2WTAA

Acinetobacter baumanii nicotinamidase pyrazinamidease
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
212
structure length
212
Chain Sequence
MNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNHISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHIDSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDACKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NICOTINAMIDASE
publication title Specificity and Mechanism of Acinetobacter Baumanii Nicotinamidase: Implications for Activation of the Front-Line Tuberculosis Drug Pyrazinamide.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 84
structure length 212
sequence length 212
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2wtaA00
3UAOA 1NF9A 1YACA 3MCWA 2H0RA 1X9GA 3TG2A 2FQ1A 3EEFA 3S2SA 3OQPA 4L07A 4L08A 3OT4A 3HU5A 3O94A 3O93A 4WH0A 1XN4A 3TXYA 3PL1A 2WTAA 1J2RA 1NBAA 3O90A 1NF8A 3O92A 2B34A 1YZVA 2A67A 3IRVA 3HB7A 3TB4A 3O91A 2WT9A 1IM5A 4H17A 1ILWA 3LQYA 4WGFA 3R77A 3R2JA 3KL2A 3V8EA
chains in the Genus database with same CATH superfamily
2VTKA 1CXZA 4LJ4A 2VHCA 3SEFA 5JFGA 2C7QA 2YWCA 4Q1CA 3HI6A 4A1OA 3EMDA 4US2R 1GUAA 1EDBA 5JO9A 2AI1A 3K9HA 5FWDA 5LDGA 1N34B 1FPQA 4UUAA 1HYEA 2CMKA 3IOYA 5IC4A 2HA3A 2IYNA 2ZCVA 4LHXA 4OGFA 3CEPB 4S35A 2QNBA 2QBYA 1JKFA 1G7SA 2ES4A 1E62A 3A3NA 3I42A 2W9XA 5TQ2B 4CKBB 3H17A 5F7OA 1CLEA 1JG2A 3BFXA 3NO4A 3IURA 2VXBA 3CW2A 2HDHA 5G0UA 1SXPA 3U4GA 1ID8A 3OI7A 5DVZA 2EERA 2J85A 1P3DA 3M4XA 3F73A 2Y6UA 2Z2IA 2TMGA 3HDVA 4HMOA 2OLJA 1IQUA 1C3OA 4QYSA 1HUQA 3O38A 3DHWC 4H2DA 4I9NA 3W8DA 3OO1A 4UHEA 1T9KA 1USVA 2Y77A 4UW9A 1L1EA 1PGNA 1XX6A 2O2JA 2IC5A 2ZOSA 3RIYA 3ZBPA 4Q39A 1M7HA 3JQ8B 3I2KA 1HLPA 4EZIA 2PJRA 1QHFA 2OV3A 3N2ZB 3UAVA 1PGPA 5CPBA 4N3NA 4DLZA 4JI1B 4UUBA 5B58T 3HNRA 4RIHA 2H1CA 3RIGA 5JAQA 2TS1A 5G1OA 3ETDA 4B79A 1UJ6A 5DM4A 4E5MA 4LA4A 3A4NA 4AQDA 5D00A 3OLYA 5JMPA 4ZCMA 3WGIA 4EKNB 4BMPB 2Z4TA 2G1AA 3DYVA 2C9BA 2IU0A 5JXWA 1WXIA 1FQKA 1GUBA 2UZ3A 4DQUA 4B0PA 2PWZA 4AJPA 4OB8A 3CN7A 1O95D 5KYYA 5K0SA 1IXRC 1PZNA 1Z08A 1P7CA 2PN1A 3VPHA 2P5UA 1KAGA 1WG8A 2IOHA 4DLAA 4V3CA 2D5IA 3P8ZA 4US0R 5DSTA 4E7PA 2CXPA 4F9FA 1XZMA 3HBAA 1T3GA 3SY8A 5B7GA 3SXUB 1P9OA 3HCOA 2QV0A 4F2WA 4BBAA 5KWVA 1FRZA 1FE8A 3DCIA 3PDJA 2O5VA 2J3LA 1KTVA 4YAGA 4Q7LA 4DIDA 4V0ME 2WA2A 4RY8A 2C92A 1X2EA 4YGYA 4AW9A 1QKIA 2VNKA 3DQZA 4JUAA 4L0DA 3EZXA 3LBNA 5DHTA 1MX5A 4WKNA 3DFMA 3FGOA 4CV2A 3QTBA 2FHSA 4RS4A 4ZDKA 1L7EA 4NENA 4G0ZA 4B71A 3H86A 4NLLA 5EE1A 1QAQA 3ETGA 5P21A 1E9RA 1TJNA 1Z0UA 2XYQA 3F1LA 4YJFA 3IKJA 3CRRA 3EXEA 4N54A 2JH8A 1L5ZA 1NVUQ 1XLTC 2X8WA 3GY0A 3I6BA 1ULSA 3G2QA 3U9LA 1XNJA 4ZOAA 4YUYA 2I4NA 5IAOA 4FFBA 2G17A 2RHHA 1N36B 4ISBA 4E33A 1B4DA 3REQA 4B33A 5JMWA 2H0AA 1CUJA 2QTHA 3V48A 2XB4A 3NYWA 1Q6ZA 5KWIA 3WGYA 3U2QA 2A35A 1OXKB 1T36B 5LCXA 3BIXA 2XCTB 1TM3E 2DH6A 5KQLA 3FZEA 3DV0B 2GPBA 3AF2A 4TMZA 2QTBA 3DV9A 1J09A 3HZHA 1J07A 4ZT5A 1CTQA 3QNWA 5ESRA 2VBFA 3TZCA 2W5UA 3LOUA 1UK6A 3I9V1 3FHJA 3IQWA 1A5BB 3NC4A 4O4JB 1R0LA 2QW1A 1XZKA 3ZWVA 2W2XA 4GPTA 2PNJA 5FF9A 1R0KA 2FJUA 3RYIA 4D44A 4S1NA 3N0VA 3SE7A 4DSNA 3A05A 3A9SA 5EJ9A 1JFLA 1XQ9A 4NDNE 1UEXC 1AMUA 1RRVA 2JKZA 3FPSA 3DFZA 3U3ZA 2EW2A 4OREX 1RYNA 2XJ9A 4OQZA 3FPLA 2CN1A 1PTJC 4FOTA 4UUPA 1A76A 1W34A 4ZXPA 2BD0A 2QMUA 1V7PC 1AGPA 1W93A 2W2QA 5KVVA 3WLNA 2OGUA 3GEPA 4P3YA 5LLSA 5ECDA 2ZIGA 4QOSA 2VLBA 1DNPA 1V1JA 1VL8A 3LC0A 5EEHA 2FA9A 4HH1A 2DFNA 3I58A 2H48A 2N0SA 3I92A 3UATA 1ZMTA 1X14A 2QQGA 4M1MA 3AR6A 4KWEA 1G21A 3K0AA 2FETA 1T9ZA 1RZVA 4I50A 3WYEA 2EQ5A 5JNTA 2HO4A 4DL9A 3OZTA 1B0ZA 2VHJA 2WUGA 3QKWA 1WHSA 4I4TB 4Q16A 4PS1A 3CJQA 1X1BA 1F48A 2FSGA 2CNWD 2PKXA 4IDGA 5E3HA 4DG5A 5HDQA 2V65A 3PFHA 1V1MA 5C31A 3UV7A 3TI9A 1RWMA 5TMEA 2EG9A 5A71A 2L82A 3UH0A 4B4WA 5FBRB 2DHQA 3WOVA 1AO3A 3T1OA 2FW6A 1F8GA 4UOEA 1O8CA 2OENG 2FMIA 1IXKA 2EGHA 4WK6A 4OHZA 1RRCA 1FSFA 1SCUB 1CUUA 3D0RA 3H83A 4FMDF 4J0DA 1GEEA 3WFIA 3CX8A 3C48A 2JBAA 3DZFA 4KLRA 1Z47A 4DQ0A 4D8YA 3NBYC 1JVSA 3P2KA 3ZX5A 4WKOA 1U80A 2W2MA 3ILVA 4ACBA 4QQKA 2QE7D 1DKNA 5ICSA 3DOFA 2O54A 2ZIVB 4RSMA 1N6KA 3CRMA 4YT5A 3H8JA 4C2BA 1PL8A 1RWWA 3AP1A 2VBIA 4G85A 5NLLA 1P2SA 2YHAA 3P26A 2NUTB 1IH8A 1T24A 2QN7A 4QDTA 5DN6D 3HTXA 2EWVA 4PAMA 4RH1A 3KTAA 1OJ7A 1Q95A 3L8DA 2OECA 2IYTA 1XD2B 3CH7A 1I13A 3T5DA 4FQ5A 3I4CA 3X2SA 1CRZA 2YJNA 3D2AA 3KM0A 3ROXA 1YQTA 4EF5A 4ZQHA 2WJIA 1TZCA 3ORFA 4OVKA 5KX5B 3ZG6A 4BX9A 2H4WA 4M1TA 3CW8X 4L74A 2QLLA 5EHXA 5KC8A 3BS4A 3JARA 3O84A 4LXGA 1G8MA 3LVBA 3AJ9A 3C3AA 3GBVA 4MS3A 4WXYB 3KV3O 2ASVA 2K6GA 5B4UA 4RGQA 1P2UA 3HG7A 4U39A 1WLYA 5K3FB 4KK4A 5AVOA 1M72A 1J8QA 4F21A 5AHKA 1KYZA 5G1PA 2BMDA 4PYOA 4JDUA 3UN1A 1I5OA 4LAFA 1MNQA 2FFBA 1UWKA 2R68A 4R9SA 1H0KA 1DWOA 2DT5A 3GVXA 5TPZD 1UK8A 3VHRA 3HXMA 2PH5A 5H3HA 3UWKA 2KLHA 1KEVA 5CIWA 4O4IA 3NH9A 4LGCA 3ZWPA 2HLNA 1Y3FE 3MGAA 1R0YA 5JZSA 4L4RA 4UHFA 5TT1A 4BU1A 3TPFA 2ICAA 1YS4A 1GARA 2Y1GA 4U2DA 1ZR2A 4KQ9A 1ML4A 2QN2A 2GSWA 2H2AA 2QD2A 3ZBTA 3QLUC 3F5MA 1IPHA 4QWMA 3PRHA 4UZFA 3OURA 3IV9A 5EEGA 2PUVA 5CA0A 3ZWXA 1O5TA 4ZGBA 1I2AA 2G70A 4OB6A 3MOGA 4XXHA 4YNBA 5TVGA 4C4YA 2VXYA 4D9BA 1C81A 2BGJA 3DBLA 4GP6A 3RH0A 4CGZA 4ILEA 3BB3A 4EPRA 3MVEA 5IHXA 4L2IB 4M6WB 1ZVJA 2QKYA 2YJ3A 3PDIA 1D7OA 5EFOA 1IN4A 1B93A 1MC4A 3WQSB 4UNRA 4NQZA 1NUTA 4JT8A 5A4MS 3RVPA 3WYNA 5E3JA 3D3NA 3H4TA 1T15A 4MR7A 4YJ3F 3T7RA 3I2JA 3QI2A 1C8BA 2NU7A 2FU5C 1C7FA 3WLRA 4WBSA 4B2YA 1WQ1R 3JAKA 1ZLXA 1PE0A 1H85A 4PTYA 4IRUB 2PT7A 3S68A 4EUEA 4TSFD 2OP0A 2PNFA 3L1VA 5FX2A 4K0KB 2X7HA 2XUDA 4LYHA 4K86A 4XIGS 3F8WA 2RGYA 2RK3A 2CNKA 2JGLA 3R4CA 1R10A 3IBFA 2Q5JA 1XEFA 3NT5A 3O4FA 4Q3EA 4LZAA 5H4HA 4BRSA 4KEAA 3RJTA 2TMKA 1KY2A 5JAMA 3ABSB 2W6PA 4L6AA 4X60A 1II8A 2XX3A 1THZA 3UWMA 1NT2A 4L8GA 3GLHE 1L9XA 3NATA 5AW6A 1MOZA 4F7DA 3B20A 3O8NA 4W63A 3X0DA 2GHRA 4DLYA 5KNCD 4LY9A 1KOGA 4OF4A 4BGDA 3FCEA 4ZVLA 4EI8A 2YXBA 4G0VA 1NULA 4W1PA 1N6OA 2FPPB 4PC3A 1Z4NA 1PJLA 1YQEA 4WZBB 1NNEA 4G9GA 2AOTA 3KR0A 2VH1A 1M1YE 3LQ2A 5CA1B 2J8ZA 1GPBA 3ZZUA 3Q87B 5IM5A 1UK7A 4C0BA 3U3RA 5FWXA 2O8CA 4PLPA 3MWDA 2WB2A 2IPMA 1U0FA 3PC6A 4QEKA 3FMGA 2O2ZA 5AESA 4P08A 1ZM9A 4TXHA 2NV0A 3TBHA 1V37A 4ZTBA 4HWSA 4OI4A 2E5LB 1D2EA 1OT5A 1UC8A 3IJPA 3REOA 2ID8A 1JJVA 2FN8A 2XB2A 4IL5A 4PBSA 2A1UB 5EP4A 4LWQA 3UCXA 1GG5A 1VHLA 1CR1A 2RHTA 4HSEA 1KBQA 1KEZA 2OPHA 1HYQA 4FLEA 4CKCA 3LDUA 4UTXA 5EWMA 1XXHB 1ZIYA 2HCBA 3X44A 5JS6A 5AJZA 2O0KA 1M1UA 3L8FA 1D1PA 2I03A 4Z4HA 2BHRA 1OZ0A 2YWHA 1LK5A 3KQTA 4G5QA 1RXSA 3B9BA 4HRXA 1V16B 1WZEA 2Q07A 2QZPA 2YQZA 4WLUA 2GZ3A 5DHQA 2Q7OE 3GAZA 1X1QA 4CE6A 3GLGA 1B1CA 4C6TA 4ZZ0A 3FPKA 4JL5A 4HEA6 4RAQA 4TKLA 4TL8A 5IUKC 6REQB 2M1ZA 2Z6QA 4QTZA 3Q6MA 2H0RA 4EB8A 5TGZA 1U3FA 4HVAA 1VBFA 1X74A 3CYFA 3PFGA 5HF6A 2CJWA 3W3AH 4A3SA 1E7RA 2JAPA 4D3YA 1LDMA 1MB4A 2B4RO 1OVMA 3SJAA 3VC1A 4NRDA 3NKFA 4YJKA 2F8MA 4CN9A 3EEIA 2BIFA 3V4RA 1SKMA 4R69A 3OZGA 1BXZA 4BXOA 5SYMA 3UFXA 3P2EA 4I9HA 4XZ3A 1OPXA 2N1BA 3N2KA 3FSRA 4FX2A 5YASA 3ZZ0A 1EFVA 3FFXA 1HH4A 3IDFA 5A5DA 3VYTB 4MTCA 1FP7A 4G2NA 3T8YA 2FW9A 1GG2A 4R1SA 4RKYA 2VCEA 2RD2A 1CNEA 1YH3A 2XA9A 1SUSA 5F4ZA 3VGJA 1JLMA 2FJPA 1JRLA 1Y82A 3AHDA 3NHKA 1BOFA 3Q72A 3B6ZA 4N41A 2VF5X 1LRKA 4FNGA 4G4SO 1V0JA 5AUPB 4IHQA 3EVDA 4UEOA 4ZV4A 2QUBA 4CG3A 4AZ3A 4IHJB 4JBNA 4B1FA 4ZTUB 1XB2A 4FFRA 5EPUA 1XMXA 4NEGA 1PAUA 3EGIA 4EQ6A 3AEKA 3S1AA 4HAXA 3X2FA 1O5OA 2ZXFA 5CX4A 4OQQA 4MSUA 3T9BA 3L8GA 1L5FA 3ITKA 1OXVA 1PBTA 2P2CA 3LGAA 3M5CA 4FW9A 5PNTA 4ZKEA 4E09A 4NH4A 3TAHA 3HMKA 4LRQA 1E9EA 1I30A 4JQCA 3RSQA 2JI9A 4P53A 3VO8A 5JNWA 5EZYB 1FVXA 4Y3UA 5CDFA 1SKUA 1PV1A 5A6SA 2BKVA 1NX9A 2HSGA 2JFOA 2YXEA 4MV4A 1DO2A 2A14A 3IXQA 1VI2A 4KO2S 3RE1A 5ILOA 1DFIA 1GT6A 3VZRA 3K4QA 4BIMA 1W7AA 1OXTA 3FRIA 4GXNA 1E5TA 1GZ5A 2OOKA 1DKOA 1N25A 1P72A 1EUCA 3TOVA 1AHNA 1I1OA 1TCAA 3WWPA 3V2UA 1X94A 1T0HB 4YONB 3FOFC 3OPXA 4ZO6A 1ZKMA 3IVRA 4L5IA 3IP3A 5L4LA 3NRCA 1WTAA 2WWWA 3QEMB 3ROGA 3AI7A 4ND4A 2QYOA 4MQFA 4IXMA 3TG8A 3N2EA 1RI1A 2NU6A 1NKSA 2RSLA 3EIQA 5CH5A 1HZJA 3R8CA 5FEMA 3AJRA 1EYZA 2TSYB 4HL6A 2HIGA 2O7NA 4AYWA 2C5BA 3A2MA 1C0IA 3ZD9A 5JYCA 6ABPA 1L5KA 2OQVA 4B3BA 5JYBA 4P8RA 1VRCA 4J4BA 2MCFA 1M75A 2I4MA 4TXJA 4BAUA 1AQUA 2FG5A 4L7QA 4KTTE 4RHFA 5SV2A 3ZIDA 3CR7A 5LWQA 2OKGA 3R7FA 3U39A 3BREA 4ES6A 4DR5B 4CM4B 4HDSA 2EEZA 3HB0A 3NBAA 4YS6A 5B3JA 4XD7D 1G5TA 2BI7A 5BNZA 5DFAA 4LYYA 1VIAA 5FOSA 2JK0A 4KXNA 2EX1A 4H7KA 5CT8A 5BSKA 1L5QA 4GM1A 2DGDA 5HJEA 2OZPA 3U4DA 5KTTA 1UZMA 3GG9A 3H3JA 2Q5FA 2R1TA 4N3AA 1QQBA 4OXIA 1O6BA 2FW8A 1SQ0A 4B43A 4BFWA 3A9CA 1MLDA 1RTTA 2R11A 3KB2A 4NJEA 3WO0A 5DHPA 2GD2A 1V25A 3BM5A 4F2GA 1DG3A 4RMHA 2P1RA 3HBNA 3FB4A 1CJVC 1XWWA 3C74A 2O2IA 2PKQP 3FNRA 2ODQA 4CLDA 2X0EA 4G4IA 4MKFA 5FNVB 4RXUA 5FXMA 1SHTX 2OQ2A 4AT1A 3LY5A 3O7WA 3DVAA 3PUHA 1Z4QA 4P1ZA 1C30B 2FZ5A 3DO5A 3VI3B 5IVDA 4NZNA 4XUGB 2ONCA 2OBYA 3HKBA 1N8SA 3O9MA 1E64A 1E2DA 4PPFA 2DLCX 2AK3A 5FWAA 4E31A 4NONA 2HF7A 4HDMB 4PHGA 2EAUA 4FFPA 3HU1A 3IT2A 4FFNA 3GQBA 1JFTA 2GWHA 1G63A 2IP1A 1H5UA 2RCYA 2H9AA 2XMGA 1FFWA 3MK31 4WMLA 5JROA 4WNAB 5EE0A 2DXIA 4HGYA 3PGJA 3AEYA 3L01A 3WDLA 2I2FA 1MV5A 1VYTA 1ZGAA 2VRCD 2B8JA 3BAZA 4FZJA 4G81A 3TNDA 1CVLA 1NN1A 3PK0A 6AT1A 1Q0ZA 4MCHA 2A33A 2R7AA 3S8MA 1FDOA 1H2EA 1JG4A 2IGBA 4ZAGA 3PQDA 3GX1A 5EXSA 4A16A 3H5TA 2DUMA 2AOWA 2XCQA 3KUXA 1EBFA 4GRAA 5AIAA 4H27A 4DLXA 3CNEA 4DADA 3W34A 3CPEA 3AEUA 2VP5A 4TWRA 1HDIA 3U09A 1YTLA 4H08A 4F5DA 1F3OA 2GFHA 5EZSA 2ZPUA 4O4LF 4OXXA 2II6A 5A5EA 4A82A 3EOZA 4K9QA 4B73A 5BRAA 1SHKA 2PH3A 5EWLB 4GYJA 4XTCS 1JEQA 4YWHA 1XHLA 1KEWA 3LNCA 3O9ZA 3OP1A 1TI7A 3PUYA 2D1QA 4UJ5A 4DM7A 2BFDB 2FSFA 1PJCA 5B57C 3U7FB 4JBIA 5I01A 3DEFA 4CV0A 1BKDR 1ZP6A 3AGQA 4MVJM 1E89A 1LDGA 1ZCFA 3OMWA 3OO0A 3PD7A 2DM6A 4EKEA 3T6KA 3WGMA 4LF6B 3EMVA 1DKMA 5BR1A 3E7DA 1CZOA 2J9YB 4HY3A 3I1JA 3VZSA 3ZXIA 3SIRA 5HRUA 1DO0A 1ORDA 2C8JA 1WCV1 2EATA 3M5PA 1RC8A 4E14A 4JYAB 1E2HA 1DC5A 3FLMA 3MJDA 1NOKA 5FA6A 1HG1A 4V0NA 4YJ3A 2V0NA 2IHBA 4S1VA 5E4FA 4TQUS 1CS0B 3BQNB 2LIVA 2RHCA 3OQ1A 1SVUA 4NH0A 3TGLA 3LDFA 3E1KA 4QODA 1JMVA 1OKKD 3L6RA 2D2EA 1Y9DA 4F6RA 3I62A 1RNLA 1BWQA 3IQZA 3EEFA 4OQFA 3VPXA 1NTOA 4YR7A 3GARA 4GMDA 1E1QD 1Y98A 4WLVA 5EAIA 4YAIA 2LD4A 3NC1C 2ERCA 4WX2B 5KSPA 4RJ2A 4HHEA 2J5KA 1JSXA 1X8JA 1K27A 3FFAA 4R2WA 4EZBA 1QX4A 4GPAA 1C3LA 3HB1A 2OXIA 1UBCA 2FPIB 4EPXA 2WAMA 3IR5A 4MDHA 2R5NA 3VU9A 1L8XA 3CMMA 4P3OA 4H1TA 1P18A 5JRJA 1T4GA 5SYNA 3SDBA 1A8QA 4CLRA 3OJWA 4NIMA 4EL0A 3IEUA 5KVAA 1WS6A 5BV7A 3IAS1 3NQ41 1TX4B 1I0ZA 2P3SA 4K8OA 4MI9A 3TEFA 3CPSA 3WYGA 2X2OA 2P5YA 3T5CA 3SKYA 3VXKA 3P97A 2BTQA 4I5IA 5HJ7A 3CBQA 3PZRA 4CIXA 3QBDA 1SXHA 4R3WA 721PA 2KSQA 3BL6A 3LPMA 3OQNA 4DT1A 5H80A 4RZIA 2JHCA 1E3MA 3K2IA 3BHMA 1KJ9A 2GTIA 4P92A 4WL0A 4H1WA 3DFIA 1Y1TA 3DBOB 3FLEA 3P9KA 4W5JA 5GOTA 4TVSA 3KEMA 1K63A 2D1RA 4C30A 1DQNA 1K8QA 4YJ2A 4I81A 2F8TA 1T1JA 2LDXA 2BSAA 1ABBA 2O3UA 1OLXB 3D6MA 1JIKA 4N65A 3LUGA 2OYRA 3BFVA 4JL6A 5ALRA 3MJVA 4MZDA 2VDWA 1RJWA 1EWYA 2WJZB 2UUBB 3FKQA 1SOAA 2O3QA 3L1JA 1SHLA 3G5AA 3U60B 4QGGA 1NRXA 2G72A 1CZHA 1BS2A 1XWFA 2HOQA 2XYVA 3QE3A 2ZRIA 4WN9B 1M6NA 1FDSA 1UKEA 2IIPA 3JY6A 3MQ4A 3OF2A 4XUDA 4AMGA 2AF3C 3HWWA 2NZXA 3MS4A 1QV6A 2JZNA 2P9YA 2W2OA 1YRLA 3HYTA 3MMXA 4P33A 2AF4C 3S8YA 1JB1A 4IGKA 1IYZA 2WIAA 4MHSA 3OOJA 5AKEA 5JCZA 4PPYA 3LLUA 3W2IA 1LX7A 3WMGA 3HQ4O 3T7AA 1NM5C 2B0CA 5L3QB 3HZOA 1GL6A 1VB5A 2H1FA 1ODSA 1BQ4A 1XTPA 4EQZA 2FMTA 4MLDA 2F1RA 4UHJA 1IK6A 1BSVA 1IDOA 5K09A 2VWQA 5ECWA 2AZDA 1WA5A 1R5BA 2X5XA 5HF5A 2GKOA 4LDQA 1BDHA 2H7YA 3KTFA 2XUKA 1G98A 3C5CA 2E4YA 4LMAA 4LRXA 2PUFA 4TYQA 3ANSA 1VJGA 3MBKA 4TRMA 3BZBA 3C6YA 4J4TA 5ESWA 3PX7A 3PHJA 2JFUA 4OV6B 4C7MA 1S3SA 3NHRA 3TYXA 4QC2A 4OK6A 5EXTA 2BJWA 1BX0A 2OR3A 1T8UA 3O2NA 2KX7A 3ZGNA 2CF6A 2WJ4A 3B2EA 4X1YA 5ALNA 3ZCQA 1BS9A 2O8VA 4Y6PA 4N39A 1AA9A 2ISCA 2AI3A 2R751 3NHJA 2CL5A 4H0NA 4LK2A 3QKSA 4S1TA 4WXPA 4C0LA 5LSAA 4LNHA 4CMIA 1ZUNB 3ZUPA 1CUBA 3N7TA 4EW3A 4C7OA 2C03A 3KV1A 3L7YA 1U98A 3R77A 2CDNA 2HLPA 2NYRA 3DMFA 3S99A 2G08A 2J09A 4QGHA 1WETA 1JTVA 4M1EA 1DADA 2EKBA 1XTIA 2OG1A 3FE2A 4MI1A 4QXAA 5HWSA 1CF4A 3A1TA 1EUQA 4NCBA 2KYRA 3U3OA 2BEWA 5JJBA 3JQFA 2VDOB 2HUNA 3T94A 2FZ4A 5INTA 3HUUA 2D1YA 2ZBEA 4BFCA 3GLQA 3EVAA 4WDQA 5E2BA 2HRDA 3ZNOA 1JWBB 2RAPA 3W2HA 2WBLC 1ZK1A 3KXLA 4YRFA 3WKDA 4RLHA 3BJMA 5DCLA 3VZCA 4OCZA 3BIWA 3OZCA 3A6ZA 5ALHA 4B84A 3PR1A 4U63A 1REQA 3B51X 1RHMA 1Q7TA 4K9NA 2ADFA 2C7VA 4YX9A 3F7NA 5H3LA 3DE4X 2Z4SA 1R5NA 1CQWA 4NMWA 1BE6A 2FWMX 4P86A 4DA6A 1IZ9A 4M9QA 3GBSA 3UMCA 2VTBB 5I7RA 5I51A 1W5SA 3KOZA 4KN8A 4RXMA 1WHTA 5IF9A 1JEYB 1COWA 1EK1A 1GFIA 3OH8A 3QHQA 3JPYA 3QIVA 1QTQA 5D85A 3TW8B 1RE0A 4UTPA 2F6RA 2E4XA 4XVHA 3B6IA 3WBBA 3F4LA 1LBIA 1WXWA 4O59O 3RRBA 1BWSA 2N47A 3FDZA 4ZOCA 1H5QA 1JSLA 4D9MA 1GPNA 3D8HA 4CMEA 3EOAI 3QYFA 1P5FA 2BCGY 2OXTA 4EEZA 3GRZA 2IYVA 4Y2GA 4KYVA 4DHWA 2ZZNA 1QH8A 3CEJA 1XU9A 4LV8B 5HKOA 4ZEWA 1C2YA 5C18A 3ILYA 1GU1A 4WY8A 4JBGA 1T6NA 3JZMA 3QW2A 3OZDA 4MV5A 1QKKA 5L45A 4OLFA 1TAGA 4TS1A 2NPFA 5CBPB 1W581 3EIFA 2WM9B 3O7MA 1N92A 3ZE9A 4RJJA 1RQNA 4LE2A 1EUZA 1VIVA 4B74A 3GIDA 4ZV7A 3LXXA 2P4EA 4Q24A 1T4CA 4H4CA 2I91A 2DLNA 1TO2E 2IPXA 2ODPA 2RJNA 4R1TA 1DAMA 5E6UA 2Q3CA 1IZZA 1T8YA 5J9FA 1TZBA 3ZTTA 3SVLA 2IRWA 3EVCA 4I9GA 4X3OA 2L0XA 2FUNB 4EA6A 3WZMA 1DIAA 2R7MA 4REQA 2UDPA 2BFNA 5CU7A 4BUCA 2JARA 5KYTA 1E1CB 2VRNA 4MYHA 1DJMA 1WU8A 3WK6A 2XAUA 3KELA 5JXGA 3C5WP 4J0CA 1TFRA 3LYLA 3P9RA 1TOAA 4RYDA 1T4MA 1U5BB 4FSDA 1W5FA 3TQHA 5KYGA 2ID7A 2H18A 2JD2A 1JGTA 1EXVA 2YS7A 2IP4A 2ZJ1A 4H16A 1C1XB 4FE7A 1DO8A 1R8YA 1D2NA 2DKNA 1VMAA 4OJNA 2Z3VA 1L3CA 1YNOA 4LTNA 1B7GO 3FDJA 4P83A 4J9VA 2CBGA 4TGLA 3MTGA 5JCOA 1N6PA 1VRVA 4MWCA 4EMTA 2QAGA 3I37X 4O4LA 1XCPA 4AYXA 1L5YA 3MWEA 2I2WA 1XKLA 8ADHA 1I10A 2JFNA 4Y1GA 3K6JA 3K0BA 3I3OA 1YT5A 4NAUA 4YRPA 5CBKA 1R6XA 3EEQA 4TLLB 1ELOA 4N18A 3S2ZA 4HV4A 1BVHA 3HY4A 5J63A 2M6RA 4BEVA 1ZUD1 2HGSA 2FTKE 2Q5LA 4Y7CA 4X6UA 1J7JA 7GPBA 2C5FA 1X87A 2KS6A 2RI0A 1F1BA 4WKBA 1QMPA 3OCZA 4F5YA 2V55B 2VPXA 3RTDA 3WQQA 2GTHA 4H1UA 4HDOB 4ZYYA 3A27A 3ZY4A 4LJ8A 1DELA 1V5IA 3RBAA 2V9PA 2YVQA 5CFLA 3OD1A 2OV1A 4MYUA 4DBVO 1CV2A 1RBQA 3EDYA 2PKRA 2JAOA 3H1FA 1UANA 2OBNA 5DBHX 5FR1A 3HUTA 1EFAA 3LT1A 6CHYA 1W8IA 1Y7IA 5FJIA 4QFBA 2UXCB 3DWFA 3PBKA 1EJ0A 3DLTA 3DEKA 1YI0A 3GFQA 3OEWA 4XM0A 2VF8A 1RVDA 5B1IA 2WIFA 4AAYA 2Q1TA 3TD9A 1WF6A 5IDYA 4E4YA 1QGZA 1QORA 2O7VA 3QXXA 2DQKA 5CHYA 5KHAA 3WHIA 3O92A 2P90A 3KKEA 4TXLA 3IEKA 5JWHA 3CVUA 3PQ6A 4JI7B 4E5YA 5FB3A 4HP8A 1AK1A 3SQXA 5GOZA 3SM9A 1M7GA 1SQ5A 2H3HA 5CVTA 1Z39A 1GVNB 1T6ZA 1N7GA 1MG0A 5D1NA 5CLQA 1LVUA 4OU5A 3LTEA 4URUR 1A8IA 1H4QA 2PK3A 1JFFA 1UPXA 2GJ8A 3E7XA 3KALA 4AJEA 4B46A 1WIWA 4C76A 4BO0A 4ZOEA 2BVNA 2ZQZA 1V9LA 2WICA 4FTWA 1I6WA 5FI0B 3FNHA 1K97A 3GFSA 3FOEC 1L4BA 1Y6RA 3PIRA 1TXGA 3EDQA 3R5FA 1CY8A 1LCIA 4D9EA 1N8NA 1OF1A 2DFLA 1OBVA 2CVOA 2ZE6A 4ILKA 5DGDA 5J5AA 3QUTA 2BW0A 1GRCA 4MS1A 4Y67A 2VAMA 2Q5OA 1Z29A 3WK9A 1E3WB 5I7EA 2IYQA 4UREA 1NMZA 1PT5A 2R65A 1SXJA 2YHIB 1R4NB 4ZVQA 4KX5A 3PLAE 1FUEA 1TJ4A 5MFPA 3UANA 3VVMA 1HYGA 2BFWA 2BT4A 4NV3A 1Q11A 3BXGA 2YFQA 2A88A 2J3QA 2FCAA 1IPEA 5F1KA 3D7MA 4KAFA 3FVRA 1QHIA 2AWNA 4R40A 4QOGA 1CS4C 4S2UA 3C5VA 5MDHA 4I1PA 1N2CA 1CULC 4L9RA 1Z07A 3KQPA 1EVKA 3TSZA 5JQWA 4JJ7A 2PH7A 4L08A 3UJDA 5C7IO 1PR5A 4BNDA 1QIDA 2C7RA 4QDZA 5FNZA 1ISRA 3LSYA 4QFMA 2HI0A 5K3AA 5B6JA 2OHFA 3EVFA 4W4TA 2FR8A 3HSYA 2O07A 1U0SY 3IKLA 1Q92A 4ZT2A 2XNSA 4EP1A 1CZKA 4MQMA 3N7UA 4TKVB 1WMSA 5T8KC 3TRFA 5IU6A 3N05A 5BOSB 1WXQA 4DLUA 4RV4A 5JASA 3DMTC 1EDOA 3FBGA 1N2SA 2A9KA 4FS8A 1E0KA 3CWCA 3E3MA 3I6MA 3DR3A 2B8NA 2E5FA 4LE1A 3ESAA 5KYVA 3RQSA 4DEXA 3L40A 1SCDA 2N42A 1THMA 1C29B 3FCAA 4BVLA 4UEWA 5DCYA 3TTYA 1S3IA 3EBPA 4RH0A 5JHHB 1A96A 1BEEA 1HDZA 1RAEA 3K16A 4QU0A 5DLDA 4C4PA 1UXJA 2FLKA 3NP9A 4NS4A 5G0SA 1FNCA 1KVSA 4BMOB 5J2UF 1GZSA 1DOHA 3TTSA 4XJSA 3INRA 4ZCSA 1WLSA 3G23A 4DIKA 4BWGA 3GJ7A 2D1SA 2HL6A 2MSKA 5KTSA 3CEMA 3SHTA 3SS8A 4RV9A 4ASUA 5BR8B 5EUMA 4F6LA 5F77A 4NNOA 3S8EA 1QCCA 3DOHA 3EJ6A 2E4UA 4IHAA 4KYIB 4ZHSA 4IWXA 5FOUA 2XYRA 1OV6A 3C0KA 2J3JA 4F2HA 3C43A 4R7GA 5HMLA 3L79A 3RSZA 1KI9A 4Q93A 1EQ2A 2I3BA 2DEUA 4WWHA 4CKEA 3B2NA 1N2IA 2HF2A 1RLMA 4M1WA 1HT0A 1NP3A 2GKSA 2PTGA 4GOOD 1P80A 1WZUA 1V8DA 3L4BC 4N5HX 1A9YA 4CUZA 5B64A 4FR2A 5ESDA 5BV8A 1JF8A 1MA3A 3NRJA 2DUNA 3F5QA 2GM9A 5TMDA 4RANA 3W8FA 4OQPA 5CUQA 2X40A 4YJHB 5JWRA 1NP7A 4J1QA 4KIJA 2QTWB 1KZHA 3X3HA 3E70C 3GLFB 1KEEB 1P1KA 1UMDB 4K9PA 3WLFA 3ND6A 3FNEA 1WD5A 4YRLA 3F90A 1ZX1A 2X2EA 3K0FB 2ZFUA 1QZTA 3E6AA 3NHLA 3ABIA 5ARBA 2PGIA 2VOJA 3TLJA 2VK8A 3PVSA 2JLRA 4QGAA 1M0WA 1JLLB 4YRMA 2PFKA 4PLHA 4DSTA 2WUDA 3GVCA 4MRMA 1PTKA 1RE1A 2PBLA 4X85A 2JBHA 3DNMA 2VDNB 3P20A 1FMCA 3BGOS 4BDTA 3WGVA 1N5OX 4F4JA 3UXMA 3BGWA 4CMCA 3G8BA 5JNLA 3R3JA 4EPYA 3RSHA 4DDTA 1Z0IA 2CD7A 1QANA 2WHPB 4KWTA 2BBSA 4C4TA 2X3UA 4WKGA 1CIJA 1U2TA 1BEUB 1X3SA 2G8LA 5HS6A 2JA2A 3OKPA 3ZVMA 4HMPA 2XPCA 4HUJA 3ZCSA 4EUSA 2QGNA 1ZXBA 1GSIA 2NZUG 4KPUA 1KOLA 3VKUA 4MH0R 1T9HA 3CLSC 3SDZA 4F4DA 1JQEA 5A6VA 3ENQA 1P8JA 3CNOA 4YASA 5LFAA 1GPUA 3UJBA 4ER7A 3FAKA 3RASA 4PINA 4MQEA 3ON5A 4PRZA 1GQYA 3I30X 1G41A 1Y5LA 4Q03A 1G8JA 3ICPA 3I9FA 2CYCA 1I2MA 4D8VA 5CJJA 2XYGA 1KR5A 4LHSA 3WWOA 2BRUC 4ENVA 1DUVG 2XIJA 3ESCA 3QUSA 3U9SA 5HE9A 5I8PA 2J3HA 5FTKA 4J07A 1FP4A 4CCAA 3IA7A 2FPGB 4G84A 1BX3A 2XDYA 5IMBA 1X8LA 2VTVA 2CNLA 3B9QA 4PCUA 2I62A 3NHMA 1O6GA 3NH6A 5LIRA 1E2JA 3OZIA 1MIOB 4C2AA 2QMYA 3ZVLA 5THKA 2OZEA 4FS3A 4WZAB 2CD9A 3C45A 3DPUA 3LKVA 4WCFA 1YHYA 4M7OA 4QUDA 4K6FA 4EO9A 4ZEOA 2JGFA 3D3KA 1XZJA 2X1MA 3IHWA 5JSZB 2DERA 1T2EA 1FP1D 2PFGA 3O94A 3CUUA 4P82A 3O8RA 4IR7A 3VAAA 4FCWA 3WICA 1WDWB 4OA5A 3DLIA 1KRXA 1IUKA 1E2NA 1YS7A 3PFNA 5KPJA 2VQ6A 2VK2A 1PF7E 2GWRA 4LRSB 5HKKA 4WT7A 1M5RA 4LWOA 1GQQA 2PR7A 4FONA 1C1HA 4E5KA 3NDBB 3CKLA 2JGKA 1UBTS 2QMQA 3BBLA 1BDBA 5BSTA 3EISA 4YT2A 2QN1A 4R1PA 1TW3A 2C5LA 1EZ1A 1DDIA 4MRAA 3RAJA 3U7RA 4UUQA 2A9VA 4KAJA 1N5JA 2GPAA 3JYQA 3LCRA 4RVSA 1UMBB 4FFOA 4QHYA 2FW1A 2O3RA 1E79A 3FIUA 3Q1KA 3E9ZA 2XYHA 1Q20A 1OJLA 2AOUB 2IXTA 1YB6A 5KVCA 4F84A 2BLNA 2FZCA 4CM8B 5C9ZA 5K0GA 3TQSA 3RI3A 4OGLA 5AVRA 1QYIA 3WDKA 4KE9A 1VC2A 4UM9D 2OUIA 4B7UA 2JD1A 2YWRA 4Q3LA 2JB9A 4C4RA 1QHHB 3O47A 1W0JA 1BMTA 1GGJA 1S96A 4YP0A 5D3ZA 5EMKA 3S29A 2QIPA 3T9EA 3DFUA 3BWXA 4B3RB 1ESCA 2RK4A 1JI0A 4DLPA 5KSZA 3TKYA 1TECE 4Y1FA 2PYZA 3AF3A 1Z0FA 2CZQA 3R3YA 1Y4DE 4XVQA 1BFDA 1Y0BA 2ZXEA 3E35A 4BCBA 4WBNF 4I99A 5HS4A 2CCJA 3QF7A 4Q82A 3WL6A 1LRJA 1G3MA 2W83A 3KQSA 4Z7OB 3R0VA 3SYNA 2Y92A 5FAXA 5HTOA 3VR5H 4UEKA 2OEPA 3ZDZB 5A0FA 2XMBA 4PG5A 1UKAA 4YT8A 5IJWA 4XWWA 4C20A 1WL8A 1AE1A 1UPCA 3IJ5A 1K89A 4LHWA 5JISA 4R9NA 3T95A 1UKZA 2EU8A 5EUQB 2IYZA 3VPGA 5AM2A 1QPZA 4GQIA 2ODNA 1SU8A 1QK5A 1SA0B 1W52X 1Z5ZA 3QLEA 4MULA 4KFRA 5AK6A 1YJ8A 4Y6LA 3Q3EA 3OTQA 4MITA 4QUJA 3OX2A 2OORC 1W4AA 3QKRA 4AS3A 4HWRA 2MU1A 4M36A 1YRYE 4GBJA 2CVHA 1HURA 1NUQA 1WDLA 5JG7A 2NMVA 2EZUA 1XZ8A 3PNSA 4PSCA 1W4RA 3P9CA 3WOHA 4Q9NA 5KOHA 2JFQA 3ZI4A 5K2MA 3IMFA 1S7GA 4U5XA 3TQQA 2NVUB 1SVMA 4EBBA 1TYEB 4M89A 1H0RA 5K8LA 1RLOA 4GXQA 4HI0E 5BUCA 4KR9A 1NP6A 1EP9A 1NUUA 1RRFA 1E3DA 2QUKA 1R9JA 1D6SA 4J29A 1P4RA 4E4RA 2PQMA 4J7XA 4LZWA 4TQAA 5G41A 1GPKA 4TTSA 4NCNA 4K9SA 3I28A 3HVRA 2B98A 2IYLD 3K09A 2WLSA 4YQEA 3WRXC 3JD4A 3P32A 1Z5NA 1PX2A 2A0KA 5ALDA 1DJPA 1A9RA 1R9MA 3TG2A 1O5IA 2AFRA 2EGGA 1V4VA 2X77A 3FTCA 3IUMA 4MR8A 2JGMA 4P93A 3HCFA 3SR3A 3E23A 3NMUF 1VSVA 1EE9A 3ASYA 2AN9A 3GFOA 3EXIB 1QV9A 1ENZA 4RJIA 1N78A 3I61A 4R54A 4M8SA 3HVJA 1CFJA 2I9PA 4FYJA 1GCGA 5LPNA 2YRFA 4ID3A 3R8XA 2EF0A 3NYQA 5LR6A 4G5YA 3WXMA 1EVYA 1PFQA 2Q4DA 4PTZA 4QVGA 2FSHA 1OFUA 2D2VA 3TNYA 4AUMA 3S81A 5AVUA 3IV6A 4Q4JB 4A03A 4EJ2A 5PGMA 3MGGA 5AVWA 1JAYA 4HZUA 4A7PA 3H18A 3CONA 3UM9A 4DZZA 1UDRA 3DZDA 3H65A 4KOAA 1IHUA 3TBFA 1B2RA 1ZI6A 2QVGA 2XMRA 1RM3A 3IHKA 3ILSA 4N01A 2X76A 2R6HA 1OZHA 4TPKA 4UHKA 5U9CA 2P3QA 1P4HA 1Z5GA 1GFZA 3E84A 3LPCA 2AN5A 3GR6A 3MB8A 4KV7A 4GFDA 3BMOA 2H2GA 3WGHA 4W7SA 3ZWMA 4B87A 3S2FA 4ER5A 5KEIA 3K5WA 3VR6A 5J2UA 2VUIB 3H4MA 4MGKR 2XE4A 4Y6QA 2D5AA 5CMLA 5LXTF 2Q7DA 2Q0HA 5BN3B 4BRZA 3COZA 3MT8A 1AG9A 4IOJA 1T3SA 1TT7A 3QG1A 1JG6A 4Q1AA 4EI9A 4IDAA 1M2KA 4HEHA 3TE6A 4EITA 1LW7A 1Q1QA 2YYSA 3FYHA 3TBKA 4HLNA 4JLBA 2HJGA 1Y9AA 4NWIA 3ABZA 1QGUA 4JQZA 4CFSA 4G26A 4F04A 3P5BA 4JI0B 4A0GA 4P4GA 3CZ5A 3ZHUA 3N0RA 1JAHA 2GK3A 2DJIA 4JI4B 3NM6B 3ETNA 4RA6A 4XGQA 1A9ZA 1ARZA 2DBQA 5FFNA 1X7YB 4PZUA 3HS3A 3AKZA 3R3ZA 4GKKB 3VR3A 1A4UA 1DB3A 1P44A 2QD4A 4MUHA 4PF1A 5IBPA 1JE1A 1RAGA 4BQNA 5LQNA 1AA6A 1Z5PA 1S2IA 2EC5A 4LJ9A 3KSAC 4NG5A 3PPXA 3I52A 4OX9Y 1WZIA 2PUDA 1Y1SA 3QKIA 3H2GA 4EY5A 2XF2A 4BYGA 3JV7A 4JBLA 4GH5A 2OV6A 1V47A 2A59A 2X0DA 2RKBA 4RLFA 1EE1A 2GZSA 4DUPA 2DBRA 3BL5A 2DWUA 4GPZA 1B73A 2XH8A 1N2JA 3BDIA 1CR2A 4YRBA 1PX0A 2JAQA 3O4HA 4YLGA 4DDHA 4BS9A 4QFDA 1S7CA 4K9MA 2AFIA 1E58A 4JUDX 1LLUA 1XAHA 2UUOA 3LIPA 3LT0A 1Z3CA 3PENA 1FTGA 4NABA 4GWGA 4JP5A 1ONBA 3VV2A 2ZSFA 2BGWA 3JQBA 4P4TA 3BICA 3RBZA 1AF4A 1LQUA 4DW8A 5DTMA 2MYPA 3SBEA 1VA4A 2ZI5A 3PPYA 2IUTA 1AKEA 5IJ0B 3WWZA 1U94A 4OK5A 2O1SA 4HVLA 1Q19A 1NASA 3ZCTA 1JECA 3QU2A 4KWCA 1G6HA 2YV5A 5G4LA 3MGKA 3MWLA 3OJ0A 1RABA 1JU9A 2DFKB 2UYCA 1XLUA 4WGGA 2RBGA 1KSJA 1SFRA 3JQPA 5T57A 1QP7A 3FUVA 3KBOA 4E6PA 1THGA 3WWEA 2X15A 4HDKA 4KO3S 4BTEA 5LU9A 2BM9A 1RXUA 2KBFA 2NTYC 2NYVA 1MVLA 1PFGA 2YN4A 4FYPA 4OI0A 2JJ2A 2YV3A 4V24A 5TARA 2XNDA 5FH9A 3LQRA 4ND3A 1J9ZA 1NYTA 5GJBA 4Q3NA 1WPXA 2A4MA 1DIHA 2Q1SA 2GZ2A 2DHRA 1QHGA 3PGVA 4HBGA 5K1ZA 6GPBA 1XD9A 1EXNA 3RF6A 1DWPA 3PUWA 5SY4A 1Y5RA 1DEXA 1RQ2A 1VKNA 3EJWA 3P19A 4R31A 4CIDA 4EGJA 4FU0A 1ZYUA 3DAPA 1G59A 3KLPX 4INPA 2JHGA 4AG3A 4ARCA 3KEOA 2PX3A 1KJ8A 5AJYA 1XYGA 1IN1A 1TM5E 2ILVA 4MGHA 3KJIA 4U0KA 1XQYA 1PIWA 2G07A 1K5PA 3SQMA 5E9QA 3RRZA 1IXYA 3SSAA 1WUTA 2ZAIA 1OX4B 5EG5A 5G0VA 4CQJA 1R6TA 4P22A 4PM4A 1CUZA 4EHIA 4Z99A 5HQTA 2UZ4A 10MHA 2I99A 1I4OA 2ALJA 2LXNA 3H04A 3ZNQA 2QRKA 4IMJB 4B2LA 2EEPA 1P2BA 4GOMD 2ANBA 3BRCA 3TLYA 4C04A 5ALVA 3TMAA 3O4VA 1ZCJA 1UM9B 4ZK6A 2IHVA 3K9FC 4ER0A 1F0YA 5LUBA 1J2YA 2IV2X 1PQPA 2NZJA 3KDSE 1OI2A 1JXQA 1PO7A 1V3TA 3EQ8A 1M67A 1M2NA 1ZVMA 3QNUA 4X8HA 4Y1RA 4C3VA 4PZYA 3QY9A 1SUEA 3HGQA 1WPGA 3MS7A 3PFIA 4GC9A 4GVXA 4XSGA 1V8FA 1ZKDA 3P9SA 2IYFA 2YBDA 4YV0A 5KS2A 3EC7A 4QHTA 3MTBA 3EVNA 3UHFA 1DAEA 1IEQA 3GZNA 3FDXA 4IUYA 2X6TA 3ZR4B 3GLIA 3UAWA 3JAWA 4QX6A 3EX7C 1UKBA 1T8TA 3GJTA 3W1EA 2PV7A 3MSXA 3N3AC 3V7NA 4KNVA 3B6JA 1FBNA 3EXHA 3FJYA 2CXSA 3Q0TA 1XZPA 1QIEA 3ZHZA 3EGVA 2QLFA 3SMVA 4A0HA 5B36A 5B2FA 1FRQA 3H2JA 4I3GA 2RBKA 3A32A 2C0PA 4XOIA 3NJ4A 3WIOA 1YVPA 1KH3A 1U3TA 3T5AA 4O4JF 3PSHA 4UHHA 3RS2A 3FJ1A 3UV3A 4WBNA 2Q2OA 4CLEA 1EZ4A 2NZ2A 4CM3A 3KYDB 5FEUA 2FMHA 2W8ZA 2C7PA 1E8MA 4XR9A 3TLZA 3J7TA 1HLGA 1SG6A 3FWKA 2FR0A 2XWPA 1EWRA 2VSNA 3DEZA 2GESA 3EGDA 5B53A 4CNBA 2QX4A 3ZE7A 5DTJA 2WJVA 1O97D 3SQDA 1B2LA 3RR2A 3TINA 1U5CA 5EUBA 3WV5A 3Q9LA 3HP4A 4KIUA 2QIOA 3DLPX 2F90A 2WE7A 1ST3A 1U2RA 4Y2RA 1Y5MA 3ZS9A 1TO6A 5HUJA 4UEJA 1JA1A 4MQ4A 4HNUA 1JAZA 5JDIA 1RXWA 4FI3C 2HX1A 3ND5A 4J3NA 1G2PA 3WIUA 4DN6A 3NLLA 3B1JA 1KARA 3DUFA 3ECAA 4Y2TA 4ENSA 3BWVA 1RAAA 2F3PA 3T3HA 3FOWA 1PK9A 1V45E 4KP7A 1NZJA 1J70A 5GY7A 2IODA 2R8PA 1QK4A 4IYJA 3VO2A 2YUTA 4PYIA 4D6XA 1QUEA 4I4TF 4DNOA 2XQFA 4I6JA 3E1SA 1RBYA 2EHJA 2VYQA 1PG0A 3L0SA 1W8DA 2LW7A 3T1TA 1E5VA 2Q5IA 2B78A 2C42A 2Y05A 4KVAA 1VHDA 3HRIA 3IOCA 1KXJA 5CVDA 4EVSA 1QH9A 3CLRD 1TKAA 4FYIA 5DSXA 2Z2XA 4YMHA 1O94A 3LKBA 3RS5A 2BEVA 4D5EA 3IHLA 5IF3A 2VCHA 2AFHE 3I5AA 4GGOA 4DABA 4J0QA 1ZD8A 3HKDA 3KUUA 1YB7A 3LE8A 1KY5A 3E3LA 3W5UA 4AIIA 3UFBA 1GV1A 1GGEA 1LPAB 2C5GA 3DE7X 3SC2A 1LS1A 3TF5A 2JHFA 1PFKA 2QRHA 4XRGA 2C2HA 1M0EA 4K6OA 4P9NA 2EBHX 3D6JA 3NBXX 5HIKA 1P7PA 1M5UA 1U02A 2IOQA 3U7JA 3DJFA 1KETA 4H17A 4DV4B 3LZCA 1PW7A 4WFQA 3M34A 3O4GA 2OZLA 3D3WA 1MO4A 4H15A 1COWD 4G0XA 4B3HA 3K9LA 3O4IA 2CJXA 4DUYB 2BSQA 2V8OA 3NDJA 2BP7A 2I22A 2J4FA 5AVVA 3T3DA 1ULHA 4DQDA 2EL9A 3FHTA 3ANMA 1A4XA 4DJFC 3BSFA 1BGWA 3ESRA 4JNKA 5E7MA 4AMYA 5DM60 3UJNA 3WJ2A 3OZ7A 4CETA 1UMCA 4II2A 1R88A 2WSBA 4OHWA 3KKKA 5KX5F 2CEAA 2ZYDA 1I32A 2AG0A 3P4YA 4M0MA 2QXTA 4TL7A 4NY1A 4C7BA 4H6WA 3PI6A 2OE2A 4EYKA 4Z4QA 1E6LA 1R4MB 5LKAA 1Z33A 4EG8A 1HGXA 2ECQA 4MWDA 3KDAA 1CB0A 5SICE 2FK7A 2FPRA 2GN8A 1AF7A 3H2IA 3IPXA 2G06A 2H9IA 3BSWA 2IWRA 2WMNB 3UG6A 3ZKWB 2P2LA 1J8MF 3I64A 4JGIA 4M46A 5H83A 5AO9A 4XLZA 3GB9A 5GP1A 3ADOA 3QPWA 1QGOA 4NYJQ 4E2XA 5LXTA 4HEQA 1KBZA 2Y71A 2BH9A 1JHDA 5EJ2A 3AO0B 1IBCA 4N8EA 5E6SA 2AFHB 3TEMA 4R8SA 4AUEA 1ZAKA 3C5HA 4CIYA 2YYZA 4D96A 3VHQA 2B99A 4KR2A 1QQAA 3H8WA 2BJVA 3K53A 3FOZA 4ZCIA 1TZJA 4C4SA 4QSMA 4YV7A 1LI7A 4TOIA 5I9IA 2HK9A 5JR3A 3COSA 1FYVA 1H3FA 2XMZA 1AQLA 4IDCA 3ABOB 3O91A 3PVCA 1XZGA 1Q0RA 2JLBA 5CHEA 1O96A 2PA3A 2PWYA 3MFQA 1WQ3A 2BMWA 2ETVA 1Z0AA 2HXSA 3M9LA 3BK7A 4HXYA 3U40A 4NBWA 1JQ3A 1V3UA 5FWYB 4F8EA 2CL0X 3G8YA 3WNVA 2RHJA 2WAYA 4R5MA 3A4TA 3BE8A 2EFDB 3GH1A 4K6HA 4BNZA 1BQ3A 3G7SA 3S2SA 5FO1A 2YWXA 1ENPA 1QKJA 2F3RA 4B75A 9ABPA 3JQQA 5D51S 3F1KA 4LK3A 2YCLA 3MTDA 1CQZA 3ZV5A 1JLKA 3R0QA 2LCFA 5B7QA 5TE9A 4LYAA 3GFGA 3W6ZA 3G88A 3AU8A 1M33A 4HYQA 3U3XA 4OQLA 1PSZA 4QXRA 4WLOA 5DM0A 2GJKA 2PTHA 4DJAA 3FD8A 1XLTA 3RTAA 1LBEA 3QXHA 4Q9HA 2GN6A 1NJFA 3HWSA 3TM4A 4NYMR 4AJ9A 4TUYB 1OB5A 4D0NA 3KQQA 3N8GA 1RHJA 4CKBA 1XQ6A 2R86A 3KQHA 3MFYA 3ZI0A 2ZJ5A 5IJ9B 3OSUA 4FP9A 1C8KA 4WERA 3W2TA 3IQIX 4CT4B 4NZPA 2GCPA 4DPKA 4KSYA 2Q2VA 1J0AA 3A9VA 4L6IA 1LVGA 2RGCA 4IJMA 3QX3A 5K20A 2P41A 5CCXA 4YRNA 4QVIA 1IJEA 2BHSA 1OH7A 4EA9A 3V4PB 1VHWA 2VDJA 1I33A 3LGXA 1ZJ6A 3M6XA 4BVHA 3ZZNA 1Q7RA 3KG2A 2NVOA 2ZT7A 5JZOA 4BRWA 3AY6A 1TEXA 1S01A 2TYSB 4WN3A 2HQRA 5KVSA 5LZ4A 3DNPA 3EULA 4X24A 3RUIA 2CHGA 5ECGC 1I3CA 2OMEA 2OO3A 3JQ8A 3JQ9C 4L02A 4QQNA 3FTEA 3RVNA 4BKMA 5CA1F 4BLOA 3L6CA 4A27A 2JH9A 3AFNA 3NTLA 3GWGA 3P45A 1B1AA 2YYYA 2HK8A 1Y7LA 4DILA 3M2PA 1WVMA 3ZHSA 1PTJA 5DISB 1HFKA 3JALA 4RSHA 2DR0A 4AO6A 1FSGA 4DA8A 3J81k 2P9HA 2WFZA 4KPGA 1R8QA 3COJA 3BD6A 5DHRA 2I67A 2FRDC 3DEAA 3BD9A 3ORQA 3HBFA 4OI2A 5UKDA 1Z5OA 3Q3VA 1CUXA 1NE7A 4DV7B 4RHCA 1Y8AA 1Z82A 3IIMA 3PQ2A 1W4ZA 5GADl 3DHVA 5HYVA 5L4SA 2JAUA 3DE6X 4PLYA 3ISVA 1F06A 1RRKA 1WP4A 1VM6A 1CX9B 1WAMA 3SXUA 4OGWA 2VJCA 3R4VA 2ZANA 3UKJA 2AQKA 2P0YA 1VIDA 3BK1A 1A0OA 4D3SA 3P1JA 3O4RA 5LMZA 4ZHQB 1H8EA 5DHSA 3ODPA 1J21A 1WP9A 4Q1EA 4PONA 2WK1A 3OY7A 5DGIA 3SU8A 3WMXA 4WQMA 1NRIA 4UE3S 3MD0A 1YMQA 2PAAA 2BFFB 4RPJA 1SR8A 4EW2A 4JEHA 5TMPA 1XR3A 4ESEA 1IN5A 2FN4A 3LLSA 1IULA 2BCJQ 2I2AA 1WMEA 2P30A 1SXJD 3EXFB 2B4KA 2RGAA 2VHYA 1V2GA 4DSZA 1ENYA 4UULA 2ISSD 3L6BA 3HFGA 4J1NA 8ABPA 1IK4A 3A6JA 5F3WB 1SIWA 1EHIA 2QL6A 2WHRA 3D4IA 1TK9A 2R7NA 1OWOA 3KWJA 2AL7A 5AOBA 3RQIA 3RWBA 2FPUA 3MYYA 3Q9NA 4I6GA 3SF8B 5I9TA 4E07A 1LY1A 1EFUA 3L1HA 4NARA 3RBVA 3W2FA 3S1SA 3T3MB 3VSBA 4WPGA 4YJGB 2PFSA 3Q8KA 1CY7A 1VI5A 1DC7A 1BN6A 2IGTA 1PW5A 4P58A 4A2WA 4RL4A 5MF6A 1N3BA 1TDJA 3BTSA 4G1FA 2QT0A 1T36A 3B1ZA 4CM5A 1TJ5A 2L2QA 2AV6A 2O0LA 3H5OA 4L57A 5E9JA 3DV0A 3HXTA 2A3NA 2ZETA 4IHJF 4PU0A 2VIIA 2HV8A 4UAJA 1FTNA 2WVHA 3VSAA 1JPNA 1DE0A 2Q6VA 1AHPA 2BUBA 3THWA 3L0PA 1RYEA 1OSNA 4LMRA 3NIBA 4MEBA 2H3EA 2E1PA 3Q7PA 1X80B 1YR9A 1W85A 1U0TA 4FZ3A 4O4JA 1JH8A 4NCHA 4V0OA 4B48A 4DCPA 4UNNA 1K3FA 2ZM5A 4MWTA 3MHTA 3NU1A 3IDZA 5EZYF 4BATA 3KL2A 3DT9A 2XUJA 3GJ6A 1JI3A 4ARVA 2DKOA 5IW8A 2F4NA 1PRYA 2HRBA 4YMTA 2W48A 3AVUA 1N1GA 1JQAA 1LPOA 2GN9A 3DVLA 3WY9A 2L42A 2QK4A 3N2LA 4ZOQI 5EPEA 2QF7A 3A1FA 1ZVQA 3FOAA 3QVTA 2H2FA 4DMUB 1E7WA 1XAIA 4TYNA 1NFFA 2AN4A 2IXDA 2QAIA 4WBXC 4ALMA 4EFKA 5H81A 1HFWA 2NVBA 3BEOA 2B5WA 3HYSA 2I7DA 5E7QA 3NHPA 3ZY6A 4FMPA 3QLUA 2J4DA 3VA7A 2AQ8A 3DD5A 4PVDA 4I4TA 1UBRS 4XQGA 4YA6A 4ARSA 2YRXA 1JEOA 4B45A 4JZYA 2PRIA 3H19A 5L3SB 1HMPA 3LC7O 3HUFA 2EJCA 3LWBA 1YCFA 3LX4A 1XK6A 3RC3A 2DWCA 1UBEA 3MXTA 4EWLA 4R6WA 3T06B 4RPKA 3BILA 3ECCA 1ODJA 2JATA 3BDVA 4Q4AB 5AFSA 5JRDS 1NLMA 4XDZA 4BEBA 2ZUFA 1SCUA 3O21A 3OZAA 1GNTA 4KPEC 1YZLA 4WHMA 3DOOA 3AETB 5AVTA 2JANA 3AL2A 4FN5A 1W88B 4ZQBA 3ZN2A 1E3TA 2AC7A 4NI5A 2MYTA 3ZLBA 2HRRA 1IOLA 2Q9CA 3DQPA 5A3VA 1TUGA 1WR8A 4LI0A 1P81A 3EH1A 1RFLA 1ZD9A 2R5WA 2GS9A 1Z12A 1PJZA 4PSUA 4IMIB 2YZKA 1AGNA 2D2IA 4JLOA 3T3NA 1NYLA 1EVEA 1NIJA 2C1ZA 4R6XA 4EHNA 5C8VA 2OCGA 3B1FA 1V5EA 1KSFX 3AU9A 1ZM3A 3CRQA 4YCJA 4MICA 2NP7A 5FNVF 1MG5A 3BMXA 5AI6A 3M4YA 3GYBA 3IEMA 2JVJA 4XQEA 3OIWA 3TXYA 4BGUA 4GI5A 4E13A 5KNDA 5GGYA 2Q5HA 1XP8A 2Y2UA 5CVJA 3VDQA 3T0FA 1OXXK 5A9SB 5DE3A 3PNYA 4H18A 3KKZA 2NZYA 3ZDDA 3K0EA 1G19A 2IZ7A 3Q5DA 4URHA 1Y6QA 5CLJA 5KX5A 3RLFA 4JKYA 2YNMC 3I9KA 2J3EA 1GKYA 1KI1A 1NR7A 2VJQA 2VQEB 1OY1A 4NX2A 3FCUB 3ZWOA 4BNMA 1P7ZA 2G1JA 4K9DA 3TQFA 3TWOA 4LXXA 1XMJA 2GD1O 2VZEA 3EQ6A 3G8AA 2LCIA 2SKEA 5NULA 3RDPA 3ZY3A 3SMQA 1ZCBA 5JVDB 1B74A 5TMBA 3QELB 2H1SA 2VT6A 1V39A 4M9UA 3QU9A 5EIXA 2D6FA 3K7EA 3NPAA 1LS6A 4CDRA 3LCMA 3ZXUB 3KJFA 1N7JA 3OWOA 4JJEA 5BMVB 2OHIA 4XQCA 1NLFA 1IBKB 4JR2A 2MMCA 4WNIA 3U4HA 1CQJB 1Z26A 3GNSA 4BO4A 2WZBA 1T5BA 3G9QA 3K70B 1JUDA 3QYJA 4AX8A 2G76A 5EP2A 1CE8B 5T4FA 3ZXSA 5MN4A 5IARA 5IP5A 4K9KA 3GGDA 2P1ZA 2H57A 1Z13A 4KDFA 3SHQA 2Q4TA 2R5FA 2B25A 1NBEA 1A8SA 4BZQA 3KE9A 4UFPA 5A7FA 1ISGA 1XU4A 4L2IA 3OFVA 4M6WA 3ERCA 2O19A 3DC2A 4C3ZA 4DMHA 2CDBA 1XVIA 4CF7A 4WY5A 3H16A 4LRUA 2O8BB 4B3FX 1J9GA 3Q6NA 3KJZA 3Q12A 1QO0A 4Y2XA 3F78A 3PQ3A 5JY6A 4YJDA 2PH1A 3RRJA 3A1WA 4QPPA 2HFJA 2W00A 3HY3A 5D6OA 2CEKA 2EJBA 4TYPA 2F67A 1E79D 3AEQB 4J1TC 3C3YA 4MJLA 5AYVA 2M32A 4OAQA 4MPTA 1A8HA 2CLHB 5C1BA 5EXEA 2BFPA 4L7VA 1FFHA 4IDFA 1CZNA 4AJHA 1UBKS 3MQ2A 4EPVA 2M6LA 4YI3A 2WC1A 9GPBA 4H7FA 3SOZA 1JXAA 2EBUA 4GYYA 4XJXA 1ULAA 3BH0A 1MKYA 1W0JD 3PDWA 5DYGA 2GA9A 3H9EO 3W5IA 4AXBA 4UTNA 2H63A 4GE0A 2AEJA 4ZC8A 1GPDG 2OCXA 4EX6A 3SBDA 5B6IA 3DM9B 1IN7A 3LKZA 2IIBA 4IJ6A 3DF7A 4WH0A 5DBIA 4B4OA 4D57A 1S0UA 2JLXA 1U81A 2NUPB 3I0MA 4NZOA 1U8UA 2X7JA 4X1IB 3ZZTA 2D1FA 3PQCA 1XEWY 2JCSA 4WZBA 4JKOA 4GR4A 1UFRA 2MWMA 3GJ4A 4Y7DA 4HUTA 1UXGA 3GAAA 2BR5A 1B8VA 3DDSA 4UQPA 4UTZA 4DCNA 4ZN6A 3C3WA 3SAJA 1NI4B 5CA1A 4GHWA 1KDYA 2ZP1A 4QYWA 4B76A 3AOEC 3ZV6A 5KTMA 3KUCA 2QTNA 1LNSA 2ONKA 2ZSAA 4ISCA 4R51A 1CUYA 1DLIA 3GCDA 4R8KA 4WTOA 1OA1A 1UDXA 3PT9A 1IUOA 4FEYA 5JMTA 2O7SA 2X4LA 1KQOA 1G20B 2VYVA 2A94A 4FHEA 4UDYX 3EAGA 4FHZA 4G4JA 3BD7A 1NDHA 1P0PA 2A1UA 2DLDA 1SU4A 2TECE 4R3NA 4EBFA 1E4YA 4G2TA 3GO4A 5K3DA 5U1PA 3TFWA 2QZ4A 3IJEB 1DDOA 5CYFA 2A5YB 4AZTA 2B4YA 2DTEA 2FZVA 1M54A 5D7BA 1XXHA 3K70C 1XMSA 2J59A 1L4MA 3TR6A 5HM6A 4BLRA 5H9WA 3W5JA 1WZNA 2WABA 3DPSA 3SC4A 2YTZA 4JUBA 4X94A 1UEJA 1NJ1A 2EKZA 4RTOA 1DWQA 1VPTA 1V16A 4XQ0A 2Q9AA 2IXAA 5D01A 4DR3B 3VSEA 5BQ5A 4PGFA 2A1IA 4J6FA 4D9IA 3C3XA 3IT1A 1RWNA 3OHPA 3O5AA 4D26A 3SSMA 5BNIA 2ODAA 1EX6A 1P4SA 5GZ3A 5CG1A 4RKEA 1LK0A 1T5OA 3CUVA 1RCUA 1UXHA 3Q3CA 2D3TA 4MPPA 3PFKA 2XT0A 1U2EA 4EG1A 5C53B 1G8PA 2I4IA 2KB0A 3GCGA 4XWKA 5A3JA 1CEEA 4BKQA 1MX1A 3DHYA 1YAJA 1C1YA 1SUBA 1MEOA 3GFRA 2XZOA 5BO5A 1TNDA 3F74A 2NAFA 3ITEA 5AR1A 3ZKAA 1PSDA 1J8DA 3B3QA 3FUUA 1ZONA 4RLSA 4YAWA 4AB1A 1Q83A 4E88A 4TKUB 1VPDA 2QM0A 3T5GA 4AXXA 4X41A 4RTPA 2HA0A 3CZCA 2P67A 2VH5R 4D3DA 2FEXA 3OKCA 3VYSB 4U8GA 1DC3A 1G8SA 2CDRA 2CWWA 1GZVA 3DEIA 3H9BA 1GG8A 3JQCA 4MRNA 1HG0A 4UPDA 5DEIA 1BGXT 1Z0SA 3ANYB 3IMEA 4IHJA 3P7MA 2H92A 4OQNA 1JDPA 2EW1A 4QIHA 1L3IA 2VP4A 3N2GB 3SFTA 5CTAA 1IY0A 4F45A 4OOFA 1M34B 2QG4A 1K4MA 2QJFA 3E5HA 1EDDA 1AU9A 5CEFA 3TJMA 4H77A 3M6UA 3HLYA 1N6NA 4QOEA 1H4SA 3G0CA 2BR4A 2PRZA 1PT9A 2NPOA 1S2OA 4HQ0A 4FEEA 3TDMA 2HRQA 4AM8A 2BHTA 3KBBA 3RS9A 3VZPA 1AQJA 4DR6B 4JQYA 3RV4A 3BJEA 2VNHA 3O3OB 1RKBA 4KFUA 3VPFA 1J2RA 3GJ3A 2B1JA 1GAWA 1JAXA 5K3SA 1YK0A 4UUMA 1QYXA 3LFTA 2J7PA 3UGJA 1L0BA 4K6CA 1YDFA 1KWKA 4RVUA 5CR9A 1DC4A 2AUNA 2VDVE 1GZ4A 3NNNA 1KMMA 4GLLA 4EK9A 3QEMA 2C78A 1N4DA 3C1AA 3DMHA 5L3ZA 2E1RA 4U4AA 3CNHA 1H69A 1ZJJA 2IEZA 1CUSA 2JEZA 3A4IA 3IVAA 3AB8A 3AJEA 4O25A 2E89A 4QFCA 1X39A 4E2FA 4HX5A 2XDAA 3AESB 3FF4A 2GEVA 4D56A 1GU7A 1SQFA 2C8VA 1S8FA 1FNSA 2ODEA 3OD5A 4QDJA 1R0BA 1V7QA 2CDCA 1C4OA 2P69A 3HJRA 3MN1A 4FLMA 2IHNA 3THOA 1YRQA 2FJ0A 1Q7EA 3NI2A 4EYEA 3RUPA 4Z4IA 2GM5A 1MTOA 2C59A 4O29A 3FWYA 1NW9B 3VR3D 5FT9A 1G8YA 3U1TA 1ZA1A 3ENKA 1XTZA 4CM4A 1Z16A 2ZAYA 4K87A 2V3WA 4FD3A 1FSSA 2H5IA 4FE3A 4LZLA 5TEVA 1OLSB 3BIFA 5FWNA 2GCEA 1IHPA 1MVOA 4DIUA 4FXPA 1EPUA 1PR9A 3NVMB 4UBKA 1H23A 4MQBA 3TSCA 4DVGA 4MUIA 1M2HA 4QOHA 1PR4A 3LP8A 4J0IA 2VDPB 3FBWA 2CFCA 3VBCA 1IEVA 1YU9A 4J90A 4FBLA 1NVTA 5FOWA 3A6FA 1C5KA 4KXUA 4PR0A 5ALGA 4C08A 4YCMA 5ILGA 5DXFA 5ICEA 1KVTA 1NI5A 2WUWE 2F1IA 4JH0A 5FNVA 5GQSA 3RVOA 1B23P 4FWBA 1Z22A 3CNQS 2I2XB 2VNIA 3JR7A 1SCJA 1T1EA 2H85A 4XD2A 1C30A 1QYVA 2AZ4A 1I9CA 3WGQA 1B43A 3OZWA 1GSOA 2Q3DA 2Z9CA 4NBLA 2P6OA 2E18A 5FUXA 4C07A 1GNSA 3ZQ6A 3SJ7A 2R1UA 4PFQA 1XZCA 4ENRA 3G9XA 1D0IA 4HDMA 4ZO8A 2WTEA 1O0BA 1MC1A 4BQQA 1WCWA 2P9GA 4MCIA 4ZWNA 1BNCA 2YASA 3KU1A 4DDUA 2ZTMA 4D8WA 2F1JA 3OIDA 4GWKA 2K87A 1H1LB 2J9RA 3AF5A 3KEGA 2H1RA 1GTRA 2JLVA 2EBWA 2IEGA 1VKJA 2JJ2D 2P9JA 2I2CA 3DTVB 5EHIA 5B3LA 2XNDD 4BLQA 2WR8A 3D8RA 3N5KA 4MVJE 3VC3A 5BR4A 3VFDA 3GXOA 1WXEA 3NHYA 3I23A 2R00C 5DGTA 3UCEA 4LF4B 1D03A 1HQYE 3TX2A 3QLJA 1YS9A 3QEJA 3PIDA 1I6MA 1MQSA 4E94A 3Q9SA 2ZYVX 2J9ZB 2ZSKA 3FPAA 1HI9A 1LK7A 1HEYA 4L3OA 1Y1PA 4BFXA 2G0AA 1KPGA 1QRDA 5EWLA 1VGVA 3WYAA 4KITB 4EB3A 1V8ZA 3CQ9A 3EUWA 5DWVA 3SEZA 2FMUA 5ALWA 1ORTA 3UXYA 3VTZA 4D7AA 2C94A 4KZKA 2YVAA 2BFDA 3EZNA 4WOPA 3I5XA 3OZVA 2F3TA 3ZE8A 5LDDC 2V7WA 2G9NA 4DB2A 2AG5A 1B16A 2E87A 3HV2A 4ICIA 4DCTA 3F9IA 4EEXA 3KXKA 2B6NA 2BDEA 2CBXA 4HDQB 4B5KA 7ABPA 5KUTA 3S7TA 2PPLA 3C8UA 2ZREA 1NM5A 1I3KA 2IZ5A 4WOJA 4L28A 4PCVA 5A0VA 2HJWA 1G2QA 2J6BA 5CXQA 3VYUB 2YJ4A 4TN5A 1EFRA 4G1MB 2JDIA 3FUTA 1PEYA 5JI2E 1CS0A 1UAAA 1KK3A 2VHWA 2Y1FA 1VKOA 4CLOB 5EWJB 4BIIA 2YWBA 2OHGA 2OZKA 3ESYA 3U0VA 1OGYA 3DB1A 3QSGA 1KFKB 1Z83A 2RHBA 2C5HA 3GVPA 2BZ0A 1CHNA 4B6SA 2V45A 5AW2A 1YDHA 1PQ4A 3LRXA 4QJ5A 5BORA 1FVFA 4B9EA 2HWYA 2QMEA 1CRWG 5JD6A 3Q15C 4IJVA 2X1HA 3WRWA 2R84A 2ZJ2A 2FPIA 1SZPA 1KSGA 3WKBA 2CXOA 3OA2A 1J99A 3R09A 4P3PA 4V0LA 3HJCA 3PPWA 5T41A 3MJ4A 3V3TA 1H2YA 3JZIA 2I6FA 1D2GA 1H4VB 1XGKA 5DJ5A 4XIIA 5EMHA 1E9AA 3DVQX 1H0SA 2FWRA 4B9AA 1Y7HA 4D9KA 1T2AA 4DA7A 3C7KA 5HZHA 4HKTA 4URXR 3BXXA 4H7HA 2HWKA 3OTOB 1ZZEA 4UU8A 1WXXA 3W5HA 2Y1KA 3A9WA 1ZZGA 3IDQA 1YZFA 5E9WA 2ZJ6A 2OVBA 2AQIA 4IWYA 3CUSA 3MT9A 3A4YA 1NV8A 5KWSA 1HK7A 2H07A 4YYEA 1PHRA 4IDHA 1KQNA 2IV7A 2E82A 2P4HX 2BM0A 3I8SA 2OA0A 4C5AA 2CDAA 2SICE 3AFOA 3M6AA 1ZG3A 3SC3A 3EIUA 2GLTA 3WDMA 1JXOA 2PSFA 2WQ6A 5E3IA 4D9GA 3KT8A 3LJKA 4HGOA 3QEBZ 3TXXA 3SICE 4C0AC 1CLUA 1EK0A 1RHQA 1U31A 2Z1MA 2PG3A 3AIOA 4ODIA 1OLXA 1LTKA 3UPDA 3W4KA 2ZK7A 3MJHA 3PDUA 2B9VA 1T2NA 2GF2A 2WJYA 4MXDA 3LLMA 3AHEA 4QUAA 1JW9B 3CGWA 5EE3A 1S4MA 3K3PA 3AEXA 3A1CA 1Y3HA 4WN9A 2ZROA 1GWNA 3HKEB 2Q3LA 4IOKA 1S2MA 3ELWA 3A31A 1PQYA 2EVWX 4R68A 1R4ZA 4ZVMA 4NCJA 4N7BA 1BDIA 1ZNWA 2ZJ8A 2X0FA 5AWFC 4BYMA 4MHTA 1IRXA 1O94D 2J07A 3NKVA 1CB7A 4MEJA 1AZLA 1I2BA 2Y93A 3BZWA 2GF0A 5G3ZA 2XVYA 2LNDA 3GPCA 4LFBB 3PV0A 4DGSA 5C8YB 3RVSA 2AUMA 2VJAA 2GNAA 3UWPA 1N57A 4HNQA 1RVV1 2IZ0A 2BMFA 3GK3A 4PYMA 5DWQA 4HUQB 1WOYA 3ZJVA 3HVKA 2ZRFA 1SQSA 3E3OA 4MV8A 1BZYA 4KMMA 1D2RA 3P2YA 4TQ9A 2NIPA 4G89A 5EP3A 4LF7B 2LR0A 3HKCB 2OCYC 1NXPA 3GV0A 4M87A 1DKUA 3R40A 1Z5UA 2N75A 3COYA 3DT8A 3ZZ1A 1OFTA 4RQBA 4G07A 1Y1LA 1ESDA 2H1WA 4MUNA 3SS7X 4EKIA 4YAKA 4UMVA 5J2TB 1SG0A 4U7WA 2MOKA 4U9HS 4ZVTA 4HNRA 1V6SA 2DECA 3IS3A 3SN6A 3ZDEA 1TYDE 4TQGA 5KWEA 1CUGA 1CJMA 1EP2B 4U6NA 5DDIP 5AJUA 3O1IC 2FE1A 1OB2A 2FSVC 3ZQKA 5K8UA 4BNUA 3F98A 5CVCA 1Y3CE 2CL7X 1ZUNA 4KODA 3WV4A 1Z36A 2FPSA 3B5JA 4M1YA 3OMLA 4MGZR 2HU8A 2Q6TA 2RH8A 2EWWA 1DS6A 2GEKA 3DO6A 5DV9A 1L1QA 3AYZB 1B8UA 4JBWA 4TSKA 4DR7B 2FKNA 3S3TA 5F5XA 3ME5A 3PXBA 5K05A 1CDDA 2PX0A 3IO3A 2IZ1A 2ZGVA 2JZOA 5HHTA 1TTQB 2QTZA 2GKGA 3HYRA 4X6YA 3RAPR 1DRJA 1GHTA 1G5IA 5AKXA 1Y37A 1PJ2A 4GSYA 4NFHA 3O3CA 2VT7A 1Z6YA 1EFCA 1JR3A 2D5BA 1TTHA 1ZIOA 2DBYA 3GL9A 4LZNA 3A2KA 2GVNA 2C88A 4N4AA 4JB0A 3CF4A 3R7BA 3WIEA 2GTPA 1M73E 2ZQ5A 1QLHA 3IUEA 3ANTA 5FUQA 3QPDA 1FNDA 3L06A 1XQXA 9LDTA 2VTBA 2MIIA 2PSDA 1P9NA 3HP1A 3MCUA 3JVIA 3QA9A 2IZ6A 1JEYA 4DGQA 3W9YA 4D0GA 3JRNA 4UXIA 4G4SP 3TW8A 1B6RA 3T3EA 4HAOA 5F3DA 3P0JA 4X54A 1YA6A 5FYDA 3NWEA 2PO5A 4EY8A 4HYTA 3DJYA 1GPJA 2HPAA 2O2GA 2PZMA 3DCNA 3EDCA 4P2GA 4ZEXA 3U3JA 1W2WB 1HDGO 1HSZA 3VMMA 1MORA 3M3DA 3YASA 3ZU4A 4E7OA 3EWIA 3VMFA 4R71A 1Y1RA 1QLWA 2FG6C 2I6XA 1YJBA 1O4WA 1X7GA 2C8LA 2WF7A 4NATA 4Z2YA 3STXA 5DZSA 4B82A 4EVIA 3HSSA 3PC3A 4ZYZA 1ETUA 1YC2A 3DHEA 2GCIA 5AICA 4P5DA 5L8VA 2AZXA 2BDUA 5JU6A 1YU6A 3P9QA 3GNQA 2UU9B 1B6GA 2ECFA 2BC9A 1RU3A 3GCXA 5KYUB 4LV5B 4UD6A 3PL1A 3BTUA 2R9VA 3DV2A 5AH0A 2XGOA 1GYPA 3W5BA 4MV7A 2YW2A 4UXJA 3ZHBA 5CBPA 4E1VA 2AFVA 3K96A 4AVYA 3HO1A 4YPOA 1NQAO 4GNRA 3QE9Y 2YHUA 1TMYA 3BKWA 1F0NA 1U2DC 1UKVY 1GPH1 2JGNA 3PXUA 3QUBA 1Z56C 3R0ZA 3E58A 2X7XA 4Y2YA 4LRYA 4FGJA 5EIEA 2IITA 4N7JA 5JXHA 3KLNA 1NUAA 1EX1A 3W3AA 5CDUA 5DI3B 3O73A 1AK2A 2Z9BA 4HCJA 4COKA 5K5EA 5JNVA 1M7BA 3T54A 4DIEA 4UPVA 4PTLA 5GINE 1H22A 1T9GS 1J0BA 4R83A 3JQGB 3PFBA 2J5XA 3NIWA 1GNPA 1AM4D 1E1CA 3SCZA 3E8MA 4Q15A 1MT3A 2Z8ZA 1D2HA 3ZW9A 2GGSA 3RVKA 1U3VA 2HCTA 2WTMA 4MWSA 2GK6A 1U5BA 3OA0A 4WJKB 3PRYA 4DWWA 2PUEA 2V9CA 3D3EA 3I8XA 3ENWA 1BKYA 2FG7C 2C95A 5ALIA 4BP1A 4X65B 3DXZA 3EYWA 2OFXA 4KFSA 3PXDA 4BO7A 2C99A 1TQ6A 4KIWA 3U7IA 4HVCA 5BRJA 8AT1A 1MZPA 3ICWA 3SEQA 1TW2A 4BMDA 1M2JA 2AD5A 1YVUA 1PWZA 5JJCA 3CSUA 5HJ5A 3Q3HA 1TQDA 2WDPA 5AJXA 3E18A 4NBUA 1GSHA 3FOBA 3O90A 5ISMA 1Q1AA 2X9VA 2IOFK 4CMKA 1AB6A 3EVEA 2O9JA 4WEOA 2FZKA 2BZ1A 4URFA 4ZZ3A 1SVKA 2BF4A 2CHEA 4YHHB 1STOA 2CFSA 2VT3A 3A3PA 4LXHA 1ORVA 5EIHA 5JBIA 1G7TA 1EP3B 1H8ED 2C4MA 1E92A 1Q0PA 4ZQGA 5T8KA 3TL2A 1KQ3A 4KLNA 3ZWWA 2EF1A 1JIJA 5C0OE 4CCSA 3DMTA 4YC7A 2DCUA 4Y1EA 1JG1A 2QXUA 1ULUA 2WV9A 1MABB 4I3HA 2EZ4A 5F52A 5BQ3A 4DZRA 1P3JA 3R75A 4EHHA 4DS3A 2A0XA 2WWRA 4AY6A 4FHDA 5DWDA 3PG5A 1SQ6A 3CGGA 3C7TA 3TPZA 4B6JA 1W36B 3EUEA 3A11A 1NI3A 2J3KA 3VGPA 4FDTA 2EDAA 3QU4A 3GMIA 1GCUA 1U8TA 5CFOA 1XO1A 1V9CA 3C8DA 3C3BA 3LQ1A 2HPHA 4K6KA 3ZXXA 4D4KA 1QF7A 2Y27A 4OHCA 5B1YA 4HLCA 5D3QA 4YO7A 3LXRA 3ZLUA 3PE4A 3ZU2A 4IVNA 3T41A 2DPHA 1P1FA 2P27A 3ZHQA 3EG5A 3G68A 2OCLA 4O1MA 3H5NA 4RVOA 5DLQC 4MVCA 4F46A 4LNUB 2G4LA 3HJUA 4F91B 2A1TS 4GZ6A 4B7ZA 3KDPA 521PA 3ANXA 5AM4A 5DULA 3KD3A 4EHJA 2GDZA 1UP4A 2OLKA 1CJSA 2IHYA 2R8XA 2XVZA 3F49S 1IATA 3OU2A 5K8JB 4R1OA 3UUEA 4OPMA 4PHTA 3L4BA 4JGBA 4GR9A 3DDNA 4UOZA 2QQ0A 4F3CA 2R1VB 3THWB 3A4LA 3C97A 1GFSA 4ZI2A 4G5XA 3A14A 3NBMA 1RMYA 5EIBC 4OSEA 4EEKA 3KHSA 3FTDA 4C0JA 3HBMA 4QRDA 5KQRA 4DMCA 1LTHR 3THYB 5GVSA 5IDQA 5DNYB 4WXHA 3CX7A 1E3WA 2WP0A 4OO3A 2GMWA 2JGIA 2YHIA 4L5JA 4Q4CA 5AXCA 1BN7A 3JYPA 5E95A 3QWFA 1HXHA 3ICQB 2W2NA 1SAYA 2VXCA 1ITZA 3GUUA 2QLJA 4CYMA 5FD8A 3AM1A 1A5TA 3ZEAA 2QL7A 2YQ4A 2QVXX 5LWHA 2IKSA 3IGFA 4B3XA 4ERNA 3DL0A 2AZMA 2G5PA 1OU4A 3R7SA 3V1KA 4CMJA 3UUGA 4IG4A 2VKQA 4XRRA 1P1IA 3WRYC 2QNIA 5JCPA 4FGUA 1J2JA 2HF9A 2ZRGA 3IP9A 4QBKA 1E5LA 2XTZA 4FYYA 5JATA 3GUYA 3EEOA 2O2EA 2CMHA 3OQHA 4BNIA 4YUZA 5GIOE 2HLDA 1BE8A 1TIBA 2VJKA 5BOSA 2HD4A 3SVTA 1TU4A 2B8WA 3CIFA 5DBOA 4RTSA 3EDRA 2G4VA 3DULA 1TM1E 1SOMA 3WTCA 3CCBA 1YGPA 1HQDA 2CLEB 5FTNA 5EJAA 3HCEA 2I4OA 4HDAA 5EJ7A 1WZ2A 1PN3A 1RMTA 3PJGA 3VH3A 3O8CA 1W36C 5JJIA 3WWCA 1DLJA 4YCSA 2OGSA 4OYYA 1FSZA 1G18A 4UU1A 4H4EA 3SHFA 5CNIA 2FWJA 1VIMA 2BRUA 2Q41A 3QNMA 4JKIA 1C7ZA 2HFKA 3KD2A 1XALA 1N8KA 3PCRB 1ONSA 3IB3A 4QPDA 1DTWB 2GCNA 5J47A 1Y6GA 1DMSA 2HMAA 4RABA 5CCDA 1CEQA 4BV8A 4HQ6A 4N0EA 3MC1A 2YJ5A 1GO2A 2CE7A 1G9XA 4N9QA 2QSYA 5FQOA 3R6DA 4B6QA 2JAHA 5KNDD 1J25A 2YY5A 1NVFA 1O9GA 1IRIA 3DBVO 4I9UA 3HN7A 2PD3A 3KSUA 3L7NA 2I3AA 3HFJA 3P4UA 4PWYA 4L0MA 4HGPA 3AUYA 3QVSA 2EFJA 2I78A 3BVPA 1RWVA 3DAYA 3GGOA 5H7XA 5TV2A 3JYHA 4MKGA 3N9IA 3VYVA 2K2QB 1ZH0A 2AE1A 2EP7A 1FFEA 2V7EA 2VSYA 3GA5A 2Q3EA 4JZKA 1UBUS 2QZ9A 3J7AC 5B6PA 2A9QA 2DWOA 1QHSA 3LAWA 4ND8B 5KU1A 1YJCA 2O0MA 1I3OA 2OK7A 3PL5A 1YQUA 2B69A 3ETEA 4YJHA 3RTCA 4KRFA 2V6IA 4M2LA 1R2QA 2BGUA 4CHTA 1N33B 3GLFA 2C57A 5DM2A 1KEEA 1UMDA 3PWSA 1ZBDA 2ONYA 3GJ8A 4E2WA 4RQTA 1RI2A 3GWZA 3IUNA 3K0FA 4G1VA 2CW5A 4GZ3A 4MKHA 5E9AA 5EC8A 1U7ZA 5IAGA 3W9SA 1AO0A 2IX9A 3NBFA 4D9CA 4PNZA 2WHQA 2J41A 1K06A 3MYRA 1JLLA 3RS4A 2TMDA 4XR4A 5LB2A 2JAWA 3BKXA 2LKCA 3PICA 2ORVA 4F8YA 3C39A 2W2LA 2XKKA 1KZ7B 1K3UB 1KJIA 2QUJA 3EVGA 3F5FA 4OL9A 1K6JA 4XDYA 3VU8A 3ZWCA 4IFBA 3HU3A 1OYVA 4QG7A 2WHPA 1NVKA 1Z8NA 2PJUA 1V3VA 4GX5A 4WLEA 1XL0A 4G5GA 4L9AA 1ZGZA 1T1RA 3NZEA 5BN4B 3OQOA 3I1FA 3A6GA 3U16A 3DW1X 2HCJB 2YY6A 4E2YA 5G0WA 3T5MA 4M9CA 1N5LA 2BFCB 3HR4A 4KV9A 4RQAA 1Z63A 4JOCA 3UNXA 4DSOA 1JYEA 1ISJA 4WXMA 1HRKA 1MOSA 3RRYA 5IUNC 4RV5A 3S4YA 1P4JA 1QO0D 1VQ1A 1RACA