2WTAA

Acinetobacter baumanii nicotinamidase pyrazinamidease
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
212
structure length
212
Chain Sequence
MNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNHISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHIDSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDACKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICOTINAMIDASE
publication title Specificity and Mechanism of Acinetobacter Baumanii Nicotinamidase: Implications for Activation of the Front-Line Tuberculosis Drug Pyrazinamide.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 84
structure length 212
sequence length 212
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2wtaA00
1NF8A 3O91A 3TXYA 3O92A 3LQYA 1NBAA 1NF9A 3HB7A 3O90A 3O94A 3UAOA 4WH0A 3R2JA 3IRVA 1X9GA 3TB4A 3OT4A 2A67A 3KL2A 4H17A 1IM5A 1ILWA 3MCWA 1J2RA 3TG2A 1YACA 4WGFA 3OQPA 2B34A 3R77A 4L07A 3EEFA 3O93A 3S2SA 2WT9A 2WTAA 3V8EA 2H0RA 4L08A 1YZVA 3HU5A 3PL1A 1XN4A 2FQ1A
chains in the Genus database with same CATH superfamily
3F7NA 1F2DA 2H7CA 2PLNA 3A8TA 3L5OA 2E55A 3OU6A 4L0CA 1K6JA 1XXHB 2PUWA 2WKQA 3LVRE 3Q7TA 1G5PA 2QR5A 4JD5A 2AG5A 2YJ6A 3T94A 2JD1A 4OI1A 2H1SA 1NUPA 3KBBA 3R3XA 3H3XA 4KQEA 3BD8A 3ZH9B 3HWRA 3NV7A 5BWMA 2GPSA 4TZ0A 1CV2A 5DNDA 3THSA 4N1AA 2ZIEA 4M0UA 1DHRA 1GGHA 1IJFA 1Q12A 4A0FA 3BM5A 1EWYA 1HKHA 5JS8A 3VZCA 2R6AA 1KO8A 2GLUA 1U3WA 4QPCA 4ZANA 4Y1RB 4L5AA 2CMKA 1P8JA 1U2QA 2E18A 5CA0F 3OLWA 5DNCA 4HZGA 1KXZA 2XE7A 5JANA 2KHZA 1N3LA 3RT9A 4MZXA 4E12A 2CCJA 1Y89A 4ZZIA 2O2HA 1SMKA 2FN7A 1XDUA 1C3LA 1D2GA 4WZZA 3UT5A 2EF0A 3SS9X 3VSEA 3W6UA 5H5JA 4IZOA 1BRTA 3QVLA 4AUMA 2YWCA 1SB9A 2ADFA 3ZY3A 1NLFA 1ZD5A 1K8RA 4J07A 1WMFA 4K6MA 1KHTA 1WF3A 2VHCA 2XB6A 4NMWA 4RXMA 4S0ZA 3U7IA 4HXFB 5KTYA 1XD8A 3I8XA 5HFJA 1KVRA 3DAOA 3VOTA 4CM4B 1FDOA 4MW4A 2XE4A 3N2EA 1NSYA 3D3JA 2IVFA 3MQ2A 1N5IA 2WG2A 1K9SA 1KDRA 4GM0A 1W73A 5AM4A 3Q3JB 2Z5VA 4I3FA 4JGGA 4PAOA 2AXEA 2FW9A 1C8LA 2BMVA 1MW8X 3ODGA 1T9GR 3HU1A 3LX6A 2C7BA 3QVTA 4RHYA 3TQOA 2IKSA 2IS2A 1FYFA 3INGA 1L5YA 4IOKA 3GBSA 1BWPA 3PDJA 4X71A 5GP1A 3DVSX 3N8IA 4Z8XA 1DKMA 4RS3A 3RCBA 2IYWA 3IB3A 4OUDB 2QS9A 3HMKA 1YOBA 2IY9A 3IT1A 3H87A 1M0TA 3P2EA 1QDUA 2DH5A 4K26A 3VR5A 5LYJF 4AX4A 3OJLA 1THGA 4RCVA 2B78A 2W6NA 3BHNA 4LHSA 1HOTA 5ERYA 2XUAA 4RQUA 2AIRA 1VKHA 4NS4A 4X84A 4DZRA 1YB7A 4JI5B 4MMYB 4G0UA 1SCIA 4L9AA 4NXMB 1D4AA 4HD8A 3W9YA 4ZEWA 5FTJA 2I3ZA 1RQLA 3C5WP 3HJRA 5J47A 1EFPA 1JAHA 1Y1SA 3OY7A 3ENVA 5JSYA 3WHKA 4D74A 3X2SA 5E95A 1GJRA 2Y1XA 1ADGA 5B37A 4HQKA 3WYAA 4BATA 3UENA 5AKGA 1ND5A 3OMWA 4ZJUA 2JNWA 2X58A 1U0OC 1Z6PA 4UHCA 3FWHA 5GY7A 2Y9PB 2VA9A 2IEBA 2XRZA 5JLJA 1SBCA 5DMXA 4UNNA 2CHVA 4CKXA 4EM6A 3KVVA 3WADA 4HQFA 3ZE2B 1V35A 3SXUB 3AR8A 1QHFA 2EKZA 3GL9A 4P5EA 1E60A 4WDRA 3LO5A 1ZX1A 3NTQA 4I5DA 1V48A 2FMFA 5I5EA 3UJ8A 1P80A 1E89A 2XXAA 4RY0A 2ZUFA 2B83A 2YNMC 2PKRA 3JAKB 3NH6A 1MB3A 1GPBA 1I0LA 1FEZA 2DFPA 2GPBA 1NVGA 1X1QA 3DBLB 3R6TA 4HYQA 4TXHA 4I1SA 2P8SA 1TD9A 1O4WA 3WLFA 3AUYA 3QF7A 1QH9A 4KLNA 2OVFA 4L74A 2QY6A 4PSCA 4B9EA 1IVNA 3RR2A 2ZVPX 1JLHA 4FR0A 4YCSA 4N3BA 2OXEA 3TBFA 3UH0A 1HG0A 3JVVA 2JIQA 1OZHA 3K8OE 5FR2A 1P9RA 1SGWA 2D1QA 2SECE 4LJ6A 5CB4B 4N48A 3KHUA 1GXSA 4OGWA 2AZ4A 2E3JA 5CLFA 2W6JD 2YBDA 2JASA 4UHFA 1U9ZA 1Z3IX 3WB1A 4ZZ3A 3ZS9A 3I9JA 1ML3A 4FHGA 1DDGA 1RLJA 3V00A 1MUUA 3W4IA 4RABA 1Y3CE 2VDPB 4OSEA 4AS2A 2O0MA 2DBQA 5JY1A 3DAYA 2FVXA 4URUR 1NR1A 1T2VA 2JJ2A 3AI1A 3DZDA 3Q3CA 3DNMA 5CNIA 4LWQA 5FA5A 1N4AA 1SCDA 3B38A 3ND5A 2PO5A 4EI9A 4ZHQF 4CIAA 5KNBA 5LP6F 3T5AA 3FN4A 4I2VA 2QN1A 3K9NA 4IHKA 3GQVA 4IY1A 3SC2B 4AJEA 4C03A 3UWOA 3HABA 4MTCA 4WX2B 4V0ME 4IICA 5J2TB 5TMDA 2Y93A 2AMYA 2XVAA 3MD9A 2OBXA 3KWMA 3QVVA 4FLEA 2QQFA 4KN5A 2WPDA 1B3RA 1EG2A 1JT9A 3MRXA 5AW8A 3AKCA 3BRSA 1NJSA 1OFVA 2H4YA 2RGGA 1SXGA 2QD1A 1PT8A 2ZTMA 3PRKE 4H15A 4XRRA 5KSPA 1B26A 3FYUC 3M6AA 1FDVA 3LF2A 2WG0A 3UB2A 2Z98A 3DZGA 1BGWA 2FPPA 5COAA 4ERNA 9MHTA 1CUIA 3NZEA 2HF8A 1B8PA 1J9ZA 1F51E 3U4GA 2V7TA 4IVNA 3D4PA 4HX9A 4KX3A 3V1YA 3H0KA 5BT8A 3LXMA 2O8CB 1JXOA 1LVGA 1CE8B 2IHVA 4HAYA 4QUAA 5AM2A 1TYAE 4ID3A 1TLLA 2ZJYA 4OKSA 2DE0X 3B53X 3FPJA 5FEUA 4MVWA 3ZCQA 3AUXA 3R3ZA 3MK31 1U31A 3CCCA 1N5KA 4RWEA 3B6EA 1UWKA 2X7XA 4D3FA 5KWIA 3LP8A 3CX6A 3F8SA 4B4UA 1S4MA 2FLVA 3WYGA 1HO3A 5HQTA 5CU7A 3QE9Y 5A4AA 1JILA 3KUUA 2C58A 5L7TA 1SK8A 2GYUA 4COKA 4D0SA 5HZHA 5H3LA 2YQZA 2OHOA 4FFMA 2JC3A 4IEEA 5HMMA 621PA 3I04M 3PEUA 3ASUA 2YNMA 2OC9A 4Q3EA 1EFLA 1MGOA 5GONF 4YCAA 3NV9A 1HRKA 5F7XA 1Y1RA 4OBEA 3D6TB 3JAWA 3O5AA 5DSXA 2G82A 2XJ4A 5AKKA 2LNDA 4AF6A 3IQHX 2Q4RA 4US0R 4FTWA 4OV6B 4BKQA 2ZQ5A 3BXHA 3LA8A 1OXSC 3JYOA 3BJRA 2I87A 2XUFA 4LGCA 4JGIA 4XX0B 3HXTA 5KQPA 3PQFA 2QJWA 3WO0A 5C1PA 4MVJD 3ZU2A 2YINC 3KPVA 3UNXA 2WJZB 3ZWAA 2ZVQX 4BN0A 1BDBA 2IEDA 5K8VA 4UNRA 1CZRA 1E32A 1UM9A 2IYFA 2WEKA 4JMLA 4JFRA 4RACA 3T34A 2GBGA 1WABA 3HYSA 3C70A 1PR5A 5BRJA 5I9LA 2R6FA 1AGPA 2Z6QA 3EUWA 2GCOB 5IHXA 1T8WA 3TR5A 3OFJA 4L9RA 1S1MA 4ZV7A 4BV9A 1IQPA 4EHHA 4Z4FA 3PFKA 3TEJA 2CVQA 4KGZA 3N59A 2QL7A 1GN8A 2XYPA 4LSMA 1XTRA 5FQOA 1G8HA 3ONEA 3BL6A 2X3UA 3UJDA 1E1LA 1YMUA 2GTPA 4MKGA 3B6MA 3T7CA 2ZEJA 5BUSA 1VGQA 2BISA 4JXZA 3ZLTA 2QK4A 5IJZA 1A9SA 3AIIA 1BU5A 9LDBA 2YIDA 2I6GA 1OASA 2CJYA 3EUAA 3ROMA 4DMRA 4TYNA 2ZS7A 2PBLA 4I4CA 1MORA 1UBCA 1UEXC 1GLVA 4QLAA 3TQTA 5EIBD 3MRSA 5ES3A 2QTHA 2YHIA 3AB7A 4GIBA 5FLYA 1DJMA 4R7GA 4R2HA 2PBFA 3MJVA 4ZEOA 1OYVA 1CQXA 2DOKA 1HDEA 1T6ZA 3V1TC 4L22A 2J67A 1XYYA 1SUSA 4L78A 3VPXA 4IBOA 1ADBA 3EH2A 3E84A 4OQNA 4WCFC 4WOJA 5C7IO 3AHFA 1Z17A 2HR1A 2JGEA 4ID9A 4XWAA 3MTJA 1GA4A 4YAJA 2X8JB 3FIUA 4YT2A 2X42A 5BXYA 1RAIA 5E0KB 4EX6A 3RKUA 3BCHA 4KAAA 1JVBA 2ENWA 2L19A 4M36A 3TPZA 2BTOA 2Y76A 3ZVKA 1C7EA 1Z4IA 3Q87B 2V7QA 1QKJA 1FY2A 3OAAD 3DR3A 2O3JA 4H77A 1E9FA 3LWBA 2JFNA 1DUIA 3EQ9A 5K5EA 2WOOA 1XO1A 1YL5A 1Z0AA 2Y67A 1P2VA 3MWDB 4HK4A 1N2SA 121PA 1YQDA 3A25A 1Z0DA 3H8WA 1J7KA 4MYRA 3DZCA 4LF6B 1B0ZA 3T6KA 2W2LA 3ZHQA 3ZHVA 1NSTA 4J2OA 2YN0A 3WDLA 4B3XA 5IYZA 4TKUA 1OOEA 2IEYA 2PUTA 2VHZA 2NYUA 3OTHA 4QFCA 4AUNA 3JQPA 3AYXB 2G06A 3EEOA 1QCCA 4CE6A 3H4MA 4PPNA 4E5KA 3LOUA 1DBPA 4BX2A 1Q1QA 3P5BA 2FPMA 3HR7A 3NRJA 2DGDA 2WLSA 4G0OA 4IH1A 4TTPA 4FKMA 5DWDA 4B2YA 2XMSA 1PWZA 1DEXA 1E3QA 1NLMA 3GCDA 3H1TA 5F9HA 2C9DA 4MS4A 3ESBA 4BNHA 2A1UB 3EAGA 1E0JA 1UJ2A 1XCOA 2FFBA 4K8OA 2DKNA 3QP9A 3KIPA 3ADCA 521PA 1E7YA 4ZZ2A 2HSDA 4UFOA 1AKWA 1UF9A 4AULA 3VV2A 1JFRA 4RJ2A 3ZCPA 2OKGA 3PIDA 4C0LA 1E62A 1VCOA 4BX3A 4G81A 5HE8A 3G1WA 1S2OA 4DLXA 3KPYA 1PBNA 3A4IA 1BH6A 1QFYA 2I33A 2RC6A 10MHA 1KVUA 2ZFUA 4CDNA 1MQSA 4NMXB 3EFOA 1Z37A 2F90A 1U8XX 1GAXA 1GUAA 4C22A 1WVMA 5IDQA 3DUFB 3PDCA 4K86A 3W8NA 4DB2A 4HS9A 1YQEA 4DCTA 4DLBA 4PX3A 2CXXA 4V0KA 4ZDKA 1DBQA 3GLHE 4AK9A 2XOKA 3SQWA 4OXKA 1LS1A 1OT3A 5BPFA 4QTXA 2XADA 2DBRA 3FGOA 1EUCB 2BKAA 1M2GA 2OFPA 3M4NA 4LFBB 4RZHA 1GEEA 3JQQA 3M81A 1OX4A 4NPHA 4XGNA 2MYNA 4KUEA 2PBZA 1XPRA 1I94B 2OOKA 1W0KD 4JXKA 3V8RA 1E2FA 4C3VA 2A67A 4B3RB 2J9RA 5E1DA 3NOXA 4DMLA 1CJTC 5LM3A 1TCBA 1DPGA 1E7MA 2PMFA 3IDQA 1LW6E 2EP7A 2VHVA 2WHPA 3DAPA 3FCCA 5JATA 1BAPA 3RSGA 1TFRA 1FMJA 1JSRA 3C98A 3GVXA 1N7IA 2HIAA 4MQ5A 5B2EA 4EB6A 2AZMA 4GI5A 2XI4A 1NUQA 4HQRA 4Y98A 4M76B 1V11B 1NFQA 5TE9A 3TKYA 3TKAA 1VL6A 4LOIA 3FKSA 4J6FA 5I8ZA 4HTFA 3LTNC 1WOMA 1SXJE 1X7GA 2JI9A 3EPPA 2AS0A 4RSGA 2RHOA 2C7OA 3CPSA 1E79D 1N5DA 4LXUA 1QTRA 1ES9A 4WZAA 5DGXA 3LC2O 1I4LD 3FUXA 3IBTA 2FR8C 4U00A 3C97A 4TSRA 3QXCA 2A9JA 4GM4A 4BQPA 3TB4A 2VTEA 1DBVO 2IOHA 1ZCBA 4G1CA 4LZZA 3SXJA 3F2VA 4KHZA 2O59A 3IDFA 3EXFA 4CKBA 3PUKA 3B3GA 3CLSD 2HXGA 4J49A 5JBQA 3P2YA 1QP7A 5BSEA 3FTNA 4QM6A 2VRWA 1T1RA 3HZHA 3E8MA 3VSBA 1GNRA 3GOQA 4NABA 1JB1A 2G9VA 3DF7A 3PZBA 5CFZA 4KLRA 1AUVA 1YQXA 3RIHA 2FUKA 5AICA 2VF2A 1J2YA 1OFGA 1WCYA 1UFOA 2QI9F 3AL3A 3CG0A 5F3DA 5EQJB 2BKXA 2G9QA 4FFSA 5CLJA 1IHPA 1ST2A 1YB5A 1J8YF 3ITKA 1PNQA 2AMFA 1B14A 3WC4A 1W30A 1P3DA 4FX2A 4H1VA 4OKNA 5JC8A 1G2IA 1U6IA 3R9XA 1JEJA 2O8CA 4OXRA 4RADA 4ZYLA 4LBYA 4QG3A 4YIHA 3V2GA 2HHJA 4CTJA 5CYGA 4HRVA 1L7AA 1WW8A 3PITA 4BGUA 2CJWA 3COPA 4UXJA 3KZMA 1UBGA 4UCXA 4S0XA 1DLIA 2IUEA 1LDNA 2JARA 2D7JA 3K3PA 1BHO1 3IXQA 3KWJA 2BGKA 3P9XA 4HVLA 3SNKA 3G0IA 2NAPA 1FFYA 5DM1A 4H1WA 1X3LA 3HR4A 3WFZA 2FRDC 1I9CA 2G4CA 1R1DA 2J09A 1EGAA 4BB0A 5LLTA 1D6JA 4PFQA 5ILGA 2HN9A 1QHGA 1Z33A 4BASA 2J87A 2DP4E 4MAFA 5AKXA 5TPWB 4EGCB 1XHFA 3P0JA 4GC9A 4M86A 3NYRA 2VXBA 2VP9A 2B1GA 1W1UA 1BHSA 3R8CA 1FFDA 3INRA 5KINB 4DJJA 2GYVA 1FFHA 2Y1WA 4N0EA 4UE2A 1DI0A 1UMBB 3ER9A 2EFDB 2BHNA 3MCWA 5EE3A 5B7PA 2EFGA 2AJBA 3PP8A 3Q8KA 2UUCB 4WA8A 5KSYA 4Y2QA 1XU9A 3EA4A 3RAJA 2P3OA 4DKXA 1WDWB 2A7QA 2RGAA 1RYFA 2J30A 3FUWA 2JATA 3TMKA 3EZXA 5FX2A 4RAOA 1TRKA 1I8TA 1LBTA 1WB5A 5JFOA 1NVEA 4UVHA 2O8NA 5LR6A 1BDJA 3VR5D 1FP1D 4URYR 5FORA 4UEWA 1W52X 3BBPA 3D1JA 4BHTA 1Y34E 3TAXA 3ZWBA 3AVVA 1GNVA 2X77A 4FUTA 4JC8A 16PKA 1H5NA 5AK4A 1AIPA 2DFNA 4CKCA 4UPVA 3SR0A 4YCCA 1Z47A 2O1EA 3EVDA 2FR8A 1B3BA 2AL7A 4TWBA 4YJ2F 1MMFB 4Q12A 4QUJA 3GC6A 4DMGA 3WHLA 3OHSX 2ZCJA 2ZB3A 3ZDBA 3TSOA 1KEWA 3ONWA 4MMZB 5C4IA 1Z4PX 4ICIA 4QYIB 4OATA 5FF9A 5LD2C 1YQUA 2FSPA 3ITDA 1TADA 2G63A 3AUTA 2QLTA 3ZZ0A 1JSLA 4DTIA 3H9CA 4QRIA 1E5VA 1Q14A 5LA6F 1B0AA 3OQVA 1XP5A 5HEKA 4EL5A 3L3BA 2GR9A 1TGVA 1E7SA 5DEOA 4E15A 4ZYYA 2H1OA 5EUBA 3V48A 4M60A 3N6XA 4LZLA 3UVEA 5NLLA 1XC7A 3CS3A 1YZTA 2W2VA 4EJMA 1XQYA 1OIWA 1DTWB 1Q3KA 4J4TA 4I1YA 2BI8A 3HGTA 5IAAA 3MS7A 1UWVA 4XDYA 4F4IA 1YB6A 5JWOA 4A6EA 3QZUA 4RD1A 4B2IA 2ODPA 2HADA 5DX8A 3O8CA 4GAEA 4EJSB 1Q0LA 1UQTA 7REQB 2FG7C 1IXYA 3G9TA 4WKGA 5EIOA 5KYGA 2AI1A 2O14A 3F6SA 5I7RA 1KERA 3CNNA 3KZVA 1YRYE 1EI9A 1F8UA 3LIPA 2R2GA 2VHEA 1SC4A 2WVGA 2ZXEA 3GFVA 4RK7A 5JE8A 3Q4GA 5CLHA 1MN6A 1UFQA 5JBNA 2F4VB 2NQ8A 3P9KA 2ZS8A 3HJCA 1Q1ZA 3HV0A 2FZCA 1U2ZA 1EGHA 5D3KA 1UBHS 4FYMA 4P98A 4EL0A 3KRTA 5TV2A 4MQMA 4DARA 5C8ZA 1LCIA 4Y2SA 1FNBA 2EJUA 5CLGA 3WLTA 4Q1AA 1CUEA 3LDFA 4WN9A 3FMGA 3WI7A 2ZI4A 1OB2A 1PT7A 1P3Y1 5CAEB 5EPUA 2NQTA 3FOZA 1SKMA 1AV7A 1CZNA 1ULSA 1TRHA 2G6BA 2JJ2D 2VWHA 4PCUA 1TO2E 1VLHA 5DK4A 3DD5A 5KJFA 4EF4A 2NADA 4CEHA 3QNMA 3ADDA 1BX1A 1SD2A 5KNBD 2NP6A 4J3NA 3L0BA 3DULA 1GEGA 2Q5LA 2J9FB 2XOEA 3IHLA 3BB1A 3KKKA 2CNWA 3CX4A 4ZVTA 3DO5A 4Y3UA 1VBMA 2EG9A 2PZLA 2I4RA 3WGZA 1I7SB 4LSWA 1E9RA 1ODSA 1NVVQ 2WPDD 1ZMXA 3TFWA 3KKLA 3W1WA 1IZ0A 2UZ1A 4R01A 4MW0A 4X85A 1TQHA 5DI9A 1ILWA 5DV9A 1GGJA 3UAYA 1R88A 3Q5DA 5DFAA 1W5TA 2QYSA 3JVIA 3O84A 4K9RA 3ZWYA 3HXKA 3WK5A 4OAOA 2INGX 4WN3A 4F6CA 3BERA 5D84A 4BWVA 2ZJ0A 3V80A 2JFYA 3BWVA 3SIPA 3EIOA 3QM1A 3RQIA 5DM2A 4X1YB 1G5FA 1G55A 3ROZA 1P7ZA 3CR3C 3DBRB 3TL2A 3GN1A 1ZNQO 4ED9A 4E21A 2Z3WA 3MHTA 1QR2A 4Z3KA 3SJ7A 3R0JA 2H4FA 2CXHA 3HJTA 1DINA 2EXXA 2OCGA 4A0QA 3I4CA 3M3DA 4FFNA 3S8MA 2TMGA 1NI4A 1KO1A 4DE5A 3GIWA 5EMLA 2X14A 2CD9A 3BMNB 2GAFA 3CU5A 4J0GA 3TLCA 5FBRB 3OA0A 1NHWA 4R83A 4G25A 5HKLA 2IY7A 4ITVA 1XAIA 1C7RA 3FSEA 3IO3A 2YNMD 3HYCA 5B1SA 2PT9A 3FWPA 1KRXA 3K92A 2FQQA 2O2DA 1R8JA 4BAGA 4CR8A 5E8RA 3TX6A 3K20A 3C16C 5ALFA 2MHCA 5AI0A 2CLHB 3ZK8A 1Q21A 4Y8VA 1LXCA 3D5TA 2QD4A 2FJPA 1KYTA 2GCPA 4EQ6B 1F9EA 1QIKA 3QHAA 4FB5A 5CD9A 4C2UA 3LGXA 2FPXA 4IQ8A 2B36A 2FSIA 5AW0A 2Q5EA 1PK8A 5D3MA 3BMXA 1TEHA 5D00A 1AQIA 2HWYA 2XNCA 4U3JB 5FLEX 2SNIE 4BO9A 1UMCA 3AL2A 4PS0A 1XQ1A 1X1DA 1KZHA 3B1YA 2P6OA 4LYJA 1QGYA 2QQ5A 1KJWA 3OF2A 4UTXA 3R8FA 4N5LA 1W1WA 1MIHA 4ZCLA 4QL3A 3H2JA 1RI3A 2J32A 3K0SA 2QT0A 2NM0A 2OO5C 1PJZA 5HRCA 2VNKA 1FJHA 2BSAA 3KNZA 3AZOA 4NY1A 2BR3A 3UJ7A 4ZHQB 5DI3B 3UAXA 3WZMA 2C2XA 2DWPA 1P6XA 3QPBA 2W48A 4QQRA 2WOJA 8MHTA 4YLGA 3PFGA 1ZYUA 2VJMA 3W3AH 5D01A 1F3LA 1TCUA 1UQRA 3VI3B 4P58A 3ZUGA 3AEUA 2GCEA 4E0BA 1SVSA 2I6UA 3PGA1 4NPAA 5E4JA 2FETA 2ID9A 2FPOA 3R9KA 4BRZA 4QVGA 4TL6A 1F8XA 1WMAA 4IDOA 5CURA 3WYEA 1WW3A 1YCFA 2P35A 2RI6A 4M53A 4PBRA 2IUSA 4IIVA 3R7WA 4F1JA 2FUCA 3OOEA 1Q7TA 5FYQA 1I2ZA 3WWZA 3ND7A 3CPHA 3O7MA 3MAGA 3PL5A 1T9CA 3ANLA 1ABFA 3I2YX 4MV6A 1LKZA 2FPWA 3ICOA 3SEAA 1U1GA 3PNYA 3TRJA 2ONZA 1TVMA 4BWGA 1NKVA 4X7BA 4BNKA 4NRDA 4CODB 3RQSA 5COBA 1M3SA 2GD6A 3OJWA 3A6PC 3GFFA 3TIFA 3HN6A 4IGEA 1TA4A 1FLVA 5CHEA 2V6BA 2AQ8A 1QP8A 4RVOA 1JFLA 4BFCA 5H9VA 3VVLA 1T4DA 1Q6ZA 1PLJA 2IW3A 4YRDA 3U2QA 4MA0A 4J29A 1P1FA 4Q4AB 5DHFA 2A5YB 1IPHA 4RPCA 4ZDJA 2CKMA 1Y0BA 2ON6A 2Q3DA 5EKTA 2NPOA 3ST7A 4GKVA 1RKBA 4OHXA 5KHAA 3L77A 2W2LD 4PX5A 3EVTA 2Z2XA 2BH9A 1KQOA 1T5SA 3QPWA 5GONB 1X9HA 3T1NA 2PZGA 3H5LA 3EBOA 4KJZA 2O7VA 1KI3A 3VA7A 2X8BA 4M9UA 1QAQA 1Y3FE 1AZTA 3A2NA 3NBAA 5F73A 2NSYA 2YBEA 3ZJ4A 2BI4A 1G6HA 2JEYA 1N4DA 4FI3F 4HZUA 1W4LA 4GGOA 1KK3A 4QDOA 5ESXA 1KZ4A 1PJRA 4E5YA 4BPBA 2JEZA 1ZD4A 2NV0A 2OVBA 3GRUA 4I2NA 3FNFA 4UQOA 2H16A 3GG2A 4OXQA 4F4FA 4P5DA 3F3KA 1N5LA 3FE2A 3CNHA 3Q15C 2O4CA 3IXMA 2DETA 1P0IA 3MWEA 4RMGA 2BJWA 2PT5A 4U6SA 3OPMA 2QU8A 4NH4A 1QVAA 4WFKA 1U11A 2GKSA 2PRSA 1SU7A 2EWWA 1I7DA 4GE0A 3WRVA 3O94A 2GN2A 2VSNA 1UPUA 4O4IF 3KQTA 4PG8A 3B3AA 2P9YA 2E5FA 1A76A 3ORHA 4PIVA 4C0WA 3OQBA 1XA0A 3WX0A 2VZEA 1W2HA 1J56A 3A6JA 3LXUX 3CRZA 1QVRA 1CUDA 3E18A 1T34A 2VHUA 5IS2A 3G2MA 1J97A 3CVOA 4M8SA 3PQ2A 4XW2A 2QMHA 2UUAB 4J0JA 1IN5A 4AXBA 1V4BA 1GGEA 1NAIA 2VAMA 1SKUA 3D5EA 5KB3A 2WFLB 1AMOA 3QU4A 1C2TA 5FI1B 4YRAA 2XOKD 1VIMA 2I29A 2C2KA 2IYOA 5FPSA 5IK2A 1JYFA 3F8TA 3FGPA 4QFBA 2DMRA 4DHWA 1KL7A 2HA4A 3MUFA 4XYGA 4E2YA 8ATCA 3MUEA 3O26A 3PXBA 5HQ3A 4LA4A 1JFFA 1P2UA 2H17A 2VZLA 3ADOA 1J33A 1LC0A 1R3UA 2JAQA 3EOAI 4OOFA 3V8QA 5BWCA 2XA9A 2ZPTX 2JVIA 4EBFA 2RI1A 2F43B 3MMPA 4LGMA 1LPAB 3QFSA 5FFMA 3W5IA 4ECEA 3U1BA 2XT9A 1JRLA 4L8GA 1OJLA 2ZVDA 4FZ3A 2GSDA 2WAYA 2XTZA 1SHUX 2JCBA 4HN2A 4OHUA 1PJCA 5GZ3A 3SHFA 1Y8ZA 3ZIDA 2W2KA 1WB9A 2F3PA 3SZMA 2JIPA 4QWMA 4BRSA 5KVAA 3FKSD 3P94A 3TIVA 1XEAA 2YIMA 2OK7A 3V8EA 2BGGA 2NYAA 3DMRA 1HE8B 1RM4A 1ZONA 2FYTA 3EE6A 4DLTA 2BKEA 2IZZA 1NWCA 2IXBA 2FKAA 3BA1A 1FXWA 1TM1E 2M1XA 1U1DA 1IBKB 3DT9A 4HNSA 4TLCA 2C5FA 2RH4A 1KYVA 3OPYA 4CL3A 3RKRA 3E7WA 3NHZA 4YJ3A 2QX7A 2XUZA 4PFSA 4HPWA 2FRVA 4RESA 1GCAA 4YJDA 4TTAA 1RLMA 2QX6A 1S0UA 3TDNA 5EQDA 2CL5A 1P9LA 1ZJZA 3PDUA 3OZXA 5AW3A 4DKJA 4YS6A 3WQSB 4QTZA 4HMQA 3Q7QA 3B5IA 3VNVA 2KLHA 5JCXA 1ODIA 3Q7PA 1XL0A 2M6KA 1KH2A 1XEWX 5DX1A 5IM4A 4JJ6A 1Y6FA 4NE9A 3BAFA 4M9XA 4Q3BA 3RSSA 1AS3A 1JR3A 5BMOA 3CYFA 1M0SA 4U7DA 4Y1EA 5LQUA 3CH7A 4E2XA 1DEAA 5CIQA 1GGNA 5IBPA 1GPUA 3EZNA 1T9GS 3R74A 1OV4A 3QKRA 3WLAA 4RH3A 4KRXA 2J6BA 2Q6TA 4Z4EA 4LECA 4M49A 4O5OA 4U02A 1QV9A 2HQSA 3GZJA 3EQ6A 3GVCA 4TUYA 4CETA 5HGJA 3VAZA 4QSHA 5B6IA 4IRMA 1I32A 2V8BA 4TKZA 3L0IB 3K0FB 1C1XB 1Y8RA 4L5BA 2VJCA 1TD1A 1OYWA 1Z0UA 5IJWA 3MELA 4NX2A 3W2HA 1FQJA 4MV3A 4D9NA 1H2RS 1MJ5A 3E3AA 2WU8A 3I12A 1XD2B 3BSWA 4HH1A 1UKVY 4FFLA 1UBLS 4FZJA 4CU2A 2VQFB 2JJ1A 4LRUA 1ZM3A 3IEIA 1JTVA 4LI0A 3TBKA 3ZNNA 3B20A 3V4VB 3NT5A 1VMDA 2CLSA 3EIEA 4E88A 1FVHA 4MIOA 1P1BA 3EVZA 2G5TA 2WV7A 3MTGA 3P0IA 2FPSA 4R6WA 1J4AA 5F3RA 1FW8A 3D4BA 4R2KA 1N0IA 1PT9A 1WLYA 3HFSA 4LYDA 6AT1A 1UPBA 4KIFA 3D4OA 4M46A 3LC7O 3NHAA 5FWXA 4TWIA 4M0DA 3OX1A 1U6JA 1GKLA 3USZA 4FGLA 4CMIA 4X3OA 5A4DA 1NQWA 3L46A 2ODNA 4QT0A 3HBLA 3U81A 1IN6A 1KMMA 1V1RA 4MS3B 1T9BA 4YI5A 3NBQA 1L7PA 4Q4HB 2ZUUA 3DLAA 3PT5A 3STYA 2C2MA 5AOAA 4AQ7A 3E3MA 1DEHA 1KJ9A 3C43A 1OIXA 3KQNA 2QN6A 2YY7A 1L2TA 3JD1A 4LRTB 4R5HA 4H17A 4DQVA 3OCYA 1SY7A 4MV1A 4ONEA 5E7IA 3BILA 5H1YA 4JLMA 1TVEA 4G56A 3HYLA 5K0SA 4Z2YA 1GRCA 1OXMA 1XXHA 3BD9A 3ZZNA 4MXDA 4C6TA 3MWFA 3STWA 5B1DA 2O2IA 2GDJA 4ZO7A 1BEZA 1AUXA 2VWPA 1ZI6A 4XIFA 1K8XB 2MYPA 2HK7A 5TARA 2AOTB 4BC1A 3H84A 3ADBA 2L18A 4DA7A 4QXQA 1J1ZA 2AKYA 4TLDA 3ABRB 1IOLA 1BDMA 1GA6A 4ALJA 4TZ6A 1LDBA 1ZA2A 1UXGA 3IMCA 1UDBA 4Y1RA 4CN8A 4I1PA 2GK7A 1QIEA 1E66A 2MYUA 2PKWA 2VOEA 3PVSA 1VPEA 4H7HA 4KXLA 5KPDA 5HJ7A 5LSAA 4IDBA 4ZJYA 1L5QA 4UM9D 4KR9A 3TW0A 4DAEA 3OTQA 4IMJB 2V1UA 3FR7A 4O4HF 1W25A 3FX2A 4FQ8A 2IYYA 3NC0C 3E4CA 5BMVA 2COUA 1G3UA 3RBXA 4ARZB 5CA1F 5FTKA 4GBJA 4NVRA 2FOLA 2Z8XA 5FDFA 1PG2A 3IOYA 4GBGA 1EBBA 3ORYA 1GGFA 1CEEA 3JD2A 5KYUA 1UP6A 1GNQA 1MFZA 1EJ2A 3O3NB 5WRFA 5KQSA 1OMOA 2WNSA 1PT5A 4MUGA 4ZYVA 2BLLA 1T4GA 4FZVA 2ZSEA 3K1TA 4YFVA 2B4RO 2GAIA 1QWOA 2IJGX 3DBOB 4ACBA 5CJ2A 4AO6A 1NXSA 3GLHB 4C7JA 2Q27A 3QLEA 3TSZA 2G88A 3ZHOA 1G18A 1TMGE 4CTNA 3IR7A 3CNBA 4Y2VA 2D5BA 2YHUA 5LZ8A 5DZSA 1P7CA 1AGXA 1Y3HA 3Q2KA 4OUDA 4E14A 3ROPA 1Y3BE 2ZYUX 1HORA 2H0RA 2OAGA 2E49A 3NHJA 3TSCA 3QUBA 4ETMA 1XRRA 3HLTA 2WHXA 4AQDA 1U3TA 2J6IA 2CNWD 3D7SA 1ZA1A 5GOTA 1PK9A 2B7CA 1JQDA 2OP1A 4XDGA 5HPYB 3D1VA 2F8SA 2MINB 2R8OA 4YV1A 3PC7A 1ESMA 2HAEA 1H2AS 4AAYA 3BWDD 1YIDA 5KNDD 1SXJB 1LBHA 3A05A 3IESA 3WWEA 4FDMA 1O8BA 3NNNA 1YZQA 3UICA 4L27A 3GLFE 4PVDA 4HR7A 2K2QB 5BYBA 5BSUA 3DE2X 1IN7A 2AF4C 5CX1B 3PHBE 2VPPA 1SPBS 1HDZA 3ORFA 4FR5A 4EB8A 5BN4A 2RE8A 1TL7C 2IKQA 3HVKA 4L4RA 4UZFA 2ZATA 2W11A 1B8UA 3OX3A 5DTIA 1R6UA 3ZGLA 3MT7A 3ZD8A 2QGZA 3H17A 5LMZA 4D9KA 3JRWA 3S2IA 3GEBA 4PZUA 3N70A 5EA2A 1ULZA 4M22A 1H1LB 4HAIA 3SXUA 3OP1A 2XCOA 2JAPA 1M34E 3A06A 4KEAA 4A3SA 3WAGA 1VB5A 2A1TR 2WIGA 5EJ4A 1LJ8A 3JAKA 2PD4A 2OZPA 4LYEA 3X1JA 2EJBA 4LJRA 4HNRA 1BMQA 3JQBC 5JXIA 2VF5X 3EJWA 3RSFA 2ST1A 4QUDA 2I62A 2A0WA 3VRHA 4HVCA 5JSQA 4LNUB 2YFYA 4P3NA 3C7AA 2B0CA 1IIRA 2I4OA 3BN3A 1JHOA 1X38A 2BGJA 4GI1A 4EYSA 1N32B 3LNCA 3PFHA 3NHRA 4RH0A 5E3JA 1BE6A 1A9ZA 4I1VA 5AIAA 5FBQB 2OKCA 1PWEA 3GNLA 5D5QA 3AHDA 1ZCZA 2AX3A 4UFNA 5CB4A 2I2XB 1XRJA 2XMRA 1N2XA 4R40A 2HRRA 4HSEA 3U1TA 3H5OA 5H3CA 2IDKA 4W99A 3GN2A 4M0KA 4Q82A 4C4XA 2M9MA 2JH9A 3CZCA 3QLVA 5LXTB 3NO4A 2BGTA 5TQVA 4ANFA 1XXLA 3RVQA 2QG6A 1Y1TA 2XECA 2Z5GA 3SLGA 3NETA 2WSYB 1K92A 3IC5A 3V3KA 5GPBA 2R2AA 4N5DA 5JISA 3ABSB 1WQ3A 1AQNA 2IOFK 1XDSA 3FJYA 1DBIA 4J1NA 2FP3A 1MA3A 4MPTA 1E69A 2QMEA 1DO2A 1U94A 1DDOA 2PBRA 3HVUA 4G9GA 3FSJX 4QQFA 4EIWA 2PZ8A 4Z53A 1ZHFA 3JQFA 4EYQA 1T2EA 2ZB8A 5FULA 1ZOSA 3BSSA 3CT6A 3H83A 3TLYA 5DX0A 4DYVA 4WLEA 1XNRB 3S2EA 3HA7A 4LDZA 4XYEA 4RSHA 3TVYA 4E32A 2C4HA 3GNQA 1R8XA 3O7WA 4ZOCA 1YJXA 1U0BB 3NH9A 5E9AA 4DG9A 3FI0A 4QTUB 3R75A 4P38A 3S70A 4BU0A 1CNEA 3VHLB 1JAZA 4PYJA 1K0UA 5EIFA 2QLLA 5F9MA 2ZE8A 3FZQA 3UC5A 3OQPA 5E1MA 1BG6A 3KEGA 3SS8A 4UUQA 3WHPA 4GPZA 4Z51A 2AN1A 4EA6A 1M1UA 2WWTA 5AI5A 2W6ZA 3EXHB 5K2OA 2OGZA 1N0VC 1RYEA 4QDJA 2D13A 1J23A 3FFWA 3FSRA 2GNPA 3RFCA 1B74A 4P7GA 1RBMA 4OP2A 4Q66C 1LWNA 5F76A 3GCXA 3LH5A 2AXQA 2ZSHA 3REGA 3D2AA 3PI7A 1V3VA 2B7BA 4N9QA 3ZDQA 4OJKA 2B4TO 3HVIA 4QDZA 4TVOA 5AHRA 2R00C 1IDOA 1Y1PA 2QTBA 4XUDA 1COWA 2HCJB 5ER9A 5BYJA 2LRHA 2D0IA 2FUG1 1IK4A 2IHZA 1BS2A 4GOXA 3WLLA 5K1ZA 5SZIA 1J0BA 3I64A 1KTVA 5LB4A 2V7XA 3P9PA 4IRUB 4JI2B 3JQBA 4FNGA 3ZTWA 1QRSA 2NTEA 2AHRA 3ELUA 1KMHB 1Z62A 3MS2A 3GA5A 2BOVA 3DEKA 5HGXA 2IHYA 2ORWA 4A36A 1IY2A 1E58A 2RH8A 1HE4A 2YFHA 4G4GA 4Q15A 3TQRA 3AHJA 1KKUA 4IF4A 1R50A 5JNRA 4PZEA 4IVRA 2GRAA 4MV7A 4EI7A 4XVQA 1M5UA 1K6IA 1GQ2A 3FWYA 3B9QA 3NHYA 4KW7A 2PAFA 2P3SA 1FS4A 4NICA 1AGYA 3I1IA 4DMHA 3OKFA 4TLMB 4Y1FA 5TT1A 4GSYA 1K3TA 4PONA 3B2EA 3R2JA 3NJ4A 4KWIA 4LYHA 3TLGB 3VR6H 4DPKA 4E2WA 3KB8A 4P3PA 3K9BA 4Y6OA 1C7IA 4GFDA 2EQAA 5JFTA 5AW9A 2QMQA 1C29B 4DS3A 1YR8A 4Q6BA 2H00A 2OHGA 2VRCA 4IJMA 1W4ZA 4TLLB 3ZXXA 4YYEA 4DRZA 4X65B 2IXAA 5J4KA 4IQGA 4BMVA 1C0EA 1UJNA 2J0EA 2VK1A 1DE0A 2WHEA 3ABQB 3LG2A 1Y4ZA 3NHFA 2ERXA 2Q3HA 4FJ1A 3KCQA 4TMKA 1GFIA 3N39C 1JL3A 3AETA 4YCMA 5EYPB 1I3NA 4XSHA 3AR4A 1KYYA 3UMMA 2GVNA 2GK3A 1B6RA 3H1GA 3RUDA 4GOMD 4JP3A 1TAUA 2E89A 5K6AC 1EZ4A 4KBGA 1HYQA 1Z7BA 1OH5A 3DWIA 2PA0A 4OEHA 2QRKA 1NG1A 1ZFNA 3BICA 3LRPA 2PGOA 4G36A 4RHCA 2C3OA 5AT1A 5U4XA 1GRVA 1PSDA 2OE2A 3G6KA 1GNSA 1MQ9A 2G17A 3EVEA 4JLVA 2BMWA 4YQZA 1W49A 5KJCA 4EG0A 1NXQA 4MW9A 3TEFA 2QSYA 5IK2D 4S24A 5AVQA 3DAFA 2AJTA 1MQAA 2OGUA 4M2LA 4L16A 1FK8A 4I50A 1DMSA 2IF2A 1UAYA 4FKBA 1PD1A 3HCEA 2R47A 3OF3A 5KO2A 4BQSA 3UUWA 2Z6UA 3BK2A 3R0IA 1TTPB 3RWMB 1TF5A 3UK0A 4DLLA 4DILA 2BDTA 2QVLA 2MR6A 3NWJA 1MX5A 5HF6A 3RM3A 3KUXA 3TCNA 3V55A 2AFVA 2REXB 2YV1A 1XZ8A 3JWJA 4ZIRB 1FF9A 3CVWA 4HC4A 5KI6A 3UOWA 4FYJA 3RJZA 3T5TA 4PWYA 4Y9RA 2O3UA 4WGFA 3IRUA 3EQ8A 3PJRA 1OLUB 5F9FA 3MWDA 1NXWA 2R4QA 4FMDF 3IT3A 3UH1A 4AB1A 2EL7A 2PT6A 3UXMA 3VYSB 4D9FA 4H1TA 2L0XA 3VVCA 4GSKA 1FVXA 4Q21A 2NN3C 1YE3A 1L4KA 2VF8A 2ZAMA 3NW9A 4U0KA 5DCLA 4A4DA 1SN7A 4FK8A 1GZVA 1NASA 4OU4A 3C3DA 2IDZA 4KRFA 4PHGA 4L4YA 3ITEA 3ZD7A 2JIZA 1I13A 4QYMA 4UBJA 3TNYA 4RZXA 5DW3A 4GW3A 1PR0A 4E94A 2AOVA 4HNHA 3K0EA 3RTGA 4O4LF 2ZWIA 3CW8X 3ETEA 2BFBB 2A1UA 4F4HA 4QQNA 4MH0R 4XQEA 4NEHB 5U9CA 1LK5A 5GZ6A 4WKPA 4FM9A 3G85A 1E6UA 4IX1A 1IXKA 3RS2A 3N3BC 4L3OA 4GRAA 3JQEA 3AHIA 1X80B 5BYKA 4DZZA 5CDSA 1ZK1A 2GN6A 3O8BA 1O8CA 2IC5A 4MVJP 4XLZA 3O8LA 4WZBB 4UU0A 3ZD9A 2JGDB 4F84A 4GQAA 5K4HA 4G24A 5K51A 5D7BA 1KEZA 1B43A 5J5VA 4GL4A 3RD5A 2E4AA 5BNZA 5KNCH 4UUBA 3GAAA 3AF3A 3TNFA 1U28C 4PS1A 3ZV5A 1DCFA 1G41A 1YJQA 1BVRA 5K6AA 4EHKA 1E1MA 1KYWA 4E4TA 3S40A 5IDWA 5H02A 5A5DA 1JQBA 1IVYA 1X87A 2E2WA 2XD4A 4NV1A 4Q1EA 1D1TA 1E5QA 2G5CA 1LLQA 3BH7A 1MXFA 2UZ4A 3CTPA 3VO9A 4N39A 3JATA 1CWUA 1BYIA 1EUCA 2X41A 3BK7A 1PGPA 3FWNA 2NVOA 3L0SA 4CCAA 1IE3A 1VJDA 4HB3A 3QUQA 1OI2A 5CT8A 4EYEA 4REQB 2B1RA 1V43A 4BJHB 2JJ1D 3K0HA 4YT4A 4G5FA 2XZPA 2PVPA 1B16A 4MPRA 3AF5A 5KVQA 3IVCA 4KUHA 1Z34A 2QE7A 5BSWA 5CBPB 4MLZA 4PPFA 2O6LA 3AF4A 2JKZA 1R5OA 4PW0A 3HCOA 4D79A 2AE1A 3M4JA 2EZTA 3DZIA 2G9RA 3WLQA 1QGOA 1G3QA 4LK2A 3B52X 3KTAB 3E5HA 5JXGA 3E8XA 4F85A 3EWAA 3JRNA 3L8ZA 3BC1A 4RDCA 1KI7A 5AKZA 5EY5B 1JR2A 1FP2A 5HRAA 1GQSA 1MD9A 4D9HA 5HIAA 1T5HX 1YDMA 2K7FA 1ZRMA 5AKIA 2IPLA 1WHTB 1IN8A 2O7QA 1BFUA 3LI2A 1QOQB 4Z3DA 2OYRA 1ECGA 5B57C 4WOCA 1T1IA 4KL8S 2G0TA 5FFFA 1A4RA 3WMWA 4RH1A 3W1VA 1JLRA 3ICCA 1J2UA 1H66A 3ETDA 1SBZA 4IIEA 1L8LA 1OGYA 3DG9A 3K31A 4MV9A 1QX3A 4CGZA 3ULKA 4DY4A 1XI2A 3K32A 1A9RA 4BQRA 3MN1A 3N05A 4YV7A 2ZRLA 5I9BA 4ZTBA 1V47A 1AKQA 1E9AA 5JI3E 1ZG3A 1ZEMA 3BWMA 1P5HA 4D3ZA 1R3DA 3H9QA 3KPJA 4XIGS 3NLLA 3I1JA 4IFBA 3DKKA 4AZWA 3L06A 1MCZA 1II8A 1XA3A 5T64A 1NJ1A 2E48A 2ZUTA 1UC5B 3L1HA 5EZYA 4IG9A 1YC2A 2CLCX 2JIMA 3A0UA 5B1YA 1RRPA 1JBKA 1ODKA 2ODQA 1NHGA 3B85A 1DARA 4EJSC 1K2WA 3TQCA 4LDNA 3V4FA 2X19A 5EHGA 5I7FA 1SD1A 3BHMA 1T2FA 1KSHA 1CJKC 3IPYA 3FZEA 5KQGA 4RLFA 1A96A 1CQJB 2GMWA 3FPEA 1XZHA 3AC0A 4R8MA 1YKFA 2BE9A 1U28A 4DUPA 4YA6A 2C99A 2C0PA 2HTFA 1G16A 2PH5A 1YS1X 4RZSA 3VZQA 2LIVA 3ZZ1A 2CF6A 5TPWA 4Z7OB 1F4VA 1P17A 3KXKA 2D1YA 2H8GA 3CZ5A 1N6NA 3C4VA 1TYCA 1L5WA 2HMSA 4IIYA 5FPKA 5JSZB 2OV2A 2BFNA 3LRTA 2IEIA 1FMFA 1ZDMA 1NT4A 1UMBA 4UU7A 1IWOA 3Q40A 4ZAZA 2F7SA 3QHPA 3LQKA 4D9EA 3JRXA 4KQHA 2V5AA 4D8YA 2VATA 1C7ZA 1VKZA 3MJRA 3OCXA 3QFHA 3JQ8A 2CMGA 4KQMA 4OHBA 4HAZA 4I9UA 5HA5A 5GV7A 1FP6A 3GELA 3OD1A 4PQGA 3WMFA 1VBKA 5A03A 5CFNA 4AZ0B 1U1FA 1WXWA 1QPZA 1NPTO 4JC5A 1WKCA 4HLUC 1MT0A 2DG2A 4N3AA 1UEJA 1NURA 2HC9A 1JSXA 2BMFA 3G2OA 5CCDA 4ILKA 3AW9A 2OBFA 3DO6A 3DOOA 4JXJA 5F7ZA 2UYYA 5L4LA 3MJDA 3M70A 1C4KA 5LQSA 2RIRA 4DV7B 2EQBA 3E2MA 4JUAA 1G60A 2QTMA 3KWLA 4CL0A 5AP9A 2CCGA 2ENUA 4UVGA 4DT1A 4YLEA 4K6HA 4UDNA 1ZO8A 4YQYA 2HF9A 1T25A 3IVRA 3P9SA 4O4JB 2V7PA 2H2DA 3L8MA 4MB6A 1FRQA 1XNHA 3FCXA 1NMEA 1ZVKA 2HBZA 1RJDA 1IN4A 4R1SA 3GQBB 3NKFA 4YAEA 3B1FA 4QYIA 2OZLB 4RA6A 2GZ2A 3S2ZA 1CJCA 1NLZA 1P77A 1N8KA 1Y8QA 4BNLA 3CRNA 3DFFA 1N3BA 5C5EA 1H0KA 1FLAA 3ND8A 2EBHX 5T67A 4WLUA 2GB4A 4FNOA 5ELLA 3U16A 1VE3A 3H5VA 2G7ZA 3MBIA 5HF5A 5CEFA 2GK4A 4RGBA 1S2LA 3VC7A 4MKXA 2QV0A 4IILA 4I4NA 3LC0A 1ZGJA 3EDRA 3OSUA 3WNBA 1P61B 4R81A 4GKKB 1G0NA 2EF1A 2QRHA 3EFEA 4KJXA 2OTCA 3WP1B 1Q7RA 1DTWA 3NDBB 5TQ2B 4CR6A 2RJOA 4PRZA 4HDRB 3AR9A 1G8JA 1JSCA 1Z82A 1ULAA 1UZNA 1NMZA 2POCA 3ESQA 1P4GA 5TVGA 3WG9A 4NQRA 1ZWLA 1J00A 1OYYA 2IELA 3EB9A 1LLFA 1O9HA 3C45A 4I66A 3MGBA 3QITA 4R9SA 2EJWA 4XB1A 5CA0A 2QP9X 5ITVA 3VHQA 2Z4SA 2Z2KA 2M6LA 1C4OA 1PSZA 3ILVA 4YO7A 1AHPA 2DRIA 3O1IC 1I33A 1K5DA 2AOUA 4R1QA 2WTMA 3CLVA 4KU4A 3KOYA 4O4HB 3MTEA 3KJFA 2FR1A 4NAVA 5K4AA 5EJ5A 3H3FA 5CA1B 1RLIA 1I5RA 1Z8NA 2X8AA 1OVMA 3USCS 2NT4A 1NMYA 3CNQS 1A69A 1OF1A 2VBGA 1J5EB 2OV3A 1ODCA 4PBSA 3O9MA 1XK6A 1O94C 1E7WA 3MBKA 3TRFA 5MGNA 1J42A 2EAUA 1OFTA 1PTKA 5TDHA 1XTQA 2WUVA 3HR8A 4ZYUA 2IBTA 2D7CA 1UBJS 4JCOA 3W8DA 1ZW1A 2NMVA 4PYMA 3QG1A 3TLZA 5JRDS 3KOUA 1ULUA 2FX3A 2WD7B 4D42A 3F49S 5DM0A 3PF9A 4MVJE 5C3MA 5B3LA 2J9FA 4D1YA 4M7RA 1G20E 1H4SA 3EBLA 3AJRA 2WKSA 3FMIA 3WMEA 1E3JA 1GZ4A 3CEHA 3WLNA 1XRNA 1XZAA 1E6CA 2F2TA 5E4YA 2P9TA 2WUFA 5LYJA 2ZB2A 3VZDA 1H85A 4D0RA 1RYNA 4IWYA 2QIPA 2V65A 2BGRA 2HGZA 3D4LA 4L0QA 4MYCA 3RUAA 1DQRA 5JXJA 2Q9BA 3KC2A 3WL5A 4H35A 4NFSA 2D5IA 2BKLA 4B17A 1M6WA 3N8NA 1FLNA 1UP7A 2PWZA 2D2EA 1JYSA 2QSZA 3TZBA 4LNAA 4DC9A 3GWGA 4M38A 1D1PA 2ZB7A 1YAHA 1P9NA 4JYCA 2W2MA 4OFWA 4X1YA 1QHSA 4ISBA 2YX1A 4G67A 2YY6A 1NL3A 1LDYA 3DBRA 1V8OA 2FFQA 3EEIA 3I1FA 3SYKA 3K9LA 1FDSA 1RC0A 2W93A 2Y77A 3P9ZA 5EXDA 1DIHA 3SOZA 4EQZA 2HNBA 2VDMB 1NVVR 1UJ5A 2EWMA 1LA2A 2WILA 3CRQA 4JUCA 3MQ4A 3OQOA 3IP5A 2XUQA 1IJEA 3EDMA 1J06A 4ND7A 2R87A 5FD8A 1NYTA 2JZNA 3CZMA 4JOSA 3JQ9A 3RVDA 3UWSA 2Q1TA 4IM7A 3A4NA 3ZV4A 3M7IA 3BMNA 3F7MA 1A5AB 1NC3A 1YZLA 3G2PA 1CETA 3S1AB 3QFCA 4CBVA 4OLBA 1IY9A 1ODJA 1K6MA 1Y5IA 3OZWA 4W5NA 4PSKA 4PXSA 4URZR 4QOJA 3G2KA 3GG9A 4O8ZA 5F5XA 4XQGA 4ZAYA 4OL9A 3M6FA 5LWQA 3IKTA 2C8LA 4GWKA 1JIIA 1FTNA 1EE9A 2PL9A 4DSAA 4F5ZA 4O25A 5C7OO 7ADHA 1UM8A 2JLVA 1MB0A 2J45A 3EVAA 7REQA 3KBOA 3RVKA 4FHFA 4OJMX 2BR4A 5DJ5A 5FEMA 2O3RA 4HFNA 4GPIB 4ISCA 4JC0A 3UHOA 2UZ3A 2AA3A 3S68A 4AY3A 3L4JA 3QVUA 4C0KA 3OM1A 3QK7A 4ZT7A 5M5BA 1XZEA 1LC3A 4JLKA 3USES 2WM8A 3NANA 2ETVA 3UWKA 3N2GA 5C51B 2VRCD 3IQGX 3O4GA 3GLGE 5KYNA 4ENSA 1S89A 3EARA 4N3NA 4D46A 4E7OA 5JZMA 3PA8A 1M72A 1YONA 1PUIA 3OFKA 2RKOA 1ZD9A 1BWRA 1JQ3A 3CY6A 4GI3A 4E6EA 4WAUA 5LYYA 2VT2A 2BUCA 1F06A 2A88A 4ZHQA 1ENYA 1OBOA 2V7GA 3NFRA 4XB2A 6REQA 2IYAA 5LP6A 3SQLA 3FUVA 1CZOA 4C0XA 3FDZB 1J99A 1SHLA 4WWHA 4A0SA 3SR4A 4B33A 2KQUA 3RFTA 1EINA 4BXOA 3L4BC 1LBQA 4YPVA 4OMFG 4LC1A 3IAEA 3DHYA 4O6VA 5IC6A 2LKCA 3VXKA 4D2IA 4DLPA 5GIPE 4E22A 4R1MA 3MAAC 1LRJA 4D3YA 4K8RB 1MRZA 1V16B 2J5QA 3ZWDA 4DMCA 5ALMA 3STVA 1SZJG 2SCUB 4KMMA 2O5CA 1RI4A 1X92A 3GNTA 1ODLA 2H2AA 3F6CA 3ANMA 4K3UA 1ZKDA 2HA7A 3BFKA 2XYQA 5HBRA 2DPXA 2NV6A 2QYOA 3PCTA 4FU0A 1U0FA 4PFKA 3GLFB 4ZCIA 1NYQA 2ZETA 5A3QA 1A7JA 1L4NA 1LWOA 4MQEB 4PX2A 4X60A 1XQXA 4JJ4A 3TNDA 2WU0A 5I47A 5CGQB 3IVMA 3RE1A 5AVWA 2XIJA 1SM4A 3OQIB 4P7FA 2OUIA 1P4AA 3KV3O 4NMLA 1VJGA 3PC6A 5JPCA 1KDPA 1QJCA 2IODA 3MMNA 3R3JA 1UOEA 4Q4AA 1GKIA 3PHGA 2DQKA 2VDWB 4E7PA 3QVXA 4B44A 5K3EA 1JWLA 4XCVA 4JNKA 1M34B 3EWSA 3WJAA 3OOHA 5B4UA 2C9YA 4P33A 4WNIA 1GLGA 4G09A 2UYGA 4H0FA 3ZV6A 1PNRA 4M21A 3AUKA 2O23A 3BFVA 5FUXA 5GONA 2PRJA 4G8BA 1JEQB 3VJKA 4DPLA 3RFUA 3ROQA 3WLMA 2VPYA 1MO3A 2HJVA 5FJIA 3U4IA 1KI6B 3P1JA 4M0CA 2VL7A 1BDHA 3RPEA 2ZJFA 3ACCA 3UJBA 5KYKA 4URWR 3JWIA 2KB0A 2JIZD 3RRNA 3SIRA 4CNBA 4E5DA 3V4OA 3E23A 4OBBA 2GNOA 1O54A 3U80A 3ZI0A 4P2BA 3PGXA 1ENZA 4A92A 1ISRA 4WKCA 3F9CA 5H70A 2YYYA 5CIYA 2CDCA 2FMXA 1IOWA 1MO5A 3OZSA 3A3PA 4O63O 3N07A 3AFIA 1RQXA 4QU8A 2ZBGA 2OMKA 1B4DA 5A3RA 4NYIQ 3UANA 2QY9A 5ER6A 3SAJA 1DJQA 1ZKMA 2APJA 3MLBA 1D2EA 2WZCA 3N5CA 2NO7A 3QX9A 3GA0A 4QHYA 1CJBA 4GLJA 4WVLA 1JDJA 1WG8A 2ZREA 3CX3A 1QO0A 2Z4RA 4I1IA 4QOFA 5CVEA 5EQFA 4W7IA 1ZD8A 1ZIOA 2X0RA 3MYRA 3YASA 3BSYA 2O5EA 1AB6A 3E5NA 2LW7A 3E81A 3GDGA 1KJIA 1KR5A 2ZK7A 3FVQA 3H65A 1PKEA 3EASA 1ZUIA 4INOA 3U7EB 3E7PA 3DMDA 5D8DA 4B40A 1RXSA 1CHNA 2P4QA 1LNZA 1XG5A 3NG1A 3ZHSA 1AK1A 2FPIB 4YLYA 2OFWA 1BCSB 3N2YA 4PAMA 3TVTA 3QEBZ 3TLBA 1OWLA 2FFJA 3W5AA 3MINB 3O4IA 3WAJA 3QV2A 4FX5A 5JNTA 4V0MA 5I4IA 2YRWA 4TGLA 3L4BA 4HDSB 3KEQA 4MP3A 3KJGA 4MJLA 5CVUA 3UPTA 3N2ZB 3N7AA 2UVDA 1QMPA 2A5FA 1YD7A 4YR9A 3G2JA 1GA1A 1XAJA 2GZ3A 1TJ3A 3T54A 2NZXA 4BX9A 3QPUA 4DADA 2BDEA 2DUWA 2BBTA 2V97A 3G5AA 5CTAA 4ER3A 1VPLA 3X1MA 1Q7EA 1CUYA 1SC6A 3M0EA 1LF0A 2RKBA 4LQLA 1SG0A 4GYJA 2D0OB 2A5DA 4DUGA 1ZK3A 3GEHA 1PL0A 2GZAA 4NCAA 3ONDA 2QE7D 3PC3A 4ENWA 1Z4QA 2C5LA 2BFFA 4QLBA 1JIQA 4JYPA 2Q6VA 4Y9TA 1ZH6A 4IDPA 4HWOA 5E7JA 4HWPA 4FWIB 2R6R1 4MPDA 1J8VA 3UV7A 1O5IA 2G9NA 3H8JA 1I6WA 2Q6KA 1CEXA 1ONBA 2A5LA 2HB6A 1LLUA 4GKBA 3O83A 3TZHA 1G66A 1H2EA 3CPJB 1X8XA 5IKOA 1XHEA 5CJPA 4FYWA 1YZFA 4FMDB 1ZGHA 2O54A 3X1WA 5DHPA 2EOAA 3E05A 1VC2A 3IE2A 4IDCA 4TWJA 1QQAA 2B69A 1YGYA 1BIFA 4O2BB 4G65A 1Z0ZA 4NMMA 4GXRA 4ZOQI 1I36A 4HXGA 3PGJA 2DWQA 3JZMA 4XWKA 3IRVA 2IVZA 2ORYA 3CVJA 3IL2A 4IG4A 2ZU0C 4HBZA 2X0FA 3L82B 3V3TA 4XOIA 1E5LA 3HB1A 2VCYA 4RFSB 5C4GB 1TK2A 3WV5A 1LEHA 3E22B 4GVPA 1BDIA 3F2IA 5ALYA 3ZE8A 1BXZA 3V2IA 3CCBA 2WIDA 2GJKA 5BWLA 2P6MA 4O4LB 1Z8HA 1KZYC 2RC5A 4FIDA 4RMHA 1SVKA 4Y9SA 1UPFA 1VZ2A 4EO4A 2NUTB 3LHIA 3OUUA 4Q02A 4YK7A 3WGQA 3DBVO 1ZRNA 1MNAA 2CL0X 1Z4KA 2JJ8A 1T0PA 2XKAA 3KQOA 2VJOA 1NZJA 2DUUA 3LUHA 4FKZA 4HDKA 3CLTC 4XDHA 1A77A 1AQLA 4OI0A 5IWCA 5DW0A 2D5AA 4NOLA 1WKBA 3JWEA 1EH5A 1ZIXA 3HCBA 1L5HB 3TOSA 3VH4A 3WK6A 4JLJA 1E1CB 1THTA 2XVMA 3Q0IA 2PAAA 5EWJB 3WMGA 4BEVA 5BSFA 2QG9A 1S2IA 2XCTB 4U2GA 4D45A 5K3AA 4EEXA 5AJZA 3FNBA 4R8RA 4ZV4A 1WMEA 2B25A 3PHIA 4JP1A 4PTZA 3PJFA 3BE6A 4DVGA 2NZ8A 4C43A 3FKJA 4B3DA 2XHZA 4F96A 4EFNA 4EP1A 4B5KA 5L53A 1XD2A 1UXOA 2EGGA 4ND8B 3BJIC 3LT5A 3BIJA 4RTPA 3AGPA 3DV2A 1AT1A 5LDDC 1QQTA 3E70C 1GL6A 4JJGA 2O2JA 4BV2A 3DDCA 2VH2A 4PLGA 4CRWB 2QYHA 5JZSA 2Q7XA 1DIGA 2VXYA 1SVMA 1XDBA 2O1WA 3I53A 3CMCO 3MIIA 2VDQB 4KLCA 4J90A 1UDWA 1V8PA 4XR4A 4C20A 2QA5A 1ZUD1 3P5SA 4NBWA 3NTXA 3ORRA 5F1YA 3DTVA 5ALTA 5IVDA 1UADA 2FZVA 1VHWA 3EGVA 1T3LA 5C52B 3GFOA 3RS3A 3A70A 2ZQZA 2NO6A 4GPBA 4BVKA 4G0QA 3DKRA 3M8KA 4MS3A 4FWTA 4ER7A 4Z9YA 1AKEA 1WD5A 1SXJC 1IU9A 2FEMA 4KVFA 2NVUB 3LYHA 4AYWA 1JAYA 1VLVA 2DKOA 1BEEA 1BMTA 221PA 2GO7A 2HU2A 2ZTUA 3ET4A 3GLVA 4EY8A 1LQ2A 2IHUA 1CTQA 3IP9A 2ZYGA 3X1ZA 1FTWA 3CH4B 3FCEA 4CFYA 1T3TA 4H7EA 2VP4A 3JXEA 3KJHA 1JTFA 3RIYA 1RZ3A 2XF2A 1SU6A 3DLBA 2VJYA 1P44A 4MW2A 1UC9A 4KDCA 4RD6A 1Y8AA 2C9BA 2CYCA 2R1UA 3OEYA 4GP7A 4BMNA 1JKJB 1OX6A 1RMQA 1SH7A 2W6QA 2WD9A 1V7CA 2AV6A 4P7BA 4QJ5A 5EIHA 1GUYA 3KK0A 1CUVA 4PR3A 3TZEA 1HZJA 2DFVA 1R12A 3ZNQA 2BGLA 3H2SA 4TMVA 4P0PB 4WASA 3KLPX 4S1NA 3SZUA 1KETA 4JI8B 4LCBA 1YR6A 2JFZA 3QGMA 2O8BA 3DYIA 3HCNA 4QO7A 1DFHA 1LBSA 2EFHB 4JQZA 4PVCA 3QA3E 3BB4A 4YUYA 3OY2A 1USWA 3AUUA 2F9MA 1VE5A 3FZGA 2DU8A 3QLJA 4KXFB 4EMTA 2QF7A 1QIJA 1K4YA 3F8WA 3VGPA 4YPOA 2Y0EA 4RJLA 4ZU6X 4ZC8A 4URXR 3MOGA 1K7SN 1OU4A 3DBHB 3E3OA 4BP3A 4MOWA 4IDHA 1CQIB 2X7JA 1B00A 2JAWA 3VTZA 5DF1A 5AQ1A 4ARZA 1OI7A 4N0MA 5L3QA 1Y42X 4GSLA 5CYFA 5ARCA 2AE2A 1GU1A 1V5WA 3JW8A 3OEEA 4MCAA 3VHRA 4Y7DA 1RXWA 5F4BA 1H4VB 1UBRS 2PRIA 2GS9A 1EX1A 1N7HA 3SQMA 4EY5A 4AQYB 4F2HA 5JG7A 1WXQA 5DYYA 3VTKA 4Y6GB 2FZLA 3GGGA 1FFXA 1R7RA 1FVOA 4JBLA 4UBMA 2GDZA 1OZGA 4N7RA 1KIMA 4TMFA 3GLHA 1H3EA 3ZOKA 4N65A 1W19A 2V45A 4E2ZA 3GYGA 4C87A 4AFNA 5E38A 2E5LB 3HJUA 2DQSA 3DWFA 4W5WA 1Z2PX 3ILYA 1Q20A 1M2HA 1O9BA 2WZBA 1K68A 4Y6LA 4TL8A 8LDHA 4ARBA 5LZ4A 1GM5A 2DAPA 2NVBA 3LUKA 3SKXA 3SEFA 3KKQA 1KI9A 3TOXA 4V3BA 1E2IA 4R7TA 3GHYA 4MIKA 4X7MA 1PQWA 2IHJA 5IM5A 3N53A 2RHWA 2PX6A 1K8YB 1S8NA 4M1YA 2MINA 1ZSNA 3C5HA 4NFHA 2QZJA 1OFHA 3BFXA 3HU5A 5DOVA 4BN4A 2C9MA 5JS7A 3H7AA 4OIMA 1M7BA 4DYHA 5JJLA 2GPNA 4H6XA 3FTFA 1JN0A 1SXJA 1OTHA 4KLAA 4E6PA 3PEVA 2WJ6A 2XIQA 5CDFA 4QRHA 1J9GA 4KITB 3IURA 1YZ3A 4L72A 2Z04A 2HU5A 2JKVA 4L2IA 2IIQA 1OGJA 1XTUA 4YRMA 4YJ2A 2IU6A 2CUNA 3EXHC 2V3VA 3NRCA 1HDRA 2BY4A 1Y1QA 1P7YA 3DVLA 1I5OA 3WKDA 2AG8A 3FKQA 4LNHA 4LWZA 4ZMSA 2XTJA 3BVPA 4YBZA 1IH8A 2BWJA 2Q5OA 4U2BA 1P9OA 1SVWA 1NXPA 3AVPA 1UK9A 1CZLA 3AOGA 1GQOA 4EGJA 1FSGA 2FE1A 1D07A 1GL3A 1G8KA 3C3PA 2PWBA 3ZOZA 5K20A 4JX9A 3LP5A 4RE6A 2RMKA 3LUBA 2F1OA 3DVRX 4XKJA 5KWVA 4IJKA 2GSWA 5LA6A 2JFWA 4DSUA 3UK1A 2HK9A 1LB1B 3H7IA 2W4IA 3LD9A 4JJZA 4OB6A 4WL0A 2R8YA 4M1WA 3H6GA 3QBVA 3H97A 4K6OA 3U9SA 2OBBA 3IEUA 3UAOA 2V7BA 1H2FA 1YHNA 1S96A 1JEAA 1SKYB 4B09A 1MO2A 5GOZA 4IJQA 3DUWA 1NKSA 1HSOA 2LE0A 4FPXA 1UC8A 3G0CA 4M9RA 4ENQA 3IDOA 4YJFA 1LSUA 1VI5A 2Q6LA 3QY9A 1B23P 4CMAA 2H1WA 1GPKA 2XTAA 4KCGA 1NJ2A 4WLFA 3IVXA 4M1TA 2ZRPA 3EXG2 4C88A 3GFBA 3GB9A 4MYTA 5LXTA 3OIDA 2DFTA 3R1IA 1FFBA 1NWHA 1R6VA 4M3NA 1K5HA 2ZSBA 2WIAA 2WG1A 4EUNA 4E46A 3STHA 3TZ6A 2OGTA 3THXA 1KK0A 2GJAA 2QMYA 2Q7DA 1NAHA 2QR3A 3HYNA 4F71A 4F6LA 5BVGB 1NONA 3DVQX 1CSEE 1CS4C 1MHPA 3F74A 4NJMB 2DC1A 1O94D 3GJZA 4IR7A 1E1KA 4HAOA 4D9IA 3VR3A 7AT1A 1EE1A 3ND9A 2EV9A 4OHFA 2FMIA 1UBUS 4RK0A 4WJZA 2W6CX 5ERGB 1XZJA 4CPDA 3LQ4A 1X7XB 3AESA 1YB4A 4XD7A 3V1LA 5HUJA 5B30A 1DXYA 3FMFA 4MGHA 1PV1A 4P4NA 3E58A 4ZT3A 2ZRNA 1C14A 1LLCA 3S5UA 4K9LA 3K5HA 3UAVA 3QTTA 3T1QA 4RXUA 2J07A 5JARA 5I7WA 2DR3A 4DLSA 2GN4A 4HSGA 3IAXA 2OV1A 4G8JA 1L7EA 2IEZA 1MAAA 4FGUA 2RGBA 1VIDA 2ES4A 1JNXX 2X0JA 2ZRFA 4QPPA 5EWLB 2COEA 4QGGA 2IU4A 1TF7A 2YJ4A 4EHDA 1CIVA 4LJ7A 3KTDA 1MV8A 1WULS 2HDHA 4FEYA 4DG8A 1TEZA 3HJFA 3EY4A 4G07A 4LOLA 3FETA 4YC7A 4YUAA 5CPFA 2R86A 1T8YA 1GUFA 2L69A 4Q3CA 2IUFA 4Q3LA 4AURA 2RD2A 4XJVA 1NBMA 4UNPA 5G40A 3RODA 3E15A 3OLYA 2C4MA 4XFJA 3V1KA 2BGUA 2XEDA 3U7GA 1Y1KE 4P82A 3NHSA 4FSHA 4FMCF 2ROQA 1JMYA 1V7ZA 3IQDB 4XH9B 4NDZA 4RPIA 1EHYA 1YMVA 2O57A 3C5VA 2P2YA 1QS0B 4KLZA 3UB3A 3NBXX 4RQAA 1YR2A 4IEFB 4YCDA 2C57A 3C8MA 4WUTA 1MJHA 3G2QA 3ZVLA 3EGDA 1UQUA 1PR6A 1DJNA 3ZR4B 4OB7A 4DCGA 5BSVA 2QNRA 3AWDA 1OI4A 3F0TA 2MWMA 1GTSA 1UBEA 1DUVG 3BWXA 4Y2TA 3PKIA 4R2WA 3TUIC 4UTNA 3GHHA 5EOVA 3R5HA 4Y2UA 3TXXA 1XSEA 2MU1A 3W90A 2HMUA 4QDKA 4EPXA 1JE1A 4TMTA 5CNMA 3AP3A 1KEVA 3F7OA 3WZ2A 1AK9A 3G49A 2DUNA 2OECA 1D9XA 4TS1A 4KFCA 3TLGA 1L9KA 2ONKA 1RHUA 2GOYA 3CGGA 1PJ2A 3QX8A 4BKOA 1KWGA 3GV0A 3UAWA 2H3HA 4ZOEA 4FI3C 3UM9A 4WZAE 2WSMA 1ESNA 4GZ6A 4EGSA 3QU9A 4PRLA 3TG8A 2NYRA 2PMWB 4TS4A 4BRUA 2P6UA 2X2EA 3BMCB 3QWBA 4LYFA 3BZWA 1I3KA 3D7RA 3G5TA 1QFMA 1I14A 3VZRA 4BWFB 4JQCA 4L0MA 1PJ3A 2AMVA 4TKMA 3U26A 3DMTC 3F5SA 3R0XA 5BR7A 4D3SA 4B9AA 2I1QA 3G5UA 3LGSA 2JFUA 4TTJA 1EWQA 4A5OA 1N2EA 3RUHA 1QRUA 1JDNA 2XJ9A 5EYPA 1C3XA 4R4JA 3CR8A 1NVXQ 4D4GA 3KYCB 3SFZA 3EK2A 4ZGBA 2XH8A 1QANA 3AT1A 1YHZA 4YJKA 4B5LA 2ZJOA 3T41A 3ILSA 3UY4A 4L95C 5CXUA 1BXKA 3R6WA 1VG8A 1OBCA 3DWEX 2Z3ZA 2RGNA 4GKJB 4RY2A 5J58A 3JR7A 5A0VA 3B51X 2VQ6A 1CY6A 1T0JB 1KTIA 1NNUA 1YHYA 1CY2A 1LDEA 1YDEA 2Q46A 3IUQA 2QLNA 1G20B 4EATA 1U04A 3B3QA 3GRRA 2C2HA 3K8ZA 4QFDA 4H6VA 1DV2A 5FUMA 4BS9A 5KNLA 1DCTA 1NJGA 1PX0A 3GX1A 4PGGA 2I54A 1Z0FA 4BO8A 3DE4X 2RK3A 4HLQB 3FPSA 4KNWA 1SXIA 4RKFA 3R7DA 1RKXA 2GARA 3JQDA 4TYPA 3SQDA 2YMQA 1YACA 1Q0SA 3L4EA 3DOEA 4L4XA 4LYAA 1PFYA 3DR5A 4MV4A 1W44A 4WERA 3ZGOA 1TW3A 2BFOA 3PX3A 4KO4S 2ZSIA 3U7QB 1PFVA 1P5JA 3EHEA 1NIJA 1GGKA 2LKDA 3M2TA 5JALA 2OFFA 4E51A 3I6IA 3BPSA 3KSMA 2W22A 1QHNA 3CNEA 2GD2A 3UYLA 4ZIRA 1YRBA 4MPJA 5G41A 2BJVA 4OQQA 2HRCA 4ZALA 4DLUA 2IOFA 3EC2A 4BJ5A 2PY6A 2LDXA 2XDAA 3RKSA 2PS3A 1QZTA 1IQUA 4R2JA 5DBFA 4HH3C 2ZG6A 4R7ZA 5C34B 3JVDA 4EFDA 2R8PA 3G13A 1PYGA 2CLOB 4DIMA 3IH5A 2Y1KA 1WUTA 3DL7A 3OU2A 1LTKA 3D8TA 3QXJA 4I08A 1VPVA 4U2DA 1KAMA 1L1EA 2MDTA 4FIZA 1L5NA 3KHSA 3ESRA 4L8WB 2AW5A 1QOPB 2CYBA 4Q48A 3SY8A 4QICA 2YWXA 2G1JA 1BS9A 1DIOB 2QPLA 4EG7A 4WESA 3LIIA 3WE7A 2QUZA 2NNWB 3T4PA 1HI9A 2PWAA 4S35A 4U7FA 3P2KA 4F12A 2N46A 4MGEA 1SNYA 1TJ5A 1EFRA 3HDYA 3MPOA 1GPNA 2GZRA 4L73A 4RIIA 3HBMA 1WP4A 2FQXA 3RVPA 4KUGA 1I1NA 4Z7NB 1P2TA 2WQZA 3S5JA 5HNKA 3D6VA 5ALNA 2ZE7A 1XZIA 3W9BA 2PNJA 2Q2VA 2UZIR 1DQSA 1RLOA 2XMPA 1U7ZA 1R0WA 3UAZA 1GUDA 1X80A 5F7JA 5C35A 3F71A 1Y5RA 5LQDA 3CKYA 4NFLA 4NECA 1LPMA 4WZBA 5AVOA 3EDQA 4M0EA 3GD5A 2PSFA 1RS0A 4RA9B 4BE7B 1GITA 3I01M 4ECAA 2QJFA 2AXPA 1M6VA 1A8QA 1YFZA 2DWOA 2TECE 3DKPA 4JHLA 5HFNA 5BYAA 3GLGB 5KU1A 1SA0B 1NP3A 1RLUA 4XDZA 3TZKA 3PCXA 1D8AA 4O4IA 3TAUA 5KREA 5LU8A 4OJQA 1BQEA 3CF2A 1XELA 4LZWA 4GQIA 4HRXA 1YZKA 4ZO8A 1Z75A 3LT0A 4BP1A 4NCBA 2Q5QA 2GD1O 4CM8B 1NI3A 1WRBA 1YI8A 4KR3A 2V4MA 2FMHA 1TTQB 4ZU3A 4UMFA 3P0HA 1U0LA 3W1EA 3VNUA 1KI2A 5IVHA 1HY3A 2C4KA 2Q50A 4PZ9A 1SU8A 3EGCA 3OIGA 4Q4DA 3U3MA 1YA8A 2WJAA 4REQA 4OHZA 3TFOA 1U5BB 1KDVA 3GW8A 1E5TA 1YXMA 2WF8A 1YQWA 3HACA 3PXXA 4NENB 4YP1A 3EDOA 4FGZA 4B82A 1HMYA 4ND2A 1Y9AA 5SY6A 4QXAA 1D04A 1DC8A 2I3GA 4F60A 4GGMX 4L3WA 4ZI7F 9LDTA 2QUAA 4ZAGA 3AF0A 5DNAA 2EX1A 1IYZA 3Q7RA 4XGIA 1QH1B 4DIKA 2A58A 3D64A 2FPLA 1Z39A 3CH6A 3L8EA 5ICEA 4KDEA 1ST3A 2I71A 4KXWA 3X43A 4QU0A 1N36B 1NY5A 3GD7A 4KAXA 3KTAA 1ZJ4A 4YAKA 3QQPA 5H4GA 3HRHA 1G9SA 3Q3VA 3LKVA 1QLJA 1SOWA 2I34A 4UOQA 4FFWA 3TFQA 4FYPA 2AZDA 3HH8A 3PWZA 3SZOA 4G5HA 4IVQA 2Q07A 4KR2A 3WRWA 1OY1A 4GZ3A 5BY2A 2HV9A 2PX3A 4AL4A 3M1YA 3D3WB 4WXMA 1R4NB 2R96A 1BKDR 2QTCA 2WKRA 4MGYR 4GLBA 4MJ7A 4IMPA 3DZBA 4B7ZA 5I7UA 3GJSA 4AIIA 4LW8A 3OCJA 2FLWA 3E27A 4QUHA 4DRXA 1QFJA 3TZLA 1QE5A 2MYTA 1MOZA 4C76A 1WA5A 1YRQA 2IQIA 1U8AA 2I5PO 4QJIA 1KGSA 5HRUA 1XMQB 3RJ9A 3LY7A 3WB2A 4C4YA 1RPNA 2A1IA 4BUJA 4DLRA 1UL1X 4C0AC 4QBFA 4M1ZA 1IHUA 1CB0A 1H8HA 3GJYA 3BTUA 3CUYA 3GPBA 2R4TA 3PENA 2AKEA 4KGXA 5CRIA 4OJNA 4IO1A 4ARIA 3AHGA 5ALSA 4C0HA 4RTJA 3JYNA 2GNAA 4OVKA 1XMXA 3DEHA 4HNQA 4N3CA 2DM6A 1I9GA 1RM3A 4OHWA 5I9SA 2Q0HA 3ZKAA 2WYWA 3UO8B 1VMAA 2Y1LA 1F17A 3ID6C 2BE7A 4YRZA 3COWA 2CDBA 3GEMA 3SFVA 3T3PB 4KTTE 2DJIA 2QZPA 2V7UA 3TLJA 1H94A 2AFIE 3MB8A 4X1OA 3ROFA 1OH8A 1DG3A 4GXQA 2GHQA 4PHFA 3RAPR 4B76A 4DLNA 1TZ2A 4GGPA 1QIMA 3MVEA 3ANNA 2CWDA 5F51A 3RC2A 1XVAA 4AY5A 2XY4A 2C2GA 1Y48E 2FPUA 4Y2GA 3TMAA 4DQDA 2GYWA 1XAHA 1O77A 3BS4A 3Q88A 1QQBA 3DDWA 3EOBI 3OEED 3D8NA 4QWWA 1ZSVA 1XK7A 4I7EA 1PEYA 3KT0A 1XF1A 1CUGA 1SUAA 1DVRA 4KXVA 4NZMA 4WOKA 2RGEA 5FL7D 4KV9A 1BN6A 2PTHA 1E99A 2WB4A 3FM9A 3GT4A 3JQ6A 1UJ4A 2XCLA 5C32A 2JLUA 1IVSA 4ODIA 4HVTA 3P0RA 4MKFA 3VNAA 2IU0A 4BOYA 2MJLA 3BA6A 2Q2QA 4TS3A 4L7VA 4XQ9A 1RZVA 2VAVA 4HYYA 5IC4A 3MSXA 3FJOA 3FB4A 1U8YA 2Z4TA 1BQ4A 3GPDG 4A15A 4KP7A 4BMSA 4GI7A 5D3ZA 3U9TA 5LB2A 4H9GA 5LQJA 5AXBA 1PNOA 1J39A 1T36B 2V6GA 2UZAA 2ZE6A 3BE4A 3BQNB 2JLQA 3PQ6A 4EZBA 1NV8A 4OBXA 4AJPA 1SK9A 5SZKB 3VC1A 4UCWA 4F4JA 3U7RA 3DEIA 4W1RA 2P2DA 2Q4EA 4Y30A 1KC1A 3AP2A 3PVZA 3ZBQA 5B6JA 2DLDA 5KTPA 2ONCA 3I9LA 1L7RA 4EJ0A 1NXXA 2FWRA 3RHTA 2BFDA 1VKRA 2OSBA 4JENA 4NBLA 1H6BA 1X2EA 2IP2A 1MJGM 2P4EA 4OXYA 4TT8A 5AYVA 5JMPA 5I3ZA 1NBHA 5F5LA 3JQRA 4WW0A 1BGXT 2CJPA 4GX1A 1SXJD 1OUMA 4TTIA 2LCQA 1CEQA 3WOVA 1EM8A 4LX0A 2VNSA 3QYFA 1E3WA 4ZVLA 2CVFA 4A2PA 5LUAA 3LPDA 3IJEB 2AG0A 4KQ6A 1NW6A 2QM3A 2BMJA 3NC1C 1LV8A 2OZLA 3K9WA 5K0LA 3T9DA 1QZXA 1QHHA 2Q1UA 4D81A 4WACA 1RI1A 4ILEA 5JCJA 3CN9A 5K8UA 3DLCA 4L4SA 4GP9A 1WOYA 1R6DA 5D87A 5A04A 5J4VA 1E64A 1V0JA 2AUNA 4G8CA 5FBWB 2EJVA 2QQGA 2FX2A 3DV0B 1EHCA 1TUGA 3C1TA 3ON5A 4QOGA 2VBIA 3LKDA 4ZVRA 5CDUA 2AD5A 1ECCA 1DPFA 1EB8A 3AV3A 5IASA 1I3OA 1W581 1U9CA 1X42A 3REOA 3L1IA 1KJNA 1ZD3A 5TQ2A 4Z7QB 2X0IA 4HDRA 4FS8A 4M8LA 4S04A 2CXUA 4F4UA 3DFUA 4ZCSA 3ZXSA 1WCWA 1EP2B 4CM3A 4KFUA 4TRJA 1WMDA 4K87A 3ZLJA 4DG5A 3AJ8A 5HILA 4CM5A 5E9QA 3ZXUB 1OTXA 3RRXA 3W3AA 4UQPA 4CKYA 2QLMA 1JVNA 3L6RA 1XLTC 2VAXA 4FINA 4IDGA 3H4TA 4ZXFA 3ZZMA 2RHJA 3UF0A 1E1QA 4O4HA 4X0EA 2EHDA 2JLRA 5JPDA 2Y9MB 3I39X 3EGEA 5CA1A 2EZUA 4EPYA 1WZEA 1YQTA 1VE9A 2IS6A 3A1FA 2XT0A 4YX9A 2FWPA 1Q0RA 1SC9A 2CJXA 2W7TA 2E9SA 1QYRA 1WPGA 2ZWOA 1EZZA 3BFJA 3A1EA 3QW4B 5E4TA 5I7SA 1EX7A 4QYWA 5CVCA 3MCAA 1T6YA 3G3EA 1G9TA 2XXAB 3I5AA 1TMYA 1G5QA 3LOQA 4YCBA 1AQJA 4Q5IA 1HNZB 3QH4A 3NTUA 3HUUA 5KZMB 5P21A 3VR3D 1VIVA 1RQ7A 4DGQA 1MHTA 3DGFC 2WD7A 5CFQA 1NW7A 1R2QA 2HCFA 2J9YB 3GRPA 5H4HA 4BNJA 4RJJA 4XD7D 1YULA 1MC5A 2PFKA 4FDUA 2XGJA 1SOVA 5K3OA 4RNCA 5FPYA 1XVUA 1U8ZA 3PZRA 4K2AA 4U7GA 3UV6A 1UJCA 3QPDA 3PQ8A 4KO2S 5IMSA 2HCRA 3IUNA 1TJNA 1P3JA 5CYPA 2GILA 2O2XA 2XGGA 3KLNA 3X2EA 1AG9A 1UBOS 3LDAA 5KTTA 2O8EB 4IHQA 5FOTA 1YO6A 4N4AA 2J3MA 1Q77A 4Y7CA 4F9EA 1J6UA 1ATIA 4RK5A 1IL0A 4E31A 5EG5A 4BNYA 1CFJA 1M66A 1KFEB 5EUMA 4CI9A 3TWOA 1PR1A 5JIBA 3E4DA 4N8EA 3VSCA 4NBTA 2FWBA 2R751 2EWVA 2HEIA 1RBQA 1YUNA 2VJKA 4OYHA 4XVHA 5DYGA 1MKYA 1X15A 3ZCSA 3NNDA 3L7CA 1JG7A 4UJ3A 1EAYA 1NBMD 1U0EA 2C77A 1G8SA 4H18A 4JL6A 5ICFA 3U44A 2N1MA 2WAMA 3BWYA 3PD0A 3MIZA 3K15A 4P36A 5DGCA 2ZPAA 3LC1O 2WSSA 4UU1A 1IM8A 4D6XA 1XRSB 3V8PA 2PE5A 4L15A 1JJIA 1TA0A 1D7AA 2BFMA 1X6VA 2FSUA 2NW6A 2PSHA 4FHEA 5AR1A 4A8TA 5DCUA 4P34A 4Y67A 3S1AA 2R4UA 3KELA 1Z16A 2WHRA 3K2BA 2W6OA 1EVYA 3CZ9A 2C31A 7ABPA 2D7DA 3B36A 2VXOA 1TUBB 2FPPB 1LSJA 4KE8A 4M0FA 5K0NA 4DAOA 1SUIA 1KDOA 1ZMBA 1BJTA 3TI7A 5HW0A 2VJDA 3QPVA 4B34A 4OLJA 1UPXA 3AIOA 4KQJA 1OBHA 1RQRA 5LZ5A 3V8MA 1CDDA 4CQMA 4HUTA 2WU3A 1E2BA 1RVDA 1G19A 2C5HA 1A04A 2C61A 5B5SA 3H0EA 1XLTA 3DPSA 1BC5A 1ND6A 4MI9A 5H83A 4K0KB 1NUSA 3EPHA 6CHYA 2XUDA 5EJGA 5IKPA 4O33A 2YOHA 2NSJA 4UM8B 4ZMBA 3OOYA 4Q03A 1Q7GA 5AVRA 5ICMA 3M6IA 2ODAA 2PX0A 3UHAA 2XD9A 3KVOA 4P92A 1AV6A 3ECAA 1ZY2A 1LH0A 3R7AA 4I4TF 1NNLA 2P1RA 2ERCA 4NS1A 4RS4A 4GR9A 2JHPA 3A6GA 3H3JA 2EBFX 4YV2A 4CKZA 1TTTA 1A9PA 4IDNA 2IWRA 4W63A 5I4BA 2GJ4A 4P08A 3BJMA 3N7UA 4ZCTA 1FRZA 4B6GA 5FPTA 1MDFA 3I2JA 4YWJA 3RGGA