3ZN2A

Protein engineering of halohydrin dehalogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
253
structure length
253
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single Point Mutation Enhances Hydroxynitrile Synthesis by Halohydrin Dehalogenase.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
molecule keywords HALOHYDRIN DEHALOGENASE
total genus 93
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zn2A00
3G17A 3WGOA 4EUFA 2G0TA 1YBMA 1NQAO 2V6FA 4XQCA 3WLFA 1ZNQO 3AI2A 4BS9A 4KDEA 3LC2O 3TZKA 4NG5A 1GUYA 5AXAA 4R41A 4E13A 4JXKA 4DMMA 3MJCA 4CR6A 3CE6A 3TWOA 3I23A 4RLSA 1GYQA 1JWAB 3PJFA 3LLSA 4BNZA 1S6YA 4BNMA 4IJKA 3ZW9A 1PWZA 3NT2A 3HADA 1Q2XA 1C0IA 1QKIA 4H7PA 1HLPA 3UAGA 1C1XB 4CR7A 1OZAA 4I08A 4PLVA 3F5QA 3G79A 3DOOA 2V7PA 4BMSA 1ENOA 1P0FA 3WGQA 1YVEI 2VYND 3VZQA 5EJ2A 1XR3A 3UCFA 2Q4EA 4PG8A 4NBWA 3IAHA 3RCBA 2EWMA 1X7GA 2GSDA 1E1MA 4I5DA 1HETA 2CF6A 5JMPA 3H65A 2R2GA 2OO5A 5GZ3A 3ON5A 1MG5A 4UUPA 2HQ1A 1GPJA 3INRA 4B4OA 1F14A 4BNFA 5DULA 3SEFA 3PGXA 3LT2A 4FPXA 5JAQA 1PQPA 2VHVA 4W9NA 4EJMA 3PFFA 3F4BA 1L1FA 2X4GA 4PLCA 4Q3CA 3RKRA 4FC6A 3ANMA 4DUPA 2WD7B 4D0RA 3GZNB 5GZ1A 5G0UA 3TOXA 5DBFA 4PVCA 3VC7A 2GDZA 5JC8A 3B1FA 4UEOA 2IXBA 5JFOA 4Q39A 1UXJA 3Q0EA 4GLOA 4DQUA 4WE3A 5C3MA 2A4KA 1AUPA 3MEQA 3I9KA 3GVHA 3GAFA 3O9ZA 4AL4A 3H9JA 3V8BA 1NFFA 3PWKA 5TQVA 4HFRA 2DBQA 1CERA 1HKUA 3GN2A 1Z74A 3AU8A 1NR1A 2PNFA 1LDMA 4ZRMA 1I0ZA 3W8DA 3H9GA 3DBLA 4TKMA 2C5AA 4FBGA 4D46A 5LDHA 3WTBA 4XQEA 5G4LA 3HUDA 5IZCC 5HM8A 1GCUA 2EEZA 3IKVA 1Q0QA 1A7AA 2ZTMA 4XQ9A 1U2DA 4QECA 4CV2A 4TZTA 4DQVA 4JCOA 5ILOA 4XDZA 1EMDA 3H5RA 2X5JO 3VPFA 3G1TA 3S2GA 3D7LA 4Q3NA 4IBOA 3SLKA 5LCXA 4FS3A 2H6EA 5IN4A 4DYVA 1ZK3A 1FDVA 2FPPA 3KYBA 4L8VA 1RPNA 4OH1A 3KUXA 1XWFA 4JJGA 4HX5A 1QYDA 2G5CA 4H16A 1UZLA 3D5QA 2GGSA 2JL1A 3D4NA 5FI5A 4BV8A 1VE9A 1BG6A 1EUCA 1F17A 4GWGA 3RVDA 3RUFA 2VRCD 4BMVA 2NTNA 5KOIA 3VZRA 2C7VA 4DIOA 1NR7A 4E2ZA 5TRTA 4ILKA 3EVNA 4JBHA 4F46A 3WGTA 2EERA 4JN6B 3E48A 3DONA 5HTOA 3AY7A 1PIWA 1DRVA 2Y1DA 5A9RA 4KDFA 4IINA 3ZU3A 4RPGA 3FHLA 4ROSA 1FMCA 3KSZO 4CM4A 4ZQEA 5EQDA 2RHCA 3C7DB 1WMAA 1P45A 4N18A 1Y7TA 3U3XA 3H6KA 5A06A 1X0VA 1EVYA 1E5LA 2DTDA 3MWEB 5TSDA 4RV9A 1Y1PA 4MIEA 2O3TA 4R1NA 2DVMA 3PYLA 4JROA 5JAIA 1GQYA 2NUAA 2E37A 3P19A 3AY3A 4ZU3A 3UGKA 5JW6A 4CV1A 3QWIA 4J9UE 1NQ5A 4WGGA 3KYDA 1YDEA 4Z9XA 4BNVA 1CEQA 3VDQA 1E6EA 4JNKA 1LQTA 1MC4A 3Q11A 2ZATA 4DA9A 1E3WB 1R0LA 4BB5A 3VH3A 1MC5A 2VYNA 4BNKA 4J6FA 4BNJA 2P68A 4XRGA 2JFFA 3LZ6A 3PJEA 1M6WA 2W8ZA 1KEPA 4UREA 1E5QA 4U0KA 3PK0A 4J7CA 4LN1A 1C1DA 1WXDA 1LRJA 4DC1A 4NU5A 3EW7A 4Y6RA 5DP2A 1E3LA 5I8WA 3QP9A 4CQLA 3W4JA 5JO0A 3ZZNA 1KEUA 1KY5A 4OAQA 3DAFA 4GX5A 2AE1A 3DHNA 1PJ3A 4BNTA 1AN9A 3QVWA 2FPGA 3WTCA 2Z95A 1QP8A 4BNGA 2J8ZA 3QVTA 4WECA 3E5RA 2HAEA 4MP8A 5GMOA 1PU2A 1H5QA 3VTZA 5A1TA 4OSPA 8LDHA 4GKVA 2EXXA 1RYEA 4RZIA 2E49A 7ADHA 1ZSVA 4XYGA 1PGPA 4OOFA 4RPJA 5CHEA 1U4OA 4BO1A 3R3JA 1KVSA 1X7DA 1ISMA 3AW9A 3U62A 4ALNA 1A71A 5T8KA 3F9IA 3N7UA 2P4QA 3ONFA 3FTPA 4ZA2A 3JQFA 4W7IA 1LC0A 1Y8QA 2X0RA 1JU9A 3M1LA 4R3WA 3SJUA 4J49A 1V3VA 3RFTA 2WEKA 3FSRA 2DPGA 3A4VA 4DMLA 4ND5A 3DFUA 4NPCA 2NVUA 1NX6A 1U28A 1HXHA 4IPTA 1YDWA 3WYBA 2YV3A 3DOCA 3S2FA 3VH2A 3A06A 4FFMA 4GX0A 4LCJA 4FJ2A 2BFMA 4QFDA 4C7KA 2HDHA 4XGNA 2FZWA 4FFPA 1CQIA 3I83A 4U0JA 2ZB3A 2JHFA 5JLAA 3WBBA 1GPDG 2A92A 4CV3A 5DOVA 3QVSA 2BI7A 3BTVA 3QIVA 4J3FA 4M55A 3GAZA 5F1OA 4DWVA 2ZQZA 4I9UA 4L76A 1FDUA 1ZZEA 3KXDA 3KSUA 1K3TA 1U8XX 4FDAA 3VZPA 1T4DA 5A05A 4E5PA 4QUKA 5K6AC 5TJHA 4IIVA 2PZLA 3S55A 2Q2WA 3JQ7B 5TIIA 2P4HX 4AVYA 1XQ6A 4FR5A 5I9MA 2FZEA 2X23A 3QSGA 1ID1A 4K9DA 2OZPA 3FN4A 4S1VA 4CM1A 2VNSA 1HYHA 1UP4A 5KKAA 3FCOA 3U4HA 4YYZA 3VPSA 1KVRA 1RM3A 4CQMD 3Q6IA 3I9LA 4FJ0A 4TQGA 4XQGA 1T2CA 3KEQA 5CPFA 4E33A 4L4SA 1YH3A 5EINA 5L9AA 5FI3A 2D4AA 1BSVA 3U09A 1HE4A 2D1YA 4UUMA 1RWBA 4RORA 2XXJA 1PJSA 1GU7A 1OOEA 1VSVA 3QVOA 4QO8A 1GY8A 4K6CA 3NDIA 3RIHA 4FB5A 5K9ZA 1D1SA 5JYDA 5ICSA 1G0NA 3PHGA 4IUYA 3W6ZA 4CMGA 1MB4A 2OORA 3V2UA 4B3HA 3GG2A 3IIEA 3VVCA 1E3JA 4GMFA 4UEJA 3N58A 5JDIA 4W7HA 2BELA 3AOEC 5JDCA 1EVJA 4YJHA 1QG6A 4Y98A 4HY3A 5IJZA 2Y67A 1GTMA 3JQ8A 3T4EA 2EKQA 4ALLA 3C24A 3M2TA 4YPOA 1XLTA 1PGNA 1A5ZA 2AMFA 3PQFA 2X5KO 2YDXA 2GZ2A 3V2HA 1BXGA 3P7MA 2VT2A 1U3TA 3HDJA 2O7SA 3KV3O 4BKQA 2IZZA 2HK7A 3GMDA 4HUJA 3ZWCA 5JMWA 1YL7A 3ZV3A 1Y5MA 3ZWWA 4E2YA 3QJ5A 2JD1A 4FGSA 3C1AA 4DREA 1D7OA 2RAFA 1PJBA 3AM3A 4Q3BA 4YEDA 3W8EA 4DLAA 1K2WA 1R4MA 2YV1A 1PGOA 5K6AA 2Q49A 2FN7A 1YQGA 3TDKA 3INGA 3BMCA 1X14A 1C1XA 2X1HA 3RC1A 3U9LA 1F06A 4NI5A 2EV9A 4M8SA 4OGWA 3BTOA 4ID9A 1B2LA 4RPKA 2Q50A 2CF5A 4J16A 4RLHA 3P5SA 2VUUA 1ZFNA 2CFCA 3WS7A 1O5IA 2O50A 1SBYA 3RASA 4MVJI 1XQ1A 4W82A 5C7IO 1OBFO 2UDPA 2QRKA 4J7UA 1PZFA 1O94A 1V8BA 3DBHB 4YA6A 1ZK4A 3UOGA 2H5LA 3RAJA 4KUEA 4FIZA 2YY7A 1PS8A 3O26A 3UFXA 1A7KA 3S8MA 4LRTB 2OMEA 3W4IA 3ZU4A 4D44A 5L4LA 1U4SA 2J5KA 2I65A 1R4NB 1U3WA 1VJTA 2Q1SA 4XIYA 4CMBA 2JD0A 5B4TA 2HRZA 2QRJA 4JP2A 4OYRA 2O3JA 1AE1A 3D5TA 4YT2A 3BMQA 1WMBA 2NADA 4XB2A 3R0IA 5JDCC 1V9LA 3SX2A 1ML3A 3AUTA 3DBRA 1F12A 2GRAA 3GK3A 1ZXLA 1NWHA 5L7WA 3TZQA 3ADOA 2ZB4A 2XPCA 4UAGA 4LK3A 5IF3A 1E7MA 4HNGA 1GZ4A 1CIVA 1P44A 1B15A 4ZQGA 4BNNA 1NQOA 2QYTA 4YVFA 2D5AA 1DFHA 3BMNB 2VCYA 3ZWXA 1I8TA 2R00C 3TL3A 1DHRA 1UP6A 3BIOA 3UW3A 1VI2A 2Z1NA 4DRYA 4GGPA 1K6XA 1E3WA 3ZWBA 2O23A 1I36A 4E5MA 2NU9A 3DR3A 4HFJA 5T64A 4GI2A 4DIBA 4YJHB 4BV9A 2OP0A 4FFNA 1PZGA 2HLPA 4U8GA 2AQHA 1E3EA 2DKNA 3Q2IA 4XA8A 1EE9A 3JQ8B 2C2XA 3DAGA 2HU2A 4TRRA 4PFJA 1YBAA 3T7EA 1G6KA 2B35A 3VHRA 1K6JA 1IYZA 1YBVA 3MCVA 4WLOA 4MJLA 1WLYA 4NDNE 5IXYA 1H2HA 1DLIA 5ER9A 4KQXA 1GV1A 4CQLB 4OQYA 1I10A 2X0NA 2I3GA 4R1TA 1PL8A 4AJHA 1RM4A 1XKQA 4BKRA 3IP1A 3HFGA 1OAAA 2HJSA 3JD2A 4Z0TA 1YONA 4FC7A 4KZPA 4MVJP 4HKTA 4AICA 1B8PA 4CLOB 5L4SA 1C1DB 4RF5A 3WJ7A 3OECA 3PFWO 1UXGA 1U1IA 3LDHA 4YT5A 4RVUA 4YACA 3GUYA 3LVFO 5CEJA 1P1HA 2GZ3A 1U3VA 2Y0EA 4DQXA 3TJRA 1Y6JA 3FNGA 1EK6A 3GLQA 4I5EA 2YHIA 1HDOA 1MP0A 6ADHA 2YZ7A 1E3IA 1JA9A 4M49A 5G4KB 4CUZA 1P1IA 1LTHR 2EW8A 2HMTA 1JLLA 5DBIA 3FI9A 1KVUA 1H0KA 3OJ0A 4IDBA 1GUFA 4Z0PA 4QX6A 4E2XA 4YT4A 2YUTA 1VKOA 1U9JA 1TT5B 3LYLA 1IPFA 4JJFA 4LSMA 4CMIA 1I24A 1V6AA 3ZV6A 1LSSA 1YO6A 5DCWA 4CV0A 3PGJA 1YOVB 2V6MA 1NHGA 1W4ZA 1T1RA 5JO9A 1VJ1A 3FWZA 3K31A 3OETA 1Q7GA 3D3WB 5F5LA 2J3KA 3HN7A 8ADHA 1BXKA 2A35A 3CUKA 5G0WA 2HMUA 2B36A 4Y67A 4CMEA 4AJEA 3DZJA 5CAEA 3MJ4A 1Z82A 3GNTA 4N5LA 3A1NA 1I2ZA 4XGIA 4OOEA 4XGKA 2X0JA 4FD3A 4OJNA 4P4NA 3SC4A 2CDAA 4YQYA 1LDYA 4DYDA 1HDZA 5IDWA 5JNLA 1AHIA 3TPCA 2OBYA 4EW6A 3F1LA 1DAOA 1EBUA 4CMKA 4F3YA 1R66A 4U6QA 2WD8A 1DSSG 4RO0A 3BMOB 3GHYA 1JVBA 4P4GA 5I7EA 4FW8A 1BMDA 1FJHA 4NQZA 1KOLA 3GVPA 3QHAA 1HDYA 3L9XA 2UV8A 4PLWA 1KC3A 4A5OA 2GLXA 2DTXA 3NTOA 2VZ0A 3BYZA 3KZVA 3NAQA 3OA2A 1XA0A 4TRJA 4CLDA 1X1EA 2P9CA 5I7VA 1HYGA 4IY1A 1DDOA 2QQ5A 4RF3A 2HCTA 5JCXA 1DOHA 4CODB 4PZEA 3H2SA 1HDRA 3FNEA 2FR1A 3PXXA 4Z3DA 1JKJA 1Y9EA 2JD2A 3HFSA 3NX4A 3NKLA 4MVJA 3AFNA 2ZK7A 1QV6A 3ZNQA 3E8XA 4TRNA 1ZK2A 3E03A 5B4VA 1SB8A 2HUNA 3Q9UA 4KOAA 3CMMA 4BL5A 1EVZA 2DPHA 4PVDA 3OQBA 1O8CA 3PIIA 3MJEA 4B3JA 3AU9A 2P9GA 3EDMA 5A02A 4RF4A 2QX7A 1KY4A 1QMGA 1ZKMA 3H7AA 4PLYA 2GN9A 3OIGA 1LSOA 4MOWA 1LUAA 3BHMA 4N5MA 5T6BA 1ZW1A 1DBVO 3W1VA 4CLRA 4WKGA 3IJRA 1DJNA 1WDLA 4UVIA 1O0SA 3ITDA 5IDQA 4GSLA 4PGFA 1ISGA 1UUFA 1R0KA 3DBRB 1Z7EA 2J3JA 1N7GA 4E5KA 3H2ZA 4PZCA 3LLVA 1C3VA 2FMUA 2JCYA 1LQUA 3OEYA 4NU6A 4OXKA 1E3SA 4IS2A 4FCCA 4YJDA 2CDCA 4FJ1A 1GDHA 4NFYA 1XELA 5K0ZA 3CH6A 4NHEA 1PJCA 3ULKA 2VUTA 4TVBA 1N5DA 4OHUA 1BXZA 3JQGA 3OJOA 5TLSA 1TXGA 3AK4A 2A9FA 1RM5A 2CZCA 2FPIA 4JJIA 4Z0HO 3GMSA 3R6DA 1GEEA 2X9GA 1NPDA 4DLLA 4BO9A 2NWQA 2P91A 4M89A 2ZB7A 4ZVVA 3OICA 1PSDA 4YTEA 2Y99A 2PZJA 4J90A 2AQ8A 2NNLD 4JQCA 4RVSA 3HZZA 4IQ0A 5JCJA 5TX7A 1DIHA 4GPD1 2B0JA 5F1KA 4X54A 4PG7A 4YR9A 3T7CA 1V3UA 3KTDA 2IXAA 2AEFA 1LDEA 4LRSB 2UUOA 1BHSA 1XGKA 3AY6A 3DBVO 1GUZA 2AE2A 2QZ9A 3N74A 3RU9A 2GUGA 2ZIZA 3AOGA 4BO5A 4E6PA 4IDFA 4RF2A 5HWSA 1PGQA 1PGJA 1VL8A 1GQQA 3MJTA 2C0CA 1K6IA 4LW8A 2DUWA 5TC4A 1TB4A 4BB6A 3NEPX 1QORA 4L9RA 4F45A 2HJRA 3DMYA 5CDTA 2PTGA 1UDCA 4BO6A 3CTMA 1H2BA 3WGGA 3D64A 1LEHA 4A03A 3PHLA 3VOSA 1HDCA 4AJIA 1JAXA 4A7PA 1UDAA 3PZRA 1UXHA 4ITUA 4BNIA 2FSVA 3S2IA 3I5MA 4E5YA 4YT8A 2B5WA 1PZHA 2DM6A 3QWHA 3TZHA 2PY6A 1P74A 3UCXA 3ROQA 2EW2A 2Y66A 3DBLB 3PLNA 1MV8A 3I4FA 1T2EA 1Z7BA 1X13A 4MKXA 4PRKA 1QLHA 3WYEA 2NVWA 4NFHA 5B1YA 1CQJA 4B4WA 5IDYA 2PK3A 3PWZA 4WLNA 4BQRA 2DT5A 3ZNNA 4L74A 1DB3A 2GPTA 2NTJA 2VZ9A 1WNTA 4TSKA 1N7HA 2O48X 4DBZA 2WMDA 2C29D 5TT1A 1X7HA 3HJAA 2E48A 3DMTC 5A3JA 3JYPA 3VPGA 4MVJD 4ZGWA 1IOLA 4R1SA 2G82A 4MP6A 4W6ZA 4UVHA 2HMVA 2G1UA 1T2AA 4PG5A 1OI7A 3DC2A 3OHSX 3GR6A 3ZHBA 4PZDA 2C20A 2NACA 1YS4A 3PDJA 2RHRA 1N2SA 1MA0A 2FY8A 1T25A 5L3ZA 1QLJA 5KJFA 1QRRA 3GEGA 3HB5X 3GVIA 4P38A 3UF0A 3JQ9A 3F4LA 1D8AA 2C07A 1LRLA 4CLXA 1T26A 2D3TA 3JV7A 3FTNA 3PYXA 4E0BA 5L51A 1XIVA 3GEDA 2IZ0A 3L4BA 2Y93A 3C8MA 4YRAA 2DBRA 1B14A 1NFQA 2ZYDA 1CWUA 1M75A 1MXHA 2PZMA 1IE3A 2PA3A 3VTFA 2Y1EA 3ZHZA 5TJ9A 2JHGA 1HE5A 1ZJZA 2EGHA 5CPBA 4BHTA 3AJRA 4E2WA 2C7GA 5KWEA 1O6ZA 2NU7A 2YHUA 4HADA 1YB1A 5A3VA 1E7RA 3LC1O 1WDKA 4ALMA 2B4TO 1PS9A 1RJWA 3HE3A 4L75A 1YB4A 5ER6A 1PJ4A 3WWZA 1N1GA 2I99A 1UR5A 1ENPA 4U5QA 4DLBA 1KS9A 3IUSA 5KVCA 4GLLA 3DHYA 5ES3A 3IP3A 5CFZA 1V35A 3U49A 4IDAA 1ZIDA 4GKBA 4AJ2A 4E31A 5DT9A 4PLTA 3RUHA 3FNHA 1ONOA 5A9TA 1JAYA 1DHTA 1E6UA 5IAAA 1VC2A 5EL0A 4F6CA 3NTQA 2W2LA 3KETA 3RUDA 1CF2O 1MXFA 2PKQP 1H6CA 4LISA 2V65A 4NBRA 4PLFA 4Z6KA 3JQ7A 4IM7A 4M87A 5THKA 3L0DA 3T4XA 2CD9A 3GNSA 1FDSA 3FF4A 3VZSA 5KCZA 1AXGA 3BMNA 3W6UA 1H94A 4BKOA 1M66A 4YRBA 4D42A 3H9UA 1DJQA 4LVCA 3X2EA 5GY7A 2AEJA 4OMUA 5FF9A 5CP8A 3GY0A 1DLJA 3PIDA 4RL6A 2EKPA 1CYDA 4BGIA 3KBOA 2ZB8A 4ZICA 2D59A 2I66A 2XAAA 5L53A 2EG9A 4WLFA 3O8QA 4NJOA 4I8XA 4CL3A 1T2DA 5BNIA 2B4RO 3DQPA 4A2CA 4EUEA 3DZGA 2R6JA 4CM9D 4WNIA 2X5OA 1BVRA 3JSAA 5KKCA 1GFSA 2OOSA 1QYVA 3C1OA 4RVFA 4W4TA 2AEMA 5FFFA 4BNUA 4A0SA 2CDBA 4J2HA 4R16A 4RVDA 2H1SA 4LMRA 3PHIA 5U4QA 5C7OO 1ZMTA 1E6WA 3DXFA 1YB5A 2AQIA 3DTTA 3GDFA 4YQZA 1M76A 3LT0A 4JGBA 3FR7A 2Z1MA 3F6YA 2NVUB 1S7CA 2DQ4A 2EGGA 1E7SA 3WWYA 3ZWNA 3FBTA 4HP8A 4B4VA 1B3BA 3ZHXA 4P22A 3ONEA 5G4KA 3V2GA 3ST7A 4B4UA 1LNQA 1VKNA 2DC1A 1VRWA 2YFQA 2HK8A 4B7CA 1Y5RA 3TRIA 3FPCA 1BDMA 4NJMA 5JPIA 1EZ4A 1Q7CA 1TT5A 1ZO8A 2IEDA 4IDCA 1R4NA 4C4OA 2NU6A 1D4FA 1BRMA 1DIRA 3HDHA 3L6EA 2DAPA 3FNFA 1UZNA 1XEAA 3ZW8A 3E82A 1VL0A 5EN4A 1HLDA 4DBVO 1JQBA 4ND4A 3CINA 1E7YA 1JDJA 4H15A 4INAA 3RSHA 1SNYA 4XR9A 4LGVA 4JLWA 4WLVA 2J3HA 4TKLA 1U8FO 2C5EA 4BKPA 3ICCA 4DC0A 3MOGA 1AGNA 4Q9NA 2GN4A 4CR8A 2PH5A 1QYCA 2E4AA 3F46A 1O95A 1MUUA 2OFPA 3JQBC 3AI1A 2X58A 1Z6ZA 4UVDA 2TMGA 2O3RA 4ALKA 3TFQA 1M6HA 5IN5A 5IZCA 4E32A 4MIYA 1ZMOA 4IMRA 4DXHA 1Z75A 4Y6SA 3PRJA 2I3AA 3WMXA 4I5FA 3P2YA 4U7WA 3H5AA 4UEKA 4PRLA 3QVXA 5IZ4A 5A03A 2BGKA 2X9NA 1W8DA 4FFOA 3NT4A 4DPKA 1DC5A 2YQ4A 3JYLA 3K2BA 3UXYA 3QWAA 5BQFA 3AFMA 3GT0A 3CSDA 3JYQA 1PTJA 3TNLA 4CM4B 3IC5A 1KYQA 1NNUA 1KEVA 4IJVA 2YQ5A 1ADFA 3DHEA 2PFGA 4YCAA 2VUSA 1GZ3A 1C14A 2Y1OA 3ORFA 5EESA 5COQA 3NYWA 4GWKA 4J1QA 5U1PA 1QV7A 4MDHA 1GR0A 5DCYA 5I7FA 2PD4A 2UYYA 1I32A 2WDZA 3RC2A 2ET6A 4H3VA 4J0EA 1I3KA 4P4LA 4GX2A 5F3RA 4E21A 2NVBA 1IL0A 3EZYA 3EK2A 2Q46A 3PJGA 4L0QA 1VPDA 1JN0A 4Y6PA 2NTVA 4BGUA 3PJDA 1G0OA 1O9BA 1H6BA 1LBEA 4PLGA 3CXRA 1YQXA 4XDYA 1Q0HA 2YHIB 4EEZA 4NZ9A 1L7EA 1GEGA 3VPHA 5B12A 1LRKA 1OC4A 4QQRA 5IFLA 2Q1UA 4I1IA 3UN1A 2ZYAA 1KBZA 4BOYA 4KQWA 2F00A 1ADBA 1KVTA 1EFKA 1HE2A 3KM0A 3NUGA 5U9CA 3ZNPA 2I9PA 1VJ0A 4XYMA 3PWSA 3ZWVA 5JYEA 4CMHA 5I9NA 2PH3A 5DZSA 1ZUD1 4PG6A 2Q1WA 1PR9A 1P33A 1K5HA 3S2EA 3DMTA 4R9RA 1N8KA 4WK6A 1YOVA 5AQ1A 4FN4A 2VYVA 2DBVO 2EF1A 5EQFA 2O3SA 4JBIA 5EPOA 3V1TC 2EKLA 3WJAA 1LLCA 3WYCA 3C85A 4XYLA 4GL4A 5LDGA 3RUAA 3LSYA 3KVOA 3EC7A 3DBHA 2Y1CA 4URFA 3LF1A 4NBUA 4CUJA 2ZKLA 3MJVA 4WASA 2BGMA 1U7HA 1R4MB 1D1TA 1NPYA 3OP4A 5T8KC 4FQ8A 3TL2A 2GERA 4XR4A 5TF4A 4E3ZA 4WUVA 2IYPA 5B4UA 1ZH8A 3DEYX 3GGGA 4ND3A 2WE8A 5L45A 1BW9A 1YGYA 1NP3A 4YXFA 1SAYA 3WSWA 1H93A 1YXMA 3I4CA 4RZHA 2D2IA 1SO8A 1E7QA 4S3MA 1QYXA 1UZMA 2PKRA 3GFBA 1NFRA 3NGXA 4NBVA 1MFPA 4WCFA 2PLAA 4NK4A 3D0OA 4PLHA 4ZQBA 1SOWA 4BO2A 3ITKA 3D4PA 4P8RA 4CPDA 2WTBA 1NPTO 2Y1FA 4O59O 2J6IA 3ZWPA 1V0JA 1LJ8A 4J91A 4AJLA 2OGUA 1QXSA 2C54A 4TVOA 4R5MA 4FFRA 2HRBA 4XJSA 3U4CA 1Y8RA 4HV4A 4DIFA 4IDGA 1E7WA 1MGOA 4OKNA 2B4QA 4LCEA 1H6DA 1P0CA 4IZIA 1DXYA 4N54A 3U4IA 3JCZA 3BAZA 3E18A 1WZIA 3NJ8A 1UXIA 4PIVA 4IGEA 3WOHA 4AJ1A 3KO8A 4A26A 3ZN2A 1SB9A 4GVLA 4K26A 4WPGA 3U5TA 1M67A 4PG4A 3GPDG 4IXTA 1N9GB 4UVGA 1TA4A 2IDZA 1UAYA 2QZZA 3CZMA 3OF2A 4QO7A 4IMPA 4GSKA 4RCVA 4ONEA 2P5UA 4M86A 3PHJA 2VZ8A 3ZH2A 3RKUA 4KUHA 4ND1A 4G2NA 2DFDA 2PV7A 5A5FA 5BNTA 1RM0A 5JS6A 5CEFA 3VH1A 1PZEA 5T57A 5CDYA 3PPIA 1LSUA 4CM6A 4E5NA 2O2YA 3AUSA 4B79A 1B16A 3ZV4A 3OJFA 2ZTLA 4MVJH 3BA1A 4DPMA 2PD6A 3KSDO 5DCUA 1HT0A 1SPXA 4RPHA 1Q1NA 1PS0A 3IS3A 3ZWYA 3WQRA 2RH4A 2V6GA 3GRPA 2QYSA 3GHHA 2CUKA 4FGWA 3V1UA 2IZ1A 1B8UA 3ZDFA 4CMEC 1A27A 1F0YA 1PJQA 2ZTUA 5EIOA 3QQPA 4WNCA 1ZEMA 1P77A 1W6UA 5AYVA 4XCVA 1X1TA 1GV0A 3C7CB 4ALJA 3WMWA 4IQGA 1DAPA 2EJWA 3WR5A 4J7XA 3MTGA 3WIEA 1TT7A 2ZYGA 1RKXA 2W4QA 3O38A 4OQZA 2YFHA 2RCYA 4HFMA 1LU9A 1K0UA 3QWBA 1T4BA 3OH8A 2IE0A 3QWFA 4MINA 3DWFA 5KJEA 4OIMA 1RYDA 3EMKA 3V5NA 1KVQA 5ICMA 1ZBQA 2NQTA 4BNXA 4A10A 1ZSNA 1A72A 1PQUA 1UXKA 4F6LA 2VN8A 4K1LA 5H81A 3FD8A 3I52A 3ABIA 5C7LO 2VOEA 3K96A 3ADPA 1GL3A 4G5HA 1YQDA 4JX8A 2X22A 2HO5A 2CSUA 7MDHA 5DF1A 3K92A 1NWCA 5COBA 3ZU2A 3AWDA 1WP4A 1OMOA 3GFGA 1I3LA 2AHRA 4XYBA 1NVTA 1QR6A 2HMWA 2B5VA 4I5GA 4CUKA 1HDGO 1ZJYA 3TOZA 1EEHA 4KP7A 3RUIA 1ZVMA 4KTVE 3SC6A 5CG1A 3CZRA 4ND2A 1HZZA 4KMSA 1SC6A 5IG2A 1I2BA 2YYYA 4ZD6A 3GH3A 1LDBA 3WGHA 1ZEJA 3KLMX 3AI3A 4RJTA 1IHXA 4RDIA 4BUCA 3D1LA 2I67A 2Y0CA 2Y68A 3AOEA 3FR8A 1ZSYA 1D3AA 3AM4A 5G0VA 4HBGA 3CPSA 1J0XO 1WAMA 3PYMA 5IXSA 3OM9A 4CM8A 4YJFB 4GH5A 2VTEA 3A28A 5JE8A 1N92A 3UVEA 3RUEA 1X0XA 3WG9A 4G65A 4WLUA 2GF2A 3DTYA 3B70A 2JAPA 3VKVA 3WIDA 3WXBA 1K89A 3O4RA 5ENVA 4YWJA 3WDSA 4J1NA 1YL5A 4IS3A 4WOJA 3F47A 3KYDB 5CDGA 3SVTA 4PCVA 5L40A 1EUDA 2NSDA 1IULA 1UP7A 3DFZA 1DC4A 3KEOA 4OXYA 3JQGB 3M2PA 1NASA 4I9HA 1HWYA 2O7QA 2FHSA 2VWPA 3BZUA 2ZTVA 5HA5A 1H6AA 1ISFA 5IDXA 4MO2A 4CJXA 4RGBA 1FK8A 2Q3EA 1KEWA 3ZGYA 1TI7A 2BF7A 3RFXA 1LC3A 5AVOA 5BT9A 3QE3A 5A9SB 3JQ9C 4BVAA 3GZNA 1F8GA 1PJ2A 4BQPA 4R54A 3WFJA 5JBIA 1JWBB 3TZCA 1YRLA 3D3WA 3G3EA 4B7UA 4RVGA 2ZJ0A 4DTIA 1R16A 3JD1A 5THQA 4BNHA 3KYCB 5I8ZA 4JK3A 3UCEA 5BSHA 5ADHA 2BGLA 3JQBA 1J6UA 4CQMB 2CMDA 4E4YA 2Y1GA 4U6SA 4NK5A 4XYEA 4CMJA 5A04A 2VWGA 3HDQA 1GAEO 3EYWA 2D8AA 2JFGA 4NH4A 5G2OA 4XRRA 2JCVA 1I5RA 2P2SA 3QRWA 1IUKA 3DZHA 1B0AA 1CETA 1HRDA 2DU8A 1JKIA 3JD0A 2FOIA 1P9LA 2HSDA 3GUCA 5BSEA 3DZFA 1DPGA 2ZJ1A 4AJJA 1CDOA 1IZ9A 4O5OA 4XD2A 2BHLA 3ENNA 4HXYA 1ZK1A 3IMFA 2OP1A 2W2KB 2PGJA 3PEFA 1SEVA 4R1UA 5DBGA 4UULA 4B7XA 2GCGA 3GVXA 1FDWA 1I33A 4A27A 1ONPA 4WOKA 4WEOA 4BGVA 1BGVA 1TEHA 2HMSA 5C37A 3ASUA 1AXEA 3DZBA 5TGDA 2Y0DA 1FDTA 3AUAA 2XOXA 1BW9B 2PKQO 5A4DA 3GVCA 2VTDA 1YL6A 2YDYA 4AFNA 2UUPA 3I9OA 1EVIA 3ICPA 3R1IA 3RBZA 5JAZA 2VT3A 1DC3A 4FSHA 4QT0A 3WBFA 3QW2A 4YB8A 2E6UX 2OBNA 2TMDA 4KTTE 3DO5A 4TZKA 1AHHA 1EQ2A 3HQ4O 4R51A 1B26A 4Z3KA 4IXWA 4CMIB 2Q1TA 3NDRA 5AXDA 4EUHA 3PZBA 3K73O 4EDFA 2XXBA 1EBFA 3KRTA 3PDUA 3S1LA 2VHZA 4PLZA 4EJ0A 4QSMA 1QSGA 2NQ8A 3GA0A 1V3TA 1NVMB 2WJPA 5JY6A 3RQSA 1NM5A 3WQQA 4JIGA 1W0CA 4GAEA 4CL8A 4I9NA 3HN2A 4HFNA 4AJKA 2NM0A 3JQ6A 1VM6A 4KWIA 1PL7A 4J4HA 4A73A 5L7TA 2Q2VA 1GCOA 1PQWA 3O8QB 2OXIA 1PEDA 1YWGO 1H9AA 3PI7A 3OEWA 4XZ3A 3O03A 4ESOA 2NLOA 1ISIA 3JQEA 4Q3EA 5ITVA 2EIHA 1EDOA 3QV1A 4BMNA 4MP3A 3RBVA 5I9LA 3L07A 1F8FA 3SJ7A 3I9NA 4AJNA 4D3SA 5L7YA 5KIAA 1DIGA 1A9YA 4XB1A 4NNJA 3BMOA 1A4UA 1Y8RB 4WEQA 4BKUA 4RPLA 4GMGA 4MVJF 4YJGA 1BVUA 5I7SA 4L4RA 5DDIP 5JDIC 3HG7A 2B69A 1LA2A 1HYEA 3H8VA 3JQAB 1WZEA 3MWDB 3COSA 4O6VA 9LDTA 1EUZA 4CMAA 5HS6A 3A9WA 2X0IA 4OO3A 3OQ6A 1ISJA 2BFPA 1R15A 2ZQYA 4YAJA 2BKAA 2VWQA 1J5PA 4L73A 2YJZA 4KWHA 4NMHA 4D45A 5KVQA 5JY1A 1CJCA 2QHXA 4LMPA 2Q45A 5JSFA 1R6DA 2X7HA 4E12A 2B83A 1DRUA 2DLDA 3OQ1A 5MDHA 4EZBA 2XF8A 3LT1A 5BSFA 5BR7A 3L77A 3LQFA 4J1SA 2G76A 4BO4A 1IZ0A 3L4BC 3VPXA 1QYWA 4CM9A 3H9EO 2VNAA 1ZCJA 4WJZA 1KETA 3DOJA 2FWMX 2Y05A 3LC7O 3VAZA 4D0SA 4B8ZA 3K6JA 1MX3A 4HWKA 3OFSA 1GYRA 2PWZA 2X8LA 1U2GA 2VHYA 4MPDA 5DOZA 2GD1O 2WWRA 4Z9FA 3WNVA 1C0LA 2PGDA 4FOSA 3VDRA 4OL9A 4LVUA 3JTMA 3GG9A 4K28A 1ADCA 3ZHYA 2JKVA 3JD4A 1ZK0A 4AG3A 1JKFA 4BNWA 3HNPA 3JYOA 1XU9A 1LLQA 3BHJA 3AM5A 3EZLA 5KJ1A 4XX0A 2FP4A 4B3IA 3VKUA 3I3OA 4NJMB 3WLEA 3E6AA 4N7RA 1SZJG 2YW9A 4R9SA 3P2OA 4ZRNA 1A4IA 4AJPA 3ROKA 3PP8A 4BNYA 4J9VA 3ZNOA 3WQSB 3L6DA 3ANNA 3OIFA 3RUCA 4QFCA 1B8VA 3UH1A 1EQUA 5AXBA 1Y8QB 4XEHA 1T2FA 4YRDA 3JQFC 9LDBA 3G49A 2GNAA 3RJ5A 4EJ6A 3DB2A 3SXPA 1P1RA 4ZQHA 4FOOA 3ZI0A 4CM3A 1XU7A 4D3DA 3WGIA 3NDJA 3UICA 5H82A 3JYNA 3KB6A 1GQ2A 2C59A 1FXSA 4M1QA 1B3RA 1NTOA 3CIFA 1UDBA 1SOVA 2BFOA 2P5YA 2RH8A 5C5IA 1U3UA 5TS3A 1A9ZA 2AXQA 3E9NA 1HEUA 3GQVA 1EK5A 4Z9YA 2PR2A 2V6BA 1U7TA 2R00A 1P1FA 2POQX 1G1AA 2EP5A 3W4KA 5F1PA 3RFVA 3K30A 5HRUA 1IY8A 3A14A 5L95A 4JBGA 4YJGB 3K5PA 1UJMA 1ULSA 1UH5A 4BGEA 1E1KA 2BI8A 3OMLA 3PLRA 3SLGA 3MTJA 1HL3A 1E92A 3KHUA 4IIUA 2GR9A 4DGSA 3GDOA 1HDXA 1E77A 2GZ1A 3DL2A 3H9QA 4EITA 3ETDA 1HTBA 2WSBA 2X9VA 3WICA 2E82A 5HS4A 1IHYA 1T1SA 3IUPA 4IZHA 1SMKA 4E30A 1Y81A 3C7AA 4D43A 4DPLA 2W90A 2DTEA 3ETGA 3FRJA 3H5NA 5GZ6A 6LDHA 3UHAA 5KVVA 5MGBA 4NR0A 4UVEA 3RBXA 2GN8A 3PQDA 5BSGA 3INTA 3QA9A 2VYVD 3X2FA 2OHXA 5ITWA 3KLPX 1LDGA 1N9GA 3D4OA 4BO3A 1HF3A 1LX6A 2QRLA 3E5MA 1WWKA 3JQDA 2JAHA 1M2WA 3H4VA 3FBGA 2BFAA 3CMCO 3ONDA 5FWNA 5KJ6A 3GGOA 1TVEA 5TT0A 5KNLA 3EAGA 2VRBA 2IRWA 5CDSA 3LF2A 4XKJA 3DZIA 1CRWG 5BNFA 1DRWA 4YAGA 3WFIA 1H9BA 1U5AA 2O3QA 2O4UX 1NAIA 4G81A 4II3A 3TN7A 5A5EA 1PX0A 1R0SA 4UUOA 4M54A 2VOJA 3MJSA 3I6QA 4BO7A 3HSKA 2WYUA 1U5CA 2AW5A 2P9EA 5DP1A 4W99A 2I76A 2WD7A 4EYEA 1BTOA 3GPIA 2H9IA 2FRDA 1E1NA 3LT4A 2FR0A 2DBZA 3ZCXA 4D3FA 3F5SA 4BO8A 1Q0LA 1SEPA 3VH4A 2PZKA 3B1JA 2VRCA 1X15A 3TFOA 4QEDA 5F5NA 3DZKA 2O4CA 3NGLA 1JW9B 2LDXA 4K6FA 1ENZA 5G0SA 3ETEA 4ZHSA 5KVSA 3F3SA 4UUNA 1Q7BA 3I1JA 1DIAA 1LSJA 1YKFA 4CM7A 4MKZA 1MFZA 4J2OA 3W8FA 4DVJA 3U4DA 3B1KA 2AQKA 2VWHA 2CY0A 4MVJE 3PQEA 3GGPA 1KERA 2ZCVA 2H63A 4R68A 3NJ4A 4MIOA 4GX1A 1OFGA 4XJTA 2C82A 1JTVA 4GGOA 3RC9A 3HDYA 3F1KA 3HWRA 3LU1A 3ZWMA 1NAHA 1NQTA 3B20A 3IOYA 2A94A 3Q1LA 2AG8A 2FSSA 4EBFA 3IJPA 1UAGA 4MVJM 2DFVA 5T67A 1YE3A 5KTKA 3SBOA 1DEHA 1EE2A 5L4NA 5B37A 3UKOA 1TLTA 1DO8A 3M1AA 1J4AA 4Y8VA 5COAA 1L7DA 2GO1A 3AUUA 4NBTA 4WLEA 1P1KA 4CLOA 3GEMA 3Q2KA 4C7JA 2FR8A 4O63O 4D41A 4D7AA 1NYTA 4OXNA 1KIFA 3NTRA 4TRMA 2I5PO 2WE7A 2RBEA 5EERA 2J3IA 2VHXA 3GOHA 4ZN6A 3K8ZA 1I3MA 1VSUA 3WB9A 4WCFB 3VVBA 3OJEA 3E9MA 4XIJA 3LK7A 4FFLA 5FEUA 4IGFA 3ANLA 5HBRA 1IPEA 4GVXA 4R01A 1DFIA 2PD3A 4YAIA 3EHEA 3BTUA 3IKTA 2W2KA 4MKRA 2BD0A 3WX0A 4XWYA 3KOUA 3BXXA 4R4JA 3EGOA 3GZ4A 1R37A 4HNHA 3ASVA 4D79A 1VL6A 4EI2A 3CKYA 2CVZA 3PTZA 1WW8A 3HHPA 1PWXA 3OA0A 4BO0A 3MOIA 1HSZA 2CVQA 3ENKA 2VHWA 4II2A 1PL6A 3WGYA 3KYCA 4J43A 4CLRB 1KC1A 2VQ3A 3RU7A 3BHIA 4J1TA 1LDNA 1LLDA 5J23A 4JP3A 4R5HA 1E1LA 1BDBA 4W9NC 4O0LA 2PGLA 4MVJG 1WPQA 1ONNA 2EJVA 4J4TA 1GZ6A 4NFSA 2J5RA 1I2CA 5JAMA 2BMAA 2CNBA 5A9SA 2X6TA 1PJLA 3OJLA 4OSOA 3WGZA 1PJTA 2BLLA 2W98A 3UUWA 4PN3A 3WSVA 4IJUA 2GN6A 1I30A 1T24A 5G0TA 5ILGA 4IDDA 3C1TA 1I01A 1ARZA 3BTSA 3ZU5A 2AG5A 2AA3A 1DFGA 1P3DA 1J49A 5DNAA 1ZXBA 3EUWA 4KUGA 4EEXA 3V1YA 5JC1A 4R3NA 3L4SO 3TSCA 1XSEA 2OUIA 4L4XA 3JD3A 4TROA 1SCUA 1WDMA 3ZWOA 3D3EA 1E0DA 3OBBA 4OKIA 3RI3A 4B8WA 1XCBA 2QG4A 2GYYA 4CM5A 3H3JA 4CMCA 5KJCA 3C3XA 1XYGA 1IB6A 4Q3DA 3ZWAA 5H83A 2JJYA 2D0IA 2B37A 2C2YA 2HK9A 1P1JA 1WVGA 4YJFA 3K9QO 1Z45A 3JQAA 5LC1A 2WYVA 2YV2A 3B6ZA 1C0PA 1ISHA 2ILTA 3E1KA 5AXCA 4RQTA 1XDWA 3IL2A 1P31A 3FWNA 2HKIA 5DN9A 2RIRA 2Q4BA 2WYWA 1GADO 1GD1O 3G0OA 4N5NA 4WCFC 3OSUA 3RJ9A 4PLPA 4Q3AA 5JCJD 3GRKA 4CLEA 3L6OO 1GYPA 2IEBA 4RDHA 4CQMA 4DL9A 1LLUA 1NBOA 4YBZA 2EHDA 3ZV5A 4WCDA 3G1UA 4YDRA 2F1KA 3WNQA 1HSOA 1LI4A 4RVHA 2SCUA 4ALIA 2ZCUA 2GASA 2WM3A 2Z5LA 4OM8A 1FF9A 2IODA 5EMHA 4ZJUA 1BWSA 4Y9DA 2J5QA 3R3SA 4YAKA 2O3UA 4J0FA 2NU8A 4YAEA 4GBJA 1ADGA 2Q2QA 4QXMA 3RC7A 1XHLA 5AOVA 4CM8B 1ULUA 3PVZA 3MZ0A 5CEEA 4AJOA 1N1EA 2CVOA 4IQ8A 1R12A 1XG5A 1JVSA 1LXCA 1YJQA 3IQDB 1B7GO 3DDNA 1NHWA 4AJ4A 3FPLA 3I6IA 4QTZA 4O1MA 4GQAA 3TZ6A 1EDZA 5CDUA 1PR3A 2D5CA 1NVGA 3K2EA 2G17A 3Q3CA 2NV6A 3GNQA 3CEAA 1HZJA 1ORRA 3U0BA 1Y9AA 5CG2A 2LDBA 4BNLA 1I3NA 2Q99A 3JQCA 2JFHA 3JQAD 2QIOA 3GF4A 3HB4X 3RROA 4NIMA 3TQHA 2UVDA 1HE3A 4IJWA 2DUUA 1YJ8A 4R69A 3ROPA 2JCXA 1C0KA 3M6IA 3QLJA 4TMFA 2W2LD 1MG0A 4J4BA 4EGFA 3NRCA 4CLHA 3RWBA 1EFLA 5T5QA 5JXWA 2QW8A 3E9QA 4BIIA 1BXGB 1Z73A 1NXQA 1DIBA 3IDSA 1W73A 2OL4A 4LSWA 5TNXA 3TF5A 1VLLA 3NV9A 5ENDA 3H3FA 1O89A 1OC2A 3EVTA 3GDGA 3EY4A 3BMQB 5FYDA 3ROMA 3GN1A 3GC6A 4TWRA 2BH9A 3RD5A 1DC6A 3STHA 3L9WA 1ENYA 3Q9NA 2EP7A 3PHHA 3NT5A 3DAPA 2IYOA 3I9JA 2BRUA 3QY9A 2O2SA 3OIDA 4IDEA 4RQUA 4ZQFA 3BMCB 1MLDA 3I9MA 2I6TA 2X86A 2UAGA 5F21A
chains in the Genus database with same CATH superfamily
1JEYB 5K05A 2G0TA 3CLRC 1N6OA 3EPLA 1DDGA 4IICA 3U40A 3L01A 1SUCA 5JAHA 4Q4JA 1ZNQO 3LWNA 3M4YA 3TZKA 4XPZA 4NBNA 5LU8A 3JZIA 4E13A 3HVIA 5JWRA 1G63A 4CR6A 9ATCA 1OFUX 3TWOA 5HF9A 5D3KA 2QTLA 3NMUF 1VHLA 2O1XA 1JWAB 3PJFA 2YKGA 3LLSA 2BEJA 1QHEA 4EI7A 5F9FA 5HSGA 2VPXA 5LB4A 4LE0A 3EMVA 1CB7A 2F4NA 3GBPA 2OZLB 1Q2XA 1QKIA 3M3HA 4H7PA 1HLPA 4KVAA 2UXBB 3UAGA 1YMUA 1UBOS 3DL4A 4RQAA 1OZAA 3DEIA 3UATA 3VUFA 4PLVA 4ZTZB 4AKGA 1UIMA 4BMSA 2XDQB 3WGQA 3SAJA 2PH1A 5EJ2A 1XR3A 2HJGA 2Q4EA 1D0IA 4PG8A 1ILEA 1GO2A 1M72A 1T5HX 5LQDA 1M6YA 2O8VA 1YR6A 4KOEC 4N5HX 3A4TA 4I5DA 1WZNA 4LRQA 1ECFA 5D6NA 5JMPA 1ODIA 2D54A 1H66A 1KMQA 1W44A 1SD1A 1BGXT 3E9DA 4X6UA 4B4OA 4BNFA 3CCCA 5TF0A 3SEFA 5J4LA 4AO6A 3LT2A 1VCOA 4JVOA 3AB7A 1F1BA 2QVZX 3N70A 5ADWA 4W9NA 3EVCA 1FFAA 2QTVB 4EB8A 3ZDRA 4EJMA 2PVSA 3BGSA 2OXTA 3REQB 2X4GA 1W76A 4KBYA 2WHEA 4AG6A 4YRCA 5GZ1A 3UPUA 1SXJE 2XHZA 3JPYA 5BN5A 2VQEB 2H65A 1A9RA 2WU3A 4I2NA 2GDZA 4NBKA 4Y2RA 5JC8A 3DEJA 1S2NA 3FHTA 1NZFA 4UEOA 4C22A 3PNKA 1QDEA 3KOWA 1XDUA 2WWGA 4HB0A 3GD7A 3STXA 4DQUA 1KSHA 2W22A 1NYLA 3HVRA 1T9AA 4LWZA 3PQ6A 2A4KA 1UBJS 4OP1A 5TPZA 4XUCA 3I9KA 1UEJA 3TAUA 2R6CA 5EJ6A 2OCPA 3KHTA 3PWKA 3MS2A 1PJ8A 2A8YA 3SCZA 1NQUA 4BWFB 3B6KA 2E1PA 5HPYB 3K0SA 3KOOA 1HKUA 2GJ8A 4IIGA 4F9FA 2Y27A 1Z74A 3AU8A 3AR3A 4QGAA 1Q21A 1M2FA 1LDMA 4M0EA 1I0ZA 4S2UA 2M9MA 3CRZA 3H9GA 2PHZA 3RS0A 1M2OA 2AXPA 1DE0A 1SK8A 3WTBA 4XQEA 5IMBA 4US1R 5G4LA 5BWLA 5FWXB 3OTGA 4MKIA 5HTKA 1UKAA 5HM8A 4W5QA 5JECA 1Q0QA 1A7AA 4TWZA 4UHHA 5BYJA 4IQ4A 5I3CA 5C53B 4S04A 4JUCA 1YVRA 1AKWA 1WKCA 3NVDA 4AZ3A 1J20A 3RC3A 4AY5A 4ZCRA 5L3SB 2P2YA 1TZJA 2UYGA 1HLGA 1OX5A 2ZUEA 3SLKA 1KJYA 4S35A 3ZXSA 2WINI 1QIIA 5C4IA 1WV0A 4MHTA 4X6XA 3RQIA 1J9GA 1ZK3A 2AJBA 2XE7A 3Q8LA 4L8VA 1T3ZA 1RPNA 1GGFA 3UW1A 5KYNA 1E9VA 3SR0A 3AR7A 4LBYA 1UPUA 4JJGA 2EFHB 4TMTA 4D57A 4ECEA 3HP7A 4UNRA 3TM4A 1DKQA 1M5TA 2JEYA 2ZJ7A 5JSQA 2Z5VA 3TZBA 4Q9JA 4G0PA 4F85A 2GGSA 5FPYA 3TYXA 2CFIA 3VU9A 3GJQA 3D6JA 3R4CA 5FI5A 5L3RA 1VLVA 4JGGA 1JECA 1F6WA 1LY1A 2QL5A 1OI2A 2VRCD 1YR3A 5TMBA 2NTNA 3RUFA 3RVDA 5KOIA 3JQQA 1DXOA 2PO7A 1NR7A 4DIOA 5TMDA 4PYJA 3TQRA 3PD1A 4DLNA 2BGWA 2HSWA 2ID4A 2MSNA 5TRTA 4C0LA 3HA3A 4J7AA 4Y9RA 3QE2A 4F7WA 2QBYA 3EVNA 4C2AA 2ZIXA 2DSTA 1Z0AA 3JAWA 4HS4A 1CS4C 3RWOA 1NBEA 3DONA 3AY7A 2XY4A 4M9CA 4PAMA 2Y1DA 2YCLA 1J56A 2GPWA 1Y9ZA 3ZU3A 3IQEA 3LYAA 1TFRA 1L7PA 2VAWA 3ZTYA 2G36A 4TV8F 3T12A 1A8IA 4N48A 2RHCA 1PF7E 5EJGA 1P45A 5CLLA 4N18A 1W4AA 1E6CA 1VLQA 3H6KA 4IF4A 1Y63A 3U3XA 2HPAA 2VRWA 1EVYA 2DTDA 4Y2JA 2WIJA 3ZTTA 4A16A 4EB0A 1N5IA 1P4RA 1TMOA 1XMPA 3FSGA 1TEZA 1VL2A 3FVWA 2DVMA 2GBFA 4YFYA 3RJMA 1BFUA 1XCGB 2YASA 5AW2A 1GQYA 2NUAA 2E37A 3GUZA 5TEVA 4S05A 4I19A 1Z17A 3EXHB 4G09A 1L4HA 1XFAA 1E0AA 3G89A 5CXQA 5BVGA 2X15A 1U7ZA 3MINA 3N3AC 1VECA 4Z9XA 4CKXA 1HV8A 2IU0A 5IPFA 1XJ0A 1UINA 7AT1A 2DPMA 2GK3A 4GGMX 1LQTA 3CRW1 5B2FA 3Q3JB 2ZBPA 4M2LA 3G9UA 1A8UA 1R0LA 4HD8A 3ROXA 5B1EA 1J09A 4DA4A 5FUVA 3VU8A 2GD0A 3D8HA 4NYMR 4KVGA 3ROEA 4C08A 1JPUA 4J6FA 4BNJA 3KUCA 3GCXA 1AK1A 1P2BA 2DKOA 2V45A 3G0DA 2XW6A 1A2OA 1ONSA 2IP4A 4UW9A 2YVKA 5A2GA 1ZITA 3COWA 4WADA 2W8ZA 4D8XA 1KEPA 1PNRA 4S24A 3D3JA 4UREA 4U0KA 2GPNA 3PK0A 3AWIA 5CT4A 4LN1A 5ENZA 4AQDA 1WXDA 2YQZA 4KLCA 4Q9IA 3VDMA 4NU5A 3EW7A 5DP2A 3RBAA 1RC8A 3LKVA 5I8WA 2BFCA 1OH8A 1TM7E 1ISRA 1ZYUA 5L3QB 4MW7A 2BN4A 4LYHA 2WC1A 3T94A 5KEIA 4OXQA 4DR4B 4BVHA 4B71A 4WT7A 3QUSA 4M7OA 3SE7A 4GX5A 2AE1A 1JH8A 1FQWA 5I7HA 1A2BA 5F35A 2QVBA 2HF2A 1RI1A 3QVWA 1QP8A 2I8CA 3WZ2A 1N77A 5B7GA 2HOQA 4WECA 1WSDA 4IG4A 4OVKA 1A9TA 4ZXFA 5LUBA 3LW8A 2ZREA 4TYQA 1PU2A 4LJ6A 1I80A 4DCGA 2C7QA 3IT1A 8LDHA 1RMYA 4GKVA 4ZK6A 4F9EA 1OWLA 4E14A 2H51A 4PONA 2UXDB 4ZIRB 1W93A 2XVAA 7ADHA 3EZGA 1MQ8B 4CT5A 3MLAA 4KH1A 4OOFA 5CHEA 1QHXA 2W0SA 3QU4A 3S7ZA 3ABRB 4Q48A 3RYIA 4ALNA 4QBTA 1XQVA 5T8KA 1UBRS 4D3YA 1QRAA 1DCFA 1AXRA 1H23A 4W7IA 1WUYA 3QMMA 4KXQA 2I1LA 3LBFA 1J8FA 5J4KA 1XP8A 4IEEA 1YS6A 3SJUA 4ZCMA 1GNQA 4BP3A 3RFTA 2WPDD 3PG5A 3X1KA 3FSRA 4KG7A 1WOYA 1J0CA 3GFOA 2F6RA 2VP3A 4LTNA 4DMLA 1TAUA 2NO0A 4Y0VA 3DDHA 1MAUA 2D13A 3LUBA 3MM4A 1U6JA 3QY0A 3RRZA 3SYLA 4I6EA 4NF2A 4EGAA 5GJBA 3DOCA 3VHLB 3S2FA 3ME5A 5H16A 2QPOA 3DJFA 3GRVA 1UMBB 3SJZA 5CT6A 2EZ9A 3BE8A 3VH2A 3DDOA 5BOSA 5HUJA 2W93A 5FUQA 4EY6A 4LCJA 4QFDA 5SYNA 3NAMA 1ZUNB 2ABWA 3ADCA 1JPNA 1K8ZB 2FZWA 4B34A 2QM3A 4JP1A 4BRSA 1J8VA 2J9FA 3A9SA 3A6PC 2CMFA 1CQIA 3OLXA 4P3YA 2ZB3A 4ZGBA 1JG2A 1QS0A 2RHWA 4R8SA 2PX8A 5JLAA 5EXEA 2AN3A 4JI6B 3DVLA 5DOVA 3QVSA 3FROA 2K4MA 3HA7A 5LZ7A 1U7OA 4AXXA 4B40A 4M55A 3A0RB 3F4KA 1Q20A 2ZQZA 4IWNA 4I9UA 4DM4A 2QMYA 3ZVNA 1ZZEA 5KTRA 1WTAA 3FTCA 2QU7A 5EJ4A 4S1WA 4QPDA 1T4DA 5K6AC 4N9WA 5TJHA 1NXSA 2PZLA 3PL5A 3S55A 4NATA 3RVOA 5LP6C 2VXCA 3IAAA 3JQ7B 2YRXA 5TIIA 4H3KB 3JQRA 4AVYA 1LBQA 3OVMA 4DSUA 4QHTA 1ZGGA 4RHTA 4ZCIA 3QSGA 5B7NA 5JIBA 5K7SA 2NUTA 2XB2A 2Z4SA 2ATXA 4HR7A 2O5VA 1HYHA 2V7BA 5KKAA 3L43A 2O0LA 3EVDA 1DCKA 1YQUA 3FFBA 3VPSA 4ZTUB 3U26A 4UNIA 5FBWB 4C4PA 3I9LA 5LMCA 3CKKA 2VP2A 1SVKA 3ESXA 3KEQA 1VPLA 4KC0A 4L4SA 5FTWA 3EAFA 3HJTA 5E1OA 4FUTA 2VUIB 1J99A 2QTFA 2VDQB 3U09A 1PO7A 4GOLD 3UJHA 5IAJA 4DUGA 3B8EA 2PZEA 4QYWA 3I76A 4F3NA 1JHRA 4EHBA 3WMEA 4QO8A 3E05A 3HCFA 4PPFA 4K6CA 4PO3X 2ZSIA 4FB5A 2G04A 3Q12A 5EYPB 2IXTA 3VKGA 1MB4A 4KGZA 4ACAA 5HBGA 4KXMA 4B3HA 3IIEA 4TKVA 1NXVA 3IUJA 4L9SA 4UQOA 3DV9A 4J0GA 4W7HA 3IV7A 3AOEC 1P0IA 2J3MA 1EVJA 1LBSA 2VHUA 3OIUA 1JX6A 1D0SA 2Z3VA 4N12A 3S2ZA 5FHRA 4KNYA 4YYEA 1W6RA 1GTMA 1ECGA 4L3OA 3JWHA 3FFAA 4KFCA 2H2DA 2KSQA 2X2OA 4QYIB 1L5QA 3HYCA 3N3BC 1W88A 3E3MA 3STVA 4DNPA 1C30B 1BXRB 2Z43A 4JBWA 3UUEA 4HL6A 3L0OA 2A59A 3FKSA 2YDXA 3UJ3X 1BU5A 5EJ9A 1U3TA 4HAZA 2O7SA 4DFDA 2QUHA 3FZQA 3D4LA 2R62A 5I48A 4MQFA 1Z0ZA 1L5HB 1CTQA 2HK7A 3C5VA 4HUJA 3ZWCA 2KS6A 5HIMA 1YL7A 1T1GA 2ZB2A 3WRYA 5FULA 2IPXA 4ZPXA 1CDDA 2RBKA 2JD1A 3SJBA 4EHIA 1D7OA 3KQYA 2OZKA 1KJQA 1LS6A 5AI8A 4LDQA 1TVMA 4KQEA 2FR8C 2DR0A 2GZSA 3NEAA 4Q3BA 2GEFA 1KJ8A 4YEDA 1CY7A 2L0XA 2XTJA 3A9CA 5EE9A 3VZBA 4A3SA 2Y3IA 3NKVA 2YV1A 2FDCA 3TVDA 4TLDA 3AG6A 3HPQA 4HTFA 1O96A 1OHHA 2HLDD 1ZMRA 1U7WA 3GX1A 4ZVRA 1X14A 3UFBA 1QQAA 3CEJA 2IVZA 1F06A 4QUBA 1S8NA 3ER8A 5EVCA 1B2LA 1CUBA 2Q50A 3MVEA 3T06B 5IK2A 2X7JA 5JWHA 2JFWA 4LYYA 2I62A 1VHTA 1ZFNA 2CFCA 3K32A 1NG9A 2XUHA 3SJAA 1CY2A 3H17A 1XZIA 2QGFA 3M9LA 2UZ1A 2IU3A 3HN6A 4MVJI 4XWGA 3WYNA 5C7IO 4K8OA 4J7UA 4PYKA 5DI9A 1TFUA 1YUNA 1PZFA 1O94A 3NC4A 1NF2A 3DV0A 3EXIB 4I1OA 4HTAA 3GQBA 1KNQA 1N2BA 1GNLA 2YY7A 3O9VA 3O26A 1ZVVA 1NP7A 4KXUA 4O2AF 3U61B 4WFQA 1ZM3A 1KGSA 4LRTB 3SBDA 2WSSA 3T7DA 3FPBA 2J5KA 2X2EA 2RGWA 1VJTA 2NU6B 2QL7A 2Z56A 2XXAA 2JD0A 1T4MA 2OB2A 3BJIC 3ZGZA 3ICOA 3BRSA 3EQ2A 1KYYA 1A69A 3NHLA 5KVAA 1XVIA 2A6PA 5JDCC 1BMFD 1ML3A 2X0KA 1DWQA 4F3CA 2CNLA 3KZCA 3H6GA 4CBVA 4XB6B 1NWHA 5LQMA 2J0UB 4N01A 3ADOA 2XPCA 1Z5PA 2ZB4A 3MLBA 3KPVA 4LK3A 3I0MA 5IF3A 4NULA 3T3PB 4U7HA 5M29A 4JBYA 4P34A 1P44A 2D0PB 2FUG6 3QSYA 3W6OA 4F71A 3RGWS 4HNAA 4YVFA 1G8JA 4N03A 3E70C 2VCYA 2IY9A 4OL0A 4IXMA 4JYMA 2BBOA 4WWHA 2VJYA 4D6PA 1VI2A 1G59A 2Z1NA 4DRYA 4JJEA 4RZ2A 4GUDA 1BYIA 1G55A 1NW9B 3DGFC 2NU9A 2WG1A 3ET5A 4WY2A 1QTNA 2HU8A 4HFJA 5JSKA 5ITZA 4GI2A 1CKEA 1J42A 4DIBA 2CV2A 1YCFA 4JD5A 4FFNA 4U8GA 3E7PA 2AQHA 2X2PA 4TM7A 1FNDA 1ISPA 2MYPA 2CJPA 4JJ7A 4PCUA 2ZJ4A 1ZGBA 3WNCA 2HU2A 4BWGA 3RVPA 1YBAA 2CXSA 3LLMA 5ALVA 4LJLA 1TZCA 3PC6A 3W5IA 3BS4A 3C2QA 3QXJA 1YBVA 4D3XA 3T5AA 1E63A 1FEZA 1WXXA 1FP6A 2RI6A 3FNBA 3MCVA 3KZXA 4FXOA 4WLOA 2XRYA 4MJLA 1WLYA 5EUCA 3SQNA 2I33A 1UZUA 4EECA 2Q0SA 1IRIA 2IXGA 2ZRCA 4MQFB 4PSCA 4UU8A 5H68A 2NTYC 4PGMA 3L6UA 5A3RA 1DLIA 4RESA 5ER9A 1L7AA 3K09A 4MW1A 1FA9A 4OQYA 1WB6A 1Y8CA 1NUSA 4V02A 1E4VA 1E4EA 1M8FA 1PL8A 2JLSA 5JJLA 4BKRA 3HFGA 3C6YA 1TIPA 1UKBA 3P4UA 3ITNA 3SKYA 4IDHA 1PVOA 1YONA 3H2HA 2D7DA 1G5PA 1DUSA 4V3BA 5D3MA 3VYTB 4YRMA 3WJ7A 3EY9A 1JLHA 5KWSA 1UXGA 1U1IA 4IUDS 1Z0KA 5DT2A 5FXMA 5FWDA 2J1LA 3GUYA 4HMOA 3LVFO 4C07A 5TGZA 2ZVPX 3LGSA 4TQAA 3FOAA 3I3SR 2Y0EA 3GLRA 4R2JA 4RULA 4Z4EA 3AVYA 1E2FA 1Y6JA 1LJUA 1M6EX 2GXUA 3FLMA 3KR9A 3GLQA 4I5EA 2YHIA 4PGAA 1T6NA 3L0BA 1MP0A 3OM0A 4RH3A 1P1IA 3IE1A 2XVZA 5BXQC 3LWBA 2IXFA 4PYIA 3LI2A 1DADA 4DJFC 3VXKA 1M7GA 2X13A 3R6LA 4MW6A 1GUFA 2Y4NA 5AVQA 2B9EA 1O94C 1IPFA 3DKIA 4LSMA 1SZPA 1VSTA 3ZV6A 4M0UA 3PEWA 5DCWA 5DTQA 2ZTHA 4CV0A 2BSXA 4QGBA 3BMXA 2A9RA 1YOVB 2E85A 3RHZA 1BS9A 4HJXA 3DOHA 2FDRA 4KEAA 4HGZA 3VAAA 4CG3A 2XXAB 3WLLA 4KPYA 1YMVA 3LY8A 1J00A 1Q7GA 2Q9BA 5EQTA 5F5LA 3RK4A 1G7CA 2J3KA 4L50A 4BTLA 2A35A 2OGTA 3QLTA 4RE5A 4MRAA 4Y67A 4CMEA 3KZNA 1EWVA 1LWNA 4B9AA 2O0MA 1L4UA 4KNVA 4N5LA 2OGSA 3S28A 2P2ZA 3R5FA 4EHKA 1GGJA 2XE6A 1ORDA 2YS6A 5TPZD 5ESDA 4CU5A 4P4NA 4MS4B 1ZC3A 1QB7A 2PTHA 3DEFA 4GRAA 1G5QA 3KT3A 2BJHA 1XRLA 2CJXA 5FTMA 3FZGA 1LDYA 1KDTA 1SXHA 4IH9A 2R5FA 3VJLA 4DYDA 5JJCA 1UAAA 5ICEA 1G9XA 4L7VA 4AKTA 3NGMA 4G26A 3F1LA 1XJ5A 1OUMA 1KP3A 4GPAA 3DDSA 4M76B 3DM9B 4GE3A 4JNCA 4QPNA 2WD8A 3W5SA 3UUGA 3FW1A 3BMOB 5GONF 2AUTA 2GEBA 3HDGA 4HUQA 1M1YA 2QRQA 5BV7A 1FYVA 1ZH6A 1Z9BA 1ZM9A 2ZLBA 3I42A 4FW8A 5FTJA 3SJCA 5HYVA 1U9IC 3GJTA 3GVPA 3L0CA 4C30A 1RYFA 3PUKA 3ZK7A 3H13A 4ZZIA 1KI6A 1QP4A 2JG3A 3OPYB 3UXMA 1JAIA 1OXKB 1IBLB 1J0DA 1UDXA 4TT3D 5LYJB 1KO7A 4MUXA 2YWBA 3NFRA 3UT5A 5FPPA 1XA0A 3C0KA 4EGQA 4F06A 4UM9B 5JSZA 5LQCA 2LWIA 3ZE8A 1XDBA 2QSZA 1MB2A 4L57A 1P2TA 1GL9B 3AEUA 1YNSA 2ZYUX 5BXYA 1J06A 4JJ4A 1HDRA 3FNEA 2FEPA 1CRPA 2IYQA 4WFKA 2HL6A 1PFQA 2G0NA 1BX3A 1ORVA 1Y9EA 4MVJA 3THSA 3OUTA 4CKEA 2AJ8A 1PYOA 3FDXA 4GM0A 4Q03A 2HA5A 4AUEA 2BDTA 1E32A 1AKYA 1DUVG 1KYXA 1L4NA 4J3NA 1S9DA 3ZNQA 1FP4A 3K9WA 4AZTA 1SB8A 5EKSA 4XUDA 3DUFA 3Q9UA 4KOAA 1J22A 1D9ZA 4BL5A 3Q72A 4F5EA 4PVDA 1GPH1 1G64A 2JAUA 5BWNA 1JRLA 1AD2A 4U2CA 3EDMA 2ZDHA 4HG2A 2PBLA 1RRMA 5EIEA 1Z2OX 4C6SA 1M8JA 5I6DA 1D04A 4F8JA 1EFAA 3H7AA 4PLYA 2NQ2C 3ADBA 2UKDA 2PS9A 3BHMA 4N5MA 2H11A 4HAIA 3HZHA 4CLRA 2EFYA 2JJ1D 3OJCA 3C3MA 2GETA 5D84A 4ZYZA 4ZT2A 5T7BA 1DJNA 3AEQB 1WDLA 2C77A 5B3AA 1O0SA 1X1QA 2GAJA 4G0OA 4GLBA 4Y3UA 4PGFA 1TQ4A 1T5LA 3A2MA 3A1VA 1SVMA 4LSGA 1UUFA 1R0KA 4EG1A 1UQTA 4PYRA 7GPBA 4PZCA 1ZISA 3PNSA 3ZHOA 4QOHA 4N0EA 5K0TA 1E1RA 1N5LA 2WZBA 1G5IA 3GUUA 3CFYA 1E3SA 2IIPA 1E3TA 1W5EA 4FCCA 1C3OB 2WI8A 3IVRA 3LQ4A 4GPBA 3AHJA 2MYNA 4KO1S 1GJRA 4PSUA 1ZJJA 1Y42X 2G28A 1XRPA 4NHEA 2ZJBA 1QPBA 4H1VA 3TW0A 4ZV4A 3LD9A 5DNDA 3TLEA 2WJVA 3VV2A 3WIUA 1BXZA 1TMYA 4YR7A 4HNUA 1XUOA 3QGMA 4PBTA 1C9YA 5JNTA 1BOOA 4JC0A 1RM5A 2CZCA 2FPIA 3I5AA 3PNLA 3GB9A 3ERCA 2QV7A 3H97A 1GEEA 3C41J 4TQ9A 4TWBA 1EGMB 4M89A 1JMVA 1FFBA 2ZB7A 4HRVA 5BVGB 2K7ZA 3IIIA 3Q3GE 4FB4A 3T3EA 3PC4A 4O2AB 4M99A 1SK9A 1SFRA 1M2KA 3IMGA 4RVSA 3HZZA 4IQ0A 1U8CB 1DQYA 4A6DA 3FRHA 1ACLA 3IVCA 1DIHA 4UQPA 2PEYA 4EKDA 1VL5A 2QNRA 1HURA 1KRHA 2MINA 3K1YA 5E6UA 1IC6A 2QN9A 2AC2A 2Y6UA 2BFDB 1TUEA 2C1XA 3EGCA 4LRSB 4YCDA 1BHSA 2UUOA 4CQLA 1T0IA 1A77A 1GUZA 3II6X 4H2DA 4J0JA 5E1DA 2J0EA 2JVJA 2H1LA 2GUGA 3KKMA 4MPJA 4ZGGA 5A4KA 4J29A 4QVIA 2DFNA 4KQ1A 1EM8A 5AFSA 2YXLA 1BEZA 2OQIA 2HZ7A 3HVHA 4F38A 1JE0A 1PYDA 4HNSA 3KQQA 1X3SA 2ZFUA 4IDFA 4JENA 1W47A 4RF2A 3TIGA 5HWSA 3DD5A 3NIBA 4WN9A 1GQQA 3MJTA 1NU8A 2ENUA 5FUXA 2VF5X 3NETA 4HDKA 5F3DA 1TB4A 4F45A 3UYKA 1ZI8A 2FQYA 1NRWA 1H2BA 3C1UA 1FUUA 4BDSA 3VU9B 4AN1A 6REQB 2VDOB 1CY4A 5CCXA 4DABA 3NLLA 4G5SA 4R3UC 4W5JA 1GGVA 5CT9A 4AJIA 4CKZA 3E2IA 4HPJB 4GKJB 5CCBA 1MAWA 1ZLYA 1AA9A 5KOYA 3S2IA 4ZP1A 3TECE 2AXEA 5ED4A 1C3EA 2FFHA 1G7RA 3TCXB 3T9CA 1PZHA 1RRVA 4O1HA 3PDIB 1LK0A 1MV8A 2J3QA 2XHEA 3I4FA 4F5DA 3VSCA 2WB2A 4DCUA 2FKAA 2DHDA 3A9VA 3H1FA 3NRJA 2QG6A 5B1YA 1G21B 1M34A 4D4MA 3WYGA 4AYTA 5EJ8A 5E2BA 4BBAA 4KMMA 4BQRA 4YLGA 4A0GA 2GPTA 1UWCA 3AEYA 2KPOA 2DPXA 4BFLA 3K71B 4TSKA 3WWEA 1N7HA 2G0AA 2QJTA 3AEQA 3LXUX 1O94D 1POXA 2O48X 3FPFA 1G3UA 2C29D 3PFKA 3QPCA 4RKWA 5TT1A 2ID8A 3TOVA 3HYSA 3V1LA 3DMTC 3HBFA 3OM8A 2Q3JA 4ZGWA 1DTEA 1IOLA 1NRIA 1GQFA 4WY8A 4MP6A 2HCBA 3D6MA 2G1UA 1E58A 4A1OA 2FI1A 3OHSX 3ROTA 3U3MA 1GPMA 2IQIA 2FXVA 2YMQA 4K9PA 4O4IF 1MW9X 5EIFA 1QHHA 2WAXA 4J0DA 3ZHBA 3VNUA 2CXQA 4L78A 1K7YA 1AKTA 2NACA 3ZE2B 3PDJA 2RHRA 2R68A 5FX2A 4DRZA 2FY8A 4DMUB 2C7RA 1YD7A 4X1YA 5KJFA 2KE5A 2QJOA 4BTEA 4P38A 4Q9LA 2W6JD 5KYXB 1QF6A 3UF0A 1TJPB 3JQ9A 2ZJFA 3FMPB 3NPMA 5AW0A 1VP9A 3R44A 3LY9A 4CLXA 3GWGA 1T26A 2D3TA 2DT8A 1T1IA 2GWRA 1CUVA 1H9CA 3PYXA 3GO4A 1WS6A 4Z1MA 1B6TA 4E0BA 1RI3A 4OHZA 4AD8A 1C9NA 2AR9A 2IZ0A 3C6MA 4ISCA 3C8MA 4YRAA 3IIMA 2D1FA 1B14A 3FMVA 2F59A 3ZY3A 3LS2A 1M75A 1JFFB 2RE8A 1MXHA 1U0NA 3ZOZA 1FBTA 4B45A 3VTFA 3ZHZA 2YNMC 1VTKA 2R44A 3GV0A 1EFVB 3GJ5A 2C4VA 4H0CA 2EGHA 2JKYA 3AERA 4DVJA 2PJRA 4LXHA 1CQZA 5ALIA 5IARA 2YHUA 4HADA 1X70A 2LZ0A 1SUIA 1YB1A 5E9JA 1E7RA 4NCXA 5A3VA 3NVAA 3PXAA 3C3AA 1WDKA 3BRWD 3TGPA 2ERYA 1EXDA 1T9ZA 3HE3A 2JA2A 4P7KA 4Q1EA 1D2GA 5EC8A 4Q4HB 1GNVA 5EMNA 1YOBA 2QUJA 3MMPA 4YRJA 2E4UA 1WDTA 3QELB 3IUSA 5KVCA 2RFLA 4UZSA 2HIMA 2VDWB 3IP3A 3IPAA 5ES3A 4F4CA 5AHRA 1O0CA 1V35A 1IY2A 1T5IA 4X20B 1VB3A 1D8TA 1XZHA 2O2ZA 3PSAA 2OFFA 5BV8A 4KU4A 1DX6A 3RUHA 4UBIA 3FNHA 1ONOA 2IITA 3LVBA 3SQMA 4NP6A 1H2AS 5EL0A 1XCMA 2K2WA 3M4XA 3QITA 2M6LA 1RYBA 1KI1A 2PKQP 4J16C 4QXAA 1EDBA 4ZT4A 4KBFA 1MZVA 1RHQA 4C6HA 6PFKA 3GEHA 1G3IA 2IYEA 2YJ4A 4QUDA 4F2HA 5IJ9A 5THKA 3L0DA 1W5FA 2J7PD 4FDMA 2DFKB 3GNSA 3Q9SA 4LX0A 1ECLA 3RHFA 3BMNA 1JAZA 1H94A 3F8TA 1USIA 3QEOA 4YRBA 4D42A 3H9UA 4FYWA 4RMGA 2JGRA 4Q7JB 4PE5B 2IUYA 3GY0A 1DLJA 5CP8A 2ZJ8A 3AVTA 4O25A 3IOBA 1Y82A 4GXTA 2FDXA 3UAZA 4QOEA 3BJZA 4TYPA 3SF8A 4EAAA 4ZICA 5ALOA 2I6XA 4BQFA 1BX0A 2FMXA 1Q0PA 2P41A 1KRWA 3PE3A 1T4GA 3O8QA 3ZZ0A 1Y4ZA 2B4RO 3DQPA 4A2CA 4IKEA 4R2LA 1N7IA 4EYKA 3K6SB 4LI3X 1T8TA 1BN7A 1DI0A 4RY2A 4HWRA 5BQOA 3FUTA 3AJDA 5TB5A 1MJHA 1BVRA 5HIKA 4TV9A 1T5DX 1NUTA 2OOSA 2WM9B 3GFPA 1PK8A 1VZ3A 4KQ6A 5DSZA 2WIKA 3TI9A 1NN3A 4BNUA 5T4HA 4ZOBA 3P9CA 3UJDA 4R2MA 1N33B 4LMRA 5FR2A 4RWEA 2D2XA 4DKJA 4N7JA 3DOIA 3DXFA 3GDFA 3PGVA 3R77A 4YQZA 1LBHA 4M4SA 2Z1MA 3Q8MA 5EGSA 1XYVA 1S7CA 5I4CA 1UM8A 1ZJ6A 2EGGA 2RGBA 3TGLA 4DVGA 2CV1A 3IRUA 4FZRA 3IPLA 1N2HA 3U3DA 4H7JA 4P22A 2BEVA 5G4KA 2QP9X 1EE1A 1VKNA 6ABPA 4JEUA 4Z5XA 1ACJA 3HNRA 3EZ2A 2HK8A 3SEAA 2EFGA 3N1UA 3SHFA 3TSZA 1RJEA 5JPIA 2Q8QA 3EXG1 1SCAA 2EIXA 1Y6RA 3OLVA 1S2LA 1Q7CA 2AB0A 1EP9A 1X80B 1MOPA 1ABFA 3LMKA 4JOQA 1R0YA 1G6OA 2NU6A 3N0WA 3B7PA 3TX2A 1TRKA 3FMIA 1EK0A 1VLJA 2QP4A 1JQKA 2DAPA 4X1IA 5KOJB 5LM3A 4TROA 1XYYA 2NG1A 1NVFA 1VHWA 2QUZA 4R8KA 2QP3A 5KHAA 3OLWA 3AM1A 4ZVLA 1G8PA 4TV9F 1YR9A 5KYYA 4TKZA 4JFRA 1IWPB 3IVGA 2O20A 5B3JA 4ND4A 2O2XA 1E7YA 2YWGA 4JYCA 4BX8A 3EDRA 2X3YA 2Q0XA 2W6JA 2XDWA 4XR9A 4Z9AA 3BB3A 3U56A 2J3HA 2WOOA 5CAEB 1AQ6A 2GFIA 3AYXB 3ICCA 3IEPA 2YINC 4N0DA 1D0VA 4EHDA 3MOGA 1FQOA 2QXYA 3JXEA 4DV5B 2GN4A 2HBZA 2PZFA 3DNMA 3G7UA 4NH0A 2E4AA 3TVTA 4HEA1 5IU6A 2UZ4A 1MUUA 3AI1A 2X58A 1EUDB 1Z6ZA 4PY2A 5B64A 2O3RA 4NARA 1DZIA 2G09A 3GJ4A 4G1EB 5IZCA 1YR8A 4FYPA 1BGWA 3AEKB 3IYLW 4IP0A 4X20A 3WQBA 3G59A 2FQWA 3CW8X 3R9XB 4MIYA 1DO0A 4XOIA 1ZMOA 1NNLA 2R5WA 2F64A 1AUOA 1DU4A 4Y9UA 2ZP1A 4BVJA 2I3AA 2ZDGA 2B82A 3P2YA 4FMPA 3FAKA 1KR2A 2B78A 1HDIA 3EPHA 3G8CA 2ZYIA 5IKMA 4G5QA 4G1CA 5DBOA 1R88A 4JLPA 4FFOA 1X1BA 1UBSB 4OHMA 1P8AA 3V55A 3QWAA 4RIHA 5BQFA 3EGDB 3JZFA 3T35A 3GT0A 3JYQA 3B1YA 5AVJA 5P21A 1H2XA 4TMWA 2YWJA 1OXBB 1Z2AA 3HEBA 2QAJA 2C2BA 3SHVA 2O8EA 5IX8A 4UEQA 5AVRA 1E3DA 3VDNB 5AKGA 3DHEA 2J3LA 2PFGA 1KTVA 2NZYA 2VUSA 2FPMA 4NZYA 1GZ3A 3L7KA 3V80A 4W8OA 2C4NA 5EP2A 3N86A 5EESA 4A2WA 3NYWA 4MUJA 2F9FA 4AKEA 2VPPA 4EVIA 5U1PA 1QV7A 3N8KA 1JZTA 1HTTA 1U6IA 1AIPA 4MDHA 4R8RA 4D3ZA 3MIIA 5BW4A 1O95D 5I7FA 1UBEA 4EKEA 5F73A 1RYHA 2WDZA 2ET6A 4HQRA 4XDHA 3RC2A 4JI3B 4DMCA 5K3EA 4X71A 1K4YA 1X8JA 1NN1A 4AT1A 3WYDA 2IHJA 1RRCA 3OKCA 2NVBA 5B3KA 3RC8A 1IL0A 4A23A 1QE5A 2W37A 3K9HA 1VBMA 3CBGA 1TM5E 5CLGA 3PJGA 1RBZA 4MS1A 4D6XA 1Z6QA 3USCS 4C9BA 1O9BA 1F5NA 1P5RA 1JDBB 3GJ7A 2TMYA 2F3QA 2YHIB 4O5AA 3JWIA 4MYRA 5B12A 3JS5A 1LRKA 4EFKA 5IFLA 5GIOE 1MABB 1W5BA 1PT7A 1WXGA 4L5IA 3TXYA 3EISA 5C2JB 1B2RA 1HE2A 3NUGA 1PJRA 3PFIA 1MJGM 2QZ4A 3Q7IA 1E2GA 4XYMA 3ZWVA 4CETA 1DV1A 4QAQA 1NG1A 2HDOA 2JRLA 3I5XA 1M1UA 3K8QA 4B2IA 4LJRA 4MYDA 1L2TA 1P33A 2WWIA 4QJ5A 4D8VA 5AKXA 3S2EA 2Z2ZA 4AY3A 4JL6A 3MSCA 1YOVA 3AIOA 2YTZA 1H8HA 2AFIE 5L6LB 3EHDA 1U04A 4BCDA 1KARA 1GTVA 3QKSB 2P90A 3QOYA 5CYOA 3V1TC 1EINA 1E6LA 2QNIA 3DTVD 1O77A 3CNOA 2WYHA 3OOSA 4GQBA 3C85A 4OLFA 5P8WA 1B43A 3WYCA 1EB8A 5LDGA 3KVOA 5B1SA 3EC7A 2Y1CA 4URFA 4X9XA 3LF1A 4OHYA 4C6TA 4NSNA 5IUJC 4GMHA 1R4MB 4HZUB 4Z4FA 3C3KA 3HCBA 4M0PA 2BGTA 5AM1A 1HYBA 2GERA 1ST2A 2GN1A 5TF4A 5JZVA 2VH5R 4KQCA 1JT9A 2IYPA 1HQYE 1KPGA 3CLSC 3JVIA 1ZH8A 4K6OA 1GL7A 4XEUA 1Y8AA 5ALZA 2I3BA 1RT9A 1NP3A 1FYDA 1YRYE 1WM1A 1MF7A 2DJ5A 4G0XA 1SAYA 3EFOB 4DDWA 4HQ6A 1FL9A 1UJ2A 9GPBA 2FN9A 4RZHA 4M7WA 4AI6A 3FPJA 3TEFA 1NF9A 3E0QA 3EC1A 3PXEA 4C3VA 1S01A 4JKOA 2PSEA 4ESHA 2JGMA 3FPEA 1A5AB 2YVQA 4FYYA 2XRZA 4PLHA 2VK8A 3UKDA 1PT5A 1L8XA 2OXFA 5CM8B 2Z5GA 4QYMA 3ENZA 3ZEAA 4B3FX 3R7BA 1AGYA 5EJFA 4CG1A 1BVYF 2ZRQA 2ZSBA 3K9LA 1CJSA 1ORTA 4PSAA 4HH3C 3O8RA 3RRXA 5JOQA 3EVGA 3HDVA 1V0JA 2NZWA 1T6BY 2VP5A 4OF4A 2EARA 4GI3A 4MK4A 4G1MB 5CB0A 3ODPA 1XRNA 2ZZKA 1N6HA 4FFRA 4UD2A 4UMEA 2HRBA 2JFUA 1KY3A 3HO6A 2QNBA 3LRXA 4I1RA 1NULA 4R31A 1RAAA 1SHJA 1E7WA 4HV4A 1F3OA 2EJCA 3ESRA 3JPWA 2B3DA 3V34A 4AF8A 1KH3A 2B25A 5JS8A 2QENA 5EXXA 4MRVA 1ODJA 4WIAA 3MYRA 2BAGA 1NVWQ 3IPYA 1ND5A 5I3ZA 1KQGA 4PIVA 1UXIA 2BEKA 3HSYA 1Z0DA 3DUFB 4IJ5A 4A26A 1SB9A 1IXSB 4GVLA 3AKYA 1TCCA 4RS4A 4PV7A 3EWAA 3HL0A 3CR8A 1YRHA 3PRKE 3SR4A 3NUQA 3F9CA 3KOMA 5LLDA 4UUQA 1TA4A 1U1DA 2BEWB 1MORA 2JDID 2QZZA 3OF2A 4QATA 1IEVA 4RCVA 4JI5B 4JV5B 1WW3A 1E5XA 4I4NA 3RKUA 4PX2A 3GGDA 5KNCA 2DFDA 2XR1A 4UC0A 5A5FA 5BNTA 2XUQA 5HJ5A 3PXBA 4DR7B 4B6PA 4MR9A 1T3GA 1XLUA 2A88A 5CEFA 1XAGA 3T7RA 5T57A 2JJQA 3RSOA 1F2UA 3PPIA 3TLGB 1LSUA 4N6OA 2B7BA 3AUSA 2R8ZA 2PU5A 4B79A 3KLBA 3SD7A 4NDAA 1H0HA 1LJLA 2BHRA 5JS2A 4DZZA 5AMXA 4V1CA 2X77A 5ALRA 2OKCA 3T1NA 3DDUA 4DT1B 3S99A 4GLJA 5DCUA 5FLKA 4BUZA 5JNVA 3QF7A 2GXAA 1Q1NA 3IS3A 3ZWYA 2WJGA 2CBGA 3F7OA 5A3SA 2RH4A 4WK4B 4E22A 3SI7A 1T29A 2QYSA 5IVDA 4AMBA 4X61A 3ZDFA 4RKQA 1HH4A 2FSUA 1A27A 1F0YA 2R6AA 5EIOA 1CZNA 2JIZA 3QQPA 3LUPA 1SD5A 2QLJA 5KYWA 4KR3A 1ZRNA 3MPUA 4UFOA 4AKSA 2XGMA 4DSOA 1EDDA 5SYMA 4LZLA 3B38A 2LP4Y 1E79A 2FF7A 2QX8A 3IAS1 3KR0A 4HDNA 4TYMA 3WR5A 2ZYGA 3O38A 2EFJA 1DJOA 1JA1A 3OY2A 2YFHA 4FYKA 3QWBA 3IBFA 1EFRA 2JIMA 3Q5EA 2OCAA 2WBLC 4ISBA 3PNBA 1N0UA 3E9YA 4Q4LA 2M32A 1RYDA 3EMKA 1KVQA 1J07A 4JWTA 5ICMA 5B1DA 2NQTA 4I6GA 4A10A 3MBKA 3L5OA 3JX9A 1A72A 5GV7A 2I2DA 4L28A 1GGNA 1YZLA 2XBLA 2EDCA 2FH5B 3I52A 3O4IA 4JJAA 4Q37A 5AKZA 3FMOB 3ZDAA 2HA3A 1V2GA 3OZVA 3TO5A 2FUG1 3CUTA 1NNEA 3Q4GA 5KNCD 1FLVA 3G7NA 4OQ4A 3ZR4B 3HFRA 5ALDA 1FDRA 3O8BA 1GL3A 5BN4B 4G5HA 4JX8A 2X22A 3ZGLA 1QFMA 7MDHA 2BFDA 2Q2OA 3BWYA 4W5OA 2I2FA 3QUCA 4RMIA 4MPTA 2TYSB 3AWDA 1WP4A 1OMOA 4KYIB 2OHHA 1BH2A 1XTKA 3SHQA 2NSJA 2RG1A 4IIDA 1PLKA 3P20A 3TBHA 1QK4A 2AK3A 3BXOA 3GLFA 2O8CB 3G8YA 3ESDA 3TOZA 4KP7A 3ZS9A 2WT9A 4OD0A 2G83A 2QN7A 3FGZA 3CZRA 2O57A 5C32A 3SWWA 1HZZA 3MBIA 1SC6A 3KJIA 4KCGA 4DV4B 2YYYA 2PBZA 3HYTA 1L3IA 3JZAA 4KV7A 4M37A