3ZN2A

Protein engineering of halohydrin dehalogenase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
253
structure length
253
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HALOHYDRIN DEHALOGENASE
publication title A Single Point Mutation Enhances Hydroxynitrile Synthesis by Halohydrin Dehalogenase.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 93
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zn2A00
1ULSA 4ALKA 1HEUA 1LBEA 3WGZA 1L7EA 1Y5MA 3MJVA 2IYPA 4CQMD 5IG2A 3C1AA 2FR1A 1C0PA 3GZ4A 4NPCA 5JW6A 2C59A 1OBFO 1IHXA 1Q7CA 1YL6A 4ZQGA 4ALMA 4E5YA 1UXGA 1YB4A 1ZZEA 1FDUA 5EL0A 5G0SA 1F0YA 3RI3A 3ZN2A 3DAPA 1XELA 5TF4A 5JDCC 1H2BA 1HYGA 4KMSA 5DF1A 4CMKA 2X22A 4OO3A 1OI7A 2NTJA 2NNLD 3GPDG 2RH4A 4AJIA 1F8GA 4PLVA 3EUWA 3ENKA 3W4KA 2I99A 3PI7A 5FI5A 1CEQA 4YJHA 5F1KA 3GGPA 2CZCA 3H5NA 4NI5A 2BLLA 4RCVA 4CLRB 1GZ6A 1MP0A 2NU6A 4OOFA 2DKNA 4R3NA 5K6AA 3RQSA 3N58A 4D42A 3BMNA 1AGNA 2P9GA 1A4UA 1E5QA 3GRPA 3LDHA 1E7SA 1LQUA 3OIGA 3I9MA 5A02A 3GGGA 4OGWA 3WYBA 2BMAA 1B8PA 3WBFA 4CLHA 1PL8A 8ADHA 2BFAA 1PWZA 4XIYA 2OOSA 3W8DA 1PZGA 1TEHA 1H6AA 5HS6A 3RUAA 3M6IA 4RQUA 3ORFA 5FF9A 3UN1A 2W2LA 4D0SA 3DBHB 5KIAA 3GN2A 2DLDA 4XGKA 1EUDA 4DC1A 4RGBA 4L4XA 2D4AA 3IAHA 1Z6ZA 1O8CA 3KEOA 1Q1NA 5G4LA 3ENNA 5TT1A 1WMAA 3AOEC 2EGGA 1O9BA 1R4NB 4LSMA 4UEKA 5KTKA 1PGPA 4FOOA 4PLHA 3KLMX 1RM3A 3PHLA 1TVEA 2FSVA 3D3WB 5JAMA 1E0DA 4MKZA 3CPSA 3K9QO 1UXKA 2Y1DA 4HWKA 3GVXA 2ZYDA 2D59A 1NHWA 2PA3A 1ENOA 3NTRA 3WGYA 1HDZA 2B4QA 4OAQA 3ICPA 3DR3A 1EE2A 4L4SA 3TNLA 4XCVA 3HN7A 1N7HA 3GDOA 1U8XX 4XDZA 3RFXA 5L53A 1HTBA 2W2KA 3BMOA 4BO5A 1OC2A 4CV1A 5A1TA 5LCXA 1OFGA 4FOSA 4DTIA 1ZSYA 1PJSA 5CDGA 1U7HA 5BSFA 3QHAA 3OJFA 1GDHA 4BO0A 4KUHA 4K28A 1WW8A 1A9YA 1HYHA 1O5IA 4YT4A 2OP0A 1U9JA 1EMDA 2ZQYA 4Q3EA 3GEMA 2RCYA 1IY8A 4R9SA 1S6YA 1ZK3A 3IP3A 2QZ9A 3JYQA 2JCXA 3PJEA 5IDYA 5BR7A 4RQTA 1K3TA 3I6IA 1LTHR 5ICMA 3L6OO 4RVSA 4YJDA 3RSHA 4GKBA 4PZCA 4CLOB 4R69A 2H6EA 5KVVA 1ZO8A 4TVOA 1A7KA 3M1LA 4FFPA 4YRBA 1YBMA 4LGVA 2IEDA 3VZRA 1P1KA 2QRKA 2X0JA 3BTOA 4TSKA 3GNTA 1KEVA 2AG8A 3ZHZA 1JWBB 5CG2A 4B3HA 3DTYA 3JQFC 3GZNB 4B7UA 4JROA 1A9ZA 1KVRA 1SNYA 3RKUA 4L73A 4NZ9A 1T2DA 1UZNA 1YDEA 1Y9AA 4CMJA 2JFFA 4BHTA 3JD2A 5JCXA 2WD7B 2V6MA 3BMQB 3L4BA 2GN4A 2J6IA 3TL3A 4YDRA 3GN1A 1C1XA 1UJMA 4JJFA 4OYRA 2GZ3A 2XAAA 3O8QB 4YA6A 3VPSA 2EP7A 1R37A 4J91A 4N5MA 3DBRB 3ZWVA 2ZTMA 4HKTA 4TRJA 2W90A 2H63A 4MVJH 3QRWA 1V6AA 2EGHA 3F47A 4R1TA 1QYVA 4P38A 4IZIA 4F45A 2DPGA 1YS4A 4TKMA 3GT0A 5A5EA 3KVOA 1B8UA 4HFNA 3I23A 2TMDA 4CMIA 4OM8A 4CV3A 2EKPA 1T24A 4XWYA 4YB8A 1DO8A 3ITKA 1AHHA 1P45A 2UDPA 1N9GA 3VH1A 3SEFA 2Q4EA 2XOXA 1G1AA 1NVTA 1SO8A 4H7PA 4I9UA 4CJXA 1B0AA 1JU9A 1R66A 4CQLA 2R2GA 3UCXA 2FHSA 4FS3A 1ISFA 4PLCA 3AY7A 5A9SA 1LEHA 2DAPA 3A14A 2DQ4A 3C1TA 1GZ4A 2GDZA 3VOSA 3QWIA 1VL0A 4QEDA 3BZUA 3RIHA 4BGIA 4BL5A 2PGJA 4E13A 2FN7A 3V2UA 1J6UA 2FWMX 4GMFA 3BTSA 4DPKA 1U5AA 4YRAA 3HHPA 1GYPA 4MO2A 3UKOA 3JQ9A 2I3GA 5DDIP 4BV8A 4ZD6A 4CM8B 4EYEA 1J4AA 1ADGA 2ZB7A 3K8ZA 1X7GA 4BNLA 3ZZNA 3FR8A 1HE5A 1P1HA 3OEYA 4GL4A 4WUVA 5L3ZA 1KVQA 1SEPA 3ETGA 3PDJA 2WD8A 1X0VA 4PZDA 3KEQA 1MC4A 3PFWO 3RUDA 4PLGA 4QFCA 4MKRA 4UAGA 3ZDFA 1XYGA 3C7DB 3NTQA 1GUYA 4CMEC 2VUUA 4FW8A 3INTA 4IJVA 3FI9A 2ZK7A 1HRDA 1TT5B 5B37A 4BKPA 4Z9FA 1Y6JA 1XHLA 4JIGA 3BXXA 5TLSA 2C7VA 4J4TA 5JY1A 1BSVA 5CAEA 3PZRA 2HK7A 2D5AA 4RF4A 3MJ4A 1DIBA 1HF3A 1VSUA 1A27A 3DQPA 3NRCA 2NVBA 3UCFA 3GVHA 4NDNE 3PYLA 3RFTA 3EMKA 4YAKA 3VKVA 3DHYA 2HU2A 1UDAA 3IL2A 1KVTA 2AMFA 4PCVA 3I9NA 1H6BA 3W4JA 1E3LA 1HDGO 1M76A 2C5AA 3TZHA 1LDMA 1RYDA 2ZTUA 4U6SA 1WPQA 3NYWA 4H3VA 4FFLA 1MFZA 4J2OA 1F8FA 3WJ7A 1Z45A 4XJSA 4U0JA 1I2CA 3WJAA 4A2CA 3AY6A 2X58A 3JQ7A 3RROA 1MXHA 2VT3A 3V1UA 4EI2A 1EZ4A 2PD4A 2ET6A 2FPPA 4AJEA 4RO0A 1U2GA 2PD3A 3WYCA 3IQDB 2V65A 4UVGA 4W9NA 1LC3A 3HFGA 3UGKA 4LRTB 5JCJA 4CMAA 2VYND 3UUWA 2Y1OA 1I5RA 5TJHA 1XCBA 3SXPA 1JN0A 2GASA 2C0CA 1Y9EA 4J3FA 3CTMA 1E77A 4BO4A 2OFPA 2BF7A 2F00A 1O94A 3WMWA 3OIFA 4A10A 3G1UA 1SC6A 4B4UA 4D44A 3VAZA 4IM7A 2Q99A 1BW9B 2AQHA 3FBTA 1JDJA 2NU7A 3NGXA 4WASA 3ZWAA 2VOJA 3GEDA 3UVEA 3WOHA 1E3JA 1PTJA 2QQ5A 3RKRA 2WYWA 3NDJA 4YAGA 1VKNA 2HMVA 2VWPA 2X9GA 4Q3AA 3DHEA 4YJHB 1GYRA 4JLWA 3TZQA 1N2SA 1ZXBA 3TQHA 4PG7A 4IGFA 1HDOA 1FDSA 3BMNB 4KQWA 4Q39A 3FR7A 4WOJA 4MINA 1P9LA 3MJTA 4BQRA 1BXGA 5DCUA 2V7PA 4GLOA 1YJ8A 3SBOA 3ADPA 2QG4A 4EITA 4ZRNA 5T57A 3RBZA 1R6DA 3PXXA 1PJLA 4E5NA 2CMDA 4O6VA 3ZU2A 4DQVA 1CWUA 3BMCA 4Z9YA 1YOVA 3C3XA 4HFMA 2PH5A 4RZIA 4U0KA 5DBGA 1LA2A 2X0NA 4UVEA 3JCZA 2GR9A 1Y8QA 1QKIA 5I9NA 4QX6A 2NM0A 4BNNA 5JMPA 1GQQA 4FFMA 4LVCA 4CLXA 1J49A 4DBVO 3QWFA 1VL6A 3WIEA 2GUGA 1A5ZA 5JO9A 1M2WA 1VM6A 2C5EA 3FRJA 3NKLA 2P68A 3QY9A 4GX0A 2PZLA 5F1OA 5DCWA 4DVJA 1ID1A 4W82A 3RC9A 3R1IA 1IZ9A 1HDXA 4B7CA 2YUTA 1EQ2A 2GGSA 1UXIA 4A5OA 1LSUA 3C7CB 1PGQA 5C3MA 4HBGA 1YB1A 1E7WA 3GA0A 5I7FA 5ITVA 4UUNA 1QLHA 4U5QA 2P5YA 5I7EA 2V6GA 2RBEA 4DWVA 5COBA 3VVBA 4DC0A 4E2YA 4WCDA 4R3WA 1U1IA 5JYEA 5EJ2A 2AQKA 3R6DA 4R41A 1FF9A 4GX2A 3QSGA 2X9NA 4PG8A 2GZ1A 1ISJA 3CEAA 5EIOA 5KJFA 1XWFA 3VPHA 2GERA 1PL6A 1ZH8A 3RASA 4ZN6A 1ZVMA 4FC7A 4OQYA 1QP8A 2VRCD 5DNAA 3ZV6A 2UUOA 2DBRA 4QXMA 5BT9A 3TFOA 2P5UA 1I36A 2O7QA 3PWKA 3NT4A 4ID9A 3F4LA 1KEPA 3ZV4A 1KVUA 3RVDA 4D79A 3IDSA 2Y66A 2QX7A 3L4BC 3PHHA 4HV4A 2GLXA 4BGEA 3HZZA 3JQ8A 3S8MA 2YY7A 4AJ1A 2GNAA 4D45A 4W4TA 4OL9A 2VN8A 3WMXA 4PLFA 4D0RA 1YBVA 1I33A 4JBGA 2H9IA 1UR5A 3C8MA 4BB5A 1TB4A 1PS8A 4YTEA 1T2FA 5B12A 1SBYA 2VT2A 3HE3A 4OKNA 3DZJA 2PZJA 4NJOA 2CF6A 3KOUA 2ZATA 4CMGA 4N5LA 2B5VA 1PQWA 4MDHA 2PH3A 5KVSA 2CDCA 2Q50A 1GFSA 3WGTA 3OMLA 4PIVA 3R3SA 4GH5A 1OMOA 5COAA 2XXJA 1HLPA 2PY6A 5I8ZA 1W0CA 2O50A 3E48A 1WDLA 3W6UA 1E3WB 1GCOA 2VZ0A 2DT5A 2C54A 1M67A 3LC7O 4E32A 1I8TA 3GG9A 1WDKA 2ILTA 3JQAA 8LDHA 1NXQA 1X1EA 2X9VA 3COSA 3K31A 3G1TA 3DC2A 1A71A 4I08A 3U4IA 4KDFA 4CMIB 4RVGA 5CEJA 5FEUA 4IJKA 2BFPA 2JHFA 3JQ9C 2HK8A 4M86A 2EW2A 4C7JA 4R16A 4Y6RA 4B7XA 3OJLA 2TMGA 4NK5A 2J8ZA 2ZYAA 1E92A 2XXBA 3ZNPA 4BNTA 1R4MA 2VWQA 4J6FA 4J0FA 2A4KA 3RJ9A 4FJ0A 3D4OA 1FK8A 2QYSA 2VOEA 3RUHA 1N92A 3KBOA 2X8LA 1QLJA 1YO6A 1BDMA 3E9QA 3SLGA 4JJIA 1QSGA 3FTNA 3NX4A 5TNXA 1T1SA 3F1KA 3HSKA 3OIDA 3DZHA 3F3SA 1B8VA 4BNFA 1SCUA 4M87A 5IXSA 1E3IA 2Q4BA 4PLYA 3AUUA 4LMRA 1IE3A 4JQCA 1HDCA 4D43A 1N8KA 1N5DA 4Y8VA 9LDBA 2PTGA 2X5JO 1QMGA 1D8AA 2G17A 4IQGA 1VC2A 2G82A 3GMDA 1TT7A 1QORA 3VDQA 2ZYGA 4MPDA 3TOXA 4JK3A 3B20A 4EUHA 1JKJA 2DTEA 1K6XA 2FR0A 1PZEA 4UUOA 2HO5A 5K9ZA 2D8AA 2GCGA 5B4UA 2UV8A 1NQOA 4XIJA 4BNXA 4MKXA 3AM5A 2NSDA 3NGLA 4QO7A 2WEKA 3DBLA 2PZMA 1JW9B 4W9NC 4INAA 3OJOA 4IJUA 1HETA 1SB8A 1SZJG 1YB5A 1SMKA 4IS3A 1NQ5A 4RVFA 4FJ2A 2P91A 1GR0A 1I0ZA 2EF1A 3KZVA 4E5MA 4R5HA 3IOYA 4XR4A 4B4WA 3U4CA 2VUTA 4GSKA 2PK3A 4YQYA 1CF2O 1GV1A 4D3SA 4Y67A 4WCFA 3ASUA 3ZU3A 5L7TA 1LXCA 3BHMA 3EC7A 2EKQA 3RU9A 1E7MA 4BNYA 4A73A 1VJ1A 2G0TA 1VSVA 4FFOA 1ZK4A 1R0KA 1PS9A 1P3DA 5ITWA 3BA1A 4Z9XA 1GAEO 1PGJA 4HY3A 2EIHA 4DBZA 4UVIA 1CDOA 3Q11A 1ZK1A 3MCVA 3RUIA 3DMTA 3I3OA 1P31A 4JP2A 4KP7A 4D3DA 4MVJA 1EQUA 4NBUA 4F6CA 1E6UA 4S3MA 1Z7BA 3DFZA 3W1VA 2A35A 3VKUA 5JCJD 3M2TA 1IOLA 1LDBA 4N54A 4CM4B 3FNHA 3PGJA 1LLDA 4L75A 4RLHA 1W6UA 1HYEA 1D1TA 2VHVA 1E1NA 4BB6A 2IZ1A 1ISIA 4A0SA 1CYDA 2A92A 4OHUA 1Q0QA 4NIMA 1R16A 5GZ3A 4IY1A 4FC6A 3JQGA 3E03A 3AOGA 4XA8A 4XYGA 3WR5A 4NBWA 1ONPA 4NFSA 1B15A 5U1PA 2AW5A 3V8BA 4WJZA 5CDYA 5TQVA 4ND5A 1L1FA 1DIRA 3KXDA 5MGBA 4XR9A 4ILKA 2NU9A 1AE1A 2EERA 3IS3A 5ENDA 2Y1GA 2NVUA 2RHCA 3F5QA 4RORA 2SCUA 4ZU3A 1DFHA 4OXYA 1OC4A 5JDIA 4DIFA 2UUPA 5COQA 4KWHA 1JAYA 2HMSA 1T4DA 5CEEA 3DZBA 4MOWA 3K96A 3T7EA 4MVJP 1KERA 5L4NA 5HTOA 1RWBA 2ZB8A 3JQCA 3K73O 1NYTA 3DO5A 4MP6A 4WOKA 1YONA 3HG7A 3NDIA 3ZNNA 3EZLA 3PTZA 4E3ZA 1DRWA 3GF4A 4HP8A 3RUEA 5CPBA 1PR3A 2HAEA 1C1DB 5F5NA 5JBIA 3VVCA 2WTBA 2D3TA 5A06A 3QW2A 4NU5A 3I6QA 3GHYA 4GI2A 5AXAA 3VTZA 4EBFA 1DHRA 1DHTA 3KB6A 4RVHA 2AEFA 1U4SA 2RHRA 4RZHA 1G0NA 1MB4A 1ONNA 4M1QA 3WICA 2OUIA 3WDSA 4DIOA 2NTNA 1P74A 3FF4A 3ANLA 3WB9A 2O4UX 1H9AA 3O03A 5DZSA 1HSZA 2OBNA 1Z7EA 3I4CA 3INGA 4WGGA 2HJRA 2FY8A 4ND3A 4LN1A 1PJ2A 1NP3A 3BIOA 4IDEA 2YHIA 2VNSA 1YGYA 3AFNA 1YBAA 3MJEA 3OQBA 3KO8A 4LCJA 4H16A 5FYDA 5A5FA 2JHGA 4YAIA 2FR8A 3KSUA 4LRSB 3Q2KA 3MWEB 3WGOA 3EYWA 2Z1NA 1Y8RB 4CM9A 3X2FA 4WE3A 3PJGA 3AFMA 3CZRA 4MIOA 1QV6A 1JQBA 3OECA 4U7WA 1ZCJA 5JFOA 3A28A 4YWJA 1LDGA 2JD2A 2ZB4A 3D0OA 3FNGA 2CDAA 1FMCA 2PKRA 1B14A 3MTGA 1DRVA 2OBYA 4XYLA 3AI2A 2V6FA 1EVYA 4E5PA 1X13A 2ZTVA 3QE3A 3QA9A 2PGDA 4BMSA 1VPDA 4GBJA 5TT0A 4PVCA 3RC7A 2BD0A 3PQFA 1DC3A 3CMCO 4U6QA 3VPFA 4WECA 1C0IA 4DQXA 4BGVA 4DYDA 3AK4A 1LRJA 2GN8A 3PIDA 3KYCB 2QIOA 2YDYA 3UXYA 4IDGA 3PYXA 1X7HA 3PIIA 1GEGA 1IYZA 4YQZA 3Q2IA 3K92A 3D1LA 3QIVA 4CPDA 4DREA 4CV2A 5L9AA 4GAEA 1YJQA 5JPIA 4ESOA 2Z1MA 3GNSA 3LC1O 1B7GO 3U3XA 1XU7A 4ROSA 4L4RA 1HE3A 1F14A 1UXJA 1AXGA 2UVDA 2ZCVA 3TN7A 1QYCA 2JL1A 3VH2A 1LSOA 3VPGA 2FMUA 4U8GA 1JVBA 3KYDA 3I83A 4XQCA 4PN3A 5GZ6A 2WWRA 3I9KA 1JAXA 1K6IA 1B3BA 3WS7A 1N7GA 4CM3A 4B3JA 1T2AA 4R54A 2X5OA 2GRAA 2Y1FA 2O3QA 3H9EO 5L7YA 3JD0A 5T67A 2FSSA 4Q3CA 2OXIA 2BFMA 2BKAA 3SJ7A 2D1YA 4CUZA 3U5TA 3ZWCA 2JD1A 5CDSA 1JVSA 3TJRA 3WYEA 4AL4A 3VHRA 5JMWA 1QV7A 4HXYA 1P1IA 3BTVA 4MVJF 2B36A 4MVJM 1BXKA 1NPDA 1QXSA 1VJTA 3QV1A 1Q0HA 5CEFA 3FTPA 1BRMA 2C82A 1I3NA 1ENYA 2AE2A 2WJPA 1Y5RA 4ALNA 2VWHA 4A26A 1FDWA 1DC6A 3L9WA 1PR9A 5LC1A 4DLAA 3W8EA 1Z82A 2CY0A 4WLVA 3DZFA 2I9PA 4I9NA 3WTBA 5KKCA 4Z0HO 3VTFA 3OHSX 5I7VA 3PJFA 4J0EA 5L4LA 1LNQA 5LDGA 3NAQA 1M75A 2VTEA 3E5RA 2VUSA 3WG9A 3IUSA 2NADA 3B6ZA 3G0OA 1LLUA 3OH8A 3QVXA 1V35A 3U9LA 4Z0TA 1GD1O 4KZPA 3OFSA 5G0WA 5BNTA 1GUFA 3ZCXA 3BTUA 5BNIA 2FZEA 3A1NA 4YEDA 4CUKA 5TS3A 1MG5A 1RKXA 4M54A 2O2SA 1O0SA 1GL3A 4WCFC 3EDMA 5DT9A 3CZMA 4M89A 1CERA 4MVJE 1NWCA 4UEOA 1ZSVA 4WK6A 5DN9A 4IXTA 1BTOA 4O63O 4BKQA 2YQ4A 3E9NA 3DWFA 5I9MA 4KWIA 4EJMA 4TVBA 3N7UA 4NJMA 3CE6A 4CM5A 3PGXA 2JCYA 3AJRA 4JCOA 3E8XA 4QECA 4MP3A 3RJ5A 1NR7A 4ALLA 2HK9A 3KYBA 1IB6A 3DMTC 1H5QA 2PFGA 3FSRA 4JGBA 1R0SA 3Q6IA 3GH3A 5J23A 3ANNA 4RDIA 5G2OA 4RLSA 3GNQA 2PNFA 1HDRA 4XYMA 3TRIA 4ALJA 3RC2A 2FOIA 2VCYA 4WCFB 4JBIA 4ZICA 3AM4A 2QYTA 3EHEA 4RPKA 5JAZA 3BHJA 5H81A 3TZKA 2ZJ1A 4FN4A 4WEOA 1DC5A 1KC1A 4WPGA 1PQPA 4K26A 1H0KA 4K6CA 4CMBA 4DL9A 2CSUA 3L07A 3LF1A 1DJNA 1C0LA 1PIWA 2AXQA 4IUYA 4PGFA 4P22A 2AQIA 3QWBA 5DULA 3LLSA 4DYVA 3HJAA 5L40A 2B4TO 2CVZA 4GWKA 4IINA 4KUGA 4Q3BA 3PVZA 4NH4A 4TRMA 2CD9A 1YQDA 4P8RA 3E18A 1XR3A 1HL3A 5TGDA 1SEVA 2AA3A 1NPTO 4NU6A 4J7CA 5EPOA 4MVJD 4BNJA 2OL4A 3H6KA 2AQ8A 4GMGA 5K6AC 1Q0LA 4J4BA 1D3AA 3I5MA 3WSWA 1UDCA 4RJTA 5JDIC 1YL7A 3IP1A 5JAQA 1KY5A 1E1LA 5T6BA 4YYZA 5ILOA 1JKFA 2C20A 2LDXA 3H9JA 4YJGA 1H9BA 1JWAB 3ADOA 3LSYA 3ZU5A 4J90A 1MX3A 4OXKA 2IODA 2P9EA 3PQEA 1XDWA 2IXBA 4XEHA 4O0LA 1YWGO 2FPGA 3JQDA 5L51A 5CDUA 3RBVA 5JY6A 2AG5A 2G76A 1B26A 4FDAA 4CQMA 1RPNA 4BS9A 3ANMA 3KSDO 4IZHA 5G4KA 3FWNA 2R6JA 1PJTA 1E1KA 4R01A 4J4HA 1ULUA 3H2SA 1E7QA 2GN9A 2Y1CA 4MVJG 2C7GA 4ND2A 3GEGA 5JE8A 4PFJA 4B4OA 3A4VA 1RJWA 4QUKA 3PDUA 2Q3EA 4DXHA 2IZZA 3H5RA 4KTVE 4IS2A 3D5QA 1U3UA 2QRJA 3I4FA 4W7HA 4BKOA 3IC5A 2A94A 3SC6A 3PHJA 1Q2XA 1BVUA 4XKJA 4AJPA 2NV6A 2W2LD 4EJ6A 2O3RA 3LT2A 3PQDA 4R68A 4BO9A 4R5MA 3DAFA 5DBIA 1E7YA 4XRRA 4YRDA 4CLRA 4DQUA 4FPXA 4FSHA 1ENZA 4AJ4A 4CM7A 1HZZA 2JCVA 1EUZA 3B1KA 1R15A 4CR6A 4OOEA 1DDOA 4BNKA 2G1UA 5I7SA 2J3JA 4CV0A 3VH3A 3ROQA 4CL3A 5KJCA 2A9FA 1LSSA 2FZWA 5TC4A 4P4LA 1W73A 4B3IA 3GHHA 3WQSB 3GAZA 1V0JA 2Q46A 1WWKA 1W4ZA 2X7HA 2DTXA 3DBHA 2O2YA 2VWGA 5IXYA 2I76A 3MWDB 4XGIA 2B83A 4S1VA 2GPTA 2WMDA 1PZHA 2W2KB 3BMOB 5C5IA 5I8WA 1PEDA 1E6EA 1LRLA 1U3WA 2E48A 4RPJA 4NNJA 1B16A 4E2WA 4ZJUA 1T2EA 3EGOA 4ZA2A 2D2IA 3LZ6A 3S1LA 3EVTA 4CM9D 3GVIA 4OQZA 4PVDA 3HADA 1UXHA 4R1UA 2B0JA 3FN4A 3UAGA 1I10A 1DB3A 4GX5A 1NASA 1XU9A 3CINA 4I5EA 4A03A 2Y67A 3GUCA 3GY0A 5EESA 4EDFA 1KC3A 5JC1A 3CXRA 1V3VA 4H15A 3VZQA 3JQ6A 4PZEA 5H82A 1EBFA 4ZVVA 3V1YA 4EJ0A 2B5WA 3GAFA 2O48X 4D3FA 3NJ8A 1EVIA 1QYWA 2PGLA 3IUPA 1UUFA 2HJSA 3L6DA 2DFDA 2DTDA 3S2IA 5IJZA 5DOVA 2GN6A 2CVOA 3OICA 4IDDA 1LDNA 3CIFA 5HRUA 3AY3A 4QFDA 4BNVA 1U28A 3MJCA 4EUEA 2RAFA 2BRUA 1VKOA 1H2HA 1ORRA 4NQZA 4CUJA 4PLPA 3W8FA 4BNUA 4UUPA 4LSWA 1LI4A 3GC6A 1C1XB 4XDYA 4DIBA 4ND1A 4K9DA 3KUXA 3KTDA 3MOGA 3PK0A 1PWXA 4PG4A 3TF5A 4TWRA 4PG6A 2EW8A 3CKYA 4AJ2A 4CLOA 1I2ZA 1I3LA 3JD1A 4BNHA 3ZWPA 1PZFA 5BNFA 1HT0A 1AXEA 3KLPX 3WWZA 2R00A 3GRKA 2HKIA 4QT0A 2YW9A 5A4DA 5IF3A 1DBVO 1MV8A 2XF8A 4BNIA 3OETA 1VLLA 4YR9A 3GFBA 3P19A 3EK2A 4KOAA 4NHEA 1N9GB 3QVTA 1PJBA 3PEFA 3GZNA 1IZ0A 3P5SA 5A9TA 1F17A 1M66A 4BO2A 1ZMOA 2PD6A 3ZW9A 4G2NA 1V9LA 1MGOA 4CQLB 2WD7A 3V2GA 3BMQA 3UFXA 1Q7GA 2XPCA 5A3JA 2HQ1A 2ZJ0A 3E1KA 4IDBA 5A9SB 3DONA 3NEPX 3JSAA 1F12A 3HN2A 3DBRA 3GG2A 2DUUA 3D4NA 2EWMA 3ROPA 4DPMA 3QVSA 3TFQA 1ADCA 1FDVA 3JD3A 3MZ0A 4WLFA 5H83A 4W7IA 1EVJA 3GLQA 4CM6A 3ZH2A 1E5LA 3F1LA 5HM8A 2UAGA 1MFPA 5EERA 3F46A 1X15A 1X7DA 3OJEA 2EJWA 1ISGA 1XEAA 1LJ8A 1EFLA 2JFHA 3NV9A 4G5HA 3ZWXA 5IDXA 3GK3A 1H94A 5AOVA 4MP8A 4NJMB 4XRGA 3NUGA 3JQBA 2IEBA 3W6ZA 3OP4A 3GGOA 1P0CA 2E4AA 3QJ5A 3B70A 2HMUA 4BIIA 4GX1A 4TKLA 1K5HA 1WAMA 3UICA 3DAGA 2H5LA 2QHXA 4IGEA 4CMCA 1FDTA 5KJ6A 2O3SA 4GVXA 1MC5A 5AVOA 1FJHA 4RVDA 5KJEA 3FNFA 1LSJA 4CM8A 1OAAA 1LUAA 4Y9DA 1NWHA 1PGNA 4GGPA 3DHNA 3CMMA 3FPCA 2O4CA 1E1MA 1WNTA 3HDYA 1LLQA 3I52A 3RCBA 4IJWA 3PWZA 3HB4X 3DOOA 1O89A 3LVFO 1U3TA 3QVOA 2J3IA 3DOCA 3D5TA 4AICA 5IZCA 1KEWA 1A7AA 1K2WA 3JQ7B 4EEXA 1PU2A 2PKQP 1TT5A 2BH9A 3DXFA 5ES3A 1PGOA 3G49A 3L4SO 2IDZA 4A7PA 4LVUA 1DSSG 4QSMA 1QYXA 4O5OA 3GUYA 2DBZA 2Y0EA 3WNQA 2P4HX 5MDHA 1HXHA 2DC1A 3WFIA 3LQFA 1XSEA 3OEWA 3WFJA 3ZWNA 3G17A 1IL0A 4XQEA 1E7RA 1N1EA 4BMVA 5KKAA 4E12A 1EUCA 1P1FA 4CLEA 4NFHA 1ZJYA 4PG5A 1C0KA 4F3YA 2Y0CA 5IN4A 1FXSA 3HFSA 4BNZA 5THQA 2GSDA 3N74A 4E30A 2D0IA 4YJGB 4J1TA 5KWEA 5A04A 1VJ0A 3K30A 3CH6A 3TDKA 1BXZA 2HRZA 1ADFA 1J5PA 5B4TA 3OM9A 2X4GA 2Y93A 3WGQA 5ENVA 1DOHA 3NTOA 5AXDA 5EQDA 2WYVA 3U4HA 3TZ6A 1E6WA 3ULKA 5HWSA 3O4RA 1WZIA 2UYYA 1BXGB 3H3JA 4DLLA 3GFGA 4E2XA 4HX5A 4BUCA 4J49A 1KBZA 4G65A 1I2BA 2VZ9A 4OKIA 3TPCA 1MXFA 1V3TA 2X0RA 2PLAA 2QRLA 3BMCB 1BW9A 1ISMA 5F3RA 1VI2A 1YOVB 2AHRA 1CJCA 2YDXA 3H65A 1NX6A 2X1HA 2NQTA 2EXXA 2NLOA 2Q2QA 3H4VA 4YVFA 4BV9A 2GYYA 4W99A 4HUJA 5IFLA 2F1KA 3QWHA 3BYZA 1Y8QB 2Z5LA 1CETA 1KOLA 4BQPA 4ALIA 5F21A 1UP7A 3P2YA 3S2EA 3FWZA 1ZMTA 3JYNA 4I1IA 4JN6B 3W4IA 1NR1A 3V1TC 1UH5A 3ABIA 3O26A 2J3HA 3ZHBA 3IKTA 3QWAA 1XLTA 4FQ8A 3H8VA 3OA0A 5T8KA 5IDWA 2NU8A 5ADHA 1ADBA 1ISHA 1T1RA 1NBOA 1NFQA 2X23A 2IRWA 2NTVA 3G3EA 1ENPA 3Q9NA 4E31A 3ZHXA 2P2SA 2BELA 3OJ0A 3ST7A 2DPHA 4XX0A 4C7KA 5B4VA 3PPIA 4ZQBA 2NUAA 3GPIA 3DL2A 1RM4A 1I01A 1GYQA 2OP1A 3DTTA 1H93A 3OSUA 3P2OA 1KETA 4O1MA 4YJFA 5I9LA 3O9ZA 1P1RA 4IPTA 1K6JA 3F6YA 1NHGA 1ZUD1 2C29D 2VZ8A 5THKA 4Y6PA 5AYVA 5HS4A 4KTTE 3GDFA 3Q9UA 4J1NA 1G6KA 3KV3O 1P1JA 2J5RA 4GQAA 5ER9A 1SPXA 1GPDG 2E49A 3UHAA 1UP6A 4N5NA 4OMUA 1LDEA 4UULA 1BGVA 2DUWA 1WVGA 4NK4A 3AUSA 4OSPA 4QQRA 1GZ3A 1KEUA 4BO3A 1P0FA 4DRYA 1ZNQO 3C7AA 3EZYA 4II3A 1GY8A 5A03A 1YXMA 3I9JA 3TL2A 1LRKA 4B8ZA 3WSVA 2YZ7A 3JQ8B 1LX6A 3B1JA 4IMRA 2AE1A 4RPLA 3SLKA 2C2XA 3OBBA 1DLIA 2CF5A 3ETDA 2VNAA 1I24A 6LDHA 1YL5A 3GDGA 2VRCA 4GSLA 4XGNA 4FGWA 3I9LA 1U2DA 1QRRA 1B2LA 2CNBA 5KNLA 1I30A 4IQ8A 2R00C 3VPXA 2EG9A 3RBXA 4WNCA 2OGUA 3ROKA 3UW3A 4RF2A 1PS0A 4URFA 4YAEA 1TA4A 3SC4A 5G0VA 3ZV5A 2NQ8A 2Z95A 1YE3A 2AEJA 4CR7A 4GWGA 1PJQA 2ZB3A 3TOZA 1GQ2A 4Q9NA 1YRLA 3VH4A 4E2ZA 4AJKA 3E5MA 2CVQA 1DC4A 2C2YA 3HDQA 1ONOA 4OSOA 1M6HA 4NG5A 3TZCA 3ONEA 3UOGA 1T4BA 4M55A 2EV9A 2G5CA 4PLZA 4LMPA 3JTMA 1WDMA 3ZWBA 3NDRA 3I1JA 3TSCA 1MA0A 4PRKA 1NFFA 2X0IA 3JQAB 2I6TA 3M1AA 4Z6KA 4J16A 4MVJI 1IULA 4I9HA 1XQ6A 3D64A 1Y7TA 1KVSA 1ZFNA 4IQ0A 4P4GA 4AJLA 3ZU4A 4EGFA 2BI8A 3AUAA 3H9GA 3T4XA 2DFVA 5CFZA 3JQAD 4PLWA 3D4PA 4DGSA 1VRWA 3PWSA 3E9MA 1XGKA 4DLBA 1NPYA 1PJCA 1KS9A 2B37A 5EQFA 4EZBA 3JV7A 1CQIA 4ZHSA 4QTZA 1GV0A 5DCYA 1R4MB 3LU1A 4NFYA 1S7CA 3AM3A 4NBVA 1BVRA 4M8SA 4E21A 5F1PA 2YFQA 4O59O 4KQXA 4BMNA 1E3WA 4HADA 5G0TA 4J9UE 1Z73A 3JQBC 4A27A 1KIFA 1B3RA 3DZGA 1R0LA 3NJ4A 1ML3A 3OQ6A 2CFCA 2Q1SA 2Q1TA 2GF2A 4FGSA 3DBVO 1V3UA 1IUKA 3RU7A 3A06A 2VYVA 1T2CA 1D7OA 3AU8A 4Y98A 5KVQA 3H2ZA 4TMFA 1Q7BA 2WYUA 3PLRA 1P33A 4CM1A 4R1NA 3WLFA 1NQAO 4J9VA 2Y1EA 1ZW1A 2WE7A 2QW8A 1P44A 3K5PA 4IXWA 5BQFA 4QO8A 4D41A 1DIGA 1I32A 2P4QA 3H3FA 3HNPA 4BNGA 3WGHA 4BO7A 3I9OA 2P9CA 4NR0A 3U4DA 2PWZA 2GO1A 1U8FO 2D5CA 4L76A 3U0BA 3MJSA 1SB9A 5IZCC 5EN4A 3KHUA 3VZSA 1C3VA 4AG3A 4HFJA 4Z3DA 1TI7A 3PYMA 1Y1PA 3DBLB 5TX7A 1GUZA 3Q1LA 3GR6A 2Q1UA 1PL7A 4LK3A 3SX2A 2HMTA 3B1FA 5L7WA 1UZLA 3INRA 1WP4A 1UAYA 2WM3A 3ZWYA 3DMYA 3NT2A 2ZIZA 1BMDA 3WX0A 4IDAA 2DBVO 1XQ1A 1M6WA 2OHXA 1E3EA 1DFIA 2E6UX 2LDBA 3DDNA 1EDZA 3VDRA 4LISA 1NVMB 2Q49A 5U9CA 4IBOA 5CG1A 3CSDA 1J0XO 1IHYA 4DUPA 4WLEA 4AJNA 4BO8A 2PZKA 1VL8A 3G79A 5AQ1A 4B8WA 1PJ3A 2I67A 2ZKLA 1JLLA 1H6DA 4Z3KA 1F06A 1QG6A 5L4SA 1XKQA 5DP1A 4BO1A 5A3VA 4ONEA 2I3AA 2IXAA 1MUUA 4B4VA 5L95A 3IMFA 4K6FA 1U5CA 1XA0A 2DM6A 3L77A 3E82A 4XB1A 1UZMA 2VHWA 3T7CA 3ZWOA 2ZQZA 5TRTA 4BKUA 3AI3A 3EW7A 1HE4A 1EFKA 3F4BA 3C24A 3ITDA 5IDQA 5TIIA 4OH1A 3UH1A 2HLPA 4K1LA 3CUKA 3WLEA 4TRNA 1LLCA 3A9WA 3Q0EA 3ZWMA 3DOJA 2BI7A 2FRDA 1A72A 3RWBA 5B1YA 1ZKMA 2I65A 3ZW8A 1DFGA 1YDWA 2C07A 1N1GA 3ZWWA 1EK6A 2CDBA 3PLNA 3LT4A 3X2EA 4CR8A 2YJZA 3MEQA 2DVMA 4XJTA 5C7LO 4YAJA 4IIVA 2JD0A 1G0OA 4YBZA 4WLNA 2E82A 4R9RA 2O3TA 3E6AA 5DBFA 3LK7A 4KUEA 3JQGB 1NQTA 3C1OA 4PLTA 3AUTA 4JBHA 3OQ1A 1BDBA 1UAGA 4I8XA 4IMPA 1K0UA 4JX8A 3AU9A 2ZCUA 3BHIA 5FI3A 3SJUA 2IZ0A 3OA2A 2EEZA 2Y05A 3IKVA 1HDYA 2PKQO 1HZJA 1ZBQA 2NVWA 5T8KC 4AJHA 1ZJZA 4E0BA 1EEHA 1EBUA 2NVUB 1WMBA 1WXDA 2X86A 4RPGA 2DU8A 4CM4A 3D7LA 4DMLA 3H9UA 5C7IO 1WLYA 1DLJA 2YHUA 3JQEA 4E33A 2EHDA 5GZ1A 1DIAA 3GOHA 4B79A 4XZ3A 2OMEA 5EMHA 1XG5A 3DZIA 2GZ2A 5GY7A 4J1SA 1UP4A 2BFOA 4MIEA 4TQGA 4CMHA 1GU7A 5IAAA 4FJ1A 5JC8A 3NT5A 4J1QA 5JNLA 5BSEA 4IDCA 1CQJA 1PSDA 7MDHA 3V2HA 4JJGA 5LDHA 1NVGA 1OZAA 4UVHA 4WLOA 4XD2A 5JYDA 3RAJA 2HSDA 2BGMA 3RD5A 4L74A 1U7TA 3LLVA 3H9QA 2HDHA 3KM0A 3JYPA 3R0IA 1D1SA 3ROMA 5JXWA 3MTJA 4F46A 4M49A 1I3MA 4XQ9A 4HFRA 4EW6A 1HKUA 3F9IA 3PJDA 4FIZA 3FD8A 1BG6A 3KRTA 2GD1O 3LT1A 1PJ4A 4FCCA 4J7XA 3O38A 3S55A 5K0ZA 3WIDA 4YJFB 4YT5A 2HRBA 1EK5A 4EUFA 3QQPA 3QVWA 5CHEA 5CP8A 5JDCA 5EINA 4ZGWA 1LC0A 4UVDA 4YT8A 3JD4A 1H6CA 2HUNA 1BHSA 2JAPA 2YHIB 5IZ4A 4NBRA 2JKVA 2DBQA 5C37A 3HQ4O 2O3UA 3HWRA 1HLDA 2B35A 4MIYA 5T5QA 4CODB 4G81A 2B69A 1GTMA 1KYQA 5L45A 5JSFA 4W6ZA 1GQYA 1C1DA 5JS6A 3HDJA 4RPHA 3RFVA 5KCZA 2BHLA 4XYBA 1EE9A 2YV3A 4GPD1 1OOEA 1P77A 1ZEJA 1R4NA 3FHLA 4ZQHA 2Y99A 2X5KO 1YQXA 5ER6A 4F6LA 2VHYA 3ETEA 3JYLA 4N7RA 4AFNA 1O95A 3WWYA 3EVNA 4XQGA 5A9RA 2V6BA 2WDZA 3EAGA 3U09A 3D3WA 3R3JA 3D3EA 4HNGA 3ZNOA 1QYDA 4L0QA 1U3VA 5JAIA 1V8BA 4RL6A 2VQ3A 3ON5A 3RUFA 4D46A 2OZPA 1MG0A 1AN9A 3HDHA 4LW8A 4AJOA 1DPGA 1ZIDA 2Q1WA 5GMOA 4PRLA 2W98A 2H1SA 2YV1A 3K2EA 3PFFA 2Q45A 5BSHA 2O23A 3WXBA 1W8DA 3Q3CA 2VRBA 2FP4A 3K6JA 1AUPA 4ND4A 3F5SA 1HWYA 2I5PO 5F5LA 5AXCA 4RF5A 1UDBA 3AOEA 2I66A 1Y8RA 4FD3A 1D4FA 1PX0A 4L9RA 2E37A 4ZRMA 3ZGYA 4C4OA 3ZI0A 2YQ5A 1MLDA 3ICCA 4TROA 5C7OO 2OO5A 4I5GA 1AHIA 1WZEA 3LF2A 1DIHA 4J2HA 1VE9A 3STHA 2HCTA 3FNEA 5KVCA 3KYDB 1JTVA 3IIEA 3VZPA 3WGGA 1NAHA 1O6ZA 1SOWA 4NMHA 3PP8A 1GCUA 4AJJA 4E4YA 2JJYA 1U4OA 5JLAA 3UF0A 4E6PA 1YKFA 3EY4A 1KY4A 1PQUA 3KYCA 1ARZA 1SAYA 4RVUA 4D7AA 1C14A 1NNUA 1TLTA 1A4IA 2Y68A 4IDFA 4Q3NA 1I3KA 1YQGA 4GVLA 4WKGA 4FBGA 4II2A 4WNIA 3RUCA 4YCAA 4KDEA 4R1SA 4EEZA 5T64A 3PHGA 4JXKA 4Y6SA 3WTCA 2Q2WA 3QP9A 9LDTA 4L8VA 3ZNQA 3JYOA 2PV7A 2Y0DA 3S2FA 4DA9A 3GMSA 7ADHA 2QZZA 1Z75A 4ZQEA 1JKIA 3L0DA 3ASVA 4MJLA 2BGLA 1RM5A 4Q3DA 2VTDA 2YFHA 1NAIA 4OJNA 3O8QA 4J43A 3WQRA 4BGUA 4BNMA 4GLLA 3WGIA 2AEMA 1ZSNA 4OIMA 5A05A 4ITUA 1T25A 4GKVA 5AXBA 5KOIA 5DOZA 2VYVD 2FPIA 4FFRA 1NFRA 3DFUA 2Q2VA 3H5AA 3DB2A 2W8ZA 4XB2A 1EDOA 3C85A 4I5DA 5TSDA 4BKRA 5BSGA 5U4QA 3SVTA 4BOYA 1K89A 3JQFA 5JO0A 6ADHA 5G0UA 1RM0A 1QR6A 3H7AA 1Z74A 3S2GA 2WSBA 1IPEA 4YT2A 1DRUA 4YACA 1LQTA 3GVCA 3HUDA 2BGKA 1ZK2A 2J5KA 3BAZA 3PRJA 4NBTA 4JNKA 3LC2O 4RDHA 4OXNA 1GPJA 4CL8A 1CIVA 1GADO 1ZEMA 2EP5A 4FB5A 4X54A 1NM5A 3VC7A 4WLUA 5ICSA 4FFNA 3AI1A 3PHIA 3GVPA 3M2PA 4BNWA 4HNHA 4YPOA 5KJ1A 5FWNA 2IYOA 4E5KA 2JFGA 3ONDA 3AW9A 3KETA 2J5QA 3OF2A 2WE8A 2HMWA 3FBGA 4AVYA 2J3KA 3ONFA 1ZXLA 5HA5A 1RYEA 1DJQA 4YXFA 2OORA 1E3SA 4UEJA 5CPFA 2O3JA 2CUKA 1HE2A 4UREA 3FPLA 3U62A 2IE0A 4GGOA 4N18A 1X14A 4ZQFA 2VHZA 4TRRA 5IN5A 4BVAA 4TZKA 1TXGA 3AWDA 3ZHYA 3DZKA 1CRWG 1XIVA 1EVZA 1YH3A 1IPFA 1X0XA 1X1TA 3IJRA 1R12A 3U49A 2ZTLA 2X6TA 3PZBA 2O7SA 1T26A 2PR2A 3MOIA 4RF3A 4Z0PA 5TJ9A 5DP2A 4FR5A 3KSZO 2B4RO 4IIUA 4XYEA 3QLJA 2RIRA 4TZTA 5HBRA 2W4QA 2JAHA 3RC1A 3L9XA 3HB5X 1LU9A 2VHXA 2RH8A 3TWOA 1SOVA 4P4NA 3V5NA 3WNVA 1GEEA 2POQX 4JP3A 4RV9A 1DAPA 1NTOA 4DMMA 4R51A 4R4JA 4CMEA 5CDTA 3LT0A 4WEQA 1BWSA 1L7DA 1DXYA 4UUMA 1Y81A 4J7UA 3L6EA 3WQQA 3FCOA 1JA9A 4CLDA 2NWQA 3GQVA 3LYLA 3P7MA 2NACA 1YVEI 3WBBA 3ZV3A 2VYNA 4LCEA 1DAOA 4DPLA 1LDYA 5FFFA 2EKLA 2YV2A 2EJVA 1DEHA 3T4EA 3UCEA 3K2BA 5ILGA 4CQMB 3DEYX 4I5FA 3IJPA 1HSOA 4BO6A 1ZK0A 2YYYA 5G4KB
chains in the Genus database with same CATH superfamily
5LZ7A 1MAVA 3H0KA 4KODA 4MGHA 5ALPA 2CD7A 2O2CA 2YWCA 1LBEA 4Q9JA 1H8ED 4YMGA 1FJGB 4FEAA 5IYZB 1KI6A 1T3TA 1L4UA 5JNRA 5IH7A 1EQAA 5C7YA 4HHEA 5IJWA 3OZEA 4Q1EA 4ZQGA 3VTAA 4NXNB 3AJDA 2HOQA 4OHRA 1DCTA 4CI0B 2CXNA 5ALUA 5KHOC 1VPTA 4UBMA 4X45A 5TF4A 5JDCC 2GAAA 4KMSA 5ANRB 4OP2A 1C30B 5DF1A 5BN3A 1BN7A 4MJ7A 2GLTA 4OO3A 1G38A 2XUZA 2NTJA 5F9MA 2RARA 2UXBB 2G09A 2NNLD 1XB2A 2BM9A 3CLSD 3DLPX 5SY6A 2P78A 2RHLA 4PLVA 5G41A 1CBUA 1HYQA 1NNSA 3EUWA 4MW0A 1N6OA 3SS9X 2I99A 3W4KA 1XZDA 4PIMA 1IWBB 4YJHA 5F1KA 3GGPA 4LXHA 1PFKA 2D0PB 4Q01A 3KPVA 3B52X 2O05A 2BLLA 3B36A 3FETA 3BREA 2VJMB 4QT4A 4TYNA 3D8UA 2NU6A 4R3NA 4DZRA 1XZBA 1LTKA 4UARA 4XVRA 2ZSKA 1DAIA 3ZZ1A 3V42A 4HEA1 1LQUA 1Z5VA 3NBXX 3PA8A 4MWBA 3I9MA 5A02A 1DKUA 2WM2A 4YCCA 2YNMC 4R8KA 4PC6A 3O2JA 5EFZA 2VH5R 4M53A 2OOSA 4EKYA 3MGGA 4K0KB 2IHBA 2QY9A 3GMTA 4O1IA 1PZGA 5DW3A 3ZE1B 2AW3A 2Q9CA 4KE8A 4Q37A 5HS6A 3ZHUA 1JFLA 4ITVA 5C2JB 4HDMA 5K0NA 5K0GA 3A3KA 3D1JA 2CL0X 1KBOA 3IAS6 4S1PA 1QG0A 1ZRSA 3U37A 1JNXX 4JOBA 3OD1A 2DLDA 2ZVJA 3LFHA 5K7SA 3TLBA 2JIPA 2OAQ1 3PNOA 4IX1A 5IJAA 4RSMA 5E0KB 4EHJA 4BCDA 5IC4A 2XVYA 3KEOA 1WVMA 1EGHA 1XP5A 3L06A 1HRKA 5TT1A 4TLBA 2B2NA 3PUIA 3NHUA 1CRQA 1F3OA 1H2AS 2EGGA 1TYEB 2RB4A 3DGEC 2NZ8A 4UTZA 4XM2A 4BLTA 2B8TA 2CMGA 2IZ6A 4YUAA 1I1HA 3MBOA 4PBSA 3LG2A 4PLHA 1F0KA 2XTZA 1CUWA 3U1BA 5G3YA 1H2WA 1LS6A 1Q77A 4PPYA 2FSVA 2XCLA 3NALA 2BJWA 5AKHA 3SP1A 5EXDA 5EJ5A 5JZVA 4ZVPA 4W5QA 1E0DA 4MYUA 2BMDA 4RTQA 4QYIB 3U4GA 1ZHOA 4Z7OB 1U3DA 2SBTA 1O95D 1UXKA 2F8LA 4HWKA 3HVKA 3R0XA 2PXXA 3L02A 3PUHA 4K81B 2ZR7A 3LHKA 5FTNA 1GRCA 2R85A 2EX0A 3LOUA 3NTRA 5JG7A 5J4VA 4NHOA 3ZDEA 3AB7A 4AY4A 3DR3A 1H3NA 2R0QC 5EAIA 4OHVA 3C87A 3MWDA 5H16A 2DHQA 2ZTHA 1XF1A 1W25A 3UQYS 4JLDA 1TQ4A 4YS6A 3STWA 1M2JA 3HJUA 3CPEA 1HTBA 4IUBS 4KAFA 2ZSAA 4BMCA 3P8ZA 1ES9A 3VNBA 3R3ZA 5AP9A 4BO5A 5KNDD 4CV1A 5JT1A 1X92A 2AN4A 4FOSA 4DTIA 2ONJA 2Z09A 1KK0A 1M6EX 4MYCA 2OXFA 1Q57A 1KQNA 5CDGA 3R8CA 1U7HA 5BSFA 3JTEA 1QCDA 5DGDA 3NETA 2ZT5A 3OJFA 4ER7A 3V7YA 4F4UA 1WW8A 1A9YA 3OKAA 1O5IA 1YZHA 4IKOA 1EP3B 1U9JA 1RXYA 2DX7A 4HXFB 4A2WA 3QLUC 3P9SA 1AGXA 4TGLA 4B2YA 3K8QA 3JYQA 1MZVA 2A0XA 4RQTA 4D9FA 3HP1A 5CW1A 1PDWA 1NXWA 4MPRA 5ICMA 1NIPA 4M4SA 5DX0A 4YCJA 4YJDA 4RFLA 3RSHA 4B6JA 2JGDB 3QVMA 3ED1A 4FIDA 4PZCA 4ZMRA 2H6EA 1OA0A 3SYLA 1SCKA 3ESCA 2EWVA 1HA3A 2GHQA 121PA 1A7KA 2N9UA 3A58B 3AZPA 4UHEA 3VHLB 4CI9A 4YRBA 1JFFB 2HA2A 3VOAA 4BX2A 5EE9A 3HC7A 3C15C 3TLYA 3CUSA 1WSBA 3KQKA 3ONNA 1NF3A 1P1KA 3I37X 2X0JA 1KEVA 1CR6A 4FXOA 9ABPA 1JGTA 5AVUA 1C1HA 2XT9A 1OH6A 2XIJA 1K4MA 3GZNB 1GILA 1T2VA 1SNYA 3DDWA 1Z2EA 2V3WA 4JR0A 4PZ9A 3TBFA 4NZ9A 3TNDA 1T2DA 4JL8A 1TUGA 4PFSA 2QN1A 4KGDA 1XVUA 2OB1A 1SXJB 1ZM4A 1OGYA 3JD2A 1NJ2A 5TY0A 2VYQA 5JCXA 4NCAA 3TL3A 4PZAA 3KB2A 4WXPA 2ZWOA 2DJ5A 3GLTA 3B89A 4CFSA 1ECBA 1UJMA 4ITRC 1QQ5A 3VPSA 2X9QA 3AEKA 3B8EA 4NPAA 4DMUB 1SOMA 1WX1A 1UMDA 3DBRB 2XZDA 5DASA 5ED0A 3PUZA 3ZWVA 3K8YA 1YA4A 2ZTMA 1GNTA 3AVQA 5BN4A 3J81A 3QRWA 1V6AA 2GEJA 1U31A 3F47A 3GIDA 1YR1A 2BHRA 1QYVA 3FPFA 2XUGA 3U5ZB 4JMPA 3R76A 2KBEA 1AVTA 1YS4A 1VBNA 1W85A 2P62A 1U0JA 4I3GA 4BLPA 3FY4A 4RK5A 3UMFA 5IK2D 3GT0A 1X42A 3MM4A 4KI7A 3I23A 2TMDA 4FYWA 4HOYA 4OM8A 4ENVA 5MFPA 3QSYA 2HWXA 5A4MS 4XWOA 4B6FA 2MCFA 2GZHA 3FVVA 3VH1A 3Q15C 3SEFA 5JEDA 3RYFB 4NYMR 4Z8XA 4M3NA 1NVTA 1OX4A 4IKPA 4XTCS 4CJXA 3A7EA 1R66A 5DGCA 1ACLA 1NBMA 1X6VA 5DEOA 3IRVA 5FPHA 4CQLA 3BF7A 4O2BA 1ISFA 5L6LB 4PLCA 3WMEA 4ASUA 2I78A 3AY7A 3DVAB 4C06A 5A9SA 1XKTA 3IBYA 4EPRA 4F5DA 2DWCA 2AJLI 2DQ4A 4ZHQB 3Q85A 1GZ4A 2GDZA 3QWIA 4BL5A 3D7KA 3RIHA 8ATCA 1IXRC 1ODKA 4GPBA 2PRSA 2FN7A 3DC7A 4UUAA 1EFUA 4AYTA 1LB1B 1J0EA 1GRNA 4PAOA 1BMFD 1YUMA 2VAMA 1KEKA 2XVAA 1J07A 4MO2A 1HMPA 5DDIP 2VDPB 5EEHA 4ZD6A 5JD3A 1SIUA 1J4AA 2CXPA 2ZB7A 3IB6A 4LI3X 3W5VA 1X7GA 1XCMA 2RG1A 5DYGA 1LLFA 3ZZNA 1HE5A 1ZP6A 2HD4A 4BJ1A 2F9FA 2AFIE 3PDJA 2WD8A 4ZZ0A 1X0VA 2L0XA 5CLIA 3MIZA 5B58T 4PZDA 3KEQA 4OHXA 2FW7A 5AKZA 2ZWPA 4TTTS 3KALA 4CIWA 3NTQA 2AZDA 2JFOA 3E2PA 4CMEC 4FW8A 3ZCTA 4Q16A 3HY6A 1JMYA 1D2NA 1LW6E 3GP3A 4HF7A 4RA6B 2ZK7A 1N0UA 4G8JA 5L8VA 1ATZA 5ALSA 4Z9FA 1D4AA 1KZ6A 1XHLA 2F1RA 4EG6A 5TLSA 4UBJA 4FGKA 2C7VA 3D2LA 1GM5A 4BXOA 3L79A 1QOZA 5CAEA 1EX7A 1VPLA 3V7NA 5DHTA 1IDOA 4AF6A 3FGZA 1OQAA 4GOLD 4C0JA 3UK0A 3GJ8A 1P61B 1HF3A 4GDMA 3DQPA 1UFQA 1XNRB 4HQLA 4EWLA 3O82A 2LD4A 2XQFA 3GBPA 4XFDA 3RFTA 4YV0A 3UV3A 2HW8A 4RFSB 4XVQA 4QULA 5JEEA 5LM3A 2AMFA 2ZVPX 3I9NA 1H6BA 3L46A 4QQKA 2M6LA 3W4JA 1PSWA 3E53A 3T5MA 5C1OA 3TZHA 3ZIUA 2I6GA 3C7KA 3MYRA 1TADA 4H3VA 4ZVMA 4AW9A 4FFLA 1P6XA 5EC8A 4KKXB 1F8FA 4D4GA 2N3ZA 2NZWA 4U0JA 1EWKA 1I2CA 3OWHA 2KYRA 4LDQA 4CQMA 3LWNA 4M1KA 1V11A 2VNKA 2VT3A 3R74A 3SLRA 1EZ4A 3RIXA 5B6PA 4JGGA 1OFTA 1UIMA 3KOMA 4N48A 2PD3A 4ZV9A 3WYCA 3IQDB 1NF2A 1CS4C 3RTAA 4W9NA 2G07A 4U2EA 1V6SA 2O0KA 4DLVA 3UGKA 4BYMA 1XZEA 5E6SB 3UUWA 2IJGX 3EBLA 3R8FA 2HT6A 3SXPA 1JQEA 2C0CA 3NUZA 1Y9EA 2XVXA 2RAVA 3AHIA 3PNQA 2Y71A 4TYQA 5K6RA 1E77A 2YC2C 4KPGA 2OFPA 4OHOA 1TJ3A 5EKDA 1G5PA 3R4CA 4UAUA 4AC9A 3GEIA 4ETIA 1XZFA 2B92A 5FTJA 2BZ1A 1BW9B 2C9YA 4WXYB 5LA6A 3D8RA 2JLAA 2NU7A 4WASA 1AV7A 2JCSA 3OZUA 2ZIEA 3LVRE 1JLMA 1CUFA 5KI6A 3V9PA 3R5JA 1GDDA 4ENUA 4RW0A 1AXRA 2ZDQA 4HYQA 4Q03A 4ZODA 1ZA1A 4KYUA 3LBIA 5KZMB 3EZ9A 2HJWA 2VWPA 2X9GA 4ZVUA 2DB3A 3ORYA 1QFJA 3V8QA 1DNPA 3DHEA 4ZFNA 3PQ4A 3G7UA 1CJMA 1N9KA 3THXB 2FEKA 4HYEA 3UYLA 3WKEA 3P4YA 1N2SA 2IELA 2Q5EA 2ZI4A 1CYEA 3QW4B 2G71A 1DDIA 1HDOA 3MFQA 4KK4A 5JASA 3BXOA 1WEKA 2J3EA 4ER6A 1XALA 2OHVA 3BD9A 4Q39A 4WOJA 1MW9X 4MINA 3CVWA 2RKOA 4WDRA 3SM3A 2MINA 1Z4NA 3AVXA 4QWMA 2ZBGA 4I36A 2XUKA 2SICE 5DCUA 2OCBA 2IYSA 4MW5A 2FAXA 3DA8A 4EITA 3CH7A 5LKAA 2FSVC 5T57A 2KLBA 3MUFA 3RBZA 2X7XA 1R6DA 4A8PA 4OPMA 4RJLA 4E5NA 3GWZA 4FDTA 4QGBA 4EW3A 3OX2A 3VYRB 2GEKA 5FIUA 3UG6A 4JI8B 1G5HA 1OBVA 1OUMA 2A5JA 2QUZA 2A4MA 4RZIA 5DBGA 3KEMA 1LA2A 1PR2A 2EAUA 3CYFA 5AVQA 2FI1A 3JCZA 1EIWA 3CZ5A 1AQYA 1QKIA 1Y8QA 2QX6A 4HDSA 4MTCA 4QX6A 4R2KA 5HDQA 4BNNA 3P9CA 1GQQA 3N53A 2WHPA 1J49A 1DBQA 4E1BA 1K8ZB 1SVKA 2K6GA 3QWFA 4DM7A 5LBIA 4MS1A 3SNHA 2EWWA 3WIEA 4CEJA 1A5ZA 1M2WA 3N2YA 5IJ0A 4UD6A 4QUEA 3BFVA 3H6GA 4MPJA 5EXTA 1WUIS 3FRJA 3THSA 2VDJA 1RJ9A 4GX0A 5F1OA 5K51A 1UMCA 2V0NA 1ID1A 4K9LA 4QVGA 4W82A 1ZI8A 3BORA 4DWWA 1ZHHA 1U2PA 1X1DA 1HDXA 3FSGA 2WWIA 1GGHA 2RHHA 2BC9A 2NZ2A 4HZIA 3PKIA 2O52A 3H5OA 5BV1A 5ALFA 4GEGA 3BUSA 2BTOA 3WV4A 1R9GA 1P4RA 4AKTA 4FE3A 3NVMB 4V0NA 5DM1A 1LD3A 1OAOA 2QAIA 2J0SA 2V6GA 3RVKA 2C8LA 5JSYA 2DH5A 3EGXA 1PAUA 3HBFA 4WCDA 2WT8A 4MNTA 4E2YA 1U1IA 4BX8A 3MRTA 1XTPA 2Q4DA 3G59A 4TTAA 2C9DA 4O2BF 5CK4A 4DKXA 1FRNA 1W19A 2GKOA 1ISJA 3CEAA 4X3OA 5KJFA 4WX2B 4TYPA 3I0ZA 4ZVRA 1USVA 2JNWA 4I4TA 3RASA 1HYBA 1ZVMA 3CSSA 2W6MA 4ZN6A 4B17A 2QPOA 2VRCD 3RSCA 4EY8A 4QXMA 4F91B 1A9QA 4YRIA 1WHSA 3OZTA 4B43A 4PXAA 1KJ9A 2IDKA 2ZSUA 4INOA 4D1YA 5EUCA 2JBHA 3NT4A 4HMOA 3CLTC 3F4LA 4QU9A 1KEPA 1OJ7A 3WJ1A 1KVUA 3RVDA 1XVIA 1ZUNB 4D79A 5I9SA 3O73A 2YMMA 3B12A 2Y66A 2HSZA 3U9SA 2FK7A 4BGEA 2RD2A 1UOPA 3KWJA 1RWOA 3JQ8A 2WMOB 5AKIA 2EZ4A 3Q3IA 5DGHA 3W78A 4AJ1A 1HKHA 4C6RA 4OL9A 1G291 3CR3C 4FQ7A 2OLKA 3WMXA 3AEUA 2ENWA 3W8NA 5D8DA 4AKSA 4Y2GA 1I33A 1VA4A 2OILA 2V7BA 2H9IA 1UR5A 3C8MA 5ULLA 3BXZA 4BFYA 5FBRB 1M34B 1PS8A 1NBME 2OGZA 1H42A 3NPAA 2VT2A 3HE3A 5IT0A 4MRSA 2J33A 1QQTA 3NATA 4NJOA 2V7XA 3KOUA 1X1CA 3JATA 4AP9A 4ZAZA 4F12A 2HI0A 2JB9A 2ZRHA 3K0CA 4GR4A 1JQDA 1CZNA 4MDHA 1PQWA 3ICWA 1FVFA 2CDCA 3DS8A 3L8YA 3L0BA 4EG7A 1RHUA 1WSWA 1AG9A 2H2AA 2P9TA 3OMLA 4PIVA 3WGJA 2ZQ5A 4GH5A 5FUBA 5UKDA 4D6XA 2ZBRA 3CXUA 1YHNA 2ICAA 4N40A 4FQ5A 5TEWA 3RVBA 3ZY6A 1C9NA 2PY6A 1M2KA 2IY7A 2IL1A 5GJCA 3UAYA 3W6UA 1E3WB 1IZ7A 1L3CA 1RC8A 2HXYA 1MF7A 5AW1A 3D4IA 1XZJA 3ZK9A 2Z2JA 5K8UA 1ZU4A 1HT2E 2ILTA 8LDHA 3O90A 5KTTA 1LI5A 3SYRA 2P8JA 5MN6A 3MERA 3HBAA 3I1FA 1LJLA 1DQSA 3DC2A 4I08A 4TYYA 1CUUA 1OT5A 4KDFA 2ATCA 2ZJ8A 4RD6A 5AD1A 4CMIB 5K20A 1DCKA 1YQTA 2JHFA 3ZXXA 2C9BA 5B7PA 2ZW9A 3FDJA 4LF8B 2DECA 4PNHA 4EA6A 5E9AA 1NV9A 2EW2A 1UEXC 2H4JA 4QEKA 1G59A 1E2LA 4PSUA 2JPDA 4CCYA 3HM2A 4B7XA 4RIFA 1C8KA 2P75A 5CCEA 3OJLA 4Z8YA 2ZYAA 1E92A 2B3DA 3ANYB 4Q4LA 4KFTA 5C0OE 3ZNPA 1YB2A 4L16A 4WZAA 3RT1A 3W9UA 4UPDA 4XLZA 3V46A 2XTJA 4QXAA 4Y2UA 2VOEA 3RUHA 1VHTA 5KYYB 3G9XA 3OTGA 4GS5A 2QVGA 2FXVA 2X8LA 1W52X 3E9QA 5LA6F 1DIOB 1OI2A 2FPWA 1C7IA 1W93A 2C5HA 5I9BA 1E79A 3V4RA 1T1SA 1JF8A 3CRMA 4WKCA 1PV2A 4EI7A 5CIYA 2ZUEA 5DIZA 3F3SA 1EFPA 1KDZA 2HPHA 2JGMA 2QTGA 4M87A 5IXSA 2JFXA 1KPGA 1MX5A 2Q4BA 2C3MA 2L42A 3L1VA 3AUUA 1U63A 4KKVA 3SFTA 1M1YA 4KMRA 3UQZA 4Z7JA 9LDBA 2PTGA 2LBPA 3FF1A 3RF7A 3W5CA 1JPVA 1D8AA 3IMGA 4JNCA 1T8PA 5GQSA 1EK2A 1VC2A 4FMDF 4RA9B 5FRDA 1WY7A 4Q6BA 1S8FA 1DPFA 3GT3A 4DJTA 2SNIE 5JNSA 1T35A 2L18A 3HUFA 4J29A 3NG1A 3PE4A 5NULA 3IBFA 1JKJA 2C7RA 5E4FA 1JA1A 3SN6A 2HO5A 5B1SA 3B1WA 1O77A 3GO4A 3IUJA 1NU6A 4MWCA 1TFRA 4D4KA 1P4JA 5HGXA 1DWQA 4C7OA 1Y42X 1R27A 2UV8A 3DNFA 1NQOA 1AQ6A 2XE8A 2ZIWB 3D7SA 3HJGA 4XIJA 5AI8A 5EHZA 3JAKB 1U2TA 5TMBA 2AZ4A 3EF3A 4L5JA 3MIIA 1DU4A 3DBLA 3Q10A 4JB3A 1RADA 1IBCA 4W9NC 4X20A 2V9PA 3OJOA 4IJUA 4LBYA 1MD9A 4YC7A 3CJRA 3HXQA 2A1IA 1JYSA 1UPXA 2FWRA 3LI2A 3DPUA 4OQEA 4YDHB 1NQ5A 5KU7A 1UBRS 3LWDA 2PZEA 1NI4A 3BX1A 4CVNA 4YRKA 3GFFA 3KZVA 1NLZA 4XR4A 4DF3A 3OUTA 5DYIA 2VUTA 4OQXA 4D5EA 3H11B 2HBZA 2QQGA 1CF2O 3ETNA 1ESZA 2DQZA 3KOXA 3LQQA 4MKHA 4QEZA 3VGJA 4CL0A 3ASUA 3EXG2 4H6VA 3ZU3A 5L7TA 1LXCA 5AJWA 4OAPA 3MD9A 5JISA 1A98A 1P5ZB 3F6PA 2H2IA 4X44A 4A73A 2H07A 4JYCA 1R0KA 1P3DA 2REQA 5T4EA 1TRKA 1XE3A 1XTKA 4HY3A 4R9NA 3I8SA 3UTDA 2XOKA 5H9WA 5DNYB 4UOEA 5KTYA 2HPVA 2P7HA 2VDRB 2XCOA 4HEA6 4LYYA 4CT4B 5IKEA 1CRLA 2JEYA 2X8WA 3Q11A 1L5HA 3ZGNA 3DMTA 3I8OA 4D3DA 4KP7A 2DHDA 1PNQA 3QE2A 1TU4A 1EQUA 2JJ1A 1W35A 2QN9A 2ERYA 1N1MA 1NLUA 5JVDB 4F6CA 3A2KA 4S3MA 1Z7BA 3DFZA 4K2AA 5IARA 5TVGA 2GD2A 2YWXA 3G2LA 5JBQA 2O2GA 1Y6ZA 1JG1A 1D5CA 1G2QA 4I4TF 1U3CA 1VHQA 1IOLA 1SIBE 1XKXA 1NI5A 1CSEE 3FNHA 3KOOA 4CM4B 3PGJA 3L92A 3L5KA 1OVMA 3D4LA 3KAQA 1U2EA 2A1UB 1HYEA 4GM0A 1E1NA 4R31A 1EGMB 1VIVA 2PZBA 1JXAA 3K9BA 4A0SA 1CYDA 5GVSA 1JHVA 3A9UA 4LNHA 4O2LA 3ZKWA 2FPUA 5AICA 2QP3A 5GZ3A 4IY1A 3DULA 4GR5A 1W34A 2W4MA 4BWFB 4Y1EA 3L4KA 1ZXXA 2GXQA 3WO1A 4KSBA 1XTJA 3F49S 1K0FA 5CDYA 4XLTA 1XCOA 3NHFA 3T3NA 3AF5A 2D1RA 3GRVA 3E9ZA 3KXDA 4Y2XA 5EMMA 1XRSB 4BMXA 4TTQA 1EXMA 1ML4A 2RKBA 1AE1A 3EZ6A 3NAGA 2YRWA 3UMCA 1TZ2A 2ALJA 4KFSA 2C99A 3DWIA 3I62A 3BRWD 4UQOA 4B0PA 1VXRA 2DQSA 3M6MD 4EHBA 1L4BA 4ACBA 1DJOA 2J9FA 1T4DA 1OAOC 5BWLA 1TF7A 3B1VA 2IHKA 2WUFA 3PQ3A 3NASA 4QDUA 3WYFA 1NDHA 4Y6QA 5L4NA 3OPYB 5FXMA 5HTOA 2D5IA 3HGMA 1RWBA 3FI0A 3TAHA 1CF9A 1TK2A 3NBKA 3O3OB 4YNBA 5FL7A 3HG7A 2PS1A 5K8JB 1RJGA 3JARA 3CKKA 4B6OA 1QIMA 2O5RA 1OHHD 4BWVA 3ND9A 2VJKA 4PINA 5CPBA 5FUMA 2C3YA 4ZJZA 4H1VA 3KCQA 4GNRA 5F5NA 3DFFA 3VVCA 3FDXA 3FTQA 4R8VA 5CNJA 4GI2A 5AXAA 2XQIA 2CVPA 3DTNA 1MO3A 1RNLA 4GBMA 4G0OA 3SSNA 2GEBA 5AK4A 4RVHA 4K03A 2RHRA 1J25A 2H4WA 3LT5A 4V03A 1NMXA 2REOA 2OUIA 3OCZA 2OO5C 2NTNA 3FF4A 4XFJA 1B41A 1KL7A 2X6QA 5DHPA 3BWYA 4M9SA 1JDSA 2OBNA 2YZNA 3AV3A 3GPCA 3INGA 3COZA 3CX6A 5E8JA 3ZY4A 4WGGA 4FN5A 2HJRA 3C8DA 4F8YA 3UPUA 1OR8A 3I1IA 4ND3A 4XJVA 5E3JA 1NP3A 4W8GA 1KDOA 4IDEA 3DFIA 3W3AD 2H9YA 3EFOB 3AFNA 5IHXA 3TG8A 1M8PA 2XNCA 3MJEA 3OQBA 4YI5A 1N5RA 1K7XB 3EMDA 1K66A 4XLLA 4YRLA 2ZFUA 4YLYA 4LYDA 4TV8A 3TGWA 2JHGA 5A5FA 1NVWQ 3AKZA 1J2YA 1QGED 3KSUA 5L7WA 4GZLA 4F7WA 2DY0A 1G16A 1L5MA 2TMKA 3HB9A 1UKEA 1XEWX 1Y8RB 4CM9A 1OX6A 1RWMA 5DLQC 2I62A 4QVIA 1Z63A 3BHNA 5I6DA 3AFMA 4LDAA 1GZ5A 3WKCA 1QV6A 4B3SB 1KPHA 1A7JA 3OECA 2V4ZA 5JHGB 3KQTA 4REMA 4YWJA 2MSKA 4EY4A 2XB4A 3U61B 2JD2A 1L6IA 4Q66C 1FQOA 4U00A 1WKVA 4UZEA 4B3GA 1F4PA 3ZD9A 1NF9A 2C94A 5AUOB 3Q8XB 2R60A 1VL5A 2JJ2A 2ZSHA 1Y3DE 4HJXA 4YLEA 1S4MA 3QE9Y 2OFWA 4YMTA 2PGDA 4I0WB 3K6SA 2GBCA 2J0VA 3IT1A 1DXHA 4JFAA 4YIHA 5ADVA 1OWLA 4D26A 3PJRA 2PX8A 1JU3A 4IRMA 3SXJA 4A6PA 2YN0A 2BD0A 3CW9A 1DC3A 1SBCA 2XB8A 2ZIXB 3FE2A 2OXEA 3H18A 3QE4A 1C0IA 1ODLA 4PZZA 1Y4DE 4Q3KA 4WZAE 3IVMA 4G0VA 3PIDA 2GN8A 5AKGA 2B78A 2VAXA 4ARZA 3UXYA 2NT4A 5L3QA 3C3PA 5C32A 3K92A 4PCUA 3T5GA 1OX5A 3D1LA 5L9AA 2I87A 3O31A 4DTCA 3NAMA 3HZOA 5EOVA 4I50A 2QR5A 5JPIA 1EJBA 2IIVA 3ELWA 4NF2A 3QOFA 3OY7A 2WJYA 5SV2A 1DKOA 3NHLA 4U2FA 1W49A 4EG3A 5H3HA 3FLEA 1UXJA 1QIJA 2P2CA 4GXRA 3IP5A 2ZCVA 3LUGA 5HVNA 1JWLA 2I1WA 4KPFC 4BAZA 3CVYA 4TTJA 3HKBB 3I6YA 4TOIA 2IE8A 2QN6A 2YIJA 3PKZA 3T3IA 2Y1LA 4B44A 2V8BA 5J2UB 4P3KA 3TVTA 1NQVA 2V7UA 2WWRA 4G4IA 3EY9A 4LJ4A 5AI5A 4YUXA 3WS7A 1FVHA 3N2NA 4R54A 4OCZA 4DM4A 2UZ0A 1EWYA 2X5OA 4OHFA 1I2AA 5IULC 1GOTA 3WBJA 1RCTE 2NNWB 2G25A 2IP4A 2FSSA 4Q3CA 3U60B 2OXIA 3M5CA 3ZV7A 4C4PA 3SJ7A 3ITEA 2D1YA 3UV6A 4ZYYA 5K0TA 4N8DA 1M1NA 1TM3E 4B4DA 1NM5C 3TLAA 1IUPA 2O20A 3HY3A 4PXYA 1CUCA 4CEIB 1P80A 1JU4A 4HXYA 4PZ0A 4DJ5X 4PS1A 4YY3B 1RWNA 6YASA 3L05A 5BVHA 1TCBA 4LZJA 1QXSA 1JXOA 2V4UA 3PIRA 2ANCA 1ENYA 1O54A 2LR0A 4G5XA 3OZWA 4UXJA 2A67A 5IFLA 2VWHA 5EVCA 1GPWB 3AW8A 1FDWA 2D2EA 4FE7A 1TJ4A 1PR9A 4UASA 1Q0PA 1QHGA 1Z6XA 3M3HA 3HCPA 4MLDA 1Z82A 2WTNA 3CEPB 4N39A 3W8EA 4LJ8A 1NVBA 4WLVA 2BJVA 2I9PA 1MB0A 1PZXA 2AFRA 2F9MA 2ZIVB 3FWKA 4I9NA 2B82A 4TT3A 5GWXA 3BIXA 1JE0A 2OCLA 2JLWA 1DO0A 1X7ZA 3PL1A 4QBTA 1X80A 1JZTA 1NE7A 2VR1A 3GLKA 3K2IA 1W4LA 4HNAA 1UBNA 2C31A 2CDNA 2W37A 3E5RA 4HH1A 3S29A 5C1IA 5C4IA 4NVRA 3B6ZA 3OH8A 1LH0A 2NYVA 3TXYA 2NZJA 4HNVA 4Z0TA 4OHYA 4IIYA 3OFSA 5BURA 3ZGOA 5BNTA 3ET4A 3O94A 1RQLA 5I5EA 2PR7A 2NG1A 3A1NA 3LUKA 1XK6A 2XYHA 3LM8A 4C29A 5A71A 2YZKA 1RKXA 1A04A 4M54A 3EUEA 1IBKB 1OWNA 1GL3A 3AH8A 4UNQA 5ALNA 1WIWA 3TCXB 1U8TA 4I1YA 4HG2A 1TW2A 3EDMA 4MHTA 3OZ7A 2Q3DA 1F20A 4BQEA 3FUTA 3FYDA 2HA6A 2ODBA 2ZRFA 4DSOA 4LMAA 2NYAA 3EPRA 4BKQA 1M33A 4EH1A 2IEAA 1J8QA 1S2DA 4Q19A 3DO8A 5I9MA 4D4HA 5JS8A 2UUAB 1JKMA 3CE6A 3K05A 1J99A 4BFTA 5LZ9A 1CCWA 3EFBA 1XMQB 2C1ZA 5F77A 3QVGB 1SBHA 4MWDA 2HK9A 4UMFA 3L41A 4EHLA 3DMTC 2XXAB 3KXIA 3FSRA 1NVKA 2AZMA 1R0SA 3LDUA 2I3ZA 3CLHA 3EOAI 2ZGVA 4QHYA 5SZHB 3GH3A 1MN6A 1E1RD 3U4AA 1S89A 2IZ7A 4RHCA 4Q00A 1RQ2A 2ZYHA 4GLFA 4HYTA 4L5IA 3TRIA 3K0BA 3VSBA 1FUUA 2VCYA 2IUYA 4R98A 5FTWA 5IT9A 1RC1A 2PUCA 2HV8A 3BHJA 5FV7A 2PAAA 5H81A 1NA5A 2O0MA 2OGSA 4D25A 4KQCA 4FZJA 2BEWA 2LP4Y 2P9HA 4XUDA 1Q3HA 1DC5A 4K3UA 1EGVB 1FYEA 4KVZA 4QBGB 2WYIA 2X4DA 4C1BA 4F2WA 5LPNA 2IP2A 1KR2A 2FF5A 3LF1A 3TUJC 1C0LA 1J22A 1AO3A 4PGFA 3EGDB 1TQHA 1VZ3A 1SU6A 3AEQA 3QWBA 5DULA 2WIDA 1RBZA 2G36A 1ABEA 4YJ3B 1KAOA 2VDOB 1UM8A 3HA3A 5J58A 3GT7A 5H0IA 4Q3BA 1XTQA 2NZYA 1U98A 4TRMA 1B2RA 1IOZA 4NCJA 4OEHA 5LLTA 1XR3A 4QYXA 2FF7A 4QC2A 5DB4A 5EE1A 4CKEA 4X00A 2IXGA 4MVJD 4TV8F 2VTVA 1KFBB 4QBKA 1V9CA 1S02A 4TTPA 1B76A 5CT4A 3D8HA 3WSWA 1RLIA 2IYYA 4EKIA 1UDCA 5IUNC 4KNWA 4WD3A 4YYZA 2WB2A 5LZ5A 1JPUA 1UT5A 2QK4A 1A9OA 2NUTA 3TRDA 1GUDA 3CGGA 5BSUA 4JU8A 4EO4A 2CYCA 2C20A 1TD9A 5DTRA 2NTYC 3Q7PA 3V97A 3LOPA 2QM3A 3OI7A 1H9BA 4GOXA 2H85A 2L19A 2YV4A 1JHZA 1UBEA 2FEMA 3HM9A 5LUAA 3FWHA 4GYYA 2C2OA 3WJ2A 1KA9H 1K4YA 4XEHA 3UUFA 521PA 5LVAA 3IUYA 2E5LB 4KAJA 2FPGA 3CLUD 3OT1A 2ZUBA 3R2JA 2JAQA 4B1FA 4L8WB 3RBVA 5JY6A 3K0SA 1EEXB 1NT4A 2G76A 1FFAA 1UBHS 4RS4A 1J42A 4GPIB 1GNSA 4PC2A 4Q18A 3SWWA 1FTYA 2YXEA 3FWNA 2YUIA 1E1KA 2R1VA 4R01A 5SYNA 3IA7A 1ZBDA 3N2EA 3ZR4B 1WU7A 1B0PA 5TF0A 1V9SA 4EOGA 4HH0A 1UAAA 1FYVA 4I50F 5CA1A 2JJQA 3KQMA 4NARA 2Y1CA 3NJRA 2QM7A 3P45A 2O2DA 4Q05A 2C2ZA 3RRFA 3ZK8A 5BYKA 2AOTA 4K9NA 3GH1A 4ZTBA 5ABPA 1IEVA 2KI5A 4HNSA 4IL5A 3H5RA 4CTOA 4EF4A 1NRIA 2PJZA 2A5YB 3O4FA 4KTVE 4W7HA 2PUTA 3P9NA 4OLHA 5AIBA 4I4CA 1J7JA 3BKWA 1HNNA 3GLHA 4D2IA 3AESA 1VLHA 2XLCA 2XR1A 4C6HA 4OKSA 4EABA 1Q2XA 2LCFA 2Y2VA 3DSRA 1E9BA 4EJ6A 4QKQA 2W2LD 5AESA 5KWVA 3GXOA 2ZM6B 5AJTA 4WRRA 2C42A 4BO9A 2PUEA 1PEYA 2ID7A 3AL0C 2RI6A 4YP6A 4ABTA 2A9JA 5HZKA 1HG0A 2C5SA 4HWGA 4ZK2A 2PWYA 3EC2A 3MLAA 2AC4A 1DDOA 4IG9A 4BNKA 3DVLA 3IDAA 4ND7A 3G9ZA 4R9UC 3M82A 2EJCA 2VQEB 1EVLA 3OU7A 2W2PA 4H77A 4US0R 3NYIA 2BCGY 2F3SA 4GGMX 4AN4A 1HK7A 1LSSA 4N03A 1BVYF 3EA4A 3IO3A 5BUZA 3UYKA 2FZWA 4JC0A 4P4LA 1BDJA 1W73A 1ZOSA 3U7EB 4DFDA 2PVCA 3TH5A 4MUFA 2KQUA 2Q46A 1W1IA 2DYKA 4V38A 1GL7A 4GM4A 1D6SA 2HMYB 3FHCB 4PPNA 4Z7QB 3OX4A 2O2YA 2VWGA 5K01A 3LFTA 1MIOB 2I76A 1Q92A 1XMPA 4S1VA 3T0GA 4KSCA 3ZD7A 2GAFA 4KBFA 1SCAA 1QGZA 4X9XA 1I9CA 2XE6A 1E3TA 1E3DA 3OOWA 1N6HA 1T43A 3TFWA 3BMOB 1FSFA 2FFQA 3DO6A 4QQFA 4URYR 3RUPA 2YJ4A 5C5IA 3I5YA 1TL7C 1LRLA 2VAPA 1E5DA 3AIIA 5K3AA 2QXTA 3OO0A 4NNJA 4ZJUA 4ZA2A 1GHTA 1U0RA 1Z8FA 4A16A 5BRAA 1QH8A 4KX5A 2OZEA 2ACWA 4QARA 1XJ0A 2ZYIA 4PVDA 2GCOA 1UXHA 1KTVA 5FHRA 4H3KB 4DQ0A 4YJ2A 2XCSB 4HTFB 5EFOA 3L93A 3TB6A 3C98A 2Y1WA 1QC5A 3CEJA 2I3BA 2O8EA 1TKBA 4QTUB 1H2EA 5K0LA 4FFWA 2VFAA 4A03A 1XZMA 2Y67A 2HFKA 2QD3A 2X3YA 4URZR 5JC1A 2JIOA 3O74A 1ISSA 3VZQA 2QBYB 3JQ6A 4H1WA 1EBFA 3V1YA 2VSOA 3H19A 4EJ0A 5KNDA 3NIGB 4C08A 2WNIA 3HI6A 3NJ8A 3RVLA 2FRXA 1OPRA 2WMNB 2R6HA 2ZU6A 2JHAA 1JHQA 2ZETA 1W30A 2HHCA 4X91A 2HJSA 3L8GA 4YP7A 5PNTA 4ZMBA 3DMPA 1YAJA 3S2IA 5IJZA 1VBKA 4NL4H 5LWQA 2KJQA 2W2MA 3IVAA 1T5BA 2LPMA 3S8EA 1LW7A 3EMBA 2ZIAA 1WCWA 4JLPA 3THYA 1K97A 1ZDMA 3A25A 2ZJ5A 3ETLA 3PNBA 3T61A 4BNVA 5HIAA 3E7DA 4WBXC 3JAMA 1W4RA 1G18A 2F3TA 2RAFA 3NB0A 1Y6RA 4I55B 4FEYA 3BZWA 1S2IA 1E66A 4JXXA 2RAUA 5AW2A 1H23A 3BGVA 5H3CA 3S8YA 1VJ5A 1WZNA 4UUPA 3TW0A 1U1CA 2FDRA 1QX3A 1QWSA 1XOIA 4H0NA 4HT3B 1GGKA 2PSJA 3M34A 4K9DA 1U0LA 3KUXA 4OHKA 4A0FA 3KP1A 4KOEC 1B1CA 1K9SA 3O2QB 4GI7A 4PAMA 4S0ZA 2YOGA 1NW8A 4W5HA 3RF6A 2WPNA 1MC8A 3JD1A 3GCDA 3VRHA 1IK4A 2E6KA 4HCJA 3CM0A 5E9JA 3FVQA 1SKYE 3A9RA 1YC5A 1W8IA 3GZTB 4GPEA 4KGXA 2HKIA 2QUIA 4QT0A 1KMMA 3N39C 1YR6A 4CDGA 1QPBA 3WLLA 1VLLA 2JCGA 3GCXA 4LSGA 3ZVNA 3P19A 3EK2A 4KOAA 2JLVA 1N2EA 3A2LA 3A27A 5KPDA 3FUCA 4LDPA 4XDGA 1PUIA 3S4YA 5JH7A 4MYHA 2GZRA 1Z83A 3N6XA 1SCNE 4W5WA 1BWRA 1Q7GA 1WL8A 4UCQA 2OWEA 3G2IA 4IDBA 3E1KA 4ZEOA 4P31A 3STXA 4LF6B 3SJCA 3DHVA 4RCZA 2J09A 1EU1A 4PYIA 1NJ6A 3ELYA 1G63A 3PR2B 5DT2A 2QU8A 3DE4X 1CR4A 4EJSC 4O3MA 3MB8A 5IK2A 5JCPA 1US8A 3M4XA 3UKJA 3AVTA 2VATA 1T3LA 1XA3A 3QVSA 5ENZA 3HKEB 2OYSA 3MZ0A 4QDZA 4WLFA 3BGOS 4W7IA 1CEEA 1I4LD 1FNSA 1E5LA 1RLMA 3F1LA 4GMXA 4YFVA 1G20A 4G1MB 2IOYA 3NHRA 2R96A 4G0UA 3DFKA 1X7DA 4IICA 5JQGB 3Q8WA 4FYKA 1M0SA 3QEMA 3CZCA 2C78A 1II8A 1EFLA 2JFHA 3I73A 1ORVA 4G5HA 5HG0A 5DTIA 1ZAKA 2IEIA 2QTVA 4P98A 2AF4C 3H9BA 2OBXA 4QDJA 2F3QA 2VDWA 3D0RA 4MP8A 1P9WA 5CA1F 1C3LA 5EUMA 4M1EA 2ECFA 1U2SA 1Z0UA 3JQBA 4LF4B 3TD6A 3N6RA 3GGOA 4C3UA 1BXRB 3CUUA 1BMFA 1P0CA 2E4AA 2MTBA 4Y1RB 3RODA 4EHHA 4F6RA 2J0QA 1UJBA 2G9UA 1WAMA 3UA3A 2JLCA 1X19A 1NN0A 2V7GA 3I01M 5EJ6A 4MCAA 4DUZB 1CDZA 2O3SA 3PRKE 3M6LA 1F6BA 2RGBA 4L95C 1F2TA 3B7GA 2BCEA 4RVDA 4X7RA 4B85A 4Q1DA 1X74A 2W8BB 4X6YA 2VBFA 4Y9DA 5AHOA 2VK8A 3CX7A 5DV9A 1K86A 2AI3A 1PGNA 2YMLA 1A2QA 3L6RA 4TN1A 2XB9A 3ENVA 1FP6A 3F71A 4N6GA 3D8NA 4BFLA 2VSFA 1J06A 3HDYA 5HQTA 4JLMA 4LX0A 3HVHA 3IIJA 5AMXA 5IBRA 4MV5A 1M2OB 1YZVA 1KMHA 2WMYA 1WF6A 3QVOA 2I4RA 2J3IA 3D5TA 3GJZA 5IZCA 3TEMA 2UXDB 1KEWA 1A7AA 3DD1A 3GJ7A 3QOYA 4I19A 3HU3A 3QBVA 4NZZA 3DXFA 4YALA 3W2IA 2VH1A 1COWD 3AVPA 3G49A 1LF5A 1D7AA 3L4SO 1NY6A 4CL2A 4NMLA 1PEKE 4IJQA 4QSMA 4B2IA 2GTPA 2I2DA 3ABQB 3GUYA </