5CIWA

Ran gdp y39a mutant monoclinic crystal form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
199
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords GTP-binding nuclear protein Ran
total genus 69
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ciwA00
3KXKA 3L2OB 1TQ2A 1KDTA 4Z54A 1NNEA 2IUSA 4Q02A 1F2TB 1BMFD 2O8DB 1JQLB 2QSYA 4BRWA 4CZ2A 4DSNA 4V0OA 4YDSA 5JCZA 2QTVB 4KSBA 1KMQA 2H57A 2RGCA 2PLFA 3SI7A 3NHAA 1OXTA 4F4IA 1G8GA 1G64A 3TKLA 3T5DA 3U61B 1H8HD 1ZINA 1R0YA 2YC2C 1FQKA 1K5DA 4G01B 1R6BX 5EE9A 2P2LA 3DOFA 1VG8A 5DYIA 2FOLA 3G0HA 4P32A 2CHQA 2ANBA 1TEXA 3X1DA 1NI3A 2R65A 2MSEB 2ZR7A 1TQ4A 5F2EA 5FPYA 3K9GA 5HZKA 5HZHA 1NN5A 2JA1A 421PA 5C46F 1W7AA 1R10A 1KYIA 2WJYA 2G6BA 1GZSA 2FSHA 4Z51A 1ZD9A 4H1VA 5E7IA 4P33A 1AK2A 4Q4LA 1Z0FA 3SBDA 2ZJ2A 1W2HA 3UXMA 3AVYA 3LVQE 2RMKA 2Z5FA 3MFYA 4W5WA 2C04A 2H7VA 5F3WB 1SHKA 2HT6A 3B9PA 3HU3A 1E96A 5SZIA 1KMHB 3R20A 1WDTA 3UG6A 1Y63A 4BWYA 1OSNA 1UAAA 3VAAA 2ECKA 2ZSFA 2WMNB 4N1AA 2ZVQX 1NBMA 3U7HB 4FMCF 1DPFA 3I5YA 1E2QA 2QBYB 3PQCA 1VPLA 3VR6A 1SQ5A 4DEXA 2WKQA 1GSIA 4LHVA 2FWRA 2QPOA 2GNOA 5BN4A 2D7DA 1AGPA 2CBZA 3LXRA 4JYBA 4G5GA 1FUUA 3WP0A 1XJCA 1LS1A 3GD7A 4BZPA 2GVDC 2H8KA 4BRUA 4A15A 2RH5A 2WJHA 4B47A 2WIAA 5BXQC 2V55B 5L3QA 1X1RA 2R2AA 2QRNA 3P32A 5F9FA 1HT2E 2XNDD 2OESA 4PX9A 1P62B 1EG7A 3AP3A 4R7ZA 1UBFA 5DNYB 1DAEA 5K8UA 3MMPA 3MG9A 4JVLA 1XF9A 2ZR0A 1ZYUA 4JL8A 1TTTA 2ZJZA 4JLOA 3SHWA 3AV0B 1Q1BA 1OXUA 3AB3A 5FOXA 4XWOA 1EFUA 4P4UA 4AD8A 2IS4A 2C5LA 4MRRA 4MUBA 1OH7A 3RRYA 3GLGA 4M1YA 2OBMA 1OHHD 3IHWA 1S1CA 3L8YA 4I99A 2NPFA 2F1IA 5FOWA 3TSOA 2H92A 2VP6A 2JLWA 2OSBA 3AVUA 4NHOA 5FOTA 4UQOA 3JZAA 5CYOA 3WNDA 5CIQA 5TDHA 1W2GA 3RDPA 5KNDA 2BHRA 2BKUA 1S0UA 2OXRA 1G3UA 3SJAA 4NCHA 2NO1A 1R4AA 2VA8A 1L8QA 4BE7B 1WMSA 1II9A 1G21E 3HU1A 5JI3E 3VHXA 3G82C 2XZLA 2YNMA 5EXPA 3O8CA 5KOYA 1KMHA 2AHOA 2YWGA 4RKEA 1SXJE 4CVNA 3QEOA 2IYWA 5EUQB 1OXSC 2HXYA 3RWMB 5ELXA 1QZXA 1W4CA 1JR3A 4PAMA 5AUNB 3AM1A 2FSIA 1E9BA 3LBIA 1G8FA 1OFIA 3EPLA 3MWLA 2JASA 3FFAA 1W49A 4I1OA 3FTQA 4RKFA 3VKWA 5IDVA 3SQWA 1NVWQ 2J0QA 3QEJA 3C5CA 5JSZB 4TT3D 5JJLA 5E4FA 2W6ID 3MWKA 3SJZA 3UMRA 1F60A 1A4RA 4FINA 3TSWA 2IYYA 3ASYA 4PO9A 3T12A 1VG1A 1W1WA 2ERYA 2GEUA 3AGQA 4HYYA 1Z8FA 3A1SA 3P1JA 4DB2A 4LJ6A 1WF3A 3VR3A 1YZQA 2P0EA 2G1JA 3BORA 4Q1FA 1CTQA 1T3HA 4DLRA 3D3QA 5AJZA 1CRPA 2GCPA 1M8PA 3UKDA 3VNVA 2QI9C 4FW9A 1DO2A 2ZI4A 3D8BA 5KUTA 2DB3A 3FPAA 3MGCA 3FFBA 3GQBA 3NWJA 4WIAA 3LVRE 2CCGA 1HA3A 1U8ZA 4LRWA 1AA9A 4IFEA 1UF9A 3CRW1 4D25A 3IHLA 6Q21A 3LA6A 5A4JA 1HY3A 3LRPA 721PA 1SVSA 1LVGA 1XXHA 3SFZA 1XP8A 5GJVC 4YMUA 2PMKA 3GLFE 1KI1A 1U2RA 1A7JA 4EFNA 3EPKA 2AD5A 2O8CB 2V1UA 2BC9A 3W34A 5UKDA 1XCMA 3AP2A 3B82A 4ZPXA 5AUPB 3K8YA 1XEFA 4OQXA 4CEIA 1CRQA 1H8HA 1T3LA 2YWHA 3K09A 3EA0A 3O8DA 4QXAA 2RGBA 2REOA 1XEXB 3U3MA 2PMDA 5HCIA 4KVAA 1G4UR 3TH5A 4TZ6A 1OT3A 1VIYA 1SZPA 3AQ4A 2ZRCA 2GCOA 3GFTA 4V02A 4DB4A 2QORA 2D06A 2ZRMA 4YMVA 4NYJQ 4DHEA 2IL1A 1W36D 3VX3A 3L43A 3IUYA 3D31A 3NBXX 3H84A 2XITA 2X2EA 2GXQA 2HV8A 4F38A 4L9WA 2PBRA 1TF5A 3MJHA 5CDFA 3PFIA 3SN6A 3EC1A 3GJ7A 3OFND 2ZVPX 1PLJA 4MKHA 1P72A 4LJAA 1BOFA 2EYUA 1LFDB 2OCPA 2Z43A 2I1VB 2ZRIA 4OHWA 2A3RA 1G8YA 1Z0AA 4KYIB 4OQNA 1X8JA 3X1YA 4URXR 3LD9A 3K0EA 4I1SA 4UXIA 2AK3A 2GRJA 2ZRBA 1US8A 1YZNA 2OXCA 1EWQA 3CKLA 1GRNA 2ASEA 5TXGA 3TGPA 4CW7A 2XXAA 3LQQA 4TMZA 1E79D 2YC4C 3UK6A 4OKSA 2PCJA 1OXVA 5FBLB 2A2ZA 2NO7A 2BJVA 2BBOA 2FPLA 5AK0A 2LCFA 2GDJA 4M9SA 4LPSA 5D3MA 1VHTA 2VSFA 2VH5R 1E69A 3PJRA 5EE5B 4XTCS 1OH6A 1N0VC 2HUPA 1Y3AA 3TMKA 3ZH9B 1J99A 1HTWA 1VG0B 5FUVA 4B2LA 1RVDA 5FOUA 3SOPA 2IT1A 4RD0A 3IDQA 1AZTA 2GJ8A 2UZ3A 1U81A 1KKMA 3A1WA 4FIDA 4BFUA 1T5IA 4CEHA 4ZCIA 2BBTA 2O52A 3ZDQA 5FPKA 4FWTA 4YMWA 3OESA 3EW9A 1KOFA 1VCIA 1NBME 5E7JA 1XU4A 1ZD8A 4MRPA 3GLHA 1MO3A 1Q3TA 4LK2A 3RS0A 3S1AA 1GKUB 1NN3A 2CL6X 2FH5B 2J7PA 2OFWA 4TTQA 2WSMA 3TR0A 4XJXA 1OPXA 1VYTA 1R5OA 2MMGA 3RLFA 2HLDA 3AUYA 3EZFA 1ZIOA 1E99A 3CM0A 2WWYA 1RE0A 3NH9A 3WRXC 4GP7A 4GSYA 5FOVA 1E1RA 1W0JD 3V4FA 4B3BA 4BFWA 2I3BA 3BWDD 3NBFA 3WYGA 4B73A 1DTSA 3KUDA 1Z2AA 4GMXA 1MO4A 2CHVA 1QVAA 4JT2A 4EQ6A 1K5GA 1RZ3A 4DCTA 1MKYA 1OV4A 4EPXA 1XZQA 3SYKA 4B71A 5JFGA 2J7KA 2Z0MA 1AQYA 1RIFA 2XOKD 1WE2A 4RZ3A 4MYHA 4QNMA 1QHIA 1S3GA 4PR0A 3THWB 1OJLA 1V43A 1GRQA 3NXSA 5AUOB 2QE7A 2VYFA 2QP3A 3LXXA 4AYXA 1J90A 4AWXA 3KZ1E 3IEUA 4Z1MA 3BAFA 2GCOB 3I61A 3ZJYA 3GLGE 2DFKB 4Q9JA 2QNRA 1KK0A 3GJ0A 4KVGA 4L4UA 4Q4AA 3IKJA 2GJKA 3KJGA 4M22A 4WXRA 1W36C 3I4LA 1RFLA 4Q47A 4MRSA 3RNLA 2OBNA 5CITA 1Q0UA 3OIWA 1R0ZA 2REXB 2ZE5A 1LB1B 4LBVA 4LZZA 4B75A 1IXRC 2KB0A 2XX3A 3U44A 2HJVA 4A9AA 1SXJB 4HAWA 2IF0A 2ANCA 4NZYA 1DS6A 3FVQA 4HI0E 1N5KA 2AWNA 4LC0A 5FL3A 4ESHA 2ZI6A 2EFHB 2Z4RA 1R5BA 2ZRJA 3TW8B 4Z8XA 2IYTA 4DUGA 1CJKC 5KDDA 3B1VA 5JWOA 2VP4A 4TMTA 1GDDA 2GXUA 1S4QA 2F55A 1NSFA 2R62A 2RKOA 1U8YA 4JIMA 3MCAA 4JJZA 4MQBA 2QUZA 4LGMA 2W6JA 1R5NA 2IW3A 3CR7A 3JZMA 2G88A 4HAYA 4EJSB 4Q4JA 2F3TA 2O0HA 3M4YA 2A5GA 2NZJA 3GJ6A 1DAFA 3AF3A 4FI3C 5GVRA 3U3OA 1XD2A 2ZSAA 4C4PA 2JJ8A 5FTNA 1DG3A 3T15A 2XTNA 2JLZA 5J40A 1QHHA 2A30A 3BH6A 1KI7A 1KZ7B 2BKEA 2OUKA 4C0JA 5C4MA 4B34A 1VDZA 4Y0AA 5EUMA 4B44A 1E2NA 2VP5A 3TQCA 2XB2A 2GWHA 3A8TA 1N0WA 4IOLA 1NIJA 2H1LA 4IW3B 4XH9B 2QAGB 2VF7A 1LTQA 1HH4A 5IRCD 1CEEA 2Q9BA 1XMSA 4UKDA 5FR2A 3QF4A 2ZPTX 3LW8A 3GJ3A 1NLFA 1KK2A 2J7PD 2P65A 4HUQB 4HB2A 5TB5A 2GXSA 4DLYA 4AKHA 3CUEF 4CEJB 2Z6VA 3LLUA 3MWJA 1FW6A 1EX6A 4AKGA 3ZVMA 1DAHA 1LF5A 4HLUA 4M1MA 1E4YA 3PEUA 5BW8A 1DAMA 4H9GA 2ZE7A 2ZRDA 4LYJA 4TYPA 4JVSB 1S3SA 1YZTA 2ZJYA 2IYUA 2ODWA 4JLAA 3GLGB 1JXMA 2QTFA 4M0LA 1EFRA 1Q12A 2PLRA 4KV9A 5DI9A 1AGRA 2A5FA 2OAQ1 4V0LA 4LJ9A 4FN5A 1NRJB 3R8CA 3EARA 1CR1A 2IF2A 4ASUD 4RD4A 2V1XA 3QF7A 2VP2A 2PJZA 2C9OA 1XTQA 5CK4A 3KQUA 3QXHA 2HDNB 1CJUC 2GTPA 1G7RA 4TYYA 3WMEA 1GL7A 4BLOA 4A36A 3K0CC 1KO1A 1VYUA 1KJWA 3FKSA 4KHZA 3ZGXA 4LHYA 1KIMA 1H8EA 2BEJA 1UBEA 2QMHA 4PC7A 4NCNA 1BIFA 2CNWA 4A8JA 1GL9B 3ONWA 3R8FA 4A0FA 3AKYA 2ZTSA 3CRQA 1WB9A 3HDTA 1RPZA 3GLIB 1EFRD 3I32A 3F3YA 1QBKC 4KFUA 1Z28A 3WNBA 2ZM5A 4CEJA 2X1VA 5AWFC 1FMJA 2CEAA 3THYB 5HKKA 2BCJQ 2F43A 4JLDA 2PT7A 3B8HA 4DLSA 2WJVA 4D82A 1D2MA 1Q57A 2LKDA 5KSZA 3K70B 5FUXA 2RGNC 1GNQA 3MRSA 3WXMA 3X1WA 1I4LD 1MRNA 2CCKA 4MYTA 2QMOA 2FJUA 3CLVA 3KL4A 2B7CA 2D4HA 5F9HA 4QRHA 4PC1A 3K0SA 1AS0A 4QFMA 4QJ4A 4S35A 2VP9A 1R8SA 1YQTA 2GBLC 3Q3JB 1HV8A 1E9SA 4B35A 1D2EA 1DAKA 3QXSA 2LWIA 1GOTA 4DXAA 2O8BA 3LBNA 1LV7A 4G3XA 1JQJC 2C03A 2RGAA 1TEVA 3ZIAA 3EZ6A 1P9WA 4GPTA 3CNOA 2EU8A 5EXXA 3A6PC 4JLMA 1OKKA 3WYFA 1WRBA 1QHNA 2JJ2D 4O0MA 2B8TA 1NY6A 4EJSC 1Z06A 3FMOB 5DHFA 2WJGA 3K70D 3CO5A 4B43A 3QE0A 1DAIA 1F2UA 4P4TA 1KSFX 2MSDB 3K1JA 1E9CA 4B48A 3SYNA 5B64A 1G41A 1EWRA 1OFHA 1E6CA 3BC1A 3EC2A 4TL9A 4PO1A 5DIFA 4L16A 2GXAA 4DSTA 2B7BA 2CK3A 4PHGA 4WZ6A 4TYNA 1ZM7A 2PZGA 2ZRAA 1XD2B 3BRWD 1ESMA 1HE8B 4M1WA 4K8OA 1G8HA 4YXWD 2AFHE 2GEDA 4GMDA 4A6PA 3ADBA 4G5RA 1ETUA 3EASA 3B9QA 5BYJA 4LSGA 1FTSA 1BS1A 1G5PA 5HPYB 1Q22A 1ZJ6A 3EPJA 3RYTC 3RC8A 2FSFA 2QL6A 3ZVRA 4PHTA 4TQUS 3CBQA 2R6FA 4O25A 5G41A 1IONA 4F93B 1Q20A 4DZZA 4PXAA 3QNUA 3PVSA 4PAOA 2WWIA 1IN6A 1QVRA 1U9IC 5H70A 3IQXA 4TMXA 2GA8A 1N5IA 2BDTA 3SJBA 2WWWA 1UBGA 4PANA 3T34A 1W0KA 2IYSA 3PXGA 5IT5A 4U7DA 2MMCA 2IYLD 3AKCA 3ASZA 3CIOA 2BM1A 1JAHA 5B58C 3MUFA 1XD9A 2ZE6A 4KU4A 4NL4H 3GCGA 5FR1A 4BZXA 1L4YA 5CM8B 4IXMA 2JAQA 3RRZA 1XDBA 1P2TA 2UKDA 5FOSA 2DFLA 2FDCA 3U5ZB 2XNDA 1CR4A 5KSPA 2CLCX 1HUQA 1WP9A 4N0DA 3CW2A 1E2JA 5CK5A 3CX7A 3H86A 4Z1MD 2ZRLA 3V00A 3L0SA 4NP6A 1PLKA 3GLHB 2TMKA 1W48A 2ZAMA 1Z0DA 2AN9A 2O8CA 1Z0KA 1ZCBA 5F98A 2JLRA 3NDPA 1X1SA 1W0KD 2FA9A 2WIBA 3NVAA 4FCTA 4YLGA 4QJ3A 1ZAKA 3QXCA 3REFA 2IYXA 2VRWA 4XWAA 1FQJA 2F1JA 4TSFD 4RJLA 2JCSA 1HT1E 3DZDA 1A2BA 4IDHA 3KX2A 1CJMA 3N2IA 5LPNA 3NG1A 1QHSA 4LBYA 4HDOB 4R71A 3NC0C 3S1AB 3I3SR 1M34E 3BIFA 4BFZA 4TQ9A 3SS8A 1G7CA 2YJTD 4JVMA 3W5IA 1IXZA 2Z4SA 4IHQA 1G6OA 4OI0A 2BM0A 4RY2A 1XTSA 5DO9A 3KDSE 4O2LA 2GESA 1U0JA 4HZIA 4M9ZA 1R7RA 2ZU0C 2WBLC 3AF2A 4MRNA 4F4JA 1QG4A 1G6HA 1F48A 1X86B 2VP0A 1TUIA 4XVQA 2ZITA 3QI2A 4A0RA 2G0NA 5FUYA 2WPDD 5EP2A 3NH6A 1E2LA 1TU4A 2BOVA 3LV8A 2OEPA 5JCPA 5KTYA 1PUJA 1NY5A 3FMPB 4EPYA 1E1QD 2G9NA 1OIXA 5B30A 1OB5A 1RW4A 1M7BA 1X6VA 3VR5A 4NCIA 3P26A 1FP7A 1BMFA 2O8EB 3QKSA 3PEYA 3A37A 3ZD7A 4PHFA 3HPQA 3QPUA 3RSOA 4ZDJA 1DE0A 1CJTC 1COWD 2WWXA 4MYUA 2OE2A 2QRZA 2J41A 5JRZA 2ZRPA 2O8EA 3VKGA 2W0MA 1NLYA 4CGZA 2D2FA 1P61B 2CCJA 4HB0A 1BH2A 4LJ5A 1QRAA 3HYTA 4GP6A 3PENA 4Q7JB 1NKTA 3B7GA 4TMWA 2C96A 4YC7A 3CPHA 3TE6A 3EX7C 1ZBDA 3BFVA 4PPGA 4KFSA 3RC3A 2QP9X 2REBA 4QBFA 4M8NE 1SULA 1ANKA 1ZW6A 221PA 3B13B 4P4SB 1SKYE 2WWFA 4R98A 2VHCA 4Q7MB 2J0UA 5IK2D 2QU8A 3SZRA 2QG6A 2ONJA 5JHGB 4IDQA 3LO5A 5GVSA 1RJ9A 3VNUA 1E9FA 4IDNA 1XEXA 2BBSA 5AJYA 1G8PA 2CL7X 2OO7A 1P4SA 1TNDA 3CF2A 4II7A 4R9UC 5BN3A 1E2MA 2ZYUX 5FBQB 4Q7KA 4LBWA 3SJCA 3B85A 3ZZ0A 5FI0B 5DH9A 3M0EA 4QGHA 4LJ7A 2VHQA 4QGAA 4D4MA 5BN5A 2H5EA 4UNRA 2P3SA 4BEBA 4A1FA 3IGFA 2OLJA 4CF7A 4Q1AA 4FMDB 1MABA 1W0JA 3NBZC 4M2LA 1Z63A 1EESA 1GILA 2MSCB 4PC6A 1KK1A 4ESVA 2ZREA 4IVQA 2F9MA 2PT5A 1FUKA 3CPJB 2FZ4A 4DCSA 1DVRA 2ZIAA 1YHNA 4EPWA 3L0OA 3UG7A 3A4NA 3BB4A 3BB3A 1P6XA 2DHRA 4ZIRA 3IBGA 2BMJA 2XAUA 3QKRB 1FX0A 3RAPR 2QE7D 4F92B 3GFPA 4AY2A 3A1VA 2WV9A 3AGPA 3GFOA 5GADl 3IPXA 1IBRA 1XFAA 4OI4A 3DDCA 2I4IA 1M6NA 4Q66C 2OT3B 1GP2A 4M4SA 1FNNA 1GAJA 3U2QA 1J8YF 4C0SA 2GF0A 5FH9A 3Q5EA 3ZIAD 2QY9A 4QHYA 1MRSA 1GVNB 2X8AA 2WAYA 2IYVA 4DT1B 3IO5A 4QJ5A 3DMNA 5KDOA 1AN0A 5LD2B 1TQ6A 4POAA 4D2IA 2EFEB 2X2FA 2I1QA 4LDJA 4IOMA 1E2FA 4BLSA 1I2MA 4PAQA 4C2UA 3AP1A 2J5XA 3CWZA 4DEYA 3HP1A 4QBIA 3R9XA 1E9RA 2C9YA 2WZQA 3SC3A 1QHGA 3SBEA 1OIVA 4M1TA 1OFTA 3M1IA 5JZVA 3HPRA 2EWWA 4O3MA 3JVVA 3K9LA 4JBYA 3CH4B 1XBTA 4V0KA 4NTZA 5HE8A 2ZRNA 3CZPA 5AR1A 3RS7A 4GBMA 2XSZA 3U7FB 2FFAA 4C9BA 4IXNA 1N6RA 3ND9A 2QPTA 1YRAA 3SE0A 4JL5A 4C2TA 2W58A 3PITA 1UKEA 4Q48A 5J4HA 5FPHA 5A5GA 1MR3F 5CLLA 1LNZA 1GFIA 1D9XA 1ZRHA 3QBTA 1HE1C 2ZSDA 2J0VA 2ZEJA 3TR5A 1XEWY 2G0TA 3U60B 1ZD1A 4TYWA 3KB2A 3H1TA 4G5OA 5CYPA 1M7HA 2ONKA 1NMZA 3QQ5A 4GZLA 2QAGA 4URYR 5LDDC 4BECA 2XNSA 3LWNA 3SR0A 1Z6YA 2DWPA 1E94E 2IX3A 3I73A 3WBKA 1NMYA 4PSAA 1KKLA 2C8VA 3U7EB 1ZIPA 2FPMA 1IY1A 3FKQA 4BQSA 3CB4A 3WP1B 2A5DA 1XTJA 4HLDA 3X2SA 4IOJA 4OK3A 1Z6XA 5IF9A 1JR3E 3BJIC 2BBWA 2ZJAA 4ITRC 4DUGD 1AM4D 2A5JA 3QBVA 3TVDA 2WTUA 3X1ZA 4HAUA 4H1UA 3SEAA 4GZMA 5DLQC 8OHMA 5AJWA 4L15A 1A82A 1DBSA 2GBLA 3Q72A 4BEJA 4TQAA 4KSCA 1FZQA 2EQBA 2JLXA 3LLMA 1NBMD 4CT4B 3NBYC 3X1XA 2PCLA 2PZEA 121PA 3FWYA 4G0NA 1G1MA 1H8ED 4QOSA 5CDFE 4A4DA 3Q85A 1Q44A 2JLVA 2F1RA 1QHHB 3SHFA 2F43B 2W00A 4LPKA 2WOJA 4KBFA 2QROA 5L3RA 2J0UB 4XD7A 4U5XA 4PQYA 3VU9A 3ND8A 1N5LA 1WQ1R 1ZU4A 2ZETA 2AK2A 5SZJA 4CRWB 3C8UA 2BJWA 5K8IA 4PSVA 3U44B 4C7OB 3UATA 4LV5B 2NOAA 3IIJA 1NP6A 3GLFA 2P67A 3H2YA 2C95A 1Q3HA 4X8MA 4Q9KA 1WXQA 3LQRA 3BD9A 3K0FB 4ZCMA 2WM9B 4LJ4A 2DCUA 3CX8A 4LHWA 1OE0A 2Q9AA 3RS5A 4BFYA 4A0GA 3BB1A 5H68A 1QHYA 3LDAA 5KU1A 2IA5A 5KPDA 2JLUA 2FEMA 3I8SA 3WNCA 4LHXA 3MSXA 4LYAA 4PPQA 3HJNA 2P6RA 3QKTA 5GJCA 1HQYE 1XPUA 3THWA 1VG9B 1BYIA 1KDPA 3RRNA 2L0XA 4JT4A 1Q1ZA 3C14C 1SKQA 5CIWA 5FTJA 1CR0A 3BXZA 3THXB 2J9RA 1DARA 3GLHE 3OEEA 1MO6A 1HURA 4D0NA 4MH0R 4HATA 1XJQA 4U00A 2CLDX 4RD1A 4NE2A 3VR2A 2DFNA 3K09C 1ZC4A 4HUQA 4Q1DA 2FV8A 3GJ4A 3DOEA 3KKQA 1XPOA 1OYWA 5JJKA 1FMLA 5P21A 5FBRB 4PPNA 3VX4A 1DOAA 2C99A 4G5QA 3PIRA 5TV2A 4GOKA 2QN6A 2HLDD 4Q00A 3QVUA 5DE3A 1S1MA 1T9HA 4MRVA 3L8ZA 3VHLB 1Z2CA 2F3RA 2A7QA 1ZUHA 5DHAA 5LD2C 2YOFA 2IXGA 4TYQA 1N6HA 2ZR9A 4QBGB 2XZOA 3B78A 2HF8A 3IQWA 1FP6A 5KNBA 1KSGA 5DI3B 2GJSA 3THOA 2Z83A 3OIUA 4Z8YA 2YWFA 1GTVA 1G20E 1ONBA 1X8LA 1Z47A 4GL2A 1X3SA 1CBUA 4Q9IA 5H8WA 1TMKA 2OHFA 2ZU6A 4B3CA 4NYJR 1UM8A 4HB3A 4OQLA 4Q4JB 3O8RA 1AKEA 1E0JA 2ZJBA 2WWHA 3DKVA 3W6PA 4TL8A 1RC8A 2IHYA 2PH1A 1JAIA 2XSZD 3DL0A 1E4VA 1QG2A 4JZKA 4UJ3A 4HDCA 2VHTA 4I1VA 5LBIA 2WKPA 4M1OA 4BASA 1LY1A 3DZ8A 1KAOA 5EXTA 1AZSC 1KO7A 1VYVA 4JLKA 1S9DA 2Y8EA 1A1VA 4MITA 3BE4A 4S2EA 1MO5A 1JJVA 2GZHA 2DYKA 2FMXA 3FB4A 2VHJA 5D3MB 3GP8A 3CNNA 2PX3A 4QGFA 2GAAA 3VTKA 4V0NA 3UWOA 3BH7A 3TAUA 4B3XA 4BFVA 1KI8A 5E3HA 4JL6A 4B6EA 5CM9C 4Q1EA 3PUXA 2GILA 3R7WA 2Q3HA 2ZE8A 4LOAA 4R2IA 4Q21A 3VMFA 2D74A 1NN0A 2HYDA 4XTRA 4C30A 4X8LA 5JMTA 1ZP6A 4PHHA 3OIVA 3I62A 4NYIR 3HU2A 2ZI9A 1L7VC 1I4TD 1AIPA 1OH5A 2V6JA 2N46A 1E0AA 2ZAOA 3DHWC 5J4KA 4A92A 3M6AA 3TW4A 1UKZA 2YV5A 2CK3D 2ORVA 2QGZA 1Z6TA 3FE2A 4IFBA 1KZGB 2JDID 3K0AA 2LKCA 3CR8A 5CJPA 3U3JA 4CEIB 2ZI7A 4UNQA 4DLUA 1E9DA 4B3DA 4M9XA 1ZMXA 2XB4A 2YOGA 4B2PA 4WXPA 4B32A 2ZANA 5C4GB 2VQSA 1OF1A 3DM9B 3W8RA 1JJ7A 1G9XA 1N6KA 2PEYA 3KXLA 1VMAA 4MKGA 3SDZA 2RGNA 3T61A 1ZNYA 3CRVA 4QNRA 3QOFA 4HAXA 1M7GA 2FU5C 4KITB 4MDFA 2F9LA 2WHXA 5K8LA 3QSYA 1EFHA 3ECCA 4XIGS 2JJ1A 3K0FA 2ZRGA 3LH5A 4AIIA 2ZI3A 3U3KA 4DLVA 2FZLA 3ZLJA 4PTLA 1KY3A 4EDHA 1XMIA 2ZYTX 4M9QA 3TIFA 2AKYA 3QKUA 2QMEA 2XOKA 4QL3A 1U90A 1NLZA 3OEHA 4M21A 4N3NA 2EYQA 3TRFA 1KAGA 4EKDA 4X8HA 2FNAA 2FE4A 4C0LA 2D7CA 1XXHB 4OK6A 4ILEA 4M53A 5L3SB 1W44A 2QQEA 5HR5A 2FFBA 1IOZA 2KWIA 1N5JA 4DLTA 3AF1A 2AKAB 2DFTA 1JEEA 2N1BA 4QHSA 2OZEA 3T1VA 1KGDA 3WBJA 4YMTA 3AVWA 3C15C 4G5SA 3ZS9A 1XX6A 3K53A 3TUJC 4C3ZA 2J3EA 2YHSA 4URWR 1F2UB 3PEVA 1W4BA 4LV8B 2Q3FA 3GJ5A 3RVBA 3WHLA 2FN4A 1KSHA 2RHMA 4NCJA 4PZYA 4K46A 2PX0A 1CS4C 4AG6A 4HAZA 1N6OA 1SXJC 2VSOA 2F1HA 2AXNA 1XJ0A 3THYA 2CVFA 4U02A 1KI9A 4LX0A 1XZPA 2R6CA 3E70C 2O8BB 4NBSA 3U6KA 4TSFA 2B8WA 3DM5A 4TT3A 1Z5ZA 1E2EA 2WSSA 3KJIA 5JRJA 1KI4A 3GMTA 5TVKA 4ZI3A 1HQCA 3ADKA 5HCNA 4US1R 1DEKA 1F3OA 2WJIA 3B1XA 5IHPA 1GITA 1TQDA 3ZVNA 4FMBB 1WBDA 3OAAA 1PUIA 2RCNA 4LHZA 4HSEA 1ZNWA 3TVTA 2G1KA 2IBMA 3BK7A 4KFRA 1JALA 2AL7A 3RABA 2QAJA 3RRMA 1JI0A 1B23P 1ZC3A 4A8JB 1SVLA 2W2VA 4A0HA 3GLFB 1ZCAA 5FBVB 1YZGA 1PLLA 3KKNA 2NO9A 4LC1A 4NKRA 4AG5A 1G3RA 1ZVQA 5CB6A 3MWYW 3ZD6A 1OIWA 1OHHA 1SHZA 1PV4A 1E98A 4GNKA 1FL9A 3A58B 3CRRA 2JIZA 4PZZA 1KNQA 4DCUA 1J8MF 1XCPA 4WZBE 2FG5A 2JJ2A 3W5JA 1KI6A 1NSTA 2JLQA 4KI0A 1ESNA 3DO6A 2O8FB 2YOHA 3BH0A 4L8GA 4DLXA 1CR2A 5DN6A 1IAQA 3GLIE 4OQMA 2ZSBA 3QPWA 3D6TB 1OW3B 2OM2A 4IEEA 4F4CA 1J70A 1FFHA 5J4VA 3B60A 1A5TA 1UJ2A 4C0BA 4ZIRB 3Q7QA 1G7SA 3Q9LA 1W5SA 4OHVA 4BLQA 2NMVA 1NF3A 3J81k 5B2ZA 1TX4B 1N25A 1W47A 4MGYR 3IIKA 1XXHE 1XB2A 3CX6A 4YDHB 4BLRA 4DLZA 2IUUA 1II8B 1G7TA 4HUTA 1YR7A 2DPXA 2OV2A 2XTMA 4ZV4A 1II8A 4DDUA 4Q03A 4DSOA 4GOXA 3BFKA 4I4LA 4MDEA 1ZM4A 4P0TA 1N3BA 4RVCA 3EPHA 4QBHA 4JLJA 3LY5A 1D9ZA 2WOOA 2OFOA 3W6NA 4V0MA 2V4ZA 2CHGA 2QQ0A 3LX5A 4TMVA 5TY0A 4D0GA 1YR9A 5G3ZA 3EA5A 1JB1A 1DAGA 4I1UA 4JLNA 5AUQA 2W2TA 3W6OA 4NH0A 1AS3A 4AKEA 4TZ0A 4G1UC 2JATA 4ZKDA 1T8UA 4IOKA 4JYCA 2JLSA 2YINC 1YR8A 1MT0A 1KJZA 3AF0A 5L3SA 1TAGA 3QPVA 2CJWB 1IN8A 1PJRA 4UNNA 1RRCA 2ZUBA 1RRPA 2FGKA 4L5BA 2DBYA 5GJWC 2XEXA 2O5VA 3FHTA 2BMDA 1ZNXA 1IXSB 1E2IA 3I92A 4GFDA 4LJ8A 4P31A 5EP3A 2P6NA 1UDXA 4DDTA 821PA 2RGXA 1COWA 2EW1A 5DYGA 2IYZA 2O8FA 1UDWA 3H0KA 3C7KA 1U94A 2BV3A 2RGEA 4BUJA 3V4RA 3K70C 1VCMA 3K9HA 1P60A 4JJKA 4QG7A 1MOZA 5ANRB 1E2KA 4URVR 3CF0A 4DSUA 3PUYA 5C18A 1T0JB 1KNXA 3ICQB 4PZLA 3P20A 3DPUA 2V7QA 3KQKA 1Z29A 2NG1A 1N6NA 4URUR 3PG5A 2HEIA 2FSGA 2ATXA 4NYIQ 1Z6GA 1VECA 5JI2E 3SU8A 5GJBA 1P3JA 3EIQA 4FMDF 2D62A 1T6NA 1KHTA 3DVLA 1W36B 2YWEA 2DR3A 2ZUCA 2IWRA 1N2CE 2BWJA 2EFCB 4Q18A 3FDIA 5FUWA 2QBYA 3IBYA 1YU9A 1W4RA 1IM2A 3QF4B 1CIPA 3QUSA 2QT0A 5L3VA 1E0KA 5CB8A 1W5TA 3TUZC 2VEDA 4JLPA 4M1SA 3B1YA 3KQHA 3KQNA 4W7SA 3R7WB 4O2RA 1FX0B 3LX8A 4TLBA 1PZNA 1J7KA 3K9NA 1NG1A 4B74A 4ZDKA 4KXFB 1JEDA 1SVOA 5LB4A 2SHKA 1HEIA 3L0PA 1CJVC 1EGAA 3PR1A 4D6PA 4Q1CA 2NIPA 1KSJA 4LYHA 4PFSA 1D8TA 5EP4A 4A2WA 2GJ9A 4JSTA 2WPDA 4R2HA 3EXAA 2FPKA 4MGIR 1QHXA 2V3CC 5FI1B 2YYZA 3T1QA 4Q4HB 2H18A 4EPTA 4M1KA 5JLJA 4ERNA 3NC1C 1TPZA 2R6GA 2ZS8A 2R6AA 2QPAA 3EZ7A 4XWKA 2V6IA 1UFQA 2QMUA 1ZM3A 3SYLA 3PCRB 4RD2A 4RZXA 4CEHB 2NPIA 1WCV1 1K6MA 3A1TA 1ODFA 2ODNA 2J45A 2QA5A 4GRAA 1SVKA 2F7SA 3MD0A 1AKYA 4MYCA 2YVUA 3FMFA 4XVUA 1NVVR 4EFLA 1F2TA 2ZQ5A 4D0LB 1ZNZA 4WA7A 4TL6A 5FFMA 3F5FA 4EAQA 4P4SA 4IKEA 3UPUA 3VR1A 4QGGA 2CDNA 2E87A 4ZDIA 4JMPA 2IK8A 1W46A 1A2KC 1M2OB 1EXMA 1SXJA 2CNWD 2VTKA 4D4JA 1XNJA 1KY2A 2WVJA 4KAXA 2XXAB 4HZUA 1OFUX 4AK9A 4DIDA 1XEWX 1E79A 1XTRA 3N5CA 2IS1A 3K0AB 2ORIA 3T1OA 2J46A 4L9SA 2YKGA 2KE5A 2C2HA 3RS4A 2QT1A 2JLYA 1ZUNB 4QM7A 4EPRA 3GEHA 2ZJ8A 1B0UA 2VL7A 2ZJOA 4OHXA 2DWOA 1X8KA 2HCJB 4RZ2A 2J87A 3L82B 3DEFA 1Z08A 3PUVA 4JS0A 2A5YB 5FL7A 4B3GA 2OG2A 1RKBA 4GI7A 1XPRA 1S96A 1L4UA 2GVZC 1VHLA 1MV5A 2EVWX 3L0IB 2GKSA 4IEIA 1UEJA 5EXSA 3REGA 2C77A 2JEOA 4B3FX 4BZQA 5E7MA 3CZQA 3ZZUA 4TTRA 4X8OA 5BYKA 4EQ6B 4W9MC 2YZ2A 3CNLA 5E95A 3W3ZB 4ZCLA 4FCVA 4IVRA 5BWMA 3PUZA 5KYKA 2Q3MA 3CRMA 1CF4A 1L2TA 1C9KA 1OYYA 4TN1A 1XD8A 2ERXA 2ZRHA 1TL7C 1Z22A 4N0EA 3RWOA 3AVTA 3DKPA 3HWSA 2R6DA 3EZ9A 2QM7A 2GCNA 4A6XA 3U6BA 5JEDA 3AVQA 2XJ9A 4IJMA 5CJ2A 3B2EA 4BFTA 2B21A 1N0UA 2W83A 3DMDA 3MJRA 3SQXA 1IJFA 2AXPA 3TAHA 3QXXA 1KJYA 4DCNA 4TLCA 4QHTA 5J5CA 5J4YA 1D5CA 3RHFA 1NL3A 1NJGA 4UJ5A 1AQUA 3WHKA 2GZDA 2GAOA 3KKPA 2IS6A 3C41J 1K8RA 3LW7A 2CJWA 2E9SA 4NCKA 2IUTA 4Q4HA 1NVVQ 4ZI2A 1RRFA 5JEEA 3SFVA 3OF5A 1XRJA 2AWOA 1GL6A 1JR3D 2J59A 3PV0A 3H4MA 3E2IA 2R9VA 5DI3A 1E2PA 4URZR 3U7GA 4Q9HA 5SZKB 3ADDA 1GNRA 3W90A 4E03A 3MAAC 4XSHA 4XSGA 4B33A 5EZ6B 2Q9CA 3EAQA 3QIAA 3FHCB 3ZS8A 4QC2A 2G3YA 1QDEA 4EPVA 2J0SA 4XVRA 2DWQA 3NEJA 1Z6AA 2Q0HA 3AUXA 3F8TA 1KI2A 2GHIA 4DBLC 4PPFA 2QTHA 1IHUA 3ZVLA 2AR7A 3TBKA 1C4OA 4UXJA 4HB4A 3UWKA 3VQTA 1GNPA 4WW0A 2IS2A 1T8TA 2RAPA 1FPMA 1P7CA 4NYMR 3WMFA 3EIEA 4MA4A 3QG1A 4XD7D 4W5HA 3P27A 1T3SA 2OILA 2OCYC 3A36A 4DJTA 1OB2A 4QM6A 1FOEB 3U4QA 5AJVB 2H17A 2X19A 2NTYC 1YRBA 1Q1QA 2GJAA 2JDIA 1RRGA 2NGRA 2QGNA 3HR8A 4HLQB 4WOPA 4ZKEA 4AKIA 2CL0X 3GLIA 2PJRA 2GZAA 2CMKA 4ZO4A 1GKYA 1TUEA 3CPEA 4IRUB 1E9AA 3KQLA 1E2HA 2B6HA 5FPTA 4BLPA 3LBHA 4HLUC 3VFDA 2IEYA 3A1UA 4A82A 1S2MA 2FEOA 1H65A 2GK7A 5FPSA 1U0HC 2BMFA 3W9YA 1IN5A 4QKQA 2FX3A 3HR7A 4US0R 2CE2X 1UKVY 3GJXC 3NHBA 4PO8A 4D80A 3UANA 1YVDA 4US2R 1UEIA 2NO0A 2RGDA 3JVUA 3TK1A 4ACBA 2ZUDA 3FOZA 4Q1BA 4RD6A 4RZUA 5HE9A 3ETLA 5K8TA 4JBWA 3IPYA 1OH8A 3THXA 4IDPA 5JWRA 3CWQA 3OEED 2QSZA 3N70A 1W4AA 4B2IA 1U9IA 2IWHA 3EWAA 2W2XA 3WYAA 5JJIA 2IXEA 5IK2A 4UXHA 3FKSD 4MKIA 2WWGA 2VF8A 1KI3A 5JBQA 1TU3A 1XTKA 4BPBA 4RFSB 1BKDR 1T0HB 1E3MA 2K5UA 5G53C 2CVHA 1S9HA 2XJ4A 2EWVA 3WRYC 4E22A 4F91B 3TQFA 1RYFA 3PUWA 1EX7A 3W3AA 2VSXA 2N42A 2VO1A 1Z83A 3A4MA 1N6LA 1IJEA 3NDBB 1XMJA 1G4AE 4JKIA 1P2VA 1NKSA 3MLEA 1KDOA 4KYUA 4I81A 1E2DA 1SVIA 2WSSD 1CLUA 5DSZA 3I8XA 5DN6D 1SXJD 3ZZTA 4JLVA 1TF7A 1JPNA 4FD2A 4HEJA 1R8QA 5EQTA 3CH5A 2ZRFA 4PC2A 3VU9B 4A2QA 2FFQA 1T5LA 4JVNA 5SZHB 1VCOA 4LV6A 1CKEA 4PSKA 2P6UA 4DDVA 1KK3A 1NG9A 3OAAD 5JSZA 2XGJA 1II0A 2GK6A 4BFSA 3ZQJA 2OLKA 2CLSA 1TF2A 1N6PA 3C16C 4JSYA 2WJJA 2WMOB 1P9NA 4DRZA 5D3QA 3QKRA 5KSOA 1EFTA 2ZRKA 4EJSA 3KFVA 2AD1A 4TL7A 5HTKA 4Q5IA 1GUAA 1JPJA 2D3WA 2ZYVX 2CXXA 2W0SA 3AKEA 4Y0VA 4B6FA 4B76A 4GT1A 1IY2A 5G3YA 4LYFA 1UPTA 4YONB 3PEWA 4Q9LA 4PQFA 4WBSA 2ZSEA 1P2UA 2ZS9A 1F5NA 3Q7PA 4OK5A 1MABB 4PQRA 1R0WA 1CULC 2AFIE 4ABYA 3EIHA 1CU1A 2ORWA 4NONA 3U3RA 2W6IA 4WVFA 3VKHA 3WY9A 1P9RA 1S8FA 5J4LA 1AS2A 1E1RD 3RANA 2IEZA 1JNYA 1IN4A 1HYQA 3AKDA 3FGNA 4NDZA 5KO2A 1QF9A 4OBEA 4UNPA 4MUAA 2HXSA 1G16A 1D6JA 2WICA 2V54A 3ICEA 2OCBA 3AVXA 1G3IA 1P75A 4GDFA 4BGDA 2IHBA 1KI6B 4LCBA 4Q4AB 1GWNA 2FF7A 1T91A 2ODEA 1SVWA 1ZM2A 4A8JC 2QZ4A 1ZUIA 1C1YA 3KB1A 3KUCA 2F6RA 1G17A 4XOIA 4ACAA 3K0CA 1PVOA 2PL3A 3RS2A 5L3QB 2GETA 3Q8XB 1JR6A 3NKVA 5DISB 4YMSA 3FHOA 3BOSA 4LI0A 3R9WA 4EIWA 4DT1A 3OIYA 1TADA 2HF9A 4D26A 1DELA 3EG5A 4F7WA 3I1FA 2J1LA 4RD3A 3GEEA 2JJ1D 1RYHA 3RS3A 2XTZA 5EJEA 2QAGC 4KLZA 4IDOA 4OJQA 3V9PA 2EFGA 1Z3IX 1G291 3QKSB 1YR6A 1ELOA 3OE7D 1AJEA 4OHYA 2BVNA 1WA5A 5BQ5A 4W5JA 5TARA 4ASUA 3R9IA 2AX4A 3D7MA 5CLQA 4Q01A 1UBCA 2Q6TA 1YJ5A 3CF6R 3KJEA 4Q19A 4AI6A 5FL7D 2JGNA 5JHHB 3G5UA 621PA 4KCGA 4NMMA 4BFXA 4E5UA 4DIEA 2BMEA 5EE0A 4GOJA 1I4DD 4RFVA 1E9EA 1G3QA 3HYRA 5EZ5A 3NEYA 2NZ8A 2EFDB 2FFHA 4C0QC 3KKOA 3QG5A 1SKYB 1OXXK 3P4YA 5KNCA 1E2GA 4KO8A 1XTIA 1KDRA 3GJ8A 3TSZA 3QENA 5AJXA 4AC9A 3KTAA 5EP1A 5HKKD 1NN1A 2HT1A 1YZUA 5A0FA 4LWZA 1VIAA 2E1RA 1GG2A 2VLIA 3OE7A 3LNCA 3QY0A 1O87A 2R44A 2ZYWX 4MGKR 2IYQA 4AURA 4C0KA 4D81A 2VPPA 4V03A 3FYHA 4HDQB 3QJYA 1DADA 4E07A 2ZROA 4AYWA 3LFUA 4FXPA 2V7QD 3IEVA 4CT5A 3IO3A 3AEZA 2CE7A 2WAXA 4D4LA 4E09A 5KHOC 3EWSA 3F0TA 3B5JA 1RJ9B 2B92A 5FTLA 2O8DA 1CXZA 4WAUA 2D2EA 3P4XA 4MKFA 3T5GA 1U8AA 4RFSA 1JECA 1F6BA 1O3YA 3KXIA 4DCVA 4NU0A 4EFMA 1KO5A 4OHZA 1Q1EA 3T35A 4CIDA 2GF9A 5KDLA 1BYUA 1NMXA 2NQ2C 2WKRA 4C0AC 4KFTA 3GPLA 3AVVA 1OKKD 1YZLA 4DLWA 1E32A 5JS8A 1EK0A 2V9PA 4NYMQ 2FGJA 3IIMA 2UVQA 2G77B 1US8B 3N2EA 3O8BA 1YE8A 4V0ME 5EE3A 2P5SA 2R8RA 5FTMA 3ADCA 1Q21A 5DGXA 4TWZA 3KJHA 4JBXA 3ZQ6A 4JLBA 1BO6A 3TNFA 2ZI5A 2G83A 4C0HA 3B1WA 4ZDWA 1NVUQ 1ZM9A 3BS4A 2A9KA 1IN7A 1U99A 1MH1A 1CP2A 3E5HA 3KFXA 1WBBA 1VCNA 4CDGA 2QM8A 1KO8A 4YQFA 1R0XA 1XMVA 2VIIA 2W6JD 3BFXA 3OEHD 4KLNA 3CONA 4TLDA 4LY6A 1NVXQ 5J47A 4OL0A 4MGZR 2KBFA 3OFNA 3IILA 3T06B 4YXWA 3TJZA 4WZAE 2HYIC 3EZ2A 5EE1A 2OCAA 2HCBA 3I5XA 3Q5DA 4FCWA 3C4JA 3AVPA 4FWIB 1DO0A 1JXOA 1M74A 2ODBA 2NO6A 4P3YA 4LBZA 1IY0A 3AF4A 2C78A 2HJGA 2C9CA 4HAVA 2P5TB 1LW7A 1E0SA 3U4QB 4OJKA 4ARZB 4LUCA 1VKJA 2PEZA 2OBLA 5TMPA 1Z0IA 4K81B 2OFXA 1IQPA 1D2NA 2BIFA 5KSYA 3OZXA 4D4KA 5M04A 1KO4A 3B1ZA 4HZUB 4OYHA 4CYMA 5C1BA 1I2DA 4FMCB 4DKXA 2RHDA 4TLAA 4DVGA 3O47A 4NPHA 3RSLA 1U98A 4J0QA 1J2JA 1G19A 1N6IA 5L8VA 1E1QA 2PZFA 2ZJ5A 1NJFA 2KBEA 3KTAB 2O0KA 1G5TA 4PC3A 3WMGA 2BEKA 5KPJA 3FMIA 3NTUA 3UMFA 2QP4A 1GM5A 2IYRA 1G3MA 2C98A 1LS6A 2Q21A 5FBWB 2IXFA 1T4GA 2RB4A 3BERA 3SNHA 1R2QA 2QEQA 1U0LA 2BCGY 2RGGA 4JKYA 4KBGA 2H16A 2DY1A 2X77A 2KSQA 1FNMA 1M1YE 3B6EA 2A78A 4HLCA 4KODA 1KTVA 1XWIA 1Z07A 1GRRA 2UZIR 2V8OA 2ZS7A 1YZKA 2VHUA 3I72A 4LJYA 1UKYA 4DC9A 3A4LA 3NIBA 4ARZA 5C2JB 2IC5A 3TLXA 3E1SA 1Z0JA 4BLTA 3AVOA 1YKSA 3OHMA 1G5RA 2VBCA 4OQFA 4RCZA 1V5WA 3W8NA 3ZYCA 2KJQA 5B57C 4DDWA 1OLOA 4OI2A 1SGWA 1VTKA 2OAP1 1GIAA 1EFCA 1DG1G 1LF0A 2ATVA 1P2SA 2JIZD 3BGWA 3TUIC 4TMKA 521PA 1P73A 3C5HA 4RSGA 5LB2A 2GEVA 1XCGB 1ZU5A 2KI5A 4UNSA 2O0JA 5JWHA 3LAWA 4KJZA 4A2PA 1UADA 3QXJA 1GKIA 3UIEA 1NIPA 3UMSA 5JECA 5JS7A 5G40A 3T1TA 3GEIA 4DWJA 3BBPA 1SVMA 2XZPA 3QVVA 4TLEA 4AYTA 3VR4A 3AH8A 4IVPA 2ZXUA 4C7OA 4EUNA 1P5ZB 4Q7LA 5FTKA 4OI1A 3KKMA 1JBKA 5H1YA 2QENA 4ON9A 1G18A 4TTPA 1FTNA 4RCYA
chains in the Genus database with same CATH superfamily
5IVIA 1XE3A 1KDTA 1NNEA 1U8EA 1O96B 5KBYA 4B2YA 2BZ1A 2C1EA 2O8DB 5JXIA 1RT9A 3JASA 4DSNA 4FTWA 3ETHA 2ZYSA 2FRVA 2QTVB 2WJZB 3RR2A 4HNSA 2ETXA 4E4RA 2X5OA 2RGCA 5CPBA 3EODA 4TVSA 3C3EA 1OXTA 2VJKA 1G64A 1TIBA 2IH2A 1VJ5A 4B46A 1ZINA 1SFRA 1FQKA 4QRIA 1DXOA 3K2QA 1R6BX 5IM4A 1UPUA 1GZ4A 2CD7A 4PS1A 4H7PA 4R8VA 4ZCTA 4IXWA 4IBOA 1BOOA 4BPRA 5ALUA 1GSHA 3NDIA 2FOLA 3G0HA 4P32A 3NRBA 2RHRA 1NUQA 2AZMA 3U7QA 4EW6A 5AM4A 1NDHA 1Z88A 5BSMA 5EJ7A 5HZHA 1B8UA 1NN5A 1REQA 2JA1A 3STYA 5JAUA 2CJFA 1UINA 3FZYA 4QQ8A 3ZHBA 4P54A 4RA6A 4KQMA 4PZAA 4U2CA 4B7XA 2Z95A 3BMQB 4F11A 1FYFA 1TEZA 1W94A 1RYEA 1ZD9A 3ZCRA 1TO1E 2BE7A 1XZGA 2WP0A 2E4YA 1VOTA 1AK2A 3C3CA 2MTBA 3CZAA 3SBDA 1A8IA 2XECA 3LVQE 3OZVA 2AJLI 4W5WA 3WQBA 1KH2A 1UJNA 1YACA 3QLTA 1J1UA 1SHKA 1AV7A 3B9PA 4U8HA 1BFDA 1GEEA 3HU3A 1IK6A 5CT9A 5F5LA 3JARA 1W25A 1PQPA 3CTMA 3SJUA 2HJHA 3ZV6A 2EEZA 1Y63A 4RPJA 3T1QA 5K0GA 2ECKA 1ODTC 3IAUA 4Q9NA 3U7HB 2H3EA 5L7YA 5EESA 3I2FA 1UBUS 3EH1A 2QBYB 2MYTA 1PT5A 1VPLA 1DLIA 4FFBA 4EABA 1GSIA 3VO8A 4PN3A 4MKRA 4YR9A 4JD5A 1NE2A 2W6QA 4IFIA 1AGPA 2P90A 5KNCD 1TUGA 1BAPA 4RVFA 4ZOCA 1EQUA 3KS9A 2CUTA 4JBHA 1QX3A 5JI2E 1VJGA 5JADA 5DT9A 1P0PA 4Q82A 2CF5A 3PX3A 5ICGA 1FUUA 1VL1A 3H5RA 1LS1A 4BZPA 5FA6A 4BRUA 2I6UA 1XAJA 2AZDA 1W9MA 4JUFA 4CR6A 5J3JA 3O1LA 1YBFA 3Q7RA 4FFPA 4V1CA 2QRNA 3P32A 1HT2E 1J22A 3FAZA 3LHDA 4JR2A 4KH0A 5KYXA 1EG7A 1FW8A 3QA9A 2H51A 3WSVA 1AN9A 1N1EA 1DAEA 3CCBA 3FI0A 1A9ZA 3MG9A 3E5MA 2FEXA 2R48A 3KSZO 3VBEA 1UWCA 1XF9A 1ZYUA 3PXAA 4RULA 5DBIA 1P91A 3UYKA 3AB3A 4QUJA 1XDSA 4I19A 4LDZA 4LMBA 1M83A 5I9SA 1L5NA 2FLVA 4HGZA 3ZY4A 3KBOA 5FAKA 2IS4A 2C5LA 3DMGA 4C3OB 4MKXA 1T1IA 3OJ0A 4GEGA 1DJPA 3ZUPA 3BHJA 3FTNA 3NM4A 2F1IA 2GO7A 4UPDA 2EX0A 2ETVA 2C5HA 2OSBA 4M38A 2FUNB 4NHOA 1RBMA 2F59A 2BPOA 3JZAA 5CYOA 3JD3A 4CODB 1W2GA 2FQWA 5KNDA 2BHRA 2BKUA 3KJNA 2OXRA 4MK4A 4X63A 3HB1A 5G0UA 3S28A 3TG8A 4RTNA 3CLSD 1W1UA 1D1SA 1QRDA 2O3SA 4ZVKA 3WWCA 5IXJA 4RKQA 1EVYA 4TMFA 1C7RA 1WMSA 3QMVA 3E2PA 3HU1A 4OHUA 5JI3E 3VHXA 4AB1A 8ABPA 4Y2YA 3O8CA 1QRRA 4LJKA 4FDLA 4E2XA 4LE2A 2AHOA 2YWGA 4ZYTA 5AOCA 3A1CA 4IWYA 3OX2A 4GW3A 1XZFA 2VK2A 5JMWA 3TKYA 2QD1A 3QLJA 5EERA 5AUNB 3AM1A 4LDRA 4ND4A 2A67A 3LBIA 2QGFA 1G8FA 1OFIA 4E32A 4OX9B 1KP3A 3A2KA 3RYHA 3FFAA 3FTQA 2WJ3A 2WT4A 3VKWA 5HFJA 1NVWQ 1ZAYA 3OTGA 2IZ1A 5JSZB 2H4WA 4ANFA 5JJLA 2W6ID 9LDTA 1QFJA 3L7BA 2CFIA 2QXUA 1NBWB 2IYYA 3ASYA 3HUDA 4KE9A 1ODSA 3AIKA 3HUFA 4ZVNA 2CZCA 4PZDA 1JVNA 2RK6A 1Z8FA 2IP1A 5B1DA 3A1SA 4CNQA 1DV2A 3IX7A 1E7RA 2W43A 4GQBA 4RVGA 1ITZA 1WF3A 2YZNA 3II6X 1YZQA 4KE8A 2G1JA 4Q1FA 3KJFA 2AX3A 4R83A 1GAWA 3GD5A 5AJZA 1T4DA 1VXRA 3SEQA 1U8CB 1U0OC 1CRPA 1M8PA 3CEJA 3MGBA 5GIOE 1XZKA 1BCRA 2YMPA 3BKXA 2AOVA 3D8BA 1X7WB 3EEQA 3H16A 3D7LA 5EEGA 3IDAA 2VWPA 1YV9A 3GQBA 1XQXA 4WIAA 3LVRE 4QZVA 1HA3A 2H2GA 3VU1A 4C22A 4L22A 3VO2A 2ZSIA 4MV4A 4NZMA 4EG3A 1TYCA 3ZU3A 3EFOB 2NU8A 2XYVA 4BVFA 1W5AA 4M89A 1IHOA 5EMHA 1XXHA 2HBYA 3SFZA 1RJFA 1ACMA 4CXMA 3J7TA 4YMUA 3GLFE 2ISCA 3FSEA 2I7XA 5JD5A 5EIBC 1L7BA 2XT6A 4G5HA 2HZ7A 3EPKA 3NXKA 2O8CB 3UFXB 4ROSA 2ZCJA 4CM5A 1DDGA 4OGGA 5HFNA 3CRNA 4F9FA 3AOEA 2EZUA 3ELWA 3TNDA 4C7BA 1CRQA 1ZH2A 2OB2A 1RQPA 4NEHB 2POCA 1LW6E 5HKBA 2GKGA 1XEXB 3QVXA 5TEVA 5K8VA 5DBHX 3ZWQA 3GBSA 1CDZA 5A9SA 5HCIA 2DAPA 2TECE 3IE2A 1G4UR 5ENZA 1KDVA 3WFZA 2DPGA 5IVDA 2NUTA 3L5OA 4CR8A 4KLCA 3TW8A 2ECPA 3GFTA 2HA3A 2ZYDA 1VKZA 2VDQB 3IIEA 4WJKB 3IURA 4OH7A 3HKBB 4RM2A 3V7FA 3A25A 2H1WA 3KYJB 2BFPA 3ERCA 3KYCA 4BNGA 2PGNA 2VZ0A 3DC2A 3IUYA 1N9GB 1DEXA 3MINA 1JXQA 1FFSA 3NBXX 4OXIA 2XITA 4F04A 4J91A 1SHLA 3L05A 3OCUA 2GXQA 4AZ3A 4CQJA 2WJWA 3KL4A 4F38A 4L9WA 1ORVA 1VGRA 2ES4A 3DTTA 3DUFB 1PTJA 3H5AA 3SN6A 3D0KA 2EXXA 3MQ4A 4JP2A 4EI8A 3F5SA 2H1HA 3DDHA 3OFND 4RMGA 3OQVA 4WN9B 1Z5VA 1EM8A 5KEIA 3RAEC 4DPMA 2A3RA 2QRMA 1DHRA 3NTRA 3X1YA 1QPZA 5LA6B 2PV0A 4I1SA 2OYRA 2AK3A 1IE3A 1D2AA 1FEZA 2ZRBA 3ZGVA 4BJHB 2V6GA 4KKVA 3RIGA 2KMLA 2ADOA 1GRNA 2ASEA 3P97A 4TZKA 1N9KA 4B4VA 3LOPA 2A57A 3WV4A 4CW7A 5BV8A 5EHIA 2XEDA 3LQQA 3DXYA 1E79D 1V96A 2YC4C 4IGAA 4MLPA 1IDN1 1OXVA 1CJCA 4HDRA 1GKLA 3C85A 2NO7A 2BJVA 1UKAA 2OR3A 4RIHA 2LCFA 2X86A 5AK0A 5FI3A 3RO7A 4A8TA 4K9PA 4N9QA 2VH5R 2WR8A 4HYTA 1LBEA 3OCWA 5EE5B 4BVLA 2PKQP 3CS3A 3AETB 2HUPA 5K20A 1I0IA 3ZH9B 5EMNA 2WVHA 1VG0B 2QTTA 5FUVA 3B5EA 1IQUA 1RVDA 2RGWA 4QDOA 4U63A 2IT1A 4IMJB 5FOUA 1AZTA 2GJ8A 9LDBA 3ICPA 1SEPA 4E15A 3A1WA 1U81A 3EMDA 3WO0A 2BBTA 3HYLA 5JRDS 3NAZA 3OESA 5HYVA 1FDIA 2XWBF 1H4SA 1GPLA 2JIQA 4KFCA 5E7JA 5GV7A 1SU4A 4UD6A 2Q2QA 2HMUA 1XZCA 3PJRA 4LK2A 4PFJA 1XDZA 3G5MA 3S1AA 1N2CB 1XLUA 2FH5B 1ARZA 1LSJA 2OFWA 2PXCA 3CW8X 4YLEA 3R7BA 2O2ZA 3CEHA 1R5OA 4O6VA 4O2AF 2WWYA 3IJPA 5DT2A 2UXBB 4GP7A 2FEPA 4JBNA 3KWJA 1XWWA 5DGCA 3V4FA 1M1XB 3BWDD 3N2LA 3NBFA 3WYGA 3O84A 4AS3A 3ESYA 2RHGB 3E15A 3EDMA 1DTSA 4BXOA 5TX7A 1QIFA 5E0KB 4FYMA 3EQ6A 1QVZA 1QVAA 3K0BA 4AZTA 1IM5A 4N41A 4UC0A 1QCZA 2WIFA 1RZ3A 5E2IA 4YP1A 5LZ9A 5I5EA 1W30A 2ZGVA 4KWIA 1L5LA 3TL2A 5K5EA 5JFGA 2IXDA 3DE6X 4FYJA 2Z0MA 1RIFA 3C8ZA 1WE2A 2V97A 1QHIA 1TM2A 4BQEA 1OJLA 1V43A 4MVJF 3NXSA 2AXQA 2HU2A 4H2DA 2ZIFA 1BDJA 2VK1A 5LOVF 3HZRA 3QPCA 1Q0SA 4AWXA 3TTTA 1Y8CA 3G1WA 5F4ZA 2FW1A 3KZ1E 3H5VA 4GX0A 2NTEA 1L7MA 1BU5A 1SD2A 1R6DA 3IAM1 4LQCA 1SQGA 3ZJYA 3K71B 4XX0A 5AK4A 1EQAA 2AQHA 3I42A 1GUDA 1MC1A 3IKJA 2GJKA 4L4UA 2EL9A 2YXBA 4Q4AA 1E66A 5EG5A 2I6TA 3ZHOA 1RLJA 4UBKA 5CVVA 1WD7A 2AOUA 3E22A 1YI1A 2OBNA 5CITA 3LWZA 4LZZA 4K6CA 4D44A 1TQ8A 1Y9JA 3M4NA 2KB0A 4AULA 1Q0HA 1ND6A 3U44A 5JD3A 2Y4OA 4RNCA 4RWZA 1CUBA 4LKOA 2IF0A 2C57A 1I6WA 2IU3A 3NCTA 3GCZA 2EF0A 5DM0A 4HI0E 3UAOA 1H1LA 5FL3A 3TZ6A 4ZYUA 2QVLA 3TEJA 1WULS 1P0QA 4WCFA 2XCRB 1J8VA 2WF7A 5GAJA 1A9SA 1CJKC 3WMXA 3FYTA 4YP6A 1GV1A 2J32A 3UMVA 2O2JA 4TMTA 4AN0A 2X23A 1VPVA 5CH3A 1PYOA 5JCOA 4JXZA 1NSFA 4XYLA 1Y6QA 3EA4A 3RREA 1UAYA 2FEWB 4WBNF 2QUZA 5T6BA 1L5OA 4LGMA 1R5NA 3VPDA 4WLEA 5HNKA 4P08A 4HAYA 1YGYA 3LK6A 1M1UA 3R5SA 4Q4JA 1GYPA 2O0HA 3CZ4A 4GPAA 1M6YA 3GJ6A 4IDGA 1DAFA 1EGVB 2GFIA 4CMEA 3PPVA 2HF2A 5GM1A 5HK8A 2P3QA 3AFMA 3JAKA 4N7MA 4B9AA 1W19A 2AKEA 3P0RA 1WZIA 1QK5A 1W87A 2C97A 3MTGA 3GBPA 1ZOSA 1QHHA 3AG5A 3EZNA 1QIHA 3BH6A 3G2IA 3TOCA 5HTOA 3BWEA 4DOMA 4HNVA 5THXA 1ZOPA 3RE1A 1HSZA 1VDZA 2X0DA 3F6RA 2L69A 4OHCA 1XJ5A 3L06A 4YV2A 5KWEA 2YVAA 4GQIA 3TQCA 3NHLA 2XADA 4MUFA 5GP1A 3ETEA 3DZFA 4CF3A 4ESOA 3O90A 4FX2A 1RWPA 2H1LA 1T1SA 2Z2KA 5JD4A 1H4QA 1B6RA 1OGJA 3T3EA 1LTQA 1JG2A 4IZIA 4TWRA 4BMDA 2Q9BA 3ANYB 4N03A 3QF4A 4AKTA 3GJTA 5DU2A 1NLFA 1FNDA 5IF3A 2VSQA 2P65A 1PFWA 1A71A 3AJ8A 1PGPA 4YPFA 1GZDA 3T5BA 1Q0QA 2VXOA 4DV2B 2UAGA 3CF4G 1LPAB 1DAHA 4U2EA 4FS8A 1E4YA 3I83A 3VZPA 4K86A 1Z8HA 2ZE7A 2ZRDA 5EKSA 3ZDRA 2GUGA 3MAJA 3H1EA 1YZTA 1UMKA 4KGXA 3WK5A 2O2IA 2ODWA 4JLAA 5HG0A 4KIJA 4FK8A 1R6UA 3EVZA 1WZNA 3FN4A 4W1QA 3NEPX 1JW9B 1Q12A 2PLRA 3S1SA 3E0QA 4ML3A 3H97A 1AGRA 2BRUC 4GMGA 4GX1A 4GVPA 1U1EA 2ZXFA 4NDNE 2OAQ1 4V0LA 3ZCVA 2B6NA 1YCHA 4QELA 3DQZA 2PL1A 2RJOA 4KWEA 4E6EA 4NLLA 1X19A 1FS4A 1H2XA 1O7JA 2PJZA 4FOOA 5CNMA 2QUIA 3MMNA 5FWAA 1UJBA 1X15A 2GAJA 4EVQA 3QWFA 4C78A 5BSGA 4UTOA 4XLTA 1JDVA 2GSDA 2A9RA 1QLJA 2HDNB 3QW4B 4MYDA 4IKPA 4R6WA 3FR7A 1KJ8A 1OX6A 4B3IA 3IEMA 1N36B 3KQYA 1UXJA 3HCNA 4EKEA 1NPYA 1YDMA 4KHZA 2BEJA 1MX1A 4NCNA 2LBPA 3BWCA 2CNWA 2DC1A 1GL9B 3B9RA 3IBTA 3LBAA 1WB9A 2L18A 4Z2AA 3D7KA 3LGAA 3HDTA 3KTOA 2EATA 4XASA 3DWIA 4JB2A 4RXTA 4CEJA 5IMSA 4FFBB 4FT4A 4LVOA 4N3GA 3THYB 3UJNA 1KAQA 4RPHA 5EQDA 5ESWA 3TNLA 2F43A 1KC1A 4HDMB 4JEHA 4D92A 1YASA 2E4XA 2P7IA 2R1ZA 4MQFB 1DRUA 1BX0A 1YNSA 1D2MA 3QLUA 4C7JA 3H8JA 1AGNA 1P81A 1H23A 2NZXA 4MUNA 2NQTA 3WXMA 2PSFA 1GQSA 3E6AA 4MUGA 4MYTA 2R7LA 4KGVA 3CLVA 5HDBB 5L9AA 4OBXA 3REQA 1QFZA 3IYLW 4MSUA 3GFVA 4H6XA 4QFMA 2NSLA 2HNBA 4BVGA 2B98A 2C3YA 2GBLC 4E4YA 4YQYA 4N47A 1E9SA 4IINA 2C1ZA 3GROA 4NNPA 4ZOAA 1D2EA 3EBOA 1GOTA 2AEJA 3RU3A 4IHJF 3EGEA 3ER6A 1LV7A 2PNJA 3P7MA 1LNSA 3KZOA 2C4NA 3DJFA 4GPTA 3ZIAA 4AJNA 2BUAA 3HDQA 5D5PA 2Y1WA 3B5IA 5HMMA 4BLWA 1QJ4A 4CKEA 3WJ7A 3WYFA 1AHPA 4TXLA 1WRBA 2GVNA 1QHNA 2JJ2D 3KBBA 2R7NA 2AG0A 1NY6A 3KEFA 4OJTA 5JNTA 3BG5A 3PHBE 4F4FA 1Z06A 1VLJA 2XODA 6PFKA 2GZ2A 1R8XA 4A8PA 3W5BA 3K70D 4B43A 3EYAA 3OURA 4KOAA 3EGIA 3KD3A 2CF6A 4P4TA 1KSFX 4P98A 2MSDB 3OZAA 1U7ZA 2VCHA 3KWLA 2EKQA 2G72A 5LQRA 3L8FA 1DHTA 4PG4A 5THQA 2HRZA 4ZJZA 3KZNA 5IT0A 4HQFA 3TPCA 3N8KA 5KOHA 3KQPA 5DIFA 3HM2A 4EX6A 1JGTA 4L8WB 1XG5A 4KQCA 4L16A 3NJ4A 3N0VA 1RMTA 4A3SA 3F6EX 3OIFA 1ZM7A 2PZGA 2ZRAA 3FYDA 3P71T 4G4GA 1ESMA 1XV5A 2IP4A 4Q93A 4AMVA 1VM6A 1A4UA 1RSZA 2NACA 1RAIA 1S2GA 3KV3O 3S29A 4E5MA 2GEDA 3N2ZB 3QLEA 3JQ9C 4TYMA 4A6PA 3IBSA 4AJHA 4CDNA 1SHJA 4AUEA 1ETUA 3EASA 5JE8A 1T2NA 5J9FA 4B3HA 5BYJA 5JXGA 1KXJA 3RHSA 3WGJA 2RG7A 1BDHA 1F1BA 2XCLA 5HPYB 1SB8A 1VB3A 3T4EA 4JI7B 3QX8A 3ZVRA 4Y8VA 3FBTA 1E5DA 4TQUS 4ZT6A 2D3TA 2R6FA 1S2DA 1IONA 4B31A 2J0EA 1SPXA 2QNIA 5K4HA 1I01A 3QNUA 3PVSA 4L8YA 2F8SA 4EMUA 3OJWA 3G13A 1QVRA 5A06A 5H70A 4XDZA 4ECEA 1VIMA 4UAVA 3ZD8A 5IJ0B 3BBLA 5I4BA 2BDTA 4ZYXA 3SSNA 1T2VA 3IB6A 4JR1A 4TZTA 1DBVO 3DO8A 3T7CA 4XVHA 3NTQA 4CL8A 4MJXA 1W0KA 2BL4A 3E7WA 1LLFA 3HLYA 5IT5A 3AKCA 3CIOA 1LK0A 1JAHA 1FP1D 3F7NA 4ZRDA 1XD9A 4NL4H 5EKDA 4PM4A 3DJYA 1U5BB 3N2GA 4MLZA 1XDBA 3SVTA 1Q0RA 5FOSA 1E1YA 1QIDA 5GINE 1BX3A 3STWA 2FDCA 4B6QA 5AK5A 5BQXA 4IQGA 1B6SA 5G02A 7YASA 4QJIA 4Y9UA 4MOWA 1T13A 5ALKA 1PT6A 2VJYA 2FPIB 1IBCA 5CK5A 3H86A 2IHZA 3L0SA 2I6FA 4MAMA 3WAGA 4EB3A 1PLKA 2ZT5A 3TQOA 1IUNA 1CHNA 2LGJA 2TMKA 2GJ4A 3KOOA 4KB5A 4TGLA 2OCXA 2ZAMA 3SQMA 1Z0KA 2BDUA 2XNKA 1ZCBA 3KJZA 4KRGA 1NFRA 3CCCA 5E2AA 4DV7B 2P78A 5FRDA 2VCEA 4R84A 2WIBA 4FCTA 4FQ8A 3CO0S 1DKLA 1QRUA 3REFA 1USKA 2QUBA 1WUKS 3QWAA 4P86A 2VAVA 5D84A 4Q0MA 1PT9A 1RHKA 1RWOA 1YVRA 1KOJA 2OXFA 3MM4A 4RWEA 5HKLA 2X9VA 3LX4A 2JCSA 3ANTA 1HE5A 3TTSA 4LG1A 3LYHA 1P44A 4IG9A 2J9XB 2WYVA 4LTMA 3REOA 3UAWA 4AVYA 1BWQA 2ERCA 1BN7A 3KKEA 3NG1A 1KQGA 4LBYA 1I5EA 2XNHA 3H5IA 2XYPA 3C24A 2JA2A 3S1AB 5I7VA 1M34E 1IHXA 3Q0IA 4CMCA 1H2RS 3RCBA 3SS8A 4JVMA 3GDFA 1CNEA 3E7FA 4C5BA 4MR7A 1G6OA 4MWTA 4PCLA 2BM0A 2WYIA 5D00A 4INOA 4B3JA 2C59A 1E61A 3ZCPA 2YZGA 2FPIA 1U0JA 4HAIA 4HZIA 1QGZA 4XPZA 2VXCA 1KVSA 3AF2A 2NADA 4MP6A 5I8ZA 5IXYA 1MJGA 4F4JA 1ILEA 3AETA 3LUGA 4IQ4A 1L1RA 3HCAA 4WLFA 3T9CA 1TUIA 3UPDA 3UVEA 1K8XB 1O03A 2D0DA 4I3FA 5FULA 5A7GA 5BP7A 4L5IA 4ER6A 1L8LA 2ZITA 3OJOA 1JHVA 3JWEA 5K2MA 3WGIA 4P3XA 1ZZGA 2WPDD 4OHKA 3O31A 5EP2A 1JG4A 3NH6A 1E2LA 3LV8A 2G1UA 1JFRA 2OEPA 4O4JA 4AP9A 4W1SA 5BW4A 3CVXA 1E1QD 3KAJA 4B7ZA 4H6VA 3F47A 2JHPA 1XKLA 3NTVA 3C4VA 2W70A 1OB5A 4NBWA 1RW4A 1YBHA 1Q1NA 2I2CA 3OBBA 3CU5A 4CG2A 1X6VA 2WY2D 4ALJA 1YS4A 3ENNA 1HDIA 2IZOA 4J03A 8ATCA 1M0TA 1BMFA 1M6WA 1V7QA 1YQGA 3QKSA 5KOJB 4G0XA 3SK0A 2WQZA 4PHFA 1QTRA 3I2YX 2W2LD 5F2OA 3ZKAA 2ZM6B 1J8DA 3OFSA 1COWD 4MYUA 1QBGA 3PGMA 4UUOA 1ZMOA 2O8EA 3RV3A 5EHZA 3VKGA 3D5EA 3DW1X 4B87A 1H94A 1NUSA 2BFFB 2Y1EA 3H5TA 3VR3D 2O8BA 4CGZA 2OBXA 3QXGA 4RVUA 3DNFA 4AO8A 4M83A 1TZJA 2J5KA 2XH8A 2ZUTA 4AJKA 3B7GA 3B38A 5DBGA 3OQBA 3UQYS 4JU8A 1YL5A 4KFSA 4JUDX 3GAFA 2XE7A 5BPFA 5BSFA 1PKEA 1ANKA 221PA 3B13B 2A9FA 4P4SB 3PDCA 5K0EA 3J7AC 1FC0A 1MP0A 5IK2D 4HWGA 4RH0A 3DOOA 1E9FA 1XEXA 2BBSA 3IAEA 2J3HA 3P9CA 3GLKA 3WX0A 4KXQA 4MR9B 3EEOA 2ZKIA 1TIPA 3O93A 4IRXA 4HEQA 1P4SA 3L0CA 4D9JA 1O0CA 3HGQA 2FDXA 4II7A 3E27A 3LPNA 1E2MA 4KPGA 5FBQB 5MFPA 4YAJA 2R1VA 1QNFA 3KQVA 1QGUB 3SJCA 3QE4A 1OC4A 2WM8A 5KHLB 2EG5A 4DABA 3M0EA 3PXCX 1IIBA 4LJ7A 5DNCA 3AR5A 1OREA 1SURA 1K68A 1MX9A 3M83A 2H5EA 2VPYA 4H3KB 3IAFA 4I55A 2UZ1B 4K5QA 4TVOA 2BCEA 4A1FA 5HBGA 1FXWA 1GL3A 2AFIA 4BEBA 5CG1A 3R0QA 4FMDB 5J59A 3SS7X 4M2LA 4RQAA 1Z63A 1GTRA 3MOSA 2RI6A 5IBCA 3BL8A 4HLNA 2F9MA 1FUEA 4EHFA 1ISPA 2WFLB 2YWDA 2Q41A 4JP1A 5ICMA 1E63A 2QX9A 3IMKA 2FZ4A 4RQUA 4DCSA 5FPPA 1YZYA 4DN6A 2WE7A 3S70A 5GIPE 1FDSA 1PR6A 4RKWA 5FBZA 2PBLA 2PS3A 2BMJA 3QKRB 4H0FA 3TTWA 2ZULA 4R7TA 1A7KA 1QWOA 4DE5A 3BQ9A 3RAPR 2Q27A 5KYYB 1H5UA 4AXBA 4JJFA 3T9FA 3ILXA 1NQXA 4G4SO 4OXXA 4LY0A 3A1VA 2WV9A 2UZ0A 3AGPA 1BHSA 2UUAB 1N3LA 1Z9BA 3L3BA 3S5UA 3RLIA 3ZV7A 4O4HA 4OI4A 4D6XA 4O8ZA 3JSAA 1F9EA 4KQHA 2P41A 3K15A 4RDHA 4RORA 3ESDA 2CNOA 4LC9A 1I14A 1J8YF 2GF0A 2NAPA 3ZIAD 1PW7A 1MA3A 1K2VN 2JIRA 4ZZIA 1E1CA 2WUDA 2X8AA 2WAYA 2P3LA 3GLRA 5F7JA 4CM4A 1F2VA 1ADJA 4EJ6A 1GA1A 1ATZA 2JIBA 4NEGA 1LDGA 1JBEA 5LD2B 3Q3CA 1PNVA 1Q1GA 2X2FA 3HVUA 2FE1A 3VHXB 4E1VA 4ECAA 1VRCA 4NX2A 1I2MA 2BE9A 3DHEA 4C2UA 2J5XA 4MAFA 3WYNA 3CWZA 4PF1A 3RVMA 4XLZA 5BUZA 1GXSB 4JQZA 4QBIA 5A5VA 1JDBC 4MI9A 1WF6A 3IPRA 4LOLA 1E9RA 2C9YA 4Q3EA 2WZQA 3TLGA 1KJNA 1OBCA 1WCXA 4D99A 3UO8B 1X1QA 1OIVA 3M1IA 3FPCA 1FRQA 2FXVA 3AR6A 2EWWA 1JYFA 1WOYA 4FFVA 4Q9DA 4C0XA 3JVVA 1TDJA 1GN9A 1XBTA 1GR1A 1LBIA 4UM8B 3RS7A 4XFKA 2VT7A 5A7FA 2OZVA 1BMQA 3AY6A 3UENA 2VYCA 5K7SA 4G2TA 2E18A 1GPAA 3ORQA 1O5OA 2IEIA 4DBZA 1NFQA 2H06A 5MGBA 1QIJA 2AJDA 1F4LA 3PR2B 2W58A 3SE0A 1W9HA 4QULA 4D3SA 4F46A 3TTVA 3WK7A 1QZUA 3O7MA 1BMTA 5FPHA 2GF2A 2JIDA 5GZ6A 5CLLA 1ISGA 4YJFB 1ULUA 2NU9A 3NGXA 4MQ5A 2J0VA 1GXSA 1ZJ5A 2HXGA 4F6RB 2R8EA 1XEWY 4YP9A 1OBHA 4EY3A 4OQYA 3KB2A 4RMJA 2JZOA 3NW9A 3KFLA 2V9ZA 4IIHA 3TEFA 1JQEA 3AFNA 4TVBA 3QQ5A 3F67A 4GZLA 4HYQA 4URYR 4KH1A 3FOFC 3FVVA 3IMFA 3I9NA 3O4RA 3RARA 1PWXA 1Z6YA 3HDGA 3I73A 1QQTA 1KKLA 2JFZA 3U7EB 1EIWA 3PFKA 1PO7A 4OBBA 4YMIA 2DUUA 1IY1A 2EBFX 4A10A 4BQSA 3EUWA 4A0QA 2EHJA 4NFHA 4I4TF 2YJZA 5KSWB 2NAFA 1JIVA 1KVQA 3AUUA 1WZCA 4G1MB 2NU6B 1K7FB 4IOJA 4MUJA 3BVPA 5IF9A 2HDHA 2Y1KA 2BBWA 2I66A 4M0EA 5CLIA 2BFAA 4QATA 4R1NA 1M2EA 5FUBA 2ZJAA 4HVCA 1QE0A 4ITRC 2R66A 3L0YA 4G65A 4IJKA 4HAUA 2XF2A 1P8AA 1H6CA 2ATCA 2JFHA 5DHRA 4QUEA 1DMSA 3Q72A 3M3DA 4KSCA 3LLMA 3CN7A 4G0NA 1W73A 4DGSA 1H8ED 4TSRA 3OD1A 3WGNA 1RAFA 2XZTA 1ZMBA 5JZMA 3OU6A 2H4HA 1NW6A 2VOJA 3I2GA 1XMPA 3EF1A 2GHQA 2CBGA 3UOWA 2J0UB 1L8OA 2HJRA 2NVWA 2EW8A 5KVQA 3RIXA 1ADCA 2YHAA 4U7WA 4ZOLA 5KVCA 2ZWVA 3ACCA 1CG6A 2Q46A 2J8ZA 4D9BA 2C4VA 2AK2A 3ZHSA 5EMJA 1Z68A 2QL9A 1A8QA 1JTEA 3CZMA 3U44B 2W4IA 2XDYA 4UW9A 4ZQGA 3UATA 3WL7A 3VOTA 3IIJA 5JVDB 3AESB 2YXPX 3FBWA 1A9YA 1JQBA 2IW1A 1CUXA 1JRLA 1OZHA 3E22B 3H13A 3H2YA 1WXQA 2FJ0A 4JJAA 4X8MA 2TMDA 1UMBA 3I4CA 3LQRA 3T3DA 3IVAA 2AA3A 4ZCMA 3ZZ1A 2DCUA 3HBJA 2XTAA 1OE0A 3BRQA 3UXEA 2YWCA 4BFYA 3LFTA 2J3QA 2O2HA 2WWRA 3BB1A 3VSCA 1DRVA 3I34X 3LCUA 2ESRA 2ZQYA 4G0MA 1PJAA 3I8SA 2RH9B 3EN0A 3PZBA 1JZTA 1TB4A 4CKYA 4LYAA 3HJNA 4TS4A 4O2AB 2PTHA 1HOTA 1HQYE 4NE7A 3RW9A 4E5SA 3FRJA 3EWIA 3C74A 4OP1A 2VK4A 1BYIA 5FJIA 5K0NA 3RRNA 2M6KA 1UM9A 4Z3OA 1CZUA 1OBOA 3C14C 2K2QB 4QUKA 1CR0A 3H5NA 4M37A 5H3CA 2DTDA 2HCFA 3MCWA 1U6JA 4KN5A 1H9AA 3OEEA 4BLUA 1E3LA 2GRAA 4PSCA 3VPAA 3CCFA 5JAHA 4C88A 1CE8B 3H9UA 1MW8X 3WLHA 2Q45A 1XJQA 1HFEL 4H16A 2EJBA 2DFNA 3H3FA 4R68A 4J94A 4HUQA 2A0XA 5E9WA 5EL0A 2V6MA 3NASA 3OKPA 3U26A 2XZLA 1OYWA 1AQ6A 2DRIA 3NBKA 2Q4BA 4NBNA 4PPNA 3VX4A 4CCSA 3A11A 4DPKA 1Y1PA 2JZNA 5TV2A 3AI1A 2ZIGA 1V45E 1UR5A 4BFCA 1VPDA 3VMMA 1YL7A 2QN6A 3RB8A 4N5NA 1M2OA 4AWAA 3AWDA 3R44A 2VDVE 2JEYA 3WLPA 1S1MA 5K3FB 4EFKA 5FEUA 3VHLB 5EGSA 4V39A 3K31A 2J4DA 1KZ9A 3O0TA 4PINA 1XZDA 5DHAA 4EQZA 4NAHA 4D6YA 5C80A 4QDZA 1T10A 2IXGA 4HMPA 1U0GA 2ZR9A 4QBGB 3B78A 4NV1A 1FP6A 3O2JA 4K9OA 1L7NA 4Z8YA 3ZU4A 1O2DA 3ZWNA 2UUPA 3FJ1A 2WFMA 4BO0A 1ONBA 3A0RB 1Z47A 3ZHXA 2C5EA 5DWVA 3STHA 4BX9A 4Q9IA 1UZLA 1O94D 2WT9A 5A4FS 2ZU6A 2W71A 4B3CA 3AK4A 1RACA 2DFPA 1RM5A 1YIDA 4ZVTA 4ALKA 1E0JA 2RHTA 2ZJBA 3KV1A 3UJHA 4BP9A 5TJHA 2ZR8A 3DKVA 4HCJA 4ENSA 3R3ZA 1VJCA 5ALEA 2VATA 2F3QA 1JAIA 3DL0A 3FSGA 3ABSB 3D2CA 3NKLA 1O1YA 3FGOA 4HDCA 3ROFA 1HDCA 1UK8A 3JYOA 4RH3A 3W1WA 4D9HA 2IZ6A 5B3JA 4H35A 2MCFA 3ESZA 4H4DA 3GJZA 3DZ8A 3FPEA 4GF5A 1AZSC 1KO7A 4JLKA 4UUPA 4ENTA 1OZ0A 1S9DA 2Y8EA 1RVV1 1PK8A 1WQ3A 2QVGA 3IQZA 4KK4A 4MITA 1MO5A 1EX1A 2GZHA 1MAAA 6AT1A 1EP3B 3EMBA 1U5AA 3PC8C 2H29A 1CUYA 2YWXA 4P53A 4KTVE 1HRDA 4EYOA 3TCNA 4V0NA 3K1AA 3MXOA 2I7DA 4GI3A 3PUHA 4ZO6A 3I9FA 5CM9C 4BLVA 2GILA 2WF5A 4C7MA 2ZE8A 2FW7A 1U31A 4R2IA 1W88B 2D74A 3U3DA 1DO8A 1GNSA 2HYDA 4ZEMA 4JFRA 3DE0X 1M2WA 4BAZA 5CA0A 3NBMA 1ZA1A 2XGSA 4O2AA 3HWWA 3VOAA 4QREA 1X7YB 3I62A 4J0EA 3L4KA 1O77A 4IRMA 1P3DA 2VZ8A 2IYAA 3MLBA 4PR3A 1I4TD 1M1NB 1AIPA 4OXNA 5BNZA 1G5HA 1JNXX 2N46A 2V6JA 1GHTA 2ZAOA 3DB2A 3ZW8A 4IYRA 5J4KA 3BZUA 1ZVKA 3VA7A 1V47A 4S05A 2K7FA 1Y6GA 1GTSA 4B1FA 2ORVA 2QGZA 4YP7A 1B4DA 3PICA 2FN7A 2JDID 3PFFA 5KAPA 3CR8A 4BKMA 2FG7C 3GMDA 4R31A 2ZI7A 2Y9PB 1Z39A 4ZZ0A 1JWLA 1TA0A 2REQA 4DILA 3CV3A 4ABTA 4M9XA 1OTHA 2LXNA 4GBGA 4WXPA 2OXEA 4B2PA 1OF1A 3WLTA 4F9TA 5GQSA 4MKGA 5CX1A 3Q2IA 2FUG6 3LPAA 1IMJA 1CB0A 4X1OA 4L3WA 4QNRA 4HAXA 1M7GA 5FAXA 4MDFA 4J6EA 5K8LA 5BVHB 4QEZA 3ED5A 1XLTC 5FLKA 3TZQA 3DE4X 3K0FA 2ZRGA 4DLVA 4JYAB 1MG5A 1UBLS 1E8NA 1OLSB 4QQKA 3HMKA 3ZDBA 1XMIA 4KN6A 4NU5A 4R05A 4YJDA 3LY9A 1VE1A 2QMEA 5IEBA 4QL3A 1U90A 1KRXA 1NLZA 2GN9A 2H4ZA 4N3NA 1RHMA 2EYQA 1BS9A 4R1LA 4LQ4A 1XNRB 2R8ZA 3AFOA 4X8HA 5ES3A 4DFDA 4N18A 4EKDA 2FE4A 4QGSA 4C0LA 4B6OA 4JC0A 1OX4A 1JU4A 5L3SB 1GNVA 4DY4A 2PX8A 4EYSA 2C4WA 3KT0A 4MVJA 4KIUA 4RHYA 4HX9A 1SBQA 2AKAB 2DFTA 4MNTA 2H65A 3DZIA 1K27A 4QHSA 1WR8A 2VDRB 3BMNB 1KGDA 5IN5A 3PC7A 3T5CA 1BVUA 1P45A 3L6OO 4NY1A 1T3TA 3GFBA 1XX6A 4FYIA 2B94A 3TLKA 1L5WA 4IGEA 5COQA 4ZOQI 5BR8B 2J3EA 2YHSA 3OMWA 4HH1A 5EJ6A 1ONNA 1W4BA 4OLBA 1F9AA 1HBJA 7REQB 3TXXA 1EXVA 3MILA 2PFKA 2Q7OE 3PEEA 2RHMA 5T4HA 1MAWA 1P2BA 2EKLA 4PZYA 3SNKA 4OSPA 4B8YA 1F1JA 5HWSA 4JJGA 3OFVA 4GECA 1CS4C 1GUYA 3E9DA 5F78A 3D02A 4D8XA 4HAZA 4MCAA 4FJ1A 2PUTA 3H6GA 3KRTA 2HA6A 4LXYA 4N7JA 1XJ0A 2CVFA 2BUBA 2R6CA 3E70C 3NR2A 1ZL2A 2CL5A 3VR5H 3VYRB 4G4JA 3U6KA 4M3NA 4V1CI 3DPSA 4NMXB 3GARA 3N53A 4TSFA 3QU2A 3CVYA 3S2SA 3DM5A 3O8LA 3E9ZA 2ZPAA 3FYCA 3GMTA