3ZN2A

Protein engineering of halohydrin dehalogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
253
structure length
253
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single Point Mutation Enhances Hydroxynitrile Synthesis by Halohydrin Dehalogenase.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
molecule keywords HALOHYDRIN DEHALOGENASE
total genus 93
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zn2A00
1MB4A 4YAKA 3DAFA 4FW8A 4NBUA 1R15A 3GVXA 4HXYA 4CPDA 2PK3A 2HMVA 1A72A 1T2CA 2VCYA 4JNKA 3ZGYA 4EJ0A 3HE3A 5JAMA 4P4NA 3DTYA 4RPGA 3VZRA 2QX7A 9LDBA 4J1QA 3VH3A 4BKQA 2PLAA 4DLLA 3DBRB 2JAPA 3WMWA 4BO2A 3U9LA 2HK9A 4OAQA 1ZK3A 3F3SA 3JQGB 1AHHA 3O26A 4EYEA 3E9QA 2JKVA 3NKLA 4R9SA 4AJJA 4KUEA 3Q9UA 2Q1TA 4TROA 2X9NA 3DBHB 4CM5A 4RZIA 4DPMA 1RKXA 4TRRA 5B37A 4BGVA 1EQUA 5DCYA 5KJFA 2EW2A 1FDVA 3A4VA 4U8GA 4W6ZA 3TZQA 4FFLA 1DC5A 2WYUA 4KQXA 3BMOB 1IHYA 1FDTA 4GMGA 4IXWA 3RFTA 3D5TA 4TKLA 3D3WB 1QV6A 1CJCA 1Q0HA 3HNPA 3EDMA 5G0TA 1YOVB 4BV9A 3EW7A 3RKRA 3H9EO 1DLJA 1YJQA 4WEQA 2E48A 1M76A 1C0IA 1ZEJA 3L9XA 1IZ9A 4CQMD 3UICA 4KMSA 4NFHA 4DIOA 3DAPA 1E0DA 1LBEA 5T5QA 1X7GA 3IS3A 3RC1A 4XA8A 2EKLA 5JSFA 3KYDA 4A03A 4BNXA 1WZEA 3AY6A 2FOIA 1LUAA 1P9LA 1R4NA 1UAYA 1CYDA 2IDZA 1QYCA 1E3IA 2ZB4A 2PH3A 2P9CA 1I8TA 3PEFA 1NPYA 3Q3CA 4PLGA 3VPGA 1I2BA 1U8FO 3JV7A 4R3NA 4NU5A 4Q3AA 2P68A 2HSDA 2ZCUA 3LVFO 4Z9XA 3SX2A 4BB5A 5CPBA 5L4NA 2CF6A 2ET6A 2OZPA 1C3VA 4NZ9A 4GVXA 4BKPA 3I9MA 3PFFA 2W2LD 4UUOA 2GERA 4LW8A 4BKOA 3K30A 2Q2VA 4E4YA 4JCOA 4YJFA 3MWDB 1LEHA 2NLOA 3NRCA 4J4BA 2QHXA 3AU9A 2CVZA 1SNYA 2I3GA 3BTVA 3UCFA 3DR3A 3MEQA 1QYVA 4N5LA 3WGZA 3GZNB 4R16A 3JQCA 4YBZA 3WTBA 3WB9A 3PJFA 4B4VA 4K6FA 4TSKA 1T24A 1VJ1A 3ASUA 6LDHA 1B7GO 2DVMA 2UV8A 1KVTA 1YB5A 4ILKA 1LLUA 3VOSA 2E49A 2OP0A 2A9FA 5DDIP 4DLBA 4CQMB 1JU9A 4J2HA 1GQ2A 4HFMA 3CZMA 3OEYA 3CXRA 4PVCA 1AGNA 3RC7A 2GPTA 1U4OA 4J9VA 1EUDA 3RKUA 2PZLA 1WWKA 3ZWYA 1KBZA 3UF0A 4KP7A 2BFOA 4LMRA 1KETA 3ZWCA 3OBBA 2C54A 3C7CB 3QWAA 3PWSA 2C7GA 2CDCA 3OA2A 4CUJA 1NASA 1U3TA 1K6XA 4ZRNA 4EW6A 3L4BA 1I3LA 4WCFC 1U2DA 5CP8A 3QV1A 4A2CA 1R66A 3M1LA 3AOEC 2J3HA 3OIGA 2H1SA 3HHPA 5ENDA 2VWQA 4XX0A 1ZFNA 5ILOA 3MWEB 2I67A 2VYNA 5A9SB 4XJTA 1ZUD1 4AJLA 1I3MA 4DBVO 1E7YA 4F6CA 1ISIA 4OQZA 1ONOA 1DIAA 2IRWA 4U0JA 3SLGA 2ZQZA 3D0OA 1D1TA 1X7DA 2NVBA 1JVBA 3PRJA 4DIBA 3DQPA 4ZICA 5CAEA 3FNFA 4YT8A 1MGOA 1EK5A 2Y1CA 1EBFA 7MDHA 3V5NA 1QRRA 4RVUA 4D43A 2JFHA 2WJPA 2DFVA 1H93A 2BELA 3U62A 5I7VA 3FBGA 1YBAA 2XAAA 1HLDA 2J3KA 5LCXA 4GL4A 3K73O 3GT0A 1HKUA 1U3WA 1CF2O 5I9LA 2WYVA 2X22A 5BNIA 3GHYA 1K6IA 4XJSA 1E92A 1X14A 1ZJYA 3ADOA 3GGPA 4WEOA 3KSZO 3EMKA 2X0JA 3N74A 1MFPA 4IQ0A 1IOLA 4Q3NA 4ZVVA 4IDDA 3CIFA 3U49A 2EERA 1YQDA 1I3NA 3D64A 1K2WA 3FF4A 3GUCA 3LT4A 4R9RA 4DLAA 2YQ5A 1P3DA 5C7LO 1GADO 4MVJI 3CSDA 4PGFA 4QECA 1MXHA 1U4SA 2C2YA 3WXBA 4XWYA 3NJ8A 1O9BA 2DU8A 2PR2A 3N7UA 1GY8A 3ULKA 1KC3A 4N5NA 4YJGA 2WMDA 1UXJA 3KSUA 3ZDFA 4Z0HO 4KUGA 4OXKA 4O1MA 4R1TA 3FSRA 1F8GA 3U3XA 4FR5A 1P1HA 2EF1A 4L8VA 1ZMOA 3JQ7B 1VJTA 4JIGA 4PLHA 3TFOA 1U3VA 2O4UX 1UP7A 4HUJA 1VJ0A 2IE0A 5JDIC 4XYMA 2VUSA 2Y0EA 4TVOA 3GY0A 1NVGA 1PGNA 1ENYA 1EVZA 3AI2A 3DZBA 3DZKA 3IKVA 3WOHA 5JE8A 1SOVA 5ICMA 1R16A 4EUEA 5JXWA 3I9LA 4PLFA 5FF9A 3UW3A 2WTBA 2DPHA 3VTZA 1KY5A 1UDBA 4BO5A 1XKQA 2IEBA 3H3JA 4PFJA 2QYTA 4NBRA 1ZXLA 3PJEA 5F21A 5JMPA 1VSVA 1T4DA 1PS0A 4RDHA 1H9AA 4QFDA 3JSAA 4BL5A 3RASA 2YYYA 3MJSA 1KEWA 4KUHA 5TSDA 3ZW8A 4RCVA 4BNHA 3GF4A 3ROPA 3L0DA 5C5IA 4IINA 4NFYA 2HMTA 3ONFA 5AQ1A 5HRUA 1UZLA 4LCJA 1GYPA 1UP6A 1A4UA 4MIYA 3K8ZA 4FCCA 4B3JA 5L51A 3RUDA 1WZIA 2WD7B 1SEVA 4QO7A 2Y05A 4J43A 4DVJA 1ZSYA 3C8MA 3S2GA 2IZ0A 1ADFA 1LLDA 4N7RA 1PSDA 3ASVA 5JC1A 4CR7A 3ZWXA 3RU9A 3PIIA 1I30A 1VL0A 4FFOA 1HSOA 1VI2A 2HCTA 3KOUA 4IIVA 5JAZA 1E5LA 3M2TA 4DL9A 1U5AA 5A9RA 3TZCA 5A03A 3SJUA 1YDWA 1M67A 3LC2O 3VZSA 5IXYA 3RVDA 1B8VA 2Q45A 2VNSA 4JP3A 3GAFA 1B3RA 1LQUA 2GNAA 4ND4A 2YV2A 3DOOA 2EJWA 3QLJA 2HJRA 4BO1A 2FP4A 1Y5MA 2HAEA 3PQDA 3E18A 3IP1A 3U0BA 4PG5A 1H5QA 2Q1UA 2YY7A 1I01A 2BMAA 1MX3A 5G0SA 1PL6A 3DO5A 3QWFA 4P4GA 1BW9A 2Y1EA 3KUXA 1I10A 2DKNA 5A02A 3AI3A 1QSGA 4RQTA 1B14A 4TRNA 1HDRA 1Y8RA 4RGBA 4OXYA 4B4UA 1LDYA 4OOEA 4YRDA 2PKQO 2P4QA 5C37A 1JDJA 4MKXA 3I83A 3QWHA 2WE7A 3H2SA 2J3IA 3WBFA 3WGIA 4ZQBA 3D1LA 1X1EA 2CVQA 2VWHA 5DNAA 1HL3A 3SC6A 3EGOA 1ZIDA 4GSKA 4YJHA 3QVOA 4MOWA 1VL6A 3ITKA 1TB4A 2A92A 3GDGA 3LYLA 3QIVA 2PA3A 1SPXA 4HX5A 4QEDA 4E0BA 3E82A 1HDXA 3RJ5A 1YJ8A 2SCUA 2FZEA 3L6OO 5AXCA 3ENKA 4RPJA 2DPGA 2VZ0A 2NSDA 1YB1A 4IQ8A 1YBMA 2EIHA 1HYEA 4MVJH 4PG4A 4YTEA 1SB9A 4FJ2A 4Q3EA 1LU9A 2HJSA 3OIFA 3EY4A 2B35A 1I3KA 2D0IA 3GZNA 2Q1SA 5JAIA 3GH3A 1NHGA 4BS9A 1VRWA 1LRJA 3I5MA 3OHSX 5CDGA 4BNMA 1PGPA 3L4SO 3EYWA 4YQZA 1WP4A 1NFQA 4E30A 2FZWA 4L0QA 1V3UA 1XHLA 1U7TA 5JBIA 1BGVA 2AMFA 2E4AA 3WYEA 3KRTA 3KLMX 1Z6ZA 4CQMA 5IDQA 4OHUA 2JD0A 2AEJA 2WD8A 3FR7A 3KV3O 3GZ4A 1J0XO 4FBGA 5CEEA 3RSHA 5ER9A 4BGUA 2NM0A 5JC8A 3GRKA 4AJNA 2Q46A 4B4OA 1TI7A 3WQRA 3EVNA 4PVDA 3ONDA 2JJYA 4FPXA 4J1NA 4BNLA 2TMDA 4CMIB 5IDWA 3PQEA 3JQEA 2A94A 2HKIA 3LF1A 1HDYA 3E1KA 1AN9A 2X86A 2HU2A 2J5KA 3H9GA 3FTNA 1XR3A 1HDOA 3Q0EA 3NAQA 4KQWA 5L45A 3I4CA 2IZZA 1XQ6A 4YYZA 4QQRA 2ZIZA 3CEAA 4TZKA 3BHMA 4I5FA 1PJ3A 1ZSNA 4D41A 1Z45A 3OJFA 5CEFA 3OF2A 4NJOA 2HLPA 5I8ZA 3GMDA 4I8XA 1LDEA 4NU6A 1P1IA 3VVCA 2A4KA 3WGTA 4D3SA 4J1SA 3E6AA 4B79A 3BIOA 1SC6A 1UR5A 2D5AA 4RJTA 5EQDA 4CMJA 4DQUA 3GDOA 2VZ9A 5G4KA 5DN9A 2I3AA 1ULSA 3SLKA 4BNFA 1VPDA 4XR4A 1Q7BA 2HDHA 1W8DA 4B8WA 3RROA 1M6WA 4OSOA 4UAGA 1Z7BA 4C7KA 2YV3A 4RORA 1HE3A 4WLOA 1GTMA 3T7CA 2B37A 3VHRA 2IXAA 4PG8A 4L76A 4XIYA 2Y66A 1B3BA 4YCAA 2GO1A 2VTEA 2JL1A 5JCXA 4H3VA 5A9TA 4CMHA 1KVUA 3QW2A 5GY7A 1X0XA 3G1TA 1T2EA 3PTZA 5TLSA 4CLHA 4Z6KA 2Y1DA 3S55A 3F6YA 4Z9FA 1IPEA 5F1PA 4GKVA 3UKOA 3ZV5A 5L53A 1SEPA 4JJFA 4JN6B 3GA0A 3I6QA 5KVSA 4UREA 2Y0DA 1IYZA 3UUWA 1OZAA 4J9UE 5CDSA 3PFWO 4MO2A 2NUAA 2Z95A 2RHRA 4FSHA 4IM7A 3ZV4A 4E5PA 2GN4A 1R0SA 4KTTE 3LLSA 4INAA 3JQ9A 3CH6A 4AFNA 3AUUA 5K6AC 1DJQA 5J23A 1E3WA 1GUYA 4YJDA 4EITA 1KEPA 5BSEA 5ITWA 3HQ4O 1NBOA 3V1UA 1KYQA 1EQ2A 1MC4A 4MVJE 1Y1PA 5I7EA 1H9BA 2OGUA 3TOXA 2ZTUA 2J8ZA 1A4IA 5ES3A 3WSWA 2FSVA 3BMCA 1UAGA 4WLUA 4XRRA 2OMEA 4D0RA 1A71A 4YT4A 4FGWA 1E3SA 4CR8A 1UXGA 1T1SA 1EE2A 3L07A 3NYWA 1E77A 2ZCVA 1JN0A 5FI5A 1R37A 4YAEA 1X0VA 3GC6A 2YDXA 3JTMA 2FPGA 4QSMA 5G0VA 2JHGA 1I2ZA 3MTGA 4PCVA 3HUDA 5TS3A 2I76A 4IDEA 3FNHA 5K9ZA 1T25A 4I1IA 4TVBA 4B7XA 1YL6A 3G3EA 3OM9A 4J1TA 3GNQA 3O4RA 3KXDA 2WDZA 3ZCXA 2O3JA 3TZ6A 4DXHA 5KJ1A 4ND2A 3A14A 3I6IA 3FPCA 3W6UA 4GWGA 4PG6A 2Q4EA 2F00A 1F06A 1HZJA 1ZMTA 4IZHA 4RF2A 1Q0LA 2UDPA 3P2YA 5KVVA 1GZ3A 2UUOA 3WQQA 4LN1A 1SO8A 1PJBA 3HN7A 1NM5A 3RU7A 5JLAA 1DEHA 3K2EA 1YKFA 4B8ZA 4IXTA 5A06A 2O48X 2PZKA 3GRPA 5IDYA 3LZ6A 1PGJA 3FR8A 4R5HA 1EE9A 3KZVA 2Q2WA 2P2SA 1NQOA 1U1IA 1EVIA 3QHAA 5GZ1A 4JK3A 3ZWAA 3GHHA 1ZSVA 1QORA 3MJCA 5BSGA 1HZZA 2C07A 3GFGA 3P2OA 4XQCA 1WDKA 3NV9A 3TPCA 5DBFA 5TQVA 1HRDA 5GZ6A 1D4FA 5I9NA 4HADA 1DC3A 1OBFO 2PZJA 4K9DA 3RUIA 5EMHA 5THQA 1P45A 1I2CA 4J49A 1NAIA 4C4OA 4WCFB 4ND1A 1C0KA 3QRWA 3HWRA 2AXQA 4H16A 4B4WA 4E12A 1K0UA 2FPPA 5IFLA 1NQAO 5L95A 1R0LA 3EC7A 4RPLA 1PJLA 4M55A 1LA2A 2GZ2A 3FTPA 3ZHBA 2JCXA 4OOFA 2PNFA 4OKNA 1RM3A 2H5LA 2PY6A 4CM6A 4U5QA 1VC2A 1FXSA 1T4BA 3BMQA 3L4BC 3TL2A 4CQLA 5LDHA 3GAZA 4E5YA 3GEMA 3KEOA 2DBZA 1F17A 4K26A 4CMEC 2CSUA 1EEHA 1P33A 3DBVO 2PD6A 4Z0TA 5BNFA 3D4OA 2RAFA 1BVUA 3FWNA 4R68A 5TNXA 1E3JA 1DXYA 3F9IA 4K28A 1J6UA 2LDXA 3M2PA 5F1OA 4R41A 1FMCA 4CM7A 5HA5A 4Y6RA 5T8KA 3U4DA 5U9CA 2EG9A 5A5EA 1NQTA 4DQXA 4JJIA 4CM4B 4BB6A 5BQFA 2HMWA 3CMMA 2VT3A 2AEMA 1DIGA 1DAOA 1PS8A 3G79A 4CV0A 4IGEA 2Y1GA 3GVHA 2BGLA 2GN6A 2P91A 1BG6A 1C14A 4EJ6A 1HYGA 3BZUA 3NUGA 2PKQP 1TXGA 1Y8QA 1B8UA 1Q1NA 3VH2A 5A04A 3D5QA 4PG7A 4D3FA 4GVLA 2GN8A 4YA6A 3WDSA 1VL8A 3KBOA 1NQ5A 2AQHA 2O7SA 4G65A 1IL0A 2J6IA 2B83A 3OJLA 3M1AA 2JD2A 4GGOA 2EV9A 5U4QA 4G81A 3RIHA 1SBYA 1H6AA 1H6CA 4IIUA 3F1LA 3QVSA 4Z3KA 1PEDA 4GX2A 4KOAA 3MCVA 4S1VA 1PZGA 1C1DA 2ZK7A 4CMAA 1VLLA 5ENVA 3TOZA 1WDMA 4MPDA 3LDHA 3FWZA 3FCOA 5THKA 3HG7A 3GDFA 4B3IA 4CLXA 3KEQA 2XXJA 3G0OA 3PLNA 1X7HA 4I5EA 1GL3A 3DMTC 1CETA 3I52A 3WJ7A 4DMMA 5KTKA 1L1FA 3SBOA 4PZDA 2VHXA 4YRAA 2G1UA 2FSSA 3ZNQA 2GSDA 1C0LA 1QG6A 2NTNA 1DDOA 3IKTA 3PZRA 1UDAA 1GV1A 1EDZA 3NDRA 5FI3A 4II2A 5G0UA 1BXKA 1PQPA 2CFCA 2NVUA 1BRMA 3FN4A 3HFGA 3ZHYA 3PQFA 1VE9A 4O5OA 5A3JA 1H6BA 3D4NA 3UN1A 4NFSA 1ZKMA 1NWHA 3JD0A 4R5MA 3UHAA 1ZO8A 1EVYA 2P5YA 5JAQA 3C7DB 1QLJA 3VPFA 2DC1A 2P5UA 1TVEA 4EUHA 3JD4A 1GCUA 3FBTA 4RVGA 5KJ6A 3ZN2A 2ZYAA 4CM9A 1O95A 2O3RA 2YJZA 4R69A 3H2ZA 4UVHA 4XYGA 3VDRA 1M6HA 1GAEO 1DIRA 1Y5RA 3QVXA 4WJZA 2VNAA 4PRLA 2Y0CA 3RUCA 3L6DA 2R00C 4RDIA 3LT1A 2EGGA 5JDIA 3SJ7A 4YT2A 3ST7A 3CKYA 2CDBA 2O23A 2IXBA 3IAHA 5T8KC 1PQWA 2DTXA 3ZU4A 2VUTA 2ZB7A 3BHIA 1LSJA 3OFSA 4HFJA 4S3MA 3TJRA 1ADBA 5A3VA 3ZU3A 4BUCA 1WDLA 2DQ4A 1F0YA 3EUWA 2BFAA 3C1AA 2OBNA 3TQHA 4OGWA 2GRAA 4NNJA 3I3OA 2AHRA 1UZNA 4J16A 5L7YA 1ULUA 1MA0A 2AA3A 4OO3A 3PWKA 4CUKA 4N54A 4DIFA 1NWCA 2X5JO 4MVJD 4JBGA 1E6UA 4BOYA 5DBIA 2D1YA 4ZQFA 1RM0A 5IDXA 4ZA2A 3PYXA 3INTA 3NT4A 5IZ4A 2NTVA 3VAZA 3P5SA 4WE3A 3DMTA 3RBXA 5DULA 4ALMA 1I24A 4BO7A 1KOLA 2DTEA 4J4TA 3VPHA 2RHCA 5TRTA 2ZATA 3ZWVA 2AE1A 1W73A 2I5PO 2WWRA 3JQ7A 4IPTA 2X1HA 4Y8VA 4TMFA 3ADPA 2NVWA 1YDEA 2QIOA 1U8XX 4BO6A 3CINA 2V6MA 3W8EA 1EK6A 1OMOA 1WPQA 1V9LA 5DZSA 2ZJ1A 1ZK2A 3GLQA 3JQFA 3TL3A 4GLLA 2BGMA 4A7PA 1PJ2A 4URFA 1UXKA 1LQTA 2D4AA 3WGYA 5JYEA 3HN2A 3JYOA 1HF3A 3FHLA 2JCYA 4NPCA 1O94A 5TC4A 4YB8A 2W98A 5L7WA 3WTCA 1XSEA 4AJHA 1CRWG 1C0PA 4YJFB 4RLSA 5BSHA 4MKZA 3QY9A 3UGKA 4R4JA 1V3VA 1IHXA 2X5KO 4DBZA 3BMNB 4CJXA 4YXFA 2PGLA 1RYDA 4BNKA 1FJHA 1F12A 4XRGA 1Y81A 4CL3A 3AFNA 4L9RA 1KIFA 2P9EA 4XDYA 3WQSB 4A73A 3QVTA 5F5LA 3O8QA 1DPGA 3AFMA 4MVJM 1LNQA 3WLFA 4A26A 3CZRA 3JYQA 3U4HA 2WSBA 4GSLA 3QQPA 1BDBA 3R6DA 2NU6A 3IQDB 4KZPA 2ZJ0A 1UXIA 1YOVA 4CV3A 1A7KA 1CEQA 1UZMA 3BTUA 4M87A 5IN5A 1RM4A 1I5RA 2RBEA 4MVJF 4O63O 2FR0A 3O03A 3KYCA 1OAAA 4JBIA 4WCDA 3B20A 2VHVA 3NDJA 1X15A 3DEYX 2X0RA 1EUCA 4QXMA 1XEAA 4E2WA 4JP2A 2I6TA 1O5IA 3DHNA 3GGOA 3TZHA 4XCVA 3Q11A 3BMOA 3H7AA 4I08A 3M6IA 3WFIA 1H0KA 1ZCJA 2YHIB 1L7DA 3KSDO 2B5VA 3LT2A 2FPIA 4O6VA 4CMCA 2YHUA 2YQ4A 5G4LA 3H3FA 3KTDA 3E8XA 2C7VA 9LDTA 1LRLA 1E1MA 1RM5A 1K3TA 4B7UA 1A27A 4XB1A 3DZGA 4AJ1A 3D4PA 3WJAA 2O3TA 4NK5A 4R3WA 4KTVE 4IMRA 5FEUA 2C29D 4D42A 3WIDA 3WWZA 3KYDB 3Q6IA 1N7GA 3FRJA 1D8AA 2VHZA 2UUPA 1NYTA 2G82A 4GWKA 3JQBC 4QT0A 2D3TA 1R6DA 4EDFA 2GR9A 1TT5A 3WGQA 2PV7A 2PKRA 3JQDA 3EK2A 1SCUA 1I33A 3K92A 4TKMA 4CMEA 2G17A 3DZJA 3GN2A 3PVZA 1ID1A 1NVTA 1GZ4A 4M49A 4ZQHA 3DONA 5T64A 3ROKA 1ENZA 4PLCA 5TJ9A 1A9YA 2DFDA 4W82A 3AK4A 3HJAA 4W9NA 3E03A 5COBA 3HB4X 3JQAD 3QP9A 2BKAA 2ZTVA 3B6ZA 1BTOA 1RWBA 5MGBA 2QQ5A 1GDHA 2EJVA 3VKUA 1EZ4A 4DC1A 3MOIA 1PR9A 4IS3A 5FWNA 1DO8A 5F3RA 3RCBA 2W2KA 3ZWPA 4YACA 1KVRA 3TZKA 2GZ3A 3ONEA 2C20A 1HETA 5ITVA 1HE4A 2WE8A 3TDKA 5A4DA 3PYLA 3OSUA 5IF3A 4XYLA 3VTFA 4WLFA 3MJEA 1Y7TA 4GMFA 4PZCA 2DAPA 4YR9A 3RUHA 2Q1WA 2VYVD 2BI8A 3SEFA 2BD0A 5JY1A 1YO6A 3PWZA 2I99A 4W7HA 2O2YA 2DLDA 4JROA 3AY3A 3GR6A 3G49A 1HDZA 3IIEA 4JBHA 3ZH2A 1N7HA 3UCEA 4DYVA 3KYBA 5ADHA 3PIDA 3GOHA 3NTRA 3DBLA 4OL9A 2VQ3A 4RQUA 1EFLA 3UH1A 3PGJA 4YEDA 4PLZA 1YXMA 2O2SA 3W8DA 4FC7A 4Z0PA 3T4EA 4IMPA 2AQIA 4KDEA 3ETDA 4TRJA 4UULA 1P0FA 3GVCA 1E7RA 1M75A 4NBVA 4OXNA 3JD2A 3I1JA 5AOVA 1FDUA 1WMBA 4B3HA 3IJRA 1ZZEA 2BFMA 2NVUB 1P44A 4L73A 5A05A 2I9PA 3RFXA 3JCZA 4CV2A 1W0CA 4ND5A 4U7WA 3ZNPA 1DIHA 1SOWA 4E5NA 2ZTLA 2AW5A 1ZBQA 3ZWOA 4F46A 2H63A 1MFZA 3HDHA 3PHGA 3F47A 1OC2A 3DHEA 5KVQA 5CPFA 5TJHA 1KEUA 4M8SA 1ORRA 4UEJA 4YT5A 3HB5X 1ZNQO 2W4QA 4ONEA 1DFHA 1MUUA 1PQUA 3C3XA 5DOVA 1W4ZA 2Y67A 2FHSA 3JQ6A 4FN4A 1Q0QA 3QSGA 4LRTB 2X8LA 4P38A 3K2BA 5EN4A 3F4BA 1BWSA 1LDBA 1QYXA 4UUPA 1N9GA 1N9GB 4ZGWA 3PHHA 3VH1A 2B69A 1EBUA 1GQQA 3AOGA 2VT2A 2Q49A 1LJ8A 2OFPA 3MJVA 3OIDA 1LXCA 3UOGA 5DCUA 3S8MA 4ZJUA 1C1XA 2JFFA 1N2SA 3O38A 3RD5A 3K96A 4BMVA 3GMSA 4ZQEA 3PHJA 3ZNNA 4OM8A 1NPDA 3QJ5A 2NADA 4HNHA 1DAPA 2VRCA 4WLNA 1D3AA 3BMCB 3GEDA 1QLHA 4OQYA 1PJSA 4UVEA 1YQGA 1ENPA 1IY8A 3QWBA 2R2GA 1PIWA 4R1UA 2AEFA 4PLYA 3D3WA 4Q3BA 2CDAA 4IQGA 2X4GA 3HDQA 1AE1A 4AJ2A 1E3WB 3G17A 4GH5A 4YJGB 4L74A 2VWPA 3LC1O 4GPD1 3E9MA 4TZTA 1N5DA 5KOIA 4RF5A 3VKVA 1ONPA 4ND3A 1DRVA 2VN8A 4UEKA 3C1TA 4F6LA 4DMLA 3GG2A 4RV9A 5KKCA 1Z82A 3C7AA 3ON5A 4LRSB 5JS6A 3JQ8B 3OJEA 5DF1A 1WXDA 1T2AA 4E2ZA 1HWYA 1Z75A 5CDUA 3WICA 2NACA 3WBBA 5K0ZA 2GCGA 1XGKA 1Q7GA 1NFFA 1QR6A 4K1LA 5KNLA 1DRWA 1LRKA 1BDMA 1UH5A 4XB2A 2W8ZA 4BNNA 3RFVA 4DYDA 4E2YA 4NQZA 1IZ0A 1LLQA 4FIZA 3PXXA 1P77A 1BXGB 5BSFA 2OHXA 4NH4A 1BXGA 5AXDA 2O3QA 3OA0A 3TNLA 1QXSA 1J5PA 1M66A 4UVIA 4KDFA 4I9HA 2PZMA 1Y9AA 4WUVA 2Y68A 4AJEA 1BMDA 3QA9A 1DJNA 2J3JA 3BMNA 3DBHA 2HK7A 1NFRA 1YH3A 1AUPA 4XDZA 2O4CA 5EQFA 4CLRB 2GDZA 4CLRA 2VUUA 2IODA 3AU8A 4BNYA 4ALNA 3H4VA 3O8QB 1R4MB 4XQEA 4MVJA 3VDQA 3OMLA 4FOOA 2OO5A 3FI9A 3V1YA 2W2LA 4I5DA 5IAAA 2CMDA 4R51A 2DBVO 2Y93A 4WASA 3V1TC 5JYDA 3NGLA 4DC0A 2JCVA 4NDNE 4IJKA 1HE2A 2NV6A 5JNLA 1ISFA 3L9WA 1P74A 1V0JA 3KYCB 3DDNA 4OMUA 1T2FA 5T67A 1Y8RB 1V35A 1GUFA 3CPSA 4GKBA 5HWSA 3S2FA 4HFNA 1QYDA 5KVCA 1V8BA 3DTTA 2ZB8A 5B4VA 1EFKA 1OI7A 4J7UA 2ZQYA 3CE6A 3GG9A 1PL8A 1MLDA 4II3A 3ZU2A 3BTSA 3JYNA 4WCFA 4J7XA 1MC5A 4D44A 1D7OA 5KWEA 2XPCA 4J4HA 1ONNA 2DUWA 4A5OA 3H9QA 3EZLA 4IJUA 4ALIA 1I32A 3F5QA 1E7QA 1GQYA 2VRBA 4W9NC 2VOJA 4FS3A 4XGNA 3UVEA 4QTZA 1ADGA 1PS9A 3U09A 1I0ZA 5EERA 5COQA 4MP3A 3Q1LA 1EMDA 3AM3A 5ER6A 5FYDA 4F45A 1GUZA 2RCYA 2DBQA 3WSVA 5B12A 1GU7A 2X9GA 2FN7A 4RL6A 4WLEA 1U3UA 2H9IA 2X9VA 3AM5A 3KO8A 3Q2IA 1JKFA 4GX1A 4CM1A 2X7HA 1TT5B 3AUSA 3PPIA 1AXEA 3PGXA 4D79A 4R54A 3A9WA 2GLXA 3OQBA 2O3UA 2VYND 4PLTA 8ADHA 5L3ZA 3C1OA 4XIJA 2POQX 1OOEA 1KVQA 3UFXA 3OJ0A 5IXSA 2HRBA 2PH5A 3EZYA 4OJNA 2Q50A 3PLRA 1NP3A 3MOGA 4ZU3A 4CLOB 1C1DB 1WAMA 5ICSA 5TIIA 2IYOA 2NQ8A 4MJLA 3ABIA 5F5NA 4Y9DA 2AE2A 1QP8A 2PGDA 2C2XA 4LMPA 1TLTA 2CVOA 2WM3A 1W6UA 1X13A 3WGHA 3KB6A 1R0KA 4NBWA 1JTVA 1O8CA 4BO9A 2BI7A 3K31A 4K6CA 5EPOA 2V7PA 1NX6A 2B36A 5JO9A 3UCXA 2GYYA 1S6YA 3KVOA 3P19A 2QW8A 5KJEA 1G1AA 2OL4A 2OP1A 4GLOA 3ZWNA 5CFZA 1P1FA 5HS6A 3WLEA 4MKRA 4FD3A 5TT1A 3I23A 4WNCA 1Q2XA 1IULA 3RUAA 2EP5A 2I65A 3DZHA 5CEJA 1LDGA 3PDJA 1O89A 3WG9A 5I7SA 5A9SA 1T2DA 2NNLD 3PZBA 2DUUA 2XF8A 3RBVA 5JCJD 4FC6A 4RF4A 5HM8A 1LSSA 4J0FA 4N5MA 3W6ZA 4DQVA 3B1FA 2W90A 1UP4A 4NBTA 5DOZA 2D59A 2Z5LA 1QV7A 1UXHA 1BVRA 1HDCA 4G5HA 4XD2A 3WFJA 4JLWA 3H5RA 1XYGA 1YRLA 3NTOA 3DWFA 1PZHA 4LSWA 4PLVA 4BNGA 3JD3A 3NTQA 4CL8A 3PDUA 1L7EA 4PN3A 4FJ1A 3Q9NA 1QMGA 4WKGA 4ZQGA 2NU8A 2FR1A 4LSMA 4AVYA 4GQAA 4WNIA 4YAIA 3ITDA 3NT5A 3OEWA 5CDYA 3A28A 1QKIA 5C7IO 4OKIA 4WOJA 3WYBA 2JFGA 3MJ4A 1B15A 3EVTA 3IUPA 1YB4A 1GYQA 3DBRA 1HDGO 1CWUA 4MIOA 3KETA 3X2EA 4IJWA 2GN9A 3AUTA 2XOXA 2HMSA 1P1RA 3GPIA 3JQAA 3WX0A 4BO8A 4XYEA 3RJ9A 4N18A 2QZ9A 4FFNA 5TGDA 1DC6A 2R6JA 3LC7O 4E5MA 3KLPX 4FQ8A 2H6EA 3TRIA 4PLWA 2PWZA 1ISJA 3ENNA 2JAHA 3I4FA 5K6AA 6ADHA 5G4KB 3RC2A 2ZB3A 4NJMB 1JVSA 1IB6A 1U2GA 4O59O 3MZ0A 3V2GA 4E5KA 5IZCC 2ZTMA 1DHRA 3KM0A 3OJOA 2NU9A 4CLEA 1HYHA 1WW8A 4FGSA 5T6BA 2O3SA 2X0IA 4P8RA 4Y67A 5CHEA 3JQGA 3AM4A 1D1SA 1YE3A 1XG5A 5BR7A 1XELA 1Y6JA 1DBVO 2UAGA 4MVJG 1PU2A 4YRBA 2VYVA 2PD4A 1B26A 4WK6A 4Z9YA 4BV8A 1HSZA 3BA1A 3NGXA 1XU9A 4WGGA 4NR0A 4J3FA 4L75A 4DA9A 1YL7A 3N58A 3DFUA 1V6AA 1GFSA 3JD1A 3K5PA 4IDGA 3OH8A 1WNTA 2DT5A 3COSA 4JJGA 1XWFA 2ZYDA 1E5QA 4M54A 4EGFA 1N1GA 4BGEA 4B7CA 3WYCA 3BTOA 4DWVA 2YFHA 3JQBA 3GNSA 4ID9A 1CQIA 3PP8A 4CUZA 3EHEA 4RVFA 3WS7A 5HS4A 1PWXA 3JQ9C 4D46A 5BNTA 4QFCA 5H82A 2HMUA 2D5CA 3D3EA 5I9MA 2BF7A 2ZYGA 1P1JA 3TSCA 2OUIA 3E5RA 4HP8A 3TWOA 4E31A 4MP8A 1ZW1A 5A5FA 1CIVA 1R4NB 1PTJA 3I9KA 1K5HA 1DB3A 1E6EA 4CM8B 4LK3A 4WECA 3ZZNA 2XXBA 1KERA 4XGIA 4CM8A 3IUSA 3ZV6A 3CTMA 4M89A 5CG2A 1PZFA 1PJCA 4Y98A 5GMOA 1Y9EA 3EAGA 4R1SA 1YGYA 3DXFA 3ROMA 4LVCA 2Y1OA 2OOSA 2F1KA 1AHIA 3T7EA 4IDCA 3K6JA 1MXFA 3RC9A 2HUNA 3DHYA 3X2FA 2VZ8A 2QYSA 4EJMA 2Z1MA 2V6GA 4GI2A 3LU1A 2E6UX 2QRLA 4BGIA 4JGBA 3AJRA 1E7SA 4Q9NA 3ZHZA 3B1KA 1IUKA 2HK8A 3BYZA 3AY7A 1J49A 5T57A 1CQJA 2E37A 3WWYA 3U4CA 2VTDA 1ZVMA 5KIAA 5EL0A 1FF9A 2DTDA 2YHIA 5JCJA 1LI4A 1E7WA 1K6JA 4XGKA 5DT9A 1F14A 2X58A 2B0JA 3GK3A 5TX7A 3S2EA 5GZ3A 3DZIA 4W4TA 3F4LA 1K89A 2G5CA 1Z74A 1KVSA 3DMYA 2NU7A 3T4XA 5B4TA 3STHA 1OFGA 1ADCA 4BQPA 5DBGA 4TWRA 5JMWA 2AQ8A 4AJIA 1KEVA 1GCOA 4FFMA 1U28A 4MINA 3AWDA 1JW9B 3HZZA 2NWQA 2VHYA 1LTHR 3LSYA 3MJTA 4YJHB 3L77A 1U7HA 2X0NA 3BAZA 4GGPA 4FDAA 2LDBA 3GQVA 4TQGA 4QUKA 4BNJA 1A5ZA 1IPFA 3ORFA 1M2WA 1TT7A 1XA0A 2BLLA 3HDYA 4G2NA 5F1KA 4IZIA 3LLVA 2J5QA 1DLIA 2IZ1A 1TA4A 1E3EA 7ADHA 4M1QA 1X1TA 1GPDG 1PJQA 4WLVA 4EZBA 3LT0A 1ISMA 2CNBA 3SVTA 5ILGA 1ZH8A 1FDSA 2QRKA 1GPJA 4NK4A 4UUNA 4H15A 3GN1A 3OICA 4XEHA 5L7TA 4UEOA 3ETEA 3NT2A 4AG3A 2PTGA 1PGOA 2FMUA 4HY3A 1JKIA 2X5OA 1FK8A 2RH4A 2FR8A 3Q2KA 1NPTO 3DC2A 4IBOA 4E21A 1PGQA 4I9UA 2B5WA 4UUMA 1XIVA 3RQSA 2EW8A 3WGGA 1RPNA 3DB2A 1H6DA 1T1RA 4J7CA 4FJ0A 4CM4A 5TF4A 2OBYA 4CMKA 5C7OO 2CF5A 2P9GA 1PJ4A 3PYMA 4D7AA 3S2IA 1ZK1A 4PRKA 3VC7A 1N8KA 3QE3A 1LC0A 1NXQA 4EUFA 4ALKA 5G2OA 4MP6A 3W1VA 3K9QO 4IUYA 4AJOA 3LQFA 1SB8A 3I9NA 4J6FA 2YFQA 4NG5A 2Q3EA 3G1UA 3NX4A 3VZQA 4BIIA 4DRYA 4ITUA 3P7MA 3UXYA 4D0SA 4EEXA 4JQCA 2D2IA 4J0EA 2FWMX 1GD1O 4XQGA 2D8AA 1XU7A 2GASA 3B70A 4NHEA 1P1KA 2X23A 5AYVA 4CV1A 4RPHA 4BNWA 3TF5A 2CD9A 4CM3A 1F8FA 2CZCA 1ARZA 4H7PA 1JQBA 5H83A 4RPKA 5JFOA 4XKJA 3NDIA 4U6QA 2YZ7A 1NVMB 1P31A 1MP0A 4IY1A 1GV0A 1HXHA 1LX6A 5C3MA 3TN7A 3R3JA 3S1LA 3F46A 4XZ3A 1VM6A 2IYPA 1DOHA 2YW9A 3PK0A 1DRUA 4NI5A 3C85A 2UVDA 5JDCA 4YWJA 1NHWA 1JKJA 4BHTA 3VPSA 2Z1NA 3GUYA 3DAGA 3DOCA 4XQ9A 1E6WA 5KKAA 1YVEI 4BO0A 3PJDA 5EJ2A 4BMSA 3HSKA 1JWBB 1KC1A 1LSOA 5IZCA 3GVPA 2HRZA 1LC3A 3ZV3A 4U6SA 4D45A 1WMAA 2B4RO 2FRDA 3SXPA 3I9OA 5LDGA 3FNGA 3ZHXA 2DM6A 3KHUA 5JY6A 3W4KA 1Q7CA 2BRUA 2O7QA 5AXAA 3IOYA 3F1KA 1HE5A 2VRCD 4YAGA 4A0SA 3ZI0A 1BSVA 4HFRA 1SMKA 2CY0A 4Z3DA 4F3YA 4C7JA 1VKNA 4RZHA 4IDAA 4E33A 1O6ZA 4DPLA 3H5AA 4AL4A 4FFRA 3TFQA 3RWBA 3IL2A 3VZPA 3W8FA 4IGFA 2HQ1A 4X54A 1EDOA 4NJMA 4BNTA 1E3LA 3R1IA 1H94A 1R4MA 3H5NA 4RO0A 2BHLA 3FNEA 3GGGA 4L4RA 4ZN6A 1V3TA 1UUFA 2WD7A 4DPKA 1ZEMA 4BO3A 1E7MA 4CMGA 2UYYA 3AUAA 3ANLA 1BW9B 3ZNOA 3U5TA 2RIRA 3O9ZA 1P0CA 1SZJG 4RF3A 1HEUA 5AVOA 4BNIA 1MG5A 1I36A 2O50A 3F5SA 2AQKA 3E5MA 2G76A 2IEDA 3DL2A 4R1NA 4ESOA 3BMQB 3ANNA 5DP1A 2CUKA 1B8PA 1CDOA 2X6TA 4FOSA 1DHTA 1Z73A 4Y6SA 2C0CA 3L6EA 3JQ8A 4CLDA 3C24A 2QG4A 2DBRA 2FY8A 3GNTA 5EIOA 1CERA 1UDCA 1G6KA 2B4TO 3NJ4A 2QZZA 4AJ4A 4BO4A 4PLPA 1KS9A 1JLLA 3B1JA 1WVGA 2V65A 4CR6A 1B2LA 1B0AA 4Q3CA 4DUPA 3OP4A 5H81A 4HV4A 4EI2A 1J4AA 3V2UA 5HTOA 2BH9A 3HFSA 3GEGA 4LISA 5EINA 4EEZA 4KWHA 4MDHA 3WIEA 4AICA 4DREA 2Y1FA 1GZ6A 4TRMA 2EXXA 4I5GA 1LLCA 3QVWA 2EKPA 1RJWA 1N92A 5JDCC 4J90A 4PZEA 1DC4A 1DIBA 3FD8A 1PZEA 4A10A 4J91A 4GX0A 2Y99A 1JAXA 1YS4A 4FFPA 3PHLA 3GFBA 3GVIA 4W99A 3RBZA 1Y8QB 1VSUA 3R3SA 1XLTA 4Y6PA 3RUEA 1E1KA 2E82A 4HNGA 8LDHA 1YBVA 2A35A 2BFPA 1R12A 2WYWA 2OORA 4AJPA 4YVFA 2GUGA 3RAJA 4WOKA 4BNUA 1DFIA 4IJVA 4YDRA 4E6PA 1LDNA 4R01A 5HBRA 4BVAA 3RI3A 5I8WA 2YV1A 4ZRMA 3DZFA 3ROQA 1PL7A 2JD1A 2OXIA 5AXBA 4UVDA 5B4UA 5L9AA 1S7CA 4J2OA 2EP7A 4O0LA 4MIEA 3IDSA 3ZWBA 3U4IA 1YONA 4QO8A 3A06A 1ISGA 4Q39A 3V8BA 3CMCO 4WPGA 4CMIA 1HLPA 5LC1A 4OH1A 2GF2A 2W2KB 4ROSA 1ENOA 4HKTA 4BKRA 4LGVA 4P22A 3ZWWA 3ETGA 4OIMA 3WGOA 4OYRA 1A9ZA 2C59A 1LSUA 3LF2A 5I7FA 2QRJA 4EBFA 1YL5A 1U5CA 4XR9A 3VH4A 1NR1A 5CG1A 2EGHA 4GAEA 4GX5A 4IS2A 3OQ1A 4JXKA 4ALJA 1RYEA 2TMGA 1ZK4A 3ZU5A 3IJPA 1UJMA 3SC4A 4A27A 1E1LA 2GZ1A 1ZXBA 1XDWA 4W7IA 2VOEA 4CQLB 1WLYA 4FB5A 2ZKLA 2HO5A 2EKQA 4BMNA 3INRA 3LK7A 3R0IA 4QX6A 5A1TA 1H2HA 1HTBA 1KY4A 2GGSA 3OETA 3DBLB 2GD1O 4YAJA 1DFGA 2JHFA 1NNUA 4HWKA 1H2BA 3OECA 1N1EA 2V6FA 4IDFA 2Q99A 1MV8A 4BQRA 1JA9A 4LVUA 5KCZA 4DGSA 1ZK0A 4NMHA 3HDJA 1E1NA 4YPOA 3PI7A 3OQ6A 4JX8A 4L4SA 3WR5A 1NTOA 3DFZA 3PJGA 1MG0A 2BGKA 3E48A 3IMFA 3WNVA 4KWIA 4RVSA 2B4QA 1NAHA 4CLOA 2ILTA 2PD3A 3CUKA 2G0TA 1TEHA 4LCEA 3AI1A 2AG8A 1JAYA 5JW6A 1ISHA 3JQAB 3AOEA 3RUFA 5DCWA 5U1PA 1ZJZA 1LDMA 4Q3DA 2I66A 1G0OA 2VHWA 2RH8A 2R00A 1NR7A 5JO0A 3IP3A 4OSPA 3ICCA 1PWZA 2C5EA 4PIVA 2PFGA 3WNQA 4BKUA 4E13A 4E32A 4RVHA 4YQYA 4L4XA 3H9JA 3H65A 1AXGA 2YUTA 5DP2A 4D3DA 3DOJA 1QYWA 2EHDA 1IE3A 3HADA 5JPIA 5KJCA 3W4JA 2EEZA 3ZWMA 3INGA 2EWMA 1GYRA 3V2HA 4MVJP 1G0NA 1JWAB 1PX0A 1XCBA 5CDTA 1GEEA 2AG5A 4HBGA 3VPXA 3GPDG 5G0WA 3IC5A 3ICPA 1C1XB 1YWGO 4ALLA 4CM9D 1SAYA 2PGJA 4U0KA 1PR3A 3H8VA 3PHIA 3BHJA 3AW9A 5FFFA 1HT0A 2NQTA 5COAA 4RLHA 4AJKA 4BNVA 3W4IA 3BXXA 5L40A 5L4LA 4DTIA 3H9UA 5TT0A 3VVBA 4IDBA 2WEKA 1T26A 4I9NA 3UAGA 1ML3A 4GBJA 4E2XA 3H6KA 5B1YA 1DSSG 1PJTA 2YDYA 1A7AA 2Q4BA 1EUZA 1GEGA 2J5RA 2P4HX 3NEPX 1U9JA 3I9JA 1B16A 2Q2QA 3JQFC 4BNZA 3E9NA 1XQ1A 2C82A 5BT9A 3ZW9A 4E3ZA 3JYLA 1VKOA 1BHSA 1YQXA 4UVGA 4P4LA 5L4SA 4CMBA 2VWGA 3ANMA 5IG2A 5IJZA 4ZD6A 3WMXA 2V6BA 1BXZA 3MTJA 3FPLA 5IN4A 1Z7EA 3A1NA 1FDWA 3JYPA 4CODB 5MDHA 2NTJA 1GR0A 3QWIA 4NIMA 4XYBA 1EVJA 2C5AA 4RVDA 4M86A 4ZHSA 1OC4A 3D7LA 1O0SA 5EESA
chains in the Genus database with same CATH superfamily
5A4KA 3N6VA 2A86A 4YAKA 3LT5A 4OFBA 1ZI6A 3PGLA 2WIKA 2VCYA 1A72A 3DLTA 3EYAA 4Z1OA 1CIPA 2J9ZB 2ZRPA 4ZVRA 4C05A 3K70B 4XH9B 2H31A 3SIWA 3U37A 2EOAA 2BF4A 2CCGA 1M8FA 1W49A 1FSSA 1SCIA 1KAGA 1CRPA 3ZXXA 2JAPA 2XX3A 2W6OA 3EIXA 4OAQA 4PZAA 4HLQB 3SSMA 3D2AA 5LQSA 3JQGB 1BROA 1NLUA 4AD8A 4EYEA 2DCUA 1YQQA 3WB1A 3E9QA 2JKVA 2I0FA 3NKLA 2GJ9A 2AOVA 2Q9AA 2WNSA 2RIPA 3QYJA 4G0NA 4KLZA 2ZVQX 2ZYIA 3K1TA 4R9SA 3TEJA 3Q9UA 3TI7A 3CVXA 1M2FA 4GPAA 3PKIA 4MYRA 3DBHB 4DPMA 4RZIA 3AP2A 4NMMA 1W46A 1BE1A 3RS8A 1OBCA 4DCGA 1FSFA 1RYNA 1FDVA 1GA1A 4O2BA 1W6RA 4Z4IA 5KREA 2C7PA 1OQAA 1RPJA 2J59A 3FYUC 5EPUA 1Z13A 2PO7A 3PSAA 2BBSA 1CUFA 2RHBA 1KMMA 3BERA 3BIXA 5DTQA 2CKMA 1TTPB 5JS7A 1M0WA 4PC6A 4GMGA 3EPLA 4Z4CA 5IEBA 3RFTA 5FUWA 4TKLA 3D3WB 1QV6A 3L05A 3R3HA 4OXQA 4PZ0A 2XTNA 1B6TA 1JV2B 3IH5A 3NNDA 4ETMA 3FTFA 2BI4A 3NNSA 1O96A 4MMXB 5MF6A 3TZLA 4AAYA 4J3NA 2IS6A 1L4YA 4KFUA 3LGAA 1NQWA 1V7QA 2E48A 5AIBA 1WBJB 4G09A 3IPAA 2JFPA 1C0IA 1MV5A 1YD7A 3WWOA 3GLTA 1IZ9A 2YWDA 4DV4B 3I01M 1I94B 2VDOB 5K0LA 1ZG3A 2GTIA 4HYYA 5T5QA 3CQ9A 3KHKA 3HLYA 3HKCA 5JSFA 1H42A 2QYHA 3ICOA 4YCSA 4BNXA 3AI7A 3C70A 5K6RA 4EHAA 3A6EA 3GJTA 1LUAA 1R4NA 5ALYA 5BSMA 1UAYA 2JAUA 2YWCA 3CUSA 4KPGA 4YUVA 2PRZA 1A8IA 1Q95A 1LD3A 2GVNA 1E3IA 4RY2A 5DIZA 5IAOA 1I5EA 5CM9C 2PH3A 2YICA 5JSZA 2L0XA 2RGAA 2VDVE 3ZUGA 3RRJA 1U0LA 4OU5A 4MGHA 5EKXA 4PR0A 1I2BA 3VU1A 1EDBA 1W4BA 3BF7A 4EGQA 2ZIFA 4Q3AA 4IJMA 5E6UB 2QUHA 3G88A 3G13A 3FVRA 5L4NA 2I7DA 2CLIB 4JB3A 5DB4A 1NUHA 2OZPA 1C3VA 3RIEA 1T6ZA 2C7BA 3QVGB 4BKPA 3D2CA 4M1KA 4UJ3A 1O77A 5CNIA 4AROA 1R9JA 1YRYE 2Q2VA 1DRKA 3KEGA 3KKKA 4JCOA 1M2OA 3MWDB 2XYVA 1SWVA 5JAMA 2JATA 1D04A 3KD2A 3OX3A 3AU9A 2CVZA 2I4LA 3BTVA 2VNHA 4EENA 1FTQA 3S4YA 2NMVA 1C1HA 4KKXB 1SG6A 3JQCA 521PA 3OQPA 3WB9A 1QVAA 2G0NA 4B4VA 3E22A 4I4TB 4MLDA 1VJ1A 4QGFA 1T5DX 2A9KA 4ZYUA 5BNWA 1B7GO 3MRXA 3DWIA 1S1MA 5JQGA 4ILKA 2VG8A 5JHHB 3IJEB 3JVIA 1XMJA 3LWBA 4G36A 4M99A 2E49A 3W2FA 2XA2A 1SXGA 5DDIP 5J5CA 4CQMB 4DLBA 3T12A 1JU9A 4HFMA 3LUGA 2DWUA 3VGJA 1X39A 3CZMA 3EASA 5ULLA 1AGNA 3ZK9A 2IYEA 1RP1A 3AEYA 1T4MA 3L1UA 1QRSA 2QTMA 1DBSA 2BDUA 1S3FA 2I03A 3GRFA 1QJ4A 2PZLA 1E58A 3PRKE 4LQDA 4C0KA 2LP4Y 3SM9A 2CDRA 3OQHA 1FYWA 3RKSA 3FRHA 3UF0A 5FJIA 1BQ4A 1V8PA 4LMRA 3RE1A 4BLSA 2WAMA 2Q6OA 1ULHA 3TLXA 4JEMA 3QWAA 2AI3A 4QYTA 4PE5B 1DDIA 1LPAB 1U1CA 1IUOA 4MR7A 1WB4A 1A5AB 3MAJA 3KNZA 1NASA 3PITA 2CSXA 4PHTA 1U3TA 1YR8A 5DEOA 1X8XA 2P90A 4CKCA 2V7TA 4XD7D 4EG7A 3CVWA 1YJBA 4WCFC 1U7DA 1X38A 4R7ZA 5FWAA 1Y0BA 3M1LA 4D9KA 5JSQA 2J3HA 1SGWA 3BXZA 3LW7A 3OIGA 4KHZA 4QUBA 2AJ8A 2K4MA 4K05A 1P2VA 4AJLA 3SQXA 4DKJA 2PZGA 5HG0A 1XFDA 4G97A 1M72A 5G53C 2WY2D 1P2UA 4XE5A 3SR3A 1RNLA 4A0QA 1RRVA 3WDMA 4IXDA 2IRWA 1Z0IA 1VP9A 1LPSA 1T5OA 2H54A 3H1EA 2ZQZA 3AL0C 2NYVA 2ZROA 1D1TA 4BCCA 3O94A 3CBQA 3LRPA 4ZC1A 3M1IA 4U5XA 1EK5A 1EBFA 1GAWA 2ZSFA 3E2IA 3V5NA 3SSAA 1EXVA 10MHA 3KOOA 1QRRA 4D43A 2IY8A 1ZGGA 5LUAA 3W5UA 2INGX 3OHMA 1AH2A 1H93A 2BELA 2XJ9A 3WZLA 3FBGA 5KNCD 4E3WA 2XAAA 1WZCA 3BJRA 1L5YA 1AGYA 2ZUCA 4IOJA 3ZI4A 3IKJA 1ZESA 3BJIC 2N47A 3D9QX 3K73O 4RY8A 1QGOA 3TB4A 1U3WA 4MW1A 1P91A 1JLSA 4MARA 3ND6A 3EGCA 1J25A 4LE0A 1KSGA 2HX1A 1I1QB 2OCBA 5CCXA 1QFMA 1NRWA 2A9RA 3UMVA 4D4IA 1Y8ZA 3MUEA 2GCEA 1K6IA 2HLHA 1SBHA 2DB3A 4JP8A 1E92A 3OLVA 4TV9B 4UHKA 5EKDA 4WEOA 2YVAA 3KSZO 1NQUA 3EMKA 3SK0A 2QN3A 3CF0A 1N8NA 1O58A 1OBHA 4WZAB 3SJCA 4OCZA 3RLIA 2R7MA 1CE8B 2FOXA 2QRVB 3GROA 4IQ0A 4MUYA 4BE7B 1RXUA 2FVYA 4MV7A 2XKAA 5CX4A 2EERA 4YCMA 4JQSA 2H4ZA 3ESYA 5CW1A 4ZHQB 5JRDS 4MVJI 4U1RA 3QLVA 1OTXA 4O4JB 3CSDA 5EKUA 4PGFA 2XBLA 1FL9A 4M7RA 1U4SA 2C2YA 2EZ4A 2FKNA 4JLOA 4Y1RB 3OE7A 5K3AA 2M6LA 4GRAA 3P2KA 4M6WA 5DGHA 3PUZA 3TL6A 2DU8A 5CX1A 1Z5VA 4NTZA 1YQTA 3TLJA 4RHYA 4H1HA 2XNCA 4FFSA 4YCBA 5HKAA 3C3PA 2WMDA 3H75A 4CL0A 3STYA 1GUAA 2C4KA 4V02A 1L9KA 2BHNA 1J2YA 3VBCA 1N77A 3RVLA 5EWLA 2F1IA 2ONZA 3N6RA 3FSRA 1UK7A 4B3CA 1EP3B 1H2XA 2PHZA 1LBTA 4Q93A 2JJ8A 2Y6VA 2AYXA 3GBPA 2BDEA 3H1FA 4L8VA 4OPMA 5G1PA 4CN9A 2C1ZA 5JALA 1WB9A 2HYIC 1JFFB 2LPMA 2W58A 3K0CC 3NRJA 5DKFA 4CF4A 3QW4B 3RM3A 4NNPA 5AUNB 3C7TA 4HUJA 3IBTA 3RRYA 1ZD5A 2IE0A 2GLUA 2CMFA 4EOGA 3MRTA 5IPFA 1HNZB 3D7NA 2J5XA 3IBYA 1NKVA 4UAVA 1KI7A 4WT7A 1U8EA 1ENYA 3AI2A 4FE3A 2WIAA 3DEHA 1NA5A 4Q7KA 5K3DA 3WOHA 5E6RA 1MORA 2XHZA 4LXUA 3K9LA 3O7WA 4ZVOA 4UOZA 4FW9A 3LQKA 4ZU1X 5FF9A 4FD2A 1DP4A 5LYYA 4G89A 4NY1A 1T9ZA 2B4AA 5DI3B 4BO5A 3H3JA 1XPOA 5JEDA 1IMJA 1V4BA 2BGRA 2CWDA 1P0IA 2X4DA 4UBOA 1N3LA 4Q4DA 4DT1A 1A8SA 2B2XA 4ISCA 2IU3A 3IKLA 4RDHA 2J6HA 4ROTA 3JSAA 5AI4A 3HVJA 1FFXB 2YYYA 2E4XA 4I8DA 4KUHA 4GE0A 4BNHA 4O2AF 4URWR 2CXOA 1PFWA 2NZYA 3EGVA 2HJHA 1ECBA 2P8JA 4N3CA 4D0NA 3AESA 4NOLA 3THYA 4MCJA 4ZDWA 5DK6A 3E8SA 2GN2A 1GQRA 5CGZA 5CVCA 1NSYA 3LX8A 2ADFA 1GYPA 1Z2EA 2HO4A 2AK2A 1A4UA 1QH8B 4LCJA 4TV9F 2PQ0A 1J5EB 4B3JA 3VU0A 3RUDA 4C4YA 1U0JA 4ZYVA 1KQNA 3TBHA 4P0PB 1F20A 4M60A 3WY9A 2BTQA 2Q3FA 5DFAA 4DVJA 2CHQA 3THXB 3NHKA 2AIRA 4D9BA 5F33A 2IZ0A 5HMMA 4M46A 5KMGA 4BRUA 1BS2A 5BY2A 4N7RA 3ASVA 1M54A 1GLGA 3A6LA 2G07A 3IAS1 4NZOA 1TZCA 2EFHB 4BAZA 1I30A 1TK9A 4N7BA 3SMVA 3MGBA 4GWLA 1VI2A 3KOUA 4IIVA 3O75A 1PEKE 3G5AA 1F1BA 4RQAA 4UMEA 3DXYA 1EFCA 4JJAA 5IXYA 5HTKA 3VR3D 1Z7GA 4EM6A 2BLNA 3LUKA 1B74A 1F48A 2Q45A 2VNSA 2ORWA 4QUJA 3N05A 1EM6A 1Q50A 5F7JA 3HTXA 1B3RA 1GA6A 1L1RA 1QRAA 2XT0A 1BXRB 3MINA 3NHRA 4M1TA 2F67A 3NIWA 3TB6A 1Y5MA 1NUQA 3PQDA 1X94A 4JQZA 3TD6A 2OB2A 4PG5A 2Q1UA 4INJA 1ST3A 5IYZF 5I45A 1OUMA 1IN4A 1I01A 1VMDA 1VB3A 3QY0A 4TWBA 1CZRA 4GPBA 2QF7A 4RY9A 2GOYA 5G0SA 3NTUA 3CN7A 3QMPA 4TTSA 1DELA 4Y2HA 1XRJA 1DQYA 1QK3A 1VRVA 4TRNA 1Y8RA 2SNIE 2O54A 4OXYA 4B4UA 2G71A 4IF6A 4QYMA 3LCRA 1QO9A 5MN4A 4OH1A 2ZT6A 2NUTA 1JDJA 4MKXA 4RPIA 4GHWA 3DTVB 3EC2A 2OAQ1 3I83A 4ZAZA 5KNCA 1JEQB 1JPUA 3AHEA 3OIVA 5E8JA 3IEIA 5ETJA 3VTKA 5LZ2A 4XM1A 1HL3A 1XMPA 1ZIDA 2GBFA 4GSKA 4K5QA 4XFDA 3UEOA 1L0BA 2H08A 4P7KA 4B48A 3PA6A 1SK9A 1VMAA 3D6HA 3O9VA 4WNAA 3FGNA 4MOWA 1GG9A 3ITKA 5GM1A 2XR1A 2ZS9A 2WA2A 1K8XB 1TB4A 1YR9A 3QIVA 4V1CB 3GYGA 4HX5A 3NCTA 3HN6A 1E6LA 4QTTB 1FNDA 1OLSB 3MGAA 3RNOA 1YJ8A 1ZUWA 3A25A 3L6OO 4YIKA 3UB3A 2CV0A 1Y42X 3FMFA 4RPJA 1L5KA 2ZANA 4MRMB 2BGTA 1EU1A 2VZ0A 5AP9A 3SZLA 3T1QA 4JU8A 4MV4A 2NZXA 1B76A 2HU8A 2EIHA 3V1NA 4MVJH 5LOVF 3ZCRA 3T06B 1D9XA 5FWYA 1M8GA 3A9CA 3DKKA 3EWIA 3EY4A 2D0IA 5A3RA 3ABOB 5CT6A 3WLSA 4F92B 3ZJYA 2Q1SA 1JSLA 1P6UA 2Z8XA 5LLSA 5C8VA 3KQKA 4BS9A 1VRWA 1K8ZB 4O3FA 5K3CA 3C6MA 4B40A 1UQTA 3J81k 4EJFA 2FMTA 3F4KA 2J0QA 1WP4A 1HNWB 1C80A 1WCXA 3NBXX 1PJRA 5EMNA 1LGYA 3DQZA 1BGVA 4GLBA 2E4AA 2HBQA 2ZBFA 4INPA 1SOUA 3QVKA 5IDQA 3FR7A 3KV3O 3GZ4A 3OPYI 4M1EA 4CKEA 2VPIA 3CLUC 3RSHA 1VZ2A 5ER9A 4BGUA 1Y1QA 5JC8A 3GRKA 4AZ0A 4HYTA 1RXYA 3WQRA 3EVNA 3ONDA 2VDWA 3FRIA 4AKGA 1FNBA 3W0LB 2OO3A 1LS6A 2PWPA 2QNRA 1Q21A 5KTTA 2HKIA 3ED5A 1U0FA 1V43A 5L3QA 3OCYA 5KS2A 1PFUA 4RK4A 4TKUA 4YO7A 4GRDA 3LY9A 1W5TA 2J5KA 3H9GA 1P0PA 1TU4A 3QI2A 4OUDA 3CZ9A 4N03A 1EVEA 5FTMA 1ST2A 5TPZA 5DWVA 3W5AA 2HY7A 4MS3B 5LU9A 3WDLA 3FJYA 5JT1A 1Y3DE 2IZZA 2GPAA 4DA8A 4YYZA 4D9MA 3ANTA 3GRYA 3A2LA 1QH1A 3MT7A 4KFTA 4RABA 4TZKA 1SU4A 5F12A 4YO8A 3T7RA 4OA8A 2MYUA 3WFZA 3AR4A 2W2XA 2EBHX 3BFVA 4UEQA 4NJOA 1CZHA 2O2HA 2VDRB 1LZKA 3CM0A 3L7OA 4JLJA 1AC5A 1GUDA 4JS0A 4L51A 3QBJA 8AT1A 4B75A 2ZSJA 2HWXA 5HKOA 1JEDA 3T5BA 3ER8A 4B79A 3EUFA 2YYZA 4IFEA 1UR5A 1B0UA 1FSPA 4EY8A 1X7XB 3AF1A 3O93A 2A5YB 2BMWA 3U1TA 1IDN1 1L5RA 2I3BA 4MXDA 5LZ5A 5JFGA 3EIQA 5G4KA 2I3AA 4U7FA 4TKVA 4BNFA 1KZ4A 1OX6A 2PXHA 3M6WA 1I3OA 2ZZNA 3PC7A 4CIWA 1U1GA 3EB9A 2GYUA 5F7ZA 3RROA 5HSGA 1CF4A 4FGUA 4BASA 6YASA 4N8SA 1Z7BA 2ZSEA 3PEYA 4C7KA 2O0HA 3TGLA 4WLOA 4BVKA 1BWPA 5FA5A 3I09A 1XJCA 4ER5A 5FD8A 3DYVA 3WJ1A 1DO0A 1B3BA 2Y66A 2AFHA 4BQQA 4EYOA 2EQBA 2IVZA 2WFLB 3L02A 1DQPA 2V4MA 4L28A 4YRNA 3NQ41 4G0ZA 3ZC3A 1U3DA 3MIIA 3QTTA 1EP2B 1NKTA 1F8UA 3QW2A 1X0XA 3G1TA 2AOUB 2MMCA 3PTZA 2R87A 4HAUA 4J16C 5TLSA 4CLHA 1D4ZA 2C5BA 3I30X 3S55A 3UKOA 2QTWB 2I7TA 3DVSX 5KVSA 5JNSA 3N87A 4UREA 1OZAA 3HA7A 5CVDA 5CDSA 1D2RA 3PFWO 2WI8A 4E51A 1RPAA 5DGIA 3ZQ6A 5KYXA 3R5FA 2O06A 5IM5A 4IM7A 4E5PA 3X2SA 5J63A 5BSKA 1MPXA 4UBKA 1P4SA 4B85A 4AFNA 3BPSA 3LRTA 2WJ3A 1GQOA 2QUIA 3G9ZA 3GCZA 3LPDA 1DJQA 5H9VA 4TXJA 3NS7A 1UKEA 5K6AC 5J23A 3MBKA 4MW6A 4WFIA 5J4YA 4RHXA 6PFKA 5BSEA 5KYGA 3I92A 4O4JF 1M1NA 3SOPA 4L85A 1XD9A 3MXOA 4FYHA 4OHYA 3A26A 3ASYA 4MGZR 4MVJE 4D25A 1L5LA 3IT1A 1NVAA 3C97A 2GBLC 2J8ZA 1MAHA 4YP1A 4CT5A 2FSVA 2BGUA 5BVGB 1JDTA 2OMEA 3L18A 5CA1B 4QL3A 5DYIA 5LQRA 1RAEA 1T9GS 3NHLA 2Q9BA 1E3SA 2PVSA 1L7VC 2WWFA 3LLMA 2C2WA 3OT4A 4FEYA 3RHTA 1T1SA 1EE2A 2X9LA 4F5EA 1OJ7A 1AT1A 3NH6A 2ZCVA 3IV6A 1QK4A 1L4LA 5ADVA 2MWMA 1DCFA 3PUJA 4CU2A 1RQGA 2QA5A 3JTMA 4OATA 4URVR 1YR6A 2JHGA 2XE4A 2LCIA 3OAAA 3KEFA 5DWDA 5FPSA 5TS3A 2ONYA 1U8YA 4A6EA 4R98A 2ID8A 2ZSUA 3FNHA 3VR2A 4RTMA 5ELXA 1Q0TA 3L1JA 3G3EA 1KO8A 1Y3BE 3OM9A 3GNQA 4J1TA 4K6HA 4UUQA 3O4RA 4EY3A 621PA 3ZCXA 2AZ4A 4HVAA 4JMPA 4XASA 4ACAA 4MW7A 4PGMA 3R7WB 1ULBA 1MB3A 3MVEA 4RACA 3D6VA 4L5YA 4GWGA 1W25A 2H2GA 2Q4EA 1F06A 4OHWA 1J7JA 1CUEA 1V1JA 1N2CE 1AUXA 2EDCA 2QN9A 5CNJA 2UDPA 5B1IA 1FQOA 1N33B 4QQKA 1CB0A 3ESDA 2PS3A 2OFXA 4KDRA 3IDOA 2XUZA 4N8DA 5AM2A 5JAPA 1GZ3A 1PNVA 2ID7A 2DHQA 5FL7A 3OHPA 3EEYA 4ED9A 4B82A 3CA8A 1U2RA 3DFMA 2D5IA 3HN7A 2W0SA 3RU7A 3S5UA 5EC8A 1DEHA 2VHQA 3K2EA 3VGPA 2I55A 3VOAA 4C5BA 3X3HA 4HNSA 4IXTA 3WRYC 3BWCA 2PEZA 4EMBA 4K6MA 2QLLA 3BEDA 4Z7NB 1OGJA 5KX5F 4IV5A 2ZZKA 4JI8B 4AXXA 1K08A 1EE9A 3KZVA 2Q2WA 3C6BA 1XZKA 2YJ3A 4J0DA 1U1IA 1F2TB 5FTKA 5TS2A 4E46A 3QHAA 5JAOA 1DX4A 3M83A 3L4KA 4JK3A 1ODIA 3TYXA 1CDDA 1UT5A 5A5VA 2X8WA 1HZZA 5AJVB 3GFGA 3SEAA 3SPXA 3PFGA 1ZX1A 4MQUA 3L0SA 3A1CA 3TPCA 4YMVA 1HRDA 3CH4B 1EG2A 1V5EA 1L3BA 2MYNA 1WSWA 1I13A 1SXIA 1DC3A 2VTKA 3S5JA 4TLMB 4L4YA 2VK8A 1AJEA 2A1TR 7ABPA 4XUEA 5EMHA 4ND7A 3V4RA 1JDBC 4OB8A 4UEWA 1IHPA 4R71A 4YAUA 1HOXA 1BXRA 2JZCA 2BFWA 2MSWA 5BR8B 4EHIA 4ZO9A 4EY7A 3QRWA 5ESRA 2A9OA 4E12A 2FPPA 2I62A 2JFYA 3FNBA 5AKJA 3HXOA 1GPAA 1XMVA 5L95A 1QB7A 2GK3A 3WGMA 4RPLA 1RJ9A 4MI1A 3UQYS 1O96B 5BSWA 1RWQA 4M55A 1YBHA 1GAJA 1ZW6A 3FTPA 2G70A 3CCFA 4D97A 1M6EX 3LI2A 4PXYA 2IIBA 2PNFA 3QOFA 2XBUA 5AKHA 2FCRA 1U9CA 1DKNA 5AW3A 1RM3A 2H5LA 1EX9A 1HG0A 3LOUA 4IW3B 2RAVA 1M34A 4KI0A 4MPRA 4CM6A 1MJHA 1T5SA 4CQLA 3BMQA 2IBSA 3TL2A 1N6NA 1RWPA 3KJXA 1FFSA 3TOVA 4GOJA 5TMPA 3GEMA 1HLGA 3R6WA 4DADA 4ZQIA 2DBZA 4OJYA 2KI5A 3OESA 3RUPA 2FUCA 3C39A 2C9MA 3ECSA 4QLOA 4U2FA 2PD6A 4GBMA 4RV5A 4NOKA 5CAEB 4ODIA 1E8NA 1PSWA 3M8KA 3Q5GA 3PXAA 2HR1A 3AVYA 1AQUA 3EW9A 1EUQA 4R68A 5BOSB 4BFCA 4EA9A 1DXYA 4K28A 1MDFA 3ENZA 4XXHA 1E5TA 4AO6A 4UM9B 2XNDD 1WW3A 2YS7A 2A67A 2D2VA 3KVNA 2IVFA 2BL4A 3CXUA 5T8KA 1SUWA 4NEQA 3U4DA 3E9EA 1T3HA 3VNBA 1CRLA 1LV8A 3A3PA 5LB4A 3U17A 4DQXA 1X7WB 1Z12A 3CEMA 3ELBA 4G0YA 1HEIA 3T3DA 3V00A 2JDIA 2HMWA 2VT3A 5HKLA 1J06A 1OLSA 1NIJA 1A1SA 2AEMA 4BRWA 2AD1A 1DAOA 2P2CA 3SSOA 2GKSA 3IIMA 4IHAA 3DZ8A 3GFQA 3GEEA 5LM3A 5C53B 3JAWB 3UTDA 5CCBA 3OFKA 2Y1GA 4GDFA 4P7JA 4AWXA 1YS6A 3W9YA 1ORHA 3K0FA 1CUXA 2LNDA 4BP1A 2RAPA 2XA9A 1HYGA 2QAJA 2Q5OA 4M0KA 3B36A 5LBTA 1YU9A 3LTEA 3VSDA 1ZVVA 1Q1NA 4EI9A 3EVAA 3D5QA 1S8OA 4PG7A 3Q87B 2BC9A 5HNKA 2YINC 4P08A 1NP7A 1NQ5A 1VHQA 1X1AA 2XGOA 3AR3A 3VRHA 4ARZA 4LJSA 3U3MA 4LJLA 5F5XA 2J6IA 1K8YB 3GARA 1ORTA 3OJLA 1V5GA 2QLMA 2F3SA 4EG5A 4YQEA 4GGOA 1TOAA 2PUHA 5JYCA 1VPTA 4IIUA 1LBHA 3CUVA 4Z3KA 1Y6FA 4KOAA 4B17A 2JK0A 4F3KA 4YRQA 2G80A 1ECCA 2QG9A 3MCUA 1BGWA 1VLLA 1RLIA 4CKEB 1E69A 4AKTA 4QTUB 1UIRA 2XWBF 5DRTA 1J09A 3WIUA 2BWJA 3G0OA 5AJXA 2VBGA 3MJDA 4I5EA 2YL2A 3WWEA 2XZOA 3W5SA 4DMMA 2R96A 4KFRA 4YNBA 1FQWA 1L1FA 2WKPA 4YGXB 4J0HA 1WCYA 1L7OA 4DE5A 4U9IS 4YRAA 2K7ZA 2YZMA 1NIPA 1JEOA 2HCBA 3ZNQA 3RQIA 1SUSA 1XVTA 1Y82A 3DSRA 5EIBD 1C8BA 3L46A 5E1DA 3UJAA 4CZ2A 1DJLA 2BFCB 2CL5A 4EJ2A 4ITVA 2ONJA 1RYMA 2IHUA 2QMUA 1PQPA 4PICA 4MEJA 4QM6A 1Q14A 4LJRA 1C30A 5A3JA 3EODA 4O5OA 1OFUA 3D4NA 1GGFA 4NFSA 3FWPA 3HJBA 1ZKMA 1AZSC 1NWHA 2QTRA 3DWGA 1FTNA 1Z68A 3JD0A 2P5YA 3MMPA 4P32A 5ALDA 1PZXA 1ZIOA 1Z4LA 3RF7A 1IVYA 1IJFA 1YHZA 2IYXA 5FKJA 4DB4A 2VDPB 1ILWA 4HPWA 5IAJA 1OH8A 3VAYA 1N5OX 2PMFA 2C99A 4D5GA 1BE6A 2VP0A 4RVGA 4GNKA 5KSZA 5HKBA 2ZYAA 5T4FA 2ZI9A 4CM9A 2O3RA 2YJZA 3HI6A 4M0PA 1EH5A 4XYGA 3H9BA 1P4JA 4EARA 4TMWA 2REBA 1GAEO 1RC1A 4H0FA 2E21A 4EG4A 3D4LA 2BYTA 4DYHA 1ONSA 4PRLA 4LF6B 3HO6A 1GZSA 1QGED 4LRYA 1M2GA 4B6SA 1NXWA 3RUCA 4D1YA 2R00C 2GTPA 5EHZA 1Q92A 2EGGA 2GYVA 1P1CA 3SJ7A 4ESEA 4M38A 1WL8A 3GEBA 3PQCA 2GCOB 1KXZA 3CKYA 4OHCA 4QRHA 1X86B 4QUDA 4CCYA 3IEMA 3IAHA 1DZIA 2R5FA 4HEA1 4RL4A 1Q7RA 3N2IA 3NBUA 1Z8FA 5EJAA 5D5PA 1SC3A 3SICE 4X95A 5LN1A 3CR8A 4IX1A 1NOKA 2YHAA 4HDSB 4C03A 4BUCA 4WBXC 4C6TA 3BB3A 2EJBA 4V0LA 3W6OA 1FP6A 3R0XA 5EJ7A 4US1R 3C98A 3ORSA 1PT6A 2W2PA 3H0CA 3PUVA 2ETVA 4GKJB 3MMSA 1UPUA 3ZD8A 2GRAA 4J16A 5L7YA 1FW6A 2CLLB 4OO3A 2PIAA 3PWKA 2C2BA 2F64A 4CUKA 1ZH4A 1R8YA 4YPFA 5E7IA 3WJ2A 1UJNA 5FBKA 2FPSA 4UCXA 3H13A 2BGIA 3BSSA 4ZI7B 5KWVA 3I5XA 1N78A 2ZSIA 4I1UA 4N3NA 4RYDA 1A0OA 3CVOA 1QAQA 4JIMA 2DR2A 5T3YA 5IDXA 2ZM5A 3EAFA 4ZA2A 4K1XA 3AR5A 3OEED 3PYXA 1J0BA 2CJFA 3INTA 3GQBB 2JARA 1CQIB 3LVBA 2XUHA 2AXPA 3KPVA 4GMKA 4JJ7A 2R4QA 5EXSA 3VAZA 3H2BA 3C5HA 1FYVA 1JR3D 2F55A 1BD4A 4JGGA 1ID8A 4LNHA 3ZWVA 1UMDA 2HA5A 1XQYA 1H1TA 3WGIA 4ETWA 1MJ5A 2AE1A 1W73A 2I5PO 2Q5FA 3JQ7A 3ZEIA 3I5YA 1RRCA 4Y8VA 4CEJB 1JG1A 1MO5A 3ADPA 3B52X 2P2NA 3VYVA 4X63A 2TMYA 5AO9A 5DTRA 4W1QA 4ZI5A 2OM6A 4EGSA 2NYAA 4OGLA 3QTBA 4KFCA 3W8EA 1ZJ5A 1U3CA 1J99A 5JNTA 1EK6A 3WSTA 4CG1A 1KFCB 1V9LA 4JC5A 1G9SA 3GLQA 1DAIA 4MJ7A 3RYHA 1QGZA 2GS9A 3IA7A 3A6FA 5DGCA 3KR2A 1XZEA 2CXPA 3TX6A 1ECGA 1LQTA 3MTAA 3S2SA 1T6NA 1FFCA 1HF3A 3FHLA 2JCYA 3JYOA 4HX9A 4YFYA 1Z25A 4Q02A 1O94A 3ZIAA 4TVSA 2W98A 1U2PA 2SCUB 3WTCA 4O29A 3BD6A 5LPNA 4V3BA 4CTJA 1CRWG 3T52A 1EZ1A 1DL5A 1UC5B 3QY9A 4RLSA 1NQVA 4UCFA 1V3VA 5IK2D 3FAZA 4DBZA 1SG0A 1YVDA 1RYDA 1Z16A 3D02A 5IAGA 1FJHA 2CL6X 1WSAA 2ZM6B 1MB2A 1KY2A 2Y9MB 1Y81A 3CHYA 4Z4QA 3AFNA 3FCSB 1HT3A 4GXQA 1KIFA 1XTSA 4KBYA 4XDYA 3WQSB 4OK6A 3HH8A 4YRTA 2HIMA 2WQZA 3E3NA 3NVMB 4S1OA 4TT3D 4I55B 1J21A 5CM2Z 4LFBB 3A4TA 3PRHA 5FL3A 3SXUA 3FPHA 5D3ZA 2QTLA 3FCYA 4KH0A 5AW4A 1Z62A 4HNTA 1G7SA 1MTZA 2Y6UA 3P9IA 3MLBA 1WW2A 1L7NA 3CN9A 1LFAA 3P71T 4B6GA 2PCLA 3AEZA 3CLSC 8ABPA 2ZJ0A 1U0EA 1L5GB 1UC8A 1SK8A 3CLRD 4CV3A 1A7KA 1CEQA 4EL5A 1JLRA 2EFYA 2B98A 4RC9A 2V7WA 2YZ2A 3GJYA 4HUQB 4EPWA 1VMKA 4OI1A 3P4YA 2FR0A 2GD2A 1MU0A 3KYCA 1PCXA 2RHTA 4OHBA 3U16A 4KYUA 4WBNF 1IBKB 721PA 2O0LA 3RT1A 3OQMA 4R2XA 3ZGLA 5DM0A 3NDJA 3DEYX 3W3AD 2JJ2D 3L8FA 3KQLA 1VBNA 2F1RA 2H3EA 3ZCQA 1H2RS 4DQLA 3G0GA 4OREX 5AVUA 2CEKA 3GGOA 4EELA 3F97A 3IALA 2WNHA 2ZR7A 3Q11A 2RGNC 4TTPA 3ZHOA 4I08A 4A8JA 3M6IA 5AHWA 4AKIA 1H0KA 4G07A 1C7ZA 1KR2A 1OT5A 4XDGA 5I7WA 3KSDO 3LT2A 2O6LA 1EVKA 3N7AA 4KC0A 2C7OA 1GIAA 2XGGA 4MGYR 4WKOA 2W6ID 2YQ4A 4LTDA 1F4PA 4C01A 4MGIR 3ASZA 1G42A 1RM5A 3IP8A 1DBPA 3DQQA 1SU7A 1GZ5A 1RYFA 2CYCA 4FHCA 4A6XA 1DQNA 4MYSA 4B7UA 1UK6A 1X2EA 2H9YA 2QS9A 2YV4A 3R7AA 3DZGA 5JQGB 1U94A 1XRMA 3GCGA 1M2EA 3D4PA 5EI5A 3ET5A 3DLIA 1NF8A 4OBXA 5EE0A 4R3WA 2P67A 3EF3A 4IMRA 4Q05A 5FEUA 1Y4ZA 2C7RA 1BCRA 5FJJA 3TBFA 2P4UA 1D8AA 2VHZA 3IGFA 4QT0A 2A8YA 2G82A 3JQBC 5I8PA 2J3EA 4N49A 4K6KA 3PWTA 4HYEA 3ONNA 5AUOB 4RMJA 3JQDA 1SCUA 4CMEA 1V16A 2X9QA 3DZJA 3MQ2A 5FNVB 3WLIA 4FZRA 4NL4H 2Z5GA 4Z1MD 2WUVA 3F7MA 2CYAA 4TTTS 3VQTA 5BMVA 5FR1A 2PLFA 4JA0A 2I6UA 5T64A 4EA6A 5FB3A 2DFDA 1J8QA 2IXEA 2EKDA 4KR3A 4F4IA 3HB4X 2EP8A 3OWOA 5EQTA 3LUPA 3PUKA 3KCNA 4WINA 3GP8A 3FH0A 3QKTA 3V8EA 4X60A 1QBGA 2VNKA 1I0LA 1RRPA 4YRMA 3HFJA 3VKUA 3OPYA 4DC1A 2C9YA 3B3AA 1GWNA 1Z0AA 3MOIA 3H16A 2X5NA 3LKDA 3ZWPA 1CLUA 1AO3A 3SKXA 2G5GX 3GUVA 3VR5A 5B58C 9ABPA 3TZKA 3NMUF 1O03A 1WKVA 3D8SA 1GCAA 2C2OA 3FPAA 1MVOA 1NW9B 2C9OA 4X94A 3BD7A 1IXKA 2C97A 2QDXA 2C20A 4MR7B 3WO0A 4A8PA 1J42A 2WE8A 1P8AA 1BMQA 1XDZA 2ZJ5A 1WPXA 3CX4A 3K05A 1P5ZB 1R74A 4HB3A 3TDKA 4XPZA 4GIBA 1R00A 1P7YA 4XYLA 4Z8YA 4WLFA 1JLKA 1A82A 3L4EA 3L49A 1V5IA 2C3MA 2CV2A 1ILEA 3OLZA 2VC2B 1QIDA 3I1IA 3RUHA 4FMDF 1XEXB 4M9SA 1QQ7A 2BFDA 2ECFA 1YO6A 4H60A 2I99A 4F38A 5JWHA 1JVNA 1ODFA 3Q0IA 1KQPA 1P2TA 4D4MA 3ETNA 3K72B 4F0JA 3G49A 2J30A 5K8LA 3ZH2A 2M32A 4DYVA 5ADHA 2H1LA 1N0VC 3NTRA 2FLKA 3DBLA 2VQ3A 2ZPUA 1IJKA 1QC5B 2ADOA 4IH1A 3UW1A 4ENVA 1GZVA 4WKPA 1YZKA 4H27A 4IDQA 3G7SA 5KDLA 2VXYA 2XAUA 3ZV7A 4KDEA 2PYZA 3ETDA 4UULA 1QF7A 3GVCA 4MR9A 4XWOA 1L7BA 1M75A 2WP8J 1X1CA 4POAA 1YDMA 3IEPA 1O08A 1T0BA 1ORVA 4JOQA 5HR5A 1SQSA 3N2KA 1WMBA 2M2IA 5IASA 2P3OA 4P2GA 5AH0A 3LDGA 5JSYA 3WL6A 4AZ3A 4W63A 3GJ7A 1SUDA 5GV7A 1KHHA 1P44A 2ESRA 1SVMA 5CGQB 2FEMA 4PRZA 1S89A 2B1QA 1W5BA 3KLNA 1IXZA 1SOWA 4U7WA 1FS5A 3T9CA 4H7JA 3ZNPA 4INZA 3R7LA 4EPRA 1X87A 1IVSA 1NBME 4OXXA 4P53A 5K8IA 5EZYB 1AKQA 1FLDA 1X1DA 3JZIA 4LPSA 3UMRA 2WAOA 1XNJA 3DTNA 2QSZA 3GFVA 1MFZA 3I73A 3PNBA 1QYIA 4KXVA 5LQKA 1NLFA 3THSA 2UYHA 5KVQA 1AX9A 1RQRA 5CPFA 5B1SA 5TJHA 4C0SA 4M8SA 3DLBA 4K86A 4BVGA 1ORRA 3LPMA 4UEJA 3HB5X 1KEKA 2XMZA 3CCCA 1OYWA 3AVUA 1T4CB 4M9QA 4OIFA 4XJXA 4KQJA 1BFUA 1VDMA 1W4ZA 3NDPA 2H0RA 4JA2A 3COPA 3QSGA 4H3HB 5B2EA 4JBWA 4RD1A 4W5TA 2GM4A 2UUCB 2Z6QA 1IY2A 3IRUA 4UUPA 2MSKA 4BMDA 3BSYA 3L6RA 1N5IA 2BONA 2QSJA 3V4LA 3VH1A 2B69A 4ARIA 1I0IA 3ORHA 4KO4S 3SGLA 3MJVA 4LKOA 4YGYA 4RGQA 4HGOA 3Q15C 1ZR4A 1V8ZA 4HQ0A 3S29A 3O38A 1EFPA 1SFRA 2C5HA 5AKIA 3RD5A 3H17A 1WMFA 2P1RA 1RQ7A 5DO9A 3GMSA 4ZQEA 3PHJA 1IXRC 3K2QA 4UCQA 2OV3A 1KP9A 2Q6VA 1W4AA 3OCCA 1KSHA 3WL7A 4DIKA 4QPNA 2JLYA 2DGDA 1ENPA 5E2IA 5ECDA 3P2EA 3JPYA 2KWIA 1MW9X 1PIWA 1J2JA 1U2GC 1H1LB 3EUAA 3IB6A 1F6WA 3K1JA 4R0MA 3HUFA 2OEPA 2V1XA 4ZYZA 4UFNA 4I36A 5KAPA 2HIGA 1KE1A 1KAHA 2BM0A 3FCCA 2CDAA 1U0RA 2X4GA 3BS4A 2R6R1 4FYKA 2C5GA 4LDNA 4TYMA 1DARA 4TZTA 2ZUBA 1O95D 3FZGA 4RKRA 3MTQA 3LCCA 1KZGB 2G67A 1ESEA 3FROA 1TJ3A 4EG3A 5FOSA 4QHSA 4DT1B 5IWCA 3C1TA 4Q1CA 4DMLA 2BM8A 3DOUA 5FWDA 1VLQA 4IWYA 2IWHA 2ZIVB 3ON5A 4G1VA 2B9EA 4LZPA 4KYTA 4LRSB 4OF4A 1CFZA 2IDKA 1EXMA 2Y3IA 4GZLA 3DE6X 4Q3KA 5EIWA 1NW3A 5FLYA 2VQFB 1N2BA 1XZLA 4CVNA 2X13A 5CB4A 1Z2PX 3E53A 3LCMA 1JMVA 2HWWA 2J3QA 1AUQA 4DMUB 4LDPA 4TLAA 3UJHA 5HIJA 4F1JA 1N32B 4NRDA 2GCGA 1W36D 5KNLA 4FKBA 1ZQ1A 4K1LA 1JR6A 5BW5A 3BG5A 4GRIA 1BDMA 1PKXA 1TGYA 5HX7A 2GM9A 2R65A 1WU8A 3G23A 3O21A 1U65A 4H7KA 4UM7A 4NQZA 4E2YA 1LLQA 4FIZA 1TMGE 1P77A 3RYFA 5BSFA 3BWEA 1BXGA 1RABA 1L5NA 1IHDA 1FE8A 4EL0A 4QPZA 2WJ6A 2P65A 3CNBA 4RGYA 5AK0A 5KOYA 3FCAA 1WCWA 4B80A 2ZYRA 2PZMA 4JEIA 2Y68A 2ZJBA 1I6KA 2DCMA 4KQFA 3BMNA 2J3JA 1LX7A 3DBHA 4FLFA 4FZJA 4HN9A 3W5BA 1VIYA 2KJQA 1XYYA 1NFRA 1WUHS 1YH3A 4IJQA 4E07A 4MI9A 2V54A 2O4CA 5KNBA 2CW5A 2GDZA 1ECFA 1SKYB 3R20A 3PR2B 3BT7A 4OTZA 3N0XA 3IE1A 2IODA 3ZDRA 1MEOA 3H4VA 3TPFA 4W8HA 5E9AA 5BQPA 1R4MB 2AFIB 4JC4A 4AKSA 4TTJA 2FP4B 3PNKA 4MVJA 1Z35A 2WK1A 1N6IA 4OJTA 1NLYA 3PFBA 1G3MA 4I5DA 4PZZA 3NVAA 1RPTA 2CMDA 2FTKE 3CR3C 5IAAA 4UQOA 3V1TC 2R0QC 3ZS9A 4IIHA 1PV2A 2LUOA 1U1EA 3G82C 2ZIWB 1HE2A 4ZVTA 4P92A 2NG1A 5DW0A 2OOKA 5M5BA 1P74A 4B6OA 4DDTA 3NWBA 3KYCB 3BSFA 3DDNA 2IXDA 2QMHA 2BKVA 4X71A 1T2FA 3GOQA 1E2QA 3MN1A 4WKBA 1Y8RB 2TMKA 1V35A 4JSRA 3RR2A