3ZN2A

Protein engineering of halohydrin dehalogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
253
structure length
253
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOHYDRIN DEHALOGENASE
publication title A Single Point Mutation Enhances Hydroxynitrile Synthesis by Halohydrin Dehalogenase.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 93
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zn2A00
1LRKA 2OP1A 3H5AA 1A71A 3WGTA 1PJBA 2YW9A 2E37A 1Z75A 2QRJA 5MGBA 2Z95A 1CQJA 1GCUA 2C5EA 3C3XA 3IUSA 3JD4A 5A9RA 4ZJUA 2EERA 2AA3A 3WMXA 2DTEA 3WGYA 1DB3A 2VUUA 3ROPA 4P8RA 2JCVA 2J3IA 1WZEA 1LUAA 1PS0A 5CFZA 2YQ4A 5F5NA 5DOZA 1R0SA 2E49A 4PG5A 1V3VA 2P5YA 2NADA 2PNFA 1BHSA 4P38A 2CVQA 1JA9A 2GLXA 3DAPA 1J4AA 4PLWA 4UAGA 2ZK7A 2DKNA 2Y0DA 3PXXA 4HKTA 3LVFO 1EUZA 4YWJA 9LDBA 2JHFA 1GEGA 1VJ1A 1DIBA 5THKA 4OQYA 1N1GA 4BKOA 2GYYA 3EK2A 3L6OO 2J3KA 1Q2XA 3KEQA 4BNFA 1U5AA 1U3TA 3QHAA 4CM6A 1PU2A 5B4VA 5U1PA 3AFNA 3KM0A 5I7VA 2V6GA 2JD1A 3JQFC 1WWKA 3IOYA 1K5HA 3HN7A 2CF5A 1F12A 1R66A 3UOGA 1MV8A 1PR9A 3F5SA 5LCXA 3E1KA 4W99A 2GN4A 3LT1A 4DBVO 3ETDA 5CAEA 3QRWA 4RDIA 2AE2A 4BNHA 5JO0A 4I9UA 4J1SA 4J4BA 1GTMA 4FOOA 1UH5A 2EW2A 4PZEA 1L1FA 1ENOA 3JQ9A 1EEHA 3O03A 3KYCB 2Q49A 2X23A 3DFZA 3ZW8A 1DIAA 3GNTA 1M6WA 2YFHA 1WPQA 3EUWA 3MJSA 3DMYA 5JAQA 1ADBA 2Y67A 4DQXA 4R5HA 3PHHA 2ZTVA 1G6KA 3GPDG 3ITKA 2E82A 3F9IA 1BDMA 3BMCB 1H2BA 1Z73A 4ZQHA 5A9SA 5GY7A 2DTXA 2G17A 3EVNA 1B14A 3ZDFA 3KEOA 1ONNA 4J2HA 1CQIA 1Y7TA 3GHHA 1QV7A 4OSPA 5DBIA 5G4LA 1I30A 3GRPA 3AM5A 4ALNA 4BMVA 5DF1A 3OIFA 4UULA 4KDFA 1QLJA 4ZVVA 4YAJA 4DA9A 4MPDA 4TRRA 1LC3A 3V2UA 1XWFA 3HG7A 2DLDA 4WPGA 3HADA 4RVHA 5DZSA 3KUXA 1LDBA 3BMCA 3S2GA 1E3IA 3MJTA 3GZ4A 4ZQBA 5K9ZA 3OQBA 3QE3A 2O3JA 4U0KA 5AXBA 2PZMA 2HMUA 4MVJA 1WW8A 3GVXA 5A1TA 1B8PA 4XQEA 3ZHZA 1PJSA 3GUYA 4O6VA 2X58A 4RPHA 4CMJA 2HK7A 3FR8A 1FJHA 3NTQA 2QRLA 4RORA 4ZGWA 4KMSA 1DJQA 4HUJA 3VH2A 1EZ4A 5IJZA 5L95A 4WASA 3WQQA 3P2OA 1DIRA 5T64A 1GZ3A 2HJSA 2ZB7A 4D3FA 1DRWA 4R1UA 2CVOA 3GGPA 1OI7A 3CUKA 3RAJA 3KB6A 1J6UA 2NVWA 3ASUA 3TPCA 2GR9A 2AMFA 1QRRA 1KY5A 3L0DA 2P68A 3AJRA 4LVUA 4CV2A 2IE0A 5LDGA 3RCBA 3NDIA 4JN6B 5JDIC 2HK8A 5B4TA 2NM0A 4GLLA 3UVEA 4AJ2A 4BO9A 3WGOA 1MP0A 3CKYA 5B12A 4E2WA 1N92A 4AG3A 5JC1A 3L4BC 5A02A 5CEJA 1GAEO 3OMLA 2UDPA 1ONOA 4ZQFA 2C20A 1NQ5A 3RIHA 4A5OA 1E5QA 1JN0A 2DFVA 3GF4A 3RC9A 4R01A 3WFJA 1EVJA 1N5DA 3TQHA 1E1MA 4YT4A 4DL9A 5I7EA 4ZA2A 3V2HA 3Q9NA 5CPBA 3MCVA 2IZZA 2OGUA 1GUFA 2QW8A 2XF8A 1LTHR 5JFOA 1A7AA 3LYLA 4R54A 3FNGA 3ZWVA 3DBVO 4EITA 2VHVA 4K1LA 4CUZA 1U2GA 3JQ7B 3MJ4A 4BL5A 4XRGA 3RD5A 3JQ6A 5KKCA 3R1IA 5BSGA 2GZ2A 4EUEA 2PFGA 2EJWA 3I83A 3I6QA 4CM9A 1NBOA 2I66A 1IHYA 1WNTA 3D4NA 2WD8A 3PVZA 4KUHA 5IZ4A 3W6ZA 1NNUA 2D2IA 4Z9XA 4N54A 4CM4A 3MOIA 4BNXA 3PYLA 1I36A 1HZZA 1H94A 2AHRA 3ONEA 3AU9A 4S1VA 5A5FA 2QYTA 2R00C 1MGOA 3MJVA 3K2EA 5JDCC 1GV1A 1RKXA 3BAZA 3NUGA 2X5JO 4BS9A 3AOGA 4PG6A 4FFNA 3ZWPA 1NVTA 1QYVA 5JAMA 4L75A 5AOVA 1YB1A 3ZZNA 3FHLA 2CD9A 1YOVB 4XRRA 4LVCA 1JW9B 4Y6RA 1CERA 3OIGA 2JKVA 1G0NA 5AXDA 4E21A 1DO8A 3ON5A 1K6XA 3NAQA 2HLPA 1RM0A 4ZQEA 4A0SA 3Q2IA 4FFPA 2P2SA 4N5LA 3PDJA 1NWHA 5DOVA 2F00A 1NQAO 1DPGA 5TS3A 2B5VA 4PG7A 3NJ8A 4XX0A 4AJHA 4WECA 2FPIA 2Z1MA 3GGGA 3WXBA 3V1TC 3O26A 1YOVA 1VKOA 4BNYA 2O23A 1OC2A 4E2XA 1SOVA 1YGYA 1ZKMA 3BA1A 3SC4A 2B5WA 1Q0LA 2GZ3A 5L4NA 5CG2A 4CLOB 1T2EA 3X2FA 4XIYA 2V6BA 4OQZA 3QV1A 3KZVA 1T4DA 2NTJA 1XDWA 1ENYA 2A4KA 1ZSYA 1R16A 3G17A 3GVCA 1EVZA 2RH4A 1VSVA 3ZHBA 2DFDA 1ARZA 5DP2A 4RDHA 4Z3KA 4PRKA 2Y1OA 3RC2A 4CJXA 4BMSA 2BF7A 1D3AA 4YAGA 3PP8A 4JNKA 4MVJH 2VT2A 2YHUA 4PG8A 4CLOA 4ND3A 3VPSA 1JKIA 3HZZA 1Q7GA 3TFQA 1ISIA 2X8LA 3IC5A 4WK6A 2FOIA 3TSCA 4CM1A 3ZWCA 3AOEA 3U4CA 1PIWA 4M87A 1A9YA 1IB6A 3B1KA 3BMQB 4GKVA 4D0RA 4FGSA 3V5NA 1BMDA 1P44A 4D45A 4KZPA 1NASA 4WCFB 3K73O 4XA8A 3K8ZA 4MVJD 1N9GA 5ICSA 1EDOA 3VH1A 4BGEA 3C8MA 2CDAA 5T57A 2NU9A 5L53A 1I2BA 3W8FA 4D42A 4RJTA 5KJ6A 3AWDA 3L07A 1FF9A 4LRSB 3QJ5A 2TMGA 3VH3A 1CEQA 2GZ1A 3LF2A 4IXWA 4YCAA 3RBXA 5L51A 3MTJA 3GPIA 4P4LA 3OJ0A 1C1DA 2X0JA 4FB5A 4HNGA 5AQ1A 5JO9A 3B1JA 4A7PA 3COSA 1RM4A 5DCWA 1I24A 2JJYA 3WGGA 2A92A 2C59A 2Y1EA 2EF1A 4ALLA 4XYGA 1U7TA 2B4TO 3SJUA 4YYZA 2JHGA 4Q3EA 4E0BA 5IDXA 1PQPA 4FC7A 1DXYA 4EEZA 4NG5A 4CL3A 4BO1A 4IQ0A 3A9WA 2CMDA 4RF5A 1N7GA 2GGSA 1IHXA 4IDFA 4XYMA 4CLDA 5BNTA 3UN1A 1Z45A 3GRKA 3C7CB 3WJAA 3DDNA 4FFOA 3JQBC 3HJAA 3VC7A 2O4CA 3I9LA 3QVXA 4CR8A 3NTRA 3WBFA 4R3WA 3VZPA 1NFRA 3VZSA 2I3GA 2HSDA 3KO8A 1P0FA 3DBHB 4CM8A 3JCZA 3OECA 4NIMA 3ZV3A 4E12A 1GZ6A 1VJ0A 4LCJA 2OL4A 3NKLA 4GX1A 4CM3A 4QX6A 4YTEA 1FDWA 1D7OA 4CQLA 4IINA 4UUPA 4PZDA 3OJLA 3P5SA 3G1UA 4XR9A 2YJZA 4OKNA 4BO7A 3TOZA 3P7MA 1EK5A 4DLBA 4IBOA 1XR3A 1PSDA 2DPHA 3DBHA 2C29D 5ER6A 4KUEA 2EHDA 1NXQA 3AUSA 4WUVA 5AYVA 4I5DA 4BV8A 1QLHA 3H2ZA 5K6AC 4CR6A 3PZBA 1KC3A 1O5IA 2H9IA 3QSGA 3ANMA 1ISJA 1I5RA 3C7AA 5CDUA 3PHLA 1EVIA 4BKQA 3UCEA 1XEAA 4O0LA 3DZFA 1PJTA 2E4AA 3SLKA 2DBVO 3QY9A 2VZ8A 1O0SA 3N74A 3ZV6A 4TKLA 2DUUA 1H5QA 3QW2A 4Z6KA 1V8BA 4B7UA 2Q1WA 5GMOA 2AQ8A 3MEQA 2GF2A 4KWHA 1SEVA 3WYCA 4HP8A 3PQEA 4KDEA 2R2GA 2J5RA 2D1YA 4L4XA 1H9AA 4GVXA 4OGWA 2RBEA 3PGJA 1GYPA 4IUYA 3BTSA 1KERA 1Y8RB 4JBIA 1GU7A 3VTZA 3GG9A 2ZTLA 4AJOA 4A27A 3WYBA 4EEXA 4OSOA 3BMOA 2NVUB 7ADHA 3H9JA 1PJQA 4YJHB 5A05A 2OZPA 3E03A 4UUNA 4ZRNA 2VOJA 1SO8A 4W9NA 3AI2A 3WLEA 2EV9A 4TRMA 4B4WA 4RF2A 3ASVA 3LT0A 1JLLA 2PKRA 4L9RA 3ZN2A 1ZNQO 5CDGA 2X9GA 5ADHA 1Y1PA 1H6BA 4U7WA 1Y8RA 4F6CA 4YRAA 4I5EA 2NVUA 1ADCA 2IYPA 3O38A 1C0PA 1LA2A 3NDRA 3RC1A 3JD2A 2ZJ0A 1O8CA 3E8XA 3I3OA 5TNXA 3W8EA 1BXGB 1W6UA 3ZGYA 4JLWA 5IG2A 4J7XA 3A14A 3WNQA 3ZI0A 3NX4A 3I9NA 1PX0A 5JAZA 4DGSA 2DT5A 4LW8A 3R3SA 3KOUA 2FMUA 2IEDA 1HTBA 3KYDB 4DMLA 1F17A 2CSUA 4HFNA 4RPJA 1VI2A 1F8GA 5LDHA 4NR0A 3GK3A 3UFXA 4WGGA 1C0IA 2AG5A 4G65A 1WAMA 3M2TA 5ILGA 1DHTA 4PVCA 4XWYA 1HYEA 1GQYA 2A35A 4ZQGA 3UW3A 1AGNA 1I3NA 1H6AA 2WYWA 4GH5A 4UEKA 3OQ1A 1YWGO 3WOHA 3S8MA 3N7UA 5BSEA 1WDKA 3GFGA 5HA5A 4FJ0A 3ZV4A 3VPHA 2EKPA 3LC1O 1BTOA 1KY4A 4YB8A 4ZD6A 1H0KA 4YBZA 4FFMA 1BG6A 3HDYA 1ZK4A 5JY1A 1UDAA 3TOXA 3OQ6A 5JMWA 4JK3A 1XLTA 4N7RA 1SC6A 2XXJA 3K6JA 1RM3A 5G4KB 3H5RA 2C54A 4GKBA 3OM9A 4I08A 1KEVA 4TWRA 5JXWA 1H93A 1ZXLA 1H9BA 1GEEA 4OKIA 3JD1A 5HM8A 2A94A 2O3RA 3DTTA 6ADHA 5TF4A 1Y81A 3EY4A 4U5QA 2X5OA 2BHLA 2C2YA 3JSAA 5IN4A 1A72A 1TEHA 1AXEA 2AQIA 3AK4A 3AI1A 1YJQA 4E5NA 1DOHA 5ENDA 2ILTA 3EW7A 3ANNA 4M89A 5JMPA 4CUKA 1FDVA 1U4SA 4UVDA 2PZKA 3PPIA 4IDCA 3MOGA 2VWQA 3DHNA 3MTGA 1KC1A 4OL9A 2FZEA 4U6SA 4J16A 1E7MA 3JD0A 4OJNA 4Y9DA 3MWDB 1DHRA 3DFUA 1K6IA 5TSDA 2Q46A 4QECA 1IL0A 5ENVA 2VHYA 3O9ZA 3VKUA 4B7CA 1R0LA 3JD3A 1Y5MA 4Q3DA 5A9TA 4G5HA 3L9WA 1ML3A 2O2SA 1Z7BA 5F1KA 5F3RA 3I9KA 1YH3A 2H5LA 3G1TA 1U3VA 2YYYA 4ONEA 5DP1A 4DPKA 2Y93A 5DNAA 2NLOA 2E6UX 3ADPA 2AE1A 2YHIB 1U4OA 3FN4A 1WDMA 3CSDA 4MVJI 2YDYA 3ORFA 2QQ5A 4OOFA 1QXSA 4GX0A 3NV9A 4EUHA 3RKRA 2PY6A 4HFMA 2G82A 2RAFA 2EJVA 5IDYA 4DC0A 2HU2A 5J23A 1UXKA 3VTFA 4NFSA 4XKJA 3UAGA 4BNUA 4UVHA 1ISGA 1X1TA 1Y6JA 3FWZA 3ZWOA 3PJFA 2O2YA 4YJGA 5IZCC 2YHIA 4CL8A 1E1NA 4XYBA 3ZU3A 1KVTA 3TZHA 1VM6A 3DZBA 5JE8A 4J3FA 5I7SA 2V6FA 1Y8QB 1OBFO 1LC0A 3BHJA 1ZJYA 3UXYA 4RGBA 5L7TA 1TXGA 3Q2KA 2EW8A 5L7WA 1EVYA 1HSOA 3DBRB 3WLFA 3GMDA 4BNMA 3INRA 3PHGA 5H81A 2HMWA 3DTYA 1YL6A 3JQCA 4CV3A 2X0NA 1PZFA 1XGKA 4BO4A 4QUKA 4CMKA 5EESA 4AJLA 1GUYA 3BYZA 2OMEA 4HX5A 4NK5A 2DU8A 2NNLD 3GHYA 4RQUA 4IZHA 4JCOA 1R4NB 4DTIA 3HDJA 1YDEA 3HDHA 1GD1O 4BNJA 3GAZA 3KLMX 3LT2A 1B16A 3TZCA 1T26A 3ROMA 3WWZA 5BSFA 1B7GO 3OF2A 2X9NA 3TJRA 4ALMA 5T8KA 2GUGA 5CHEA 1E3EA 3F5QA 4DPMA 1LDGA 1P45A 4FC6A 2X86A 2Q2VA 2NACA 3HB5X 2D4AA 3ONFA 3OH8A 4DWVA 3KXDA 5CPFA 1HLPA 2X1HA 4CPDA 1MLDA 1E7SA 2FZWA 2C2XA 4GQAA 3VVCA 3FNFA 3GY0A 4DPLA 1YKFA 1GDHA 5FWNA 4HFRA 2CY0A 1R4MB 3WGZA 3W4IA 1GL3A 3GAFA 4GAEA 4IXTA 4J43A 5DULA 1UDBA 3RBVA 1YJ8A 3DBLB 1GFSA 1ORRA 4XGNA 1XYGA 3UCFA 1DJNA 5EERA 4AVYA 1BW9B 3U0BA 1C3VA 3V1YA 4H7PA 1ZK0A 3L6DA 4JQCA 3PFWO 3GC6A 4GSLA 4BIIA 3KYCA 4MVJF 3HQ4O 2I65A 2Y1CA 4J6FA 3I9JA 3ABIA 3ST7A 3VDQA 3MZ0A 3GR6A 1HSZA 1HYHA 4FFLA 2RIRA 3DBLA 2HMSA 1V6AA 1JAXA 1LSJA 2P91A 3ENKA 1I2CA 3UH1A 2F1KA 4II2A 1SB9A 1LLUA 3D5TA 1CDOA 4M86A 4N5NA 1M6HA 2AXQA 3GLQA 1PTJA 1QV6A 4K28A 4MIYA 2EXXA 4MINA 3IAHA 4G2NA 2O3UA 3R6DA 2PGDA 4YT2A 3JQ9C 3W4JA 3IL2A 2UYYA 3NTOA 3D7LA 4RQTA 3VH4A 4IJKA 3ZWXA 1V3UA 4TRNA 3H9UA 1NAHA 3EZLA 1NHWA 1RYDA 3TNLA 4BV9A 2W2KB 1PGQA 5HWSA 5KOIA 3PTZA 3KHUA 3DZHA 5B37A 1GQ2A 3GDGA 5KTKA 2DBRA 4DBZA 3ONDA 4FQ8A 5IDWA 2JFGA 5IAAA 6LDHA 3SVTA 2BLLA 5T5QA 4G81A 1SCUA 3JYOA 3VPXA 1E7YA 3LK7A 5KJEA 1E6EA 3KVOA 1B15A 1LRJA 3FNEA 5EIOA 1W73A 1YBMA 4QQRA 3X2EA 4DLLA 3K96A 3F1LA 1JWBB 5TJ9A 2G1UA 2W2KA 2BELA 1QORA 3Q0EA 1GV0A 1W8DA 4DUPA 3H5NA 4LK3A 4J91A 1HT0A 2QX7A 1YBAA 4MKXA 2VTEA 2FPGA 1HDXA 4WCDA 4CUJA 3TFOA 3D4PA 5F1PA 4UVEA 1J5PA 3AY7A 1PZHA 1E3JA 4PLFA 3I52A 4GWGA 1NWCA 2YUTA 3D5QA 2X0IA 4IDEA 4WKGA 1NPDA 1X14A 4NNJA 5IXSA 3NYWA 1U2DA 5ITVA 3CPSA 3I9OA 3PK0A 4MP6A 3BTOA 2OO5A 3TWOA 1V3TA 2NVBA 4RVSA 4CMEA 3CIFA 4MO2A 4XIJA 5BQFA 4WLFA 2NTVA 1XHLA 4D43A 1EQUA 4D7AA 4EGFA 1A5ZA 1DBVO 2UUOA 4NBRA 3WYEA 2YV3A 4CV1A 4RVUA 1T2FA 5I8ZA 1PGJA 2IZ0A 3U3XA 3G3EA 3L4SO 3C24A 3ZNOA 1LEHA 3WX0A 4IJWA 3WTCA 2AQKA 4BO2A 4Q3AA 3AY3A 2Q4BA 1VKNA 5COQA 3GG2A 3GDOA 3BXXA 1VL6A 1HDRA 2IXAA 4E5KA 3PJEA 4XB1A 1Y9AA 3F6YA 2HJRA 4F6LA 3QWIA 2NU7A 2FWMX 4HNHA 1ISFA 1ENPA 1Y5RA 3JQ7A 4GMGA 4R9SA 4TSKA 5FFFA 3W1VA 1LDNA 4GL4A 1KEPA 4DMMA 2AEFA 2FSVA 3ZWYA 3D4OA 2HKIA 1E1KA 4L0QA 3NT2A 4CV0A 1NVMB 3ADOA 3PIDA 4ZICA 5L3ZA 1ID1A 2YY7A 4CR7A 2JAHA 4CLHA 1MXFA 1NHGA 3QVOA 5COBA 2HDHA 1N7HA 4BNKA 1XIVA 5L4LA 1AUPA 4XGIA 3HDQA 1QMGA 8LDHA 1I3LA 4C4OA 4E5MA 1EMDA 1UP7A 4Y98A 4YA6A 3QQPA 4DXHA 1NVGA 1B3RA 5DCYA 2VOEA 4LISA 3CTMA 5TLSA 4KOAA 4UUMA 3HNPA 4L4RA 5BNIA 3IUPA 5TQVA 9LDTA 3FF4A 3FBTA 1I2ZA 1GPDG 1M66A 4XYEA 2IODA 2RH8A 1E0DA 3CZRA 1U3WA 1FDUA 4NJOA 4XDYA 3W6UA 1O94A 4R1NA 2DPGA 2VHXA 1OC4A 4IQ8A 1VE9A 1XSEA 5DT9A 1E92A 3FTNA 4ZRMA 3ZHYA 4YRBA 4MKRA 2Y99A 4J90A 4QFCA 4D44A 2Z5LA 4R1SA 4BNGA 2HRBA 1I32A 5EL0A 2VWHA 1P1HA 4J7UA 1CJCA 1NTOA 4J1NA 1GZ4A 4S3MA 4MP8A 5AVOA 4CODB 4HY3A 5I7FA 2C5AA 2UV8A 3V2GA 4FIZA 3TL2A 5GZ3A 2P9CA 4HFJA 4CLEA 4GWKA 1K6JA 2AQHA 3C1TA 4YQYA 4B4UA 4KUGA 1BXZA 1FMCA 1JVBA 2OP0A 1KS9A 5H82A 4C7KA 3D64A 2IYOA 1KYQA 1N2SA 4Y67A 1WMBA 3K9QO 3EGOA 3F47A 1X13A 4U6QA 1MXHA 3TF5A 2EG9A 1K0UA 4IGEA 2ZYAA 2JD0A 3N58A 3EYWA 5L9AA 1RM5A 2PD3A 4FFRA 4FD3A 2EGGA 3VAZA 1XELA 3DHEA 4GMFA 4YAKA 1PGOA 2Y66A 2VQ3A 2GD1O 1DFIA 4NHEA 4BQPA 3OSUA 2V65A 3T7EA 5I9NA 2OHXA 4BMNA 4NFYA 1P31A 3BMQA 2JL1A 3IJRA 2OOSA 1HF3A 1EQ2A 1A27A 1KIFA 4NJMB 5TGDA 4W7IA 3D3WB 4WCFA 4B8WA 3D3EA 1LJ8A 1E3SA 1ULSA 3DAGA 2WYVA 5JSFA 3BTUA 1EBFA 2Y1DA 4AJJA 3F3SA 3WFIA 1LLDA 4BKRA 1PGNA 4U0JA 4XJSA 3FTPA 3S55A 1MC4A 1DIHA 3WQRA 3AUTA 3I5MA 3DC2A 3NJ4A 4JBHA 1O89A 1PS8A 1E3WB 3H3JA 1ZK1A 3AOEC 5JYDA 4GX5A 3WDSA 3CH6A 3F4BA 4I1IA 2QIOA 1G0OA 3WG9A 4J49A 4L4SA 1YE3A 2D3TA 3ZNNA 2W2LA 4D0SA 5JW6A 1ZMTA 4WOJA 1E6WA 3H3FA 5T6BA 1DFGA 3F4LA 3LZ6A 3O4RA 5HRUA 2J5KA 4K6FA 1A4UA 4I5FA 4RLSA 1W4ZA 1U8XX 1S7CA 1YB5A 4L73A 3PI7A 3IIEA 4FDAA 1ZZEA 3ETEA 4WEOA 1DC5A 1SB8A 3UGKA 1DLJA 4OXNA 3FPCA 2NTNA 2FHSA 4FN4A 4LSMA 3GEGA 2CF6A 5K6AA 1F8FA 3RFTA 5KVSA 3EHEA 3PDUA 4QXMA 4BGUA 3WICA 4QTZA 3UCXA 3G79A 1NX6A 3Q3CA 3VKVA 4A03A 1YBVA 2H6EA 1H6DA 1LNQA 3WGHA 4IQGA 4BNZA 5JLAA 1KEUA 3RUDA 3M1LA 2Y1GA 1SPXA 4II3A 1M75A 1DDOA 3QP9A 1X1EA 3IMFA 1IPFA 4K6CA 1DC3A 4BO0A 1E7WA 1TT5B 1F0YA 3U4HA 1GYQA 1ZH8A 4I9NA 1GY8A 1R12A 4OXYA 3M2PA 4YQZA 1YL7A 1JTVA 2Q1UA 4Z9FA 3RASA 1T1RA 3RUCA 3FPLA 2Q4EA 3RSHA 4Q3CA 3OFSA 3DMTA 1WXDA 3AY6A 1KVUA 4IM7A 2VYVD 1V35A 1YQGA 4AICA 4DQVA 3H9EO 1HETA 4AJKA 1G1AA 1LI4A 3E18A 1P77A 3GH3A 2Y1FA 1TT5A 4E30A 4AJIA 4DREA 5CDSA 2FSSA 2A9FA 1JKJA 4IJVA 4CQMB 4GBJA 4N5MA 1IZ0A 3INTA 3PFFA 4PG4A 4CM7A 5BSHA 4NK4A 1YB4A 1U5CA 1LBEA 5C7OO 1UZMA 4GI2A 4RVGA 1ZSVA 1HWYA 4IGFA 3GZNB 4IS2A 4AJ4A 1JDJA 4E33A 2JD2A 5DBFA 1X7GA 4CM5A 2FPPA 4U8GA 1A7KA 3E9QA 3VHRA 3IKVA 4CQMA 4D3DA 3RUHA 1Q7BA 1J0XO 2I5PO 2IZ1A 1VC2A 4NMHA 2O3TA 4OIMA 3DZKA 1ZJZA 4RZHA 4XQCA 2WSBA 2Q2WA 4UVIA 4YJHA 2NQTA 5FI3A 1TT7A 3PRJA 1QYXA 1UAYA 3GUCA 3UHAA 2Q50A 3EAGA 1C1XB 1GR0A 5BT9A 3GN1A 1Q7CA 3CE6A 4BOYA 3S2EA 4B3HA 2I76A 1Q1NA 2QHXA 4OYRA 4MOWA 3A06A 5FI5A 1B3BA 5ITWA 5F5LA 2NSDA 3NDJA 2GRAA 4WLOA 5EINA 3JQGB 1U9JA 3ZV5A 1NP3A 5KVQA 3PYXA 3WS7A 1T1SA 1HRDA 4FCCA 5JNLA 1BXGA 2X0RA 2UUPA 4UEOA 5EQDA 3ZWBA 1R37A 1VL0A 1ZW1A 4FGWA 3STHA 3WSVA 1LDEA 2RHRA 3RI3A 1GADO 2GNAA 3IJPA 4W9NC 3FSRA 2YQ5A 1B2LA 3KYDA 1SOWA 2BRUA 2O7QA 3JQGA 4RV9A 1UDCA 4ND1A 1P1FA 2VT3A 4B3JA 2HO5A 4TQGA 3A28A 4E13A 1IOLA 3QWHA 4YJFB 2DBZA 5IN5A 3Q11A 1BSVA 1ULUA 3ZU4A 4ALKA 4EW6A 7MDHA 1NQTA 3FD8A 2IEBA 5K0ZA 3BHIA 4FR5A 4BVAA 4BB5A 1HL3A 4QEDA 1K3TA 2PD4A 1ZK2A 2P9EA 4BGIA 4E31A 2J6IA 2O4UX 2I9PA 3OJEA 2PKQO 1ISHA 4LN1A 5THQA 4PCVA 1UXGA 3L9XA 1NYTA 4IZIA 5A06A 4JJIA 1ENZA 4FSHA 2ZCUA 1PZEA 2PD6A 4YJFA 3ICCA 3GT0A 3GGOA 4PN3A 4OOEA 1Z7EA 2WD7B 1PL6A 3IS3A 5G4KA 1KEWA 3UUWA 3PLRA 3T7CA 1EE2A 1OAAA 1XQ1A 2ZTMA 1IPEA 3C1AA 4UREA 5KWEA 3IP3A 5JPIA 2VWPA 2W2LD 1DRUA 3TL3A 1UJMA 2GSDA 2HMVA 2ZB8A 1H2HA 3L6EA 3SXPA 1PL7A 1BRMA 2VRBA 3IKTA 4NU6A 5L4SA 5JAIA 1RWBA 3LDHA 3WTBA 1R15A 2CNBA 3DZJA 4NU5A 3TRIA 4JBGA 1U3UA 4D46A 1UUFA 1IY8A 4TKMA 4BUCA 3CMCO 3DR3A 1EDZA 2WYUA 3B70A 4PIVA 3RFXA 3H65A 4IIUA 2IXBA 4IY1A 2GPTA 2JFFA 1PR3A 3WQSB 1W0CA 3AI3A 4L74A 1E7QA 4GPD1 4Z0HO 4A2CA 2GDZA 3QVTA 3BMNB 2IDZA 4Z0TA 4ILKA 5FEUA 4XCVA 1CWUA 4OM8A 5FF9A 2EGHA 2BGKA 4AJNA 4WNCA 3AU8A 3HE3A 2B83A 3DB2A 4CMIB 4IIVA 1P1JA 2CDCA 3LT4A 3QVSA 3AM4A 4JGBA 4W7HA 2C07A 3BHMA 3GOHA 4DQUA 3ZU5A 4EDFA 5ILOA 1N8KA 1SBYA 4JP3A 3PLNA 3I9MA 3D1LA 4XQ9A 1NPYA 5KVVA 4RZIA 4E3ZA 1LQUA 5KIAA 4FBGA 1UP6A 3Q1LA 4OAQA 4XYLA 3MJEA 2BKAA 3UKOA 1GCOA 3VVBA 1KETA 3U4DA 4ND2A 3FRJA 1L7DA 1NR7A 4GLOA 1FXSA 4FW8A 1C0KA 3RUEA 5G0WA 5KNLA 4D79A 2DC1A 3VPFA 4J9VA 4R69A 1DIGA 2ZIZA 1I3MA 3F1KA 3NEPX 2WE8A 4PRLA 3ZNPA 3U62A 3E5MA 4INAA 5G0TA 2C82A 2FY8A 4QT0A 1HE5A 4FOSA 5DBGA 5G2OA 5JY6A 2PA3A 2C7VA 2PH3A 3DOJA 1JQBA 1YS4A 1OOEA 3JQFA 1K89A 1DAPA 1ZBQA 2PV7A 4N18A 1Z82A 4AJPA 1Y8QA 3ZWNA 3I1JA 2FRDA 2J3HA 2ZB3A 3SX2A 4E4YA 3RWBA 1E5LA 4BQRA 2Q99A 3AW9A 3FI9A 2PH5A 3PEFA 2W90A 1IYZA 4CQMD 3CXRA 3DBRA 1NM5A 3OBBA 5AXAA 1J49A 3GFBA 4PVDA 4R16A 5CP8A 1LSOA 2P5UA 3K92A 4NBVA 3WSWA 1EE9A 4OXKA 4M49A 1AXGA 1XU9A 4PLCA 3HB4X 3KSZO 2YZ7A 4CLXA 1WLYA 4WLUA 3JYLA 4KTTE 2DUWA 3QA9A 4Q39A 4YXFA 4XJTA 3SEFA 1AE1A 4J1TA 2XXBA 3UICA 2FR8A 3VPGA 2G5CA 2ZJ1A 3RROA 2R6JA 1R4NA 4BNTA 2W98A 1BGVA 3U4IA 4DLAA 3H9QA 1O6ZA 2RCYA 2UAGA 3ZWMA 4DRYA 5G0VA 3VDRA 3FNHA 3DOOA 3LU1A 1LXCA 1I01A 2Y05A 3MWEB 1E1LA 4ID9A 3AM3A 3DQPA 3G49A 4YRDA 5KCZA 3C7DB 3B20A 3R3JA 4R41A 4XQGA 4IMRA 5T67A 4EBFA 5TRTA 4RVFA 5JS6A 1YRLA 1Y9EA 2C7GA 1I10A 2X9VA 5HS6A 4XEHA 3NT4A 1ZXBA 3MJCA 5KJ1A 1B26A 4JP2A 4TRJA 1D4FA 3BTVA 4M54A 4BKPA 2I3AA 3LQFA 4R51A 1FK8A 1JKFA 3E48A 4NBTA 5A9SB 5CG1A 3T4EA 3GEDA 3ZNQA 1PJCA 5EJ2A 1PQUA 4K9DA 4D3SA 4E6PA 3GVHA 3OEYA 1R4MA 3CINA 4LGVA 1T2DA 3HWRA 3NGLA 5T8KC 4PLPA 4KTVE 1GPJA 3WIEA 2GN6A 1PJ4A 1Q0HA 1QYWA 5EPOA 1KOLA 2VTDA 1ZUD1 2PR2A 3FCOA 3OIDA 1R0KA 3DL2A 1BW9A 3H6KA 4PLYA 1XCBA 4AFNA 4YR9A 4HWKA 4WLEA 3LSYA 3I6IA 5F21A 3ENNA 2GN8A 2PLAA 3AUUA 3E9NA 5ICMA 3LC7O 4P4NA 5G0SA 1IZ9A 5FYDA 4ROSA 2O48X 3DAFA 2FN7A 1LQTA 1SEPA 1YONA 1EUDA 2DBQA 3GNSA 4NZ9A 3RJ9A 1VPDA 4CMAA 1CETA 5JBIA 5JDIA 2P4QA 1IULA 1T24A 1ZEMA 1ONPA 1O95A 4XDZA 1QKIA 2CVZA 2ZYDA 2TMDA 1QSGA 4PGFA 1ZIDA 2DVMA 4YACA 2X5KO 4LMPA 3L4BA 4RVDA 2Y0CA 1SMKA 3GEMA 3ITDA 1I3KA 4BGVA 3KV3O 4GSKA 1JVSA 3HFSA 1E7RA 5TT1A 4XB2A 2G0TA 3RUIA 1U1IA 5CDTA 4Q3NA 3OEWA 1LSUA 3K31A 5GZ1A 2E48A 4IPTA 4L76A 4E2YA 1EFLA 2WMDA 4E5PA 1YQXA 1TLTA 3LLSA 3DONA 1VSUA 4RO0A 3WMWA 3R0IA 4Z0PA 3ANLA 3H8VA 1NFFA 2CDBA 4NQZA 3FBGA 4F45A 2WJPA 3SC6A 4EI2A 1D1SA 4R4JA 5I9MA 2HUNA 2PWZA 2OUIA 3OHSX 3KYBA 4F46A 3W4KA 2Q3EA 1BDBA 1ADGA 1CYDA 3KBOA 2AW5A 4DIOA 4M8SA 4B7XA 3WJ7A 1YQDA 2O3QA 4B4OA 3M6IA 4W4TA 4YT8A 3S2FA 2DTDA 2WTBA 4WEQA 5EQFA 4DVJA 1PQWA 4J0EA 4TMFA 1QR6A 5CDYA 4O63O 2D59A 1A4IA 2FR0A 4ALIA 1YXMA 2VYND 1C0LA 2ZKLA 5IFLA 1P1KA 1UXHA 4J9UE 2AG8A 4E2ZA 4YAIA 5C3MA 5EMHA 1GYRA 2GO1A 3CZMA 5KVCA 1B8UA 5TIIA 2R00A 2FP4A 3FWNA 4QSMA 3PIIA 4LMRA 2Q1TA 3RVDA 2B0JA 2W8ZA 4PFJA 1LDYA 1PGPA 4PLTA 5JDCA 2JCXA 3WWYA 1PJ3A 2P4HX 2BGLA 4XZ3A 4KQWA 4A73A 1U7HA 1U28A 1QG6A 3TZ6A 1KVSA 2HAEA 1NQOA 4A26A 1CIVA 1DFHA 2W4QA 2Y0EA 1EK6A 4CM4B 2ZCVA 4JXKA 2JAPA 3KSDO 5C5IA 1HEUA 3HSKA 2AEMA 2EKLA 4FS3A 4W82A 2B69A 4EUFA 1M67A 1PZGA 4H3VA 4M1QA 3PWKA 5JCJA 2VYVA 1X15A 1AN9A 5ER9A 4CMGA 2EWMA 2Y68A 3VZQA 1DC6A 4MIEA 5GZ6A 5IDQA 4I8XA 4IDBA 1AHHA 3DXFA 3F46A 4H16A 4YT5A 2EP7A 4CMEC 3PQFA 4TVOA 4EJMA 2NU8A 3IDSA 4JIGA 2O3SA 3A4VA 4F3YA 4P4GA 1MFZA 3K2BA 4MJLA 3ZHXA 2X6TA 4DC1A 1SNYA 4BO8A 3ULKA 1X7DA 3E6AA 5AXCA 4W6ZA 1CF2O 1F14A 3ROKA 4EJ6A 4J4HA 5A03A 2VCYA 1XQ6A 4MKZA 4R3NA 3HHPA 1UZNA 2B4RO 2IRWA 5F1OA 4Q3BA 4J7CA 4TROA 2Q2QA 1MA0A 4B4VA 2QZ9A 4O59O 3ROQA 3WGIA 4MDHA 2V6MA 3JV7A 3NT5A 2SCUA 3GNQA 3QWBA 5B1YA 4B8ZA 4IDDA 3DEYX 1A9ZA 4MP3A 3C1OA 4RF4A 3GQVA 4QO8A 4WE3A 4XD2A 5IF3A 1E77A 1MB4A 3OA0A 4CLRB 4ALJA 3H4VA 4B79A 3CEAA 1HE4A 2QG4A 2QZZA 5C7IO 3LC2O 3WIDA 3TZKA 2NWQA 2VWGA 1ZVMA 5CEEA 4HBGA 3U9LA 3HFGA 4I5GA 4ND4A 3GN2A 3H2SA 4O5OA 1HLDA 4JROA 1B0AA 2D0IA 4J2OA 3ZU2A 4TVBA 1ZSNA 2ZATA 2J3JA 2POQX 2LDXA 2GCGA 3GVPA 1TI7A 4NH4A 1C14A 2H1SA 2YV1A 3RUAA 4NFHA 3EC7A 4AJEA 4RL6A 4CLRA 4OO3A 2PTGA 3JQ8B 4BNNA 4A10A 4Y8VA 1N9GB 4ESOA 3PQDA 3U09A 2EKQA 1PS9A 1P3DA 1WDLA 4ND5A 1UXIA 2DAPA 2I67A 1M2WA 1DC4A 3NRCA 4R5MA 5TJHA 1JU9A 3SJ7A 3Q6IA 1LSSA 3GVIA 3PGXA 3M1AA 1JWAB 4HADA 4BKUA 4JX8A 2VUSA 1WVGA 1C1DB 3JQBA 3JQ8A 1ADFA 3P2YA 3QLJA 5C7LO 4MVJM 1OMOA 1KBZA 1XU7A 2BI8A 1LLQA 3QIVA 4YDRA 2BFPA 3RJ5A 3IQDB 4DIBA 1XG5A 5L45A 1OFGA 2VHZA 1EBUA 1HYGA 1NR1A 2YDXA 3WB9A 1UR5A 4J4TA 2O7SA 1X0XA 1TVEA 1P33A 1QYCA 2B37A 3RUFA 1RJWA 2PZLA 1XA0A 3RU7A 3HN2A 4Z9YA 1MUUA 4CMCA 1IE3A 1T2AA 2WEKA 1ZO8A 3JQAB 4NJMA 2BH9A 1JAYA 3D3WA 3PWZA 2ZTUA 4GGOA 2I99A 4YPOA 5A04A 3ZWAA 2OBNA 2EP5A 5H83A 4ITUA 3LLVA 3FR7A 4OHUA 1HDZA 2DM6A 4IMPA 3EMKA 5ES3A 1K2WA 1I0ZA 3A1NA 1OZAA 1YO6A 2B4QA 2WWRA 4KP7A 5CEFA 2X7HA 4WJZA 3VZRA 1DSSG 3V1UA 1E3WA 3E5RA 3O8QB 3CMMA 3QWFA 2ZB4A 3JQAA 4CM8B 5IXYA 3D0OA 5BR7A 1QYDA 5DN9A 4BNWA 3S2IA 4YVFA 1T25A 4RCVA 2LDBA 1RPNA 1UXJA 4HV4A 4BB6A 1MX3A 4E5YA 4WCFC 2XPCA 3DHYA 3QWAA 3LF1A 4CQLB 3WNVA 4PLHA 4DIFA 3RU9A 3E82A 1FDTA 5BNFA 1SZJG 2BGMA 4QFDA 3O8QA 5I8WA 3OA2A 2BD0A 3H7AA 5G0UA 2PKQP 4R1TA 1D1TA 2PK3A 3ZH2A 3Q9UA 5C37A 3B1FA 1Z6ZA 4BNIA 4BO3A 1EUCA 3JYQA 1F06A 1LRLA 4D41A 3RQSA 1YVEI 3AFMA 1PEDA 1UZLA 2Q1SA 5HBRA 2VZ0A 3PHIA 3OP4A 1IUKA 1Z74A 2YV2A 5LC1A 4C7JA 5A4DA 3DZGA 2NU6A 5A5EA 1HDYA 5JCJD 4RPKA 5U9CA 1ZCJA 4CM9D 1DEHA 1P1IA 2CFCA 2VRCA 4NPCA 4URFA 2VZ9A 4PLVA 5JCXA 2ZYGA 3KLPX 5MDHA 1HKUA 3EDMA 5DCUA 4RF3A 3U5TA 4YEDA 1Q0QA 3GA0A 5A3JA 3KTDA 3VOSA 3DOCA 4GVLA 1MC5A 1E6UA 1S6YA 2WDZA 3BMOB 3ZCXA 4R68A 2D8AA 2OBYA 2ZQYA 1U8FO 4MIOA 1GQQA 1YL5A 2HMTA 1UAGA 2O50A 4FJ2A 4UEJA 3ZW9A 1I33A 1PL8A 5TC4A 2PZJA 2JCYA 2Q45A 4BO6A 2J8ZA 1NPTO 2HQ1A 2VNAA 2OORA 4BO5A 4P22A 5TT0A 1DAOA 4EYEA 5KJCA 1BVRA 1ZFNA 4UUOA 2VUTA 1HDOA 1V9LA 1CRWG 4CMHA 1UP4A 2X4GA 1P74A 3GZNA 5HS4A 1WZIA 3DMTC 2RHCA 5TX7A 2B35A 1ZK3A 3JYNA 2BFMA 3V8BA 1E3LA 4PLGA 1DRVA 1H6CA 1ZMOA 4IDAA 4LRTB 4RPGA 3WBBA 4ZU3A 3DO5A 4XGKA 1R6DA 1LLCA 2VHWA 1LU9A 2NUAA 4JJFA 4OMUA 4E32A 3ETGA 1LDMA 3BZUA 3RFVA 1X7HA 4X54A 3KETA 2BFOA 4L8VA 5COAA 1P0CA 5I9LA 4YAEA 1SAYA 3QVWA 3BIOA 4LCEA 1QP8A 4LSWA 4M55A 2DQ4A 2X22A 2HK9A 4TZTA 2EEZA 1C1XA 3I23A 2GERA 3WR5A 3OETA 1P9LA 3KSUA 2AEJA 2D5CA 3NGXA 3TN7A 4Y6SA 1D8AA 2HRZA 4EJ0A 3T4XA 5KKAA 2B36A 5B4UA 2OXIA 3DWFA 2H63A 1VJTA 2NV6A 3OJFA 4BNLA 2P9GA 1LX6A 3ZWWA 1P1RA 2CUKA 4RLHA 3RBZA 1WP4A 4NDNE 4WLVA 4EZBA 4RPLA 1L7EA 4IDGA 1XKQA 1BXKA 1GUZA 4XR4A 1I8TA 3K5PA 5EN4A 2C0CA 5A3VA 3DZIA 1T2CA 2I6TA 2FR1A 4Q9NA 1ZEJA 4MVJE 2BMAA 2WE7A 1VLLA 3P19A 4I9HA 2EIHA 4QO7A 5JC8A 3INGA 2XOXA 5L40A 1AHIA 1TB4A 2G76A 5L7YA 4BHTA 3PJGA 4J1QA 4MVJP 3IP1A 1HE3A 3HUDA 3K30A 1X0VA 2VNSA 4NBWA 4IJUA 3GDFA 1BWSA 3ICPA 3JTMA 3TZQA 4DYDA 5HTOA 4GX2A 1NAIA 1VRWA 4JJGA 3U49A 2VN8A 1MG0A 4FPXA 1HDGO 2HCTA 1V0JA 3W8DA 2QYSA 2UVDA 3JYPA 3PHJA 3E9MA 3H9GA 2V7PA 3L77A 3EVTA 3WGQA 4O1MA 2PGJA 4AJ1A 1M76A 1N1EA 4NBUA 8ADHA 4TZKA 4KQXA 2WD7A 4PLZA 3JQAD 4MVJG 4FJ1A 1WMAA 1HZJA 4AL4A 1PWXA 2QRKA 1PJLA 4Z3DA 4PZCA 3PZRA 4HXYA 1FDSA 3OJOA 4NI5A 5DDIP 3UF0A 5IZCA 1HDCA 3KRTA 2YFQA 3JQDA 3GMSA 3RKUA 5KJFA 1HE2A 5JYEA 2GASA 1MG5A 3PYMA 1HXHA 3PJDA 4WOKA 5U4QA 1PJ2A 1VL8A 4DYVA 1KVRA 4K26A 2GN9A 2ZQZA 3AUAA 1DLIA 4UVGA 1O9BA 2Z1NA 1ISMA 1T4BA 3I4CA 1NFQA 4ZN6A 2BFAA 3BMNA 3TDKA 1B8VA 1KVQA 3SBOA 4BNVA 4ZHSA 2VYNA 2ET6A 3I4FA 4GGPA 3RC7A 3PWSA 1RYEA 2J5QA 2PGLA 3G0OA 2NQ8A 1BVUA 4CMBA 4YJGB 3C85A 1PWZA 4CMIA 4WLNA 3EZYA 4H15A 4WNIA 1TA4A 2WM3A 1EFKA 4KWIA 2XAAA 2BI7A 1MFPA 2VRCD 3JQEA 2OFPA 2JFHA 4B3IA 2D5AA 3B6ZA 4OH1A 4R9RA 3OICA 4J0FA 1YDWA 2CZCA 4Y6PA 4YJDA 4IS3A 3S1LA 3SLGA
chains in the Genus database with same CATH superfamily
3QU9A 1LRKA 1KAHA 4D9KA 1A71A 3C3CA 4P3PA 4P5DA 5THXA 4WI1A 4NMWA 1LPNA 5CTAA 1UZAA 2AFIB 2Z95A 1CQJA 4K6KA 1Z0SA 4MW4A 3NB0A 5KSOA 4OCZA 1GPH1 2WJYA 1OH7A 1L8XA 5G3ZA 1DB3A 4RIHA 2VUUA 5CT4A 4W63A 3ROPA 1VPTA 2WKQA 1FSZA 1IM5A 3LH5A 4P3OA 3R6GA 5BNWA 5LA6F 1LUAA 4UXIA 2JW5A 4P3XA 3SGLA 1OROA 4RMNA 4HJRA 5CFZA 2YQ4A 1E69A 3UK7A 5F7XA 4FD2A 2E49A 2ODEA 2P5YA 1UM8A 3F9CA 1IBKB 2QTTA 3FHOA 121PA 3CFYA 4WESA 1JA9A 4U2EA 4LFCB 2GLXA 3FXAA 1J4AA 5KHAA 2G70A 4RD0A 5ECWA 5AHOA 3NWJA 2DKNA 2W6ZA 5ALKA 1N32B 1J2EA 2BEVA 3PXXA 1RHJA 9LDBA 2B8TA 2MSKA 4RKYA 2XB8A 3PRHA 3CY6A 5HGXA 1DIBA 5THKA 3WP1B 1K88A 4DCVA 4C87A 3TOSA 1XK6A 4RIIA 1JSZA 2J3KA 5IT5A 2JASA 4FXPA 4TKUA 3R3HA 1P60A 1PDWA 2D00A 1JYFA 2JK0A 2N0SA 3LCJA 2YKGA 4UTPA 3LD9A 2C94A 1W581 4TYNA 4HNTA 5I7VA 1UQRA 2QE7D 5FLEX 3JQFC 3I9V1 3JVEA 4OGGA 4BJ1A 2CF5A 3T5AA 3HHEA 1F12A 5I8PA 1R66A 3HZHA 5LCXA 3VC1A 5BOSA 3VYVA 3NOOA 3G5UA 4MGHA 2XT0A 5LP1A 3T7RA 2XKJE 4MR9A 1WV1A 5WRFA 3S6JA 3N59A 3BXFA 2VPZA 1NM5C 4PSUA 4PZEA 4C14A 2XMDA 2L2QA 2N9UA 5IBQA 3P9KA 4B84A 2HTEA 4ZVKA 1N36B 3KYCB 1Q14A 2Q49A 3SHVA 5JASA 5BVHA 4Q6BA 1M6WA 1Z6AA 4FKZA 1WPQA 2IKSA 2ATEA 3MJSA 1SKMA 3NZEA 1GGHA 4JGIA 5PNTA 4F4UA 2QPOA 1G3MA 2YY6A 3T1VA 1YRQA 4ZQHA 3RUIA 2B8NA 3BMCB 1H2BA 5JVDA 1XCGB 3O8DA 1N25A 3FYCA 3NI2A 4ZT5A 4YCSA 3EVNA 3OBIA 4FFBA 2WPNA 1OWMA 2ATXA 3ZDFA 5B57C 5DBIA 2HPHA 3GJ5A 3W1EA 5EMKA 2P90A 3GRPA 2WU8A 4EGSA 3KVRA 3JALB 3OIFA 5ALGA 4D8YA 4EG0A 4ZVVA 1QFZA 3MGAA 2MIIA 1N6LA 1P8JA 3HG7A 2DLDA 5ALNA 5JHGB 4WPGA 5KYTA 3RAFC 3HADA 3ABSB 1VYHA 2R6AA 5DZSA 3KUXA 3CXUA 5BSVA 1LDBA 3R9XB 3DLAA 2FQXA 1IY0A 1OV4A 3FYUA 4Y3UA 1EWTA 1WMEA 4Z54A 4FSXA 1DX9A 2G83A 4P0TA 4INZA 2A58A 2OBLA 5HEKA 3OQBA 4J0DA 5K9ZA 2OR3A 2O3JA 2V74B 5D3QA 2AOXA 2L42A 2PO7A 1ORWA 3GARA 4E3WA 4CEJA 1KJZA 2VIIA 3ZHZA 1Q50A 5KTOA 3EEQA 1YCDA 1Q12A 4O6VA 2X58A 5KMGB 1GG9A 1FP6A 4L7VA 2ZJOA 2WV7A 3N2KA 3PDIB 5SZIA 4AS3A 3NTQA 5CA1F 4O29A 1SUAA 3EBLA 2OVFA 3NW9A 3PA8A 3RVNA 2VQ6A 4BLQA 3ESZA 1EZ4A 1XAHA 3DZDA 1NNSA 1K7EB 2PSDA 4L16A 3RSGA 5HJEA 1QHNA 1DIRA 2EZ9A 2HJSA 4N0DA 4KPFC 1ECCA 3LYHA 2XGMA 4D4MA 2NO0A 2OO7A 4R1UA 3R7BA 2C7BA 2CVOA 4GLJA 4LY3A 3UV7A 1IY1A 3AMVA 1HUQA 3DG9A 4CN8A 1ZM2A 3FJYA 1QS0A 2ILVA 1JG4A 2FPGB 2GR9A 2R1VA 3ABQB 2ZI4A 2FEKA 1G41A 1V5FA 2RC6A 5BWMA 4MQ6A 4MQEA 5E6UB 1EH5A 1NRIA 1NBEA 1Z0ZA 2HRRA 2OD9A 3BE6A 3GLHA 4WDRA 5LDGA 4BWVA 5L8VA 4AI6A 1M0WA 1KRXA 5TXGA 4DGQA 5BVGA 1T2UA 3C3JA 4XM1A 2OD7A 3FYSA 2NM0A 2OOKA 5EHQA 5B4TA 1T9CA 2Q28A 1J70A 3UVEA 2OYSA 4AJ2A 1D07A 5G40A 1UODA 2KB0A 3K2QA 4U7PB 1IY9A 3BSFA 1QFXA 3CKYA 3VNQA 2P78A 3RVRA 4B6FA 5KZMB 4AG3A 5I51A 4ZYVA 4HATA 5F76A 3PUKA 2OK7A 3KOOA 3LFHA 2V0GA 3SDBA 1IBLB 3EEIA 3K0AA 1NQ5A 2NZ2A 3W79A 4A5OA 1QTQA 3AEQB 3ZHSA 1OA1A 4PGHA 5EXTA 1FU8A 5AJWA 4B82A 1HK7A 3F2IA 2IF0A 3TVYA 5HILA 3BBLA 1E1MA 2ETXA 2GPJA 1KKUA 1E0JA 1GHTA 1V5EA 3P26A 3UK0A 2ATCA 2XF8A 5E1OA 3ELUA 5BWOA 1RPZA 3M83A 4KK3A 1QGOA 4R54A 3TX2A 3DBVO 4ZIRA 2JFXA 4K1LA 3IO3A 2NU7B 1Y37A 3K8OE 2YMLA 3VMFA 2WIFA 4M2LA 1TADA 2WUGA 4FGZA 2R87A 4D3ZA 1ADYA 3RD5A 5KNBD 5KKCA 2Z6AA 4NAUA 2ZWMA 1PTKA 3CSUA 2GZ2A 5JARA 421PA 2ICAA 1YC2A 3NONA 5DBOA 4BIMA 3L8EA 4YRGA 4IP0A 4YRNA 1U2TA 2VK8A 4MJ3A 1LVGA 2X5NA 1GSHA 1VLHA 3DKPA 2ZVJA 3MC1A 1QCCA 4KUHA 4MQFA 5CTJA 3W6ZA 3H11A 5BNZA 4E4RA 5A1JA 3CU5A 1C7FA 4LQ4A 4ZAVA 4LHYA 5CVDA 4O4JF 4V24A 3QSYA 3F7NA 4FR2A 4RJLA 5CFLA 2D1SA 3MOIA 3GT4A 3TD6A 5AVSA 1UPXA 1AG9A 1PVDA 3PIRA 1I36A 3Q0TA 1NBHA 3A4IA 3E7FA 5EI5A 5J47A 5K09A 2AUNA 2DWQA 1M2NA 4G8JA 2JFBA 2AHRA 4KDRA 4LXGA 4EY4A 5A5FA 1SY7A 2QYTA 2R00C 3PSAA 1CX9B 4M6WA 4I0WB 4AF6A 4H4DA 1OVMA 4ER5A 1XZNA 2QM7A 4G07A 2UVPA 4UXHA 4HNQA 3NTXA 2H1HA 1F6DA 2NUPB 3WOVA 5JAMA 1K8RA 1CUJA 2FPIB 4L4UA 1CUDA 4ZOEA 1D2CA 1FNSA 1SKYE 3ZZNA 4DMRA 3IHKA 2YVAA 2KSQA 1JW9B 4Y6RA 5DFAA 2JKVA 3O91A 2Z43A 5AXDA 4LK2A 1DKMA 5G41A 4H7FA 2MSDB 1Y5LA 2HLPA 1XMJA 3E2PA 5FUQA 5KYWA 2PN1A 5EZ6B 2AB0A 2HSZA 3CNQS 1D1PA 1NWHA 3PB3A 1BIFA 2GAFA 3CNOA 4DM7A 1ILEA 5EPEA 4JXJA 5FA6A 3ZQUA 2I8CA 4J0JA 4AJHA 2BHSA 4HUTA 4AW9A 1P7VA 2P75A 1HG0A 2Z1MA 3WXBA 3ZJ4A 4I8DA 3OLYA 3GFTA 3M49A 5AQEA 3V1TC 4TKZA 4HK4A 1NUUA 1YOVA 2WSSA 3OSZA 2O8BB 4JMPA 1TDJA 2O23A 4JT2A 1QBKC 3X1DA 4P3YA 1VMDA 3BA1A 3CHYA 5T41A 5L4NA 5LD2C 4GKAA 1EXWA 3K1TA 5KCMA 1PNRA 1T2EA 1BAPA 3C3YA 1CW2B 5FKJA 1MF7A 2HRDA 4RE6A 4O4LA 1ZUHA 4GBMA 1ENYA 2A4KA 3OCZA 1R16A 3ZS9A 2W2NA 5EP4A 5ISMA 4DLNA 1CPYA 4PXAA 1Z56C 4MKIA 3DBOB 4KXVA 4S0XA 4B3XA 1Z2OX 1KDOA 4HAIA 3TS1A 1OX6A 2C2OA 2QL7A 5FWAA 1D0VA 1ARZA 1M1ZA 3KELA 3TKLA 4EJFA 3H5IA 1P7PA 5T4FA 3PDWA 3RC2A 4YRMA 2B1GA 4Y2XA 1D3AA 4PC1A 3I05A 4MS4B 5EWLA 1F2DA 2X6RA 2VT2A 3H2KA 1QLWA 1V1JA 4PG8A 4CLOA 3IUQA 3LXRA 5IT4A 5LJLA 3HZZA 3U7GA 4UATA 4PEVA 4KGVA 1FE8A 2CL5A 4YRRA 2P8SA 1NRXA 3EA5A 3NCHA 4HDKB 3ZWCA 1PIWA 2V45A 3OOJA 2R7KA 3P2JA 3PFHA 1QH8A 3KAJA 3NYRA 3D2AA 4FYXA 3U44B 1I9CA 4WVFA 1CYEA 4S35A 3EFEA 1NYRA 3G59A 5DTRA 2VPXA 1NASA 2XYPA 2FQYA 1XB2A 3A6FA 3K73O 4KXNA 1BS9A 3VR5A 4M38A 4PO8A 1V4VA 1U0LA 2Z56A 1EDOA 3GX1A 3KOZA 3N75A 5FBHA 4ZVUA 5LNK6 3DDZX 5L53A 4H6PA 4RJTA 3ZUPA 2G4CA 3BEDA 1JPUA 3A26A 3P9XA 1EWYA 4LRSB 3QJ5A 2FX2A 4KO8A 3A6KA 2Y3IA 3GEEA 3LTEA 1CEQA 2GZ1A 4LFBB 5L51A 2GJKA 4X8MA 5CFOA 3RUPA 3OJ0A 1C1DA 1S89A 1YR7A 4HNGA 1DG9A 2IYEA 5LQJA 4QU0A 2BSQA 1W29A 3NC1C 1MB2A 3N1UA 3DCJA 4AF8A 4L2IA 3K6RA 3WGGA 5JWOA 4HVCA 3G7SA 1NUHA 1UKAA 4MUKA 4O3FA 4ZJYA 4PPNA 4XYGA 1U7TA 4V0OA 4YYZA 3GOQA 3FDXA 2H0QA 5HF8A 5LYYA 3ZHRA 4YP9A 5E2IA 5HFJA 3SZOA 1L4EA 5HFAA 4E0BA 3FIUA 1GTG1 4FC7A 4N9WA 2PS9A 5FULA 5BYAA 4YCBA 1GUAA 3A6GA 2ZJFA 1KEEB 3F5MA 3GJTA 1IONA 4OUDA 4BO1A 2F62A 4C7MA 3QOYA 4IDFA 4XYMA 3CVYA 1YB6A 2QMQA 1A50B 3GRKA 2Y9PB 3LPNA 2XBUA 3N0TA 4L51A 3KE8A 3NR2A 3IH5A 2XMZA 4TMXA 3V6LA 4Z5XA 2A86A 1DKPA 3HJAA 5IC5A 1PG0A 1VPEA 4JU8A 3EQ8A 2O4CA 4OI0A 1ODTC 1Y82A 3K5HA 3A4LA 4IFEA 1HBJA 3UXEA 3AXSA 2CT8A 4JSTA 4LRUA 2RGNA 5AKJA 4A6DA 2BPOA 2IP4A 3OX3A 2WZDA 3ILVA 1NFRA 1VDMA 4UBKA 4KI0A 2PRIA 2JI4A 4PO9A 1EK2A 2HWXA 3HGQA 5FJIA 1H4TA 2BFEB 4HT3B 2X2FA 2XDQB 1NE7A 3A70A 3FZQA 5ICCA 3ZV3A 1GZ6A 2PYIA 4TV8F 4DCOA 2I4RA 1BJTA 2VP6A 4QX6A 3KZCA 4HMQA 3T0IA 2XB6A 3ZDEA 1QU2A 1LWOA 2G77B 3OO0A 3UW1A 4WBNF 4IINA 3EXEB 3HMKA 2LUOA 4UUPA 3T1OA 2C88A 5C8YF 4CXMA 3P5SA 4XR9A 1N7JA 4OKNA 4BO7A 3SIWA 4PFKA 2CB0A 3MPUA 1EK5A 3P7MA 1F2TA 3A36A 4I1UA 4LYFA 1PR6A 4Y2VA 1XR3A 2RHDA 3SHTA 3FMFA 1OH6A 1PSDA 1EESA 1DZIA 3ADBA 4QUBA 1XDDA 2C29D 5KAMA 5ER6A 3RSOA 1ZR4A 4AT1A 4M9SA 4WUVA 4GM1A 3G2IA 4RJKA 2WJVA 3UV3A 4CR6A 1OGJA 1KC3A 4E70A 3GU3A 1PEKE 3A6PC 2COKA 1O5IA 2YC2C 3T35A 3AJ9A 3ANMA 5I6DA 4A0RA 1GRNA 3HA2A 3W78A 2AI3A 2PKEA 3C7AA 5CDUA 2J09A 3NQ41 3B1VA 5B55A 1ODJA 3UCEA 1HA3A 2XQKA 3HCRA 1UKCA 4IILA 4OFXA 2H06A 5K8VA 2O1XA 2ORIA 2CCGA 3N74A 4XXHA 4KKXB 3DMHA 1H5QA 4TS3A 4K6GA 2CWWA 1V8BA 2QR3A 2AQ8A 2YIVX 5BYBA 3WYCA 3K16A 1RYYA 1SVUA 4HP8A 3PQEA 2GEVA 3PC8C 4N1AA 2D1YA 1MB9A 2OZVA 4NS4A 2NPIA 3USCS 1GYPA 5KNDH 2O19A 1X2EA 3IUJA 1ZA2A 4JBIA 4AMVA 3VBCA 4W9MC 3WYBA 1UBGA 1N5OX 3F78A 3KLBA 2PUEA 2BTEA 3HVIA 1OBOA 1HDIA 1PJQA 2XUZA 2ZZKA 4YC7A 4BMZA 3H13A 5A05A 2OZPA 4RABA 1OBHA 4UUNA 5IYZF 1KYTA 2JGFA 4DQKA 2E6KA 3WTBA 3W04A 3WLEA 4TRMA 4RGYA 1TK2A 2WSSD 3H2GA 3NANA 1NW9B 4FZ3A 4QQFA 4KVGA 2PKRA 4UEWA 6PFKA 1EM6A 2Q9AA 1O94D 5HBGA 3ZN2A 2XTJA 2I4MA 4LTMA 1X9GA 4V0SA 4L6CA 5ADHA 3SSNA 4LBWA 1ISSA 1U7DA 4UC0A 4M8NE 4ZVNA 1Y8RA 2LCFA 1SC3A 3WB2A 4AZ0A 5JJBA 2ZIEA 4YRAA 4FYWA 4G0QA 1DEXA 3I64A 2E89A 1GNQA 2LV8A 3D6VA 3TRKA 1C0PA 1YT5A 1IPHA 2V6IA 1CE8B 5DPMA 4C0AC 1O8CA 3E8XA 3I3OA 4HG2A 1NMQA 2IHTA 1U2PA 3C6YA 1EEXB 5JG7A 4JLWA 2QN2A 4LXYA 3WXMA 5IG2A 4FN5A 2XCSB 3DFIA 4GYYA 1X94A 4KRYA 4DA7A 5C31A 3OO1A 3MRSA 2QG9A 2ZRPA 2ZRDA 2L17A 1FNBA 4MW6A 3VNAA 4B3DA 3WGLA 4DGSA 2FEWB 3BL5A 4IYRA 4KAFA 1R4ZA 1KYZA 3R3SA 4DM4A 3CZ9A 3PRKE 4HWRA 3U3ZA 1FLVA 2ZBDA 1QONA 2BR3A 2OUKA 1RWWA 3BJEA 2CSUA 3KAPA 4H3SA 4RHEA 5EEGA 2NPFA 1NJ1A 2FKNA 1VMIA 3EJ6A 2YJ6A 3DVAB 3BZWA 3KJQA 5ALJA 4WGGA 1AZSC 2AZMA 4M98A 5TY0A 3A2KA 4OQPA 5JNTA 3U16A 3M2TA 2VDUE 4IVQA 5I9SA 5ILGA 3FMGA 2YFKA 4N7BA 4PVCA 4B7AA 4ES6A 3UW3A 5JZBA 1CP2A 1AGNA 2WYWA 4GH5A 4NU8X 3JZIA 1AKQA 4RD6A 1P80A 4KO1S 1YWGO 3V9AA 1EXMA 1SQSA 4KH0A 3N7UA 4L7QA 1OH5A 4B6QA 3GFGA 1T4CA 2ID7A 5HA5A 2L19A 2YWRA 3U4QA 2EKPA 2QVGA 1U2RA 1BTOA 1AQ6A 3M33A 2WWTA 4PRYA 4FHDA 3F97A 1KJJA 3CJRA 2PR7A 5AVUA 1ZK4A 3FRIA 2MSNA 4H1VA 3DGFC 1XQWA 1UDAA 2OGSA 3HXLA 4H2DA 4WV3A 2YJNA 3X1JA 1MO5A 1L5VA 1QH0A 1NG1A 1UMDB 2JANA 2VPWA 1SC6A 4OMDA 1H2ZA 3FYHA 3VU9B 4YRSA 2F3TA 1QIGA 3I1FA 3K5WA 3SAJA 2PX6A 2XR1A 1O5TA 2C54A 2GN2A 3SFTA 1EKXA 2G0NA 3CUSA 4M1SA 4TWRA 3E3OA 2ST1A 3AH8A 1Q83A 1H93A 3OOYA 3V8NA 5BN4B 1JKMA 1H9BA 4BZXA 3NUZA 4LHXA 3QBTA 4GS5A 1FQKA 1Y81A 1IXKA 2HU7A 1H4SA 1N5RA 2ZTHA 3LUPA 4E51A 3LMKA 3GW8A 2AN3A 4RS3A 1R2QA 3LYUA 1GPMA 4KXQA 4ND6A 2C4TA 3RK1A 1VTKA 2VDMB 3HYSA 3QEMB 3HJHA 3EW9A 3RVPA 2YFYA 3MRVA 4Z9AA 3ANNA 5JMPA 3SBXA 3K0CA 5B2ZA 3W5AA 3UT6A 4CUKA 1B0ZA 1RZRA 2I4IA 4K86A 4YCCA 3AHCA 1FP2A 1V2HE 4ER7A 3PPIA 2PLFA 5FXMA 1FB5A 1CDZA 1YMVA 4HBZA 4BX0A 2VWQA 1OTYA 5DM60 3OHPA 1LPSA 1MENA 4OL9A 2FZEA 3TQTA 1ZL2A 3B7PA 1OE0A 4WACA 3JD0A 1UK9A 3WIUA 5CW2A 5TSDA 2WICA 2AFHE 1B93A 4QECA 1RJFA 1NE2A 221PA 4L07A 1ZC3A 4YMIA 3JD3A 5ALUA 1JV2B 3JZDA 5HMLA 5DB4A 5I4KA 4IHJB 1U63A 1ZESA 4DLYA 3SZLA 4B33A 5IM4A 2G25A 3L9WA 2W6OA 1IHUA 2WA2A 2QLTA 5BWLA 5F1KA 3SS9X 5F3RA 2V5AA 2H5LA 2YJGA 1ZNYA 2EL7A 2GFIA 4M83A 3UJBA 5E8RA 2Y93A 4DPKA 3OT4A 3WI7A 2FG5A 1EX1A 4HQ6A 4NY1A 3ADPA 4Y1RA 2AE1A 5C1DA 3FOEC 5KS2A 4U3JA 4DR6B 1I3CA 3LIPA 4ZO8A 3IBYA 1QXSA 1SCQA 4CEHA 3O1HB 5B7NA 2YYZA 3RKRA 2PY6A 2VKQA 4Z0NA 2G82A 5E6SA 3WLQA 5CX1A 4M53A 2WHPB 4FYVA 4LXIA 5KU7A 1YVUA 2VSQA 2HU2A 2ZLBA 4MICA 2OXRA 4F9GA 1A69A 4NFSA 4XKJA 3UAGA 1NNEA 1SCJA 1G2QA 1OXUA 1O96B 1KKLA 1I6KA 1Y6JA 4BFVA 3Q3VA 2O2YA 1DGQA 2CBZA 5IZCC 4BP3A 3DXYA 1TM4E 3HY6A 4CL8A 2J33A 4NZYA 4FDTA 1HY3A 3A4NA 5D6OA 2PE5A 1O4VA 3VR4H 5JE8A 4J3FA 1C9YA 3PITA 4HTFB 2ZAIA 1GM5A 4UHHA 1OBFO 1X70A 1JEJA 3BHJA 1ZJYA 3H05A 1YBHA 1YR1A 3EGCA 4O33A 5L7TA 2JGKA 1ZYUA 2EW8A 4MW7A 4XWWA 1K86A 3CX3A 2UXBB 1EFDN 3CKKA 1HSOA 3DBRB 1N9ZA 1MABA 4H7KA 2LXNA 5KWVA 1JQDA 1RE0A 3CGGA 4JZKA 1DWPA 1NXXA 3KYJB 5H81A 2IZ7A 4X62B 2XCQA 1AB6A 2Q3FA 4MWZA 2JHCA 2XA2A 1QAOA 1K9VF 3P2IA 4GMDA 3RRFA 4BO4A 1V71A 5LU8A 5A71A 1E66A 3C97A 4G5FA 2G28A 2ES4A 2DR2A 5KSPA 4AJLA 3OPVA 1L0BA 5LUAA 1O6GA 2O2ZA 5A3SA 3UATA 4JP1A 2P2NA 1ZCBA 3F49S 4LVNA 4QTTB 4PFSA 621PA 1PF7E 3YASA 4PAMA 4G0MA 5IBCA 3LOQA 5IAEA 3HDHA 3GAZA 1F8UA 4HB0A 3LT2A 1B16A 1YQ9A 3U9TA 4OHZA 2XZLA 4NOMA 1R88A 3ACBA 4Q37A 1ML4A 4PV7A 2Q0HA 4PANA 3BHNA 1ESEA 3FWPA 4DPMA 1P45A 1HTTA 3N05A 2BFFB 1ORDA 5CVCA 2WAXA 1AQJA 3D6FA 2RBGA 3HB5X 4RTJA 1TK3A 4EX6A 1T0PA 2Q62A 4UW9A 1GL7A 5H68A 2ZT6A 2OXCA 4EJSC 1G4HA 3KXDA 5CPFA 2JCBA 3ZIDA 4KRFA 2YBEA 3Q7RA 2DPMA 1Z0JA 2C2XA 4GQAA 4DPLA 3FNFA 5F78A 4R71A 4GNRA 1YKFA 3E2IA 1J24A 1REQA 2YIJA 5LZ7A 1AM4D 3WGZA 4F5DA 5JRJA 5KQMA 1Z22A 2AXEA 2DUJA 3MQ2A 3U7JA 4IXTA 5DULA 3G0BA 5CT6A 4ZU1X 4NU0A 1GFSA 4L8FA 4FE7A 4XGNA 2NMVA 3KE9A 4Y9SA 1VYUA 1DAGA 1RC1A 3CH7A 2NT3A 3KEFA 1BW9B 1QVVA 5MFZA 3TUZC 4OAOA 4IEEA 5DHPA 3ANYB 1QTIA 2GBLC 4JQCA 4YIHA 4LRWA 3TR0A 4ZEXA 1M2VA 1RRVA 5J4YA 2IBSA 1G7RA 4ADSG 2Y1CA 4RTKA 1Z63A 1IVNA 5AW5A 5CIYA 1WCXA 1C9KA 1Q21A 3NPMA 5SYMA 2AZXA 1VKHA 2RIRA 3C3DA 2BEKA 2HF7A 3DBLA 2HMSA 4ME6A 4LY9A 5AKLA 2PT7A 3ENKA 4NCIA 3P96A 1AX9A 2HNBA 1ATZA 5DW3A 4II2A 4IXNA 2WSLA 1PFGA 1H4VB 5FT9A 1BN7A 4UBLA 1M6HA 4O2BA 3AIOA 3ERCA 2QSYA 2AXQA 3QKTA 1SIBE 4F6RB 4K28A 4MIYA 4UHJA 1S4QA 4MINA 1OXSC 5EJ5A 2O3UA 3GFOA 3L1UA 3R6DA 2GO7A 2RGGA 5F51A 3PXBA 3NHLA 1UK8A 3NEYA 5EP3A 2RJ3A 4D9JA 2CL6X 5J2UF 3BQNB 1QZ3A 2PA0A 3RR2A 3UMCA 3PQ2A 4MQUA 2BJVA 3OTHA 3FF1A 3P2EA 1PGQA 4DLUA 2A30A 1UFVA 3PC4A 5J58A 1WSAA 3PTZA 2PV0A 3DZHA 2Z5VA 2FP3A 5B37A 1MOPA 1UJBA 4FMCB 3B3FA 1RZRD 3GDGA 5IVDA 3AFHA 2C97A 1ABFA 5L3QB 4DBZA 3ONDA 3D4IA 3U2QA 4G81A 3L02A 1I80A 1GPAA 2YWDA 2IPOA 4Q48A 4ZODA 5A6VA 5FBQB 2JCGA 3OQOA 1E7YA 1KI2A 4LDNA 4MW0A 3JXEA 3FNEA 1S3FA 1YBMA 4IFBA 4LWQA 5D7BA 1OPXA 3KSAC 3Q0EA 1GV0A 5BMVA 2WKPA 3ABOB 1U9YA 1W8DA 3AKZA 1LK7A 1P4GA 1JDBC 3CUUA 1TCUA 2F59A 2Q8PA 4MRMB 5AK5A 4DUPA 4A15A 1GA6A 2IFTA 2W2QA 4II7A 3TJZA 1U7ZA 3OQNA 2ECFA 2VNIA 2GLTA 3G2MA 1X1CA 1SURA 2QX7A 4X8OA 1P2BA 5AI8A 4LYDA 1B00A 1YBAA 4MKHA 1A2BA 1MIOB 1VE7A 5DBEX 5U4XA 1AO0A 1HDXA 2B7CA 1XKLA 3IERA 4WCDA 3ZWDA 4UMVA 3TFOA 2I4LA 2VJNA 2FCRA 5B3LA 1VHDA 3R2JA 2A1UA 1T6YA 3VHXB 1ZW6A 5IPFA 1JX6A 5JQGA 4MCIA 1YKSA 4G0UA 4YN3A 4YAOA 4IDEA 1L5SA 3FA2A 4CI9A 3A05A 4NNJA 2Q4TA 5IXSA 3PPVA 4Q7JB 2ZZNA 1WPRA 1KFJB 3PNKA 4I4IA 4LDPA 1SGWA 3G68A 4Q9JA 1RFGE 3BTOA 1ODLA 1GGMA 2IHZA 1R0ZA 1X7ZA 3AR7A 2QTVB 3TWOA 2QP9X 4CFYA 2NVBA 4RVSA 5CNIA 3QPVA 1GFZA 1UJ6A 3JWEA 3N0WA 3N2IA 3GROA 4G4IA 1G8SA 2AFRA 5DIZA 1JHMA 1XHLA 1KAQA 1PVVA 1Z15A 1SK9A 5FHRA 3H1GA 3X0DA 2DFNA 3SS7X 4EGFA 1APBA 1M83A 1FU7A 3HR8A 2I2XB 3VQTA 1T2FA 3PGMA 2IK8A 4OYYA 5I8ZA 3H2HA 3U3XA 3G3EA 3OE1A 1GGJA 1ONSA 2PX3A 4XDHA 4B46A 3ORYA 2RH5A 3IDZA 1E2EA 4PQEA 2BEJA 2P62A 1P4HA 1ZAKA 4BO2A 2WAAA 4U63A 5L6LB 1LPPA 1NT2A 3D8BA 2WIBA 3N8HA 4GOJA 3BXXA 1U8TA 2MR6A 2EYQA 1Y9DA 2NW6A 3UJDA 1JDZA 2E1RA 2UZ1B 4POOA 4C2UA 4XB1A 1W46A 2ZBEA 1WOMA 1PG5A 3KKMA 2VA9A 4Z8XA 5FFFA 4TSKA 4XVCA 2IUFA 4R9SA 1Q22A 2IX3A 3PX7A 1XEXA 4BAGA 4HQFA 4LC9A 2VQEB 2ZT8A 3VO9A 3D4OA 1E1KA 2NU8B 5C1OA 1PV2A 4CV0A 1N7IA 2RHLA 3HWX1 2JGNA 5GONF 4ZICA 5ESXA 5L3ZA 2P69A 2B1JA 2V55B 2JAHA 4X90A 2ZRHA 5JU6A 2GHQA 1MXFA 1Q1ZA 3QVOA 3IPLA 1FLAA 2HDHA 2CHVA 1XIVA 2V7WA 3SC2B 5L4LA 1XTJA 4G0OA 1R0BA 1BH2A 4NJEA 2PXCA 2F9FA 3KZOA 4C2BA 1UKEA 4BLUA 8LDHA 1UP7A 1XTTA 3RO7A 1FYWA 4QYWA 4AQYB 3NM6B 3ZCSA 3QQPA 3KLOA 1H42A 5DGCA 1B3RA 4GXTA 1T36A 1XBTA 2J5XA 2MT9A 2AN5A 2VJMA 3GJYA 3OTIA 2P7IA 5E8JA 4CE6A 2QTWB 3PICA 1Q6ZA 4UUMA 4M60A 3WZ2A 3HJCA 3CR7A 5BNIA 3FF4A 1KR5A 4NE9A 3AVUA 1M66A 1M6VB 2B5OA 3GEIA 3R6LA 5GTDA 5JRZA 2JFYA 3LQ1A 1RXCA 1H3EA 2RH8A 1VMEA 2I55A 2PZEA 3CLSD 4ZVLA 3W2TA 1RTTA 2J32A 1QP7A 3W6UA 3ET5A 4R1NA 4IQ8A 5LQAA 2YOFA 1VE9A 1EX7A 3TPFA 2CLCX 2F1RA 3ID6C 3OZGA 5BXYA 2OCGA 4I1OA 1PWHA 4L9AA 3UKDA 1Y3AA 4LZNA 1RHUA 1C3XA 5TQ0A 4ZRMA 4YRBA 2PQ6A 3NOVA 5DSXA 4QFCA 1QZTA 4R1SA 4CTOA 1NJ6A 4ZOLB 3TXXA 3D3JA 4HNVA 3COWA 2V6JA 4PBTA 5JJIA 1FFWA 5AVOA 1TQDA 2FPUA 1M0SA 4V0QA 1C29B 1WD7A 2C5AA 2FLVA 1Z6QA 3LHKA 4HL6A 4C4TA 3TL2A 3DFMA 4AMBA 3CLRD 2GRUA 2B78A 2OLJA 4NOJA 4ZDIA 5GZ3A 1DV2A 1SXPA 1ZH2A 2ECPA 2YW2A 4ZT6A 2ANCA 1IEVA 1NVXQ 1OZGA 3UAXA 4GWKA 4WL0A 1K6JA 2AQHA 3C1TA 3GLIE 5AM5A 1KS9A 3HBJA 3RC8A 1JHZA 3ZI4A 1N2SA 2P35A 1DMRA 3HRIA 3IA2A 4Y67A 3HJTA 2QBYB 2QPTA 1BCSB 3DOHA 2F2TA 4ZAXA 2QM3A 2RKWA 3TF5A 3I3SR 5BYKA 4LE1A 2ZRBA 3N58A 3DZCA 1T3HA 2HSEA 3ZH9B 1ES9A 2LRHA 1M8JA 1RM5A 2NSHA 1Z4KA 2QJOA 2WM8A 4JEHA 5HZMA 1PZNA 5DVZA 1UBMS 3KALA 3L3BA 3EGDB 3PUVA 2BUBA 4ZGGA 1LV7A 4YJ3B 1PD1A 2Y66A 3CRVA 2GD1O 2JDIA 5F4ZA 2ID9A 2PX8A 3C2QA 4IIJF 3JWHA 3TRHA 4EHNA 3QG1A 3T7EA 2XYGA 3K9GA 4N0EA 4TT8A 3ZE6A 5FTNA 5LVAA 3WDLA 2G08A 2JL1A 3E23A 4WY8A 4YV7A 4OA8A 1JT2A 1E1DA 1XRPA 1EQ2A 5TMDA 1YF3A 4FMDF 3AC0A 2JHPA 5JSYA 2O5RA 3BE4A 1YASA 4C6TA 1RLJA 4W7IA 2HSJA 3AWIA 3D3WB 4WCFA 5BN3A 1THTA 2E5FA 2PFKA 5K3CA 1D7AA 4BC1A 4DNPA 5JBQA 2QVBA 3BTUA 3G9ZA 4KWCA 3M5WA 3T7IA 1JHOA 4ZEOA 4BKRA 2J6CA 3KQTA 1PGNA 4FDUA 1ZI9A 3S55A 3I39X 1MC4A 2JI7A 3AUTA 1O89A 1NA5A 5DXJA 1Z4JA 3DTNA 3CCBA 3NMUF 4LHVA 4XJXA 1JHRA 1M1YE 1N2CB 4W5TA 2MJLA 1EVEA 5D84A 4EBBA 2BKVA 1ZUWA 2RHOA 2YYAA 3F6RA 2NAPA 1GTSA 1GZUA 2DWOA 3QITA 4OHVA 1PL0A 2NZVG 1ZMTA 1PQYA 3FLMA 4KYUA 4C0HA 2P6RA 1DFGA 4UTZA 2IUUA 1Y4UA 3O4RA 5HRUA 2HPVA 2J5KA 2R6CA 4I5FA 2OAP1 4O08A 4F5WA 4Q4JB 1J1IA 4FDAA 3VJLA 1SB8A 3DDSA 2CFOA 3DEKA 1KK3A 3UGKA 2P9YA 1ISRA 2FHSA 4EKEA 3E5HA 3GEGA 3N2LA 4AO7A 4POAA 4ISBA 1NJFA 1K08A 3EHEA 3O8BA 4FEGA 2MYTA 3REFA 5JNVA 2VDQB 3QPCA 3VU3A 3T3EA 4D3XA 1ZHHA 1KJWA 4MRAA 2QRZA 5FI0B 1UT6A 3QNMA 2FUG1 2VJDA 1AH2A 2PRYA 1UIRA 2ENWA 4M88A 4WW0A 2J9RA 1JB9A 3NNDA 3NRBA 1SCIA 1YBVA 3LCVB 5J2TF 1J0DA 1WF6A 2FUCA 4MARA 1YHYA 4BNZA 4KIUA 2QB5A 1FFGA 1DBWA 2NU6B 2VZEA 1SPXA 3DCNA 2FW8A 4II3A 1JEYB 4RPCA 5HIIA 3QP9A 1AKNA 1RBYA 3K0HA 3IMFA 2ZKIA 1BRTA 3VO1A 3LRPA 1TZCA 5KQRA 2AI2A 3M2PA 1YL7A 2YVQA 1V39A 3OI7A 1T1RA 4ARAA 1ZA1A 3ORQA 4ZHQF 3GFQA 3UQYS 1PJAA 3UAZA 3MHTA 4MYDA 5FTJA 2PGIA 5D5QA 1UKVY 2OHOA 2Q5IA 3AY6A 3EFHA 2B98A 3GJ4A 4MYRA 1SCAA 3UGJA 2VYVD 3T9EA 1YQGA 1SKBA 3EZ2A 3H9EO 2CD7A 4BE7B 1RAIA 2G9UA 1HETA 1C3LA 2CVHA 2M32A 1E2NA 4NZMA 3P94A 1ETUA 2OHVA 1KMHA 1VG0B 4E30A 3NTLA 1DQSA 1N75A 3EWAA 2FSSA 1JKJA 4IJVA 3S99A 3NHFA 4PHGA 3V7YA 3WKAA 2I9KA 3W9BA 4QJIA 5K05A 3INTA 1U04A 3M3PA 4W8GA 4NK4A 4CG0A 2NZXA 5K0BA 4DR1B 1DMSA 1UZMA 3JU3A 1VGRA 4GI2A 4MPRA 1P2UA 3W1WA 2J1LA 1FMLA 1Y7HA 4JSRA 3S29A 2ZUEA 4LX8A 4E14A 1XMSA 4KQ2A 2HA7A 3I1IA 1NKTA 2GJ4A 4NP6A 3TOCA 5BR4A 3O90A 1N6IA 2FPPA 3U6BA 1II9A 2H1VA 2B4KA 3JQPA 3E9QA 5FPSA 5I9TA 3K09C 1T5BA 4I4TA 4CQMA 1OI4A 4RTOA 2XVZA 1JHYA 2ONYA 2Q29A 4NZOA 2OMKA 2ZVPX 3GJ6A 3PNQA 1J0XO 1U8CB 4TL7A 1R18A 4BLPA 4GP6A 3K0BA 4B5KA 4EG5A 1QF7A 2BYTA 3O8CA 2XUKA 3IAM1 1OI2A 1D6MA 4OLHA 1T43A 4NV3A 3KQOA 4XQCA 3ZBTA 1X7XB 3QE4A 4RANA 1TX4B 3LBYA 5CU7A 4CIDA 3C4QA 5FI3A 3JW8A 1QC5A 5FCDA 4JC4A 3N8DA 3UHAA 1LY1A 2BMFA 3ZVMA 2YWCA 3IVRA 5JD3A 1GR0A 4MUJA 3CE6A 5H3LA 5AVQA 5B1IA 1GTRA 3AEZA 2GM3A 7AT1A 1Q1NA 1GQOA 1Y5NA 2X42A 3QVGB 4MOWA 5EXDA 4ABTA 4XE5A 5FI5A 2UUBB 5AK0A 2VXBA 3CVXA 1KXZA 5ITWA 3D81A 5F5LA 3QKRA 5I01A 2GRAA 3GP5A 3QX8A 4WLOA 5EINA 4YRPA 5FH9A 2NQ2C 2QRNA 3EPKA 1V7PC 3HY4A 3OKAA 1TAQA 3SQLA 2FGJA 1T1SA 5K1ZA 2GVZC 2WAMA 2WTXA 2Q2OA 3VR2A 3CUVA 2I4OA 1XJQA 1KQNA 3ZGLA 4DFDA 2HA4A 2BHRA 4UEOA 4YHBA 4Z4HA 2HRQA 1R37A 2OHHA 2ZUBA 4IF6A 4INJA 1ZW1A 3OZEA 3L43A 4FGWA 1Q17A 1YACA 1D5CA 2XLCA 3RI3A 3RVMA 1JYEA 4BPBA 3A32A 3DLBA 2OLKA 1JMVA 3PT5A 4P7FA 1SWVA 1B2LA 1LJLA 2P27A 3KYDA 1O57A 4ZWNA 3L7LA 1MMFB 1E62A 1ZRNA 3ANXA 2BRUA 2CYCA 1Z06A 3CJTA 2JDID 4RV9A 2VHTA 1DKLA 5DT2A 4R9VA 4YLEA 1P1FA 2ISCA 3HRKA 1OLUB 2CDNA 2NXCA 3K4QA 4PW0A 3MXTA 4BX9A 4XFDA 3BL8A 4EI9A 4UU0A 5I45A 1G6HA 1WUHS 2EX0A 3NIGB 4HDAA 1NULA 1A4RA 4HLUA 1V4BA 2C9OA 2ISSD 3P9QA 4EA8A 4ALKA 2VHQA 3HDVA 1TW2A 2P1DA 3ONNA 5FRDA 2PUAA 4RV5A 2FFHA 4Y6QA 1T10A 1K3TA 2PD4A 4ESEA 4RE5A 1MVLA 3A2MA 4WERA 1KK2A 3OJEA 4JNCA 4M0FA 4E11A 5F3DA 1VZ2A 2CCKA 4JBNA 1XVVA 5THQA 5C1BA 2OCKA 3MSCA 5H70A 3T7KA 2QE6A 3F96A 4MEAA 4LGMA 1MW8X 1NYTA 5BY2A 4MA4A 1SUWA 4WKBA 4TWBA 4MV9A 2H16A 1M2OB 2O1EA 4NMLA 4X8HA 3THOA 3MTIA 3LC0A 3FHTA 4YJFA 3GT0A 3WC4A 4PN3A 4KV7A 4EUKA 2XIJA 4WXMA 1ZRSA 3QKSA 1Z7EA 1PL6A 2DP4E 3IS3A 2RHHA 4I81A 2P67A 2C2MA 3C1AA 1IPEA 4UREA 5KWEA 5JPIA 2WUVA 2VWPA 3C6QA 3OQVA 1GRCA 1UJMA 4X44A 3C5EA 3SXPA 1LD3A 3W5BA 2RFLA 2H85A 1BRMA 3I2GA 3GGJA 1QJ4A 4HO1X 2NP6A 1VKRA 2YWJA 5JAIA 4ZVTA 3SBDA 3VGJA 1U3UA 1ZOIA 1ST2A 3CX6A 1VLJA 4O4HF 2O1WA 1OWNA 4JELA 2FKAA 1GAJA 1L3IA 3I6ZA 4NABA 4Q4HB 4PIVA 5JH7F 5CDFE 2GJSA 2IXBA 1BROA 4IY1A 5FTMA 5HF9A 1YVPA 1G8JA 5CYGA 8AT1A 1UEJA 1PR3A 1USUA 5C8DA 1QP0A 1QIDA 1E1RA 1M5UA 4GPD1 4L74A 4LZPA 4LKOA 4YRTA 4Z0HO 1OR8A 1JI0A 2ZI7A 3HBLA 2IOHA 2O0JA 3QVTA