3ZN2A

Protein engineering of halohydrin dehalogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
253
structure length
253
Chain Sequence
b'STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOHYDRIN DEHALOGENASE
publication title A Single Point Mutation Enhances Hydroxynitrile Synthesis by Halohydrin Dehalogenase.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 93
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zn2A00
3TRIA 4XGNA 1LDGA 2WYVA 3H65A 2A92A 4IZHA 3WGTA 4RPJA 4DL9A 3VH4A 3KUXA 4ITUA 4GWGA 3WGHA 3U9LA 1X1TA 5IXYA 1LUAA 3JYLA 3ZGYA 1K6IA 4RLSA 4LN1A 2JCVA 5TJHA 1LLDA 2RAFA 1Z7EA 3GZ4A 3PI7A 4BNHA 3O26A 4E2WA 4IJUA 3MJ4A 3QWHA 3RCBA 2J3JA 5FWNA 3NGLA 4URFA 4CV3A 3F3SA 5KKAA 5B4UA 3KETA 1GL3A 1R4MB 2AHRA 2GN9A 4J0FA 4BNWA 4BHTA 3IAHA 4RGBA 4BNNA 4J7CA 3OJFA 4E21A 2OORA 4YT4A 4WGGA 3VH2A 1BXKA 4AVYA 1PQWA 2P5UA 2X58A 3D7LA 1FXSA 2ZTMA 5TT0A 1LLQA 3ROPA 4H16A 1YOVB 3GGPA 3Q6IA 3NV9A 1E1KA 3ST7A 3ADPA 3TNLA 3OJEA 4Z0PA 1P0CA 3OHSX 2GDZA 1I8TA 4RDHA 1FDWA 3AI2A 1X14A 2EIHA 1GU7A 4D7AA 2B5VA 1JTVA 2W90A 5TT1A 1LX6A 5KIAA 2NVUB 4IY1A 4WASA 1VL8A 1DXYA 1NQTA 3F4BA 1KEWA 4PLCA 4QXMA 3NAQA 1H93A 1PS0A 2QIOA 4RVDA 2P9GA 4NU6A 1Z7BA 4I9UA 1B2LA 2IXBA 4J4TA 5CEJA 3EW7A 3NJ8A 4KUEA 5I9LA 2YZ7A 1QYWA 1ZSYA 2XXJA 4CM7A 3B1FA 3UN1A 2Y67A 3ENNA 4J91A 4MVJA 4YRAA 4R68A 3CE6A 3JQDA 4L4XA 4XQCA 3H3FA 2JFHA 2ZCVA 1M75A 1IHYA 3OH8A 3LT4A 1XU7A 1Y8QB 2BFAA 2CUKA 5KJEA 5CEFA 2O7SA 1QG6A 5TLSA 1J5PA 3OJ0A 2JD0A 1DFIA 2W4QA 3EC7A 4R5MA 3FBTA 5JY1A 2HDHA 4XWYA 1PGNA 4E5NA 5IZCC 4DXHA 3JYOA 1DC6A 3PGXA 4QQRA 3T7EA 1EVIA 2YDXA 3WIEA 2GYYA 4JJFA 1QYCA 1V9LA 4YPOA 3GVIA 3BIOA 3RUDA 1EK5A 4BNTA 4A0SA 2PKQP 1VL0A 3MTJA 3ZU2A 9LDTA 2GERA 5JYDA 4IDEA 4KQXA 2P4QA 3K73O 1PL8A 4PLYA 1DLJA 4PZEA 4JX8A 3DL2A 3IIEA 4XYLA 3S1LA 1HYGA 4MVJF 4O6VA 2ZJ0A 3I5MA 4J49A 5IDYA 5ADHA 5I7VA 4GMFA 3F6YA 2IE0A 5ER6A 3AOGA 3E8XA 2PKRA 3GNTA 4I9HA 3KBOA 4GX0A 4CMJA 3AUAA 2UVDA 5LCXA 1HF3A 4ALNA 5HBRA 2VNSA 1VL6A 3I9KA 5IZCA 2PGDA 3QP9A 3VDRA 2X4GA 1PGQA 4JLWA 4B3HA 3GY0A 1GFSA 3ZU4A 4GQAA 1YONA 3O03A 3I9OA 4IXTA 1GPJA 5I7EA 2GN4A 4FGSA 1NWCA 3JD2A 5F21A 2I5PO 4WOJA 2IZZA 3GC6A 3Q11A 1J6UA 3A1NA 1ISGA 5GZ3A 3CIFA 2PH5A 4CM8A 5IN5A 3I6QA 4F46A 4BKOA 3JD3A 2ZTLA 3AY7A 4AG3A 2OZPA 2Y66A 3WNVA 4RLHA 1LEHA 4BV9A 1X7DA 2AW5A 5A1TA 3BYZA 2CVQA 1LJ8A 4PGFA 4EZBA 1V3VA 1RM3A 4XR4A 3IUSA 3DBRB 4O59O 4YDRA 1TEHA 3PQDA 3F47A 1ENOA 5U4QA 1QR6A 4YA6A 3JD1A 4CMBA 5BSEA 3ZCXA 1K6XA 2RHRA 8LDHA 2J8ZA 3O9ZA 1N7HA 4A73A 1U3WA 3ITKA 2D5AA 3JQGB 2LDXA 3O8QA 3TQHA 2HJRA 3JQAD 5JAQA 4BB5A 1XWFA 4BO2A 4Y67A 3B1JA 1GZ4A 2D4AA 1ENYA 4O0LA 4D41A 2P5YA 3F4LA 3SLGA 1PJ4A 3TZKA 2O4UX 3OA2A 4EJ6A 2POQX 2VT3A 3KZVA 4KTVE 1N9GA 4MKZA 1DRWA 5AXCA 3QA9A 4ZQGA 5A3VA 4Y98A 3HQ4O 3LU1A 1LQUA 3PIIA 3GAZA 4TRMA 1HWYA 1MA0A 4UEKA 4D3FA 4OYRA 1A7KA 1NHWA 3DBLA 4ALMA 3BTOA 3ONDA 3JV7A 1BRMA 1AHHA 2V6FA 5L51A 4R1NA 3Q0EA 1UZNA 1YL7A 3RBVA 2X9NA 7MDHA 1F8FA 4RPHA 5F5LA 1PGJA 3QLJA 4M49A 1HDXA 3GLQA 1KS9A 3JTMA 2HCTA 2ZK7A 4PLGA 1DSSG 5G0TA 1GADO 1LU9A 4E12A 5IDXA 1ADBA 4EUHA 2X6TA 2I6TA 3OETA 2YV3A 5JY6A 5L53A 1SMKA 2X5KO 3PYMA 3VKVA 2IYPA 1DJQA 2RH4A 3Q1LA 3LDHA 3DZJA 3WYEA 1QYDA 3QWBA 1KYQA 1VKNA 3IS3A 1BMDA 3VH3A 4E5KA 1LDBA 2F00A 4UVGA 3DZHA 3DXFA 5H81A 2G1UA 5JO0A 1DOHA 2NM0A 1NM5A 3BTSA 3PQFA 1BGVA 4D45A 2Z5LA 1AHIA 1F06A 5JSFA 3RUIA 5AXAA 2DU8A 4QX6A 1VPDA 4ESOA 3WB9A 2QRKA 2IZ1A 3GH3A 4KZPA 1MX3A 4S3MA 3RUFA 2QRJA 4GVXA 1SEPA 1VJTA 4TRRA 3GPDG 4FQ8A 3IMFA 2JAHA 3GGOA 2VHWA 3QIVA 3W4KA 1I5RA 1LLCA 1E3JA 3DHYA 3FBGA 4IDDA 2WD7B 1Z75A 2BMAA 2EKPA 1MFPA 1HEUA 3EY4A 1PX0A 3L9WA 4JBGA 1NNUA 1XEAA 1T4BA 2B37A 2GLXA 4DPKA 1R4NA 2VQ3A 1P0FA 3INGA 3TPCA 4B4VA 3ANLA 5ITVA 4NBUA 3HN2A 2Q3EA 3ASUA 4PRKA 4JXKA 3U62A 2J3KA 5JPIA 3QWIA 1H94A 4BNLA 3C7CB 5ER9A 3GDGA 1T4DA 2G82A 4WLOA 3U4CA 3M2PA 3MWDB 3VZRA 3W1VA 2JL1A 1HSZA 2BH9A 2R00C 3DBHA 5G4KB 5IJZA 2V6GA 4MVJH 1U3TA 4YJHB 2A94A 1E3IA 2UYYA 2BGMA 3JQGA 3T4XA 5LC1A 2VRBA 3U49A 4LISA 2ZIZA 4IQ8A 5DF1A 3WYBA 4J1QA 1L7DA 3SVTA 1ULSA 3ZWVA 3SEFA 1JQBA 4JK3A 2CNBA 1I3LA 3AM4A 3HADA 3DZKA 4B4WA 4ZQHA 3E48A 2H1SA 2HQ1A 3BMQA 4HP8A 1Y5MA 4NIMA 5IDWA 4GX5A 3HFSA 4D3DA 2B35A 3V5NA 1I33A 2UUPA 3F5QA 3MOIA 4U6QA 5C7IO 4JBHA 5KJFA 4O63O 1D7OA 4OHUA 4BUCA 4HUJA 1LRKA 2EKLA 5LDGA 1LA2A 5BR7A 1E7WA 1Z45A 1P45A 1PS9A 4Q3DA 1T2EA 1E1NA 3ZNPA 6ADHA 1YBAA 3VPXA 4LVCA 4P22A 5COAA 4NBVA 1HTBA 1DIHA 1F8GA 4BKRA 3EAGA 5DCUA 2EKQA 3MJCA 4YAEA 4ALLA 4BNFA 4DLBA 1P9LA 2B0JA 1U2GA 4YT5A 1VSUA 4YYZA 4RPKA 4EJ0A 1UDCA 1F17A 3WGIA 4NMHA 3BHMA 4BO3A 3W8FA 3P2OA 3V1TC 1YDWA 1V0JA 2AQKA 1ISJA 1GUYA 4PLWA 1FF9A 3GG9A 4AJEA 2NU8A 3KYDB 3D1LA 1GUZA 1G0NA 1ZJZA 2G76A 2WYUA 3BMCA 3RSHA 3AUTA 2D0IA 3WLFA 1J4AA 3QQPA 2J5RA 4FJ0A 3L6OO 5T8KA 5JE8A 4CQMD 3H9QA 2GZ3A 3DOOA 2E82A 5JAIA 4IXWA 3FTPA 1GV1A 5EERA 4LCJA 1KVTA 3UH1A 3FNFA 4Q3EA 1DC5A 3TN7A 4DREA 3DHNA 1T2DA 3H5NA 3K8ZA 3PWSA 1TLTA 3L4BC 2YHUA 3OP4A 1QSGA 2H5LA 4CM6A 1R16A 2X23A 3I9JA 1Y7TA 3VPFA 1B15A 2FPIA 4KWHA 4GSKA 5U9CA 3C1OA 2LDBA 5TQVA 4PN3A 2J5KA 3BMNB 3DMTC 3PJFA 4OJNA 5KOIA 2VTEA 1VSVA 5JLAA 3OBBA 2Q49A 4O1MA 1PJTA 1QP8A 2A9FA 1SPXA 5AXBA 2OXIA 4XYBA 4XA8A 4WLFA 4BOYA 3V2HA 2I3AA 3M6IA 1WP4A 2DKNA 2HUNA 3B1KA 3HFGA 1N1GA 3D4NA 5CDSA 1BVUA 1GEGA 2HRZA 4MVJD 2DQ4A 2HU2A 4GWKA 1HKUA 3NX4A 1MG5A 4J16A 4CM9A 5ICSA 5FI5A 3VTZA 3JCZA 3PP8A 2XPCA 2E37A 4TSKA 4BNUA 1MG0A 1Z82A 1K5HA 1EK6A 5DCWA 5G0WA 1U8FO 4FFMA 2YHIB 4CJXA 5CDYA 4TROA 1SAYA 1KEVA 1PL7A 4BNZA 1KY4A 4OQZA 1RYDA 3QW2A 4IDBA 4J4HA 2PZMA 1NWHA 2NVWA 3LT2A 2RIRA 1ZJYA 1E7SA 2HMWA 2Q2WA 2Z1NA 3L6EA 4BV8A 2BLLA 4CLRB 1BW9A 4Z6KA 5KVCA 4QO7A 2AEFA 2VUUA 3ABIA 1DAPA 3EZLA 2C54A 3KOUA 3LYLA 4LW8A 4D44A 1DIGA 1S7CA 4I08A 2NADA 3U4DA 1D1SA 1D1TA 3FR7A 5H83A 5IFLA 3QWFA 5CAEA 1YWGO 5JDCA 1YBMA 2PGLA 4CMEC 1YB1A 3B20A 4FD3A 3RI3A 1T25A 4R54A 5A06A 2NU6A 4CM4B 2OP0A 1C1XB 2C0CA 1ZEMA 1ZUD1 2B4TO 2ZB3A 1PJQA 2D2IA 2EW2A 2X1HA 4R1TA 1YGYA 3NT2A 2DBQA 2X9GA 1Y6JA 4GKBA 3DZBA 2GGSA 1GQQA 1C3VA 4IQ0A 5GZ1A 2Y1CA 2WDZA 2VTDA 1E7YA 2O3TA 3NTQA 4P4LA 3A4VA 3PJGA 4DIOA 5HWSA 2QYTA 2YFHA 5L95A 4R9RA 4UUOA 1ONPA 2EEZA 3IKTA 2VZ9A 1R37A 3B6ZA 3FI9A 4HNGA 3H9EO 3PGJA 3WJ7A 2VYVD 4DBZA 5DP1A 5C3MA 2WE8A 2HAEA 2O3UA 3C7AA 4NNJA 4YWJA 1E3SA 3K2BA 4J9VA 2AE1A 3KYDA 1DHTA 4CQMB 1Q7BA 1TT5A 4B8ZA 5JAZA 3KVOA 2NVBA 4RDIA 3NKLA 3RUCA 5A9RA 4D46A 1OFGA 2O2SA 1KVSA 4GH5A 1K6JA 2ZQZA 1BXGB 3AI1A 1WWKA 3T4EA 1H6AA 2I67A 4CMCA 2GN8A 4C4OA 3RROA 2C20A 4JP2A 3VH1A 5AQ1A 2GASA 5CEEA 3QVOA 3CKYA 1FK8A 1QKIA 1BDBA 1ORRA 1XU9A 1XLTA 2B4QA 1DJNA 1MP0A 1UXIA 4HY3A 4I5EA 3OICA 1XA0A 2HK9A 2Z1MA 4B7XA 4YQZA 3GUYA 2O23A 4FJ2A 3ZWOA 1KOLA 1ZK4A 2AEJA 3WTBA 3GVCA 3AU9A 4AJ4A 2DPHA 4OH1A 4BVAA 3DZFA 3WBBA 3SC4A 4M8SA 1U3VA 3ZHZA 1FDVA 4DRYA 4J1TA 4BO6A 1DIAA 1CEQA 3F5SA 2AG5A 1C14A 3PRJA 4RO0A 3D0OA 4KTTE 2X0NA 3OQ1A 4JQCA 4D3SA 3PWZA 1Y8RB 4XYEA 1O95A 1Y5RA 4WKGA 4CLOA 5J23A 4U6SA 1TVEA 4YT2A 3PHLA 5L9AA 2AE2A 4YACA 1IHXA 2FHSA 2EXXA 4IDGA 3WTCA 4W4TA 1GR0A 2XAAA 1RPNA 3DBVO 2O50A 2NWQA 2ZYDA 1PQUA 1LQTA 4JJGA 4R3WA 4DYVA 4N5MA 2PNFA 4IS3A 4BO4A 2CSUA 1C0LA 3VVCA 4YTEA 3RC9A 1IY8A 4QFDA 4Y6SA 4RCVA 2IEBA 4FC6A 5KVVA 1SOWA 3WJAA 4K9DA 4MVJG 1ZK2A 3K5PA 3ON5A 1XR3A 1UXKA 4WEQA 3ZNNA 4EJMA 5A4DA 2PZKA 3RIHA 3GOHA 4DWVA 4R01A 4QECA 2ZYGA 3T7CA 1G1AA 1MC5A 4WCFC 5DBFA 3P19A 1YH3A 4R9SA 4L8VA 4XD2A 3OIGA 1ISMA 4XQ9A 1KY5A 1SBYA 5A04A 3ITDA 3E03A 5A02A 3D5TA 1EBUA 3MJEA 3NRCA 1CQIA 2Y1OA 4CV1A 4E33A 5FEUA 3DWFA 3QVWA 1M67A 4QEDA 1FDTA 4D0RA 3ZV3A 1PJ2A 3BHIA 3LF1A 4IINA 1IE3A 1SO8A 2FR8A 3PHGA 4W9NC 5CPFA 1I3MA 4PVCA 1VJ0A 3I3OA 2ZATA 1OBFO 3HHPA 3VDQA 3WGZA 2O3SA 1I3NA 1TB4A 2FWMX 2DAPA 4L9RA 3GA0A 4XX0A 4YJDA 4OAQA 4CLDA 4PLPA 1LDYA 5L4LA 1PWXA 2FZWA 4IIUA 1JW9B 5C5IA 3FRJA 3JQBA 4WLEA 1PJBA 2R2GA 4MP8A 1EE9A 1IZ9A 3AM3A 1Z6ZA 3CZMA 3S2GA 5TRTA 4RVHA 5IXSA 2W2KB 5I9NA 1YS4A 3H5RA 1R0SA 2IZ0A 1JKIA 2Q2QA 4BGUA 1YJQA 4MDHA 4BO1A 1ULUA 2OMEA 2VZ8A 4J9UE 4J2OA 1IPEA 1H6BA 1OMOA 3PYXA 3E9NA 2GF2A 3NTOA 2JFGA 1P33A 1UDBA 2AQHA 3PTZA 2VOJA 4TWRA 2VHXA 3I9LA 4UVEA 4ZQBA 1SB9A 1UP4A 4KDFA 1A9ZA 4C7JA 1ADFA 3KV3O 1P44A 2PR2A 3I6IA 3F1LA 5GY7A 1PWZA 1BXGA 2BGLA 2CF6A 4Q39A 3G49A 2AXQA 3AUSA 4D43A 2C5EA 3ANMA 2PA3A 4AJLA 1BXZA 2GZ1A 9LDBA 2AQ8A 1E77A 3STHA 3RU9A 1MXHA 1YO6A 3K30A 4XQGA 1R0LA 3KSUA 1B3RA 4YT8A 1XQ6A 5KKCA 4JIGA 5H82A 2V6MA 3BXXA 2VYNA 5FFFA 1TT7A 4AJKA 4BL5A 5BNIA 4HFRA 4YB8A 3ADOA 5IZ4A 1CRWG 1OAAA 4BQRA 3JQCA 1DAOA 1UAYA 2Q1TA 3ZV5A 1GDHA 4YAKA 3WX0A 4ALIA 4ZJUA 4TKLA 1HL3A 5TX7A 1P1KA 4ALKA 1U1IA 4NR0A 3EVTA 4XYGA 4IPTA 1G6KA 3HNPA 4RF3A 5BSFA 3V8BA 3L6DA 5K6AC 1UAGA 4RORA 3GHHA 1NQ5A 5KVSA 2QRLA 1UXGA 4MVJM 3DFZA 3ZNQA 1NR7A 4P4GA 2D1YA 3DB2A 4CR7A 3FR8A 1HLDA 1VE9A 3KEOA 2X7HA 4LCEA 2D3TA 2SCUA 3HWRA 1T2CA 4PG8A 1ONOA 3TZ6A 4U7WA 1X0XA 4MKRA 4Q3CA 1K2WA 2Q50A 1GPDG 4E5MA 4RVUA 3IL2A 1EQUA 2DFVA 1NQOA 1P1JA 1QV7A 1VC2A 3ZWYA 1SCUA 4D79A 2WWRA 4GGOA 3C7DB 2EJWA 3LC2O 4Z9YA 3WFIA 4IQGA 1SB8A 3L9XA 3D3EA 5F3RA 4NFYA 4PVDA 3IKVA 3KYCB 4YVFA 1R4MA 2EF1A 4CLEA 4UUMA 4WEOA 2IXAA 5TF4A 4IGFA 5CDUA 1LRLA 1YQDA 3COSA 4INAA 4RVFA 3DHEA 3RUEA 5EN4A 5ICMA 2VHVA 1RWBA 1N8KA 4MOWA 4GL4A 4P38A 4ALJA 3GZNB 1P1FA 4W7HA 1N92A 1H5QA 4M87A 1U28A 1U3UA 3W6ZA 1YOVA 4I9NA 3VZQA 4A27A 1DIBA 3NTRA 3RC7A 1R0KA 4J4BA 1ZO8A 2Q4BA 5ILOA 1EFLA 5HTOA 5K9ZA 4BB6A 3UXYA 1VKOA 4E30A 1ZCJA 1G0OA 2H6EA 2YQ4A 3JQ9C 3Q9NA 5JDIA 2GSDA 2NTVA 2NVUA 3TZQA 4IMPA 3IP3A 1HZZA 4FBGA 1IL0A 5CPBA 1C1DB 5AOVA 3S2IA 4D42A 3HB5X 1E6UA 3PFFA 4FC7A 1XKQA 1LNQA 3PIDA 3WBFA 2ET6A 4MJLA 2JFFA 2CY0A 3JQ7B 3RASA 4CM9D 5DULA 3OMLA 1DC3A 2V7PA 3DOCA 3P2YA 4YJGB 1SZJG 2G0TA 5BSGA 1PL6A 4J1SA 3WGQA 4NPCA 3AOEA 3I83A 2W2LD 4PLFA 4B4OA 1MXFA 3PDJA 1ML3A 4RZIA 1WZEA 1QORA 2NUAA 4H3VA 1I32A 2AQIA 1RM5A 4OM8A 3RD5A 4BMNA 1HYHA 3NGXA 4CM3A 4WE3A 1P1IA 2PH3A 4YAJA 1NASA 4TKMA 5L3ZA 1U9JA 1ADGA 1UZMA 4DIFA 1Y8QA 3ONFA 3KLPX 4CMAA 4DLAA 2VWPA 3DMYA 2JCYA 3C8MA 3KSZO 3Q9UA 2FRDA 4IDFA 4DUPA 2VRCA 1GZ3A 1NPYA 4OKIA 1OZAA 2VHYA 4U0JA 2GD1O 4HWKA 3SJUA 4CM5A 1XGKA 5C37A 2DBRA 4BGIA 4UUNA 4KUHA 3EZYA 4BKPA 2O2YA 5ES3A 2ZKLA 3GMSA 5EQDA 3ZWXA 4OSPA 4L73A 4FFNA 1AXGA 1LDNA 3JSAA 1MLDA 3DAFA 1GY8A 2RH8A 4OSOA 4HV4A 3SLKA 3PQEA 1SEVA 2X5OA 3LT1A 5G0SA 1KIFA 3ROQA 2Q45A 4DA9A 4OIMA 4Z3DA 4MIEA 3W4JA 3ORFA 1HDRA 5IDQA 1UZLA 3RVDA 3K92A 4N7RA 4MVJE 3D5QA 4YRDA 2H63A 1YE3A 3KEQA 1D4FA 4NK4A 2P91A 1AUPA 4AJOA 5DN9A 2G5CA 1NFRA 1MUUA 4F45A 1VI2A 2BHLA 4DPMA 3ICCA 3LT0A 4Z0TA 4DQVA 4O5OA 5B4VA 4ZU3A 3JYNA 4FSHA 4WLVA 2WEKA 5EL0A 3QE3A 4BO0A 4Z3KA 2C2XA 3S2FA 1EUCA 1BWSA 5AVOA 5BQFA 2C82A 3GRPA 4AJHA 4II2A 3R3SA 1HDCA 1WDLA 1BSVA 4LRSB 1ZMOA 1IYZA 3PJEA 3S55A 3TF5A 3TOZA 2PTGA 1NP3A 1GUFA 3JQFC 3ZWPA 3H6KA 1RM0A 4AJJA 3CSDA 3DBRA 1Q7CA 4LSMA 1P74A 3JQAB 3E6AA 3QHAA 4PZDA 1GYPA 2UV8A 5EJ2A 1WDKA 3VHRA 1ZW1A 4MP6A 1A71A 1NTOA 1TI7A 4CPDA 5T64A 4DMMA 3MJVA 3ZWCA 1ZK0A 3G3EA 3IP1A 3UW3A 3FCOA 3ROKA 4X54A 4XJSA 4PCVA 1BHSA 3D4PA 4DIBA 2EP7A 4NJMB 4YJFB 3PVZA 3AK4A 2Q99A 4QFCA 2X0IA 1M6HA 2R6JA 3JQ7A 3QJ5A 4L76A 4ID9A 2I66A 3ZNOA 2YJZA 4FN4A 1JU9A 2CDCA 2DT5A 4XKJA 1XSEA 1A4IA 3DTTA 3LC7O 1DFHA 1HE5A 1QLHA 1EVYA 3KYBA 4YJGA 4G81A 3ZDFA 2BGKA 1B0AA 1PZGA 4B3JA 3ETGA 5AYVA 2Y0DA 4W6ZA 4Y8VA 1GQ2A 3C1TA 2OP1A 1PTJA 4OL9A 3TDKA 5IF3A 4ZICA 1XHLA 1JLLA 3PWKA 1E0DA 1IB6A 2HLPA 4ND4A 2JCXA 3TFQA 4LK3A 5G4LA 4RZHA 5C7OO 2DUWA 2XOXA 3D3WB 3ZU5A 1U2DA 2E48A 3ETEA 4JGBA 3HDHA 4R3NA 5B37A 5KNLA 4JN6B 1JAYA 3OIDA 4N5NA 2FR0A 2NLOA 1ZVMA 3DC2A 5COBA 2EP5A 2YUTA 1M2WA 4U8GA 4B3IA 4OOEA 3CEAA 2EWMA 1U7HA 4JBIA 5KWEA 3WWYA 3JYQA 4MP3A 3GGGA 2IODA 4CM1A 2EGGA 2V6BA 3U0BA 1KC1A 1I2CA 1A72A 1T1RA 3ZW9A 2H9IA 4KP7A 4A03A 1LXCA 5KVQA 4J2HA 5KJCA 4L75A 4Y6PA 3FN4A 2PGJA 2Y68A 4IGEA 5CP8A 4GX1A 4PRLA 4NI5A 4JP3A 3RFVA 3UF0A 2GRAA 3OEWA 1QV6A 4GLOA 2O7QA 4Q3BA 3R6DA 3GUCA 1CQJA 1BDMA 1CERA 2HO5A 1UUFA 2IEDA 3V1YA 4F3YA 1XCBA 3DQPA 3AFNA 3PJDA 5JCXA 4AL4A 5G2OA 3FNHA 3KTDA 4OQYA 2WTBA 2J5QA 3PDUA 4FJ1A 5JCJA 1IZ0A 5A9SB 1M66A 4WOKA 3FNEA 2FSVA 3WWZA 2WM3A 3GVHA 5EQFA 4AJPA 5HA5A 2ZCUA 3KB6A 1LTHR 5COQA 3ZZNA 3IC5A 2J3IA 1RM4A 4A7PA 3OIFA 4N5LA 1EUZA 4LMPA 3CXRA 5JO9A 3WGGA 4CUJA 5DBGA 2WD7A 1PJCA 1PQPA 1WLYA 1P77A 4UREA 1A7AA 3HB4X 5I8ZA 3BA1A 4XB1A 1PEDA 3WSVA 4IJVA 1HSOA 2HMVA 1ZFNA 2FSSA 2X9VA 3AY3A 1NYTA 1T26A 1WPQA 2ZB8A 1LSJA 3G0OA 1QMGA 3PHJA 3RWBA 1JDJA 4KUGA 3PYLA 4BMSA 2TMGA 1H2HA 3INTA 1YBVA 4ZQFA 3HUDA 1KVRA 4HXYA 4M1QA 3S2EA 4Q3AA 2DLDA 3KO8A 1A4UA 2VYND 4BNVA 3OFSA 5G4KA 3GFGA 4OO3A 1H6DA 4FIZA 4YJHA 1B14A 5F5NA 2X5JO 3WFJA 3W4IA 3TJRA 3A14A 1LC0A 5DP2A 5F1KA 4I5GA 1UP7A 1EDOA 3GEMA 4NJMA 2CF5A 2Y05A 4XIYA 2OBYA 3U5TA 3OJOA 3L4SO 1IOLA 4BQPA 3BTUA 1A27A 3N74A 1BG6A 1A5ZA 4YEDA 1AE1A 1CETA 1X15A 2YFQA 2P9CA 2EGHA 4FOOA 3K31A 3U4IA 1YQXA 4LVUA 5TC4A 4JJIA 3M2TA 2GR9A 5MDHA 1OC2A 2PLAA 4K28A 2X86A 3JQEA 3OSUA 1HDOA 4BGEA 2BRUA 4YCAA 4TMFA 4BMVA 3FNGA 3WIDA 2WYWA 3D3WA 3U4HA 1FDUA 1NFQA 2F1KA 3V2GA 2I3GA 2NNLD 4BO8A 2PD3A 5KJ1A 4ROSA 5L7WA 4XDZA 2FY8A 4A26A 2BI7A 4GGPA 5CG1A 1Q7GA 1W0CA 5I8WA 1HZJA 4PG5A 1PGPA 5DNAA 4BNGA 1LSOA 2Y1GA 3ZU3A 5LDHA 4MPDA 4W82A 1EDZA 4XZ3A 1WAMA 3PZRA 4PG4A 3ZWMA 1Y9EA 1P31A 1R66A 4J7XA 1EE2A 3NJ4A 4R4JA 4EBFA 4U5QA 1EMDA 3EHEA 3H5AA 5G0UA 1MB4A 3GK3A 3VC7A 2C5AA 1JWBB 2GPTA 2VN8A 4GLLA 1K89A 2VWGA 1HE3A 4XYMA 4I5DA 4CR6A 3QRWA 1ZSVA 4CMKA 2NU9A 2C59A 3BMOB 3Q2KA 1EVZA 2Q1SA 4CUKA 4J0EA 1E7RA 3HN7A 1I30A 3JQ8B 3X2FA 1EFKA 4BNIA 3G1UA 3WSWA 3TOXA 4UUPA 4PFJA 1E7QA 1C0IA 2ILTA 3PPIA 3KXDA 4QSMA 5BSHA 4CMIB 3E1KA 1BVRA 3WG9A 3FSRA 3H7AA 1JVBA 3MTGA 5T57A 3MJTA 3TFOA 4M86A 1E7MA 1R6DA 1VRWA 1YJ8A 3VPSA 3MEQA 4FB5A 1E6EA 3CPSA 3DZIA 3BMNA 3JQ6A 2PWZA 1IPFA 4GPD1 1NHGA 5EMHA 3D4OA 4M55A 3E5MA 5CDGA 4I1IA 1B7GO 2QG4A 1RYEA 1DB3A 3E5RA 5HM8A 1ZBQA 5JC8A 3NT4A 3UCFA 5G0VA 3PLRA 4HX5A 4FCCA 5GMOA 1CJCA 4J7UA 1EZ4A 5TSDA 5IG2A 3C3XA 3GEDA 3FD8A 2Q1WA 3VVBA 3CUKA 3GVPA 5U1PA 3L77A 1F0YA 5JS6A 2QZ9A 2A4KA 1NBOA 2YHIA 3H9UA 4M89A 4WNIA 3Q3CA 4BGVA 4ZHSA 2D8AA 2P2SA 2GZ2A 4BNKA 5L4NA 2ZB7A 4ZQEA 1YXMA 2Q2VA 3RBXA 5FF9A 1U5AA 7ADHA 4C7KA 3UICA 2FOIA 3ZV4A 3JYPA 1AGNA 3MZ0A 3UAGA 1EVJA 1NQAO 1X7HA 2R00A 1NPDA 1ARZA 3A9WA 3FPLA 4CLRA 1F14A 3IJRA 2EERA 4EW6A 1EEHA 5T67A 3AI3A 3AFMA 4DTIA 2P4HX 3NT5A 4R69A 4XJTA 2C7VA 1KVQA 1NAIA 5DZSA 2BD0A 4G5HA 4I8XA 4OXNA 3ZW8A 1T2FA 4ZN6A 4J43A 4PG7A 3OEYA 4U0KA 1H9AA 3R1IA 4CM4A 2VHZA 3EUWA 1C1XA 1P1HA 2CVOA 1E3LA 1ADCA 3E9MA 4FFRA 5JW6A 5TNXA 4CLXA 4NBRA 4NJOA 2A35A 1EUDA 2WMDA 3RKRA 1XQ1A 3UKOA 4DYDA 3H4VA 3HZZA 2OL4A 3G79A 1TXGA 4W99A 1E3EA 1R15A 1B8VA 1CF2O 3CMMA 4ND1A 3TSCA 1LBEA 4A5OA 1UP6A 5JFOA 3RC2A 2VUSA 5JAMA 4B7CA 2BKAA 4CM8B 1Q2XA 4BO5A 1CDOA 3P7MA 4CUZA 3P5SA 4IS2A 1M6WA 4FDAA 4MINA 3ZHXA 3GAFA 5B1YA 5A03A 1DO8A 5CG2A 4IM7A 5FYDA 5T6BA 1OC4A 3F46A 3SJ7A 5B4TA 1GV0A 3GF4A 1HYEA 3LQFA 4XB2A 3RUAA 4CQMA 2WJPA 1WW8A 4GSLA 2O3QA 3H2ZA 3U09A 1ISIA 3IQDB 2DUUA 2CVZA 5A05A 4L4SA 1O89A 4R1SA 4CV2A 2EV9A 1KEPA 4E2XA 5HRUA 1DBVO 2VWHA 3KRTA 3N58A 3BMOA 3M1AA 3O8QB 1UXJA 3OF2A 1HXHA 4ND5A 5BT9A 1JWAB 2Q4EA 2Y0CA 5C7LO 2B36A 3JQ8A 2O3RA 5ENVA 3WOHA 3VZSA 3AM5A 4NBTA 4CL8A 4CMIA 3DZGA 3PXXA 1LDEA 3TZCA 3O38A 4Y9DA 4F6LA 3TZHA 3QSGA 1N9GB 3L4BA 1LDMA 3H8VA 3I52A 4GKVA 1E5LA 3QVXA 3GEGA 4LRTB 1O6ZA 3LK7A 1XDWA 4BIIA 2WSBA 1PSDA 3DMTA 3EMKA 3TL3A 4E2ZA 3DBLB 4E4YA 1B26A 3AJRA 3K9QO 4JROA 1UXHA 1Y8RA 4ND3A 3Q2IA 4R5HA 1YKFA 2OBNA 5JXWA 2EJVA 3DTYA 4XRGA 1ZZEA 4P8RA 4PIVA 1GCOA 2GCGA 1ZIDA 4D0SA 3PLNA 5TS3A 4P4NA 3WDSA 4AJ2A 5BNTA 4NBWA 3GRKA 3ONEA 5ENDA 5ITWA 4AJNA 1YL6A 3MJSA 2QYSA 4OGWA 2BFMA 1VJ1A 3UHAA 5A3JA 4A10A 2WD8A 2CFCA 3TWOA 1I3KA 5T8KC 4GBJA 1CIVA 3AUUA 3GN2A 1LC3A 2VWQA 4IBOA 4E2YA 1U8XX 1PZFA 4E5PA 5A5FA 1YB5A 1GAEO 2W8ZA 1XIVA 1HE2A 4UULA 2HK7A 3HDYA 1PU2A 1JN0A 2IRWA 4J3FA 2DTDA 3F1KA 1B8PA 1JA9A 4BNMA 1H0KA 3UOGA 3UUWA 4WCFB 1QLJA 1Q1NA 5L4SA 5JC1A 4CMEA 3NEPX 4KMSA 3RJ5A 1HT0A 4AJIA 5EIOA 3LLVA 3DONA 1T24A 4BNYA 5JMPA 4RPLA 1ID1A 3ICPA 4PLTA 4RF4A 5JCJD 2I65A 3V1UA 2VYVA 2Y0EA 5L45A 4S1VA 3DAGA 4HFJA 5THKA 3GHYA 1NVTA 3WYCA 2NQTA 1YRLA 4UEJA 1ISHA 1NPTO 5KCZA 2IYOA 4E5YA 1EQ2A 2GO1A 2I9PA 4CMGA 1PGOA 5TJ9A 1QYVA 3QWAA 4QUKA 1X7GA 4QO8A 3RC1A 1R4NB 4TVBA 4EYEA 1PIWA 1MC4A 1O94A 4NK5A 3W6UA 3GT0A 4E6PA 4QT0A 1MV8A 2QX7A 2W2KA 4UAGA 1VLLA 2JD2A 4WNCA 1N7GA 2FP4A 4K6FA 4GVLA 1ZXLA 3KHUA 3SBOA 4NZ9A 4TRJA 4NH4A 4R1UA 1HDYA 4ZD6A 2RHCA 3HG7A 2RBEA 1D3AA 3DBHB 4H7PA 1NVGA 2Y93A 2HRBA 2YYYA 4EUEA 2PD4A 1E5QA 4WJZA 2ZTUA 5ILGA 1O0SA 2O4CA 3GN1A 1I36A 3RAJA 4UVHA 4RQUA 5JNLA 1I0ZA 4QTZA 1DEHA 4YAIA 3HE3A 2GN6A 4HBGA 2YV2A 1NXQA 4EGFA 3DR3A 5CFZA 5JDCC 1B8UA 1YQGA 2VT2A 3RU7A 2UUOA 2C29D 1NAHA 3I4CA 3ETDA 1V6AA 4E0BA 1AN9A 2GNAA 3BMQB 4DC0A 4FR5A 4FFPA 3BAZA 3RFXA 1PZEA 1Z73A 2HMUA 2P9EA 1NFFA 3G17A 4Z0HO 2E4AA 4XDYA 1WZIA 4HADA 1LI4A 2BFPA 4MIOA 4K1LA 4Y6RA 5EINA 1WVGA 1DRUA 5L40A 1UR5A 2C7GA 5I7FA 2FMUA 2BELA 4FS3A 1YDEA 2BI8A 4HFNA 2EG9A 4R41A 5KJ6A 3DFUA 1GYQA 2FPPA 3WMWA 3SX2A 4MO2A 4BKQA 5CDTA 5MGBA 1P1RA 3E9QA 5I7SA 3GNQA 4B8WA 4ZRMA 1H6CA 2NU7A 1KC3A 2PZLA 2Z95A 3WLEA 3QVTA 1U4SA 2OUIA 2PK3A 4DGSA 1CWUA 3NUGA 2YDYA 3GR6A 4WPGA 3LLSA 3ZH2A 2OGUA 2HK8A 4RF2A 3G1TA 4RVSA 1A9YA 1JVSA 3FTNA 3HJAA 1C0PA 3BMCB 4E31A 4NFSA 2I76A 3ZWWA 3F9IA 3ZWAA 4WK6A 3PFWO 3VPGA 1X13A 1F12A 3R3JA 4ND2A 1I2BA 4IZIA 4OKNA 1Y81A 4LMRA 2E49A 5DOZA 2UDPA 1J0XO 1HRDA 4B4UA 2NV6A 3K96A 1ZNQO 1S6YA 1WXDA 2Y1FA 3KYCA 1ONNA 4WCFA 1SNYA 1KEUA 4ILKA 1N5DA 4RV9A 3K6JA 1ENPA 3NDJA 4J1NA 8ADHA 4KOAA 1JKJA 6LDHA 4CODB 1KBZA 1XELA 2NTNA 4FFOA 4DQXA 5DDIP 2BF7A 4NG5A 3PHIA 2TMDA 3GZNA 3LZ6A 2QW8A 5F1OA 2JKVA 2FR1A 2HMTA 2OO5A 1QXSA 4NDNE 5DCYA 3U3XA 4N18A 4RL6A 2PZJA 4ONEA 3FF4A 2ZB4A 3GDOA 3CINA 4K6CA 3CTMA 5CHEA 4W9NA 4E3ZA 2C2YA 5DT9A 3IDSA 4L4RA 4ZRNA 2YY7A 2V65A 4AFNA 4A2CA 1I01A 4XR9A 1PJSA 1B16A 4TVOA 2FN7A 4EEXA 3QVSA 1V8BA 3SC6A 4IJWA 3I23A 1C1DA 1UDAA 2VUTA 3LC1O 2OHXA 1P3DA 2FZEA 3WGYA 3WQQA 1J49A 4J6FA 4IIVA 2JHFA 3EYWA 5HS4A 2HKIA 3CZRA 1H9BA 4I5FA 4IDAA 3HDJA 4GX2A 1LSUA 4NU5A 3L0DA 3VKUA 5FI3A 4XQEA 3X2EA 1WDMA 4GI2A 4OXYA 3FWNA 1BW9B 3OM9A 4J90A 2HSDA 3NDRA 2XF8A 1DFGA 2EHDA 1SOVA 3C24A 2CZCA 4AICA 4CL3A 5JMWA 2QZZA 4L0QA 1Q0QA 3GPIA 3H3JA 1LLUA 3I9MA 2CMDA 1WMBA 4K26A 1M76A 4BNJA 3EDMA 1DHRA 3KM0A 1ISFA 1BTOA 3UVEA 3R0IA 2NACA 3QV1A 1PR3A 4LGVA 1N2SA 1GCUA 3NYWA 4FOSA 3AU8A 4EDFA 1UH5A 4YXFA 3NDIA 1YL5A 2I99A 3OJLA 3UCXA 1U7TA 1NR1A 1VM6A 1E1MA 3PZBA 4DQUA 3I1JA 4WLNA 4XIJA 1V3TA 3VAZA 1E3WB 1QYXA 4WLUA 3ZI0A 4CV0A 3K2EA 3JQBC 4PZCA 4OOFA 2VNAA 2DC1A 3KLMX 1Y1PA 5L7TA 2NQ8A 1W4ZA 4II3A 5IN4A 2IDZA 5K6AA 4NQZA 2ZJ1A 1C0KA 2AG8A 3GDFA 1Z74A 3H2SA 3IOYA 3MCVA 4HNHA 4GAEA 3GMDA 1PS8A 4WECA 4Z9XA 2HJSA 2QHXA 3EVNA 2UAGA 4IUYA 4XRRA 3IJPA 3ANNA 3GQVA 4ZGWA 3H9JA 4CMHA 4XGIA 4XCVA 1R12A 1TT5B 4RQTA 5IAAA 1ZKMA 4HFMA 1KVUA 4E13A 3FHLA 3CH6A 2XXBA 4WCDA 1MFZA 5BNFA 2X8LA 5TIIA 1TA4A 5EPOA 1ZSNA 2EW8A 2DBVO 4H15A 1Q0LA 4NHEA 3ZHYA 3RBZA 1E1LA 3OA0A 3JD0A 3GVXA 3A06A 5HS6A 2CD9A 3HSKA 4DVJA 3ROMA 4MVJP 3FWZA 1DC4A 4G2NA 2DM6A 2NTJA 2DTEA 1DDOA 3TL2A 3DOJA 4FPXA 1ZEJA 2O3JA 3MOGA 1W8DA 2PKQO 2VZ0A 2ZYAA 4MKXA 1GQYA 2GUGA 2DBZA 1DPGA 4R51A 3UFXA 3WNQA 4YAGA 2DFDA 3SXPA 4MIYA 3LVFO 4BO7A 1OOEA 2AEMA 4IDCA 3I9NA 1KERA 4BS9A 2PD6A 3AW9A 1ZMTA 2DTXA 3JQAA 5T5QA 3DAPA 1X1EA 4G65A 1V3UA 2CDBA 3W8DA 3ZHBA 1GYRA 3V2UA 3QY9A 4UEOA 4BNXA 2D59A 3EK2A 4EEZA 5DOVA 2B4RO 4LSWA 4Q3NA 4Z9FA 4OXKA 1B3BA 4CQLB 5GZ6A 4CLOB 3WQRA 2P68A 4R16A 4EI2A 3EGOA 2QQ5A 3DDNA 5EESA 3I4FA 3JQ9A 2E6UX 4YJFA 4DPLA 1DLIA 2JJYA 1PZHA 3PK0A 4JCOA 2WE7A 3ZWNA 4AJ1A 4B7UA 4YBZA 3L07A 3D64A 3RJ9A 1FJHA 3C1AA 2W98A 4E32A 2JHGA 5L7YA 3RQSA 1WMAA 3UCEA 2W2LA 2AA3A 1X0VA 4ZVVA 2X22A 2JD1A 1IULA 1K0UA 3OQ6A 3BTVA 3CMCO 2OFPA 4GMGA 5THQA 4B79A 3ZN2A 3DO5A 4FW8A 3RUHA 1PR9A 1E92A 3E18A 1ZXBA 3VTFA 2D5CA 1HDGO 3B70A 4YQYA 2YW9A 2PFGA 2HMSA 3WS7A 2Q1UA 2DVMA 1WNTA 2RCYA 2YV1A 3W8EA 1U5CA 1T2AA 2CDAA 1UJMA 2C07A 5B12A 4N54A 3HDQA 1FDSA 1K3TA 4UVIA 3LF2A 2ZQYA 1IUKA 5A5EA 2NSDA 3E82A 1NX6A 3PHHA 4RVGA 2O48X 2BFOA 3INRA 2B69A 2DPGA 4PG6A 1ZK1A 1MGOA 4TZKA 1O8CA 1GZ6A 3ULKA 1HLPA 1L1FA 3GG2A 4RPGA 4TQGA 1LSSA 4HKTA 1E3WA 3O4RA 3MWEB 1HDZA 1T1SA 3ENKA 4NFHA 5JDIC 4DLLA 4DBVO 3VOSA 2B83A 4ZA2A 3M1LA 1PJLA 5JBIA 2VOEA 3DEYX 3JD4A 5I9MA 2J6IA 3WGOA 4DC1A 1AXEA 1I10A 1ZK3A 2JAPA 1EBFA 2Y1EA 1YVEI 3OQBA 3VZPA 1H2BA 1Y9AA 3GNSA 1Q0HA 4PLHA 4EUFA 4OMUA 5A9SA 1RJWA 3GFBA 3AWDA 4F6CA 1E6WA 3LSYA 1CYDA 1V35A 2PY6A 4PLVA 4BO9A 1OI7A 3AOEC 4W7IA 1W6UA 2Y1DA 4TZTA 1DIRA 4IJKA 1GTMA 2OOSA 4BKUA 2YQ5A 2ZTVA 1HE4A 1KETA 2B5WA 2Y99A 1W73A 4Q9NA 4KQWA 1L7EA 3BHJA 3UGKA 4JNKA 3WMXA 1JKFA 4RF5A 5DBIA 4EITA 3ASVA 5TGDA 1QRRA 3BZUA 2PV7A 1YB4A 1ENZA 2Q46A 3IUPA 3H9GA 5KTKA 2AMFA 4UVDA 3C85A 2J3HA 5JYEA 1JAXA 5K0ZA 4IMRA 1PJ3A 3WR5A 4MVJI 3WQSB 1DRVA 3FPCA 1LRJA 2X0JA 3ZWBA 1I24A 4WUVA 4YR9A 2VCYA 1HETA 3AY6A 4YRBA 4PLZA 3JQFA 1O9BA 3A28A 4M54A 3KSDO 3RKUA 2VRCD 3OECA 5AXDA 4XEHA 2G17A 3WICA 4CR8A 5F1PA 1XYGA 4KDEA 3WXBA 4CQLA 4TRNA 1N1EA 3PEFA 1GD1O 3S8MA 4L74A 1RKXA 4RJTA 4DMLA 4CLHA 3VPHA 1O5IA 1I2ZA 1GEEA 4XGKA 3N7UA 1ZH8A 1U4OA 2FPGA 4FFLA 1NVMB 5A9TA 4FGWA 1FMCA 1XG5A 2X0RA 3RFTA 1SC6A 1D8AA 3ZV6A 4KWIA
chains in the Genus database with same CATH superfamily
2H2IA 4UE2A 4PANA 2WYOA 4WFJA 1LI5A 3NUZA 1NRIA 3AGPA 4P83A 3C39A 3H65A 5ISMA 3WGTA 1C9NA 4DDHA 4RPJA 3ETLA 3DJYA 5GINE 2V9ZA 2MDTA 3T7AA 2BKXA 3E5NA 3BIFA 2R7MA 4Q82A 1YQ9A 4ZTZB 3SZOA 1X1TA 1LUAA 3ELWA 3JYLA 3CY6A 1DXHA 3NWJA 1R8YA 1WHSB 3ANSA 2JCVA 4MW2A 4P81A 1LLDA 3FYUA 5TJHA 4ENPA 5JQGB 3V4RA 4GOOD 1JTEA 3K0CC 2XE7A 1Z7EA 3LPCA 4RXTA 3PI7A 1F0KA 2H3HA 3GGSA 5KOJB 3MJ4A 3VKFA 1YUNA 3O8DA 3PUVA 4CI0B 1J20A 1V96A 3UG7A 2X0FA 2F1RA 5D5QA 2WZCA 1GL3A 2Z83A 2BH2A 4J0FA 3GJ0A 1GFZA 1RXYA 3IAHA 4J7CA 3O2NA 4RGBA 2AOTB 3IGFA 3IP5A 4C4AA 1JYSA 16PKA 1CY1A 3VH2A 3ZC3A 1EB9A 4A5SA 1JFFB 1HL7A 1CVIA 2P5UA 2FMHA 5ECWA 3D7LA 2B8WA 1UJ6A 2IYFA 2ZTMA 1KJ9A 4CKWB 3BL5A 5C8YA 2XMSA 3T35A 3VDRA 4ZJYA 3QY0A 3K15A 5IYZB 1YOVB 2O7RA 3GGPA 1Z2AA 1E1KA 3TNLA 1FUEA 3VU9A 5KNBA 3FA2A 3NETA 1YBHA 4EJSC 1EESA 5AMXA 1FL9A 3CUYA 1ONBA 1SQ6A 2QD2A 4PR3A 4RDHA 5CT5A 1G6OA 3TMYA 3PC3A 5IJWA 3I2IA 4FDTA 3NFYA 4EUKA 3CEHA 5AVUA 4D7AA 3M5CA 4A1FA 2E89A 3SDZA 3R6WA 3U7JA 3VR3A 2Y8EA 2NVUB 4IY1A 2XGGA 5AOAA 5FTKA 1VL8A 3LPDA 3TUJC 3FPAA 2PBRA 1S3GA 3B89A 1C4XA 2LNDA 2IH5A 3ZIAD 2JZCA 4D3DA 2OKCA 3E3OA 1EUQA 4PLCA 1N6LA 2BKEA 1YK1A 3M33A 4O4JB 5DWQA 4U2CA 1YA6A 2QTZA 2QIOA 2H07A 1Y37A 1Z7BA 4AZ0A 1X1SA 4ZC8A 3PFKA 3HCEA 4J4TA 4LKRA 2XQKA 3KZKA 4XJXA 1Q12A 4JOCA 4JR1A 2O1SA 1VP9A 2YZ7A 3UUGA 1ZQ1A 3CRW1 4CM7A 1U9ZA 2AOXA 1MAAA 3LVQE 4BFLA 3K70B 1Z0SA 3ENNA 5CUQA 2OXCA 4J91A 3QW4B 1B0PA 1ULBA 4JHLA 3I76A 4UCXA 4C07A 5KWIA 3AUKA 3PC6A 1RWMA 4L4XA 4TUYB 2WJAA 5ULLA 4WNAA 4UEQA 5EYPA 2OFWA 2H4HA 2W9XA 1YDGA 4KFRA 1GR1A 4YP0A 2OBXA 3KAPA 3TRHA 4MUXA 1XU7A 1AD2A 1T6NA 2CUKA 2O7SA 1QG6A 4ZK2A 4L5CA 5A1JA 5BQPA 2JD0A 3EC7A 4R5MA 4FHFA 1N2EA 1N3IA 5JY1A 4XWYA 3N2LA 2XGJA 2AOWA 2B7BA 1LPNA 2GNOA 1UC4B 3MMNA 3T7EA 1ZAYA 1VJCA 5KCMA 1QYCA 4DJAA 4RHCA 1G16A 1GQOA 1W87A 3BB1A 3EDOA 4XIGS 3O7MA 5I4CA 4KSYA 2H59A 1KPGA 2F55A 4GW3A 2PKQP 3ICQB 3CRRA 1DWUA 1H0HA 2PL1A 3HY3A 3KKZA 4Q1FA 4B3TB 3GZJA 4IDEA 3K73O 1PL8A 4PLYA 1WJGA 1TU3A 2AJLI 1KO8A 4JX8A 4KQIA 4PZEA 3RRYA 3DL2A 3VA7A 4Z4IA 1V4BA 3T3MB 3DYBA 1S89A 3OCYA 4L7QA 2VEOA 2HGZA 4KQCA 5JAOA 1Q0TA 1EGHA 2QLBA 4O6VA 3I01M 1NRWA 4QFMA 5AVVA 1C8VB 5AKXA 3T1NA 3T9BA 1AHPA 3Q15C 5ADHA 2PKRA 2IVFA 3M83A 3NV7A 3KBOA 1ZVVA 4GX0A 3LX5A 1S2GA 3AUAA 2UVDA 5FPYA 3MIZA 4CMJA 2PX5A 1WCXA 3PQ3A 2VNSA 3OFJA 3I9KA 3EG9A 1WMDA 3LW8A 1TDJA 2P65A 2PPVA 1M2OA 3PX2A 4NKRA 1V6CA 1KEEB 1U7XA 2AJCA 2P2NA 3GY0A 3Q0IA 4JLWA 4OIFA 3ZU4A 5AUOB 5HK9A 1UJ4A 2LGJA 2R4TA 3O03A 4IXTA 4N7MA 2A9VA 4FZ5A 2GN4A 1EK2A 3AEKB 3TRKA 1NWCA 5I7EA 1M8FA 3VZBA 2IZZA 1KZGB 4RK5A 3Q3JB 1E62A 3JARA 1R4AA 4UDNA 3OFKA 4L0CA 1ISGA 3E0XA 4YLEA 2ONYA 1CUGA 2BF4A 1C50A 4CM8A 1JBQA 2WF8A 3GFSA 3NGMA 1F6BA 3NBUA 4XFKA 4GL2A 1KJZA 2PRSA 2G83A 1JDPA 3JD3A 3AMVA 2AUNA 3GLUA 4AG3A 3LBIA 3WA7A 4QVKA 3ECSA 3WNVA 2CZGA 4F60A 1YU6A 4KFCA 4B80A 5LQNA 1LEHA 4R2JA 3Q7IA 2VPQA 1RR6A 2HU5A 2C7BA 3L7JA 2BFEA 5BR1A 5CVTA 4HGQA 1CLEA 5DXJA 5HQJA 1HFWA 1JHDA 3GLHB 3OJXA 4UM7A 4EZBA 4D9IA 3FY4A 4O59O 3CX4A 3AVWA 1GU1A 3LXXA 1DKRA 4HUQA 1IOWA 3OM8A 2Q5QA 3PQDA 4K6MA 2DCUA 1BRTA 3B51X 4YA6A 4CMBA 2QROA 2D3WA 1K6XA 1P9WA 5DSXA 5C34B 3CO5A 3N6RA 3X0DA 4B35A 1NVDA 4XVCA 3FCAA 4D4IA 2OYRA 2WY2D 3C5EA 2XDQB 2XI4A 1F3OA 3HCOA 3Q88A 5FLEX 3VNRA 3JQGB 2LDXA 4Q3KA 3FPJA 2W2TA 3JQAD 1DAGA 5JAQA 4YI3A 3ZCPA 4CKBA 4Y67A 3B1JA 1GZ4A 2D4AA 2ZFUA 1ENYA 4Q4JA 5D1NA 3K0HA 2KB0A 2O5VA 2R7KA 2QF7A 3K1JA 3ETNA 1L8AA 2HSGA 4D41A 1LW7A 4FN5A 1ZS9A 5KS2A 3SLGA 2ZR9A 1PJ4A 3TZKA 5LQCA 4EJ6A 4NZOA 1C9DB 1EB8A 2VT3A 3CV3A 4HGZA 1FS6A 4EI7A 5E1MA 2Q6KA 4KC0A 5ALTA 1YR6A 5EHGA 2JVJA 4AC9A 4AX4A 4HB4A 5FAXA 3BGSA 3KCNA 1Y9JA 4FILA 5HVNA 2XGOA 4ZOAA 1Y33E 1H3EA 5ILQA 1YKSA 3QA9A 1RI4A 4ZQGA 2JGEA 5FHQA 3HP1A 1LQUA 2VHEA 4M9UA 1FMFA 4O2LA 4O4HA 2YCLA 4DSTA 4XUDA 1JLLB 3PSAA 3L0ZA 3SK0A 4FP9A 4HAXA 5AW0A 4WK2B 4G0WA 3DBLA 2PH7A 3LO8A 2ISQA 3C3CA 1JFLA 3ONDA 4YRFA 4ALMA 4QJIA 2REQA 1L5QA 4EJFA 5L51A 2V6FA 4Q18A 4EJ2A 1F0NA 4WXHA 2R0QC 3I0NA 1YL7A 2PE5A 4GYJA 7MDHA 2ECQA 3ZQKA 4KR6A 2ZIVB 1CR2A 2KWIA 2X8AA 5F5LA 4X64B 3FCCA 4HYYA 4P5DA 4BX2A 2I6UA 1E0SA 2XVMA 1DIOB 1BYUA 1QOZA 4Q4DA 4XUGB 4RJIA 3JAKB 1CJMA 4IFTA 1ADBA 4GOND 3VUFA 1W94A 2IBSA 4PGGA 4EQZA 2YV3A 4R7GA 1JPJA 1WCIB 1ECBA 2Y27A 4NMWA 4KPGA 4LJ4A 5EAIA 1V4VA 2FDCA 3VKVA 2IYPA 2ZSJA 5KC8A 1UOOA 2RH4A 4G36A 3HB9A 3RDPA 1ZKDA 3DZJA 2PPLA 2VG8A 3EEIA 3IS3A 4FOPA 4RZSA 1CUYA 4G09A 1SCBA 1TTPB 2QYOA 3QTBA 1JIQA 2C2KA 2ZXEA 1J56A 3T5GA 1FSGA 2JLBA 4AWXA 1CQJB 1EP2B 2HDWA 1EKXA 2H31A 3YASA 2A84A 2NM0A 4FUTA 1QZZA 2J30A 3BTSA 3HXKA 5SY6A 4CU2A 1T1JA 3IAM1 2E1PA 2GSWA 1SUPA 3DKRA 3NHUA 4G67A 4JBXA 5JSFA 2ATXA 1XZIA 3GJQA 3JSXA 3NUQA 1FZQA 1PYGA 2IUFA 2QRKA 2VF7A 2ZR0A 3C3WA 3GH3A 4KZPA 4QU9A 5FTNA 3RUFA 4N48A 1RBZA 2ZAOA 4GVXA 2E4ZA 3TLMA 1VJTA 2W6CX 1QH9A 3GPDG 4TRRA 4GS5A 2EJUA 4GPEA 3ZGLA 4XXHA 1I5RA 4JVSB 3HGTA 3SX4A 4ITVA 4ZFNA 1IEWA 4HDCA 4L1KA 5IX8A 1C7JA 4B09A 3HJUA 1RABA 3PRYA 3FBGA 3GRYA 1I0LA 3JPWA 5I9SA 5BN5B 3EDQA 3VNBA 1Z75A 4CF3A 5B6JA 4JJZA 4HLDA 1MFPA 1ESMA 3LQKA 1Z6XA 1PX0A 3L9WA 1ZJ4A 2AWOA 4JBGA 5B1DA 1NNUA 2OC4A 4LQDA 5KU7A 1T4BA 3A0UA 1PVOA 2JFXA 4OHMA 5BSRA 5LMUB 2VQ3A 2H5IA 3TPCA 1O4WA 2Q3JA 5LOVB 2DQSA 4PYJA 2HQOA 2PJUA 1GDTA 3HKDB 4X00A 5LXTB 4B45A 1VHJA 2ZT6A 1CFZA 2X41A 1H94A 2ZUCA 3QWIA 1N32B 5HE9A 2RAUA 3N87A 1QQ5A 3MLBA 5EP2A 3FPGA 1T4DA 2A9QA 4WAUA 3M2PA 4M9ZA 4YCCA 1YRWA 1M8PA 5H68A 3A9UA 3VZRA 2ZSIA 1MA3A 4Z2YA 2ZUDA 2MIIA 3DBHA 5IJZA 2G06A 2O05A 3B9RA 3IOEA 3HXQA 2QS9A 4Y2XA 3PITA 4TV8B 5FNVF 4FSXA 2BGMA 1L7BA 2HJVA 2EX0A 2Q9AA 4DW8A 2OD9A 2V4UA 5LC1A 1DX4A 2FF5A 3QF7A 1OFUA 5BOVA 3NBQA 5AK0A 3ZX4A 2ZIZA 5CGQB 1YI8A 3WYBA 4B34A 1EAMA 4J1QA 2PYIA 1L7DA 3SC2B 3MWJA 1ULSA 3MYYA 1GZHB 1I5OA 2OT3B 1TZ2A 1JQBA 4YRMA 3STUA 4EHLA 3AM4A 5DIZA 2ID9A 1XD8A 4QM6A 4ZQHA 2EJBA 2WB4A 4HZGA 2X7XA 1KY2A 1Z4LA 4PE5B 5CAEB 4BB9A 1NSYA 1QDEA 3BIJA 4UUBA 1A8UA 5IDWA 2FZ4A 1ODCA 1GL7A 3V5NA 4U6QA 4ZCSA 4N3AA 1L9KA 5IARA 1E20A 2LRHA 1Z0UA 1V5IA 4WGFA 2QN2A 1K7YA 4B3FX 5BR7A 4NONA 1Z45A 1OWLA 1PS9A 3PS9A 4IXNA 3VPXA 4LVCA 1JR3A 2QE6A 5COAA 5FB3A 2VDQB 1VB3A 3GRCA 1DIHA 1F8GA 2JS7A 2XIJA 3B6MA 4Q1AA 2A8YA 4JI1B 1JF8A 3MJCA 4RZXA 4YAEA 3HS3A 4YS6A 3ZIDA 1N2ZA 2IW1A 3V8RA 5T7BA 3OTOB 3AEUB 1G7CA 1EFTA 2QTWB 4H1TA 1YRAA 4YYZA 4B6FA 2P0AA 3AUFA 3HJCA 4GPTA 4F11A 4AS2A 4TMKA 4MB2A 2Y9PB 4JH0A 3EOBI 1AXRA 2W2OA 1R3DA 2J67A 4UHHA 4BO3A 3PQ4A 5DBHX 3W8FA 3HU2A 3P2OA 5H9WA 4FOLA 4MMYB 4TXJA 4ARZA 2AQKA 2HYDA 1IUPA 4ZOQI 3NONA 4L5IA 3OX4A 1GUYA 4PLWA 4EABA 4RC9A 3O83A 5M04A 3KYDB 1JDSA 1ZJZA 4RXMA 4Q9HA 4K03A 1L4MA 2XUDA 3BMCA 3LBYA 4W5RA 1XLVA 3TRDA 1RAHA 3LBHA 3GWZA 1RAGA 3L02A 4IEIA 4ND7A 2YHAA 4K88A 2AKEA 4Y0VA 5JAPA 4UBNA 2XE6A 3CURA 1VLVA 2GBPA 1YF3A 3DV2A 3AXTA 3JVVA 3PGVA 4OPMA 4ON9A 1DS6A 1DU4A 1SVUA 1Z5OA 1Z13A 3W04A 3HMKA 1K8RA 1UXOA 4KNWA 3WKDA 1NN0A 1T43A 3QVJA 1G8SA 2B20A 2FW9A 1A04A 3OTQA 1KP3A 4LJSA 4Q3EA 1QLWA 1Z7GA 1Q21A 4DREA 4HS9A 4J0HA 3O2JA 4PAOA 5K0CA 4TM7A 3PWSA 4MICA 3ACBA 3OF3A 1J33A 1L9XA 3L1HA 1Z4NA 1W25A 2YHUA 3OP4A 1IHOA 2FUNB 4B48A 3MS4A 1S7GA 3DMGA 1F3LA 2JHAA 2WHQA 3HV2A 3ORHA 3CUTA 3LNTA 4EFNA 4XFDA 1PFGA 4KWHA 2JIQA 3GA7A 4OX9Y 2QD3A 4FMPA 5FKJA 4BMZA 1ZW6A 2A9RA 3PJFA 4OJNA 2VTEA 3MNFA 4DLUA 4O1MA 2BOVA 1CUUA 4BQOA 2WTUA 3FTDA 4ECAA 4O1HA 3PXCX 2JI6A 3N28A 3OUTA 3R4VA 1NP7A 1MNQA 4XA8A 5EJGA 3P2MA 2ZJ5A 3MCAA 3QKUA 1SHKA 1GL6A 2C97A 4IV5A 1QNLA 3DB1A 2HUNA 5T6MA 1WD5A 1N1GA 1MX1A 2FFJA 2JLCA 3TLCA 3UMYA 2VDPB 3ITEA 5KAPA 1VYUA 3M4YA 3AGQA 3VYUB 2ZI3A 4RIGA 5C8VA 1WKCA 1ZBDA 4IIHA 5GAJA 1E9EA 3NX4A 2V7TA 4J16A 3AP1A 4N3CA 4UCQA 3VTZA 3WL7A 4F7WA 1CV2A 2E37A 4BNUA 3JASA 4G86A 5CB8A 5IM4F 2Z56A 4IG4A 5L3SB 3H11A 5DCWA 4NHOA 3UWOA 4BX8A 1U8FO 2OAQ1 1FFWA 1N6IA 2YHIB 4ZO6A 5ADWA 2WKWA 3GRZA 4BNZA 4KNYA 1KY4A 1QAOA 1CJTC 4OQZA 1RYDA 3WNDA 4Y6LA 5AM5A 1NWHA 2GF9A 3CZQA 3SP1A 3GUVA 3LT2A 1RKQA 1Y0BA 4BUZA 2RIRA 4BV8A 1E7SA 1YFLA 1BW9A 1S2DA 1T29A 2ECFA 4QO7A 1FUUA 1DAPA 3EZLA 2P8JA 3KOUA 5ESDA 3RABA 1BD4A 1Q1QA 2NPIA 1DIGA 3S4YA 1L7XA 2D62A 4FNAA 4HWGA 5AH0A 4BMPB 4I08A 1FTWA 4TTIA 2NADA 4BASA 1YMVA 3VMFA 3H18A 3BQMB 3FR7A 5H83A 4IVPA 2CB9A 3AZQA 1L3CA 1XZBA 1I13A 1YB1A 4AQDA 1UBKS 1XNJA 2VLBA 3GO4A 2X42A 1T25A 4YWHA 2HHJA 3AEQB 3PUXA 4J3JA 3ZLUA 3ILYA 1ZEMA 3DFFA 4BU1A 1D2MA 2ZSUA 2C99A 1Y6FA 1LJLA 4DZRA 2WSSA 2XZPA 5ALOA 5BV1A 1YGYA 4F04A 1SPBS 1Y6JA 3HVUA 3L0BA 3TJZA 3BBPA 4IILA 5GZ1A 3UUEA 2WDZA 1TKRA 1L3IA 3NTQA 3WBJA 5HWSA 5FLXA 2D06A 2YFHA 1Y7LA 2NZVG 1K8QA 3CW8X 1ONPA 4JVLA 3IKTA 5B2FA 4NAHA 1AA6A 1UMDB 1O94C 2BFWA 2CCKA 2JCSA 2JIMA 3AB3A 1YAHA 3FHOA 3FI9A 2VYVD 3PGJA 4NV1A 5FQOA 3S5UA 2WE8A 3JYHA 5IKMA 3KKEA 2OCXA 3C7AA 3P9NA 3WB2A 1E3SA 1H0SA 4TLLB 3K2BA 1L5GB 1DI0A 1BVHA 3BH0A 1U5BA 3H2JA 5LSAA 1YJ5A 1USKA 1RIIA 4OU4A 1QE5A 4CQMB 4Q4AB 1D4OA 3R7WB 1VMIA 1G3IA 5DHAA 1Z4IA 3DXXA 1E6KA 3B3JA 1J2RA 3AV0B 5JAZA 3BEDA 1U0GA 3G0GA 3NIFB 1QVWA 2EKDA 3NXKA 3P5BA 3QG5A 2NVBA 1GLVA 3FYDA 3NIGB 3QBDA 2BEVA 1UEXC 2OM6A 2WA1A 2YR0A 2CZQA 3L8FA 2WT4A 1I3CA 3OZAA 3GQBA 2R6DA 2RGWA 2R60A 2WTEA 4G1UC 4YJ3B 1BXRA 4GH5A 1IK6A 2JB9A 1VBKA 1NF2A 3T4EA 4LXTA 4K1XA 5AQ1A 5BWMA 1GWNA 2GN8A 4MEAA 3M1YA 2MYPA 2H7YA 3O90A 4JP2A 4C4OA 2GASA 2YY6A 4KQJA 1JHYA 1SVWA 2R7LA 5KPDA 1FK8A 3WGVA 4HPWA 5LP6B 1KQNA 3ZJUA 1XU9A 1BOFA 4ZVNA 4Q9LA 1RBQA 1XLTA 3DT8A 2JDID 1G1MA 1MP0A 5CDFA 4CFYA 2QW0X 1XA0A 4JLUA 3H8JA 2Z2IA 1YR2A 3UZUA 4B7XA 3QHPA 1EA7A 2J85A 2ZRIA 4YQZA 5AKKA 1KOLA 4I55F 1JLKA 4UTZA 2GM3A 3DEAA 2GPAA 3WV5A 4AJ4A 3KQKA 2R8BA 2XYVA 3O4FA 3LUGA 5EFZA 3GJXC 1A7JA 1YZ3A 2XX3A 4Y2SA 5E2AA 1U3VA 1GGKA 2DOKA 5FLKA 4DRYA 4GKAA 5KC9A 1WVMA 1DIAA 2GK6A 4W5JA 4NMMA 4EM6A 1WABA 3AP3A 4NCIA 4XPIB 3PWZA 3G2QA 3KUKA 3ZY6A 2X8BA 5HMMA 1OHHA 4LYDA 5IKOA 2C00A 3KOXA 1G59A 4G0MA 4MI9A 3ZQJA 2P4UA 4MWEA 1GRCA 1A9TA 2X7JA 4LQLA 3WLTA 4M36A 1ZPDA 3PQ5A 2FKNA 1P61B 4YT2A 3MG9A 1E1RD 3E1GA 3X1XA 4Z53A 3DZDA 3LWBA 4IDGA 4PQFA 4W4TA 4UPVA 4BDTA 4IMJB 3A3NA 3DBVO 2NWQA 1EX1A 2OHHA 2PL5A 4LAFA 4P7BA 4R2KA 3AWIA 4R3WA 2ZJ3A 4IEEA 1RBYA 4IDOA 1IJEA 2R8RA 4N5MA 4PZUA 3UAVA 3ZKWB 2CSUA 2ZVJA 3KNZA 4YTEA 4WUTA 3O92A 1KWGA 1RWWA 3DFKA 4NOMA 4FC6A 2FSFA 1Q5PA 4FSDA 2H65A 5KVVA 1L4BA 3BRQA 3Q0TA 1SCKA 4QWMA 5LQAA 4PINA 2POCA 3WJAA 2CEKA 1BFUA 3U37A 5AXBA 4OBWA 1XR3A 4S1TA 2JBWA 4GPIB 1QFXA 3OT1B 3W2IA 3G2HA 3V7UA 3ZNNA 3VSEA 2CLKB 4MJXA 4BMYA 4DLTA 5A4DA 3EPLA 3U4MA 1MJHA 1XCPA 3T7CA 3HZHA 4FGUA 3L7BA 3A2LA 2VYFA 2P69A 3T7DA 2JCBA 4QM7A 1NR5A 3VX3A 1LVGA 2V7BA 3P19A 5F3DA 4L8VA 4G1CA 4XD2A 5LL6P 2UYGA 3OC0A 5CNKA 3GCDA 1TM3E 3LFTA 1SBYA 4XQ9A 2FVXA 2JAOA 3FHCB 3TTVA 4B40A 5C32A 2CWDA 1PDVA 2C31A 2O14A 3D5TA 1OZFA 4MUIA 4MQ4A 2EFEB 1DKLA 4RTNA 4CV1A 4E33A 1J2EA 1E58A 1ES9A 4QEDA 3ZR4B 3ESQA 1BE6A 4BAGA 3KKPA 1BZYA 3BHIA 3LF1A 4H1VA 1VQ1A 1SO8A 4AMVA 2A5YB 4FMCB 4CEJA 5CYGA 4MUFA 2H2WA 3PHGA 3DE5X 4G1BA 3PXEA 1OH5A 1I1HA 1I3MA 2CLSA 4PVCA 5J2TF 3V1NA 1VJ0A 3PLAE 3EOAI 2RHGB 2ZZNA 4PYRA 2HQSA 2O3SA 1I3NA 3QVGB 5AICA 2YWJA 3WGZA 5C2JB 7YASA 2V7GA 4KDRA 3QUBA 4EPTA 1E1DA 4HQKA 3IEVA 4RA9A 1EFVA 1MOZA 3G6KA 1GNQA 3WOVA 3BKXA 4R2HA 3I2GA 1RLTA 2FZWA 3E1SA 3JQBA 4HL6A 3TB4A 5CVCA 3CKLA 2V7EA 1EE9A 5A71A 4F9EA 3S2GA 5TRTA 5AI4A 1RXSA 2B7CA 1L3BA 2VNJA 2XHEA 3WRVA 4RUKA 4JY7A 3PC7A 2VAPA 2UKDA 4ZVRA 4BGUA 1YJQA 4X7PA 3M5DA 2CNWD 4UQLA 1DKUA 4K3VA 1IPEA 2VF5X 1OMOA 3PYXA 1X8XA 3E9NA 4QPNA 3IAAA 1UDBA 2AQHA 2NZ8A 4AUMA 1A82A 3GLFE 3KV3O 1SVLA 1P44A 2BFBB 3I6IA 3F1LA 3KKMA 4Q21A 8GPBA 4OAPA 2BGLA 2HPHA 1CUVA 1L5OA 4ZZIA 3WGLA 1TMOA 4Q39A 3VSAA 4BX3A 4D43A 2AEEA 4QBFA 5B7GA 1AV6A 2YXEA 2PA3A 3DVAB 4XX1A 2G5PA 1XRPA 2WAOA 2WABA 1LCIA 4EKNB 5C80A 9LDBA 5KZMB 3VR6H 5LYJB 2RH5A 1E77A 4AF8A 4EVIA 3SKXA 1MXHA 2XDAA 2ZJFA 5KNDD 1R0LA 1XQ6A 2FX5A 5IKPA 5KKCA 1PSWA 2CEAA 4YRIA 2OV1A 4QUDA 5H82A 2HTFA 4V0SA 1S3FA 4BL5A 5FFFA 2QN1A 1W4BA 3DE1X 2QR5A 5EKTA 2W2VA 3UIEA 2HU8A 4DILA 3THXA 6YASA 1P4HA 2AXEA 2Y71A 4KGVA 2L19A 1F0PA 5JH7B 1TCVA 1AZLA 3JQCA 1H3FA 1G4HA 1CY8A 2J87A 4IW3B 2Q1TA 3BWMA 3LRTA 4ER7A 1C1HA 3IODA 3WX0A 1DP4A 3GLIE 4ZJUA 1APBA 4MLPA 4CNQA 1QGOA 1HL3A 2I2XB 1P1KA 2WZQA 4J3NA 5IEBA 3IUMA 1U1IA 4RTLA 4LF7B 4GI5A 3EVTA 1G17A 2BHNA 3V8BA 4C2BA 4MCIA 1L5FA 2NO6A 3AH8A 5DMXA 3TQFA 1KARA 4RORA 4MV4A 2QRLA 5K7SA 3FIUA 1N8SA 1EP1B 4HVTA 1UXGA 1XMQB 4KXVA 4MVJM 3PC8A 4AS1A 1NR7A 2FG7C 3D59A 4P4GA 2HWYA 2IBTA 5CK5A 2XW6A 3THWA 1REQB 4YMTA 1HLDA 1TQ6A 2RGBA 3KEOA 2X7HA 1RPTA 3LPNA 3NH6A 4KE6A 1HLGA 5H16A 1X0XA 2VDWB 3IBYA 4DQ0A 2HRQA 4MKRA 2FTKE 3MT7A 5KSYA 4RVUA 4N6GA 2Q5IA 4F1KA 1FCJA 5AW3A 4HDAA 4JUAA 2DFVA 5YASA 4DTCA 4MITA 3M89A 4H3HB 2GJSA 1QV7A 1WHSA 3CNNA 3CX6A 5EJ9A 2WWRA 4KMMA 1O97C 4LYHA 1HOXA 5JQGA 3OZUA 4D81A 2B5OA 3LC2O 3U5ZB 5KOJA 2IUEA 3ET4A 4GE3A 1FFCA 3FCUB 3PQ7A 4GXRA 1O08A 5F3RA 2FMIA 4FM9A 1SIBE 1US8B 2ENUA 2WMNB 2GEUA 2XVAA 2ZSEA 3IKVA 4XTRA 4IIFA 4YVFA 3UV7A 4AUEA 2BY4A 2XRFA 3KIPA 5K5EA 1QQAA 2CFIA 5DYYA 4OXIA 2AOTA 2B92A 4IGFA 4R2WA 3ZWQA 4INAA 1YQDA 1PD1A 3A9VA 4PYQA 1VE7A 2DRIA 4OXXA 3KR9A 4RVFA 1XNGA 2P30A 2IEGA 1JFFA 5EN4A 4ZXPA 1V1RA 4TSRA 1N8KA 3OCUA 4I4LA 1JXOA 2D7JA 4KQ2A 4RAQA 4O3MA 2JASA 4RANA 2VP0A 1H5QA 4NJEB 4CCAA 3W6ZA 1U28A 1U3UA 4CKWA 5IYZA 1OZ0A 1BEEA 1YOVA 3FKSA 3ITNA 4NBLA 1DIBA 3L6CA 3U4QB 1G7RA 3KP1A 3D6UA 3N7AA 1TYAE 1P7ZA 2Q4BA 3Q5GA 2F8MA 1U1FA 4IICA 3DE4X 1P4JA 2XUIA 5HIIA 1W6RA 3GD7A 5BYBA 1SKBA 1U9YA 1W4RA 1ZCJA 1Q14A 3PDWA 3IYLW 1K7CA 1D0SA 4MCJA 1TM4E 1WLSA 3JQ9C 4BN4A 1IPHA 5DT2A 2ORYA 3AEYA 4NBSA 3X1DA 5IRCD 2PLRA 3AIKA 4LJ8A 3WAGA 2NTVA 2NVUA 2P8SA 2XMQA 4KI7A 1UANA 2QGFA 2WUDA 5SZKB 3TS1A 1QP4A 1XJCA 1QH8B 2WJ6A 3GMIA 3FXAA 4TS4A 3G2JA 4JGGA 4ZC1A 3THRA 1ZYUA 4E07A 3LMKA 3CZPA 2VT6A 4R8LA 4PXSA 4GBMA 3ELDA 4O4JA 3FWPA 4DIEA 5MFPA 1QRSA 3VSCA 4Q7EA 2JFFA 2VVTA 2XOKA 3K0FA 4RM3A 3VR6D 4BGDA 2MSCB 1P6XA 2JA2A 2EU8A 3LKDA 4BX9A 1ZM3A 3VSDA 1SZJG 2KM1A 4RELA 4W8OA 3RSGA 3BFKA 1HO3A 5B2EA 4Z1MA 5K45A 4J1SA 3TECE 3BSFA 1DNPA 3EPRA 1UMCB 3AOEA 3OZTA 3Q98A 1MXFA 2W00A 1ML3A 1YFKA 3E3MA 4MW5A 1QORA 4XIIA 3SBXA 3HXLA 1R7RA 1W9MA 3FOCA 5BUSA 4OM8A 4TUYA 2XJ4A 3SCZA 3TH5A 1OFVA 2SKEA 1P1IA 2PH3A 3HEBA 1L4LA 1NASA 3F8SA 4M1KA 5D2CA 4O4LF 2XCOA 2W22A 2VL7A 3IV7A 3ONFA 1M2FA 3O8OB 1NQXA 1L5YA 1ZD1A 1RWQA 2AD5A 1U3DA 2Z09A 1XLUA 3KSZO 4HEA6 3WB0A 2DKFA 4GSYA 5C8XA 4ESVA 1BS1A 3U80A 4IDFA 4NCNA 4LC0A 1MB3A 3L79A 3WYAA 4MGKR 4A91A 3L0CA 2CE2X 4OKIA 1UFVA 3L05A 5FNZA 1Z33A 2GD1O 3M6AA 4K9NA 4U0JA 1XGKA 5D00A 3EDYA 3I2HA 4E5VA 4DY6A 4KPEC 2O1WA 3NBFA 4J2TA 4K9OA 1DDGA 4L22A 5HJ5A 4FGJA 1AX9A 3A7DA 4UUNA 2IIVA 3UMVA 4C6HA 2MR6A 4QD3A 1QCCA 3T5DA 2Z3ZA 2A88A 3FROA 2ZKLA 4QAQA 4OSPA 4KN5A 1VKJA 2OLKA 3EZ7A 4G24A 5CGZA 1U0TA 1E1CB 3JSAA 3CXUA 1MLDA 1Q0UA 2RHWA 2Q0QA 4LZWA 4O4HF 1GY8A 1F2TA 1ZGGA 5H3HA 3BJRA 3TOVA 3A11A 4DCGA 5IG2A 1GAXA 2X5OA 2KBFA 1FFXA 1KIFA 3KPWA 1LGYA 2Z8YM 3BF8A 3INYA 2VHJA 5ED4A 4A6PA 2ZRPA 4MYUA 5E6UB 4YV2A 3ROQA 5DSTA 1UZAA 2VPIA 3ND6A 3ORFA 1HDRA 2MSEB 2AOUB 1UZLA 3RVDA 4OY3A 1SHUX 1XPOA 4YRDA 2Y4OA 3KDSE 4B73A 1YE3A 3KEQA 4FVTA 2W2QA 4LDNA 4LCBA 5LA6F 4EHDA 3CGWA 4AJOA 4TWAA 3DDZX 1VMAA 3EAQA 1SXIA 2G5CA 1KEEA 5DE3A 1OX4B 2WWHA 1C8KA 1VI2A 3C97A 4HVCA 1L7QA 5KWSA 3AEKA 3FI0A 3R8FA 3PGMA 1NDHA 3GRAA 3RRFA 4PX9A 2QAGA 3AHEA 3LT0A 3IAUA 3VYTB 5EMNA 5FA6A 5JCOC 3M9XA 2CYCA 2PN1A 4WOPA 1IC6A 2ZIGA 4D99A 1JHQA 5EL0A 4ODIA 1AGXA 2BBTA 3COWA 2C2XA 2FQYA 4G8DA 3OE1A 4ZANA 5DHSA 3S2FA 2GKGA 2AN9A 1B0ZA 3K4PA 3LUHA 1GQRA 4FT2A 4AJHA 5DTRA 4UTVA 4NATA 1RWPA 2DE0X 2G1JA 3T5AA 1WDLA 1ZUWA 1OIWA 3PJEA 3ZYCA 1SA0B 2WKSA 1J7KA 2HZBA 1NP3A 3HDTA 1CNEA 1XZKA 5DM60 1GUFA 5FPPA 1N5RA 1QHXA 1Z39A 1NYLA 2FK8A 4JWKA 4YRLA 2PZBA 3URKA 3ZWPA 1RM0A 3PT9A 3UWDA 2QL7A 2AG0A 2QV7A 3FRHA 4QJ4A 2UV8A 5AM4A 5EJ2A 4CKZA 4MAMA 4UZSA 2J1LA 4OH7A 4H6XA 2RGEA 5A3QA 2GCOB 3BFPA 4GECA 1ZW1A 1USIA 2Y76A 5GJVC 2XDQA 4CPDA 1FDRA 1F9AA 1I4EB 2OMKA 4DMMA 3ZWCA 3X1WA 2I6SA 1Y1QA 621PA 4CHTA 4OHXA 4LNUB 4RH3A 5CA0B 2FNAA 4X54A 2V0NA 3K0EA 1USWA 5LWQA 2EFJA 3HCCA 1ZICA 1K5GA 1SFRA 2EJTA 3R0JA 1OI4A 5DWVA 1CJSA 1QWSA 3HYRA 3BAFA 5E3HA 1ESDA 3FIJA 3OSZA 3ZTTA 2NPOA 3ZDYB 3UPUA 1S1MA 2QU7A 4IHKA 1UKEA 3OPXA 4ID9A 3T0GA 2YJZA 1JU9A 1IZ8A 1A4IA 1SWWA 3LC7O 1HE5A 1FPMA 1XVUA 2ZE8A 1JI0A 4G81A 1CY4A 3EXG2 5TPZD 2IGTA 1XZGA 1GN8A 3ETGA 4ENRA 2A9JA 1GQ2A 1L4EA 3G0BA 3C1TA 1Z88A 2H3EA 2C5BA 3KSMA 1QJCA 2ZSFA 3M6LA 4MZDA 4OL9A 1JLLA 4CVNA 1E0DA 1QANA 4ND4A 4X1OA 1UK8A 4DZTA 2WJGA 2QMZA 4LK3A 3TFQA 3TYXA 4RZHA 3VO8A 1Z6TA 2G67A 3S6JA 3GLGB 3CNLA 2NOAA 1CF4A 1RIFA 1J2JA 1DUVG 1NJ5A 2HQRA 4ZQCB 2GRUA 3QKSB 3C4JA 4Z2AA 3OU6A 2OORC 3CUEF 3SQMA 4JN6B 3OIDA 4N0DA 2AZDA 5CT4A 3DC2A 5COBA 2RB5A 2I7CA 4PSCA 5KU1A 1M2WA 4B3IA 4OOEA 1X6VA 2LR0A 3ED5A 3BWVA 4OK6A 4KHPB 4FGKA 5KWEA 2JI7A 4MR7B 3LI2A 5INTA 2VJNA 3JAKA 3MGKA 2V0GA 1WCIA 1A72A 4ZVLA 1FSSA 3DLTA 5M7EA 1VE1A 1P4SA 4IGEA 2WAAA 3FMVA 5TQ2A 2NUTA 1ML4A 2IEIA 5CP8A 3CVJA 4NI5A 4RKRA 4JP3A 3VNUA 2WF6A 4X1IB 3RFVA 2GRAA 1K3FA 3M5PA 7MHTA 4QUHA 1DAKA 4DAOA 1MO2A 3I32A 3UWSA 4GQIA 4OQDA 1FLVA 2UUAB 3BWDD 1CQJA 4F3YA 5KNBD 3L0IB 3A36A 1URPA 5D3QA 2EZUA 2WM9B 5JCXA 2ZSDA 1RE0A 1ATZA 5G2OA 1UC8A 1WDWB 2ZCJA 4GYWA 1WUKS 3ESCA 3M4JA 3ZGXA 2J5QA 5JCJA 2E4VA 1Z07A 3S8EA 1GOTA 2L18A 3CGGA 2EBWA 5BN1A 2FSVA 1AUOA 4ZKDA 1DBIA 1NVWQ 1G8YA 2WM3A 3O3NB 5D6OA 3UENA 4BTVA 4C5CA 4AJPA 1ZD2P 4DA8A 2ZCUA 4OGLA 1CVLA 1MEJA 1OROA 2QT1A 1XVLA 3N2GB 3REQB 2M1XA 5KTMA 3KD2A 1EUZA 3B9BA 3CJRA 2Z9CA 3QI7A 2QD4A 4LMPA 2HY7A 1VE5A 5BN5A 4P0PB 5DBGA 1G63A 1QV9A 3EUAA 5EIBC 3SZMA 3HB4X 4C0BA 3F4KA 3DE2X 3S40A 4Z1OA 5KSZA 5IJXA 3KFVA 3N7TA 3C3JA 4RTJA 3B2NA 4LE1A 4JDPA 1ZFNA 5GGYA 4WA8A 1NYTA 1WPQA 2ZB8A 4LC1A 4YGXB 5LOVA 1VGVA 5AM2A 5EE0A 4XPZA 3CW9A 1JDJA 1YKGA 4C7BA 5LXTA 5DNCA 1CZLA 2Z98A 3G2NA 4MS1A 4BMSA 5ADUS 3W5SA 1CVRA 2Q21A 2ZWPA 1MC1A 5IABA 3QE2A 4IWYA 4WXMA 4YRTA 2DSTA 4QGSA 1NMQA 4M1QA 3QU2A 5CFMA 2BFDB 3G23A 2VYND 1Q22A 3R6LA 5LIPA 5FTMA 1L5LA 4TV8A 5BYJA 1YA8A 1CR1A 2ZREA 2X5JO 4I9GA 5F5NA 3RVJA 4RQBA 3SNKA 3W4IA 4D9BA 2J46A 4JMLA 1ZRMA 5F1KA 3JWHA 1JT9A 2BBSA 2R79A 1MOPA 4I5GA 4E11A 3C48A 1UP7A 1CJKC 1XTRA 3R0XA 4RJKA 3U5TA 1XAIA 3JS5A 4QYMA 1KAHA 4HDKB 4M0PA 3BTUA 3LPMA 4UBKA 4UHFA 5ALKA 4BQPA 1BG6A 1A5ZA 2E4YA 3PNKA 1VG0B 2NG1A 4M8NE 1VFPA 3SYRA 3RU2A 5AW6A 3AI7A 3EMDA 2TECE 1T36B 1A5AB 3DYIA 3AFHA 3L93A 3HUFA 2P9FA 3I4LA 2A4MA 3EGCA 4H7JA 1F8UA 4FOOA 2PLWA 4K05A 4OFZA 3K31A 2YNMA 3K32A 1YQXA 1GGHA 3HI4A 1DE0A 5TC4A 3CNBA 2CMFA 5EZ6B 1BX1A 1BGXT 5CLIA 2GR9A 1ORTA 3PCXA 3DKPA 2QP4A 3FSEA 1OC2A 2DWOA 4ZYTA 1G8JA 1EUDB 1SY7A 1R5JA 1OD6A 5CM8B 1QVZA 1YSCA 1J9EA 1MBZA 2VTKA 4XGRA 1X3LA 3EQZA 2QX4A 3OP1A 4F4HA 3WIDA 2WYWA 1JSXA 1LX7A 2X4IA 3AEUA 3ODPA 5ESWA 2AN1A 4NU0A 1N2CB 2I3GA 1W9HA 1BCRA 2NNLD 1EHIA 2XQJA 3IDOA 2YWCA 3HP4A 3NFRA 2Z8XA 4BO8A 2PMDA 3U16A 4AKGA 5L7WA 1GPAA 5D86A 1D5CA 4MYHA 4XDZA 1V3QE 2BI7A 2WG1A 4B6RA 4YUVA 2ZUVA 4CF5A 1W52X 1ACJA 1WOYA 1ZOSA 4EO9A 1UBMS 2Y1GA 2SBTA 2W48A 4MPDA 3N2ZB 1OKKA 3QLUA 1J39A 2AL7A 4JQSA 1QNFA 1YIDA 1Y9EA 4RJ2A 4C4PA 1VE6A 5KYXB 3CNOA 1TGYA 4J7XA 4I0WB 3REFA 3VDXA 2L82A 2ZVDA 3HCPA 4KSBA 4JYPA 4QXRA 1UL1X 3AUXA 3ORQA 3QQ5A 1F8XA 2R25B 2XTZA 1ZLYA 4C08A 5IC6A 1V16A 2VN8A 4GLLA 3LY5A 5F78A 2D7DA 4D26A 1YRHA 4I5DA 3NIWA