5CIWA

Ran gdp y39a mutant monoclinic crystal form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 69
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ciwA00
4H9GA 2ZE5A 3IQXA 4FXPA 2QBYA 3E1SA 2PMDA 3HR8A 1QHXA 2J45A 2VP9A 4JLKA 4YDHB 3NKVA 4PPNA 5DI3A 5EE9A 1GSIA 2WPDD 2WWFA 1TQ2A 1WF3A 1S4QA 2QAGA 4Q5IA 3K0CC 3SZRA 3KJIA 1G64A 2ANCA 3EWSA 4K81B 4RJLA 4G01B 4LJ7A 3UPUA 1VIYA 2EFGA 1JI0A 3VMFA 2NQ2C 3CRRA 3DKPA 5A0FA 2IS2A 1US8B 3GLFA 1KAGA 2DYKA 2E87A 2NO1A 3QXCA 4M1WA 4C7OA 4B3GA 1Q1EA 1GZSA 4HAYA 3BJIC 4O2LA 3UMFA 1VG0B 2GKSA 2OAP1 2P6NA 1T5LA 1PZNA 1CLUA 1R8SA 3TE6A 1S96A 1DG1G 2A5GA 1Z22A 4KCGA 2ZRBA 3GFOA 1E32A 4TQAA 4DJTA 5GVSA 1N6KA 2CCGA 2EFDB 2ZITA 3B1YA 4HDQB 4C2TA 1Z8FA 1P2UA 3GLGB 4QM6A 2IT1A 1G6OA 2BC9A 5E7JA 3QKRB 4TTRA 5AR1A 1WCV1 2C77A 1A2KC 2YWFA 1XPRA 4K8OA 1XD8A 3SDZA 1UBCA 4BUJA 3HU2A 1T8TA 2ZAOA 4URZR 1P4SA 2IS1A 2VP5A 1H65A 2ZAMA 2QA5A 2XX3A 5CDFA 5JJIA 4LJ6A 1EGAA 1IAQA 1KK3A 3KQKA 1E9FA 1W0JA 3RLFA 5FTLA 1GG2A 2DFNA 3DHWC 3N5CA 4LHYA 2IUUA 3SI7A 2FFAA 3F8TA 2AN9A 2BIFA 4QOSA 3NDBB 4Q1FA 5CYOA 2ZVQX 4UNSA 4AKHA 3QF4B 4N1AA 5ANRB 1Z0DA 2IK8A 2Y8EA 3JVUA 2FFHA 4Q03A 4M8NE 2G6BA 2QGNA 2OUKA 4Q7KA 2CXXA 2FU5C 2RGNC 4A82A 3E2IA 1CKEA 2EU8A 2WJJA 2ZI5A 5JLJA 2XNDD 2OHFA 5EZ5A 5F98A 1YE8A 1YRBA 5CIWA 1CTQA 3ZIAA 4WVFA 1E9AA 3A1VA 3QXHA 2PT7A 4NONA 4XIGS 1BIFA 1GL6A 3CR8A 1M7BA 5JRZA 2J46A 1ZM4A 2WM9B 2RGXA 4HI0E 4D2IA 3AVUA 2BWJA 2VSOA 2Z5FA 2JIZD 5AJVB 3RS0A 2YJTD 2YOGA 4AKGA 1ZUIA 5AJXA 1Z5ZA 1VPLA 1G19A 2QM7A 1KZ7B 4JLDA 3LFUA 3QNUA 5EQTA 1R0YA 3B1ZA 4QG7A 4QXAA 5FPTA 2IEYA 3QY0A 4JLNA 3SYKA 4MUBA 1W36D 3RDPA 3F5FA 2O8DB 1G41A 1OHHD 3VR2A 1XJQA 1E0JA 2W6IA 2CL7X 3WMFA 4DCVA 3HPRA 3EX7C 1Z63A 3FFAA 4LJ4A 1OLOA 4YC7A 1XBTA 4FCVA 1E2QA 2ZSEA 3UMSA 1W1WA 1RJ9B 5CM8B 4EPXA 4Q7LA 4JL5A 4C0QC 2X77A 1U9IC 3I32A 3NEJA 4TMWA 4BZXA 1HEIA 2N1BA 1W4AA 2MSEB 5GVRA 1JPJA 1YR7A 1AS2A 4LHVA 4R2HA 4AIIA 5FL3A 3DEFA 1Z0KA 3FKSA 3EZFA 3AKCA 2A5FA 4JSYA 4PO9A 4BFSA 5JECA 1TAGA 3T15A 5C46F 4JLPA 1ZM3A 2IYVA 1SXJB 2ZS8A 4HUTA 3THYA 1XPUA 2NO7A 1NSFA 2G77B 2GZAA 1OH5A 2DWQA 4TL8A 1N0WA 2AFIE 4YONB 2C96A 1YVDA 3AF2A 5JWRA 4TMTA 3O8DA 3X1XA 1GOTA 1P7CA 3K09A 4Q19A 5SZIA 1KI9A 3EXAA 4ZIRA 1XEXA 2AK3A 2HV8A 2J7PA 2VSFA 2QGZA 4MA4A 1FOEB 3NBYC 4B3FX 5HZKA 2ZJBA 5KSZA 3VKGA 1N6HA 1NIPA 1I2MA 3CRW1 1VG1A 2NOAA 1ZCBA 2I4IA 2G83A 1S9HA 1D2MA 1KK0A 2MSCB 1P2TA 1ZJ6A 4TQ9A 4U5XA 2ZXUA 2FEOA 1G7CA 1VECA 4H1UA 1E69A 2YYZA 5DH9A 2WMNB 3BORA 4A0FA 3TR0A 2G0NA 4DDTA 1VCIA 2GK6A 4MGKR 4NTZA 4URVR 3VR5A 1LF0A 2X1VA 1NMZA 5KSYA 3AVTA 4MRNA 3IEUA 3MD0A 2OLJA 2X8AA 2J0QA 1KJYA 5JJLA 1CP2A 2O8EA 1N0VC 4URWR 1Q1QA 2VHUA 2ZSFA 3SBEA 4GRAA 4NCJA 5LD2C 3IO5A 4IVQA 2QN6A 2IUTA 1ZW6A 2YWGA 4TLCA 2ODWA 2V8OA 4JYBA 1VYTA 5FI0B 3MG9A 4N3NA 3EIEA 2OFWA 1N25A 1NP6A 2RB4A 5CB6A 5HR5A 4OQMA 1MH1A 2MMCA 3VQTA 3KDSE 1X1RA 4DKXA 1NN1A 3RS2A 1P3JA 4KFUA 1NMXA 3VTKA 4BFZA 4A1FA 1NLZA 2H8KA 1E9DA 1UDWA 2IYQA 4L9WA 4OI1A 3RHFA 4V0KA 2O8FB 4C0JA 3B13B 3SE0A 4DXAA 3UG7A 3EG5A 4JT4A 4E07A 2KWIA 4TLDA 3Q3JB 1RRPA 1VDZA 2RAPA 4M9QA 2VEDA 3H84A 2IL1A 3EPKA 4C4PA 2GAAA 3DZ8A 2CE7A 3EA0A 4A6PA 2H16A 1ZIPA 2P65A 1FP7A 1TU4A 2J3EA 2QT1A 3CPJB 2QPAA 5FTNA 3SEAA 4HUQB 3EPLA 1D8TA 3BXZA 4XVUA 3CNOA 5GJBA 1G291 1XX6A 3PVSA 4UNPA 1FUKA 4DT1A 1SVMA 2ZROA 1E9BA 4QBGB 2X2EA 3L0OA 3GLIE 2FWRA 2WWXA 4DSUA 1VIAA 4A4DA 3ZD6A 4OI4A 1XTQA 4YLGA 2GEUA 4XWKA 3LAWA 4M1TA 3IILA 4HB0A 3U60B 1E9EA 4NCNA 1SKYB 1GITA 1XTJA 1L2TA 1N6LA 2ZU0C 2JLZA 1OKKD 2YC4C 5FL7D 3LNCA 4IRUB 3ONWA 2ZE8A 1OT3A 4O25A 1II8A 2PZGA 2FG5A 2ZE7A 1U8ZA 2WV9A 1N6NA 721PA 2VHCA 2FFBA 2R65A 3ASZA 4RZXA 1A7JA 5DSZA 4PQRA 5C4MA 2WWGA 5BW8A 3ZDQA 2O8CA 5C1BA 3W6OA 2OBMA 4HDOB 5DYGA 1P73A 2O0KA 2F1IA 1M34E 5DE3A 3ECCA 2GBLA 4QHSA 4F4JA 1GAJA 2JASA 2P5SA 3SHWA 3VR3A 4HAUA 1UFQA 2V55B 5DI3B 1QVRA 3ZVMA 4UNNA 4A0RA 2P67A 4ZI2A 1KK2A 4A6XA 2ZRFA 1FP6A 1XEFA 1NIJA 2PT5A 1KTVA 2C5LA 2WAXA 2KSQA 3QPVA 4AI6A 3L8ZA 4Q7MB 1FPMA 4OKSA 1PJRA 3IKJA 1XZQA 3MMPA 5IF9A 4JVLA 3NC1C 3ZS8A 1R6BX 4NP6A 1GTVA 5GJWC 3B7GA 1EK0A 3PFIA 3NBFA 1XJCA 2E9SA 5H1YA 2ZJZA 4W5WA 3NBXX 4C7OB 1IJEA 2VH5R 4MITA 1TMKA 2RCNA 3B8HA 1KY3A 1M8PA 1VYVA 4GFDA 2A9KA 4C0HA 5FOTA 4RFSA 2MSDB 3GEEA 2TMKA 2C9CA 1P62B 5KUTA 1COWA 1QHYA 3FPAA 4Z54A 4JLOA 2ZM5A 2HYDA 1GNRA 2NPIA 2CHGA 4NYMQ 4YMWA 4D4LA 3FMFA 2JLRA 1XMIA 2QP4A 3CNLA 3IIKA 4HZIA 4JBXA 3MWJA 4QGAA 3DOEA 2AHOA 2IXEA 4OHWA 4A2WA 1R10A 4BE7B 2QTFA 5P21A 5TY0A 1DOAA 1Q3HA 4A2QA 1KMHB 1UPTA 1E1QA 2PEYA 3WP1B 1YZLA 3G82C 1NLYA 1JB1A 2GILA 1RRFA 3FGNA 3NBZC 3TSWA 5JBQA 2G1KA 4C30A 2G3YA 1W5SA 3B82A 3TQCA 1OH7A 2ZRKA 2N46A 3W3ZB 3CH5A 3DM5A 4GPTA 3F0TA 2QENA 4NYJQ 1FTSA 4D80A 4NCHA 2D2EA 3U3RA 1ZC4A 2NZ8A 3GJ4A 3LVQE 3KQNA 5BXQC 4U00A 3CX8A 2OO7A 5FTJA 4FWIB 2ZU6A 4HLQB 4DIEA 4F7WA 3HPQA 4GMXA 4JLBA 5FUYA 2ZJOA 1Q3TA 2EFHB 4OHZA 4D4KA 3DVLA 3BERA 3EARA 2Z0MA 2WHXA 2AD5A 2V4ZA 5EP1A 3Q7QA 2HLDD 2QQEA 1CRPA 3AF0A 1N5JA 4E5UA 4JBWA 3NVAA 5B2ZA 1KI6B 1ZBDA 3CPHA 4DVGA 2QORA 1XCGB 4WZ6A 1S1CA 4A0GA 4CYMA 5HE8A 4R9UC 2C9YA 1JEEA 3FVQA 3N2EA 1NVVQ 3TKLA 2DWOA 2ZS7A 4S2EA 3X1DA 4MQBA 1F5NA 2BKEA 3U2QA 2ZRLA 4DWJA 1R0XA 1Z6YA 1E2MA 2P0EA 2XJ4A 1KDRA 1FL9A 2ZIAA 4C0AC 1CEEA 2W6JA 1OXTA 2F9MA 2FX3A 3GD7A 3GP8A 3GLIA 2ECKA 5K8LA 5JI2E 1UBFA 2DFLA 1JQJC 4NL4H 4FMBB 4M22A 3OFND 2Q9BA 2F1JA 2BEKA 2D74A 1RRGA 4GOKA 4LBWA 1TADA 2JJ2D 3CIOA 2Q3FA 1G3IA 2GNOA 5CITA 4XVQA 4P32A 3UKDA 4PHFA 4JVMA 1O87A 3EWAA 3H1TA 4PR0A 2WJHA 1XU4A 1E6CA 2W00A 3IPXA 4CEJB 1Q57A 2GVZC 2LKDA 1ESNA 3WMGA 4HLUA 4JVNA 2FPLA 4G5SA 5KNDA 4II7A 4LV8B 1L8QA 2RGBA 4BLQA 1Z06A 4A8JB 4HAWA 5FBQB 3ZD7A 2Q9AA 4A8JC 1NBMA 1L7VC 4XOIA 3RANA 3IBYA 4AKEA 3REGA 3WBJA 2CLDX 1TF7A 4ACBA 4B3DA 1XCPA 2V1XA 2ZRAA 3KKMA 1ESMA 3N70A 3QXSA 3RSLA 3KQLA 1MT0A 2ODEA 1KO7A 2VIIA 4M2LA 1E0SA 1F2TA 4DSNA 3V00A 3BK7A 2REBA 1F2UA 3OZXA 4ERNA 2ZRDA 4XD7D 1RPZA 4ZIRB 1XEXB 4U02A 4DCTA 4M21A 3ZGXA 3R8FA 4Q4HB 1KDPA 2DY1A 5IT5A 5JSZB 1G20E 4MDEA 3L0SA 3A4LA 4LYHA 5LBIA 4EPTA 2RGCA 1SHKA 3ND8A 2ODBA 4OI2A 4JIMA 2A5JA 3RWMB 2C2HA 2FEMA 2XAUA 2REXB 4KJZA 3U3KA 1G7RA 3GQBA 4PC6A 521PA 1OIWA 4UKDA 5AK0A 2QSYA 4KI0A 1G5PA 2FZLA 4PSVA 4W5JA 1W44A 1UADA 4V0ME 1OXXK 2ZJYA 1G8FA 4ZCLA 1G17A 2V6JA 3CM0A 2IA5A 3WHKA 1XDBA 1W4BA 2GXUA 2PCLA 4IDHA 2OBNA 4M9ZA 2QEQA 3VHLB 1Z3IX 1CBUA 2Z83A 4PQFA 2QPOA 4DLTA 2QY9A 1JJVA 1WP9A 1W48A 2A3RA 2XSZA 2O5VA 4KFRA 2XTMA 3W5JA 4CVNA 1VMAA 2P3SA 1DAEA 5HKKD 1AQUA 1ZD1A 4I1UA 5BN5A 4M9XA 2OLKA 1RW4A 1XD2A 1LF5A 3T1TA 1GKUB 1P5ZB 4TN1A 4OYHA 3P4XA 3HU1A 3OEHD 2BCJQ 5FPSA 1X3SA 1S1MA 4ARZA 3V4RA 5ELXA 1A2BA 2DPXA 2K5UA 4BLRA 1XXHB 1SXJD 1MABA 4DB2A 1DTSA 1CRQA 3P4YA 4MGZR 4MRPA 1ZCAA 2HDNB 4DSTA 3M6AA 4PC3A 1XMVA 1OIVA 4G1UC 4QFMA 2DFTA 1FNNA 4RD6A 3K9LA 1E2LA 2GTPA 1EFTA 2QE7D 1QRAA 5JCPA 2WZQA 4PHTA 1ZM9A 2FE4A 2GF0A 4BFWA 3LX8A 4MYHA 1KNQA 1EWRA 3Q7PA 421PA 4IOJA 1C4OA 5JZVA 3X1ZA 4Z51A 2WSSD 3I62A 2WBLC 1DADA 1DAFA 2BBTA 3L43A 3QG5A 4TL7A 1JR3E 1GDDA 2ATVA 5GJCA 4C0KA 3L0IB 4IOLA 1R5OA 2GEDA 2B7BA 2I1QA 4CW7A 2BBSA 4TMKA 1CJVC 2XB4A 2NPFA 3LLUA 3AUYA 1LFDB 4NDZA 1IN8A 3W90A 4D0LB 3FMOB 2R2AA 4KITB 3AP2A 2NO6A 1E0KA 1IY0A 1WBDA 3AUXA 1OH6A 1QHNA 4UQOA 5D3QA 1MRNA 2VP2A 4MYTA 5CLQA 3PUZA 2OE2A 4XWOA 5KPDA 2IYUA 1ZAKA 2FSGA 1GNPA 4EQ6B 4KBGA 2O8CB 3PG5A 1YJ5A 1X86B 4B3XA 5AWFC 2GXSA 1GRRA 4EPWA 1TQ6A 3MUFA 1RYFA 4PC2A 1AA9A 2ZTSA 3QSYA 4AKIA 2CK3D 5JI3E 4LWZA 4Q4JB 1M2OB 4DLXA 1YZKA 2FZ4A 2QMUA 4RCZA 1G3MA 1KDOA 1E9SA 2IYSA 3NTUA 2IYZA 2KBFA 3M4YA 1FW6A 2BMEA 2OXRA 1YQTA 3O8BA 3PUYA 1NI3A 1JPNA 1U0HC 4O3MA 2JLQA 2F55A 3K0EA 4IDPA 2QRZA 4WBSA 1AIPA 3HWSA 5K8IA 1JALA 4FCTA 2ONJA 3KTAA 2JLWA 3ZYCA 3W8RA 3SR0A 2KJQA 4RVCA 2JLUA 1D2EA 2NO0A 1GM5A 1P72A 1KK1A 4YXWD 4TL6A 2WOOA 4P3YA 1FTNA 1X8LA 3B1XA 4HYYA 2XXAB 1TX4B 4W5HA 3A58B 4GMDA 4YQFA 3KQUA 4NCIA 4R7ZA 2BBWA 3A36A 2YWEA 3KKPA 3PEUA 2DFKB 3C8UA 4V0MA 4LV5B 1LB1B 3WYGA 4A0HA 1NVXQ 3U3MA 3THXB 3TR5A 1T3LA 4M1SA 4Q48A 3RS7A 2IX3A 1KSJA 1K5GA 3BB3A 4RZ3A 4LHWA 4PSKA 2GCPA 1HY3A 4B75A 5KDOA 2XTNA 4JJKA 5EXPA 2EYUA 3I8SA 5D3MA 4P4TA 4I1VA 1KZGB 1SZPA 2GCOB 1KHTA 5LDDC 2V54A 1H8HD 2OM2A 3B60A 2XB2A 2QUZA 1P61B 3O47A 2WJYA 3BFKA 3R8CA 1BYIA 2YC2C 3RWOA 4DSOA 3I4LA 1EFRD 1EFCA 1HUQA 3H4MA 5E7IA 4U7DA 2F43A 1E0AA 2HF8A 3GJ0A 1I4LD 4Q4AA 4LC1A 5KYKA 3DPUA 4EIWA 4HLCA 2IYWA 4PZZA 5FUWA 5JHGB 3ICQB 2HXYA 3BH7A 4IEEA 3ZJYA 2XNDA 3AF3A 5AUNB 1SQ5A 1J2JA 5EXXA 3ASYA 1Q0UA 5JJKA 3SN6A 2BM0A 3RABA 1R0WA 3EPHA 1HT2E 1KY2A 3TVDA 1OB5A 2AFHE 2QTVB 1QHGA 2AWNA 1YZGA 4LC0A 4RKEA 2JIZA 4EJSA 1ZVQA 3IEVA 2XZOA 3PEYA 1AS0A 2PX3A 1M1YE 1GIAA 4FD2A 4KLZA 2NO9A 1JQLB 1UJ2A 3LBHA 2WWYA 3GLHE 2ZRGA 1JR3A 3C7KA 4KFTA 4Q01A 1G1MA 4Z8YA 5L3QB 4S35A 2YV5A 3UWOA 1AM4D 621PA 2PJZA 2KB0A 2ZI9A 3KKOA 3SQXA 3K8YA 4MGYR 2ZPTX 2OXCA 1QG2A 3HR7A 1OFHA 5FOVA 3THWB 1B0UA 4CIDA 2IUSA 1VG8A 1BKDR 1I4DD 1TPZA 4URXR 3P20A 3FDIA 1OB2A 1TQ4A 5F9HA 1HQYE 4B47A 4TZ0A 2X19A 1I4TD 4YDSA 1GL7A 5A4JA 1IXSB 3T12A 4CT4B 1AKEA 3SFVA 1E2JA 1R5NA 3OF5A 4UXHA 2YKGA 2IYLD 2XOKA 4B76A 2F3RA 4GL2A 4OHXA 1P9RA 1PLJA 4BPBA 2GETA 4DUGA 1MRSA 2PMKA 2Q3MA 3U6KA 4IDNA 3BC1A 5TDHA 2RHMA 4FIDA 3MWKA 2JLSA 1FX0B 1F2UB 4GP7A 4LJ9A 3JZAA 2FF7A 3SFZA 5EE3A 1ZP6A 2C9OA 1DAKA 4XTCS 4I4LA 1M6NA 3PITA 4LDJA 4PANA 1L4UA 2VA8A 5JFGA 1LW7A 1ZNZA 2ZJ5A 3OIYA 4JYCA 4KU4A 4KYUA 4URUR 1J90A 1HQCA 1CULC 2AX4A 4Q9KA 1WB9A 5GADl 1SXJC 3AVQA 5E4FA 4DLUA 2V7QA 4ITRC 3QXXA 3GJ8A 4GNKA 1N3BA 1NY5A 1R4AA 4TLEA 5CK5A 4DCSA 1N0UA 3NHBA 1E2GA 2XJ9A 1X6VA 3RSOA 3LVRE 5L8VA 4RCYA 4ZCMA 2W0MA 4WAUA 3W9YA 3JZMA 4D6PA 1XZPA 2VP6A 1N5LA 1WQ1R 2SHKA 3KQHA 2RGGA 4ZKEA 1RKBA 2XZPA 4QHTA 4BLSA 1Z07A 4QKQA 1AKYA 1P9NA 1FQKA 4B2IA 1TQDA 3QXJA 3EIHA 5CM9C 3FKQA 2JJ1D 2W6ID 2GWHA 2H1LA 5FPYA 3F3YA 3QOFA 3TH5A 1E2IA 1H8ED 3CNNA 3TMKA 5A5GA 4NYIR 1Z6XA 2W83A 4PZYA 4ZO4A 2Z6VA 4DLVA 2A30A 1W2HA 2WTUA 5H8WA 4JZKA 1MO5A 3U7EB 1G5RA 1XD2B 2X2FA 3AVWA 4FMDF 3B1VA 4ZI3A 3R9IA 1DAHA 4D4MA 4QJ3A 4ARZB 1U2RA 4M1OA 3K0FB 4KV9A 4DC9A 4WIAA 4Q47A 4D0GA 3OEEA 5LB2A 2GVDC 1R5BA 1NN3A 2H18A 1E79D 4CEHA 5J5CA 3ADBA 3GJ3A 4P4SB 3VKWA 1AZSC 1IN4A 1CJMA 1T3HA 2FV8A 2QMHA 3DMDA 2JLYA 2VO1A 1KDTA 5HCNA 5FOXA 2VF8A 1KGDA 1Q21A 2J7PD 2OZEA 3DM9B 4Z1MD 4Q1DA 2NMVA 2D4HA 1DAIA 2OESA 3SJCA 3CWZA 4KXFB 4HAVA 4X8MA 2FGJA 1OXUA 5G3ZA 4RD4A 1PVOA 3QEJA 1OKKA 4DDUA 2W58A 5FL7A 2YVUA 4P0TA 3GLHA 3GCGA 2R6DA 2ORWA 3GLGE 2WIBA 4US0R 1Q22A 1VYUA 2ZI7A 121PA 1JJ7A 2QL6A 1T3SA 1FUUA 5H68A 3GFTA 4EPVA 4TSFD 3WNBA 2HJGA 2ZSDA 4IKEA 3VHXA 2REOA 3ZZUA 2C78A 4Q1EA 2FMXA 2I3BA 3E70C 2IXGA 3AB3A 3P32A 4LJAA 1ZIOA 3GFPA 3I1FA 4GZMA 2RGEA 5DIFA 2VLIA 1NLFA 3H2YA 5J4HA 1VG9B 4QM7A 2GEVA 2ORIA 4LY6A 5B58C 1DEKA 3VR4A 4AWXA 2F3TA 4C0BA 2ZS9A 3EC2A 2IS6A 3U44A 1RFLA 1U0JA 3D7MA 4DBLC 3CKLA 4B32A 4ZV4A 4TYYA 4DIDA 5L3SA 4FWTA 4BWYA 1ZNXA 3D8BA 4RY2A 2DBYA 1BMFD 3QKSB 1QHHA 1YKSA 3MRSA 1SVKA 4CRWB 3GPLA 1E2KA 3WRYC 1F48A 1NBME 1NY6A 3CX6A 3EZ7A 2V1UA 2PH1A 4B3CA 2Q3HA 3DKVA 1Z08A 2QBYB 4QGHA 3G0HA 2PEZA 1NJGA 4M1MA 3UIEA 3CUEF 3T35A 3K1JA 2QG6A 4MKHA 3I61A 4PFSA 1JEDA 2VPPA 3KJEA 1U81A 3QVVA 2QAGB 5CB8A 1CR2A 2WJGA 4UJ3A 2QAGC 1UF9A 1LY1A 3T1OA 3Q8XB 1CJUC 4LRWA 1E9RA 1T9HA 3LDAA 3Q72A 2GESA 3FHCB 3GLFB 2B6HA 4LPKA 2ZANA 4KYIB 1LVGA 3ZH9B 3ZVRA 1QF9A 2XNSA 4GOXA 1ZD8A 1G8YA 2RMKA 1Z6AA 5DISB 1ZNYA 5IK2D 1XEWY 4MKGA 4F91B 4HATA 4ZDIA 2VSXA 3I72A 3SU8A 3OAAD 1I2DA 2RKOA 4GI7A 4LSGA 4TT3D 3TSZA 2WWWA 2W0SA 4ASUD 1CF4A 3CRVA 4XSHA 3MCAA 2XEXA 4IOMA 2JEOA 4CEIA 2C04A 2GDJA 3W6PA 2O0JA 2OCPA 2FN4A 4IHQA 1NJFA 2HLDA 4BZQA 2F43B 3H0KA 4MH0R 3TW4A 3PUXA 1CS4C 1DAMA 4Q21A 3VX4A 1K8RA 3K0CA 3P27A 5FH9A 2C95A 2QP3A 3ADKA 5E7MA 4G5GA 1C9KA 4OJQA 5SZJA 2O52A 3HYRA 2AD1A 1ZU5A 1E4YA 2IHYA 2J0UA 3LLMA 3BFXA 3KKQA 3RRZA 4WXPA 1G3RA 3SS8A 1NSTA 1PV4A 3EZ6A 1ZNWA 5FPHA 1V5WA 2YNMA 3M1IA 1DBSA 2D3WA 4D26A 1LTQA 3CO5A 2ZRNA 3GMTA 3OFNA 2PJRA 2XZLA 1E2EA 3Q5EA 1KO4A 3T1VA 3ZZTA 4ABYA 4FW9A 4MRRA 1R2QA 4JS0A 4LX0A 1E2FA 4BFUA 1SVIA 3KL4A 4DLYA 1RYHA 4DRZA 3ICEA 2AKYA 1ZRHA 4HAZA 4MUAA 2C8VA 4OBEA 3T34A 1PLLA 3SQWA 3U5ZB 1KJWA 3BAFA 3GLGA 2B8WA 3VU9A 4IDQA 3ND9A 2J7KA 3QKRA 5TV2A 5KOYA 1COWD 4GT1A 4P4UA 4XTRA 3QPWA 2EWWA 1J99A 1UKEA 1DG3A 1NN0A 2ERYA 3MJHA 5KSPA 1CJTC 3NH6A 2WWIA 4Z8XA 5EP4A 2JA1A 4B74A 4CGZA 4V0NA 2RGDA 1W0KD 2WSMA 4I1OA 3WY9A 1J8MF 1M7HA 5F2EA 4B6FA 1KKMA 2QP9X 1B23P 2ZRPA 1GRNA 1ODFA 3IBGA 5JS7A 2FOLA 5K8TA 5EXSA 4HB2A 3EIQA 5C2JB 2OSBA 3FTQA 3R20A 4XD7A 2J41A 3U7HB 1TUIA 4TWZA 2ZYWX 3O8CA 1XF9A 3IIMA 1XMSA 2J5XA 2GZHA 3QF4A 2R62A 2W2VA 1FZQA 3WRXC 3J81k 3R7WA 2HEIA 2RGNA 2BEJA 2WICA 3TAHA 3AP1A 1KOFA 1SHZA 2GAOA 1F6BA 1TL7C 1G8PA 2OV2A 3UMRA 1ZD9A 1U98A 1D2NA 1KI3A 4DCNA 4O0MA 1UDXA 2L0XA 2VTKA 1HYQA 3CF6R 2FPMA 1II9A 2BMJA 2BOVA 2QPTA 3MSXA 4OQXA 2Z43A 1EWQA 4N0DA 4IJMA 1Z2CA 3THYB 5JWHA 3TNFA 3ZZ0A 4QJ5A 2ERXA 2OEPA 3WBKA 4F38A 2G9NA 3BB1A 4M53A 4F93B 2F9LA 1XMJA 3NXSA 4L8GA 3K09C 3U3OA 4QNRA 4A9AA 1P6XA 1BYUA 2DCUA 2CNWA 5AJZA 4GDFA 3MJRA 3ZVLA 2ZRCA 4QL3A 4UNRA 1W49A 1WA5A 2O8DA 1UKZA 1T0HB 2PLRA 4WXRA 1QG4A 2QU8A 3LBIA 1QDEA 2GJAA 4B34A 4MDFA 3BIFA 4KSCA 3V9PA 1UBGA 1U9IA 1E1RD 3FYHA 2JGNA 2XTZA 1DO0A 2IYYA 3G5UA 1Z47A 4TLBA 3LWNA 5FBVB 4WW0A 1TUEA 5CLLA 1IOZA 1NVWQ 1OV4A 4IEIA 1S0UA 3OEHA 2O8EB 3PCRB 3AF4A 1NMYA 3OE7D 3C15C 3K53A 1SVOA 4HSEA 4TLAA 4OK6A 4PTLA 4D81A 3UG6A 5KDLA 2GRJA 2JCSA 1E94E 2H92A 5EXTA 3WNCA 3A1UA 3TAUA 1EX7A 2WAYA 2LKCA 3MWLA 1IONA 1OSNA 4DEXA 2EQBA 3W5IA 1GKIA 2R44A 4PO8A 3V4FA 2QE7A 3PENA 3TLXA 2QMOA 2PCJA 4XJXA 4B71A 1A82A 1SVWA 5FR2A 4I1SA 4JSTA 3Q9LA 2ZYTX 1CR4A 2D62A 2PX0A 4R2IA 2AXNA 1IM2A 3CF0A 4TYPA 3SC3A 4R71A 4XH9B 1N6IA 4OQFA 8OHMA 2WSSA 5HTKA 3P1JA 3KUCA 3IIJA 4TTQA 5FTKA 1NN5A 3TQFA 1NKSA 2A2ZA 2AR7A 3C5HA 4LV6A 4TMZA 4HLDA 2YINC 2HXSA 4X8OA 5AUQA 5TVKA 3WMEA 5SZHB 1OJLA 4HB3A 2ONKA 1GFIA 3D31A 5HZHA 5KO2A 4OQNA 2HUPA 5TXGA 1ZINA 2CLSA 1KO5A 4LJ8A 2IF2A 5FR1A 3FB4A 3T5GA 4LK2A 2VQSA 5DI9A 1M74A 4L4UA 3BWDD 4M9SA 1HA3A 4DT1B 4BRUA 2Q21A 4LYAA 4HAXA 2GXAA 2HT6A 1TF2A 4OL0A 2JDID 2RHDA 2FJUA 3IDQA 4D82A 3EA5A 2CK3A 3VX3A 3LY5A 1PUJA 2OG2A 1U94A 3KJGA 5BN3A 4NZYA 4W7SA 1IN7A 4X8HA 2ORVA 3FHTA 1Z0JA 4QBIA 3U44B 5EP3A 4A15A 2HCJB 1OE0A 3AVVA 1P60A 1VCMA 1II8B 1E96A 4UXIA 1FMLA 1PUIA 3AVPA 4BLPA 1T6NA 1IN5A 2FA9A 3PJRA 1N6OA 3PEWA 1VHTA 1CXZA 4JMPA 1II0A 4EPRA 3OHMA 4G5OA 3K0SA 4C3ZA 4IFEA 1DARA 4NCKA 3BH0A 4PQYA 4PXAA 4C9BA 4V02A 1CR0A 2WPDA 2C98A 2GJSA 5DLQC 3K0AA 2V9PA 3FHOA 2AXPA 1KKLA 2GBLC 2NGRA 3BB4A 3WXMA 2B21A 1AJEA 4F4CA 4C0SA 4LOAA 1TEXA 3HP1A 2VF7A 1NNEA 3HJNA 2CDNA 4HZUA 2GJKA 4LJ5A 1GP2A 4OK3A 1V43A 2ZSAA 1KI2A 3TJZA 2NZJA 1HH4A 1D5CA 1XTRA 2WJIA 1KO1A 3SJZA 1O3YA 3U6BA 1JAHA 4C2UA 1UKYA 3KZ1E 3KX2A 1R8QA 3GJXC 4RD0A 1H8HA 5EUQB 1SULA 2DWPA 2GCNA 1N2CE 2UZ3A 1Z83A 4KAXA 4BEBA 3AM1A 2FPKA 4V0LA 2B92A 2D7DA 4QRHA 3A4NA 3QI2A 3ZS9A 4ZDJA 3R9WA 1OFUX 3BD9A 4RFSB 3EASA 2CL0X 3QEOA 3VR1A 3B2EA 2CJWA 3K70B 2WJVA 3RAPR 4TTPA 4JVSB 3K70C 1G16A 4EFMA 5G41A 2BVNA 4BECA 2BV3A 4EFNA 1DAGA 2JATA 4CEIB 5J4VA 2ZRJA 2W2XA 1XPOA 2ZVPX 2B8TA 2ZYUX 1N5KA 5DN6D 4AC9A 1IXRC 4G0NA 4M4SA 3REFA 3VAAA 2JJ8A 1YZUA 2QQ0A 1F60A 2AK2A 2ZRHA 4J0QA 4Q9JA 3Q5DA 2AL7A 2ZREA 4NU0A 3SHFA 4RD3A 3JVVA 4AYTA 3A4MA 3TK1A 5FBLB 4B73A 1X8JA 2XITA 2J0UB 5HPYB 2PZEA 1UEIA 2IYTA 3LXRA 5EE1A 4TQUS 1SVLA 1FNMA 1LS6A 1AGPA 4JLVA 3T5DA 3RC8A 1MO4A 2QZ4A 4EPYA 1IY1A 2QI9C 1E3MA 3K9HA 4PC1A 4JLMA 1NL3A 3I92A 4ACAA 3RVBA 4Q00A 3PUVA 1DO2A 4KODA 5DYIA 4OHYA 1S9DA 3U61B 4JL6A 3RNLA 4MGIR 4NYMR 3KJHA 4XWAA 3CZQA 4WA7A 1W4CA 4LUCA 1IJFA 3PXGA 1AGRA 4GZLA 3VU9B 1U8YA 1D9ZA 3ETLA 4LCBA 2BJVA 4YMTA 3KB2A 1CIPA 5FUVA 1XNJA 5TB5A 3RS3A 3MGCA 1SKQA 1G3QA 1E2DA 1XCMA 1YRAA 2GXQA 3AQ4A 3QVUA 4G5RA 2VHJA 5FBRB 3TIFA 1KMHA 2EW1A 1C1YA 4NYJR 4US1R 3GLIB 4HDCA 4L9SA 1E2NA 4KLNA 1OHHA 2EVWX 5LB4A 3OIWA 4FMCF 1BOFA 3T06B 1UBEA 4RZ2A 5IHPA 1FQJA 3LXXA 3O8RA 2FH5B 3KUDA 4ESHA 1MR3F 2ZJAA 3RRYA 4CT5A 3EAQA 2FSIA 3LQQA 1XXHE 5CK4A 3ZVNA 1MO6A 4ZDKA 1XTSA 2P5TB 1VHLA 5E95A 2OCBA 2HF9A 4MRVA 3R7WB 1OPXA 5AUOB 1YR8A 5CIQA 2NIPA 4B3BA 4A92A 4HLUC 2Q9CA 3SJAA 2RGAA 1SGWA 1NVVR 4FINA 4G3XA 3QBVA 4XSGA 5G53C 4AD8A 4DCUA 2AKAB 1KI6A 4Q1BA 3FMPB 1S2MA 1U99A 1Q20A 3QIAA 4CDGA 4E09A 2PL3A 2ZI4A 3C5CA 4DEYA 3S1AA 5DGXA 1YZQA 2WMOB 4JLJA 1W0JD 3BH6A 1F2TB 4IVPA 4ILEA 3GEHA 4BLTA 1Z0IA 1OW3B 4GSYA 3ADCA 2GZDA 2H7VA 3EZ9A 3DO6A 2N42A 3SYNA 4DHEA 4NMMA 1VKJA 1E2HA 3QKUA 1MV5A 3KKNA 2YZ2A 1K5DA 2LCFA 3RRMA 1CR1A 1T91A 3X1WA 2ZRMA 2JJ1A 4JL8A 4YMVA 1PLKA 4CEJA 1G8GA 1JR3D 3KXKA 5CJPA 1H8EA 4NHOA 3PEVA 3PIRA 3SNHA 1WRBA 3KFVA 3NC0C 4NH0A 4PAOA 2WKRA 4IW3B 3TUJC 4A8JA 5UKDA 3ZIAD 1P9WA 1XJ0A 3A1WA 3B6EA 1KI7A 2DB3A 1KSGA 1YZNA 4BFTA 1GILA 3LQRA 2O8BA 2R6CA 2FSHA 4L15A 3R9XA 1DPFA 2ASEA 5DNYB 3KB1A 5EJEA 2RH5A 3OIUA 2H17A 5EZ6B 3IUYA 5BQ5A 4M1KA 1E79A 2YWHA 3L82B 2OT3B 1T4GA 1HE1C 1UKVY 4JJZA 1E4VA 4DDVA 4W9MC 4E22A 3GJ7A 4LBYA 1QZXA 2XOKD 4DB4A 5AJYA 5E3HA 3P26A 3U4QA 5C4GB 1OXVA 2KE5A 4Z1MA 1UAAA 3QJYA 4TMVA 4DUGD 3TUZC 4Q1CA 5J40A 3NH9A 1MO3A 4JBYA 4Q4HA 3TW8B 2PBRA 3PQCA 2ZJ2A 1MOZA 3GJ5A 4KSBA 3TVTA 5JSZA 1W2GA 3MAAC 4H1VA 4KHZA 4ON9A 3QF7A 2P6UA 1NG9A 1JAIA 4QNMA 3FKSD 2CCJA 1HE8B 2QSZA 2VHTA 2G88A 4PAMA 1OFTA 1IXZA 1QBKC 3K9GA 5JMTA 3LD9A 3W3AA 1MABB 4AY2A 4AYWA 1KAOA 2V7QD 3VNUA 1AK2A 3DMNA 4OI0A 4PX9A 4TSFA 2J9RA 2R8RA 1T5IA 1A5TA 2GA8A 5LD2B 2QTHA 3UK6A 1JR6A 2CE2X 4PC7A 2FGKA 2C99A 2ZQ5A 4PPGA 1X8KA 1VTKA 2IYRA 4B2LA 3MWYW 1QVAA 2IEZA 3RS5A 2BKUA 2IXFA 1VCNA 5BN4A 2CCKA 2JLXA 4QJ4A 3VFDA 1IHUA 1HTWA 5FBWB 3W34A 1S3GA 5JHHB 4KVGA 4AYXA 1AN0A 3QUSA 2R9VA 2PZFA 3PR1A 4MRSA 2BM1A 4FMCB 3I8XA 4GOJA 4I99A 3AP3A 1OIXA 2LWIA 4L16A 4B35A 3ADDA 4IFBA 3U3JA 4CF7A 2D06A 3WYFA 1G5TA 5G3YA 2MMGA 1D9XA 4B33A 4EFLA 2GHIA 1BMFA 2A7QA 2D7CA 2ZR7A 3LO5A 4EUNA 4A36A 1GRQA 1NVUQ 3HU3A 4O2RA 2IS4A 3NIBA 1OXSC 4UJ5A 5JS8A 4N0EA 3CRMA 1XXHA 2YOFA 4ZDWA 1P75A 3A6PC 2ZI3A 1S3SA 4WOPA 3ZQJA 4B6EA 4LHZA 4BFVA 3C41J 4PPFA 1HT1E 4PO1A 1GWNA 3OEED 2QRNA 3A8TA 1E9CA 2GJ8A 2OAQ1 5F3WB 3K0AB 4QBHA 1KO8A 1LNZA 1OH8A 1KSFX 5G40A 3SYLA 3CH4B 1CU1A 4KFSA 3I73A 5EUMA 1Z28A 3KFXA 1J70A 2OBLA 4POAA 1W4RA 2EYQA 1Q44A 1TU3A 1U90A 3N2IA 5KNCA 2FSFA 2NTYC 2WVJA 3CPEA 5JRJA 2CBZA 2G0TA 4F4IA 1Q1ZA 1BH2A 4HZUB 5HCIA 4RKFA 2JLVA 5DHAA 5IK2A 5FOWA 2ZYVX 4DDWA 2ZI6A 1Y63A 2WKPA 4KVAA 3AGQA 4GP6A 3FOZA 3KTAB 3IGFA 4PSAA 3OAAA 4LZZA 2IC5A 1TTTA 3NEYA 4TT3A 1Z2AA 3BFVA 5FI1B 2BJWA 3SOPA 4ASUA 3SBDA 2ZSBA 1XB2A 3BS4A 1U8AA 3EZ2A 4NPHA 1NKTA 3AH8A 4FN5A 3X2SA 3H86A 2CLCX 4EQ6A 1KIMA 3CRQA 4Q02A 5BWMA 2CJWB 4TL9A 4LGMA 1E99A 4AURA 1WE2A 2BMFA 2FNAA 4KO8A 1X1SA 4ZPXA 4JLAA 3CX7A 5B64A 1YHNA 1Z29A 4PHGA 2D2FA 1OFIA 3A1TA 4Q4JA 4BQSA 2PLFA 1KMQA 3AEZA 4NKRA 1XTKA 3CF2A 4X8LA 1KJZA 2KBEA 5GJVC 5J4LA 5L3VA 4BFYA 2HYIC 1SVSA 3LH5A 2ZR9A 2VHQA 3IHWA 1GL9B 1YR9A 5D3MB 2Z4RA 3EW9A 2J0VA 4V0OA 3TSOA 1ETUA 2VP0A 1GKYA 2QNRA 4E03A 1GNQA 3SJBA 1AS3A 1EXMA 1SXJE 4L5BA 2EFCB 1T0JB 1G7SA 1RE0A 4M0LA 3C4JA 4FMDB 4B48A 5K8UA 3CBQA 4BLOA 1NG1A 4PHHA 4Q4AB 3IPYA 4A2PA 2O0HA 1AZTA 1N6PA 3D6TB 4YMUA 5KTYA 1LS1A 2XXAA 4Q9HA 2CHVA 3L2OB 2C03A 4QBFA 2EFEB 4D25A 2WOJA 5BYKA 1F3OA 4UNQA 1US8A 3D3QA 2ZETA 1W7AA 1N6RA 2J87A 1W0KA 1ZMXA 2P2LA 2ZUCA 1TF5A 4IXNA 4OQLA 2HJVA 3MLEA 3THXA 1YR6A 1DELA 1Z6GA 2IBMA 3NHAA 4RD1A 3U7FB 1KI8A 2BMDA 2QT0A 3DDCA 1AQYA 3PV0A 4QHYA 4EJSB 1OYWA 3AVOA 5KDDA 4PZLA 4EJSC 3EPJA 1WBBA 3T61A 4QGGA 3QE0A 4EDHA 3AKDA 5L3RA 2R6GA 2FFQA 2JJ2A 4FCWA 4LJYA 4Q9LA 2GCOA 4BEJA 2JAQA 1W36B 3BGWA 3AV0B 5F9FA 1ELOA 3FMIA 2OCYC 1G18A 1W36C 1KSHA 1YU9A 2ATXA 3KXIA 4B2PA 2CVFA 3RRNA 4DZZA 3K70D 5M04A 1YZTA 1U0LA 4LBVA 1G4UR 2EWVA 3FWYA 1G3UA 2H5EA 4WZAE 1G21E 1JNYA 1XFAA 4BRWA 4OHVA 5JWOA 4EKDA 1RIFA 5KSOA 2VL7A 2OFXA 4Q7JB 4ZKDA 4M1YA 4P33A 3BBPA 3CR7A 3KXLA 4HEJA 1P2VA 3AVXA 4Y0VA 1EESA 2A5DA 3AF1A 5BYJA 2WIAA 3QG1A 1E1QD 1XRJA 2IHBA 3B78A 3B1WA 3C16C 4OJKA 1KI4A 1IQPA 3GEIA 5FOSA 3S1AB 2BDTA 1EFHA 3B9PA 3VR6A 3UANA 2QMEA 4RD2A 1FMJA 3EC1A 4P31A 3X1YA 4DLSA 3B85A 3WNDA 1OYYA 3K9NA 2QM8A 1WMSA 2VRWA 5AUPB 3BOSA 4AK9A 2BHRA 4HB4A 3GJ6A 4QGFA 1L4YA 1NRJB 4R98A 5L3QA 4D4JA 3TGPA 1E1RA 1G6HA 3RS4A 3M0EA 2ZUDA 2YHSA 1GUAA 2F1HA 5DO9A 3ZQ6A 1ZM2A 2F6RA 5JCZA 2G1JA 2DR3A 1JXMA 3THWA 4LHXA 1Q12A 1Z6TA 5KNBA 2GK7A 3OE7A 5AJWA 3OIVA 4IOKA 1TEVA 4ZCIA 1G8HA 4UXJA 1GVNB 1SKYE 1P2SA 1G7TA 3I5YA 2HCBA 2R6AA 5FUXA 4FI3C 3T1QA 221PA 1UM8A 2W6JD 2O8BB 1WDTA 1ZUHA 3QBTA 4K46A 4PPQA 4C0LA 5FPKA 3DZDA 3QQ5A 4QC2A 5J4YA 3WYAA 3AKYA 3W6NA 3LW8A 1RJ9A 1FX0A 5HKKA 3FFBA 2VP4A 2WKQA 4RFVA 1HURA 4RZUA 3U7GA 4Q1AA 4D0NA 3U4QB 1JBKA 1ZC3A 2W2TA 3NG1A 2IF0A 2WWHA 2ZE6A 4IXMA 3RC3A 2V3CC 1LV7A 1W46A 3AVYA 3VKHA 3Q85A 4Q4LA 3CWQA 3IO3A 4LPSA 1SXJA 1XTIA 5FTMA 2XGJA 1D6JA 4Y0AA 1IBRA 3TUIC 2ODNA 4Q66C 2ZR0A 4NYIQ 2OFOA 2J1LA 4Q9IA 5TMPA 1NBMD 1WXQA 4LYJA 5C18A 2VBCA 2A5YB 1ZM7A 1XP8A 3RYTC 3AKEA 4JKYA 4MYCA 4PAQA 3L8YA 2F7SA 2KI5A 3UXMA 5IDVA 4CEHB 4LI0A 4B43A 6Q21A 2OILA 2E1RA 3LBNA 1Q1BA 4US2R 3GLFE 1VCOA 2H57A 1IN6A 3BE4A 4AG6A 2BCGY 3B5JA 1HV8A 3OESA 2JDIA 5EE0A 2IW3A 2J59A 1RRCA 2UVQA 1ZYUA 3IHLA 4EAQA 4BFXA 3NWJA 2CNWD 5H70A 4CZ2A 1FFHA 3MFYA 4Q18A 2F1RA 5SZKB 3CZPA 5EP2A 3HDTA 1RC8A 2UZIR 3LV8A 4URYR 1EX6A 2V6IA 4WZBE 4BGDA 4TZ6A 1Z0FA 2ZEJA 2HT1A 1JECA 3WP0A 2A78A 1KI1A 5FOUA 1XD9A 4TYNA 3GLHB 3TRFA 3DOFA 5CYPA 2IWHA 5B30A 1XWIA 4LBZA 5JEDA 1Z0AA 3DL0A 1R7RA 4GBMA 3WHLA 4G5QA 2ZRIA 4DLRA 1UEJA 3FE2A 3CW2A 3LRPA 3K0FA 1S8FA 1ZUNB 3AGPA 4TYQA 1DVRA 5KPJA 4XVRA 4MKIA 1CJKC 4OK5A 5CDFE 3BRWD 1ONBA 5KU1A 4P4SA 2Q6TA 821PA 2Z4SA 4LYFA 1RVDA 4AG5A 2UKDA 1K6MA 1BO6A 3A1SA 2B7CA 5FFMA 4DLZA 1OF1A 4V03A 2BBOA 1M7GA 1R0ZA 2XSZD 4YMSA 3TBKA 3E5HA 5TARA 2O8FA 5J4KA 1G4AE 2CL6X 1Y3AA 1QHSA 4ESVA 1IY2A 5L3SB 2IWRA 2I1VB 3W8NA 4B44A 1E98A 2J0SA 1ZU4A 5LPNA 1JXOA 5EE5B 1DS6A 2AWOA 2FDCA 5DHFA 1W47A 5JEEA 1QHHB 4BASA 2ZUBA 3NDPA 1ANKA 4TMXA 3HYTA 4TYWA 5HE9A 4YXWA 2CEAA 2QROA 3A37A 4MYUA 4HUQA 4NE2A 4MKFA 1DE0A 2OCAA 3VNVA 3UWKA 1QHIA 2P6RA 1BS1A 1EG7A 4DLWA 5KHOC 3QENA 4NBSA 3I3SR 1KNXA 1TNDA 2NG1A 3CONA 1J8YF 2CVHA 3CLVA 1G9XA 2ANBA 2DHRA 4JT2A 4RSGA 5DN6A 5IRCD 3CB4A 2VYFA 3UATA 4JKIA 4F92B 1J7KA 1XEWX 2CMKA 5J47A 1E2PA 2GJ9A 1RZ3A 3LW7A 4IDOA 5B57C 1A1VA 4IVRA 3I5XA 1MKYA 2ZJ8A 4BZPA 3QPUA 2YOHA 1N5IA 3B9QA 1W5TA 3C14C 2Q0HA 2QAJA 1NF3A 2GF9A 3L0PA 3LA6A 4I81A 4KBFA 5CJ2A 1EFUA 2IYXA 2R6FA 3IQWA 3QKSA 1A4RA 3THOA 2CHQA 3PUWA 3ZLJA 3QKTA 1EFRA 1KYIA 3LX5A 1T8UA
chains in the Genus database with same CATH superfamily
1JIVA 3K1AA 1XWFA 2B1JA 1Y3DE 4B7CA 3O8OA 4Y6RA 3IQXA 1TAQA 1AHPA 1RQPA 2ZB7A 3H3XA 1QHXA 4QYTA 2B34A 4JLKA 2ECPA 5CURA 4ZT3A 3SEZA 2HJSA 4LNUA 5IARA 4B3JA 1ZG3A 2WRZA 1VBNA 2JPDA 3PWSA 4PZ0A 5CVJA 1GSIA 4R1OA 2WPDD 5IFLA 1JHMA 4Q5IA 2QAGA 3B6JA 1O03A 1QZZA 3EBLA 3K0CC 3SVZA 1AE1A 2VAVA 4ZGBA 2MYNA 4OSPA 1IWBB 4G01B 3LX6A 3T1YB 2Q45A 4KQ9A 3VMFA 4P2GA 1ACLA 3CRRA 2WYVA 1G6KA 4KK3A 2PBFA 1OGJA 2POCA 4LJKA 1W5BA 3GLFA 4PLGA 4BNLA 1L4NA 2WUDA 4XDHA 3LPCA 3IAHA 1GJRA 1V41E 2YV3A 2J07A 3KTDA 2XCOA 2W70A 3MT7A 4A1OA 4C7OA 4HAYA 1XMOB 3BJIC 2C9ZA 1JJFA 1E59A 1H6DA 4O2LA 4W5QA 5KAPA 3WLJA 5AW6A 2OGZA 1NFQA 4BUCA 4LJRA 2XE7A 4MW7A 1CLUA 1R8SA 4WZBA 5CNIA 1JYEA 2A5GA 2WA1A 4NNPA 1Z22A 2YZGA 5B5SA 2QG9A 4TQAA 1E32A 4DJTA 1BN7A 4LOJA 3ZEIA 2EFDB 4XGRA 2ZITA 3BK2A 3ORRA 4AJLA 4TVSA 1FNCA 3SS7X 1QE5A 3V7YA 4QXPA 2M6LA 4F2HA 4DIOA 3F5DA 1MTZA 2Z6UA 2XLCA 5AR1A 1WCV1 2BD0A 2QYOA 3M3HA 4FEGA 1XPRA 3IR6A 3ITEA 3VYTB 3KR0A 1IJKA 4G0ZA 1UBCA 3H2GA 3L7BA 2HI0A 5TQJA 4B3IA 1IULA 3UC5A 2ZAOA 1H69A 1NVAA 3QH4A 1L9XA 2QA5A 1QNFA 1OI2A 4S3MA 5G1OA 3IKVA 1A5ZA 3UCEA 5JJIA 1AQIA 5KOIA 2R8BA 1E9FA 3RLFA 4E2ZA 5ARDA 4EY7A 1GG2A 3OD5A 3CLRC 3EJ6A 2DFNA 3OH8A 2IUUA 3SI7A 3P5BA 3W77A 3I9OA 3I01M 5GTDA 1INLA 1MLDA 2RARA 3DB1A 4QOSA 5CYOA 4YVFA 4AKTA 4BMNA 2PY6A 4BJ6A 3CLSD 4UNSA 1Y8RA 2YUIA 1LTKA 4JFAA 4Z0HO 3S29A 3QF4B 4IIDA 4N1AA 2IK8A 4YREA 1H4QA 1YQDA 2NYRA 5HG0A 4BMZA 4COOA 2OUKA 8ABPA 2ZTHA 1N5OX 3HYLA 1WPGA 2FU5C 4UUNA 1O7JA 5I9LA 3ILYA 2TMYA 2HSZA 1L8XA 3SR3A 1CUCA 1ST3A 4Y1RA 1OZGA 2EU8A 2WJJA 3P2EA 5B6JA 4Y6SA 3C8HA 2BE7A 4R6XA 3RKRA 3WSWA 2OHFA 5EZ5A 1AZLA 1BSVA 1DIOB 1NUSA 3PRJA 4MOWA 5CIWA 3E48A 4L0DA 2IELA 4UD6A 3KSUA 3WICA 1CTQA 1P1JA 4WVFA 4X54A 3ZIAA 3QXHA 1NMEA 3R6TA 1THTA 2SECE 4XIGS 5AIAA 2YJ5A 5DKFA 3T4UA 4H77A 4JGGA 3DLIA 3T7IA 5C8VA 1M7BA 3TZBA 5KKCA 1GU1A 2RGXA 5KOJA 3BMOA 4HI0E 2FLKA 2VSOA 3PUKA 3L7IA 4WCFC 3NYIA 3OZIA 3O4IA 3RS0A 2YOGA 2JLCA 4JKOA 4BVEA 4AKGA 3O5AA 4UPDA 2P5UA 2ENUA 1HQDA 2COEA 1G19A 2UZ1B 1KZ7B 2G5CA 3QNUA 3QFHA 4C89A 3IOCA 4O0LA 4B85A 1EJBA 2VUSA 2J33A 3N53A 3AR3A 3GK3A 1E0JA 5LIRA 2CL7X 3ECAA 3R3YA 2BONA 1Z7BA 3ROKA 4YC7A 5DTEA 2C0QA 1XBTA 5CCXA 4BLVA 3JD3A 1L6IA 1TJ5A 1W1WA 1RJ9B 3I23A 4EPXA 4Q7LA 4C0QC 1U9IC 3QOYA 3AB7A 1HEIA 1UIMA 1VSQA 1AS2A 1YR7A 2OLEA 4UCFA 1QFXA 1QYWA 3ABZA 5AQEA 1P44A 1V96A 4I9UA 1SN7A 5IFKA 3DEFA 1FUYB 3EZFA 4JSYA 1EX1A 3N87A 3T15A 5LZ4A 1YJ8A 4K28A 1F51E 2QX9A 4BBJA 3RK0A 4EMSA 1NSFA 2Y1OA 3VDRA 2CLFB 1E3IA 3W9YA 5AFSA 1Y5NA 4IUYA 3TKYA 2YFHA 3NONA 4N01A 4ZYZA 4FZ3A 4J3NA 4TMTA 4HX5A 5JWRA 3L93A 1GOTA 1P7CA 1U04A 1Y5IA 2YHIA 3L5OA 4LFBB 4CM8B 4FLMA 4TQGA 4IJQA 2J7PA 2VSFA 4H18A 2J3IA 1D2HA 1RWXA 2J0QA 2PR2A 4B3FX 3ZY6A 2ZJBA 5F77A 4EYKA 1H6CA 4HO1X 3TX2A 4N8DA 1ZQ1A 4ENPA 5K0NA 2PS9A 3RG8A 2L18A 1QO0D 2YWXA 3KR2A 4RSHA 2X86A 3UHFA 1GUDA 3O7MA 5EY5B 4UPEA 4DNFA 5BV8A 3HCFA 4FQ5A 1L4HA 3OCVA 3WR5A 4YWHA 2PUDA 3SXUB 3LX4A 2Q9UA 4QDXA 1L7NA 1SU7A 4YH1A 5DH9A 2C7RA 2HJ9A 3BORA 3TR0A 1DKMA 3QUQA 5D2CA 2HADA 2UYYA 2GUWA 4N12A 1TYBE 2BFCB 4PNHA 1VCIA 3PC3A 4DDTA 4CL8A 4FKZA 4DA4A 1URPA 2X1VA 1NMZA 1X38A 5FF9A 3TIGA 4FYVA 3MD0A 4BQPA 3D6AA 3E84A 4DZTA 3O8QB 5JJLA 3G79A 1N7IA 1MTOA 2GKOA 1RYNA 4NCJA 4B9AA 3QUAA 5KNBH 3W2IA 4Q39A 1PX2A 4WTOA 3ZV4A 2ODWA 4EATA 1EBBA 3S81A 5FI0B 4N8EA 1J21A 1RYMA 4N3NA 3EIEA 3GNTA 5H80A 1N25A 1NP6A 2CF6A 4JP3A 4D5EA 3HP4A 1T13A 2IHTA 1EK1A 1N2ZA 2A9VA 1X1RA 6NULA 1Y80A 3EN0A 1HDYA 4DKXA 2YW9A 3BGIA 4OUKX 5KC8A 3ANMA 1NMXA 1H2HA 5BN3B 4A1FA 1XYYA 4XGNA 3L1IA 5EHQA 1BKYA 5U4XA 3A27A 4P7GA 1GG9A 1Y9AA 2H8KA 1UDWA 2IYQA 3VU1A 5IAAA 4UMFA 3L4KA 2O8FB 2C7VA 3C45A 2OORC 3FG9A 2A0XA 2AUNA 3NM5A 4AVYA 3UG7A 3C3YA 3T7EA 4ZXPA 3H2BA 4QX6A 2A9PA 1JT9A 1VDZA 3ZUGA 3M6WA 2RAPA 3ETJA 1CIVA 1QDUA 2JLAA 2JFVA 3U60B 4BMOB 3DZ8A 2AG5A 3ABIA 4OXXA 5EZSA 1J22A 4A6PA 3E61A 4OG2A 2R8ZA 2HZBA 1FP7A 2O7NA 1GLGA 2X5OA 2CVOA 2ECQA 1R00A 2RAFA 3HBNA 3O4HA 1CLEA 2HK8A 4UAJA 3K0KA 3P2IA 2YHAA 3FGPA 1FUKA 2UV8A 1NVGA 1V3TA 3K6JA 1KGSA 5H81A 4ZZ3A 4ZYYA 5IULC 2GMWA 3KJZA 2MCFA 1VKOA 4XKJA 4YRFA 4A4DA 3BXEA 4OI4A 1XTQA 4YLGA 3WNQA 1PJAA 3MILA 3ZWYA 2ZT7A 4NV3A 4EG3A 2APJA 1VHJA 4HB0A 3PDJA 3DTVA 1GITA 3I42A 3TMYA 2EZ9A 4BZZA 2JGDA 4FBGA 3CVUA 2ZU0C 1PSZA 2WABA 3M6LA 1YQ9A 2JRCA 1DXYA 1K98A 3MWDA 3R40A 5EHGA 4DV4B 5LOVB 1RP7A 2I67A 3LNCA 4IRUB 4CL0A 4DNQA 2V5VA 1QR2A 2D0PB 2WF9A 2ZJ1A 4GLOA 1EM6A 4JDPA 4O25A 1CNEA 1XFDA 2I22A 4OGWA 3HFRA 4ETMA 1VP3A 5B4UA 2G8NA 2YBEA 2ZE7A 2Q3LA 3B5IA 2VHCA 2FFBA 2R65A 3ASZA 4RZXA 3UA4A 2O7VA 4FYKA 3ZYZA 2DHCA 2PMFA 5BW8A 2H4ZA 4U7FA 1ZH6A 2Q6IA 5FV4A 3A31A 4NBUA 1PJZA 1BE1A 1FXWA 2OQIA 4ROSA 4R1TA 1DC8A 4LW8A 3O8OB 5DE3A 2DU8A 3IVAA 1JSXA 2O2YA 2XRYA 2Z56A 3DZCA 4QHSA 2JASA 3AR9A 1M2OA 2PRYA 4EKEA 4HAUA 1CW2B 4R2XA 3O6VA 1U2DC 2J9ZB 2XIQA 5LZ7A 1PZFA 3HVUA 3VR4D 2X8JA 4A6XA 3EQ2A 2P41A 1I0IA 1XEFA 1NIJA 3QWAA 1NZDA 2NZXA 1ZJ4A 2C5LA 5EMHA 5ILQA 4GI3A 3AY3A 2GASA 3QPVA 4AI6A 3JZFA 1Q83A 4DV0B 3RIXA 4NOLA 2R6ZA 4ESOA 4BUZA 2Q1XA 3CSUA 3EWIA 4TX1A 4ZVQA 1JEAA 2Q6OA 3TL6A 1NONA 2XUOA 2E6UX 3IE1A 1VRCA 3NBFA 2RHHA 3IB3A 3RQSA 2BR5A 2TECE 1I24A 1K66A 4RF4A 1NJ5A 3OLXA 4Z4QA 1SBIA 3L0YA 3NBXX 1Y98A 1QE0A 1WUJS 2NXWA 2CLIB 1IJEA 2VH5R 4GE0A 1HO3A 4FNOA 2RCNA 1MXFA 3B8HA 3KYCA 2G06A 1KY3A 3A6EA 4MITA 1VYVA 3SX4A 5LQRA 2P2GA 1LRKA 2VWPA 3WLKX 4V1CI 7YASA 2H2HA 1MUUA 5T3YA 4DYHA 5CNKA 5KJ1A 4CNBA 4NENB 4LF4B 4QO7A 5JNTA 3FPAA 1A9QA 2PR7A 4K1LA 1U2SA 2IYNA 2WTNA 3D3NA 3UUEA 2HAEA 3CB2A 2AR0A 1QBGA 4HWTA 3NASA 2B2XA 3LUAA 4B83A 5C7LO 5H4GA 2DE0X 1XMIA 2JLRA 2QP4A 3IIIA 3HCDA 3H4IA 2UYOA 3MWJA 2VJNA 3DOEA 4GXQA 3MMSA 4HZIA 4TRJA 2IXEA 4OHWA 4BE7B 5C1DA 5LBUA 5P21A 3FNGA 4YCDA 3RO7A 1MVNA 1KMHB 2Y1FA 4A2QA 2C20A 1E1QA 3STYA 3WP1B 3LZ6A 4JJ8A 3OZRA 2G1KA 4LXHA 1OH7A 3ZDFA 3R0ZA 1DTEA 3RI3A 1VL5A 3CH5A 2WE7A 2GN6A 2F1OA 3DM5A 2XQJA 4GPTA 1W35A 2QENA 2Y1WA 4MCAA 3DZFA 3GJYA 4NYJQ 2B0JA 3B36A 3F3SA 4IMPA 1ZC4A 1XMXA 4F96A 2NZ8A 3LVQE 2OBBA 5BXQC 5AVQA 2D0OB 3PHBE 4MPJA 1ZGZA 4HMQA 4WK2B 3KS9A 3OQPA 2I9KA 4YB8A 2WTEA 2EFHB 3GA5A 4HDNB 2YWDA 4WVLA 4OHZA 4DWWA 3TECE 1R18A 1RHQA 2PXHA 3DVLA 3EOZA 3FZNA 1NBAA 5JJCA 3NGMA 4KMSA 4ARIA 3WWOA 3Q10A 3K2EA 1ZIYA 1CRPA 4L4RA 1QFZA 4I1YA 1M2EA 4FDAA 3H1FA 3EEIA 3I1JA 3NVAA 4JBWA 4LY9A 4OHKA 4Y1RB 1RLUA 2D5IA 3NP9A 1P1CA 1Q0SA 4RTJA 1XZHA 1AMUA 4A0GA 1M8GA 5KTTA 2K7FA 4V2IA 3N2EA 1JS1X 3X1DA 1LFAA 2DWOA 2ZS7A 3BHNA 3K8QA 3AO0B 3R5KA 1PKEA 1Q91A 3BGSA 1VJDA 1H2EA 1E2MA 3EFBA 4WFQA 4FQ7A 2ZIAA 4JLWA 2W6JA 4MVYA 4S1PA 5ESWA 4HT3B 1C8LA 1JA0A 1OXTA 3DBIA 1D7AA 1KZ9A 1M76A 1UZUA 2JFZA 1GPJA 2NYVA 3H5RA 4AWBA 2ECKA 4CF4A 3GLIA 2Y0PA 5KYNA 2UUAB 2HSJA 1BRMA 2WVHA 1J56A 4MUMA 4FMBB 1JQAA 1U2PA 3R4CA 1YRLA 5K3FA 3QYJA 3RW9A 1YCFA 5ITWA 1U0TA 2D74A 1C80A 1SFRA 2I6UA 4GOKA 4BLWA 3UFXA 1NRWA 3AEKA 3L8MA 4B84A 1T5BA 4B7UA 2X3YA 2QW8A 3I2GA 3M70A 4P32A 3UKOA 4CQLA 2WJHA 1S2GA 3IPXA 4CEJB 1Q57A 2GVZC 2QRJA 2BGWA 1EX9A 3ZI7A 1N2CB 3VYWA 4A3SA 2J0EA 3JQAA 2QRMA 3ZHVA 1YFLA 4PZDA 3GFSA 3SF0A 2P75A 4II7A 1GT91 3HFSA 4LV8B 1L8QA 3IKLA 2EJUA 1Z06A 4MS1A 3R8XA 4EVSA 4A8JB 2W48A 4HAWA 4MUHA 1NZFA 4PV7A 1XHEA 3ZD7A 3U19A 3QMPA 3OQVA 4MW0A 3H1BA 1NBMA 4EH1A 1XQXA 7REQA 1L7VC 1FCJA 2A4MA 3RANA 3REGA 1JTEA 1RJGA 1ULAA 1TT7A 4YNBA 2V1XA 3KKMA 4ALJA 3RSLA 4MQLA 3RF6A 3VNRA 2I0FA 2IBSA 3U4GA 3WJ1A 2EHJA 4F5EA 1KO7A 2DQKA 2FN9A 2PZKA 3D81A 4O5OA 4M2LA 4PIVA 1E0SA 4C3UA 5M29A 3RSFA 1X92A 1DG9A 1FJHA 1SQ6A 4XD7D 4XIIA 2PIAA 4DCTA 4M21A 2R00C 1PWZA 5NLLA 1KJQA 1MC1A 3ZGXA 1FLVA 2Y93A 3R8FA 3MK31 4JWKA 4ZOBA 2FZKA 4Q4HB 2A0UA 3RJMA 1OA1A 5DHTA 1G20E 3GA0A 2BAGA 3S8YA 2PGAA 2X41A 3P9XA 4LYHA 5LBIA 4EPTA 2RGCA 1D1QA 1SHKA 2PUJA 3DBRB 3TLKA 2ODBA 4JIMA 5FX2A 5A05A 2E4ZA 1B3BA 3KDAA 2NPOA 2DMRA 2QMZA 1IMOA 3BZBA 3D0KA 3IR7A 4KJZA 3WWZA 2FOIA 5IZCC 2Q5QA 4IIXA 1J5EB 2Q0XA 2Q2WA 2WEKA 5BOSB 1WCWA 2WU1A 3EDCA 4YRPA 2QSYA 4EW6A 4KI0A 1ADJA 3AL2A 4PSVA 4FHEA 3I8OA 4IIJA 1W44A 1X0VA 1AKNA 1BWQA 1G17A 1V8OA 2ZIZA 4IIVA 1OLSA 1PDVA 1S2LA 3IODA 1FEZA 1XDBA 4JT8A 4ODIA 2GXUA 3PC6A 2PCLA 1L7QA 4GPEA 1P7YA 4MWDA 2Z1DA 4X6LA 1HDIA 1L3CA 4RA6A 1YRYE 3A2LA 4H1WA 3IP8A 3QEKA 4UBKA 3VHLB 3NBQA 4BKRA 1CBUA 5T6MA 3ZJ4A 3QOXA 4N3AA 1J8DA 2IXAA 4PQFA 3SQDA 3ROZA 2W4IA 4RMIA 3INYA 4RF3A 1JJVA 1PTJC 5JPCA 1BROA 1DFGA 1RXYA 2K7ZA 2V4UA 3IQIX 4HDAA 4DJDC 2HL6A 2N3ZA 2XTMA 3L1HA 3WLPA 4CVNA 1VMAA 1DAEA 1QLJA 3VZQA 3JD1A 4PLYA 5HKKD 3CU5A 5CW1A 3GHHA 4LZWA 4I1UA 5BN5A 4BXOA 1C0IA 3V8BA 5DNEA 2VA9A 1KH2A 3QELA 4JP2A 1LC0A 2QI9F 2VTVA 4FTWA 2Y2VA 4OYHA 1OI3A 3FPEA 2UYCA 2Y67A 3EOBI 3OEHD 5FPSA 3V4RA 1BJTA 2XIJA 3QFRA 1ZMRA 2D3TA 4CM7A 2GD1O 1A2BA 2K5UA 4FKMA 2ZBGA 1F2DA 1MABA 4FC7A 4DWVA 5TR9A 1HSZA 2P3OA 5G2OA 2COUA 1JSLA 1C1DA 4DSTA 4PNZA 1OIVA 1R6DA 4K8RB 2GTPA 2QE7D 4ZT2A 1QRAA 4BNGA 4UOEA 3H3FA 2HJRA 3FUTA 4PHTA 1UC4B 4ISBA 1ZJZA 2FE4A 4EW2A 1KYXA 3VJRA 3WK6A 1NXVA 1XTPA 3LU1A 3LX8A 4GEGA 3D8TA 5FORA 4BFWA 1OCEA 3PNYA 2R68A 4F5WA 4F6RB 5HWSA 421PA 1WSBA 1QO7A 3NM6B 1CJBA 3SS9X 5JZVA 2G7MC 3H18A 2PL9A 4Z51A 2BHLA 2PX4A 2WSSD 4EKYA 4YV7A 3L43A 1JIQA 3OCZA 4DQLA 1JR3E 4GHWA 3L0IB 4IOLA 4XGIA 3IL2A 3DTVB 4B8YA 1N9KA 1E6MA 3ZWCA 4NNJA 1YB4A 2DFVA 4B5KA 4CW7A 1E64A 2EKLA 2XB4A 2DJIA 3ITKA 3O4RA 3P9IA 2FPIA 3F90A 4GZ3A 1SM4A 1GTRA 3R41A 1IN8A 1XNRB 1DL5A 2JK1A 3E9MA 1U3VA 4FFMA 1AF4A 4AZVA 3FMOB 2R2AA 1Q7CA 4OD0A 1JFSA 1L5NA 4MB2A 1V2GA 1IY0A 1EZZA 1T35A 3RPEA 4ZFNA 1HFKA 1WBDA 1OH6A 1J9ZA 4MYTA 1QGAA 3KR9A 3PUZA 1ZK0A 2HWUA 2EG5A 1C9MA 1XTTA 2FSGA 3COZA 3HWX1 4MVWA 4YO7A 3PXXA 3KLPX 4KBGA 5CLFA 3PG5A 1BRTA 1X86B 4RY9A 3PF8A 3T3HA 2XRFA 2GXSA 1T4CA 3G5MA 4CPDA 3V48A 2ZVDA 3MUFA 4C4YA 2DERA 3HRHA 3ZE1B 5JVDA 4PC2A 1FBNA 2WD8A 3VPFA 4F86A 3KQMA 1ABEA 4JP8A 4AKIA 2R5NA 2AYXA 3BEOA 3IAS6 2CK3D 5KREA 1M2OB 4PZ9A 4ZVOA 1XDZA 1B2LA 2QMUA 3C1AA 3OWHA 2WD7B 1KDOA 4MV3A 1SUCA 3QVGA 3UMCA 2BMEA 4EHBA 4IIFA 1NI3A 4IXWA 2JLQA 5LMZA 4FFDA 1RAGA 4G0XA 1R66A 3C8ZA 3NLLA 3MQ4A 3M6UA 4UUQA 3LP8A 2I2AA 3ISJA 2F3UA 4MVJF 4RCVA 5K8IA 4MA5A 1QJCA 1K4MA 4RL6A 4FCTA 2ONJA 1WHSA 4C6SA 4WLEA 3RVKA 1R88A 2GI4A 2XHEA 3PC8C 2Q2NA 3B6ZA 1PR0A 3EVBA 1TDJA 4B6OA 5BV1A 1P72A 4YP7A 1AZWA 1XA0A 4IJKA 2OAEA 3TM4A 5AM4A 4P3PA 5BQXA 3TD9A 1K3FA 1XHLA 2IDMA 2WOOA 5LQAA 4W8HA 4QPJC 1ODCA 2X40A 3K8ZA 1FTNA 3B1XA 4TUYF 1WULS 3R5XA 5DOVA 2VF4X 5DBFA 1DT3A 1ILWA 1D6SA 1BOOA 2XUPA 4W5HA 3A58B 1Y1LA 4GMDA 4YQFA 3KQUA 2P4HX 4YCNA 2BBWA 4FK8A 3JY6A 4UULA 1SUIA 2DFKB 4HZGA 1BTOA 4IZ6A 2C4TA 1X1BA 1LB1B 4FYXA 1A50B 2XE8A 3QV1A 1NUPA 4HCJA 1HXHA 1M2HA 3THXB 1M1ZA 5GV7A 4I2VA 1GNTA 4M1SA 2E1PA 1E3SA 4DJAA 3E81A 1Y6GA 1ZGCA 2QQFA 3I2KA 1BEUB 3BB3A 4LHWA 2YRFA 2GCPA 2YQ4A 4TSKA 4CETA 3IFSA 3X2FA 2EYUA 5AHRA 4DXDA 2I8LA 1NBOA 2CXOA 3WL5A 1KZGB 1MQAA 3H5TA 5ITZB 2XXJA 1KHTA 1RAFA 2HMYB 3AIMA 4NJMA 1ZXLA 1DV2A 3LCRA 3WSVA 2BY4A 1U8FO 3PQ7A 2MOKA 3KQVA 5HSGA 1ZH8A 2G7ZA 2PYZA 2QUZA 1HMPA 2Q5EA 3Q11A 4DF3A 3O47A 2WJYA 3DE5X 1X42A 2PD4A 3OX3A 4TZTA 4X97A 4DSOA 2LRHA 3LGXA 3P2YA 1WB6A 1EMDA 3H4MA 1E0AA 3M6XA 1JAXA 2F43A 3STVA 4BWFB 1ESCA 1I4LD 3O95A 1EFVB 2O07A 2XCQA 1WVGA 3DPUA 2ID7A 3RJZA 4DR5B 1GGFA 1H23A 3W04A 5EHIA 2HXYA 4IEEA 4QDZA 2FLWA 4I50F 5AUNB 2I78A 5EXXA 3C3XA 3LP5A 1C0PA 1VMEA 1PIWA 2NV0A 1DO8A 4ZZ0A 5KYTA 2P8SA 3EQZA 4UM7A 3PHGA 1R0WA 4KFCA 3EPHA 3FFWA 1HT2E 5EC8A 2AFHE 4GM1A 1UINA 2J9GA 4KWEA 5JASA 2B99A 1KP9A 4CLOB 4ZT4A 3U09A 3G7NA 3N59A 4H6WA 4MARA 1YZGA 2R7KA 3HJUA 1V5EA 1VE6A 4L22A 1PQPA 4AMZA 4BMCA 5JR3A 1CVLA 2BGNA 2XZOA 1BAPA 4NOMA 3NV7A 2OHVA 2PSJA 1TCUA 2FCAA 3D4LA 1BVHA 1YA8A 1GIAA 3SQMA 2V97A 4FD2A 3CVWA 2PQ0A 3LY7A 4PCUA 3GPDG 2NO9A 1UJ2A 1XN4A 3LBHA 1H9AA 1L1QA 3HB9A 4AY5A 4JUAA 1RYZA 4GIBA 2YJ4A 3M6VA 4HTFA 1C14A 1VJGA 3LC7O 4Q01A 4TSRA 5K3FB 3UNXA 1HORA 4I9GA 1ML4A 4S35A 1NNUA 1AM4D 3UWOA 1GZDA 3UFXB 2PJZA 1PFQA 5FD8A 4L85A 2NVUB 4UFPA 5IT0A 1L8OA 3F6SA 3WKDA 4MGYR 2ZPTX 3SWWA 4KL8S 1XTBA 1ARZA 1WBJB 4MO2A 5FOVA 4MQ6A 3MCUA 1RWQA 1MGOA 3TXXA 2VAWA 3A9WA 4I8IA 4CLXA 1SUBA 4LKOA 2Y76A 4PG8A 1Z2NX 3VU3A 3TNYA 5HS6A 4DIBA 5A4JA 3KJXA 3GFGA 2RHCA 4CT4B 4YAKA 4E51A 4C7MA 2JCBA 2AOUA 1G4HA 2YKGA 5DW3A 5HGJA 2D1RA 7REQB 1Z25A 2GBIA 3U5TA 2X9GA 4GL2A 2HF2A 3EZXA 4BCCA 3PDUA 5KNCA 2GETA 4U1RA 1KP3A 3BJRA 1KC3A 3ZQUA 1CEYA 2JIRA 2PMKA 3V8NA 1CY2A 1A69A 5TDHA 4BWVA 4CTOA 2RHMA 4OP3A 2JLSA 4AL4A 1FX0B 3K30A 2PNFA 3WGMA 4F2DA 3DC7A 1XZMA 1KDVA 4LJ9A 1O95A 3DWFA 2AJTA 1MVOA 2EV9A 2I6SA 4JU8A 5FLKA 1ZSYA 1ZK3A 4ZXFA 4ZEOA 1U65A 1L4UA 4Q3BA 5FIUA 2AF4C 2ZJ5A 1SD2A 2Y6VA 2ZDGA 4JYCA 4KU4A 4URUR 2Z2YA 3F7OA 4KIUA 5FBZA 4KQ2A 3SIWA 3SIRA 1TYAE 4BL5A 1CULC 4NQRA 4D8WA 2VQ3A 4Q9KA 5LCXA 3FNIA 5AXBA 3V9AA 1VL8A 3HSSA 2EJBA 5JG7A 4UCWA 3R6WA 2BR4A 4ITRC 4DGQA 1N3BA 2CNNA 4KR6A 4C5BA 3U7QB 2OD9A 5CK5A 4D3ZA 4F5YA 1GZ5A 3AONB 1XF1A 2WNSA 3NHBA 3RADC 4M54A 1NR7A 1TM3E 1X6VA 3RSOA 3LVRE 2CHFA 4RCYA 4X85A 3HVHA 4AZ0B 5FKJA 4ZCMA 1JHOA 3LYAA 3BMNB 3OJWA 5BYBA 4D6PA 2I6FA 3A0RB 3PFFA 4IIJB 1KERA 2NSLA 1MG0A 1V1JA 1YDWA 3A2NA 2BRUC 3FUVA 1I5EA 4K2HA 4WKGA 2YHBA 2RGGA 1K27A 3Q0TA 3SMVA 3GUUA 1OU0A 4DC0A 1JQ3A 2IPMA 4RA6B 1IBLB 3TXAA 2QYSA 3CEHA 3AR4A 2IPAB 3O94A 2Q62A 5ES4B 1Z07A 3CSSA 2IUEA 1Z36A 3L77A 3PI6A 5THXA 1AQJA 1AKYA 2XNHA 2I91A 5AHXA 3R4VA 4BV3A 3GH3A 5CM9C 3QXJA 4ZYTA 3MELA 4PO3X 2JFNA 2H1LA 5FPYA 4LFCB 3TBHA 1HNZB 3TH5A 1H8ED 3FBWA 3Q5GA 1J49A 1CUBA 2EP5A 1JTVA 2W83A 1DQYA 2P2YA 4NYIR 3RFFA 2WA2A 2Y3IA 3ZLTA 5BN5B 4BXOB 1YDFA 2OO5C 4J16A 4Y98A 2H4XA 1IMJA 4HXEB 3U7EB 5HP4A 3EULA 3UJPA 3AVWA 3QIVA 3F98A 3PP8A 4QJ3A 4LRXA 4NZNA 1U2RA 4PGMA 3PQDA 4AS3A 2FETA 3B3JA 3K5HA 1V16B 2GVDC 2HA3A 3OEEA 4ND4A 1XRMA 3MNFA 1ICIA 4DJEC 4FYIA 3SHTA 1PJBA 3B53X 1E7SA 1CRLA 2CSXA 1AZSC 1BDBA 1UKBA 1C1DB 1QM5A 2FV8A 3TZKA 3UMVA 5AIBA 3I53A 1UDBA 2REQB 5K1ZA 4DS3A 1LI7A 4L7VA 3DEKA 4MS4A 3QLJA 3ZK7A 4KXYA 4PR3A 2VF8A 2J7PD 4LZNA 3U1BA 1K08A 2P11A 5K7SA 4Q1DA 2P2ZA 1PJ4A 1REQA 1XRLA 1SIBE 3VMMA 1LPPA 1WNTA 4KXFB 3AEUA 2P30A 4OHUA 5I5GA 2SNIE 1OXUA 1U3DA 2OOKA 1HF3A 3L05A 4IXTA 3G5AA 4MV4A 1AMOA 2C5SA 3QEJA 1PVOA 2CUNA 3VJKA 2F3SA 2P0YA 1D1SA 3FAZA 1P4GA 4DDUA 2D1QA 4LCJA 4RGBA 4D3DA 3LDHA 1E5VA 5BNWA 5EJ9A 5TIIA 1T26A 2I2XB 1Z4QA 2JH3A 3GLHA 5TF4A 4E11A 3R3VA 2H29A 5F2OA 3GLGE 3H8WA 4US0R 1IIBA 2ZI7A 3JTEA 3CEAA 1RQNA 3HV2A 2QL6A 4CL2A 1TYCA 1C5KA 1XZNA 4AFNA 2ZTUA 4MUGA 5H68A 3IPAA 5AW3A 2ZSDA 3SC6A 4I3HA 4IKEA 1ISHA 4KH0A 1ECPA 4QJIA 4H3HB 4RABA 2C78A 4Q1EA 2FMXA 4XLZA 2I3BA 2ZSUA 3E70C 4X41A 5CJJA 1L8LA 1EM8A 2IXGA 3UWMA 1QQTA 3GFPA 3OM0A 1I0ZA 1NLFA 2GM5A 1VG9B 4CHTA 3EIXA 5J4HA 1E2BA 3ZV5A 1DEKA 3FZYA 3HLYA 4C0BA 3T5PA 4FS3A 3AILA 2Q4BA 3EC2A 3ZNPA 1VPTA 3VXKA 3ZBUA 4OYRA 1HG1A 3U44A 3L4BA 3SLRA 1E18A 3D7MA 4FKBA 4IMIB 4RC9A 4DBLC 4ZV4A 4JI4B 3J81A 3IELA 4QARA 3UCXA 3W7VA 4FWTA 3EZNA 1WSWA 2EGGA 3ECSA 3QVGB 2WUEA 3VPHA 3L6CA 4HS9A 4IO1A 1O9HA 3B2QA 2JGEA 4A27A 2WKWA 2C9BA 1N33B 1P39A 2O7SA 1EA7A 1SVKA 2E4VA 2Z1NA 5IMBA 4CRWB 4K6FA 4K0RA 3WRYC 2OK7A 3E05A 4JIGA 4HGNA 2XCLA 1NY6A 2X15A 4B3CA 3E7DA 1NQ5A 1WHSB 1IXYA 4RA9B 1E1KA 2J6HA 1Z08A 3N2YA 4QGHA 4Y2JA 1HDEA 4WFJA 1PQUA 5IKPA 2QBYB 4HNAA 1NJGA 3BGDA 1SZJG 4M1MA 4I4TB 5IMSA 4KP7A 4EMUA 3EZGA 3F47A 2QG6A 2VG8A 3GRVA 4CKXA 4HPWA 1F38A 3MTAA 2WVAA 5CB8A 1NR5A 4HD8A 5ICSA 3OM9A 4LOHA 5EJ8A 3VR0A 1UH5A 3VKUA 3GZJA 5J2TB 1T3GA 3DYBA 1DKOA 4ENSA 3D2CA 5IBQA 4R83A 4ZYUA 1IJBA 3ZW8A 1W5FA 1XRPA 4WIAA 2ZANA 2AG6A 4KYIB 4JXJA 2CD9A 5HF8A 2JD0A 3NKLA 2AIRA 4X3PA 4FM9A 5HKAA 4UBIA 1ZD8A 5GINE 2IPLA 2HH9A 1M3SA 3DTVD 5DISB 4MKGA 1GCGA 4CKWA 3A1DA 1TZJA 4HATA 3ZVKA 2VSXA 4MLCA 2Y4OA 4DL9A 4FSHA 3IIEA 1WHTA 4GI7A 1K0FA 1HOTA 1PV1A 3TSZA 4KR9A 5CAEA 4NJMB 3JVDA 4CIVA 1CF4A 1RI5A 4YRDA 4XX1A 3V2UA 2BGIA 5GAJA 2DBQA 1WW3A 1XQ6A 4F06A 2FR8C 4IYJA 2J9XB 2QRVA 1XDSA 1V37A 2FN4A 4D45A 1TZBA 4IHQA 4D6XA 3SBXA 3QVSA 2HLDA 3QTLA 2F43B 3TW4A 2GPWA 3T3OA 3IQHX 2VBFA 2G67A 4IDFA 4I8DA 1L7PA 3I58A 4Q21A 3JQ8A 1B73A 3GLVA 3P27A 5AJUA 4BNVA 5FH9A 5E7MA 2FJPA 4L78A 4YCAA 3CMCO 2ZM6B 4G5GA 5SZJA 4AJOA 1Y4AE 2PN1A 2J0UA 3BWVA 4HP8A 4EUEA 3BHIA 4QDKA 3UWSA 1QHFA 4FXOA 3RRZA 4WXPA 4YRNA 3NTRA 2E85A 1T2NA 1PV4A 3C5VA 1CUUA 5C37A 3RKUA 1PL7A 5FPHA 3M1IA 2RK3A 4P3XA 2CYBA 1LTQA 4GR4A 2ZRNA 3GMTA 3O9ZA 2PA0A 3CG4A 3OFNA 4Q3OA 1E2EA 3JRXA 3SQNA 3OQMA 1ZICA 4TGLA 4RK4A 2CFOA 1KO4A 1Z9BA 3T1VA 3UMYA 4FW9A 2EP7A 2X23A 4QEDA 2HTFA 2ZT6A 3RTGA 1DUIA 3HN7A 2QZZA 2CEKA 5IN5A 1MQSA 3ETDA 3JSXA 3KL4A 4XM0A 5JYEA 1J39A 4DRZA 4RADA 4HTFB 4N6OA 1P5RA 1GPWB 2Y1DA 4MUAA 4B6PA 3NWOA 5M34A 5LXTA 3WLIA 1PLLA 3ORQA 4FILA 3SQWA 5EMMA 2H0QA 3IPCA 1FS6A 4L5JA 3VU9A 3T9DA 1OAKA 3QKRA 3WGLA 3HXMA 4JUBA 2O7RA 1SC1A 1AUVA 4BC0A 1U3CA 4UCQA 1RBQA 2Q4DA 1J99A 3QPWA 1EHIA 4B74A 1CJTC 2AI1A 2WWIA 2IODA 4WKOA 2FZ5A 3KYDA 3EA4A 2DCMA 3HXOA 1FJGB 2WSMA 2BEWB 1CY8A 4I1OA 4M46A 4A5OA 1M7HA 3OY2A 5F2EA 3ZV6A 3ITNA 4OHRA 4MHSA 3Q7IA 3PR3A 2E49A 5AI8A 2FOLA 5K8TA 1JYSA 2I3GA 3NT4A 2C54A 2JGLA 4TXJA 2AOUB 4MINA 1C9YA 5A5FA 5IG2A 3OHSX 4HB2A 2C07A 3WLQA 4W6ZA 1LK5A 2V6BA 1FP2A 3LFTA 1GZ6A 3FOFC 1H5QA 1FTYA 3HEBA 5I4KA 5KWJA 4RDIA 3O8CA 4RY8A 4MRMA 2OB2A 5LYJF 3KQOA 2XYPA 3DMFA 2DSTA 4CBVA 4NOKA 1B16A 2RGNA 4CLEA 1E6LA 1RAHA 1SHZA 1L5GB 3HA2A 5CLIA 1TL7C 4V38A 5T4EA 4UAUA 1DINA 1QVZA 2EKPA 3G02A 4ZO8A 3UMRA 1ZD9A 5JATA 4Y1EA 4Z4GA 3KJQA 3HGQA 4F6LA 2G17A 4EO9A 4D3SA 4K9DA 2FPMA 3L18A 1BE8A 2BOVA 4ZMBA 5K0CA 1T9ZA 4M88A 3ZTTA 4R5MA 1MEOA 1Z2CA 4MR9A 1ZR4A 1QH0A 2RH8A 4O1HA 1QYCA 4OQQA 5E1MA 4HC4A 5JWHA 2H2FA 2WJ4A 3WBKA 4R1LA 5F2KA 4YX9A 3JQBA 1PL8A 2IEGA 1L5RA 4F93B 2V3WA 2F9LA 3LSYA 1JJIA 2AXEA 1HWYA 1X7GA 1JPUA 4M7WA 2FSUA 4FDTA 3A6JA 5LP6B 1BYUA 1SCUB 2F8MA 1I7PA 2WY2D 4GDFA 1K2WA 4AJ1A 1P5HA 5IXSA 2P9GA 1PL6A 3NBMA 3EXHC 1HSOA 4UNRA 2PZAA 2AHRA 4AUEA 1A9RA 5F7ZA 2O8DA 3QEMB 3C3WA 3MOIA 2NACA 4MDFA