QVAA 3THYB 2CDNA 2D7DA 3REGA 2NG1A 1YJ5A 2O8DB 2ERXA 3EC1A 2I4IA 1XMVA 2ZI3A 2F1IA 3A8TA 3VX3A 4D0NA 2BMJA 2GK7A 4JL5A 3Q7QA 4MA4A 1R0XA 1M7BA 3Q9LA 1Z0KA 3U7FB 3KJHA 3P32A 1VIAA 3BJIC 3WMFA 3A1VA 2DWPA 2EW1A 3HP1A 3AF3A 3DM9B 2NIPA 2WWFA 3C8UA 4PHGA 4MKIA 5KSPA 1E1RA 4YDHB 1YZLA 4NMMA 2W2VA 2BEKA 1G3IA 1T8TA 3WNBA 5FH9A 3AVPA 4NP6A 5L8VA 2VEDA 1GWNA 5F9FA 5FTMA 4IOJA 3KB2A 4GNKA 4OYHA 4QJ4A 2FPKA 4G5GA 5L3VA 1DBSA 1FP6A 3NHBA 3SDZA 1NMYA 3MSXA 1RZ3A 1E2KA 4M53A 5CM8B 2ZXUA 4DCTA 2YV5A 4EPXA 1G7TA 3D8BA 4QBFA 1YVDA 4EDHA 1OH6A 3WHKA 4MDFA 1G8GA 4P4SA 3B6EA 3SJBA 3VR6A 2JLWA 1P2TA 1XEFA 5AJWA 4FINA 1XP8A 2FFHA 3B1YA 2WM9B 1P75A 1NLFA 2RGNC 1SVIA 2IHYA 2QRZA 3QF4A 4CEIA 3CB4A 1M34E 2HEIA 1YU9A 3PG5A 1KDOA 2YC2C 1A2KC 2JJ1A 5FPTA 1K8RA 4V03A 1VECA 2ZSDA 5L3SB 4PR0A 2ZPTX 2BJWA 1Y63A 1OXTA 2BBSA 3WXMA 1Z0JA 4TL8A 5FPSA 3WRYC 1G16A 4XWAA 3K0AA 1TL7C 2QPOA 1KMHA 2KI5A 3BRWD 3F5FA 3NG1A 5FBLB 1XMJA 1WBBA 2J0UB 4XTCS 5C18A 4BFXA 1U94A 2O0JA 3IIKA 4C7OA 3TR5A 1U8YA 5FBRB 3QI2A 1NKTA 4RD0A 1P73A 4DLXA 1PLLA 1HQYE 3RC8A 4TMZA 4BPBA 1DG3A 3VU9B 2IS6A 2F6RA 1FMLA 3E5HA 1K5GA 4JT2A 4Q66C 4TSFA 1W5SA 1WE2A 1T9HA 5KUTA 5DYIA 3GJ0A 1U9IC 3MMPA 1J8MF 2ZAMA 1W46A 2UVQA 4HUQB 2K5UA 1X8JA 5DISB 3U3RA 5AJXA 4JLVA 1D2MA 4E22A 3GLHA 1XPUA 3HPQA 2VPPA 2YOFA 1T3LA 4DCNA 4IDQA 4Q7MB 3MCAA 3SOPA 3AF1A 1UBGA 4IXNA 1NVVR 4TMVA 1U0HC 1J99A 1TUIA 2BJVA 1CR1A 3QKTA 4IOMA 4NONA 2ECKA 2REXB 1E2IA 2WWGA 4URUR 5FTLA 2B7CA 3S1AA 4FXPA 2XOKA 2CHGA 1N6IA 2OCYC 4RZ3A 5JWRA 4AK9A 1AQYA 1KI8A 4KXFB 1VYTA 5FR1A 1KJWA 3CX6A 4LX0A 5GVRA 4C0JA 1HY3A 4HB3A 2D3WA 4I4LA 1U8AA 3WYAA 1XTSA 1SXJD 3ASZA 1E2NA 3PEWA 3QXCA 5TXGA 2ZE5A 3THWA 3IILA 421PA 3ICEA 5AUQA 3AVVA 3RS3A 1WBDA 4MYUA 4YONB 4LBYA 5H70A 3AH8A 2O8FB 1UEJA 2GZAA 1E32A 5AWFC 3THXA 3DOEA 3TVTA 3FDIA 2HF8A 5E3HA 2ZS8A 1NN1A 3LQQA 2IX3A 3Q8XB 3PVSA 2GA8A 4XOIA 3TUIC 2XX3A 2D62A 2YC4C 5JEEA 1QVRA 2C77A 3BB3A 1XMSA 4TWZA 1FP7A 4TQUS 4NKRA 3OEEA 4CW7A 1V43A 3GLIB 4XWKA 2A5GA 4CEJB 5AR1A 4KLNA 5SZIA 4KYUA 3RRYA 1NBMA 2F3TA 3AVXA 3ZZTA 1Z07A 2G6BA 4A2WA 4EFLA 1QF9A 1GNRA 4JLNA 5G3YA 4MH0R 4A0HA 1XD8A 1P9RA 4Q4JA 3KJEA 3KJIA 2RGDA 4GP6A 1MO4A 2QBYA 3RWOA 3K70D 4B33A 2H8KA 1ZNYA 2NPIA 2RHDA 4KLZA 3ZZ0A 4AWXA 2WZQA 4B3CA 2Z4SA 4POAA 3MAAC 4BFUA 4D0GA 4C3ZA 2ZEJA 1KO5A 1G5TA 1IN8A 1CJKC 4PPGA 3NXSA 3EIQA 3TGPA 1II9A 2ZJYA 4M0LA 3H84A 1TQ6A 2HCJB 1LY1A 4IW3B 3WP1B 1PLKA 1CJVC 2GEUA 4GMXA 4MUAA 4BE7B 3FMFA 3U3OA 3QY0A 2R9VA 2EQBA 2XGJA 4KFSA 3U44B 4X8LA 2OE2A 2GESA 3HDTA 1G3QA 4OHYA 1OXSC 3L0SA 4AYTA 4OQFA 4DEXA 2VP9A 4GMDA 4TTPA 5CK5A 4TYQA 1IN7A 1BIFA 3CNNA 3QOFA 4Q9LA 5FTJA 5GVSA 3TSWA 5CYPA 5FUWA 1MABB 1W1WA 3RABA 2CVHA 4CT4B 3IPYA 1YZNA 1G291 1ODFA 2AD1A 4XVQA 1YR7A 5B64A 3E1SA 2VQSA 2ZAOA 2Z43A 1GNQA 4IDPA 1X86B 2OLJA 1JXOA 1TQ2A 2XB4A 2CE7A 2R8RA 4RCZA 4A9AA 2JLZA 4DLVA 4PAOA 1WCV1 3O8DA 1TAGA 1N6KA 4C4PA 2RMKA 4NYIQ 2GRJA 1CJMA 1K6MA 1GKIA 4B44A 3L2OB 4BRWA 1I4DD 1ZC3A 2OFOA 2QROA 2A7QA 3W3AA 2NGRA 4JYCA 1CIPA 3IBGA 3FE2A 4ZDWA 1J90A 4DUGA 3NC1C 1FUUA 1N2CE 2QAGA 2AHOA 3KL4A 1NVVQ 4QNMA 3RS7A 3QIAA 2JJ2D 2BM1A 3OFND 1SVOA 4AYWA 1YR8A 4NZYA 1WQ1R 2GWHA 2PCJA 1NIJA 4QHSA 3SNHA 5F3WB 3A4LA 4IEIA 3B1XA 4Z1MD 2V3CC 2C9YA 3K0FB 4NDZA 3W34A 2FZ4A 2BMEA 1IBRA 3L8YA 4JLPA 4DCUA 8OHMA 4HI0E 1XCPA 2G83A 4QOSA 2P0EA 2F9LA 4GOJA 2LCFA 1OIXA 1PJRA 2BM0A 4Q01A 4DJTA 2NTYC 2NO1A 1SXJC 4MRPA 3MGCA 3LWNA 4KV9A 3GFOA 4Q19A 1OB2A 2WIBA 1Z83A 4PC2A 2O8EB 3ZIAD 3RS2A 4QHYA 1VG1A 3RSOA 4GBMA 1JB1A 2IUUA 3AKEA 3B9PA 4MRRA 4NCNA 5D3MA 4OHZA 4JLBA 2DB3A 1ZJ6A 3AB3A 3OE7D 3X1XA 1ZD9A 4ZIRA 1GITA 1Z6GA 4KSCA 1Q1QA 2DFKB 3ETLA 4QRHA 4LPKA 5J40A 4GDFA 2D7CA 2W0SA 4QBIA 2FSIA 1RJ9A 4YMVA 4LK2A 2WAYA 3I5YA 2IS2A 2EYUA 2C8VA 5EP3A 4A6XA 3KXKA 5DI9A 3B5JA 5FL7D 4M1TA 4D4LA 2VHUA 5IK2D 1TU4A 4O2RA 4G5QA 1ZW6A 2AWNA 2GK6A 4XSGA 5JLJA 1ZM4A 3IGFA 2GBLC 4AI6A 2IYZA 1KO1A 4R7ZA 3F8TA 3SYKA 3G5UA 3EZFA 2QENA 3EW9A 2KE5A 2JLXA 2QQ0A 4DDVA 2A5YB 2EYQA 1B0UA 2JATA 3AEZA 1NNEA 1P2UA 1GRNA 3I72A 3X1YA 4A2QA 3GLIA 3CWZA 4ZO4A 1U9IA 2DFTA 3PENA 4CEHB 4M21A 3WNCA 3KQLA 3U61B 3DKVA 1AKYA 4LV5B 3H0KA 2QP4A 4Q1FA 4O2LA 3I4LA 3ADCA 2EU8A 3BH0A 3QBTA 3D31A 1F5NA 2OCAA 4GPTA 1KDRA 5JI3E 1PV4A 2X77A 1A1VA 2H18A 1UKVY 2HV8A 4CT5A 4QXAA 1MABA 221PA 2F43B 3SZRA 4HB0A 4FMCF 4V0OA 1KSFX 1U0JA 4FI3C 2WMOB 5DN6D 4KJZA 2ZR9A 4LHVA 4W5JA 4B71A 1AN0A 4QJ3A 2FFQA 3TVDA 3Q5EA 4RD2A 4BLRA 1EFTA 1Z6AA 3EA0A 1NLYA 3B60A 3W6NA 3CZQA 1W7AA 2CNWA 1OH7A 2FN4A 4BFYA 2IXEA 1O3YA 3F3YA 1S2MA 3TSZA 3UATA 1VCMA 3LY5A 4A8JC 5AUOB 3KQKA 3KJGA 2R6AA 3IPXA 4B6EA 3W6OA 1OT3A 4PFSA 3H86A 5FBWB 3REFA 3EPHA 4MGIR 4Z54A 2E87A 1R5OA 5G3ZA 1EX6A 2X1VA 3HU3A 2RGBA 4Q7KA 3SR0A 4JVSB 2CNWD 2C9OA 2GJAA 4PXAA 5HTKA 1COWA 4NTZA 3EC2A 1E79D 3K0CA 2JGNA 1R0ZA 1RVDA 4ZPXA 5BW8A 1PUJA 1JR6A 3M4YA 3IEVA 3U4QB 1JAIA 2XEXA 2ZJAA 5AUNB 1LF5A 1WDTA 3BB1A 1GL6A 3H1TA 1OFHA 1MKYA 1OYYA 1KNQA 5IT5A 2R6GA 1KSJA 4WVFA 2C78A 1GFIA 3I73A 4PO9A 4CF7A 1GKUB 1IY0A 1E9DA 5JEDA 1QZXA 4JLDA 1W36B 2VL7A 4NH0A 1XXHE 1ZBDA 3LD9A 1R6BX 2O8BB 4OQMA 2PEZA 4PC6A 2ZSFA 4JBYA 5GADl 2QM7A 3QG1A 2EFEB 2ATVA 3QEOA 5H68A 3O47A 3RC3A 3RS5A 1OV4A 2DCUA 5TARA 4US2R 2OZEA 3J81k 4YMWA 1ZMXA 4RFVA 3UMRA 3CF2A 1HQCA 3KQUA 4E07A 2R44A 1VYUA 3CR7A 3THWB 1GZSA 3OEED 5DO9A 1AQUA 5JSZA 1LS6A 3R9WA 2ZITA 4UNQA 5C4GB 2KBFA 4ERNA 2ZS7A 2J3EA 3IHWA 2D4HA 1EG7A 4B3XA 1NN3A 4N0DA 1Q21A 4A8JB 5EUQB 1GP2A 5BN4A 1G21E 2ORVA 3LAWA 3NEJA 5H1YA 4CYMA 1VPLA 4TLBA 4C2TA 3CLVA 2CHVA 3VR3A 1KY3A 4EAQA 3L43A 3T5DA 4JBXA 4RD6A 1GL7A 1N6NA 1N6LA 2XSZD 4RCYA 4OL0A 2C96A 1LW7A 1R5NA 1II8B 1CJTC 2GVZC 3TK1A 4LJ6A 3H2YA 4LHWA 2AKYA 2YOHA 3CO5A 2DWOA 3KUCA 1U8ZA 3DL0A 4IEEA 2VP2A 1L4YA 2OXCA 2QRNA 1DE0A 2GJSA 2VH5R 2XOKD 3ZJYA 4CZ2A 3KXLA 1NVWQ 1DAGA 4UJ5A 2QMHA 1DS6A 4TN1A 3RWMB 1DARA 1KY2A 4PC7A 3QXHA 2G9NA 4LV8B 1R10A 2HXYA 2VYFA 4RZXA 2G0TA 4C7OB 4DXAA 1P2VA 2FF7A 5J4YA 5AK0A 3THOA 2A5JA 3ZH9B 3EPLA 3LQRA 4WXRA 3PUVA 4WXPA 5KOYA 2YINC 3UMFA 5EE0A 5KNDA 2CMKA 1RJ9B 4KBFA 1E0JA 1XJCA 1M2OB 1W47A 2VA8A 3MG9A 1NSFA 1NMXA 2YHSA 1Z63A 3DKPA 4F92B 5JJKA 2ZRGA 1XXHA 3QKRA 1DAIA 2C99A 1KO7A 2ORIA 2RH5A 1NJGA 1G6OA 2CK3D 2OCPA 4KAXA 5FFMA 1Q57A 4XJXA 4X8OA 2NOAA 3CH4B 5KNBA 3TE6A 3R8CA 3QNUA 1E96A 4OI0A 2CBZA 3PUXA 1EGAA 1G3RA 5JHHB 2Z6VA 1W4AA 4M2LA 1N6RA 3WMGA 2RGGA 2A5DA 2ANBA 5G53C 2JJ8A 2O0KA 1FUKA 2QAGB 1QRAA 2HDNB 2IT1A 4G1UC 1SZPA 5KPDA 4QGAA 4R71A 1DO2A 3GLFB 4HZUB 4B75A 1AM4D 1MOZA 3CRW1 3GLGB 4JKYA 3UXMA 1XDBA 3O8BA 3OAAD 1HUQA 4LPSA 4XIGS 5KSOA 1US8B 4EFNA 2JJ2A 1G7CA 3CONA 4L16A 4OI2A 4R98A 1XFAA 3K1JA 1P72A 1QHHA 1ANKA 1G8PA 3IQXA 4TMTA 4B3DA 2O52A 4HDCA 2JDIA 4TT3A 5EZ5A 2C2HA 1BS1A 3WBJA 3IDQA 3OE7A 4J0QA 2NMVA 2XZLA 1NP6A 3QJYA 4M4SA 5IRCD 2WWXA 4KSBA 2ZUCA 4L8GA 5FTKA 3TJZA 1H8HD 4YXWA 3PXGA 4JSTA 4KITB 3KQHA 1E2MA 1KKMA 1DVRA 4M1OA 2ZJ5A 5F2EA 3I8XA 2ZRHA 1Z0DA 1MO3A 1YQTA 3VAAA 3ZQ6A 2H1LA 3K70C 3SFZA 1D9XA 3AVTA 4F4IA 2FSGA 4EPTA 1YKSA 2VLIA 4FWIB 1E9FA 1E9EA 1IAQA 2P5SA 1SHKA 1E2LA 3K0CC 3A37A 3QPWA 3GFPA 5EXSA 3ZIAA 1FQKA 3DMNA 1OPXA 3T1TA 3THYA 5F9HA 5HKKA 2O0HA 4JYBA 1OLOA 4PPNA 5CYOA 4C2UA 4F4JA 2FFBA 3CPJB 2Z0MA 4LJ9A 4EKDA 1F48A 1KI4A 1G20E 2EWVA 1CXZA 3GQBA 5FOVA 2AD5A 4RSGA 5CDFE 4LJ7A 5AJVB 5B57C 2OFXA 4BFZA 3NHAA 2QGNA 4AURA 1G6HA 4WOPA 3VR4A 4LYHA 3V4RA 2ZRCA 4Q00A 1DOAA 3N2EA 3VNUA 5IF9A 1EWRA 1YR6A 4MGZR 1KAGA 1LS1A 4MKGA 1MT0A 5P21A 2ZRJA 2W00A 4I1UA 1AGRA 1V5WA 2KJQA 1OIWA 4Y0AA 5BN5A 5DI3B 3V4FA 2WSMA 4Q7LA 1XTRA 1MR3F 4ZDKA 1S96A 4ZDJA 1ZYUA 2IS1A 3SC3A 1KK0A 2VTKA 4HEJA 2W2TA 3CUEF 4PSKA 1FW6A 121PA 2RHMA 4NCIA 3VR5A 2O8CB 3B7GA 1DEKA 4WZAE 4DHEA 4P4SB 5FPHA 4A6PA 1L4UA 3FKQA 3QXSA 4LWZA 3ICQB 4RZ2A 3KDSE 3TLXA 4A2PA 1M7HA 4XD7A 5KPJA 3A1UA 5KDLA 1BMFA 4DT1A 4TL9A 1VCNA 1EFRA 1Z0AA 2PZFA 3NH6A 2WSSD 5C4MA 2ZRAA 4B35A 3AGPA 3FTQA 3KTAA 2IL1A 4IVPA 3SHWA 1EX7A 1H8HA 4YXWD 5DI3A 2R6CA 1NBMD 3IO5A 4FN5A 4HAYA 4S35A 4GZMA 1XCGB 2QUZA 2G88A 4HLCA 3PEVA 1KKLA 1A7JA 2NQ2C 1RFLA 1G8YA 5TVKA 2B7BA 3GEEA 4BFVA 4N0EA 2QL6A 2P5TB 2FG5A 1NI3A 2QNRA 1OH5A 2VHTA 5EE1A 2ZYTX 3NKVA 4QM7A 5KO2A 1TEXA 3OIUA 1FOEB 4BFTA 1KGDA 1EXMA 3B2EA 3FOZA 2AFIE 1BO6A 4E03A 1MH1A 2NPFA 1HH4A 1XBTA 2GBLA 1E9AA 1XD2B 2W6ID 2HJVA 3KFXA 1TUEA 2MSCB 3T34A 1E69A 4AG6A 1Q20A 1VG8A 3SHFA 3SJAA 2ZRFA 4W7SA 2CVFA 4PPFA 1CTQA 1JNYA 5BWMA 2XZOA 2ZUBA 3C16C 1UFQA 1ZC4A 2W6JD 1LF0A 2A30A 2F9MA 1C4OA 4PHTA 4WIAA 2PH1A 3U5ZB 4U02A 1S4QA 1KI1A 1KK2A 5K8UA 2I1VB 2A5FA 4HAVA 2CLDX 3ZVLA 2PBRA 1D9ZA 3SYNA 3VHLB 4G3XA 1G41A 1XPRA 4OHVA 2WMNB 4C0KA 1DG1G 3LVQE 3R7WB 4D81A 3ZLJA 2W83A 3IIJA 2N1BA 4EJSB 3OIVA 4MUBA 1JEEA 4DSNA 2OM2A 3TQFA 3SEAA 2TMKA 5FI0B 4B3GA 2P6UA 5DLQC 3PEYA 3UG7A 3IHLA 4QBHA 2OAQ1 1C9KA 3FKSD 1SVKA 5HE9A 4GSYA 3TAHA 2QPTA 1A2BA 4DBLC 4JKIA 1SQ5A 3PFIA 3QG5A 3I8SA 4K8OA 4HZUA 3G0HA 2IEZA 2BBOA 2Q9BA 1G7SA 1KTVA 3K0AB 1JJ7A 2OBLA 1OIVA 3CPEA 3PUWA 4C0BA 2JLQA 1OE0A 2ZYWX 3QENA 3CW2A 1CR4A 3IQWA 4M1WA 1QHHB 2HLDD 4UNNA 5DN6A 5TDHA 2ZM5A 1GSIA 1FPMA 2CHQA 1N5LA 2OT3B 3EX7C 2DHRA 3K8YA 4TL7A 2G3YA 4LV6A 1IY2A 2WTUA 4Q1DA 2F43A 2EFDB 3SN6A 3VFDA 1R2QA 1VHLA 1NL3A 3AKYA 2DYKA 3NH9A 4P33A 3IKJA 4F93B 1LFDB 4JZKA 1GUAA 2PT7A 3ONWA 4HB2A 4RJLA 4KO8A 1T91A 2YVUA 4ILEA 4U5XA 2CL6X 2WOJA 1MV5A 4QNRA 1W0KD 2IYUA 5C46F 5J4LA 4CEJA 2QP9X 2WKQA 1QHIA 2PEYA 4D4KA 3BC1A 2QSYA 4M1MA 3FGNA 4MRSA 1E2HA 4TYWA 2ZROA 2ZRIA 1ZUIA 2AX4A 5LD2C 2DY1A 1QDEA 1CJUC 2FGKA 4MRVA 4XWOA 4RVCA 2YJTD 1YHNA 1Q44A 1X8KA 2QP3A 3CRMA 2MSDB 4NL4H 1U90A 5KNCA 4HAXA 1CRPA 2P6NA 2ODWA 2ZU6A 3U7EB 4V0NA 4PX9A 1ZVQA 2B8WA 4M9QA 4BFSA 1P9WA 3B13B 3EASA 3B8HA 1TF5A 1U98A 1RYFA 2VHCA 2F7SA 1SGWA 3QF7A 2QM8A 4URXR 4A82A 4Z8XA 1D2NA 1E2PA 4M1YA 2R6DA 1G8FA 2FNAA 1CP2A 2REBA 4R2HA 2QQEA 2C04A 5CLLA 3RAPR 1T8UA 2C95A 3K0FA 3P20A 4OK5A 3PJRA 2RGCA 2GJ9A 3SU8A 3GLHE 3EPKA 4TLDA 3I1FA 3BH6A 2R65A 1T5IA 3BD9A 3BOSA 1R0YA 4Q4JB 4ITRC 1RRFA 3ZD7A 1D6JA 4EJSC 2L0XA 4KVAA 3KKNA 2V55B 3PUYA 2WJVA 5LPNA 2J46A 1VIYA 1W2HA 5BQ5A 4BEJA 3KKQA 4RD4A 4DKXA 3FFAA 3K9HA 1M74A 1T0HB 2X2FA 1PUIA 2H7VA 3RRZA 4UNSA 5EE3A 4GOXA 5EP4A 3V00A 1I4LD 2H5EA 4B74A 4DLYA 5AJYA 4IVRA 2IXFA 4OI1A 3BXZA 3Q5DA 2QTHA 4EPWA 4QKQA 1XX6A 2ZVQX 2W0MA 4G5SA 3U3JA 2QEQA 4HAUA 1EFHA 3B9QA 3ZD6A 1Q22A 1E0AA 4KFUA 1WB9A 3RS0A 4BFWA 5TB5A 1JPNA 3RVBA 2G1JA 4O25A 2GAOA 1G19A 2PMKA 2OAP1 2NZJA 1ZIPA 2ODBA 1M6NA 3R9IA 4HAZA 3RDPA 4L9SA 4M22A 4B73A 2ERYA 1R5BA 3BFVA 1OHHA 3L82B 1OH8A 1CKEA 1YZQA 2VSFA 2CCGA 2IF2A 2A2ZA 4Q4AB 3QPVA 4BLQA 1W4BA 3OEHA 4PQYA 4BRUA 2W2XA 4B2LA 5CITA 4FCWA 3EXAA 5J47A 1G8HA 3U2QA 5C1BA 2OUKA 3RSLA 3D7MA 1UBFA 1E2DA 3UG6A 1WF3A 1KNXA 2YNMA 3X1DA 1QHXA 4QG7A 2FPMA 3TSOA 2HYIC 1OB5A 4TTRA 3T15A 1Q12A 3P26A 2AK2A 1QHYA 2GCOB 4PANA 1SVMA 3N5CA 1EFUA 4DZZA 1RKBA 3K09A 4AKEA 3GEIA 2PJZA 1LB1B 1S1CA 2XTZA 4IFBA 4DLRA 5K8LA 4TZ0A 3GJ4A 4C0AC 1XTQA 2QT0A 4QJ5A 4YQFA 4A92A 3C41J 2OEPA 2F55A 1DTSA 1YZGA 2VP0A 4JBWA 4QBGB 5AUPB 2GXAA 3GJ6A 2ZS9A 1BYUA 1N3BA 2FGJA 1Q1ZA 1S9DA 4WZBE 2V9PA 3UKDA 1GAJA 4HATA 1E2QA 4URYR 4ZCLA 2ZE8A 1I2DA 2WWWA 3IO3A 2I3BA 1TQDA 4LC0A 3LRPA 1ETUA 1QG4A 1VTKA 2BVNA 1RYHA 3GLHB 5FOTA 4H1UA 4JIMA 4BZXA 5DE3A 2P6RA 1E3MA 1IXRC 5FTNA 1NF3A 1OJLA 3TW4A 3MWYW 4DSUA 4NYMQ 2OILA 3RS4A 1HYQA 3ADBA 2IXGA 1NN5A 4RD3A 4I81A 2GF9A 4B34A 4Q4AA 2CCKA 3NEYA 4K81B 4PZZA 5DHAA 3MWKA 3T1OA 2IA5A 4URZR 1NY6A 4A4DA 3K0SA 3M6AA 2X2EA 3K70B 4FMDB 2LKCA 4Q02A 1FNNA 3OIYA 2JASA 2IUSA 2WAXA 2V6IA 1I2MA 1SHZA 2ZANA 3EIHA 2W6JA 1T3HA 5J4VA 2IYRA 4DSTA 3KTAB 4AIIA 3VR1A 3HR7A 1SXJB 5BXQC 1ZNXA 5EE5B 1W0JD 5LB4A 3JVVA 2XNSA 1D8TA 3GMTA 3LLUA 2E1RA 5KYKA 4ABYA 3L0IB 1NMZA 2Q3HA 2OFWA 2IWHA 5FL3A 4TL6A 3W8NA 4O3MA 3NWJA 1HA3A 3WBKA 4BLPA 4HYYA 2ODNA 2D2FA 3NTUA 5KTYA 4TYPA 1OFUX 4QFMA 4HLDA 4OQLA 1LV7A 3LW7A 1IOZA 2RGAA 5E4FA 3AUXA 4I1VA 3ZS8A 1L8QA 3PCRB 3T1QA 3SE0A 1TMKA 1E94E 3DZDA 5FOXA 3WYGA 2QMUA 4AYXA 2VO1A 1YRBA 1HURA 1KO8A 3MRSA 3CRRA 4JL8A 3TQCA 4QHTA 3TR0A 1X1SA 3O8RA 4JJZA 4YMSA 4LHXA 1IHUA 1KYIA 3DDCA 5FUVA 4A1FA 3NC0C 2MMCA 1Y3AA 2QE7A 2GZHA 2J41A 2CCJA 2ONKA 4Q1CA 4G0NA 1Z5ZA 4NCJA 1RRPA 3VKHA 1M7GA 2PZEA 3T5GA 3A1WA 4M1SA 3KFVA 1DPFA 3AVYA 1X8LA 1N0VC 2GF0A 1KK3A 2HXSA 2PJRA 4Q47A 2IUTA 4ESVA 1XF9A 1S1MA 1DAEA 3K09C 4PHHA 1R8QA 4LJ4A 1W48A 2QN6A 2CJWB 2ZSBA 2LKDA 4DC9A 3WMEA 2ZI9A 1C1YA 3VNVA 2XSZA 1FX0B 2GILA 5EP2A 4C0HA 5JECA 2B6HA 2BMDA 2CXXA 2WOOA 3AV0B 3G82C 4KU4A 1KI7A 2F1HA 4TSFD 3IBYA 2WJGA 1CLUA 2OLKA 3FMIA 3PITA 5EXPA 5E7IA 5L3RA 4CGZA 3I5XA 2J0SA 4KYIB 1JBKA 2C03A 2NO0A 3A1SA 3OZXA 4W5HA 4CIDA 4DIEA 5B2ZA 1T4GA 1AJEA 1G3UA 2ZR0A 3BERA 4HB4A 4A0GA 1PLJA 1RIFA 4JLAA 2DFNA 1R4AA 1W0JA 4IRUB 1OF1A 1GKYA 4D2IA 1G7RA 1KI2A 4HUTA 1IONA 3NIBA 3GCGA 2CJWA 5JZVA 1IQPA 2XJ4A 1UBCA 2PX3A 2IF0A 4KFTA 1DELA 3VR2A 1K5DA 1Z28A 3Q72A 4A36A 2ZRMA 2FOLA 1ONBA 4BUJA 4R9UC 3AQ4A 3FHCB 3BWDD 4PC3A 4Q9HA 4WAUA 3CRVA 2ZREA 1XJQA 5LBIA 4S2EA 2G1KA 4C0QC 1CULC 3P4YA 2WJHA 3LBIA 1Z6TA 2VF8A 2JLRA 3E70C 4NCKA 4QGGA 2FEOA 3WHLA 4URWR 1XEWX 5EJEA 4FWTA 3HYTA 3QVVA 1P6XA 4EUNA 1A5TA 1BKDR 3MFYA 4PPQA 1RPZA 2ZI7A 1VYVA 3OAAA 3GFTA 3VTKA 2PMDA 1ZCBA 3DPUA 4BQSA 5M04A 1CR2A 2V1XA 4LBZA 2GHIA 1SKYB 2J0UA 4KI0A 4OJQA 4DVGA 4KCGA 4XSHA 5GJCA 2HJGA 3MWJA 4D6PA 3ZYCA 1U0LA 2FMXA 1AZTA 1N25A 2OCBA 3LBNA 1JECA 1XU4A 1KJYA 3DO6A 4NCHA 4Q9KA 5DNYB 3TNFA 4B76A 1CF4A 3UWKA 5FR2A 1QBKC 3L0OA 5GJWC 1JQLB 3N2IA 5BYKA 2X8AA 3TAUA 4EIWA 5CK4A 1ZNWA 1SKYE 2PCLA 2AL7A 4ZCIA 1QG2A 5EUMA 5L3QA 3AP3A 1JI0A 1GDDA 3U6BA 3CPHA 3ZDQA 4YMUA 2J7PD 1AS3A 1G3MA 1SULA 3C4JA 5EZ6B 1WP9A 5SZJA 3NBYC 1VHTA 1X1RA 3T12A 2KSQA 5C2JB 2WV9A 2XNDD 3AUYA 4LJ8A 3RYTC 5E7MA 2ZVPX 2XZPA 3O8CA 1X3SA 2WJJA 1IN4A 1YZKA 2CLCX 4CDGA 1J7KA 2ZSAA 4UJ3A 4LUCA 3AM1A 4QM6A 4GL2A 1ESNA 3QPUA 1EFCA 2OV2A 2X19A 721PA 2NO7A 5JCZA 2AXNA 2BEJA 3EZ7A 1YZUA 3GJ8A 1XJ0A 4LDJA 1KI6A 4PHFA 3CIOA 3FFBA 3EWSA 3K9NA 3UK6A 3OEHD 2OSBA 2JCSA 4DSOA 1G5PA 4TYYA 2REOA 3SQXA 2IYYA 2O5VA 1P4SA 5KSZA 3GD7A 3FYHA 1DAKA 4P4UA 2O8FA 2YWGA 4BECA 3DMDA 4LBVA 2ANCA 2QT1A 3U7GA 1UDXA 4US0R 1GVNB 2D06A 2Q3FA 1W4RA 4XH9B 5FOWA 5CDFA 2O8BA 4RD1A 4JVMA 2GEDA 5CJPA 2MSEB 2YWFA 2IYLD 4OK6A 2ZYUX 4QC2A 1LTQA 5HPYB 1Q1EA 1Z6YA 1RRCA 4WZ6A 5J5CA 1P60A 3CF6R 3SJCA 3VU9A 2UZIR 1DAHA 3EPJA 1E2EA 2Y8EA 3FVQA 1UPTA 2MMGA 2Q9CA 4BZPA 3R20A 2ZJZA 4LY6A 1ZM3A 3E2IA 3GEHA 1DAMA 5H8WA 1RRGA 2FU5C 4KODA 4BLSA 4PZYA 1G64A 2JDID 1E1RD 5FL7A 1KI3A 5SZKB 1FQJA 3AKCA 1P2SA 2QA5A 2HYDA 2VHQA 1IY1A 1KOFA 4C0LA 1N6HA 2LWIA 2XJ9A 5LD2B 2AN9A 1N5KA 4LI0A 4B47A 3GLGA 1UKEA 1SXJA 2GJ8A 6Q21A 1E4YA 4UXJA 4MDEA 1H65A 2W58A 3HJNA 2FWRA 4RY2A 4ON9A 1TF2A 5JI2E 1NLZA 1TEVA 5FOUA 4MQBA 4NE2A 2IEYA 1CS4C 1XCMA 1ZD8A 3LW8A 3TH5A 3CWQA 2KB0A 4NBSA 4TQ9A 3NDBB 4E5UA 4I1OA 2WKPA 1T3SA 3U4QA 4B32A 2R62A 4JJKA 1XNJA 1BOFA 2EFHB 1T0JB 3RHFA 5KDOA 4LJAA 4AD8A 821PA 3LFUA 5J4KA 3TUZC 2IK8A 2WJYA 4GOKA 4OK3A 4XTRA 3FPAA 4HLUA 4URVR 5JJLA 2YZ2A 2BOVA 4GRAA 2GXSA 1ZCAA 3AP1A 4FMCB 1AKEA 2GZDA 2V4ZA 3JZAA 4QL3A 3T35A 3VKWA 1P62B 4F38A 4TMWA 4DUGD 4B3BA 4PSVA 1DO0A 1AK2A 3P1JA 1SKQA 2JJ1D 3ND9A 1VCIA 4DLUA 1M1YE 4YMTA 1KI9A 2GNOA 3LVRE 3A6PC 3T06B 1Q1BA 5A0FA 4M9SA 2YKGA 2VSXA 5JCPA 4EPVA 1E1QA 1ZIOA 4UNPA 4PQRA 3C7KA 2XXAB 4MGKR 4IDOA 2YOGA 2GKSA 2VHJA 4BGDA 2ZI6A 2Z4RA 3L8ZA 1E9SA 4GI7A 2ZTSA 5HZHA 4Q21A 4K46A 3VKGA 1DAFA 1IN5A 4UXIA 2ZI4A 3OHMA 4IXMA 4NYMR 2BIFA 1F6BA 3C5CA 5ELXA 3KKOA 1HE8B 1TNDA 3GLFA 1KIMA 3EWAA 5JFGA 3M0EA 1OSNA 3SBDA
chains in the Genus database with same CATH superfamily
3BIJA 3DHVA 1PQYA 2JAUA 1P1IA 2HL6A 4RDHA 1AV7A 3FTNA 3I1IA 1XZLA 3OZTA 1C50A 3S1AB 3GP8A 1TX4B 1HYEA 5BT8A 1FVHA 1BU8A 2A9VA 2J7PA 2H17A 3EAQA 3HL4A 4RVUA 1W76A 4HEA6 1C3JA 2A4KA 2QTRA 4LZZA 4INZA 4XDHA 5BYAA 1RC0A 2B9VA 5LYJA 3KWLA 4U7TB 3PR1A 2JLUA 4RDCA 5HE8A 3CEMA 1FDIA 2BFBB 4TZ6A 1Q6YA 1TA9A 1NE2A 4NYJQ 1ACLA 1UCFA 2NYUA 3RC7A 3DHWC 3FCYA 3K53A 4L5IA 1S3SA 4XCQA 1QOZA 3DPIA 3K94A 4CFSA 2FRXA 3EEOA 1BG6A 1YAJA 3E81A 5K3SA 1MMFB 3LL4A 1YCDA 2C98A 2CMHA 5IXYA 1HV8A 2Q3DA 4NCBA 2JJYA 3BGWA 5ED0A 3FNGA 3V1MA 1NLMA 4BQIA 1GIAA 1KBZA 4C4TA 4V0MA 1J39A 3E7XA 3IH5A 2HCTA 4LRSB 1G1MA 1EDOA 5F12A 5FPYA 2SHKA 1IWPB 2WNHA 3L01A 2HGSA 4BKUA 2J9YB 2HQBA 4B6FA 2AKAB 4G0PA 3R8FA 3R09A 4ZOLA 4EHHA 1IN6A 2R6ZA 1GZ3A 3H1GA 3HSYA 1BDHA 4OXRA 3N8DA 3C8HA 3FHTA 1EK2A 1A50B 3MJSA 2BT4A 2QPAA 3GQBB 4GM4A 4EF4A 4BN4A 1SC1A 1KMHB 3KPWA 3EDQA 3ZV4A 1VJ1A 4H7EA 1OBOA 1JR3E 1QHNA 2SICE 1TJYA 2EF0A 3DZHA 4G5OA 4Y6SA 3B2QA 2W2LA 1T1EA 1X92A 3LCUA 1YONA 1E1QD 3T7SA 3NOQA 4YJHA 5C5DA 3ESXA 1YR3A 5JFOA 2XZDA 1O94A 4FVTA 2OCGA 3KYCA 3W9YA 3Q88A 2BUCA 2ZAYA 3GFQA 5L6MB 1J9ZA 3A2KA 1X7ZB 3HCAA 4JI5B 4JSYA 4QGFA 4DJAA 1ZK3A 3NVMB 3C5EA 4L0CA 3F6SA 2JFXA 4R3NA 4MYCA 1S9HA 2QMOA 3SIPA 1U2ZA 3SYRA 1II8A 4BBAA 4ER0A 7MDHA 4NICA 2GLUA 4H3HB 1ZK0A 2FEAA 3BB4A 4P5PA 2ZE7A 2I2WA 4DLZA 2D0DA 2E2WA 4EA7A 1I2AA 5JS1A 4TRNA 2M32A 1KO4A 1DEOA 2JFZA 3FYUA 5CURA 3ZLBA 2H65A 5MHTA 1ESMA 4U7HA 2ONZA 2K2WA 2RHGB 3MS7A 4D3ZA 4N1AA 4NEHB 3D7RA 4R9NA 3RNOA 3X1ZA 1KZ7B 4BOYA 3ECSA 3NAGA 1DG9A 4LRYA 2WU8A 1QV7A 3D3KA 4YP7A 1DLJA 1TGVA 3D02A 2ONJA 5IKPA 3MXTA 1NVXQ 4ILKA 4N3NA 3LPDA 1RWPA 1ICEA 4L15A 2HUNA 1R0BA 1MZVA 1DT5A 2QN2A 3SZMA 2RIRA 4EG6A 5KNCD 4BO2A 4HSEA 3FDZA 2KS6A 3KAPA 4D9CA 3DJYA 1QTIA 4QGSA 1E1CA 4BX2A 1DT3A 5JCOC 2N46A 1E0SA 2O3UA 2C9ZA 2Z2JA 1M2KA 1P91A 1JH8A 3I5AA 4I2VA 4MB0A 3QYPA 1P9NA 3CRNA 1HEIA 5J4HA 2C7PA 1FNCA 2I66A 2JK1A 4HWGA 4ISCA 3N8GA 1OXUA 3K6JA 4JXKA 1UR5A 1UC9A 1JDZA 1K75A 2Q9UA 2WSLA 4R16A 3SF8A 2QI9F 2YWHA 1E3EA 3BE6A 1A1SA 1H5QA 2GAJA 5CFPA 3VH3A 3H97A 1EE9A 1TZMA 1T2CA 1Z17A 4FZRA 4RVGA 2UXDB 1GTMA 4G6ZA 3CXRA 4OATA 3K1TA 1U6JA 5I9NA 4OUDB 1ST3A 2PZGA 4NK4A 1S0UA 4J3FA 2YMMA 2WWYA 1AF7A 3ETEA 1OPRA 1I4TD 5B1DA 4YQEA 4OHWA 3WYFA 4LTMA 4L0DA 2JIZA 5TQ2A 2NUAB 1A88A 5CVVA 4ACAA 1KVRA 3H16A 4O63O 4OHUA 1AXRA 5ELMA 1ZR4A 1C41A 2B8JA 2X9QA 3LFTA 5JD4A 3ENQA 4HDNB 4EY7A 1O95A 1LBIA 1M8PA 4OKSA 3SNKA 1NG9A 3CNQS 2BC9A 2QLMA 1MPTA 3LDAA 4JOCA 4ZTBA 1ZBQA 3LXXA 1PZGA 1ZU4A 4Q9NA 3OEWA 4R1MA 4L73A 3ACBA 3U0BA 4OOFA 5DBIA 1F6WA 2JIRA 3Q8MA 1TK9A 1I0IA 3FWHA 5KKNB 2QUIA 3NVAA 5UKDA 5MGNA 2IUFA 1SOAA 1EFPA 1UM8A 4MITA 1Z08A 4Z0PA 3T9EA 2NU8A 3UAOA 4D9FA 1E6UA 2R68A 3BXXA 1XVUA 3QVKA 4B5LA 1QZUA 2NO5A 3QUSA 3ROTA 3LSTA 5BPHA 3DTNA 2HZ7A 3ABIA 3LNCA 4RABA 2C4TA 4HRYA 5TF0A 2PT6A 5EIBD 4HXEB 1WOYA 9ATCA 4KNYA 2VWHA 2DE0X 2P40A 5LDHA 4J0KA 3VPFA 3WLAA 2GXQA 2Q1WA 2QSZA 1S3GA 2FG7C 3KTDA 3PIIA 5TX7A 5BNTA 3EZ6A 4R69A 4UE6A 1L5HA 4D9BA 1RWXA 2JLVA 3CINA 1JXMA 4JY7A 3HI4A 1YVUA 1A7UA 4ML3A 4XFDA 1I4EB 4YT5A 3TYXA 3LO5A 3VRHA 2HT1A 5EXTA 3U3ZA 1DKMA 1OXVA 1V0JA 3C7CB 3BMOA 4BQNA 1MHTA 4F4FA 5LIRA 4Q48A 1G63A 4GYWA 4KQJA 3GGGA 4YC7A 1U2TA 1YIDA 2R00C 3FRJA 3OFVA 1G5FA 3ZXXA 3FETA 4AMUA 3ZJ5A 3RLFA 3AFNA 4ZI7A 4EWLA 1JB9A 3WJAA 2RB4A 3BILA 3CCFA 5KI6A 3VV3A 4HBGA 3QMWA 1EVZA 3FUTA 2Z5FA 4PQFA 1FX1A 1RYYA 1FC0A 1Y4SA 4KIWA 4OI4A 1L5HB 2HBRA 4S24A 4BNKA 2AOTB 1JEDA 1MIOB 3KUUA 3DWGA 3OZDA 3W3ZB 2DFLA 3R3YA 3ICPA 1X1TA 2JA1A 2J3JA 3T9AA 4EYGA 4JHLA 4OJMX 4WKPA 5J5AA 4YV0A 1SB8A 2BZGA 4P0TA 3QTTA 3WAGA 1E66A 3FNEA 4P35A 1BWSA 1U0OC 1RFGE 2I8CA 4E5SA 1IAVA 4J0JA 5HHTA 1EYZA 1G18A 2JEYA 3UMJA 1Q77A 1TQ4A 4LFAB 3JQEA 1W44A 5JSKA 3L8FA 2V54A 4FBMA 3WL7A 3QWFA 1LJLA 2OFFA 1CUGA 5LXTB 3WGNA 1AGPA 5LMNB 3UIEA 4BKOA 3RT1A 1FU4A 2EFCB 5LM3A 1YL6A 3D5TA 2A33A 2H9IA 2MINB 1RAFA 2GZSA 3A1NA 1SC3A 1I7NA 3P7MA 2YZMA 4MHOA 5DZSA 3VMMA 4O4JA 3JY6A 1BD3A 4JC4A 3W90A 4COKA 1UAYA 2XXAA 3T5BA 1Z39A 2IODA 9GPBA 5B37A 1LDEA 7YASA 5LLDA 2GN0A 2B3DA 3FCXA 2WIKA 3MHTA 3O94A 3H2JA 1O1YA 4UDXX 1N3LA 3ACCA 3KX2A 1XQYA 3CQ9A 4L72A 3A4TA 1BN6A 1H23A 5F5NA 3P9YA 1YKGA 5KU7A 1HTWA 2BR4A 1DDGA 2HBZA 4GZ5A 4BJ3A 3NOXA 4M37A 2HA7A 3G0IA 4RZSA 2QD2A 1QC5A 4ZXFA 3UCXA 2C7BA 5JSQA 2HJRA 4DLSA 4QATA 1OVMA 4NV1A 1TB4A 5F51A 1V2GA 2XRYA 2DG2A 2HQOA 4NOLA 4IL5A 1RQ2A 2PZ8A 3LTEA 3VDRA 1FE8A 1SVWA 5KNLA 1LZLA 2V7PA 1M5UA 3D6MA 3BRSA 3MCZA 4X85A 4IMIB 1UOQA 2X7JA 3HKBB 4IQFA 4K87A 3WGHA 2OCLA 4EQ6B 3L40A 4IOKA 1KAOA 5HUQA 1HZZA 3EZNA 3UV6A 1MT3A 3P4XA 1COWD 1N0UA 3B1ZA 4AMBA 2XUKA 4XUCA 5U4QA 2ICAA 2ZRLA 4YMLA 1UBEA 2VSOA 1F1BA 1NYQA 2FSFA 2FZWA 4Z7JA 4R9VA 4G85A 2MJLA 3V32A 2V96A 4MYTA 1EX9A 5KHOC 4WDQA 4Q9DA 4HFRA 4X60A 1VIMA 3EZ2A 4MV6A 4N9QA 3BPSA 4DMLA 4E5YA 4JXXA 1F51E 2GS9A 3ESQA 3GU3A 3RBXA 4F5EA 1HE1C 3KUDA 4HAWA 4YRQA 3LFHA 3SX0A 1HDEA 4BVFA 3QVLA 2WLSA 2QTLA 4N0QA 4D79A 1CRWG 3IS3A 4D42A 3RRNA 1OKKD 1L2TA 1O58A 3COYA 3H3XA 3LA6A 3QLVC 4HTAA 3E53A 5JWHA 4DWJA 2Q3JA 5IEBA 3WIDA 5IH3A 4TRMA 3F1LA 4IKEA 4BEBA 2ZUUA 5JQWA 3VU1A 1FSZA 3KLBA 4A26A 4EJSA 1FTNA 3HN6A 4NZZA 1NIPA 4XYGA 4U9UA 4IOLA 2Z5GA 3TBKA 2WD7B 5K3CA 3CX7A 3EGXA 2BFDA 2Z2IA 6YASA 4WOCA 2HLDA 3DW1X 4HDOB 4KEAA 1RPAA 1X7XB 3NHLA 1VMAA 1T6YA 5CW1A 4L3VA 1MRSA 2DPLA 4W1QA 4MWZA 4MPPA 1GRRA 5EUBA 4W1PA 4A15A 5HCNA 1UINA 1T4MA 1IBCA 2VP5A 2ZIXA 4UMEA 5DBOA 2ZBFA 2NYAA 4L4SA 4W5TA 3DQPA 1V16A 1WUYA 5DHFA 2OHJA 2UAGA 5CD9A 1WVMA 1S8FA 1Y1SA 1D6SA 4JOSA 3SAJA 2WJ4A 1T26A 3K05A 3GRAA 2V45A 4L76A 1ORRA 4FFOA 3WADA 4X7PA 4QXOA 5C34B 4ZI7B 1KRXA 1B73A 1W9HA 5JYBA 4MP3A 3FPGA 5BYJA 4U0KA 5JYDA 3R3XA 1BEZA 2PXAA 1XLVA 4RZUA 2M6LA 5DM70 1JLMA 4ZREA 4UAGA 2DBYA 1AS0A 1TKRA 1VFNA 1GTG1 2ZCUA 2PSDA 4IHQA 1K4YA 1C7JA 2O7NA 3FNBA 3QEMB 4NG5A 1JR3D 4OXKA 4R1QA 4WJZA 3SQNA 5BR7A 3AF6A 2V4UA 3E0QA 5IWCA 1M72A 2CE2X 3A3NA 2RAPA 2YMPA 5I3ZA 4J4TA 5F4BA 1SELA 4E88A 5A02A 4NFHA 2O3TA 2FPIB 1F8UA 3B82A 1OGJA 1LVGA 2JFOA 3DBHA 1WABA 4ITUA 2H7YA 2BMAA 3CWCA 2CYAA 2F1JA 3DFZA 4JP3A 2F3RA 3R5XA 4B9EA 4CCSA 2RH8A 1J8FA 1RCUA 1SXJE 1GNPA 1HRDA 2ZRBA 3GJYA 3E15A 3KQVA 1N9GB 2YWRA 5BO5A 5BW6B 1ZIYA 3QX3A 2Z30A 2WA1A 3O4HA 4XVUA 5KVVA 1W5BA 1ZJYA 4N41A 2NP6A 2BLLA 1OYWA 1UP6A 1NJFA 2EJVA 2WFMA 4JN6B 4YJ2F 5G0UA 2IV2X 5DX0A 4OV6B 4Q6WA 4HQFA 3KVVA 5CM9C 1E0KA 1EPUA 2VP4A 5A06A 3UWDA 2M9MA 2BKUA 4Z6KA 2E85A 4L50A 3BWYA 3IIMA 3DXZA 1O87A 2ECPA 2I6QA 4Q03A 3BZWA 2JIZD 3JZMA 1KK1A 4KRYA 1JNXX 1OA0A 3SSMA 5DX1A 5EHZA 2QGZA 3FMOB 2B4TO 3TFWA 2E5LB 3T1VA 2J09A 1C9DB 1P5HA 3BIWA 3E18A 2RHBA 3EJWA 4JD5A 4PO8A 1C7RA 2WHPB 2X0JA 3G02A 2ASVA 2NX2A 4MVJE 5AJZA 3K96A 4G65A 1IZ7A 1MQ8B 2NXJA 3H1FA 3QLTA 3MAJA 4LYAA 4D74A 1DC7A 5CFRA 3VJMA 2VK1A 2JL1A 3CNHA 1YVRA 2RCYA 3VYVA 3WDKA 4D9KA 5B30A 1TYDE 6NULA 4Q0MA 3SBEA 3L06A 2YN2A 2ZJ2A 4XD7D 1R8SA 2CLSA 2IYWA 5EFZA 1DU4A 2OG2A 1RWNA 2J33A 3U1VA 3U7QB 4XGQA 4EEZA 1T6NA 2DXIA 3K9FC 1YTUA 2GT1A 4BMZA 2VRBA 4YRDA 3H5TA 2QMEA 3OCXA 1O0BA 1U1GA 1TFRA 3HCDA 1E6CA 1JQJC 3LZ6A 1O89A 3NRCA 4DN6A 3KYBA 4GFDA 2EFJA 5I9IA 3RE1A 3GLFE 1UBNA 5K09A 3M1YA 3ZGXA 1CVIA 2I0FA 5ITZA 1ISSA 3KQOA 1E7YA 3GRCA 1AUOA 2P27A 3ZHBA 3CYFA 4GYKA 3C5HA 3SS8A 3RVDA 5JR3A 2Q6VA 5GJVC 4O29A 1V5IA 5BMVF 1A8SA 4DAEA 1MB9A 3K6RA 4Y1EA 3TMKA 4C6TB 4JLKA 1MNQA 3FB1A 5FI5A 4DBLE 2PLRA 2CMFA 1R00A 3L0PA 5FRDA 1NXOA 5KNDH 3QKWA 5HKLA 2PS0A 1X8XA 3IUEA 4CU5A 1TJPB 3R7WA 4FD2A 4P36A 5MN5A 3EXEA 2EWWA 2XTMA 4DRZA 1XMIA 2AOUA 3CZMA 2ASEA 2K7ZA 3GPCA 4M8NE 4BWYA 9LDBA 1BW9B 1UF9A 4GOLD 3W04A 2UV8A 1P81A 1PFWA 2FX3A 5A3VA 3FH0A 2YH2A 2W70A 3B3QA 4BVHA 1HNNA 1VHQA 3HQ4O 4B85A 3LOPA 1H9BA 3IUPA 4PIMA 4PLCA 3ETJA 3ZDCA 2FPPA 2ILTA 4K8RB 3H1PA 3NNSA 4RJIA 1AV6A 4WY8A 1SHJA 4PZLA 4FGLA 3D6HA 2GA9A 4BLUA 1UT8A 3G5LA 3HU2A 2GYVA 3SD7A 4YJ2A 4PU0A 1QPGA 3LCJA 3AR8A 3MOSA 1AURA 1J2RA 3NM6B 3LZDA 2W6CX 1HG0A 4M7PA 3A25A 4NPHA 3MWDA 3ZJUA 2AB0A 2HPAA 4S1VA 5F2NA 3COSA 3CUVA 4CLHA 1B0AA 4V02A 1SNYA 4KMOA 1RMYA 5DHTA 2ROQA 1XMXA 3Q6IA 4Z0NA 4DCGA 4XRGA 3ZS9A 5HR5A 1UKZA 4WGGA 5ALWA 1W2GA 2NSLA 1I4WA 3AXSA 3W9BA 5JY1A 3GCWA 2FXIA 2B5OA 5EHQA 1M83A 2ATXA 1TGYA 2BGTA 2IYXA 3L18A 3TFOA 2JLYA 3EEIA 4RMIA 5FLXA 2YHBA 3VTAA 2EHDA 2CL7X 5CDUA 4OQPA 2FDCA 3MUFA 4DQVA 3I92A 5G41A 3SBXA 5JUWA 1PR1A 2QN8A 1N6OA 3WIBA 4BU0A 3SFVA 1OFVA 4TMKA 3N3AC 2DHEA 4ZRDA 1M2EA 1VRCA 5CIWA 5IC6A 2H0AA 3K8QA 1K97A 4TLEA 3HKCB 4G89A 4GX5A 2VPTA 4PV7A 3FUXA 1WMDA 2D5BA 4GX2A 1QR6A 1MVOA 1TVKB 3PDHA 3PRYA 4H7PA 3PC7A 2I4IA 2BFCB 2F1IA 2QU7A 4D0NA 2H0QA 5C81A 1Y5RA 3PC6A 4R4JA 1ZRNA 3HRHA 2VG8A 3QUBA 1RZRD 1M7BA 2G1PA 2BR5A 2QTNA 4ZOCA 3LIIA 3U7FB 1ML3A 2JB9A 1GG9A 2N3ZA 1VHDA 5JH7A 5JW6A 1CLEA 3HL0A 3A1VA 3ZKWA 3HP1A 3AF3A 3P71T 4W8OA 3K71B 3IBCA 2GYWA 3C8UA 3I1YA 4MKIA 1CW2B 3N6VA 8ATCA 2H06A 2V6BA 3GIDA 3IMGA 2W2VA 4AB1A 4D9HA 4F9GA 5HM6A 1T8TA 3WNBA 3WGUA 2UUCB 4C4XA 1GWNA 1UBHS 3O9VA 5JJ5A 5FTMA 1KETA 2D00A 3KB2A 4OYHA 5L3VA 4G5GA 2O1SA 4U7WA 5IARA 4XSVA 1B8NA 4LEIA 4C3UA 1Y9AA 1YQQA 1NMYA 3MSXA 4JI6B 4A8PA 2EJBA 4M53A 3C6QA 1XTVA 2IITA 4LMPA 1Y3CE 4EATA 3PKIA 3L9XA 1IQUA 1C80A 1GTZA 4ZHSA 2DECA 4F3NA 3L6CA 3FNHA 4CM7A 2Y66A 4HRVA 5KKCA 2Q6OA 2XMZA 1YVDA 2YY5A 4N01A 3U17A 3ULKA 5BV2P 3DD5A 4MDFA 3R44A 1SBNE 4KQ2A 3BAZA 2G9RA 1XEFA 3MGBA 3O8NA 5AJWA 3WL8A 5D7NA 2O7RA 3B1YA 4MARA 4OGFA 5CXQA 2WM9B 1P75A 2IYNA 2RGNC 5JNSA 2WVAA 1OWOA 1SVIA 4RESA 4G5HA 4XYEA 5ILQA 2W2OA 3QF4A 3CB4A 4PYLA 4FEAA 3GJSA 3KNZA 3PG5A 3ESAA 2YC2C 4OAOA 5FPTA 3F5MA 2EARA 4U2DA 4UUBA 2LIPA 4EL5A 3SDBA 4ND8B 4PR0A 1VGVA 1NKVA 5GONB 4AJJA 1P33A 5DP1A 4CV3A 1G16A 1NDHA 1KS9A 4M46A 3EYAA 2OD7A 4C1BA 3K0AA 4W5QA 4OA5A 4CV0A 1X80A 2BFFA 1QTQA 1QIDA 3O92A 1HK7A 3HHEA 3UB4A 1FNDA 3U81A 2QY6A 3BQMB 3N7TA 2ATCA 2AI2A 1FDUA 1TW2A 1U94A 2G0AA 3GOHA 3O3MB 3ZHVA 3Q0EA 2O3SA 2EZ4A 3NC4A 3WS7A 5ALHA 1DP4A 3NR2A 1FB5A 3FSRA 1RZRA 5EMMA 1HEUA 1NKTA 3FCAA 4DLXA 1PLLA 1M1UA 4RPLA 3FOAA 1HQYE 1P1BA 4RHFA 5BN3B 2WF6A 3N75A 2B2CA 1DG3A 3QFSA 4TMZA 4ER3A 2F6RA 1RYDA 4TSFA 3FTEA 2I99A 3WGTA 2WJAA 2VPXA 3F9CA 1SC4A 4LGYA 2VWGA 1LSOA 3GJ0A 3NBQA 1QGOA 2C3UA 2CB9A 3MMPA 5KMGA 2AXEA 1U4SA 1W46A 2R79A 3J80A 4MR8B 4XQ9A 3BE5A 2DLDA 3FDXA 4B9AA 2K5UA 1ZX1A 2DTXA 2Q5IA 1V5EA 1D1QA 3REQA 4JLVA 2JFVA 4AXXA 3ITKA 4GRIA 4C6TA 1ZLYA 4E22A 1B23P 4MX8A 3GLHA 1LH0A 3UUEA 4HNGA 4O4LF 1G2OA 1N4AA 1YC5A 2FPUA 1QRSA 4M0EA 2H54A 1T1SA 3H8SA 4IXNA 1NVVR 2GHRA 1U0HC 1C30A 1CUEA 5I4BA 2AUMA 1OA1A 3CMCO 1OCEA 2ECKA 4H0NA 4X90A 3V4PB 1WPQA 5K0TA 3M7IA 4WLNA 1A5SB 2CHFA 2I6TA 2X6QA 4H59A 5A71A 1ADYA 1Z7YA 3B6JA 4S05A 1YRWA 3HUFA 4OA8A 4Z9AA 5JWRA 5KEIA 1KJWA 2AMFA 3NS7A 4MQFA 1L5FA 3A6ZA 5K0ZA 1U8AA 3EEQA 3NJRA 4UUOA 4G26A 3DCJA 4XDYA 3ICEA 3JD3A 5AUQA 3FYUC 1JHPA 3WWEA 2CT8A 2QUJA 2W8BA 3UMCA 3LRTA 3VYWA 1WTAA 2ZJ3A 4YIHA 3E48A 1HLFA 1AY0A 2FUG6 2JAWA 4RK0A 1TVCA 5FNVB 5AWFC 2HF8A 1T35A 2ZS8A 4J8PA 1WDMA 5E3HA 1K86A 4GYJA 2FR1A 2FLWA 3ZWVA 2Z9BA 3PR3A 5DEOA 3WGGA 4ZO9A 2QHXA 4RIEA 3CF4G 3EZLA 1PN3A 3JU3A 4ZO6A 2D62A 5T3YA 4WLOA 5IXSA 3LM8A 4R1TA 2C77A 3OEEA 2JKVA 4FB4A 2G71A 3C39A 3GLIB 2MR5A 4XWKA 1U2EA 2A5GA 3FCOA 3R3HA 1KAEA 1QX4A 3TNYA 4KLNA 4DDKA 2OV4A 4Q82A 2RIPA 4KYUA 1NBMA 3MJCA 2NT4A 4ETWA 4Z7QB 3ZZTA 2UYGA 2DTDA 4A2WA 4KN9S 2XMPA 4IDAA 2PAFA 3WXBA 3IQZA 4JLNA 2HJHA 2RHLA 4MH0R 4A0HA 4F3CA 4DGSA 1HR0B 1P9RA 2HLNA 3EDMA 4LKOA 4Q4JA 3KJEA 2V7XA 2HREA 3KJIA 3C6BA 3RSFA 4BPBA 1F2DA 3GNTA 4GP6A 3VH2A 1RABA 1T9GS 2Z3WA 4FFMA 1SBQA 2R25B 1IWBB 3BYZA 2RHDA 3QHQA 4AWXA 2EV9A 4BWVA 4CDMA 2CVZA 2IOHA 2Y1WA 3AW8A 2VSYA 1XVIA 4FDVA 3STHA 4BFUA 1LVHA 2OXTA 4CKWB 5IG2A 3PC3A 3SVZA 1F8YA 1G5TA 1CJKC 1HDCA 3CX4A 4M83A 4BB6A 3NXSA 3UWMA 1U1DA 1UDCA 4CCYB 1UBRS 1HDZA 4UEKA 5TSDA 1H3NA 4CIXA 3QOWA 3RIXA 2R5FA 2ZJYA 4K86A 4M0LA 4CM9D 1MC5A 2OBXA 2P35A 1N2HA 2PT9A 3EE6A 3IOCA 3MOGA 4QUJA 4JJEA 1BE8A 3FUVA 3LK7A 3PJDA 5E0KB 4BE7B 3U3OA 5KC9A 5L53A 3FVVA 1PG0A 1PUXA 3OLWA 3QY0A 4ID3A 4YAOA 3NW9A 4XZ3A 1NQXA 1ZXBA 2YV2A 1YOVB 4K6FA 4X8LA 2GESA 2BM9A 4TKUA 5ALSA 2IXTA 3L0YA 4C22A 2GASA 1JJFA 2J3DA 4JIGA 4E0BA 4OHYA 4KR6A 3K0KA 3GOQA 1M1NA 4X7RA 1EVQA 3AR7A 4GMDA 1WZ2A 3EIXA 1G38A 1XZFA 3O82A 3QOFA 4Q9LA 2WF8A 1C4KA 4PR3A 1L5RA 2FPXA 4RIIA 1RQRA 2WHEA 1CP3A 2R4TA 2X4DA 2YNMC 5I6DA 4Q24A 3CVYA 1ML4A 1QB7A 2AFIA 1H2XA 1S02A 2AD1A 1PHRA 2PUAA 4IJUA 4KN8A 1QO0D 3E1SA 1GNQA 1AUQA 3L93A 1LI7A 1YA8A 3K5HA 3QU9A 1JXOA 2CXHA 3DTVD 1OZAA 2R7NA 4RCZA 3DYBA 1VLQA 3NX4A 4B3SB 1YL5A 1PWXA 2KM1A 2I71A 4YWHA 1GR0A 1K6JA 4BNZA 2R96A 2DH5A 1SHUX 2XLCA 1KQ3A 3ANSA 4TXNA 3L2OB 1PVDA 1QYWA 5EGNA 4RQTA 3UMVA 2A7QA 5CW2A 4BUZA 3WA7A 1B1AA 4JP1A 4W9NC 4LWQA 1E6WA 1RJEA 2GK3A 3DG9A 3GEPA 3FE2A 4IZIA 1J90A 4WESA 2GZMA 1PNOA 3KEOA 4REQB 3W79A 1XCOA 3AOEA 4EFKA 5HQ3B 3FXAA 1DBIA 5B1IA 5TPWA 4B8YA 4QDKA 4EB8A 5CB0A 3O90A 1SCIA 4GMGA 4NZYA 5K0LA 3HWX1 4QHSA 4WKOA 2PYZA 1A8QA 4IEIA 3WFJA 2O3JA 3B1XA 3N3BC 3IUJA 4LMRA 4RK5A 1OAOC 5EPEA 3WKDA 2AVDA 4DHWA 5FLKA 1HL7A 3OA0A 1MX3A 1E2UA 1IBRA 4MTLA 3ZOZA 2ZT8A 3L8YA 1W8DA 4JLPA 2GARA 4FHFA 4UTXA 4Z99A 1UH5A 1KE1A 3VU8A 5A3RA 5KREA 2P0EA 2LCFA 4WA8A 1ZI8A 2BM0A 4FW8A 4INPA 5FWNA 4DJTA 1H3FA 3F98A 2QRVB 1N1GA 1JG4A 1KARA 3PSAA 2FI1A 1B42A 3HXMA 3GFOA 1OB2A 2O0LA 2WIBA 4PC2A 2O8EB 3ZIAD 1RYZA 1FFWA 4AUEA 3K6SB 2HWUA 1MIHA 3BMNB 3AINA 1RLUA 4MRRA 3DNMA 3AERB 4EGQA 2QLNA 3E9RA 1ZJ6A 3LP8A 4WERA 1H85A 3DV0A 4FD3A 2C61A 1ZD9A 3BJMA 4MW4A 1Q1QA 4C4OA 3LCRA 2CZQA 3KYIB 4QRHA 1E4OA 3NO4A 2W0SA 3CU5A 1YRYE 5K3EA 4YMVA 1A9RA 4LK2A 4PZCA 4O4JB 5U9CA 3NEPX 1CSEE 1BRTA 4II3A 2EYUA 5T5QA 5JOQA 3KXKA 3MGGA 3NUGA 4LX8A 1QFSA 3N0WA 1N7HA 1TAQA 3FNIA 3KVNA 4O2RA 3EWNA 3STVA 3WQSB 1UBJS 2WD8A 3QE3A 3RU3A 1BHO1 1IM5A 1LNSA 2GBLC 2VF5X 3CVOA 3HZZA 3UJPA 4AI6A 8ADHA 5KOHA 5E4JA 1T9ZA 4PQGA 4MVYA 3AJ9A 4EJ2A 2QK4A 4REQA 4FYIA 1C9EA 4AJOA 3PEEA 4DC0A 2ECFA 2EBUA 1DIRA 1W9MA 2Q2OA 3HJAA 2QKYA 2HU7A 1REQB 3UM9A 4K0RA 4B7ZA 1U9IA 1XZGA 1RXEA 2OTCA 4WMLA 4XLTA 3KQLA 1TC2A 2LXNA 3E7PA 2Y1LA 1P2BA 4LV5B 1OYOA 1L6RA 4O2LA 3RG2A 1CUFA 2VNAA 3I4LA 1K5HA 1K88A 1Z4QA 2NAPA 1KEEA 1MZPA 2HNKA 1VJ5A 4MAFA 4MQEA 1DZIA 1GQQA 1SY7A 4W9NA 1F5NA 3RJ5A 3DAFA 4ZMBA 4GPTA 1N2EA 1X15A 4XIIA 1ZXLA 2CNKA 4IIJA 1C7ZA 1P7VA 1A1VA 1QAQA 4A8TA 4ME6A 2HV8A 4QJBA 2R7LA 4TVOA 4U5QA 4JB8A 1D5WA 2DLCX 1E3DA 3I9KA 221PA 2M1ZA 5FFNA 1IY8A 4QYSA 1P4GA 2CUNA 2F43B 5I7WA 1ENPA 3SZRA 4OFZA 4V0OA 1GA6A 1KH2A 3I6QA 1EGQA 2VBFA 4FFNA 4FI3C 4TV8A 4Y6OA 4KJZA 5CT4A 4LHVA 4W5JA 4ZRNA 1FUIA 1XRLA 1YE3A 1SIWA 4FOSA 4J49A 2Q6IA 5G1NA 3TBFA 2VT3A 2BYTA 1J2UA 1MJGA 2R1TB 2ZYDA 4GRDA 2CGEA 3Q3EA 4GL4A 4R31A 2F4NA 4D9GA 1W7AA 4M88A 4JENA 2ALJA 4PZ9A 2X9NA 4R8MA 3N59A 1BDBA 3FWZA 4G5FA 2IXEA 4PFKA 5KCMA 3GARA 4BQFA 3MJ4A 3F3YA 1DWUA 1ZSNA 2PHZA 3DO5A 3CUTA 4PGAA 1IHOA 1BHQ1 1R0LA 2A59A 4JB0A 4Z9FA 3EMDA 4HRAA 4WK2B 1QQ5A 4CKWA 2HX1A 3K16A 4EJFA 1XUOA 1H42A 4GVXA 3REFA 5K05A 1GHTA 3D8SA 4KDEA 4MGIR 3MPOA 4NNPA 4XX0B 4Z54A 2C5AA 5IW8A 3OOYA 2RGWA 3IAS1 4EENA 1QJCA 1EX6A 3N1UA 2DR2A 2GBIA 2Y6VA 3CNEA 1GZ5A 1Q83A 1SFRA 3HU3A 3KWFA 4P9NA 4YI3A 5BWLA 1U1FA 2CNWD 1LPOA 4PXAA 4RH0A 1COWA 4BJHB 4Z4FA 1E79D 2UVDA 3HVHA 1Z56C 3KE9A 4ZPXA 4GSKA 3CXUA 1A4IA 4IJKA 5KYVA 3U4QB 3CNBA 1H0SA 1MKYA 2ZUTA 5IT5A 1R8JA 4AZWA 2GD2A 2C78A 1GFIA 3I2HA 2JI4A 2H51A 3U62A 3ZHCA 4CF7A 5CU7A 1Q7CA 2FP3A 1GKUB 1E9DA 2WQZA 1RLOA 2YV1A 3EK2A 1R6VA 4MINA 4WLFA 3STXA 2NVWA 3M49A 4FFSA 1W36B 5AXCA 2F4VB 4GLJA 1RS0A 1R6BX 2IW1A 3FZNA 3L7DA 2PEZA 3OQNA 1DSSG 3FPKA 1XK6A 1CYEA 4X20B 5BT9A 5F3DA 4RXUA 4NMLA 1MB0A 2QM7A 3QG1A 5T8KA 3WMRA 5LWHA 3HEMA 2PKCA 4TV9F 5H68A 1QHEA 3OZFA 4PZ0A 5BV0A 2Z5VA 4M1ZA 3F6BX 5FWAA 3WR5A 5C9ZA 1NBHA 4OL9A 4NE9A 4US2R 1FP1D 4OB7A 4YMWA 1VL0A 4RFVA 1FTWA 4G84A 3UMRA 3U3DA 3LDHA 4EZBA 3P9IA 1Z13A 2R44A 1L5VA 4HEA1 4XGKA 3SX4A 4YEDA 1GZSA 2A7XA 4DXDA 1CHNA 4HQRA 1B15A 5JSZA 1UOOA 1ZGBA 1LS6A 3DDOA 4D56A 3IDSA 2R87A 1F6DA 2X23A 2ILVA 5FJIA 4E1AA 5KHAA 1UBSB 4KTVE 4DLBA 4JV5B 5H80A 4E31A 4D43A 4CM8A 1MC8A 5EUQB 2OV3A 2QM3A 4LRQA 1G21E 3LAWA 4CYMA 5BN4A 10MHA 1VPLA 1Q19A 3DE1X 3EVDA 4EDFA 3L6DA 4XDZA 1EAMA 3VR3A 4YPFA 4BNTA 2PGDA 4MP8A 3L7YA 5FT9A 1N6LA 5C8YB 4LY9A 2VK8A 4RCYA 4OL0A 5LQSA 3ZWQA 4E4RA 2PVSA 2ZZKA 5C3UA 5K45A 5LR6A 5ALNA 4DV5B 3CLUD 1II8B 3ZCTA 4X66B 1S01A 1KMNA 1V4NA 3N0RA 3NHJA 4LJ6A 1HM5A 3QUTA 2AKYA 5GMOA 2DWOA 3KUCA 5H4HA 3DL0A 3JWJA 3Q41A 2QRNA 1YIOA 4OHKA 3QE4A 4F6RB 3KBOA 3M6LA 1RSZA 5J2TA 1DE0A 2GJSA 2VH5R 2AG1A 2WTMA 3QFCA 1CYDA 4I5DA 3EQ2A 1DJPA 1U8FO 2HA5A 3KXLA 3PD0A 2ZKIA 1DAGA 4M98A 3MVEA 4UJ5A 3LPAA 4U7GA 1B7GO 1JIUA 1DS6A 1J1UA 1J7JA 3HKDB 5A2QA 4KQFA 4C7MA 2G9NA 4EJ6A 3C1AA 2VYFA 3OPXA 4DIBA 2G0TA 4DXAA 1W2WB 1UWKA 3WAJA 2JFUA 1KZ4A 1G8SA 4R84A 4UHKA 5DPMA 1FIUA 5AM0A 2VRCA 1GV1A 2FRDA 3LQRA 5BV8A 4WXPA 1UPUA 2A9PA 1RXSA 1YMVA 4QUHA 3TW6A 1RJ9B 5IVDA 1BE0A 1XJCA 2OGTA 3SLKA 4C87A 3MG9A 3E1KA 1NSFA 1L4FA 4FILA 5TQVA 3O93A 5AVVA 3G59A 4FHDA 3NHUA 4ZOLB 4F92B 2GHQA 2BGGA 4LE1A 2XUJA 3STWA 3RPEA 3SYTA 4RFLA 3CHYA 4B31A 2ZRGA 4A27A 1I13A 4WXEA 1XXHA 3QKRA 5ECDA 2ORIA 3WYNA 5ADHA 3DEJA 5LA6F 1G6OA 2XCRB 5KNBA 2NOAA 3F71A 5B36A 2TS1A 3R8CA 3TE6A 3QNUA 5EINA 3MIZA 3PUXA 4NAVA 3AJDA 2EJUA 3CX3A 3OQBA 5EMLA 1YRHA 1PZHA 1W4AA 1DWPA 1N6RA 2C4MA 4NJOA 1ZGGA 2C7QA 2GM4A 5IYZF 3W5AA 1QONA 3KUKA 4FFLA 4J1QA 6CHYA 1SEPA 1FUKA 5A1TA 1JILA 2X2OA 3MQ2A 4RTJA 1PR4A 4ND6A 3AFIA 4QGAA 4RLFA 4MV5A 4R71A 3ADOA 3IERA 2YL2A 4NU5A 3KJNA 9MHTA 3GLGB 1MOZA 2ENUA 2JS7A 1AK1A 1GKKA 1RMTA 4U2KA 5H59A 3WNQA 1RAEA 4DY6A 5GONF 5BQPA 3ZD8A 1WHSA 3CLKA 1US8B 1O9GA 4R40A 2V03A 4L16A 1XFAA 2G17A 5EJFA 1ZKMA 7MHTA 5KTRA 1NJ8A 1NW8A 4CMBA 3EVZA 1N77A 4TMTA 2PMWB 3MK31 2O19A 2JDIA 4DLLA 5EZ5A 2V7UA 5HF5A 2XZTA 2C2HA 3WBJA 3ABSB 2I2AA 3HGQA 3QU2A 1WLSA 4DIUA 1KEKA 3DVSX 3LHFA 3V5NA 4DNOA 2XZLA 3RVOA 5A03A 3TJRA