3ZN2A

Protein engineering of halohydrin dehalogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
253
structure length
253
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOHYDRIN DEHALOGENASE
publication title A Single Point Mutation Enhances Hydroxynitrile Synthesis by Halohydrin Dehalogenase.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 93
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zn2A00
4CLEA 4IMRA 3GMDA 3RUHA 4M86A 1LLCA 4GQAA 1ULUA 4PLTA 5DBFA 4PG6A 4E5KA 2HAEA 2AG5A 1HE3A 1EFLA 4D45A 5DP1A 3M6IA 3I4FA 3OICA 4E6PA 1H94A 1I10A 4MO2A 1E1NA 3B6ZA 2WDZA 2AEFA 2ZCUA 1NVMB 4D42A 3ROKA 4RZIA 1DLIA 1T2CA 1W4ZA 3JD1A 5CHEA 5EN4A 2X4GA 4YAGA 5COAA 1HL3A 2NWQA 3OQBA 5G0SA 2D59A 4OJNA 5JAQA 3H8VA 1A4IA 4CR6A 1PJCA 2GZ3A 5HM8A 4FOSA 1CQIA 3SJ7A 3U3XA 1DC3A 2VZ8A 3DBLA 3WIEA 4C4OA 2HMWA 1JDJA 3IKVA 4A27A 4BNLA 5I9NA 2BHLA 2Q50A 3GDFA 1S7CA 1I33A 2FPIA 3K31A 4YQZA 4WE3A 5JYDA 1HETA 5A9SB 4DBZA 3KUXA 1A9YA 1ISMA 1GD1O 1ONOA 2EERA 2B4TO 1BTOA 1SB8A 1E7SA 1Z73A 2DLDA 3RASA 3E5RA 4J49A 1T1SA 4J1TA 4RV9A 5CDSA 1I36A 3O26A 3EUWA 1BW9B 1WZIA 2ILTA 1HE5A 3PP8A 1NM5A 2CDCA 2IEDA 7ADHA 4KDEA 1GADO 4NG5A 1LI4A 1RKXA 4GKVA 4F46A 3WYEA 4E5NA 1GQQA 2VOJA 2GSDA 4B4OA 4XCVA 3BMOA 3E03A 4ALIA 4R1SA 2AA3A 3DMYA 2W90A 2FOIA 1LJ8A 4BNXA 1J0XO 1C1XA 1B2LA 1EUDA 4E31A 1JKIA 2SCUA 4Y6SA 1E77A 2VTDA 3F9IA 1O0SA 3OHSX 4OGWA 3GVPA 2X9NA 3UAGA 3LLSA 4BV9A 2W8ZA 4YVFA 5F1PA 1XEAA 3GNQA 3RWBA 3C7DB 1JWAB 2ZTLA 3FWNA 3KB6A 3HDJA 3RQSA 2FN7A 3VOSA 5IDWA 2J3KA 4OSOA 1AUPA 2D2IA 2GCGA 4QFCA 3UVEA 3ORFA 1YB1A 4Z3DA 2O7QA 3RFVA 1F12A 1PJQA 4BGIA 3PI7A 4OXYA 1KOLA 1A5ZA 2DPGA 4PFJA 1ZUD1 2GR9A 1FDWA 4IQ0A 2EGHA 1N5DA 1ISJA 1RM0A 2VYVD 4TKLA 1A4UA 2ZJ1A 5G4LA 3WGZA 1T2AA 4XGKA 3IMFA 3ZHYA 4E30A 1J49A 3GQVA 2O4UX 3L4BA 3WGGA 2O2YA 4NJOA 1SOWA 3WTBA 1DRVA 3GDGA 5JE8A 1Y9AA 5T6BA 2AG8A 4P4GA 2VT3A 3B1FA 4MKZA 4D3SA 1A9ZA 3NDIA 4K9DA 1X0XA 4U6QA 4ND1A 1NQ5A 1NFFA 3D5QA 1NFQA 1EK6A 1UXHA 1G6KA 5G4KA 4CQLA 4RPHA 3MEQA 2C2YA 3NJ8A 4ZQHA 1ZH8A 3MJ4A 3ABIA 3VZRA 4CUZA 1PWXA 1RJWA 2JCYA 2BRUA 1W73A 3QIVA 4OMUA 4KQWA 2UYYA 5DBGA 5G2OA 3ZW8A 1XGKA 5TNXA 4CLOB 4R5HA 1W8DA 1VC2A 4WOKA 4FIZA 4AJ2A 5KKCA 5KVCA 4UUMA 1DIGA 3GVXA 2BD0A 1DIAA 5CPBA 2B4QA 1HE4A 4JP2A 1ZK1A 4WJZA 2BKAA 5CG2A 3JYLA 3PGXA 1W0CA 4BO2A 1LRKA 1MFPA 4L76A 3QVTA 4XDYA 3F4LA 1AGNA 4UEJA 1R15A 3AFNA 1NAIA 1FK8A 3WGOA 1NTOA 3DR3A 1GR0A 3W1VA 1ML3A 4AJNA 3OJFA 4DPLA 5AXAA 1G0NA 2UDPA 1C3VA 4CV1A 2X22A 4PLCA 3ZWYA 5FWNA 2W2LD 2VHYA 2I3GA 3DZJA 1KVUA 5CAEA 3TZCA 4E2YA 2QQ5A 3ZV6A 5U4QA 3ZW9A 4O0LA 5G0TA 2ZYAA 3DHEA 1HT0A 2B35A 2I6TA 1QKIA 3QP9A 1KC1A 2X0JA 2I5PO 4MP8A 1LSSA 3AUAA 3TZHA 4EDFA 1BDMA 3KXDA 4DWVA 3BXXA 3GN1A 3LVFO 1Y8QB 4AJLA 1VL0A 3O4RA 4BO3A 1N9GA 5L7YA 4E21A 1YQDA 4UAGA 3BMQA 3H4VA 1NYTA 2IYOA 3ENNA 3OP4A 3PWKA 3U0BA 3KZVA 1H6CA 3EAGA 1FJHA 2BFPA 4MPDA 4Z0TA 1H6DA 1O89A 4DC0A 4AICA 2O23A 1WDMA 3WQSB 4IJUA 4U0JA 3V2GA 3SVTA 3WDSA 2JAPA 3ROQA 1Y9EA 2O7SA 5JC8A 3C1TA 4Y9DA 5KJFA 2GN8A 4K6FA 1DAPA 3N7UA 2OOSA 2P68A 4YAEA 2Q46A 1E5LA 3BA1A 4ZQBA 5T8KA 1U7TA 1R0LA 3H9EO 1K89A 4BNZA 3ZHBA 3D4NA 1WW8A 4JJGA 3ZNPA 2VYND 3JQ8B 3F46A 3QWBA 3AY3A 4EGFA 4CUJA 4PIVA 4IY1A 5G0VA 4R5MA 2Y1GA 3P2YA 2PKQP 3K2EA 3OJLA 3PZRA 3WIDA 1GCUA 1E3WB 4O5OA 2AQIA 5A1TA 2YHIA 3JYQA 1PQWA 4E33A 2NTJA 4GX0A 4PLFA 4EEZA 4YRBA 4NU5A 1OMOA 1RYEA 4DQUA 1YJQA 5LDGA 4DREA 3K73O 3E18A 4XRGA 4PG5A 1IYZA 2EKLA 2X6TA 3PHGA 4CV0A 2GGSA 5JO9A 3RD5A 2FR1A 3AJRA 2JCXA 4J9UE 4DVJA 1DXYA 3JQ9A 1ISFA 4CM8B 1MC5A 1MA0A 1EQ2A 1VE9A 1PIWA 1VKNA 1O95A 3D4PA 2PH5A 1OBFO 3OF2A 3PJFA 5DULA 2OFPA 1R6DA 4NIMA 3BHJA 3S2IA 1NX6A 1XIVA 1K5HA 3OEWA 4G2NA 2H9IA 4B3IA 1EUCA 3KEQA 2J8ZA 1YL5A 2CDAA 3ADOA 4JP3A 4CPDA 3ONFA 4WCFA 4BNVA 1I3LA 1DOHA 5JCJD 1YWGO 3WFJA 1L7EA 3PLNA 4P22A 4J2HA 2IZ1A 4LVUA 3V1YA 4EJ6A 1WNTA 2G82A 4ZN6A 2CNBA 2G5CA 4U6SA 5F1KA 1HKUA 2NTNA 4WK6A 3CKYA 1V3VA 1PGPA 3JCZA 5A05A 4XRRA 5DP2A 1TEHA 1HDGO 4OYRA 4BV8A 4W6ZA 4Y67A 1BG6A 3ZZNA 3AY7A 2YDYA 5BNTA 3ZU5A 2IXAA 3CSDA 5B4UA 2B5VA 4RF3A 5TJ9A 1ORRA 4BNKA 1MX3A 1U5CA 4I5FA 4DUPA 1NR7A 1GZ6A 2VT2A 1KY5A 2VHZA 4GX1A 2VWQA 4I5GA 4BNJA 3FWZA 2GNAA 3GHYA 2UVDA 4FFNA 4QX6A 3WWYA 3JD3A 3ZWBA 4Y8VA 3GEMA 1FF9A 3DC2A 3ON5A 5KKAA 2XXJA 4R68A 2CVOA 3WJ7A 2QZZA 3OIFA 2RCYA 3ZCXA 2J3HA 4IXTA 1DDOA 1HLPA 1YGYA 1XA0A 3GC6A 1ENYA 4IDAA 2AQ8A 1DB3A 1DC6A 1UP7A 1X7HA 1F0YA 1P1RA 4CM9D 5IN5A 1ZMOA 2PH3A 4K26A 4BGUA 1EVJA 4K1LA 4BMVA 5JO0A 5EJ2A 1K6IA 5GZ1A 4CQMA 1FMCA 4HV4A 4YJFB 3PDJA 4BNHA 4J4HA 2VNAA 4RVUA 1GUZA 3NTQA 4OKNA 4RVHA 4F3YA 5T5QA 5ILOA 3U4IA 1GPDG 2X58A 4JNKA 4U0KA 1NP3A 4MP3A 3SEFA 3HB5X 1LDEA 3DAPA 4RPJA 2PA3A 3I9NA 2WWRA 1KETA 4XIJA 2DBQA 2NU8A 2ZB8A 4L9RA 4HBGA 4YQYA 3C7CB 4FGSA 4EEXA 4AJIA 3TF5A 1B8PA 1U3VA 4PG7A 1PGJA 1A72A 2YQ4A 4C7KA 3IP3A 2EP7A 1PZEA 3RFTA 4MKXA 4Z3KA 1J6UA 1Q0QA 1UXJA 3CMMA 1ZVMA 4UEOA 2P5UA 3HFGA 4FJ0A 5CDTA 1ONPA 3INRA 5EQDA 5L7TA 2GZ2A 4YAJA 4B8WA 1LQUA 1EDZA 5EL0A 1V0JA 3LK7A 4JJIA 1T24A 3FF4A 1Q0LA 4XR4A 4XYEA 2JFHA 3RSHA 4R1UA 5DZSA 4BNIA 1EFKA 1HLDA 1O94A 1GUYA 4UUOA 4ND2A 1ZSYA 2AHRA 5A9TA 5C3MA 5IG2A 2ZYDA 4BO0A 2GRAA 3KYCA 3K9QO 3QWAA 5U1PA 4MVJA 3IUPA 1R4MB 2B0JA 5A02A 5F21A 3M1LA 4OIMA 4FPXA 1Q7BA 4OO3A 4CMAA 3QQPA 4DL9A 3KOUA 3WYCA 2YV3A 4EUEA 2O3RA 3P19A 3Q3CA 3FRJA 3RUIA 1L1FA 3LT0A 4BO4A 5FYDA 3HFSA 5I8ZA 1F06A 2HK8A 4AJEA 5MGBA 1F8GA 1JW9B 3LC1O 1PJBA 1V35A 1U8XX 3S2GA 3TPCA 5AQ1A 2Q4EA 5CEEA 2PZMA 3M2TA 1ZBQA 1WXDA 2Q99A 4H7PA 4RLSA 2EJVA 1DO8A 1ZZEA 3U4DA 4NPCA 2O50A 3IIEA 3GRKA 3NGLA 3B1JA 3MCVA 1CERA 5DCUA 4RVGA 1QYCA 3R1IA 1J4AA 5TF4A 1ISHA 4WASA 5HWSA 1HTBA 1C0PA 4GKBA 1YB4A 4NI5A 3U5TA 4MIYA 1I0ZA 1IOLA 1DIBA 5KVVA 4IDBA 4IUYA 5KTKA 3DQPA 1N2SA 1OI7A 1ZSNA 3GGGA 4ZA2A 3UHAA 4XB1A 3OH8A 5L3ZA 3PYMA 4YT4A 4RDHA 4R41A 1JKJA 3FTPA 1Q0HA 4GGOA 4LCJA 3RC7A 4CMJA 1E3IA 1LC3A 3RVDA 3DB2A 2ZB7A 1ARZA 2PKQO 2FP4A 4AJ1A 2PFGA 5JDCA 3DHYA 4CODB 4FD3A 5A5FA 1N92A 4I5EA 2Y93A 1E7QA 4YTEA 3QWFA 4LVCA 2YQ5A 3PVZA 1LC0A 4H3VA 3TQHA 1M6WA 3WSWA 3WGIA 4OXKA 3MTJA 4RQTA 2Y68A 1C1DB 4J1QA 3PZBA 1NASA 2OGUA 3S1LA 4DIBA 2QYTA 5IN4A 3GPIA 3PHJA 5DBIA 2D4AA 1SMKA 4DIFA 3I3OA 3QLJA 2OBYA 4KP7A 4CLRA 1UJMA 3OJEA 2PY6A 4XQ9A 3VPSA 3W8DA 1PEDA 5BNIA 5L40A 2HMSA 4IGEA 2R6JA 1A27A 1D7OA 3OECA 4YJGA 3UCXA 4RVDA 3K8ZA 1UAGA 1YVEI 1AHHA 1NWCA 3QSGA 1GQYA 4FC7A 3GZNA 3PQFA 2YV2A 1PSDA 2P5YA 3W4JA 5KNLA 5ENVA 1Y6JA 5L51A 3ZWAA 4PLYA 3D3EA 3FTNA 5AXBA 3OQ6A 3HWRA 1QLJA 2WJPA 1GEGA 4J7CA 5HTOA 1MG0A 4E13A 3V1UA 1K6JA 1RM5A 4XWYA 3SLKA 1WMBA 1P1KA 4JROA 4W82A 3QW2A 1WZEA 3C24A 4KZPA 4WLEA 3UICA 3B70A 1PR9A 5ILGA 4DRYA 5I7SA 4IBOA 3VDQA 3GEGA 3NAQA 1ADFA 3N74A 4PZEA 3V5NA 3TFOA 2G17A 1UP4A 1PQPA 1KEVA 2J3JA 4JLWA 1XHLA 3JQDA 2W2KA 3DBHA 4ND4A 5JAZA 3Q2IA 3JQGB 4E2ZA 1NHGA 2QRLA 1SEVA 3ZGYA 4BHTA 3I6QA 3PDUA 2VWGA 5AVOA 3ZWNA 4ALKA 1DLJA 1NQTA 2YHUA 2B4RO 4XKJA 1A7KA 2WYWA 2DU8A 2GPTA 1DFGA 1BHSA 3DHNA 1A71A 5LC1A 3U49A 1BXKA 4IIUA 1LDNA 1LEHA 2NLOA 4LMRA 4FFMA 4G65A 5AXDA 1MC4A 2IE0A 1WDKA 3Q9UA 1DEHA 1E7WA 1Z6ZA 4NBVA 4BKPA 1GU7A 2RAFA 2ZTVA 4CMGA 1GYPA 2FR0A 2R2GA 2AMFA 4IPTA 2D8AA 3ZU2A 3G1UA 2VHVA 1T4DA 1PS9A 1VSUA 1WLYA 4NBWA 4OHUA 4EZBA 1KVQA 3H9QA 3K92A 3V2HA 2LDXA 4JXKA 4IJVA 4XEHA 3WTCA 5TS3A 3QE3A 2CMDA 1ZJZA 5IDYA 3O8QB 2JFGA 3I9OA 4RPLA 4YBZA 4GAEA 4CM4B 5JDIC 4BO5A 3T4EA 4Z9XA 3H3JA 3NEPX 1YE3A 3RFXA 3NT2A 4BB5A 2WE8A 3ANNA 4R9RA 1E6EA 4MVJI 3TFQA 5EPOA 1B3BA 1IY8A 4II2A 3TNLA 2E4AA 3FNHA 2GZ1A 3NX4A 4WLOA 1Q1NA 1UP6A 3W4KA 2A92A 6ADHA 3WBBA 1PU2A 4LGVA 4URFA 2HQ1A 3JQAD 3SLGA 2OHXA 4DMMA 3HJAA 2ZCVA 2D3TA 1LA2A 4AG3A 1Z75A 3GFBA 3T4XA 2PK3A 3PIDA 3OIDA 1XLTA 3PHHA 2HSDA 3COSA 1PWZA 4YJHB 3NTOA 2Y1OA 2PD4A 3BTVA 1R37A 4ZD6A 3CEAA 3JV7A 3UFXA 2D1YA 2O3JA 4D0SA 4XD2A 5F1OA 2FPPA 2VZ9A 1MB4A 1EVYA 3WG9A 1ENZA 3D1LA 3DXFA 2C7GA 3HG7A 4KWIA 4PLVA 4RCVA 3IP1A 3T7EA 3EY4A 1X7DA 3IJPA 4M1QA 2YW9A 4X54A 2R00C 3VDRA 4XR9A 4I08A 4WKGA 3WR5A 5CDUA 1LSUA 2BH9A 4EW6A 2WYUA 1QV7A 3TSCA 3NGXA 2AE2A 2EP5A 1TA4A 2QW8A 4GX2A 3ZHZA 5DN9A 1YQGA 1YXMA 4Z0HO 3UOGA 3BMCB 3JYPA 4IS3A 2Z95A 2EV9A 5C37A 3PGJA 5JDCC 3AU9A 5TSDA 4BOYA 2WE7A 2BMAA 3PHLA 3HDHA 4ID9A 4BMNA 4WCDA 2W98A 3BMNB 4JBHA 4BO7A 3O03A 3ULKA 1B8VA 4J90A 1N7HA 2CSUA 4HUJA 2Q2QA 3I23A 1BVUA 2UUPA 2X86A 4XQEA 2AXQA 1HEUA 3MOIA 1BDBA 5DOZA 1E5QA 1Q7GA 1B3RA 3L07A 1ZCJA 2DBZA 4Q39A 4ZICA 3CMCO 2J5QA 4IDFA 1KEPA 5J23A 1XCBA 1LLDA 4PVDA 1L7DA 3PK0A 4NMHA 3DMTC 4L74A 5EINA 2I66A 3LT1A 3PWZA 2A35A 5B1YA 4BIIA 3WS7A 3WGYA 1LX6A 3GNTA 4NFSA 2NACA 4BNWA 4YR9A 1HDXA 4JN6B 1NVTA 1E3SA 2NQTA 3IJRA 1B8UA 1RM3A 3VZPA 3KO8A 1XELA 2CY0A 2NVWA 4R4JA 4XYBA 4CR7A 2OXIA 3LT4A 4L8VA 5FI3A 1C14A 4OH1A 4CM8A 2A9FA 4ZU3A 1DSSG 4M54A 3GUCA 1WAMA 1I2BA 2FR8A 4NK4A 4QSMA 1HYEA 3RC1A 4DLLA 1K3TA 5I7VA 2NADA 3RKUA 2CDBA 5FI5A 4QT0A 4NZ9A 1JVBA 1I3KA 2P4HX 5HBRA 2J5RA 5TC4A 3FBTA 1R4NB 2E82A 1VM6A 3GFGA 1EE9A 3ZWPA 5A4DA 3ASVA 1PZHA 1G1AA 2JD2A 2BI8A 4HFRA 4LSWA 3OETA 1P31A 4GMFA 4UVGA 3PJEA 4BKOA 5HA5A 1B14A 1XQ1A 4CMHA 3GN2A 1H9AA 5T67A 4DPKA 1F17A 2AQKA 3WSVA 4INAA 3RAJA 3ONEA 3ZN2A 2C59A 2Y66A 3C1AA 2HK7A 2WD7A 1CJCA 1E92A 4ZJUA 4R51A 1UUFA 4FC6A 1IPEA 1WPQA 1U3TA 4QUKA 1MV8A 3AOGA 3ENKA 1TLTA 3UH1A 5C5IA 5K6AC 2PZKA 1GY8A 2PZLA 1R12A 5G0UA 3ZV3A 4BQRA 4L0QA 4CQMD 1CDOA 1YRLA 3DO5A 4QEDA 3JD0A 4TSKA 4RL6A 2H6EA 3VPHA 4DPMA 3KTDA 3H6KA 1A7AA 2CF5A 3HN2A 2Q3EA 3OJ0A 2O3UA 1EVIA 2FWMX 2AEMA 4LRSB 3ADPA 3H9JA 1UAYA 3DZKA 1IULA 4IZIA 1DIRA 1V3TA 4M55A 2IEBA 2G1UA 2PWZA 2AQHA 1LDBA 4ROSA 5DNAA 3ZV5A 3F4BA 2GUGA 3I6IA 4MDHA 4C7JA 1IE3A 3M2PA 4HY3A 4Q9NA 4YJFA 5G0WA 3FD8A 3KBOA 4J7UA 3HB4X 3RIHA 3P7MA 5F5NA 1XSEA 2PLAA 3BMOB 2GN9A 4DMLA 1OZAA 3KHUA 1ZXLA 3UCFA 2IXBA 2VWHA 3EK2A 4AJHA 1HYHA 3WWZA 5U9CA 3AM3A 1C1XB 2DQ4A 1KEWA 4L4XA 2YV1A 2YY7A 1R66A 4J1NA 4CLDA 5L45A 3RJ5A 1JLLA 4L4SA 1DHTA 3KYDA 3CPSA 3SC4A 4F6LA 2NUAA 3AI2A 5L4NA 1NHWA 4I5DA 3CTMA 4N54A 5A5EA 4G5HA 3MWEB 4Q3CA 2RIRA 1PL6A 5JMWA 4B4WA 4MVJD 1MXFA 2Z1MA 1T25A 1LDMA 3RUCA 1QMGA 3GY0A 4YDRA 3W6UA 2E6UX 1EK5A 4IJKA 2DKNA 5CG1A 2B83A 5AYVA 3GVCA 3X2FA 4BL5A 5CFZA 2FMUA 2I3AA 5IFLA 4ZGWA 4G81A 4RPGA 4YRDA 4HADA 1AHIA 3AY6A 4UVHA 1GCOA 1UXKA 3WXBA 3MTGA 4CM1A 3R0IA 2IRWA 3EZLA 2X1HA 4QFDA 1SO8A 5IZ4A 2VRCA 3GH3A 5DDIP 3UN1A 3DOOA 3LF1A 2A4KA 4NHEA 1BGVA 4HFMA 4CQLB 5THQA 1H2HA 1G0OA 3GEDA 5EIOA 3ZV4A 4XX0A 3Q0EA 1UZNA 4FGWA 4RF2A 2C2XA 5ES3A 1X1TA 2Q2WA 3SX2A 3UKOA 3KSDO 1K2WA 3JQ7A 4TZTA 2NVUB 2VYVA 4YAKA 2GYYA 2PTGA 2O4CA 2PGLA 3PEFA 4PLPA 2G76A 3V1TC 4ITUA 3RUDA 3CINA 3BAZA 2I9PA 1F14A 1YQXA 4JBGA 3DL2A 3H3FA 3GUYA 3VZSA 4A7PA 1Y8RA 3L6EA 4R69A 3WGTA 4MINA 4J2OA 3HSKA 2B37A 2DM6A 5JS6A 1GZ3A 1X14A 1BXGA 3U09A 1GEEA 2D0IA 3FSRA 3K5PA 4QQRA 5AXCA 3B1KA 5GZ6A 1BXZA 1O5IA 2Q2VA 1XYGA 4PLWA 5BSGA 5ITWA 1PS0A 2VWPA 2JFFA 3QVSA 1NWHA 3BHIA 1D8AA 4PLGA 4FJ1A 1QV6A 1D3AA 4HX5A 4FFPA 5DCYA 3ANMA 4DC1A 1I2ZA 1T2DA 3L9XA 4A73A 1EVZA 1MUUA 2P9GA 1PR3A 3H9GA 3JQAB 3PQDA 4RF4A 1AXGA 3ONDA 4YT5A 2NU6A 1DRWA 2C5AA 5L7WA 4IM7A 1N1GA 1VI2A 5KIAA 1YONA 1P1FA 3QY9A 4Y98A 4AJ4A 2WYVA 3UGKA 4BNUA 1ADBA 5JY6A 4E5MA 1ZSVA 2VNSA 4BNFA 5I7EA 1MP0A 1XG5A 2Y0DA 1GV1A 3GRPA 4BGVA 5C7LO 2BGKA 3Q1LA 5MDHA 1CEQA 4IXWA 3OIGA 3X2EA 2GD1O 3MWDB 1ZFNA 3H5NA 4M87A 4OXNA 4RF5A 1P0CA 2OZPA 2ZTMA 3GA0A 1I30A 1PJ2A 3WLFA 3HHPA 1E3LA 3U62A 4BKRA 1MXHA 1Y81A 2V6FA 4PZCA 3G3EA 3FNEA 5A04A 1JAYA 4Q3EA 3EVTA 2JAHA 2EGGA 4FBGA 4CV2A 1OOEA 4P4NA 3AWDA 5KJEA 1H6BA 3IC5A 2DTDA 1U3UA 3ST7A 1P0FA 4IJWA 2DPHA 2X5OA 2Z1NA 4BGEA 4PGFA 4XJSA 4WUVA 3IAHA 2EIHA 3WGHA 1I8TA 3RUFA 3BTOA 5IF3A 1ZEMA 2ZB4A 1H2BA 4AJKA 4CLHA 2V7PA 2UAGA 1ISIA 1LBEA 3H9UA 3F3SA 3AM5A 2PNFA 4ZRNA 3LT2A 2IZ0A 1P33A 5IDQA 2ZQZA 4B4VA 2GF2A 1O6ZA 5JDIA 5IXSA 4XDZA 2J6IA 2YHIB 3H7AA 2O48X 4EBFA 4P38A 1N8KA 4MIEA 1JVSA 3OA2A 3V2UA 3I9KA 4IZHA 4WPGA 3EZYA 3ICPA 3WNVA 4UVIA 4FFOA 2O3QA 3VZQA 2VYNA 4XYMA 3DFZA 3UW3A 1KERA 3EW7A 1OC2A 4II3A 1HDRA 4HFJA 2ZK7A 2F00A 1W6UA 1NQOA 4CM3A 4J4BA 3KV3O 3HDQA 4PRKA 4O59O 2TMGA 1QP8A 1E7RA 1DC5A 3CXRA 3DBRA 1HSZA 1LDYA 3E1KA 3PYXA 1LUAA 3QHAA 2Y67A 2O3TA 2RBEA 4WCFB 2ET6A 2RHCA 4UREA 2NM0A 3WX0A 4HP8A 2Z5LA 4YA6A 1YO6A 2Q1TA 3I83A 1H93A 4E2XA 4JJFA 1WWKA 1YS4A 1FDVA 3S2FA 3HNPA 1KVSA 1QLHA 2NQ8A 1NAHA 4A03A 1V3UA 2PR2A 3WB9A 4RGBA 4N5NA 1YKFA 4GWGA 3SC6A 3IS3A 4XGNA 5JNLA 2R00A 3G17A 1T1RA 4LSMA 4RVFA 2RH8A 3LYLA 4DQVA 5KCZA 3OFSA 1TT5A 2DAPA 1HSOA 3LC7O 1Y5RA 3MJEA 1YBMA 1DRUA 3O8QA 5FF9A 5I7FA 3GZ4A 3EC7A 4J6FA 1PTJA 2H63A 3NV9A 4B7UA 4CM4A 3PJGA 1LTHR 1VL8A 3ITDA 3VH1A 1UXIA 1B0AA 4KUHA 4CMEC 3W8FA 2ZB3A 1T2FA 4LISA 4RLHA 3VTFA 3WMXA 3MOGA 4HWKA 2Y0CA 4B4UA 2BGLA 2BLLA 3ZWCA 5IAAA 1U8FO 4NBUA 1JN0A 3D7LA 1AE1A 5L4LA 1EBUA 3TZ6A 3D64A 3DZHA 4RZHA 1OFGA 1H9BA 3KEOA 4I9NA 1IL0A 2AW5A 1KEUA 4E4YA 5DCWA 5KJ1A 5TX7A 4J4TA 3K2BA 4CR8A 1NQAO 4AL4A 3K96A 2CFCA 1X1EA 1H0KA 4CQMB 1J5PA 4CMBA 3RBXA 3LSYA 3ZNNA 2Q1WA 3A14A 1K6XA 2OP1A 3C3XA 3WYBA 5A9SA 3MJVA 1QYVA 4BO9A 3ICCA 3OSUA 4JX8A 2HJRA 4E2WA 1VRWA 1UZMA 1I5RA 4EJ0A 4EITA 2XF8A 1TI7A 3FR7A 4ALNA 4CM5A 1MLDA 3DMTA 3AI1A 1FDUA 2C0CA 2OUIA 4MVJM 2I99A 4TRJA 1BVRA 2BI7A 1ZO8A 3Q6IA 4QECA 3RCBA 1BW9A 2P91A 2JHFA 2X0NA 1XU7A 3GHHA 3SXPA 3WQQA 1YDEA 4AVYA 1ZK0A 4KDFA 3LDHA 3D3WB 1LNQA 4WECA 1YH3A 2IODA 2D5CA 1Z74A 4ZQGA 4TVOA 3HE3A 2QRJA 5JBIA 3L6DA 1CQJA 3VPFA 1VLLA 4GSLA 5COQA 1KVRA 3LU1A 4R3WA 4YCAA 3DZBA 2JKVA 4E5PA 1PS8A 1ZW1A 1VJ1A 4XIYA 3OJOA 4FDAA 4B8ZA 3HDYA 2E48A 3GVIA 1ENOA 3DONA 2GO1A 4LK3A 4MVJE 4NBRA 2F1KA 3VKVA 3VPGA 3QVOA 4HFNA 3MJTA 2I67A 3JQCA 3KYCB 3PXXA 1VKOA 3F5QA 3D5TA 1CWUA 1IUKA 3DAGA 3I4CA 5TT0A 1HZZA 3G0OA 4EJMA 5FEUA 1KIFA 3H2SA 1WDLA 2BGMA 4OQYA 1BRMA 2HMVA 3DOJA 4IIVA 1F8FA 2E49A 2HKIA 4YXFA 3FPCA 3ZHXA 2RH4A 3MJSA 2WMDA 3BYZA 5LDHA 3I9MA 5K6AA 3TOXA 1M6HA 2AE1A 3PJDA 1WMAA 4K28A 1PJTA 4J3FA 4DTIA 4JCOA 1SB9A 3ZDFA 1P1JA 5TRTA 2C20A 2FZWA 4D46A 4FOOA 4P4LA 1ZNQO 2YFHA 2IDZA 5GMOA 3E9NA 4U5QA 2X8LA 3L6OO 3BTSA 3TZQA 3E9MA 3RC9A 3ETDA 4DLAA 4HNHA 3W6ZA 2GASA 3NUGA 3PTZA 5EMHA 5B4VA 5CEFA 5L4SA 1PGQA 5CP8A 1P74A 2IYPA 4LCEA 3GLQA 3NKLA 3GR6A 3AUSA 1P1IA 3IOYA 4J43A 4UUNA 1P77A 3DEYX 5TGDA 3MJCA 5H81A 1M76A 1X15A 2GDZA 4WLVA 4CLOA 1QSGA 3ZNOA 3VH3A 2PZJA 5ER6A 1DFIA 3JYNA 2PV7A 4I9UA 2BFMA 5C7IO 5AOVA 4WLFA 3OM9A 4JQCA 1R4NA 5JY1A 1QRRA 4NFHA 3JQFC 3JTMA 5F5LA 3IUSA 2VUUA 1JAXA 4XYLA 1P3DA 4YJDA 3FHLA 2YYYA 4QO8A 4N18A 4L4RA 2VUSA 2C54A 3TRIA 1CRWG 5HS4A 1ADCA 4IDEA 4Z0PA 4IS2A 5BT9A 3IL2A 3PPIA 1I3NA 1LSOA 3PLRA 4KOAA 3U4CA 2P2SA 1O8CA 1N1EA 4GL4A 4NQZA 5H82A 1O9BA 3VHRA 3W4IA 4RO0A 3L4SO 2J5KA 2EEZA 4QTZA 2X0RA 3OA0A 3E8XA 2C5EA 3DAFA 4H15A 5T64A 3QRWA 3BZUA 4CL8A 3NTRA 3HZZA 2JD0A 3RJ9A 1JWBB 1NBOA 4CLRB 4WGGA 1R0KA 1PZGA 3JSAA 4O63O 2H1SA 3INTA 1Y8QA 4FQ8A 4BMSA 4MVJG 3GPDG 4YACA 1JKFA 1QYWA 3ZU3A 2VHXA 4BVAA 5JW6A 4YJGB 2NTVA 1I3MA 4NDNE 3U4HA 1I24A 5H83A 4I1IA 4LMPA 5ADHA 3GZNB 3OMLA 1C0LA 1U3WA 3WOHA 4CM6A 1E7YA 1GL3A 1Z82A 2EW8A 2O2SA 4UULA 2DC1A 4JBIA 5JAIA 4I8XA 5GY7A 3DTYA 3RKRA 2EHDA 1E3EA 2V6GA 4YT2A 3VTZA 4J0EA 4NJMB 2X9GA 3PWSA 3FBGA 3ETEA 4CMIB 2X5JO 3EVNA 1RWBA 4W9NC 4OOFA 2B69A 2VZ0A 4ILKA 1BWSA 4R9SA 4ALMA 4RPKA 1VPDA 5IZCC 1H6AA 1KVTA 1NNUA 1SAYA 2PGJA 1ADGA 2W2KB 3DBHB 3JQ8A 1LQTA 4YRAA 4JGBA 5ICSA 4D7AA 5HS6A 1LLQA 1PQUA 4GH5A 4MVJH 2VN8A 1YOVB 2DFDA 5A03A 3S2EA 3WMWA 1E3WA 1NPYA 4PVCA 4D44A 3IDSA 4Y6PA 2WM3A 6LDHA 3CE6A 5TLSA 2JJYA 4XJTA 1FXSA 3B20A 2VRCD 3RC2A 1PZFA 3H5AA 2YUTA 1M67A 2VRBA 3RU7A 1GPJA 2YFQA 4CMKA 3NT4A 3E82A 3CUKA 1ZK3A 4TKMA 4FR5A 3TL2A 1XR3A 3GT0A 4A2CA 1GTMA 3T7CA 4WNIA 4CLXA 4WLUA 3FNFA 4MP6A 3JD2A 1ZJYA 5JFOA 4IDDA 1UDAA 3AOEC 4ONEA 1IHYA 1TXGA 2P9CA 4CJXA 4DXHA 5I8WA 5F3RA 1SBYA 4TWRA 4OL9A 1PJ4A 1DHRA 2X0IA 5T57A 4TQGA 3WLEA 4J16A 1D4FA 1R0SA 2HU2A 3WFIA 1Z7BA 1UH5A 4KQXA 1NPDA 3E5MA 4R16A 2BFOA 2PKRA 3GAZA 4WEQA 4TVBA 1HRDA 1EE2A 2NU7A 1R16A 3CZRA 4GVLA 2NVUA 1X0VA 4GSKA 2CVZA 1GZ4A 3FCOA 5LCXA 4A26A 2P4QA 1B16A 2Y1DA 3L77A 5A06A 4NH4A 4D41A 3R3SA 3TN7A 4BS9A 3NDJA 1V8BA 3JQBC 4GBJA 3JQEA 5DF1A 2JD1A 2Y05A 1HDOA 1M75A 4YT8A 1BMDA 4O1MA 4RDIA 4E12A 4PLZA 4UVDA 5EQFA 4BNNA 3EDMA 2VUTA 1S6YA 2V6BA 3DBLB 3A9WA 1EEHA 3HADA 1YBVA 4IQ8A 2AEJA 1SOVA 4WOJA 4GX5A 1U28A 2DTXA 9LDBA 4R3NA 1Q7CA 1LRLA 3KRTA 5K0ZA 1MGOA 1QR6A 5I9LA 5A3VA 1SEPA 3VVCA 2Q1SA 2EKPA 1C0KA 1MFZA 2Y1EA 4IDCA 1ENPA 4MKRA 4NK5A 4PRLA 4ESOA 4PG8A 5CDGA 5ITVA 1GYRA 2HLPA 2HCTA 2VQ3A 1EMDA 1NVGA 4H16A 4A10A 4OKIA 5TIIA 2HMTA 1CETA 2LDBA 3JQAA 3JQ6A 2XOXA 3TDKA 2WEKA 4MOWA 4ALLA 4FCCA 5JYEA 4XGIA 4E3ZA 1IZ9A 4OM8A 4GLLA 2D5AA 1JQBA 2B36A 3GMSA 3FNGA 3VPXA 3ZI0A 2V6MA 2Q4BA 1U7HA 2XPCA 3IQDB 2DBRA 1PGNA 4LN1A 4CM7A 3QWHA 3V8BA 1LU9A 3AK4A 5THKA 5K9ZA 1Y1PA 3L0DA 1OAAA 1EUZA 2TMDA 4BO1A 1HWYA 9LDTA 1UZLA 2DUWA 4DGSA 4WNCA 1SPXA 3UXYA 3GF4A 2FY8A 2YDXA 4XA8A 5JAMA 4UEKA 1C0IA 2GN4A 1E1KA 3UF0A 5FFFA 4Y6RA 3M1AA 3NRCA 1VL6A 3I52A 3STHA 3W8EA 3HN7A 5EESA 4BO6A 4D3FA 4Z6KA 3RI3A 5ENDA 3FN4A 1Y5MA 1U9JA 3S8MA 1E1LA 1LXCA 1IPFA 1B26A 1T4BA 3R3JA 3O38A 1K0UA 1LLUA 1TVEA 3F1KA 3KSUA 4ZVVA 1UXGA 2QYSA 4D79A 4QXMA 1M66A 5KVSA 2HMUA 3PYLA 4J7XA 4MJLA 3AFMA 3OEYA 2HDHA 3NYWA 3DDNA 4PCVA 2BF7A 4YEDA 1E3JA 4AJJA 3WICA 3WNQA 2GERA 3E6AA 2DVMA 5KWEA 1ZKMA 4DYVA 4TRNA 2GN6A 1Y7TA 4ZHSA 3UCEA 1PJSA 2Y0EA 3C7AA 4CMEA 1R4MA 1GQ2A 1V9LA 2QG4A 1YB5A 1VSVA 3Q9NA 3BTUA 2Y99A 4M49A 5G4KB 1E7MA 3LQFA 3VAZA 3WQRA 5BSEA 1VJTA 5L95A 3AUUA 3F47A 2FZEA 4AFNA 2EWMA 2A94A 2FSSA 2C07A 4D0RA 4PN3A 5BSFA 2CZCA 1DJNA 4TMFA 4TZKA 5JXWA 3UUWA 2CF6A 4AJPA 5BNFA 4E32A 1RPNA 3LF2A 3DZIA 3K6JA 4UUPA 3D0OA 4S3MA 1DFHA 1DBVO 5DOVA 4J0FA 2XAAA 3ANLA 1QXSA 3PFFA 4W7IA 1PL8A 3C8MA 3ZH2A 8ADHA 3MZ0A 1LSJA 3S55A 1PJLA 4TRMA 2X9VA 2W4QA 3PQEA 4N5MA 1GV0A 1U4SA 1EBFA 4J9VA 1EDOA 5ER9A 2FSVA 2QIOA 5DT9A 1HF3A 3VC7A 5IJZA 4ALJA 1X7GA 2VTEA 2Q49A 4ZRMA 3QV1A 4MVJF 1YL6A 4OSPA 3Q11A 1E6UA 4W4TA 1KC3A 1U2DA 2WD7B 3QVXA 4IDGA 4B7XA 4FSHA 3EGOA 3HQ4O 4JIGA 4WLNA 4XYGA 2NNLD 4NR0A 1SZJG 4Q3BA 1ZIDA 3L4BC 3U9LA 1FDTA 4YWJA 3WJAA 5CDYA 2Y1FA 1HXHA 2X23A 1DJQA 3VVBA 4XB2A 1IZ0A 4BO8A 1JU9A 1LDGA 1EQUA 2G0TA 1ONNA 3KM0A 4GPD1 4KUEA 1KBZA 1XDWA 3DOCA 4KTTE 4D3DA 2EG9A 4Q3DA 2QHXA 3PHIA 2UV8A 1N9GB 1PX0A 5BR7A 4DQXA 1DIHA 1B15A 3BMQB 3DFUA 3ZNQA 2W2LA 3HUDA 3KLPX 4FFRA 3TL3A 4NNJA 2JHGA 4GWKA 1GDHA 1DPGA 1PL7A 1RYDA 1ZK2A 2NSDA 3KLMX 4M89A 3VKUA 3G49A 1C1DA 3GK3A 2HRBA 2ZJ0A 2EXXA 4W99A 4RJTA 4CMCA 3GG2A 3TOZA 5I9MA 3N58A 4DIOA 4FB5A 2ZATA 1ZXBA 1PJ3A 3BHMA 1NPTO 2QRKA 1UDCA 3CIFA 5JLAA 3VH4A 3PRJA 4NFYA 2EF1A 4KWHA 1CF2O 4EI2A 4LW8A 3ZWWA 3I9LA 1KS9A 4K6CA 1P45A 2NV6A 4GMGA 4S1VA 3AUTA 3OBBA 3GVHA 1D1TA 3OQ1A 2HRZA 1QYXA 4L73A 1U4OA 2DT5A 3AW9A 3QA9A 4J91A 4R1NA 4FJ2A 3JD4A 2I76A 3I1JA 1CYDA 3KYDB 4OOEA 1E1MA 3D3WA 1RM4A 2C29D 2BELA 3RROA 4NBTA 3ZWXA 4D43A 4KUGA 2JCVA 1P1HA 4BNYA 4I9HA 5JMPA 3WGQA 1QORA 4R01A 4BQPA 8LDHA 3CZMA 4B3HA 3RBVA 1JTVA 1MG5A 2CD9A 3NDRA 1CIVA 3ZWVA 4AJOA 1ZEJA 2CUKA 3ITKA 3ZU4A 3EYWA 1VJ0A 3CH6A 2J3IA 4Q3AA 5KJ6A 2YJZA 3QVWA 3RUAA 1NFRA 1ULSA 2E37A 1XQ6A 4WEOA 3FPLA 3TJRA 1U2GA 2VHWA 2QX7A 4BNTA 3NJ4A 3GGOA 5L53A 2ZTUA 4Z9YA 3JQGA 2Q1UA 3F1LA 1SC6A 3GAFA 3JQFA 1EZ4A 2Q45A 4GI2A 4BUCA 4CV3A 3AI3A 3AU8A 3LC2O 1ISGA 2EKQA 4EUFA 4DA9A 3O9ZA 3TZKA 4A5OA 5COBA 4HXYA 1I01A 4FFLA 4QO7A 5KOIA 4OQZA 4YAIA 2GLXA 1HYGA 3SJUA 5TJHA 3BIOA 3SBOA 4BKQA 4N5LA 3JQ7B 3LZ6A 5JPIA 2OP0A 2IZZA 3H2ZA 4Q3NA 1QG6A 5L9AA 4JK3A 4DLBA 1YBAA 3PIIA 4BNGA 3RUEA 2FRDA 2B5WA 5B37A 3EMKA 3L9WA 1UR5A 4PZDA 4KTVE 5T8KC 1I32A 1Y8RB 1NR1A 3H65A 1DAOA 1T2EA 1GUFA 2DFVA 1Z45A 2Y1CA 1AN9A 1SCUA 2X5KO 2OBNA 3VH2A 2ZKLA 3LLVA 4TRRA 1FDSA 1E0DA 1BXGB 5KVQA 4ZQEA 3FR8A 4FS3A 1YL7A 4YPOA 5JCJA 1DC4A 2QZ9A 1GYQA 1D1SA 3F5SA 4R1TA 4U7WA 3GDOA 3H5RA 1HDYA 3RBZA 2WSBA 3G1TA 4B3JA 3I9JA 2OMEA 3QWIA 1TT7A 2PGDA 4IINA 4BNMA 2VOEA 3JQ9C 4HKTA 4EUHA 5A9RA 3C85A 1H5QA 2WD8A 4P8RA 1I2CA 5IDXA 3GG9A 1KY4A 4IGFA 2WTBA 4OAQA 3ETGA 1IB6A 3A4VA 3R6DA 5BQFA 4W9NA 1N7GA 3D4OA 4MVJP 4BKUA 1E6WA 1HDCA 2CVQA 2ZYGA 4YJHA 3GNSA 4EYEA 5IZCA 3KVOA 1ZK4A 5CPFA 4YB8A 3K30A 2FHSA 4O6VA 4WCFC 2O3SA 4Z9FA 1UDBA 5TT1A 1JA9A 3DWFA 3ZWMA 4L75A 2POQX 3DTTA 3P2OA 1KYQA 1ZMTA 3DZFA 2I65A 1ID1A 4HNGA 1M2WA 2NU9A 4IMPA 5KJCA 4BB6A 4CM9A 4GLOA 3JYOA 1LRJA 4F6CA 5EERA 2XXBA 3E9QA 4E0BA 1T26A 4F45A 4DYDA 2VCYA 1B7GO 3QJ5A 1HDZA 1PGOA 3ZWOA 4U8GA 2HO5A 4LRTB 4DBVO 1V6AA 5JCXA 2EW2A 4CL3A 1SNYA 2EJWA 2ZIZA 1BSVA 2HUNA 4ND5A 1NXQA 3TWOA 5ICMA 3AOEA 2YZ7A 3BMCA 5GZ3A 1P44A 1P9LA 4XZ3A 2HJSA 3F6YA 5IXYA 3DZGA 3E48A 1X13A 2X7HA 4MIOA 5A3JA 5BSHA 3KYBA 3AM4A 2HK9A 3PFWO 3BMNA 1AXEA 7MDHA 4CUKA 4RQUA 5TQVA 1WP4A 3NT5A 2FPGA 4NJMA 2UUOA 5B12A 1QYDA 1U1IA 3A06A 1XKQA 1Q2XA 4CMIA 4W7HA 1XU9A 4B7CA 4M8SA 3G79A 3GOHA 3IKTA 1XWFA 1GFSA 3JQBA 1TB4A 3KETA 2OORA 4NU6A 5JC1A 1Z7EA 5HRUA 1HE2A 2JL1A 1U5AA 1YJ8A 2DTEA 3Q2KA 4FN4A 4ND3A 5CEJA 1YDWA 3KSZO 1IHXA 3INGA 1YOVA 2NVBA 3RU9A 4PLHA 3P5SA 5JSFA 2OO5A 3DBRB 3I5MA 5B4TA 4KMSA 5C7OO 2C82A 1HZJA 4GVXA 4R54A 2P9EA 4YYZA 2ZQYA 4RORA 3ASUA 1WVGA 3DBVO 2PD6A 4N7RA 3ROPA 1OC4A 3ROMA 4XQGA 2V65A 3EHEA 1GAEO 4E5YA 3C1OA 3WBFA 2DBVO 3A1NA 2BFAA 4UVEA 2C7VA 4IQGA 4GGPA 2DUUA 4J1SA 4RVSA 4ZQFA 4A0SA 2OL4A 4FW8A 3A28A 3FI9A 1TT5B 3GGPA 4TROA 4B79A 2H5LA 4PG4A 2RHRA 4XQCA 2PD3A
chains in the Genus database with same CATH superfamily
4IMRA 1ACLA 1E4EB 2Q9AA 3GMDA 1TUEA 4M86A 5ELMA 1LLCA 4L0MA 1DTWB 3E15A 1SBIA 4LTDA 1M2NA 2A33A 3B2QA 4E5KA 4NMWA 1JL3A 5JLJA 2IVZA 1HE3A 1EFLA 4D45A 1RW4A 5DP1A 2XKAA 3OICA 1GO2A 3NBYC 2G4CA 1I10A 2Z6AA 3B6ZA 2Y2VA 3KHTA 2XSZA 1YK0A 1ZA1A 3H2JA 3O4GA 4HXEB 2ZCUA 1NVMB 2ZI5A 3U44B 2GCIA 1Z63A 4DILA 1ZXXA 3F5FA 5GJWC 2X4GA 5COAA 5G0SA 1R1DA 1VG1A 2NWQA 5SZJA 3W79A 3LXRA 3OUTA 1JHMA 1A4IA 1P5JA 1JI3A 1X9IA 2GN0A 3N6XA 1E79A 2ZR7A 3KD2A 1PVDA 1S89A 4OHXA 5HM8A 1MNQA 2DCUA 3SYKA 3EBOA 2A5GA 4MMYB 5ALHA 3SJ7A 1DC3A 3DBLA 1JB1A 1BD4A 1BYIA 2HMWA 1FRZA 1XVLA 3IKVA 4BNLA 1YS7A 2WOJA 1KF0A 4DDMA 1P2VA 2BHLA 4P0PB 3MT7A 1UMBA 1R4AA 2FPIA 2JLVA 1V96A 1LD3A 1KH2A 1T3SA 4MS3A 1K27A 4QRIA 2I71A 2A9KA 5JS8A 1TTPB 1H3NA 2JI9A 3K5IA 3KUXA 4UTOA 1ISMA 1GD1O 3WB2A 1T6NA 2EERA 3VR2A 4HLQB 3DV0A 1BTOA 1FYFA 3GFRA 4UATA 4Q7JB 3SS7X 4DSOA 2DLDA 1F20A 2BGNA 1MF7A 4V2UA 4ZO9A 1TYCA 1RRVA 2AOTB 3NC1C 1T1SA 4J1TA 3USCS 5LP6A 2PMCA 2F6RA 2YY6A 3KZXA 4OXQA 4UBLA 4H08A 4ZAXA 2G40A 3E58A 4HMOA 2ZRAA 1IBRA 3NHYA 4GRAA 4TSFD 1YBHA 3A6EA 1QS0A 3LWDA 2BGGA 3A7EA 3IDAA 1JHPA 2CDCA 1N7JA 2XWSA 4CFYA 7ADHA 3K9GA 3PDCA 4NG5A 5G40A 4ZZIA 3OPYA 4LF4B 3BAFA 3ILXA 1Y4AE 4GKVA 3WL5A 2V7WA 3HEMA 1D8TA 2EFGA 4F46A 4EJ2A 1D4OA 1DCMA 4E5NA 2PWBA 2GSDA 1KDRA 1E32A 1D6MA 5TMBA 3PEWA 1G2OA 2VK2A 1UM8A 1NNSA 5HJ7A 2RAVA 1EGMB 1QYRA 4DJJA 3U7GA 1Y33E 4RIGA 1FU7A 3C2QA 1FX0A 2CJFA 1T5OA 4M0EA 5KYWB 5K8LA 1KEZA 2KMLA 1GKYA 1OUMA 1EUDA 2OV4A 2QL7A 2HCBA 3AXTA 3A2MA 4KW7A 4OLHA 9GPBA 5I7UA 4Y6SA 2QRVA 1ZVVA 2C58A 2MWMA 2DB3A 3F9IA 1O0SA 2BFFA 3HFJA 4US0R 4ZO6A 5BSWA 2ZWMA 2ACVA 3I6YA 4Y9RA 1QHHA 4GS5A 1KTIA 2X9NA 4REOA 1X1CA 2QE6A 1K6MA 4QKQA 3GNQA 2DRIA 2ZJ5A 2BBOA 1JWAB 3IEVA 2JIZD 3FWNA 4GQIA 3SOZA 2ZS8A 3T99A 2YNMD 4L15A 2FN7A 2NO6A 3HV0A 1SCIA 3IT3A 1U9IA 2GCGA 4JSYA 4QFCA 3VOSA 1FXWA 2I2FA 3LTEA 4Z3DA 1FMFA 2HSGA 3AHCA 4P2BA 1PJQA 3QY0A 1ZOPA 3IALA 3AFOA 4HNQA 4HRYA 4U6NA 2IF2A 1Y7HA 3GFFA 1YKSA 4PFJA 4P36A 4KXNA 2QXYA 5T4BA 3WISA 3KT0A 2AI1A 2X1VA 1QNFA 1G6OA 1K97A 1O6CA 1GGEA 2W6IA 3EF0A 4IXDA 4M9QA 4TKLA 4GWLA 3WGZA 4E30A 1T2AA 2E4XA 3KOXA 1J49A 3WKEA 3R2JA 4IR7A 5KNBD 1IMOA 3F90A 3GEHA 3PC6A 1YZQA 2HGSA 5LUBA 3WGGA 4NJOA 4EEKA 4TTTS 5T6BA 4FDMA 3UOAB 4P4GA 1E8DA 3B1FA 4MKZA 1ZH4A 4O8ZA 1HT3A 2FLWA 4D3SA 4Z4IA 1A9ZA 3NDIA 3Q8LA 3OAAA 1X0XA 1NFFA 3D5QA 1CRQA 1OBVA 3IPYA 3L02A 3RTCA 9MHTA 3D6JA 4AYTA 4GI3A 1HR0B 2BEKA 1EFPA 4K40A 2VIIA 3N8DA 4RGYA 3NJ8A 4MGEA 1S2NA 4MW5A 1RKQA 2D2FA 4V0SA 5SICE 1PWXA 1RJWA 2GZMA 2BRUA 3Q7RA 1W73A 1E2JA 3C3DA 3QIVA 4PU0A 3PA6A 1OTHA 1AMNA 1Z18A 4UC0A 4D4HA 5KYTA 3V4LA 5G2OA 1T1IA 1U7XA 1XGKA 3IO5A 2YYZA 1X8LA 2J0VA 2ADMA 4YP7A 3VSAA 1VC2A 4WOKA 4FIZA 2NTYC 5DIFA 2SHKA 5KVCA 1U1FA 1DIGA 1FP6A 1V95A 2PLWA 1T91A 4KPGA 3W5VA 1ZI6A 1HE4A 2VBFA 5DLPA 5J1TB 5EJEA 1ZK1A 3L1VA 2BHSA 4P9NA 4Y2HA 1DWQA 1NY6A 3JYLA 6CHYA 2BTEA 1RYNA 1B0UA 4BO2A 3TW0A 2XOEA 1Z2OX 4XDYA 5FUWA 4P7JA 2HSJA 2V3WA 3UT5B 1W46A 1FK8A 4MB0A 3QX7A 4ZHQB 2Q9BA 5HHTA 1MEJA 2Y27A 3W1VA 3YASA 5AXAA 3SMVA 1K7SN 2QAIA 1LF0A 1RBZA 1Y34E 2P1ZA 4TVSA 3SQNA 2QLNA 2V54A 2BTQB 4HLNA 4CV1A 1EB9A 3GD5A 3CA8A 3TE7A 1KGDA 2Q4DA 4MHOA 2JA2A 3JPYA 1FQWA 2MDTA 2OLEA 1XPRA 2ZS9A 3DHEA 3JVVA 5CUQA 2Z2XA 4B6RA 4FN5A 3NLLA 2YJ5A 3FF1A 4ZO4A 3QP9A 3OVMA 4LDRA 4UM7A 4ARZB 2D06A 1UEIA 1SXJE 4OMFG 5JYCA 2D0PB 3UJHA 3E2MA 4D8YA 3LQYA 3TR5A 3U3JA 2H92A 4DHWA 3GN1A 1M7GA 4L0DA 4HLUA 1Y8QB 3FYCA 2DFNA 2QBYA 3O4RA 5DI3A 2EFYA 2IZOA 1I0IA 4LIPD 4E21A 1JJIA 1SXJB 1M1XB 1YQDA 3FTEA 3BMQA 5FOXA 3SHTA 3G7UA 2B78A 4LJLA 2LWIA 1LLFA 1TKRA 2IYOA 3PVCA 4EHNA 1JIQA 1G291 2F9MA 5FR1A 3QOFA 3RU3A 2DQYA 2XEXA 1TVKA 4BLPA 1H6DA 4DC0A 1NXOA 1EJ6A 4IGAA 1G3IA 2RGBA 4LRUA 4NARA 1CJBA 2MMGA 4U0JA 3KQHA 3ROQA 3COYA 4Y1RA 3ZDXB 2HSEA 2O7SA 4FNOA 4N4AA 5F4ZA 4UASA 3HU1A 2RGAA 4KN6A 5KJFA 5B57C 2NYUA 3MJFA 4JC4A 4DIDA 1DAPA 2HSZA 1EHCA 1EVQA 4R2MA 1KSJA 3B9PA 3N1UA 3CT4A 4P86A 3QVGB 3MRTA 3QG1A 4PS1A 3ZKAA 1EWKA 4XIGS 2ID8A 3AF1A 2AB0A 4F11A 2HNAA 2TMKA 3KR9A 1U7TA 2RGNA 3O3CA 1Z6GA 4BNZA 3H9BA 2ONCA 4Y2RA 1EFVA 4G37A 3R9KA 4BZZA 4ZT4A 4UTNA 3JQ8B 1IEXA 3COWA 3IHLA 1HQKA 4LYHA 3DV9A 2NVOA 4IY1A 4PIVA 2RGDA 1JX6A 4R5MA 3RAGA 3BDIA 2EZ4A 3ETCA 5A1JA 1MOZA 3PZRA 1L7VC 3IEPA 1GCUA 3WIDA 3DTVB 2LIVA 4UDNA 2XZOA 3NHZA 4ZYXA 3LCVB 1DRKA 2F64A 3EQ2A 1LBHA 4A8JA 2YHIA 3JYQA 4E33A 1LY1A 2OG1A 3PUJA 3FFBA 4DQUA 4V0ME 2Q21A 4AQDA 4KAFA 2Q6KA 5LQKA 1KMCA 1SQ5A 1YA8A 4CV0A 5JRZA 2GGSA 1RC0A 1IK4A 5FORA 5JO9A 1KO8A 5H7XA 3CPJB 4ECEA 4DVJA 3QEOA 3JQ9A 1ISFA 1NDQA 2GKOA 2NXJA 3DDCA 1KE1A 4AY4A 1MC5A 4CM8B 1MABB 2FPMA 4R2XA 5B3KA 3FOEC 3OCUA 5HKLA 2JPDA 2EBWA 4KIGA 4FYIA 3BXEA 4K81B 4ZU6X 3GLFA 5E6UB 4PSKA 5DULA 4NCAA 4IRUB 1ECGA 3PSHA 4HAVA 1YQWA 4HB3A 1ODCA 3EXAA 4TLDA 3HKEB 1RP1A 3ED1A 3REGA 3R5KA 3NTXA 1U6IA 2J8ZA 2VDMB 4JP3A 4BGDA 2A8YA 2JH8A 1XRQA 2GEJA 1YWGO 5K3AA 1XTIA 1V4VA 3WFJA 1FE8A 3AQ4A 3CSUA 3GBSA 1DAKA 1QAQA 1SQGA 4J2HA 4MI1A 2IZ1A 2ZWIA 2C4NA 1WNTA 2CGEA 5JXHA 4Q21A 1VLQA 4X90A 2Q7OE 2G5CA 3HI4A 4ZCPA 4BBJA 4EENA 3KZCA 3DCYA 8AT1A 2H7YA 4PN7A 1GIAA 1C8LA 3CKYA 1FMLA 1V3VA 4MUFA 3HACA 2Q3DA 3KQQA 2XGGA 5ESXA 3AHJA 3LC0A 4W8OA 3AEQA 4RK4A 4GZ6A 5IM4A 1YI0A 4CKWB 1TQ4A 3ZZNA 4GC5A 4WHMA 3QPDA 4EW2A 1NT2A 2YDYA 5CVDA 3GCGA 4MUJA 2QPAA 3CSDA 2B5VA 4I50A 4R31A 4BNKA 1ORRA 1QVWA 3L7JA 1MX3A 2WA2A 5E9QA 4D8TA 5KHAA 4HCJA 3R7LA 1GZ6A 2VT2A 4GX1A 4YPFA 3DO6A 5LWQA 3A1DA 1L8AA 3FWZA 2VYCA 4CT5A 1Q2UA 3HA2A 3QOWA 3KJXA 2H08A 3NU1A 2UVDA 5JARA 3O8RA 2FUEA 1KZ7B 2VRNA 1RWVA 3ZWBA 1XE3A 3GEMA 5IVPA 3T95A 3OZSA 5KKAA 1E1QA 2DKFA 3JWJA 3OZAA 4LV5B 3WJ7A 4QUHA 3BB3A 1N2CE 3KQOA 3RVMA 2RGUA 1XA0A 2Y77A 1Z2EA 4QBIA 1U81A 1ENYA 3TXYA 4IDAA 2AQ8A 2OKCA 5JSZB 1WX1A 2JC3A 2OUKA 2CW5A 1X7HA 2OZKA 4RNDB 2O2DA 3LZDA 3MD0A 4NPHA 3W2FA 4D25A 2GM5A 3C5HA 1N2CB 4BZQA 2WSIA 1K6IA 5ERXA 5GZ1A 3BE4A 5IC5A 3T3OA 4HV4A 1P4HA 1A5TA 2ZRFA 2JFQA 4JU8A 3IKJA 3PDJA 4RD4A 1KZYC 3GJRA 4J4HA 3TOCA 4RVUA 3NTQA 3UYLA 3PI6A 1Y9ZA 5KYGA 4HYYA 2PJUA 1R00A 2GLTA 4OK5A 4RVHA 4MWBA 5D7BA 3AVXA 5ILOA 3U4IA 3VAYA 3DZ8A 1NVKA 2CJXA 2PPVA 3EMBA 3EPKA 3X0DA 2UZ1A 2X58A 1Z5UA 4JNKA 5M34A 1YKGA 4NESA 3F6RA 1U0HC 3BRWA 4ETMA 2XQFA 1JFFA 3HB5X 4I81A 1LDEA 1SUBA 4NMMA 3N2YA 2WWRA 1FYDA 5FNVA 3O8DA 3DOIA 2CLOB 3E7FA 3KOMA 3UY4A 2YIMA 1JT2A 1QRTA 2QQFA 3GJ0A 1U3VA 3WQHA 3HB7A 4HEA6 4EHIA 4X6YA 4J07A 2HK6A 4KLZA 5D87A 1NL3A 1CUEA 1NMEA 2JEYA 2EP7A 1LPBB 1IFXA 3L2OB 4FDUA 3FCAA 5HF6A 2FEMA 2VA8A 4C3VA 2O8BB 1OJ7A 4IF6A 1UXJA 3CMMA 1ZVMA 2DPXA 2NT3A 4UEOA 4D5GA 1NF2A 4RPIA 3KSMA 4H1VA 4D9JA 2R4TA 4GKKB 5L7TA 2VPIA 3GRRA 2C4MA 4K7JA 4B8WA 3SC2A 3ENWA 1N77A 1BH6A 1E1CA 1RCUA 3ZGZA 1GTL1 1M0TA 4FYHA 1KI4A 2ZCJA 2JFHA 2ZRJA 5CLJA 2P90A 2F8TA 4H0NA 1HLDA 4UD2A 3KNZA 4UUOA 5C3MA 2AHRA 1R6VA 2DF8A 3OI7A 3SHFA 4QODA 1MIHA 3WYNA 4BO0A 4ZQIA 3KYCA 4DCJA 1AD2A 4MVJA 1MT3A 1RCTE 3IUPA 3HJTA 4PX2A 5U1PA 4WBNB 5A02A 3K70C 4V0KA 3ZLJA 4OIMA 3V7NA 4FPXA 4ASUA 4BE7B 2LIPA 4DQDA 1O96A 4JVSB 2WABA 3DDWA 4B3XA 3A1EA 2H2FA 4XX0B 3MIZA 1DBSA 2DZDA 1UFQA 3IVGA 4PQFA 5J9FA 4EUEA 4I55F 3FFWA 4X0EA 3H5WA 4J6EA 4GDMA 3LXMA 2Q4RA 3MWYW 5DLEA 4EHJA 1QIGA 2NUPB 4X8LA 1RRMA 1XZIA 3W7AA 3LT0A 4FFBB 3AEUA 2FOLA 3FLMA 5K0BA 1TQ8A 5DNDA 1SOUA 1Z7GA 2ZRNA 1T0BA 2ID4A 1U8ZA 1F06A 1S1CA 1NE2A 3MSXA 1EFUA 1F51E 1E6LA 1OA0A 3KKOA 4Z2AA 5MGBA 3LC1O 3BD8A 1CJTC 2WAXA 2IJGX 4IMIB 3S29A 2GUWA 1V35A 1RXCA 2C95A 2Q5EA 2O9JA 2RI0A 3AKDA 3D6HA 2OR3A 3S2GA 3VYUB 1PEYA 2ZIAA 1J22A 3HABA 1WXDA 3EEBA 2HJHA 3AILA 5K4AA 2Q5QA 5DWQA 4D99A 3ICQB 2F43B 3A1CA 1KA9H 3VR3A 1H8ED 1G3RA 4ZEXA 1TAHA 3IIEA 4DCNA 3SS8A 2WF7A 3UW1A 2AR0A 1G20E 1QYCA 2XIJA 1J4AA 5TF4A 3COJA 4WZAA 1IHDA 1T8YA 3OCVA 5ITSA 4MDFA 3VNBA 1HTBA 3LPDA 1GN9A 1Z26A 1TM1E 1M1NA 2IU4A 1NR5A 4NI5A 2JKYA 4YMIA 3U5TA 4MIYA 4UD6A 1VZ2A 5CM9C 1KQNA 3CZ4A 2RHJA 1RMYA 4IDBA 4IUYA 5CCEA 5KX5F 1G20B 4Q6WA 1YAJA 3FE2A 5LPNA 4QAJA 2A84A 1OAKA 2R1UA 4XOIA 2LV8A 1N1DA 1OYVA 5P21A 3LE8A 4RQAA 2CNWD 3U40A 5L3ZA 1KI3A 1A04A 2ZKIA 5AW6A 2H06A 1PK8A 1Y63A 2R8PA 4PONA 4RDHA 1JKJA 3FTPA 4CMJA 2XHEA 1KDPA 3MTEA 4YLEA 3CISA 3DB2A 4ZCSA 4LXXA 1M6VB 4G97A 4A4DA 1P9NA 2IOFA 2VDQB 3GRCA 4JFAA 3K72B 3DHYA 1P7VA 1IJFA 1EX7A 2H4YA 1N92A 4WXMA 2HMYB 4ID3A 2PSHA 3A3NA 3ILVA 4D96A 1AH2A 4WUTA 3STUA 2I2DA 3C6ZA 3QWFA 1K9VF 1T8PA 1QDUA 1Z5ZA 3C5VA 3W9YA 4DCPA 1GTG1 4Q0MA 1RWWA 2GKSA 4RGVA 2DWOA 2ZE8A 3FFTA 5I4IA 3BICA 1OD6A 3ZGVA 3B2NA 4J1QA 2H1HA 5LA6B 4B7AA 5IN4A 4GI5A 1ZKDA 2R5FA 1QC5B 2BCEA 3MJRA 5ALWA 2K2WA 5G41A 5CCDA 1FMJA 1SMKA 3DULA 2C61A 3VZDA 3MCUA 4KP7A 4EHAA 4XQ9A 3OJEA 2PY6A 4G0ZA 4KAAA 1L5OA 3VPSA 4D6XA 5LFAA 4KX3A 3A70A 5AM5A 2HMSA 3EA5A 1J20A 3FLEA 2Z0MA 4IGEA 5K3BA 5L40A 4HL6A 3DW3X 4TUYA 3USES 5INTA 2H17A 1A8UA 1MHPA 1A27A 1D7OA 3OECA 4TTSA 3FCCA 2J9GA 3HRIA 4DYHA 3GFPA 4UQPA 5E38A 4EL5A 1N5IA 3L06A 2D1SA 3KAJA 1NWCA 4ECAA 3K0FA 1E2FA 1VHLA 2I6UA 2YV2A 4AZ0A 1PSDA 4CCYB 3DSRA 5ENVA 1EU1A 3ZWAA 3RT1A 5AVSA 3AKEA 4PLYA 1VPTA 1QLJA 4FLFA 2OQ2A 1L5SA 2FUNB 3OZEA 5EHGA 3WKDA 2FQYA 3ICVA 2EWWA 3V1UA 1DJMA 3KUKA 2G1JA 3IVCA 4GEKA 2WFLB 2XD9A 1H1LB 4PWYA 5FLKA 2BSAA 4ZZ1A 1N34B 3SBDA 1CIJA 2ZIXB 2B1IA 3EWAA 1NRJB 3THXB 4XVRA 1WZEA 3C24A 4M7OA 4RU1A 4BX8A 1X3LA 1WB6A 3B53X 3H5VA 4IBOA 5KYWA 2XZTA 1IM8A 3N74A 4PZEA 3V5NA 2Y6VA 3CW2A 3TFOA 1UP4A 4TVKA 1BEEA 3ZXUB 2FUG6 1ZMBA 2J3JA 4M9UA 1DG3A 3HO8A 1PNTA 5FLXA 2PQ6A 3PNKA 3DBHA 3B48A 5DXFA 5A6SB 4LJYA 4S12A 4MGZR 3WHLA 3JW8A 4LXQA 4E2ZA 2ILVA 2DETA 4JI7B 4LHYA 1SEVA 3OOJA 3ZGYA 4QUDA 4B82A 4JI0B 4ZGBA 2VWGA 5AVOA 3K6RA 3LKBA 3S81A 1MW9X 4XASA 1MVOA 1RHKA 5E0OA 3E0XA 2HXGA 3KTAB 1FY2A 2VXYA 3EVEA 2DU8A 3CNHA 4U9HS 3IV7A 1EXDA 4N76A 4U7JA 5LZ9A 3DHNA 3EULA 3PXEA 5LC1A 5LZ5A 5CLFA 4LMRA 3CZAA 3RGGA 1SCKA 4FFMA 4QGAA 5GM1A 3CVWA 4EBBA 1MC4A 1WDKA 1TQHA 1DEHA 1E7WA 4QYWA 4TKUB 3EDYA 4AWAA 2R97A 4FWIB 1GU7A 5BSVA 3FOWA 4CMGA 1GYPA 3PS9A 3KOOA 4Z4QA 5D3ZA 1XPJA 4IPTA 1LI5A 1NKTA 1WLYA 2PU5A 4UU7A 1IU9A 2XCSB 2KB0A 3ISJA 3DBOB 4B3TB 3DMRA 4E1VA 5JIBA 3U4GA 3DS8A 1UDRA 2NSJA 2EZUA 2LDXA 2PDAA 2GTPA 2WSYB 5DGHA 1XL1A 5BWBA 2WG2A 4YAWA 2CMDA 1ZJZA 3L0SA 4TM8A 3A6FA 2ON6A 5KS2A 2CFSA 3OQNA 3VO9A 4X8MA 1JMYA 2XZLA 3I9OA 4YBZA 1BCSB 4BV2A 3RRNA 1KFKB 5HIJA 1GSOA 2C4TA 3BGDA 2GCOB 4X7RA 3T4EA 2PBZA 4RM3A 1J2RA 3N76A 4RAOA 4TLMB 3U3RA 4GYYA 3ZEIA 2WF8A 2CLSA 4ZYLA 2WV7A 1RQGA 1DEXA 1XN1A 2WE8A 1P6XA 3IH5A 4RHUA 3VPAA 1T9KA 2WTMA 1E6EA 1UC8A 3O94A 3TFQA 5EPOA 1JG6A 1ZH6A 5F2KA 4MMXB 4II2A 1TW2A 1FFGA 3FNHA 3NX4A 1SULA 1HDEA 3LMKA 1Q1NA 3BQ9A 1UP6A 1G8GA 4OHPA 2JNWA 1PO7A 2A92A 6ADHA 1GDDA 4NYIQ 2YIDA 1XLVA 1HMPA 3RAEC 5FWYB 5I01A 4N9QA 4FHDA 4OBBA 4TLBA 4PXSA 2IOQA 4DMMA 3LBYA 1JIKA 1GQOA 2D3TA 1LA2A 2TRSB 1KSGA 3LCMA 3UV7A 1R6AA 4AG3A 2PK3A 3OU6A 3VUEA 1B76A 2KM1A 4TWZA 5EIBC 2WTEA 1LTQA 2XKKA 2CYCA 1XZNA 1OX4B 1XZAA 2H2IA 3EEYA 5F33A 2VJDA 1KI6A 1OIXA 2XXAB 4ZHQA 4CXMA 3CEAA 4Q1AA 4L5JA 3UFXA 1ZCZA 4B45A 3CF4G 2LTAA 2O3JA 4D9IA 4E94A 5HYVA 3EMVA 3HCPA 4DZZA 2VZ9A 4H60A 1ENZA 2IC5A 2PGOA 3D1LA 1AQUA 2FWAA 3DXFA 2W4MA 4KL8S 3E05A 1RXVA 4TXHA 5H5JA 3MS4A 5AWFC 2V7QD 5K3CA 4JNCA 3G9UA 1X7DA 2C1XA 4MEAA 2YW9A 5ARCA 1DKOA 4TTIA 1VG8A 1Z12A 4WKGA 4X8OA 5CDUA 2QJRA 4LI3X 3ORSA 1KO5A 5HIIA 4C0HA 1R0RE 2CYBA 3JVDA 1T3HA 4EW6A 1O08A 3FLBA 1ZIPA 3RJTA 2VJBA 4AUEA 2FWIA 3GFSA 4OFWA 2HJVA 3NHAA 3ZHZA 1W94A 4MA0A 4AN1A 2YC4C 5DN9A 2V8BA 4Q48A 1YQGA 2ZE5A 4LDQA 1TU4A 3UOGA 3BMCB 1ZITA 2CB9A 2EV9A 1M8FA 2WYHA 1VG0B 3BD9A 1XXLA 2A30A 5TSDA 3CO0S 1U8AA 1M0SA 3L1JA 3I5AA 5E2BA 4BOYA 4BMNA 2F90A 5EJ5A 4HDCA 4P5DA 3EPHA 2W98A 4O25A 3BMNB 1SWVA 4JBHA 5K99A 3HXKA 3U61B 5AK0A 1ILEA 3T38A 2ONZA 1B8VA 5EGSA 4CKXA 1R0YA 1SKQA 5AT1A 3WRYC 4X1KB 2Q9UA 2XE8A 1QIDA 3C97A 3I23A 4HNRA 2UUPA 5ELLA 2AXQA 1TRKA 3PDHA 3QVGA 2BFBB 5D3KA 5DK6A 4WZZA 1P0MA 1PQ4A 1OBOA 4UARA 5G0WA 4MPTA 1HFKA 3GUZA 3L07A 1RI3A 1CNMA 1ZCJA 4JLAA 4DSUA 4Q39A 5C80A 4MV9A 2AVDA 3TTWA 4GE0A 4U7DA 1Z15A 1A5SB 1X1DA 2AIRA 1KEPA 3AH8A 1XCBA 6REQB 2JGRA 3I9V1 1SPBS 4GPBA 4XUEA 4ZVNA 1U11A 2IQIA 3RLIA 4QJ3A 1L7DA 4TX1A 3TVYA 1DCFA 1CUWA 1URPA 2I66A 1C7RA 2A35A 1YUBA 2CFOA 2PIAA 3PWZA 4GPIB 3RS7A 1CEXA 3T5MA 3WS7A 3WGYA 1OLXB 3AETA 1IJBA 2QSYA 1V1MB 4NFSA 2I4TA 1PR6A 4BNWA 1XK7A 4HF7A 1J8FA 2G4VA 121PA 2ZUUA 4MAMA 4QXRA 2PG3A 3GJ4A 4RETA 2VEDA 5IM5A 3TLZA 4AIIA 4QICA 5EE9A 1C9KA 4O3MA 3KR0A 3R8XA 2GXAA 2NVWA 2WF6A 3PRHA 2ECPA 2AMJA 2OXIA 2N42A 3H75A 1HEIA 1D4AA 2PZGA 1KORA 3L7AA 4YQFA 1C14A 5CK4A 2ZYVX 4OH1A 4CM8A 1OJLA 2XTNA 4ZU3A 4CU2A 2Y2UA 3AF0A 4MR8A 1QGED 3KUCA 2OKGA 3ZE0B 1QHNA 3GUCA 2O5EA 5E6UA 3B9RA 1CY6A 1JEAA 4KYIB 1HGXA 4J2TA 1G41A 2OCYC 1A1VA 1UBCA 2IOFK 3C3BA 3PQ5A 2GBIA 1PR5A 1FSGA 4KN5A 1C9NA 4ZPXA 3L8HA 3MT0A 2MINB 1GVNB 3HCCA 1ZUNA 5BW6B 5AUPB 1SHLA 4IYJA 1VM6A 5L3SB 2XA9A 2NGRA 3O4VA 1CJSA 1N5KA 4XFKA 4Z2YA 3ZWPA 5BXQC 1JDBC 1NA5A 3HXMA 5HRAA 3FFAA 1G1AA 1JTEA 2GK7A 2JD2A 4HFRA 1XQVA 3T9CA 3FUWA 5HA5A 1B14A 1XQ1A 1WVIA 4CMHA 3KB1A 3BFKA 3LLUA 8MHTA 3BD7A 1L4FA 5GPBA 4INAA 5JEEA 2OPBA 1R5JA 3T1NA 2QVYX 2Y92A 4E07A 1CJCA 5IRCD 3DC7A 1V9CA 1WPGA 3PEUA 3IQHX 5IEBA 4FC6A 2W58A 1Z16A 3UK7A 1JLRA 2XZPA 1JUDA 1RACA 3ENKA 4J0KA 1TLTA 2R66A 5EZ6B 5C5IA 1QANA 4MAFA 4OP3A 1RJ9B 4GUDA 1R12A 4MUEA 2II6A 5BSRA 3FGPA 1DZIA 1E9FA 5G0UA 5DXJA 5FUMA 2Q0QA 4L0QA 4KXXA 1MH1A 4CQMD 2M6SA 1YRLA 2VQDA 1Y6GA 2R11A 4TSKA 4DJEC 2Z9DA 2H6EA 3HU2A 3G9ZA 4QULA 4B2IA 2E4UA 1A7AA 3ETNA 2BM9A 3BC1A 3H16A 3L7DA 3DFIA 4XIFA 3U7IA 5KBYA 1Z7YA 2O3UA 4CEHB 3ONNA 4UCXA 1Z4OA 1HNZB 3ADPA 5BYKA 3AKZA 1BDHA 5JSZA 5DLQC 1BCRB 1UAYA 1F4PA 5T3YA 1EBBA 1VCMA 1ETHA 2VDRB 5GWXA 3C7KA 3GL9A 1OB5A 4NZZA 2IP4A 1BYUA 4LNUB 3WHIA 1V47A 1LDBA 1Q57A 4ROSA 4F96A 5DNAA 3OEHD 4MDHA 4C7JA 5ILQA 1IE3A 2QEQA 2JLUA 1ZM7A 4HY3A 2SKDA 4PGHA 2H7XA 3FD8A 4X1YB 2P9ZA 4J7UA 1ZLXA 2BMVA 2O2HA 2QRMA 3CEMA 4ITVA 3UQYS 3HP7A 2QMEA 4WTOA 2YXNA 3P7MA 4F2GA 2HR1A 1WBJB 4CRWB 3BMOB 2A88A 2Q0HA 1SG6A 1XFDA 4C01A 1OZAA 3I9FA 4XGQA 3NHLA 4LX8A 4YCBA 1T8RA 421PA 1HYHA 4J8PA 2JGLA 1WUYA 1KEWA 4JL8A 4L4XA 2C83A 1TUBB 2YY7A 1BJTA 2B2NA 4H3SA 4OA8A 1R66A 2KYRA 2O5VA 4J1NA 4JJ8A 4M9RA 4CLDA 2Z04A 4CIBA 3RJ5A 1JLLA 4L4SA 3CPSA 5IT5A 1UFRA 5A7GA 5FULA 4KJZA 1R6TA 4CQNA 2R1TB 5A0VA 2XCIA 5LQNA 5ICEA 1EH5A 2XECA 4N54A 4HWGA 1O94D 1PRYA 2ORVA 1JG4A 3IDFA 2RMKA 3MWEB 1JG1A 1S3FA 4Q3CA 3V97A 4QJ5A 2RIRA 1ZIOA 5TY0A 1MTZA 3H2KA 4EW1A 2Z1MA 4TKZA 4TWJA 2YUIA 3EHDA 5FFMA 4LTMA 3AEYA 2V98A 2G5PA 4OHMA 5HKAA 5LQMA 4DV7B 1HKHA 1IUNA 4KXMA 4F3RA 4CTNA 1QMGA 2A3RA 3C0KA 1WSDA 3EFHA 1EK5A 5F7ZA 2QZ4A 5CG1A 1B23P 3Q85A 2ETVA 5AYVA 1Q95A 1MB9A 4RY8A 4UMVA 1Q0RA 4NS4A 4UUQA 3VMMA 3CUTA 1C1HA 3ILYA 3SNKA 1PDOA 4F6RA 5DXAA 4G81A 1A76A 3TRDA 3R3VA 4G63A 4ZGWA 5IFLA 2W7TA 3FYHA 5MN5A 4HADA 2A0UA 5LBTA 1SUIA 4L3WA 3R24A 1E3MA 4F5EA 5KYVA 5NULA 1M5RA 5BR8B 3MILA 2WJZB 1WLSA 3O4IA 3U16A 4LF6B 3N87A 4WBNA 2J32A 2V7BA 1COWD 3E81A 3DOOA 2MMCA 3LF1A 2A4KA 4JSTA 4NHEA 4RD2A 4CQLB 5C8VA 1G0OA 4UEQA 4XX0A 1P5RA 3A04A 16PKA 1S01A 3MTBA 2Q2WA 2WAMA 5GV8A 2VTKA 3SX2A 3UKOA 4KGZA 3V7FA 1GDTA 1VB5A 2PGXA 1W4AA 2VSFA 3DE3X 3ESBA 4C7MA 2H5IA 2O4CA 2PTGA 1HI9A 1YAHA 4KH1A 1B41A 3PEFA 4MTCA 5CXSA 3TLKA 3CINA 5GM2A 1MTOA 3MNFA 4KOEC 3ZDZB 1RWKA 1F14A 2ID7A 1R74A 3NPMA 3OM1A 3VZSA 4Q4AB 3EQ7A 1FLDA 2PRJA 3HGTA 3HUFA 3ROZA 4MINA 4D92A 1AY0A 4FXOA 3G7NA 1NUPA 3HSKA 4D4LA 4UNNA 2ZJ3A 3ENVA 3VU3A 1XF9A 2J6CA 3VPCA 5JS6A 2NP7A 1X14A 1BXGA 2O14A 4LY6A 3U09A 1C4XA 1CBUA 4BQSA 2YOFA 4RH1A 1T0UA 3H05A 1HNWB 3QU4A 4DV2B 1SD1A 2A1UB 4RJKA 1XCLA 1R6XA 1EEXB 3DCNA 4INOA 1X7XB 4PLWA 1CNFA 3NCTA 3ROGA 1LK0A 3CLVA 2VWPA 4HPJB 4PLGA 1NWHA 4R2IA 2G06A 5CRIA 1D3AA 1O77A 2GWRA 3CONA 5IDVA 2GPJA 5DCYA 4OFXA 2GBLC 2DECA 4MS1A 1I2ZA 5LXTF 1WPXA 4TKUA 4A73A 1W9MA 2I1LA 1PNOA 3OG9A 4FMDB 3T9FA 1W0KA 4FK8A 3S27A 2V1UA 3JQAB 2WWHA 3K53A 2ORWA 1NVVQ 3ZDDA 3I2JA 3FUXA 4NABA 1VGQA 3AHDA 2RB5A 4WY8A 2HA3A 3OIWA 4RA9B 2J41A 4PHTA 5KZMB 1VI2A 5D5QA 4FP9A 1N6KA 1YONA 2GX6A 2LKDA 1H85A 3QY9A 4O4HF 3CURA 1M6VA 1PT9A 4J16C 5C35A 1UFOA 4C6TB 3C6YA 5ALRA 5AW7A 4GRIA 3SYLA 1KP3A 3MLAA 3WP0A 2VAXA 5BO5A 4MV4A 1E6MA 3GRPA 4ARUA 4BGVA 2BGKA 5JNSA 2HI0A 3QMWA 2CHVA 3RLFA 2RHTA 4Y30A 4IXWA 3X2EA 4CFSA 1EHIA 1GZHB 2GD1O 1QBGA 4HNSA 4X3OA 3G6WA 3FB1A 4XD7A 1YZVA 2ZTMA 5HIAA 4B84A 3GA0A 3P2IA 1L7MA 3WL3A 3HHPA 3HXOA 3IGFA 1YRHA 2QGZA 1GKUB 4MYSA 3SIWA 1C81A 3A0RB 2XVXA 4PZCA 3OMWA 1W75A 3N0WA 3G3EA 3OCCA 1QC5A 3PC3A 1JAYA 4ZTUB 4MWDA 3OQIB 3S2ZA 1OOEA 2H54A 1FUEA 1SVKA 4P4NA 4WXYB 4KYUA 4QDJA 5E8JA 3AEXA 3VBCA 1G8SA 2Q3JA 3O8OB 1U3UA 3WL8A 1P60A 4IJWA 1GZVA 2X5OA 3R76A 5JBQA 2Z57A 2Q3CA 4MICA 2I80A 1CCWA 2XQJA 1Z6YA 4QEKA 2R3SA 4V24A 4HDNA 3C3PA 1I8TA 4JQYA 1AN0A 3BTOA 4TN1A 4YP9A 3K20A 1ZEMA 2ZB4A 3NBUA 5KSPA 3ZPXA 3I61A 2X3FA 2I6QA 3NQ41 4FD2A 4G5FA 4RM2A 4YFYA 1JBEA 1OWMA 2FRVA 1ECBA 3QYFA 3WLSA 2AI2A 3H9UA 4YJ2A 3KPYA 1RHQA 3I6BA 4ZRNA 1YUMA 4OQQA 3AL2A 1KEEB 2FGJA 5CURA 1AS2A 4BZWA 2DX7A 5A4MS 4XDZA 4PAOA 4Z3OA 5ADWA 4XM1A 1H1LA 2CHGA 2O48X 2XNKA 1BVYF 4G8DA 1J42A 2QD4A 4EBFA 4P38A 3FKJA 3THXA 1WB5A 2YJNA 3FCSB 5H9WA 5KHOC 3ZJTA 4WPGA 3EZYA 2R9VA 1AK9A 4FFWA 1GU1A 4RLFA 5TEVA 3UG7A 3F7MA 3EVCA 1DKQA 2O3QA 3TPFA 1JFVA 2B1JA 1Z13A 5T4HA 3VZQA 7MHTA 2VYNA 1JDUA 2XMBA 1P8JA 1ULHA 2XVYA 5CR9A 3UW3A 4IIJB 1LBSA 1OC2A 3O82A 5LLDA 5FD8A 2PWPA 1HDRA 4HFJA 3I0NA 2WW8A 1KJ8A 3A6ZA 1UEXC 5ALLA 2XA1A 4CM3A 5JASA 3HDQA 4PRKA 4O59O 2VBCA 3V8EA 3ZZUA 3NBAA 1E7RA 3QH4A 4MW6A 3R7WB 1LDYA 4REMA 1V6SA 2BOVA 1IY2A 3BH0A 1LUAA 1P29A 1TLFA 3SDBA 2J7PD 1TPZA 1BMQA 1WXQA 2Z3VA 4R9UC 2H0RA 1KHHA 2VF8A 521PA 4DJFC 5IX8A 5JNTA 2O8EA 2RBEA 4OHOA 4YMHA 2LGJA 2ET6A 2RHCA 2CLDX 2HD4A 4GFDA 2QJTA 3Q3GE 1B74A 2B7LA 4HP8A 1NMSA 2Z5LA 4RDCA 1QGYA 3I83A 1R6BX 1MDBA 3QI2A 1Z07A 3D7MA 3QVKA 3AFGA 4FGZA 4MUKA 4JJFA 4H2DA 1YS4A 3K5WA 1FDVA 4E2XA 4OXIA 3CUVA 4F21A 3HNPA 1KVSA 1QLHA 4Z7NB 1A9SA 3B7GA 3PNLA 5E2IA 4A03A 1FC0A 5HZGA 5A0TA 1VJCA 2MSWA 1YKFA 3A4LA 2PS1A 3SC6A 4HVTA 4DA6A 3GLIE 4XGNA 1XZ8A 5JNLA 3GFTA 4LSMA 1T1RA 5HCIA 3LYLA 3SHQA 2YWGA 3WLLA 1WEHA 3P9QA 1GTZA 3T1OA 1RHRA 2R6R1 2CXOA 3M4JA 3EC7A 1NYQA 4J6FA 2D0OB 3K6KA 4B2LA 2QPOA 4QUEA 4CM4A 2ZYHA 2YNMC 3ITDA 4AP5A 1UXIA 3FMVA 5K0TA 2CJPA 2BGUA 2CFRA 2G83A 1OLSA 3DT8A 4CF6A 4RS4A 4CMEC 2ZB3A 4N0MA 4LISA 5EVJA 2RHOA 2YBDA 1JHYA 2QD5A 3WMXA 4BLWA 2EZTA 3O2SB 3W90A 2BGLA 4MRRA 2BLLA 4ZCTA 1IOVA 4ZJZA 1JN0A 1CD5A 3D7LA 1EBUA 4J3NA 3TZ6A 4E88A 2RI6A 1BFDA 3DZHA 1XPOA 2PBRA 2PVPA 2GRJA 4I9NA 4HOYA 1KEUA 3AR7A 2MHCA 3D8HA 1JG3A 1K7FB 4KV9A 3WRYA 2VPTA 1BX0A 5CVTA 2Q07A 3VU9B 3F6PA 4A0HA 5DM2A 4L95C 4F12A 2JB9A 3DM9B 2VDPB 4FNAA 4BMYA 1JHUA 4EECA 2XYRA 1YR2A 2QF7A 3W5CA 4NV0A 3NFRA 1XTTA 3VKFA 2HWYA 1YZNA 1J5PA 3DMGA 3ND6A 3RBXA 1JIUA 3HNOA 4CMBA 1Y48E 3A14A 2OP1A 5A9SA 3MJVA 1PV2A 1UOPA 1FBTA 5IVDA 3UJPA 4OHCA 3GLTA 1IWBB 3PD0A 4D2IA 2B3DA 3KEGA 1UKCA 1E2KA 1MLDA 4FQ5A 1V4BA 2OUIA 4MVJM 4P84A 4GPAA 3NAZA 1IQUA 2ODAA 3DOUA 3VI4B 2WIGA 5FQOA 1G5RA 4ZZ3A 1U8UA 2VCEA 3RCBA 1BW9A 3N2IA 2ZGVA 3RS8A 4ND6A 1QHXA 3UOWA 4TTRA 3NPAA 2QUAA 1U2DC 2CLHB 4MWSA 4TWAA 3D3WB 4DR6B 3WRWA 2IODA 4OQNA 1Z74A 3IHTA 5DHPA 5K3FB 5KTTA 2QTRA 2R0QC 1XZQA 1SK8A 3HE3A 3L6DA 1JDVA 2P6OA 3RM3A 5E1MA 4ZAWA 4B7ZA 1YTLA 1Q91A 1KVRA 3GV0A 3LU1A 4GF5A 4DZRA 3EEIA 4YCAA 3C48A 3W3ZB 1NY5A