3W3AH

Crystal structure of v1-atpase at 3.9 angstrom resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MAVIADPETAQGFRLAGLEGYGASSAEEAQSLLETLVERGGYALVAVDEALLPDPERAVERLMRGRDLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords V-type ATP synthase alpha chain
publication title Origin of Asymmetry at the Intersubunit Interfaces of V1-ATPase from Thermusthermophilus
pubmed doi rcsb
total genus 12
structure length 100
sequence length 100
chains with identical sequence P
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3w3aH00
3VR5H 3VR4H 3W3AH 2D00A 4IX9A 4RNDB 3VR6H 2QAIA 5KNCH 5KNDH 2OV6A 2I4RA 3AONB 5KNBH
chains in the Genus database with same CATH superfamily
1PK9A 3VR3A 4UXHA 3EPLA 3BF8A 1U7ZA 4HAOA 3OU2A 4GECA 4I19A 4U3JB 1C1DA 2TS1A 4LQCA 1Z7EA 3RUPA 2FMTA 4X1KA 2OQVA 1ZD4A 5H7XA 4L8VA 3QVSA 3IPRA 4REQA 1T5BA 2H85A 3WICA 1QQBA 1FU4A 1WSAA 4JR1A 5IN5A 4BMPB 3SM9A 4UNSA 2J3JA 1ISFA 2EAUA 4O2BF 4XQGA 1A4XA 2PWAA 3ANLA 4NDZA 4INOA 1T36A 5HK8A 1WMBA 4GGPA 2J08A 1ZN9A 2GPNA 1NG9A 4F7WA 1G8YA 1KIAA 1RT9A 3LKVA 5BWNA 5CGQB 4A03A 3BGSA 3L7NA 1M67A 2H1HA 2OQRA 1EXNA 2MMCA 4K9SA 4M49A 5DMXA 2JJQA 3UJ9A 2ZDGA 4D0GA 2XXAB 2V3WA 3TUIC 5LLDA 3CX6A 3WMGA 5C2JB 2PWPA 5DNEA 1YZKA 3G0GA 4OQLA 2Y0PA 2A9PA 2J4CA 4B3DA 3HWWA 4AJEA 2HK9A 5KYVA 1DAFA 3F3SA 3FTPA 4ZO4A 4EYGA 5EJGA 4W99A 2BLLA 3E18A 1KQFA 4IQFA 4YDSA 2J3KA 2Q3BA 4ZT3A 3M1LA 3DEFA 5A6SA 1II8B 5KTKA 2F59A 2AI2A 2AW5A 1RXYA 2W2VA 3AFIA 5BQ3A 3GAFA 1G9TA 2IJGX 2VRCD 4G26A 4TS3A 3AW9A 4URFA 1CQPA 5LQSA 4BQEA 2PSDA 3SJBA 3P0FA 1JTFA 5J2TB 3PG5A 4RVFA 3G8CA 4X3PA 1TM7E 3C6BA 3V1YA 2YRXA 4UFNA 3SDZA 1SKAA 3ZHRA 2QUAA 2M6LA 3AHJA 5EMKA 4JLMA 3SBDA 3GZJA 3HTXA 2YVUA 3ZTYA 1O87A 2VUSA 4XLLA 4DDKA 1N5JA 4P7BA 4CKEA 5BN5A 2W71A 4QU0A 5JZVA 4HLNA 4P5DA 3WZ2A 2C5FA 4C1BA 4ZAGA 3KJNA 1AUQA 1P4JA 2PD4A 3RIMA 1SKUA 3FYUB 4DA9A 1C7EA 1JJ7A 1MCZA 3SCZA 1ISHA 5I51A 1GPBA 3CPJB 2FYTA 2HSGA 2O7QA 3CNQS 3H8JA 1E98A 4A27A 3R7NA 4HVTA 5EQFA 2VDKB 2X23A 1XNHA 4K2HA 4BQFA 1GJRA 3STUA 1J5PA 1OJ7A 3LY8A 4FR0A 1P9OA 2XYPA 2DUNA 4JFAA 3OE7D 1S2GA 1WBJB 2FEPA 2ZSEA 3E03A 3UH0A 5B64A 4LE2A 5JZ9A 3HXMA 3RQIA 1DP4A 2H9YA 4CTNA 1P5JA 3B51X 3DONA 4MVYA 4BN0A 1DO8A 3GA5A 2DWPA 2G0TA 4RSGA 5DM70 2O8DB 1YUNA 3V4RA 1I3CA 2JIMA 1GITA 1KYZA 4IQ0A 1VSVA 4W9MC 3C3DA 1P60A 1E6KA 4ZOEA 4DPMA 4DR3B 4HBZA 4IMIB 4MRNA 2EEZA 5J5AA 4L8FA 4YY3B 5E2BA 4FDAA 3ONDA 3TO5A 1QAMA 1GR0A 1NULA 2JKZA 4YBZA 2K2WA 3IQZA 1PZXA 5IMBA 2WHPB 4K6HA 3T9FA 4S04A 1NOJA 2XCIA 1NE2A 2HGSA 2DT8A 2ZDQA 3MRTA 4MUMA 4WRRA 4XFDA 1HRDA 2ES4A 2EP8A 1BGWA 1KRHA 3CRRA 1KI8A 1QQTA 2JS7A 3DJFA 4G23A 3E3NA 4V0RA 5DSZA 1XDBA 2TYSB 3TDMA 4HDRB 4DQXA 1TIKA 2TMDA 2NM0A 3B2NA 4XDGA 2HBZA 3TB4A 5LU9A 1ZIXA 5CFRA 4Q4AB 4D9JA 4B47A 4F85A 1MZVA 3HDJA 5JWHA 2PH3A 2G1JA 1JDJA 4LYHA 2DBRA 2L82A 4BLTA 2RGRA 2QI9C 3GEHA 3WK9A 1FA9A 3KAKA 2CV2A 5H82A 4DMCA 1PFVA 4IHJB 1PHRA 2DFTA 4MITA 4R1PA 3UC5A 3AUKA 3GFOA 3IDQA 1JMVA 4TRMA 4FFWA 4CFZA 3ZGZA 4B17A 4OQEA 4MDFA 5HJ7A 3FMGA 5DP2A 3C6MA 1L8XA 2HBRA 4I5DA 4Q9JA 3ZH9B 3EIFA 1JEEA 3KT0A 5A3VA 4B4WA 1EU1A 3C87A 2V7QA 1YZUA 3L49A 3PCTA 4KXLA 4YB8A 4JASB 5GGYA 3K3PA 4FKMA 4JGBA 3VFDA 3QPDA 1T9AA 3BE4A 2X2FA 3GJ4A 4QPPA 3WB2A 3LW8A 1LDNA 4ZMBA 3IOBA 2EKQA 1SUDA 4PPNA 1LLQA 4WBSA 1W85B 2OYCA 1Q0LA 1FX0A 3HRIA 4HQFA 5F4ZA 1PR1A 3MJEA 3QF4B 4R1QA 5IEJA 2VYCA 5LXTF 2C2YA 4KR6A 1ZD5A 4MAMA 1DC3A 5TY0A 5AHRA 4UHKA 4FFMA 3ESBA 1PRYA 3KEQA 3R7FA 4B3HA 1NQOA 3DJYA 3MT8A 2PA0A 5CIWA 2B8TA 4FN5A 2QBYA 4EJ6A 1XC7A 2JCXA 5T4FA 5J1TB 3GZNA 1T4GA 5DXJA 1GA6A 4M22A 4ZVMA 2HQBA 1XMVA 3KWLA 4F9EA 1XEWX 5EY5B 1QGUA 5ALJA 3DKRA 3X1XA 4FM9A 1NVBA 4G0YA 3KLMX 3LYHA 2N47A 1AGRA 3B1YA 4JT9A 4QAJA 3Q7TA 1D07A 2Q1YA 1QIIA 4J1TC 2CLCX 2FSSA 3C14C 5ITWA 1M8FA 4IJUA 1ISIA 4YI3A 5HBGA 3FNBA 3IPCA 2WQ7A 2R6DA 4YDQA 5KJFA 1Q0RA 3NKLA 1E0DA 4ND3A 3L8DA 1KMNA 1KO5A 4BVEA 5JAUA 3D1VA 1XF9A 3H1FA 3EVGA 2HM7A 4P2BA 1NF8A 1X1QA 4EG3A 3ZGOA 1NC3A 1CUBA 1F2UB 2C3OA 1MC8A 1HDGO 1TO6A 3KX2A 4OMDA 4CV0A 1ADYA 2JLWA 3BB4A 1WQ3A 4CVNA 2FZCA 1U8AA 1ZIDA 2NT4A 2NU8B 3SLRA 1G2PA 3NVMB 1UPCA 1HDRA 2G82A 1K75A 4MV1A 2X14A 4NONA 3RU3A 3UJAA 2C4TA 3N0VA 2GEUA 3AF5A 3W6UA 2B4AA 3GN2A 1GTL1 4IOMA 3KOZA 4EKEA 8MHTA 3CRNA 3HV0A 1DTWA 3H5LA 4OQ4A 3WBJA 5DSTA 4M0DA 2VQEB 1YA6A 1G3RA 4D9BA 3WSWA 2R8EA 3ZW9A 4PRKA 4Z0HO 4WKOA 2WILA 1KSJA 4BNUA 2IH5A 1MJGA 3T95A 4ENPA 3BWYA 4JEIA 3U17A 1RI4A 4MUIA 1QO0A 2C92A 2ZJ1A 1FDUA 5ELMA 2QD4A 1F7UA 2I4NA 3EZYA 3KM0A 5TT0A 1WD7A 2YHIB 3AB7A 3HJGA 3ILHA 1DXHA 3P97A 2GCIA 2QT9A 1U7XA 3Q9LA 4X61A 4X3CA 2C5SA 3B1KA 1JR4A 3JQGB 1L7AA 4FSDA 5LNK1 4CM6A 4E2WA 1WB6A 2I1QA 3TAUA 1AKTA 4ITVA 2JGEA 2JJ8A 4MQEA 3VJRA 3FGOA 4JQSA 3GLHA 2VQ3A 3MMSA 1PYDA 5BXYA 2VJAA 1NI4B 2XVZA 4BVFA 2JCGA 1KYTA 2AR9A 3R7LA 2H7VA 3DW1X 3IVMA 5C8YB 4GMKA 1WV0A 2PX0A 1BWSA 3ISTA 2DLDA 4HTFB 1MIOA 4LGMA 4EJ2A 1BCSA 1PT7A 2ZBVA 3NHLA 4DRYA 4IH1A 4C7KA 4D3XA 2DU8A 2GNOA 1EJ2A 2Z8ZA 3OQ1A 3RS5A 5JROA 2QLLA 3AFMA 4WEQA 1RXVA 1YOBA 1UEJA 2WJYA 2H63A 4NARA 4OSPA 4UHEA 2GSDA 1CP2A 3ON5A 1BJRE 4C0KA 4O29A 4YAIA 2C59A 4R8VA 4PO8A 3T7RA 1HDIA 4BMOB 2ZVQX 1G19A 1VOTA 5DN6D 4K0KB 2EV9A 4O4HF 3R5TA 1W2WB 2JGNA 3D2LA 3FH0A 2FB9A 4CM7A 3AESB 2HXGA 5EZQA 5LOVA 1BW9B 1FU7A 3OOWA 4BWYA 1J70A 2IP1A 4GKVA 1T8WA 2YKGA 3PEYA 4ER7A 3LWDA 2CKMA 1G8FA 3D6VA 4G1FA 4MIYA 4B7CA 5DYYA 3DOHA 1JHVA 1TMKA 2ZRNA 2FW8A 1ZH2A 1GCUA 1S7GA 3ANYB 3LK7A 1NYTA 4NAUA 1FRNA 4OAPA 4X0EA 3T7AA 2OOSA 1B0UA 3I30X 2G70A 2W2NA 3HCDA 3PX3A 4KX5A 1SHZA 1Q84A 2FXVA 3NRCA 4OX9Y 1FQOA 3H99A 1VPTA 1RKVA 1LS6A 3WGQA 1Z4MA 1HRKA 3RVDA 1P5RA 2B3DA 1II9A 2CXUA 4LZJA 3E48A 4EQ6B 4M1WA 1LLFA 4DLXA 5HS4A 2I1WA 4V38A 1FOEB 4NBTA 2ZB2A 5I4CA 3T9EA 3HBMA 1ZITA 4URZR 4GM4A 5AM2A 3KVOA 2J41A 2FR8C 1GPWB 1AG9A 5FEMA 2FPRA 2J46A 4Y6RA 5C4IA 1QPZA 4S1OA 4IV5A 2ZUUA 4ZOBA 1N7JA 1LPOA 2WP0A 1UT6A 4P98A 2OESA 4IDPA 4BBPA 4ZYLA 1FJXA 1Y3AA 4F6CA 4Q3OA 4OKNA 1T1IA 3V6MA 5ALTA 5HR5A 1A0OA 3LP8A 3JD0A 3NV9A 4ZQFA 5B4TA 5EQDA 1DOZA 1JBQA 1SB8A 1UDWA 2O07A 4Q3NA 4QNRA 4C7VA 4EF5A 4YMVA 2XA2A 2IYLD 3BM5A 3NTOA 4DKXA 5BWMA 1UKZA 2NO0A 2ZRLA 5A1TA 5KCZA 2JBAA 3ZGXA 3WOHA 2YVAA 2IXBA 1KJYA 1FDIA 5CMLA 1QVRA 5HF5A 3TPFA 4R9NA 3EX7C 2QR5A 3Q5EA 2M6RA 1VE1A 3BIOA 4GQAA 1OI4A 1RU3A 1AXRA 3KZMA 1V25A 1A04A 1Z0JA 4MRRA 3K96A 4M9UA 3TVDA 1XZNA 5AUPB 1NW8A 4MW7A 5DB4A 3WK6A 3CH5A 1M76A 2YY6A 1B6RA 2P4QA 3O8LA 1ZD2P 3PXAA 1GL7A 4MV4A 2W4MA 4KIWA 4CHTA 1OXKB 2VK8A 3H7IA 3DLPX 4FBLA 3THWB 4IUYA 4C6SA 1P5HA 2WZCA 3BRSA 4XGRA 4XSVA 2BD0A 2WD7B 1XQ1A 1GZ4A 2YWHA 2HRBA 3QLTA 1IH8A 3OHPA 5A02A 5ALYA 3C5VA 3C4JA 4R1OA 1OZ0A 2E4AA 4QVGA 2PX6A 5AK6A 4HK4A 4HLUA 1SKYB 4JD5A 4BLOA 4DG8A 3PI6A 5EUCA 1ZINA 3JVUA 4EVRA 3WP1B 2DQKA 2O2GA 2VHXA 3UXEA 2P7HA 2PHZA 1U0EA 5K51A 2R00A 3HCEA 5BNWA 3GRFA 1VRCA 4TT8A 3V1KA 2H5EA 5IS2A 4DA4A 1TCVA 5JVDA 4QYIA 5LLSA 3ZQKA 3ZHVA 4I1PA 4ISBA 5BNTA 5I7UA 5KJ1A 3H2KA 2PY6A 5EJ4A 2EWVA 1UH5A 1D2MA 1DEKA 1UPAA 3OPYI 4W9NC 3SNHA 1LSSA 3U7RA 4CIXA 3U7JA 1CQJB 3Q7PA 1Z74A 3T9CA 1JLKA 3ZI0A 4AKEA 1RQLA 5A4AA 4F4CA 1T3TA 2AMLA 3HVKA 3AJDA 1I7LA 3RCBA 4WESB 1BRMA 4DJDC 5EZYF 1L0BA 3OFKA 3WGOA 2I1VB 3EFEA 3THSA 1I1NA 4YWJA 4EFKA 1JBKA 5A4KA 5C1OA 1FJHA 2IXTA 5CA0A 1EUYA 1UM8A 1QNLA 4LRYA 4IF4A 3HDVA 1T9ZA 2ZIVB 1RHMA 3FFXA 4OHUA 3ZJ5A 2QY6A 4MARA 3FJOA 4I55B 1Z2DA 7AT1A 3AUYA 4FMCB 4Z99A 3OT5A 2J67A 4MR9A 3NX4A 3V4PB 4QWWA 4DV1B 2XY4A 5K4AA 2R8OA 2NZ2A 4JLVA 3L6EA 2NXNA 2IXGA 2GDJA 3S5JA 4FX2A 3E8MA 5FJJA 4OQXA 4EA8A 1KK2A 3N8IA 3HA3A 3TZEA 1G98A 2XWSA 4K1LA 4PS0A 3D2BA 3WLEA 1OBOA 1YC5A 3ZS8A 1B74A 2YJTD 1BXRA 3D64A 5CK5A 4QOIA 2W6QA 3MWKA 1HO3A 5GOZA 4HC4A 4MJ7A 3RAEC 3UH1A 4ZAWA 2V7XA 3LPDA 5DLPA 4YXWA 2VK4A 5ALNA 2JJYA 1JS1X 4MWBA 4Z4EA 4AYTA 4IV8A 4DDTA 3TRFA 3I92A 2AH5A 4HQRA 4EO9A 4IGEA 5B3JC 3F1LA 5EYPB 3PR1A 1AKWA 3MOGA 2CD7A 3RS9A 1C9NA 3AY6A 3SI7A 1A5SB 2J0QA 2C5AA 1ZXXA 4WK6A 1DS6A 5I8WA 1IBKB 3K4HA 3ZWKA 4HUTA 1UBFA 2O1SA 3AZOA 1PJTA 4LRXA 2WKRA 1VLHA 4ZJPA 4AZWA 5B6PA 3D6JA 2R4UA 4C2TA 1JB1A 5JMPA 2BZ0A 2WVAA 3QBDA 4IRUB 5IVHA 1XU4A 3Q85A 4B71A 1DIOB 1DXQA 1ESCA 3A1NA 1SQGA 3PEVA 4YQYA 1HETA 4KPGA 4QG7A 2XVYA 4RK4A 2ZBRA 1ZR2A 1IG0A 3IT0A 4U2BA 5EJFA 1TQ2A 1R1DA 2MSCB 3B6KA 1A50B 1ZQ1A 3UKDA 1FTSA 1FTQA 2CHUA 2GN1A 1M2VA 2EW2A 3CZRA 3QVOA 4HXEB 5JIBA 1IBLB 1DAKA 2BHLA 2CJXA 4YRDA 3IDSA 1NRIA 3KJFA 2R8BA 3HABA 5G02A 1ORWA 3R9XA 5CNMA 1JSZA 4UCXA 1B93A 2VAWA 2BKAA 3ZQUA 3CEJA 4G0WA 3ME5A 1TL7C 3VAAA 5F21A 2YMQA 3NFRA 1F7VA 4YCMA 4C7MA 2GTHA 2PANA 1DV1A 3UMVA 4YLYA 1U2QA 3HHEA 5EJ8A 1GTMA 1I6LA 1GRCA 1YASA 2V5VA 3CISA 3CLRC 3BMNB 3C3AA 2JI7A 5JAOA 2OHFA 3R5FA 3IP7A 4EENA 5JCZA 1AKRA 3O6VA 4TXJA 2J6CA 2PZMA 1LA2A 2BZ1A 3HXKA 2ZS8A 3W5JA 2HA5A 3HCWA 3MWEB 4AL4A 2JFBA 4ALKA 4F97A 2TRSB 5HZGA 4R9UC 1RBMA 4HGYA 2F1KA 3RRZA 1QYDA 4N0DA 5GOTA 1GV0A 2HU2A 4W5JA 1GG8A 4LJKA 3T3IA 2LPMA 3CNLA 3T7TA 4DLRA 2XOKD 2FEXA 1CCWA 3DH0A 5K0CA 1RLUA 2O5EA 3OJCA 2X0EA 1XLTC 1ADGA 1M5RA 3HDGA 3RC3A 2H7YA 1N2CB 4N7MA 4RIGA 4TSKA 4UMDA 1C0PA 4MAFA 3GX1A 1SXJC 1A8UA 1EVJA 1H5QA 2MSLA 3JCZA 5DHFA 3FSRA 4B3XA 3K1AB 3W34A 1E3MA 2RK3A 3VYWA 4AC9A 3JX9A 1WW3A 4EYSA 4R69A 4A8PA 3EGEA 4U6SA 4B85A 4PSDA 1WS6A 2PXHA 1ZFNA 4BTEA 5CFNA 1YQTA 2WYUA 3IEIA 5HXAA 1LJUA 3AEXA 1Z4JA 3BIWA 4URVR 3FB4A 3K8ZA 3KVVA 5M7EA 3GJ7A 1NY5A 2B5OA 4F5ZA 1JR3A 2MSDB 3QQ5A 4Q16A 3OEWA 1TJNA 1DPGA 3O9ZA 2HO5A 1V47A 1T5TA 4OFBA 1FSFA 2B7BA 1A9ZA 1BE8A 1KBQA 1O54A 2J3DA 3FRJA 3IOEA 1MMFB 2YHBA 3IAAA 4HQOA 4RPCA 4XVHA 2PR2A 4ZQCB 4EJSB 1QHXA 3MIIA 2VYVD 2VAPA 5C34B 3WGLA 4C29A 3O47A 3AVPA 3QM1A 1PK7A 4PR3A 4U6NA 2ZYDA 4B6SA 1BN6A 1XVVA 4BGUA 1BKYA 5ITZB 1E0SA 1E2KA 1VE3A 3BT7A 2CWDA 3AF6A 1BWRA 1DMSA 3T4XA 1R4AA 4BNKA 2WY2D 3I1YA 1BA3A 2AG8A 2JCYA 2SCUB 3IIKA 3FHJA 1Q0QA 3MTGA 2NUAB 2P9YA 4NENB 1GG5A 1CR2A 1BWPA 1ZOPA 4ARZB 3ESAA 4W1PA 1DGQA 4GOXA 3TKLA 1Z25A 1RXUA 3DHEA 4YMUA 4R6XA 4Z4FA 3LWNA 3AUTA 1XN1A 5JSQA 3X1DA 1GZDA 621PA 1N0WA 2XBLA 2RGUA 4BAGA 3WS7A 2D74A 3R09A 3TXXA 1ZMRA 4INAA 3U4AA 3LDGA 1OFGA 3UZUA 1GG9A 2I4OA 1TZ2A 2FMXA 1EUDA 2REBA 3FBGA 3LVRE 3OQIA 4L3OA 5A05A 3PE4A 4GHWA 2VC2B 4L6IA 2JKVA 4OX9B 5C1DA 1LQ2A 2WUWE 1FLNA 1I3OA 3DWGA 1THGA 4BO7A 4EMSA 4ZTZB 3AERB 2A9JA 2FCAA 2QX6A 2W6JD 2VDJA 3PNPA 2C58A 4NV3A 4MS1B 4Q4HA 2PL5A 3U5TA 2OYRA 4X1KB 1VSTA 4ZCQA 2PX4A 1O5OA 2IK8A 4HGQA 5ALDA 2QPTA 2ZYTX 4KC0A 4K6GA 1ECFA 4OI4A 4RH3A 1A9XB 2J7PD 3E23A 3ORSA 2WW8A 2H2FA 3ET4A 1LLCA 2C9ZA 1JVNA 3FWYA 3LTNC 1K7EB 4DNOA 4BQNA 4ZRDA 3HO1A 1YMQA 5AJWA 2Y0DA 1T36B 1PNVA 2QORA 5K0NA 2EKZA 4QUEA 3VSDA 4MWCA 1IIBA 3DT9A 3ZV3A 2AOTB 4QSMA 1N9GA 2W37A 3W6OA 1WG8A 1ZLXA 2G1KA 3FPEA 3L6CA 2PVSA 2J32A 3UKJA 3CVWA 5PGMA 2W93A 4K1XA 3GNQA 4KLNA 4S0XA 1A7KA 2VPYA 3KVYA 3RWBA 3S2FA 3V7YA 5MN6A 3HJFA 4V24A 2VSYA 1YFLA 4B3CA 4XAQA 1G20E 5AFSA 2IKQA 1IY1A 2JGIA 2RAUA 3ETNA 4RJTA 1DUVG 2ERYA 2IPAB 2ZIWB 4OHBA 3SYLA 4AUKA 4DV3B 1T2VA 1U2ZA 2QXTA 3CRVA 4BNTA 5T64A 1FXWF 4AG6A 3K0KA 3V32A 3ADBA 4Y6LA 1NJ1A 5A6SB 3IHTA 4GRAA 3BCSA 1ADJA 3UGKA 5HYVA 3DBLA 3G13A 4TX1A 1FRVA 4NBRA 1P2TA 3IBCA 1MQAA 5EIBC 1CVRA 3WLSA 3DAHA 4CDMA 5FQOA 1N3YA 4C01A 4UBKA 1L1QA 1QVZA 1TADA 2VRNA 3OIDA 1O9GA 1P7CA 1RQRA 1RSZA 3QPWA 4HYEA 1SCQA 4JEUA 4KFRA 5TPZA 1IY0A 3AT1A 5KDLA 4F9TA 3TF5A 1I2AA 5ESWA 2GYWA 3PXXA 3MSXA 1MABA 4QREA 3EAGA 3REGA 2RFLA 1JG6A 1Y6GA 3AXTA 3NEJA 4ZKEA 3JQFC 1E2BA 4OSOA 3OLQA 2IELA 2ZSBA 1S2NA 4CKEB 1H1DA 1EWRA 4AJKA 4N8DA 4M0UA 3FHOA 2ZRDA 1XCJA 1UKYA 4K05A 1D7OA 2ANCA 1TVKA 1JQ3A 3DVRX 4JCOA 1LPMA 1P1KA 3CN9A 4JBGA 1GPKA 3HYNA 2NVUA 3MGCA 4DABA 2APJA 3I8XA 1X8JA 1P9WA 4ID9A 1C8LA 4KWIA 1SCUA 3PLAE 4MUXA 4QU9A 2C4WA 2O4CA 3PENA 4LTMA 4E2YA 5CFQA 2V7GA 1QE3A 4A2CA 2PSSA 2IPMA 1VHLA 3FKSD 4PRLA 2JCBA 4G9GA 4QOJA 3WLFA 4ZJUA 4CM9D 4YJ3A 4R0MA 1O4WA 4N7RA 2DFLA 4KE6A 1V71A 1FQJA 1OFIA 2GSWA 3R6LA 4TZTA 1AK2A 4FNMA 2QN9A 3SS7X 3KXLA 5DOVA 3EEQA 1NBHA 3HLKA 1XO1A 3KV3O 1RXWA 2J9ZB 4HY3A 1PG2A 1MRNA 2WF7A 3RGWS 3D54D 3QIVA 1R8SA 1TNDA 2IU3A 3QEMA 5KSPA 3QX9A 2JIPA 1FBNA 2OAEA 4OJQA 3IR5A 2Q5IA 2JIDA 5DHTA 3RLFA 1VYHA 1ODLA 3UK6A 1IL0A 1WA5A 1NF3A 2CL7X 3RUCA 1DFGA 3LQFA 2AV6A 2J4FA 1JA9A 1G16A 3CMMA 1VJTA 3K8YA 1K4KA 2YINC 2WM2A 4JNCA 4A0FA 2BGTA 3W8DA 4JX9A 2HCBA 4N5IX 4GX0A 2ZZMA 2QMYA 5MN5A 1C7ZA 2CXNA 4ZGWA 2HHHB 1EZZA 1S8OA 4HNSA 2IXDA 4LOJA 3JSXA 4Y6OA 5LZ5A 1ZHOA 3U3OA 2GFIA 4L72A 1KAMA 2ZU6A 4S35A 3EPKA 2ATIA 4INJA 1KI6B 2DY1A 2IOHA 4MCJA 1BOOA 2QAGC 2DG2A 4WVFA 3OJEA 2FF7A 3E0XA 2QPAA 4H9GA 1YZLA 3RM3A 2EBFX 1TUBA 3AR6A 1D2NA 1AKUA 1O95A 2FCRA 3MUNA 5E1DA 5EE5B 1C7JA 2OBBA 2PH1A 4GT1A 5CBPA 3PBKA 5CLGA 3RU7A 1OWOA 2ETVA 2FQWA 3SC4A 2JPDA 1N6LA 5BN3A 4P8RA 3KHKA 2OV8A 4IIDA 3TFWA 5KTYA 3KJGA 2IPXA 3E3AA 4RY9A 3UCEA 2PWBA 4MDEA 4HFNA 5CDFA 1J2YA 2OVFA 4NZNA 4EPRA 2VFAA 3AHGA 1EWYA 4ZVVA 1GRRA 2EQ5A 3VU0A 4DC9A 3JAKA 1V5WA 5JJLA 4KVZA 4ZARA 1V9CA 5JXHA 1VJ5A 3UUGA 2XNCA 1B8VA 3RAGA 4F4FA 1JKIA 1FX0B 2WKSA 1ZMBA 3W1EA 4NCXA 5E4JA 3BFPA 3NGLA 1DC6A 2QRUA 2BELA 4KUEA 3OQOA 1E3TA 1IDN1 1VKZA 3KPUA 5ER9A 5IXJA 3DCYA 1E2FA 3GEGA 3OIUA 5AJTA 2QBYB 2FPLA 1PJ3A 3IJRA 1A5TA 1EE1A 1S4QA 3E5MA 3GZNB 2IZ6A 4RYDA 4JYPA 5IJ9B 4I3FA 3U3KA 3ZQ6A 4KUGA 4RDIA 4UQOA 1OASA 1G21E 1ZK1A 2CXXA 221PA 1LZKA 4ZOLF 3WKDA 2QMZA 4PSAA 5SZIA 1GAQA 4MA5A 5I5EA 1F48A 5J4HA 1BH6A 1VQ1A 1XD2A 1IVNA 3RC9A 3PP8A 1DIHA 1KP3A 1L5ZA 4LPSA 4RAOA 1JH8A 1X1BA 5CIQA 2B4TO 4EITA 3Q8MA 1O96B 5T4BA 1WZ2A 4IIJA 1Z2CA 4JKIA 1E6CA 1YJXA 1V1MB 5K6RA 1VYVA 2YZ7A 2X22A 1WXEA 1D4ZA 4DUGA 1KPIA 4FSXA 1E20A 3C5EA 3UW3A 2I2AA 1WZUA 4KWEA 1LD3A 3I04A 4D8XA 1Z88A 3CE9A 4PHHA 2QR2A 1JHRA 3E9YA 2QMUA 4KQJA 4UEKA 3PHHA 1X1EA 2AI1A 1PGJA 2O0JA 4HDMA 1TQDA 3EA0A 2WSBA 3UYKA 3X1MA 5DULA 3ZU3A 5EWMB 2Q3JA 1DKQA 4ROSA 4TVBA 1QGDA 1XZMA 2FRDC 721PA 3AKEA 2QVZX 3RODA 5KMGA 2AEEA 3IUJA 4H7KA 2ETXA 1M1XB 3C3JA 4ND8A 3T1VA 3GXOA 1DTWB 1HZZC 1GHTA 1P2UA 1Y0BA 3UOGA 3VM6A 1Z0ZA 5DTRA 2H48A 1TYAE 3W7AA 3NOXA 4DLSA 3EXHB 3ILXA 1P33A 2W0MA 4MR8A 4UTZA 4RD1A 5HRAA 1HYEA 4Q6BA 1GUBA 1QMPA 2AN9A 4BV8A 4CM5A 2ZRKA 4BPBA 4D1YA 1IATA 4MWZA 5IUNC 3SC2A 5B53A 1JQDA 3IAXA 4BN5A 2E4VA 1XPOA 1QCZA 1FSPA 1J8VA 1Y7LA 2XUFA 4BNGA 1HFWA 2BFOA 4Z1MD 1DG9A 1DZIA 1W6RA 4NMHA 4MI9A 4V2IA 3V3KA 3ZY4A 2B1JA 3W4JA 2XF8A 1B6SA 2NV0A 2HHJA 1FE8A 2R65A 4RVUA 2IFTA 1M7HA 3O95A 1JHYA 2Q99A 5FR1A 1QFMA 4WY8A 4OOEA 1Z8HA 2J7KA 3GLHB 3OSUA 2Y1DA 1UADA 2QIPA 2WDPA 3IE2A 5JADA 4ERXA 5JFTA 5LQMA 1BRTA 1WDMA 1PNQA 5KO2A 4MICA 3A3OA 1B0ZA 1PQYA 4ILKA 1ELOA 1QS0A 4HPXB 4R2IA 5AJHA 3REFA 2A67A 1EXWA 1MIOB 1T9BA 1BCSB 1C7QA 2FEKA 1PSZA 3ND6A 5EJ6A 2NYRA 3N58A 2BFDA 4DEYA 2NZXA 2H1RA 2ZPAA 4M1OA 2XE8A 4MB2A 2QVXX 4ZYXA 3BXOA 3H4VA 4URHA 2WJ3A 4JLWA 4XQCA 1RJDA 3FVVA 1XTBA 4I1IA 4OOFA 4W6ZA 1UPUA 4HFJA 3UAVA 3G2QA 1K97A 2SKDA 3N7AA 4KWHA 2Q4EA 2ISSD 3ELYA 1NVDA 2FE4A 1KBZA 2RH4A 3L05A 3QKWA 4KO1S 5JO9A 5SY4A 2ECQA 4I08A 3RK0A 3TNLA 5TV2A 3RADC 3EGWA 4KHZA 1V1RA 5BY2A 5H4GA 1EFAA 4YAUA 3E9EA 2F2TA 3PKIA 3KKEA 4IRMA 1BFKA 4AZVA 3ZLTA 4EO4A 3LDFA 3Q3JB 2Q3FA 1Z4KA 5A4IS 1I24A 3PR3A 4Z4CA 3UO8B 1Y6ZA 3M33A 4MRMB 2ZTLA 3BH7A 2Y93A 1CJCA 3D3KA 5GJVC 5D5QA 1POXA 2BDEA 2WT8A 4ICIA 4CMKA 4M9RA 2B1QA 1ADFA 1E63A 4C3VA 1CZKA 4JP5A 4Q15A 2GCGA 3JZIA 1R8YA 5AR1A 5FTLA 5AM0A 3QG1A 2Q2VA 2C8KA 1FRQA 1E61A 2VT3A 1XCLA 5I01A 5AO9A 1AGNA 2I4MA 1Z12A 1ZS9A 2J8ZA 4FMBB 4KIGA 4CLEA 1IULA 4B6GA 1T9GR 2BONA 2JL1A 3EIHA 3I4CA 1HL3A 9GPBA 5KJCA 4WE3A 3MN1A 3K6JA 4E5DA 3DZBA 1OWPA 2A84A 2Q46A 3SE7A 4IVQA 4WA8A 2XUHA 3GLIE 4H0CA 5TGTA 1KSHA 3DZGA 3CC8A 5ALRA 2EZ9A 1K8XB 3R9KA 2HV8A 1DDGA 3A6KA 3KVRA 4IM7A 3QF7A 1L8OA 4J1QA 4S2EA 4ZXPA 1AMUA 4LFAB 1RYNA 2P9HA 2ONYA 3BHJA 3ECCA 3KJEA 4GVPA 1NNEA 1DX4A 1J8YF 1GEEA 5HIAA 1CY4A 1NXVA 1QB8A 1QP8A 4C88A 4ZDJA 2YWJA 3BKXA 3EMKA 4XUDA 2HUNA 4E7PA 3UG7A 4US0R 2GXAA 3DHNA 3CBGA 3HWSA 3STHA 3QHAA 5F5LA 3D4PA 1JG2A 3CNNA 2JBAB 2B0CA 2HCJB 2O3RA 4L28A 4B6QA 4MYDA 1YCDA 3RRNA 1E1QA 4NOLA 2WJPA 4TRNA 7ABPA 3WRXA 1OB2A 1PT6A 3F47A 3WDKA 3BRCA 2J3EA 4K8RB 4N0PA 3ZHXA 3DGEC 5H4HA 1Z06A 2CXTA 3LP6A 3GT0A 5A2QA 1BYIA 2C3PA 2GK6A 2HEGA 2BCGY 2ZVJA 3QLVA 5E0OA 3WSVA 2BTOA 5CH3A 3Q7EA 1I3NA 2Q29A 3K2BA 3QWAA 4FYXA 3P4UA 1NUTA 1NRWA 3K6RA 4RLFA 4R84A 3W5UA 1IN1A 1P3JA 1J33A 4N5MA 1Z7BA 4AUNA 2QSJA 3GCXA 2DAPA 4ES6A 3SU8A 3ERCA 3CJTA 5SYNA 2M6KA 1JAXA 2XE7A 4YHBA 3KHSA 4CI9A 1DJMA 3RG8A 2WVJA 4HXGA 5AKGA 5DX0A 2WABA 3E1GA 3L5OA 3INYA 2QTBA 1TQ6A 1XJWA 4M9CA 2GLTA 1QU2A 1G9XA 2DMRA 4DA6A 4P7FA 2J30A 4X44A 4PIMA 3TX6A 1V11B 1KJ9A 1NX9A 1ECBA 4HGZA 4MRSA 1XVLA 5IBQA 2AFIA 4TUYA 5CVVA 3M4ZA 2Q27A 4IP0A 2A9OA 1M2WA 2BFBB 4QYIB 2JIOA 3CX7A 1Z36A 4UU1A 1NVFA 4TMKA 3DXYA 2FSFA 1VGQA 3AKDA 3DSRA 4BX2A 4CDNA 3K5IA 5JAIA 1E99A 3HUDA 1N6OA 4X1YA 3SYKA 3FOEC 3T3MB 2QTTA 3I6YA 2L0XA 2C77A 2Q5QA 1P4GA 1KBOA 4EPTA 4BCDA 2FN8A 2W00A 3V4OA 1U4OA 4ND5A 5CA0B 1FUKA 4KTVE 2GBIA 3UBTA 3U3XA 2CZQA 4GWGA 2CVQA 1JHMA 2Q1WA 3BTUA 5I3ZA 1K08A 4GPTA 4MQ6A 2ZPTX 2DF8A 4LYFA 3NW9A 4KGDA 3FTNA 3EZ9A 3WJ7A 5K0GA 2H1CA 3P8ZA 1B8PA 3LUDA 4O25A 2VDWA 3NKFA 2NYUA 2A5YB 4J07A 1JLRA 4JBYA 4RPHA 3RS3A 1UPXA 3U4HA 4XYLA 3WLNA 2C7VA 1OFVA 4YP6A 2X42A 3QXJA 2Q5JA 1BXRB 4KPUA 2C2XA 4YAEA 3HYLA 3A3YA 4GI3A 1SXGA 3CRMA 4ZQEA 5BQ5A 2PYIA 2A8YA 1EX7A 2V97A 3ZWDA 1MRZA 4BEVA 3DFMA 4LC9A 2GAIA 3F46A 3OY2A 3OMLA 3X1JA 1FUIA 2YMPA 4HMOA 4BJ5A 2ZBPA 4I81A 1Q44A 1YZVA 5EWLA 1SC6A 2XGJA 1BVUA 4R0VA 1SCNE 4Z9BA 4G65A 4QJIA 4GRIA 1CZNA 4Q1CA 1O3YA 1S2OA 3WKCA 1MXFA 3ANNA 3A4MA 5I7WA 5K2MA 4ZHQB 1P0FA 2PUFA 5KNCA 1FNBA 4MUYA 1U04A 3IV9A 4NEHB 4CL3A 4Y1GA 4F4IA 1JT9A 2FFBA 3VKFA 3FY4A 2HIAA 3LKBA 2ZJFA 1MJGM 2Y4OA 3EH2A 5EEHA 1FPMA 4M88A 1M74A 1Z5UA 1GFIA 3QH4A 4LX8A 2RHRA 3QKTA 4M0KA 1UODA 3C3PA 4PQFA 1SU6A 2JGDA 4NAHA 4BQPA 5LMCA 3JVDA 1SHKA 4FOPA 1USUA 2FDCA 1M2VB 4M1QA 4R9RA 4RGYA 4XQ9A 1D09A 1RQ7A 4HDKA 4Y2RA 5DNVA 4X5OA 1T34A 4BUZA 4EGSA 3VKVA 3TFOA 2DX7A 5CDSA 4M0LA 4YMLA 1ZZEA 1KH2A 5ALPA 4FHZA 4WOPA 3R9XB 2N1MA 3HKDA 4FCTA 3FYSA 2G09A 3L1JA 3NORA 3PSAA 4HLDA 4LQDA 3O8QA 4UVGA 3CM0A 4TXNA 2DM6A 2ZB3A 4R3NA 1NTOA 4NU8X 3B1JA 2UYOA 1XROA 3MS4A 4OQQA 1ZXBA 4HNRA 5CJPA 1GL3A 3MUOA 4J2TA 2PYZA 1G8JA 1U6IA 1YI0A 4HWRA 5ANRB 3TCKA 1W49A 4EKDA 3ORYA 1ZVKA 1Q14A 4PZ0A 5ICCA 4CMEC 4P31A 4I6EA 1T13A 1LC0A 1L1RA 4TV9B 2UXBB 1B8UA 4YWHA 3ZDXB 1ODFA 5FDFA 1YQGA 2HA4A 3HP7A 4Q7JB 2Q3HA 1V8OA 1X9IA 2P9FA 3PFWO 1PZFA 4UEQA 4QXAA 2PUJA 1EFDN 2RCNA 1PWHA 2VHJA 4AW9A 1O94D 3AEUB 1ZM7A 1BU8A 2WC1A 3T3EA 2XWPA 5LOVF 1BHQ1 1FYXA 2Q8QA 3GDOA 4NCHA 5U4XA 1F2TA 3F97A 4ROTA 4RU1A 1WMDA 4G5OA 1SUAA 3FROA 4L3VA 5JD3A 3MWFA 1E3EA 3GO4A 3PVCA 3K9CA 2P8SA 1XCBA 2JI8A 4EGAA 2C4UA 2OAQ1 3NP9A 3O94A 2WWTA 3CX4A 5U1PA 2OA0A 4UQLA 2OORC 1E3JA 3K05A 4FWBA 4LOIA 5EIXA 2UV8A 2GD1O 3TUJC 1KRXA 3ICCA 5EKSA 1KNXA 2ZT8A 3T5MA 1H93A 3FPSA 4TKZA 5IDYA 4ZD6A 2Z2ZA 4OUDA 3W2IA 3WE7A 3T4EA 2FPPB 3HA7A 3O38A 1R6XA 1W93A 4QVIA 1YR8A 3LQQA 1J7JA 3QK7A 4U39A 5E0KB 4LHVA 2R6R1 1T3ZA 2J0VA 3EHEA 1CR0A 1W1WA 2YHUA 5TC4A 5I8ZA 1BXGA 2I3AA 3WP0A 1TK3A 1QIHA 4R81A 4L27A 5CT6A 1XNJA 4B2IA 4FZ3A 3IT1A 4FT2A 4GM0A 4L16A 3SM3A 5JR3A 3E1KA 1X7WA 1IIRA 3MOSA 4KQGA 1DTSA 1M1UA 4DLWA 4JLKA 4BVAA 1J4AA 3T1QA 4L4RA 4AMGA 4BZPA 5AKKA 3R76A 2WR8A 5IKPA 2GBCA 2HK6A 2ZKLA 3T12A 3GPIA 2QU8A 3LT1A 5F12A 4F2DA 3OC6A 4RNCA 2UXCB 3AK4A 2C5EA 3K6KA 1BHO1 3P9ZA 3AXSA 2ZIUB 4U0KA 1S2DA 3P19A 1U2GA 3SF8B 2HMUA 1C4XA 3HI4A 4LZAA 4YUAA 4OXIA 1BWQA 2P40A 2XI4A 1ZOSA 2OCYC 3OZGA 2HF2A 4UAGA 4AJHA 3T7EA 1YTUA 3TCNA 3OQIB 1UFVA 3TMYA 1COZA 1SR8A 3JZMA 4NE9A 3COZA 1ACLA 3GLQA 4EABA 1AB6A 2KHZA 2PNJA 3H5RA 4FI3F 3D3EA 4IIUA 1QGZA 4DREA 3GLUA 3KZKA 4CMIB 3D1LA 5JCJD 1ULBA 1YF3A 2A5DA 2PS1A 3BICA 4BNMA 1HTBA 1Q17A 4IUCS 4KQHA 4BFVA 1G0NA 4UXIA 1M0WA 3T06B 4XARA 4B3SB 2R48A 4TOIA 1VG0B 2ZREA 4H59A 4Q4HB 1KHTA 1YS7A 3ONEA 4RESA 4LZWA 4BECA 4D81A 2W11A 1FYWA 3QPCA 4X97A 4EM6A 2POCA 2YR0A 4G2TA 1USVA 3BGOS 3Q3HA 2WK1A 2RBGA 3GUZA 3QI7A 4J49A 4ZVKA 2KS6A 3K30A 4DS3A 4Y2VA 3RV3A 5JVDF 1VYUA 1Q6ZA 1XN4A 1HH4A 3NT5A 2WWRA 3EXG1 3HJRA 3TLGA 1CU1A 2EFDB 3ZHTA 4BIIA 1GKUB 1VPDA 4NX2A 1NLZA 1N8KA 3GRYA 3NAGA 4G89A 2YOHA 2YTZA 4KI0A 4NY1A 1SA0A 5EVCA 3T5TA 1P2GA 3WB1A 4D0LB 2X7HA 5LZ8A 1FXSA 5DE3A 1DBIA 1UMBA 1GNTA 1N9GB 2X9VA 5F51A 1O8BA 5DYGA 3CY6A 4I7EA 3MCWA 3PQ3A 2F4NA 3LX5A 1SIBE 5C51B 4PGHA 4R8KA 2WWYA 3AW8A 2KB0A 1YRAA 3OQNA 2J0UA 3H1TA 5DW0A 1EINA 3PQ7A 1PQPA 2ACEA 3MNFA 2OHXA 1HYBA 1P0MA 3G89A 4I1VA 4Y8VA 3QWHA 4YFYA 1MBZA 5JY1A 5EMJA 3DBLB 5I7VA 3U19A 4AWXA 3A6ZA 1QZZA 3JYHA 4MB6A 3SD7A 5LMZA 3LQYA 2C8JA 4O1IA 3KSAC 3QFHA 4Y6GB 3OJWA 1W48A 1DBQA 1DKNA 1Z83A 1CVLA 1G1MA 3AMVA 4UJ3A 2GXQA 3UB2A 3HDQA 4YJHA 3PNVA 4E1BA 2P4UA 3ZGYA 4DZRA 5DX1A 3SHOA 3ZWXA 1FFSA 2ZRMA 2QZ9A 3GFPA 1PR9A 3ILSA 3OZSA 3EISA 4U8HA 2DR2A 4UATA 1EBBA 1WDLA 4P4NA 5JJIA 3JZDA 5LWQA 3QEAZ 4TWRA 2QRZA 2GVDC 4QOGA 2IDJA 1E1CB 4FPXA 5JG7A 2E49A 3BZBA 4KI7A 1A4UA 2IHVA 4MUBA 1TVKB 1WVIA 3KZCA 4G6ZA 4KMRA 4GZ3A 4R01A 5IK2D 1T6NA 1LPSA 3OLWA 3PIDA 5IC5A 3WMRA 1PF7E 1EWVA 3WJ1A 1E6MA 1GA1A 4NNPA 4RK7A 3ZU4A 3T61A 1RRKA 3EEOA 4B3RB 2AMFA 5TQ0A 4X3OA 5L45A 1GSOA 1U8UA 3HYTA 4JT4A 1E1KA 4Q4JA 1N4AA 3GT4A 1HDOA 3UTCA 3C8HA 1ST2A 2GKSA 4RFSA 4YJ3B 4JXXA 1ZJZA 3G2PA 1CFJA 1O5TA 3H16A 5CNKA 5JOQA 3ZZMA 3T3PB 1DO2A 2Q3MA 3DCIA 3EDOA 4NMLA 4WI1A 3I2GA 3OIFA 1P0QA 3PFKA 5B58C 4OI1A 4L57A 1T5SA 3S70A 4F72A 1LDGA 2KM1A 4X1OA 3NYWA 5DM60 1ZX1A 2ATEA 2FVYA 4Y7CA 3NFYA 1H69A 1NJSA 1VIVA 1ZM4A 3KNZA 3KYDA 1ZAYA 2PRYA 2YW9A 4IKPA 5D00A 1C0EA 1U0GA 2AC4A 1O77A 1SURA 3KJIA 2G36A 5H02A 3WHIA 2W98A 1LI7A 3CS3A 5CDTA 2GHIA 1TJPB 3ER8A 4K9PA 1L5OA 4OY3A 1OLOA 3DDHA 4LNUA 2Q5HA 1HT1E 4NV0A 1WLYA 3SICE 2D00A 3TZQA 2Z58A 1Q1GA 5K8TA 3EEIA 3TB6A 4KN8A 3HMKA 5C32A 3A6LA 5F2EA 3MS7A 2O7RA 3OEYA 2QB5A 1YJBA 3TLCA 1V2HE 3DE7X 5FO0A 2P69A 5KC8A 5LQJA 2FDRA 2PRJA 2FY8A 16PKA 1XL0A 1T15A 1WBBA 4M4SA 1U0TA 2FW0A 3TIXB 3ZYCA 1FFAA 2EYQA 3LLMA 2ZULA 1GNSA 1WHTA 2FUG1 2IZ7A 3OFND 1HX7A 1A71A 2GK7A 5DW3A 2P9JA 2EF0A 1EBFA 3A11A 4CFSA 1R6DA 1AQJA 3OICA 2XZDA 2WHEA 1VL8A 1TEXA 2B37A 2VPIA 2YDYA 2P78A 4DNQA 4F06A 4F9FA 5IUJC 1U94A 2E5WA 3NHPA 4NFLA 4BPRA 2C7BA 2X5XA 2P9GA 3JAKB 4R2HA 2X4LA 4PINA 3W0LB 4FIDA 4GKAA 3HQ4O 3NOQA 3FNQA 4IQ4A 2OR3A 4RKFA 1TUGA 4RPGA 1AUVA 5KIAA 5JBQA 1TZBA 4QATA 5T7BA 3MIZA 2F6RA 1RWQA 1F1BA 2PBZA 3PWKA 3QX7A 4JCCA 5B3LA 5IP5A 4YJFA 1D2HA 1BGXT 2OBMA 4K26A 8LDHA 1TAUA 1NVUQ 1V1JA 4B1FA 3VNVA 1S1CA 4HDNA 2WV7A 1C4OA 1X39A 5AJXA 3L6OO 3CTPA 1E62A 5ALWA 2OSVA 3M8KA 2XUZA 3CLUC 3VDRA 4XWWA 4OJKA 1A9YA 1VE7A 4NE2A 3VAYA 3WYNA 1H3FA 4B6FA 3H1BA 4B73A 4HNUA 4N3GA 4MR7A 3OBBA 5IDXA 1XD2B 2I67A 2V7TA 1FNCA 3KZXA 3MJDA 3KZ1E 1SUBA 1XX6A 4JI3B 3OA0A 2ZUFA 1TQ4A 1PHPA 4BO5A 4D9MA 5JYDA 1FDRA 3FPHA 2NZVG 3D8TA 3EASA 3OY7A 1ISGA 2MINB 3QVKA 5ALEA 4L9RA 5FD8A 1KO1A 3G2IA 1QM5A 1BMDA 2X2OA 4JJKA 2P4SA 3G7UA 4JP1A 1H3NA 3T3HA 4DMLA 4IUDS 4PXYA 3WB0A 1JFRA 1WQ1R 4UCWA 3OTOB 1AF4A 2YOGA 4E09A 3ZZTA 5FTKA 2QL5A 1JG1A 1LJLA 1DSSG 3O1JC 4PNPA 1W4BA 4Z51A 4HDMB 1DC5A 5HMMA 1U81A 3QW4B 2PFKA 5FB3A 1G8AA 3UGQA 4LJRA 2C9YA 3RROA 3AHCA 3VPBA 2V4ZA 2ZE8A 3N75A 4TT3A 3SWWA 5U9CA 1UBSB 3DM5A 2EG5A 1I8TA 4BRUA 2GETA 1FLVA 3ZCUA 4ETMA 4E21A 5BMVA 5A9RA 1WCV1 2H2GA 5TXGA 3LNCA 1AQUA 3VOSA 3FZGA 1ISJA 2X8WA 3N8NA 4LQLA 1BQ3A 1QFXA 2OWEA 4TKUA 4Z5XA 3PKJA 4MR8B 1BMFA 1EGAA 4KFUA 5HKLA 1REQB 3L9WA 2VH1A 2WAXA 4HYQA 3ZXIA 2DWOA 3DEKA 3B52X 1DARA 4RS3A 3SHQA 1RM5A 4LNHA 4WFIA 3FCSB 3SC2B 4BY9E 4KREA 3TOZA 4LF7B 1U31A 4X64B 4F6LA 3WDMA 4EG4A 1D1SA 5AW4A 1B8OA 1GZSA 1C3XA 3QYAA 4TLAA 4NFHA 1GAJA 1JZQA 2O7SA 3DEHA 3FPFA 5DBGA 4QA9A 1MUUA 3OT1A 3MWDA 3D5EA 3DA8A 1WXIA 3RS7A 4BFUA 3PFGA 1CUFA 1Y1PA 4D4HA 4H08A 4URXR 1F4PA 4E94A 5LZ2A 5TARA 3MHTA 2QZ4A 1WDKA 2IEYA 1Q50A 4O6VA 3WKEA 2PTHA 4GX2A 2IP2A 3DQZA 3HJCA 4KE8A 4CTJA 2IY8A 4YV0A 3ODPA 1EFTA 2JF0A 1KFCB 2ODTX 3BFXA 1ZWLA 2D5IA 1BXKA 1U0HC 4Z3OA 1KP2A 2I6UA 1OZAA 3B9PA 2EP5A 3FCAA 1RPTA 4Z9XA 1CYDA 4E22A 1JU9A 2Z43A 1NVVQ 2COUA 3RTDA 5BO5A 5G3ZA 3RR2A 4WNAA 2HPHA 2EBUA 1FSZA 4YRBA 4G97A 2I8LA 4O3MA 3TKYA 1ID8A 5IVDA 1ZKMA 2BE9A 2ZJ0A 2LZ0A 4WK4B 4PVDA 5JXWA 4QM7A 1DIAA 1P29A 2CEKA 3D3NA 2JAHA 3M9XA 3PGMA 1YDFA 1Y7TA 1K7CA 1T9KA 4ADSG 2QD3A 3TBKA 2Z08A 3AI2A 2OC4A 4EYEA 1FLDA 1CQIB 5GJWC 1VFPA 3BHIA 5BWCA 3GI1A 5K3AA 3W9SA 2Y1OA 3FUTA 3HG7A 4UC0A 1IEQA 3CZPA 1CUCA 3IXLA 5TE9A 5C7IO 4CM4A 2PJRA 3W8NA 4F4JA 4II3A 4TLMB 2ZAOA 3SEFA 3STXA 2XMPA 4JLBA 3LOUA 1F5SA 5BPFA 1Z3CA 3DQQA 3GLVA 1YGPA 3AOEA 4BO2A 5J4YA 1XV5A 1M2OA 2P77A 1IFXA 3EWAA 3IHLA 2O2IA 4JX8A 4YRSA 5HF8A 1SCJA 2OHGA 3JPYA 2QRPA 2XQJA 5BN1A 1CQZA 4DWOA 4JT8A 1CBUA 2B1GA 1UMKA 2WSYB 1N0HA 2BUCA 2IXAA 4CF5A 3U4MA 1U0SY 5L4SA 3ZI4A 3IR6A 2C96A 2FFRA 1TCCA 4MGZR 1TF5A 3BE6A 4RGVA 4EFDA 3KAQA 2V6GA 1R0KA 5IXSA 3I9JA 3H2HA 2CYAA 4PS1A 1M1YA 1ZC4A 2CNLA 2HK7A 3KU1A 3M4YA 2Q3CA 1GU7A 4R31A 1NXWA 1R00A 1JKJA 2I99A 3RNLA 2D0OB 3LCMA 2OFFA 1GXSB 1QZ3A 2BFCB 2JHCA 4GX5A 3E81A 3A26A 1QTNA 4KIJA 3PDIA 3DEZA 5FOXA 2EJTA 1FMCA 3PUVA 4XEUA 3M81A 3WHKA 4RTRA 3KUCA 2AFHA 4U2DA 3OTWA 3RVJA 4LF9B 2VQSA 3DZIA 4RVDA 3RJZA 2WJIA 2NTYC 1Q3KA 5HM6A 3JQDA 3PPYA 4KR0A 5KS2A 4DXAA 5TX7A 4F3RA 2ERCA 4DT1A 2PKQP 1NLUA 5GZ6A 1EFHA 5BORA 5LYJA 3O2NA 3O4VA 3GBSA 4PM4A 3HPRA 5F5NA 1SBCA 1U8EA 5LBIA 3U61B 1XPRA 2CV0A 1WLSA 4BNLA 2HXYA 1P0CA 2Z0MA 3E9RA 4OXQA 2O8CA 3QBTA 2VR1A 2V5AA 1CUAA 1OX5A 2FJ0A 3VMFA 4AMBA 4DDMA 4F93B 3RSCA 4UKDA 3MQ2A 1DWPA 1D0VA 1IN5A 1JT2A 3PGKA 3WBBA 2K2QB 1EQAA 1QANA 2AFIB 2Z2JA 3P9KA 2PZLA 4M9XA 3HC7A 4JC4A 3S44A 9LDTA 2YFYA 4TWIA 2VJPA 1VFNA 1QF6A 1ZH0A 3QU7A 2EC5A 4KLZA 3PNMA 3GEPA 3QKSA 4BU1A 3UENA 1JU4A 2X5NA 1V26A 4I4CA 3RC2A 2QN1A 1KARA 5FPYA 4X1YB 1ZO8A 2P3OA 1X70A 1RPZA 2VNHA 3BBLA 3MERA 3T9DA 4EHHA 1KK3A 1YS4A 4FI3C 4BGDA 2F3TA 2G08A 1XDSA 2JHGA 1Q15A 3DAGA 2JFPA 3CPEA 3O90A 4H7FA 4I9GA 4UE3S 1X8XA 3GJ3A 3SBOA 4UTOA 4K9MA 2HOQA 2ZBGA 3LG2A 1J09A 1Z13A 3E9MA 4RJ2A 1BKSB 4JBWA 3TLMA 2PZEA 4HLUC 3H86A 4TZKA 3O83A 4UMEA 4W5WA 2NO1A 3LHSA 2ZI4A 5TGDA 3NBMA 2XE6A 4MQUA 4D74A 1EK2A 3AB8A 1G8PA 2RHDA 4IIJF 2Q2QA 2D59A 2R00C 1XQXA 2V6JA 3MLBA 4URWR 2PQMA 5K0JA 1DAHA 1RTKA 5LP6A 1CEYA 4GNRA 1Z39A 3I76A 4PCAA 1XRLA 3QVGA 4BLWA 2IYPA 4D6XA 2DEUA 5K0LA 3A3KA 3PC3A 2RHOA 4FBGA 4Z54A 2JLUA 1BCRA 1YBVA 2ZRQA 3SQLA 1BX3A 4BHTA 4J6EA 4J0FA 4TL9A 3RSLA 4DQKA 2AQ8A 1KEVA 4H15A 5ALFA 3I04M 5ERYA 3JWEA 1W36B 3HDHA 5AH0A 3F78A 3G0OA 3MMPA 1E2IA 3PDHA 4BB9A 3EDQA 4DXHA 4E88A 4OHYA 3AFNA 3H9BA 4JR2A 2P2ZA 4H7JA 4KCGA 4OKSA 5DHRA 2R7LA 1Z6QA 5LZ9A 1EG7A 4AO7A 2V54A 4MYSA 3I23A 2WINI 3TIVA 2QX7A 4R2XA 4BV3A 1TYBE 3GMDA 5C7LO 2BGNA 1NPDA 2H1LA 3ORHA 3QIAA 3UWKA 2AK3A 3RC7A 3V8BA 2VHEA 1CLEA 1E8NA 3ZDEA 4BKPA 5FOSA 3BREA 4JVOA 1ODKA 2ZG6A 2P62A 3OF3A 4BV9A 5FL7A 1QP4A 4FU0A 5ALUA 2NQTA 1KR5A 3OEHD 3IAS6 2JGDB 1RHRA 1Q2XA 3PXGA 1Y6RA 1QFJA 2I6XA 2UKDA 3KWMA 3NM5A 4I9HA 5E6RA 5SZHB 5GIPE 1FS6A 1OY1A 1OWNA 1VA5A 2XSZA 3ETCA 3H1AA 3NBYC 2I76A 2Y1GA 3ONWA 4HDKB 4LAFA 5FO1A 2PUGA 1YK1A 2LW7A 2ZTVA 1IBSA 1KJJA 1VL0A 5KAPA 3STWA 2UXDB 3M1IA 3OO1A 4BU0A 3P9SA 2R5NA 4MPPA 4X66B 4RMHA 5CPFA 1G63A 3H5WA 4Q3CA 5K6TA 4EG0A 2P9TA 2XGSA 3G2MA 2ZATA 2ZIEA 3CSSA 4AMZA 2QXUA 3CZAA 1RWNA 2FK8A 3VZPA 4YRCA 4D57A 3IQWA 4TTTS 3F4LA 1N1EA 4D6PA 5BW8A 4FGSA 4GH5A 3F9CA 4JBHA 3AKYA 1DBPA 3M4JA 2CE2X 3MLAA 1YZQA 3GDFA 5ICMA 1OQAA 2VL7A 1BMQA 4AS2A 4PZDA 1JQKA 1XA4A 1QV6A 3ZKWB 3GLKA 3W2FA 4UAVA 3ZJVA 3MAAC 3HU3A 1L5HA 1J42A 1F38A 2I7TA 4LYJA 4N5LA 5T57A 3RVBA 3RWMB 3FRIA 1EYZA 1Y5NA 1XAIA 1BNCA 1DCFA 4QNMA 4GFDA 1I4DD 2DFVA 3QHPA 1F2TB 5DM2A 5IC4A 1PW5A 1AQYA 1XP5A 2A9QA 5HIJA 1NKTA 4I2NA 2QEQA 3LECA 4IIHA 2GPBA 2BKUA 4G5GA 1QQ5A 4G86A 5K8CA 2IYOA 13PKA 2GBPA 2LD4A 4LZPA 4EKYA 4YT2A 2E1RA 3JARB 5ALVA 1M0EA 4JI2B 3G6WA 1L5NA 4I2VA 2LNDA 2YL2A 3RVSA 2GAFA 1Z33A 1JTEA 3BK2A 1ISPA 2GEVA 3G02A 1L1FA 1H0RA 3JU3A 4LV6A 5EIFA 2EJVA 5CVTA 5JMTA 4RZ3A 3SX2A 3SX0A 2WPNA 2C5HA 3WQBA 2O5VA 5K9ZA 3Q8LA 2OLKA 3EVBA 2ZYUX 3FJYA 2J9GA 4C6RA 1HORA 2W2XA 4TL7A 4OA8A 5H3LA 4KXUA 3P2EA 4DY4A 3HEBA 2CUZA 4L85A 2CMHA 1E18A 1MD9A 4CF6A 3HB4X 1G0OA 4KQCA 4M21A 3SZGA 3L4JA 3JALA 4A8JB 3ASVA 5KHOC 1X7WB 3VJMA 4AU1A 5CA1A 3DWEX 1HSOA 1ZMXA 5F33A 4U1RA 1YL7A 3V46A 3VR4D 1DWQA 4LWOA 4PQRA 4HAUA 3LRTA 2OPHA 3X2SA 2OECA 2R0QC 1D6NA 2PIAA 4MGIR 2YYZA 2QZZA 5DOZA 4I4NA 4IINA 4HADA 5LA6B 3CO5A 1ZSYA 2SECE 4YJKA 3TBHA 4MP3A 5DNCA 1T35A 3HZZA 1EVZA 1WKVA 2RGCA 3HB0A 1X87A 5AVVA 5AHWA 3KVNA 1PFGA 1RZVA 1W4CA 5AQ1A 1XRRA 1YCHA 2OBFA 4B74A 4CIVA 2EEPA 1IXZA 4G4GA 1TLLA 4TQ9A 3R74A 2RHWA 5ADHA 5DRYA 3FUVA 4K7JA 1YHYA 3TM5A 2JH9A 1DQPA 4HEA6 3T6KA 6PFKA 3LA8A 4MV0A 1E5DA 2ZS9A 5COQA 2QG9A 1G3UA 4C04A 4KX3A 4FWIB 3SOPA 5F9FA 1SPBS 2W48A 2PL9A 1T8TA 4PVCA 2M9MA 3PYLA 4I4TA 3MFYA 3DHVA 3WK4A 5CFMA 5K3DA 1FTGA 4ZEMA 4LDZA 4LDAA 4BKOA 2NU6A 1S3SA 4LHWA 1L7EA 1NF9A 4JKOA 1P7ZA 2FVXA 2RC6A 2GO1A 3BSFA 4H16A 1NONA 1PJSA 4LWPA 4PAGA 1PL7A 3OC0A 4YK7A 5D5HA 1MW9X 1D03A 1DJLA 1VCHA 1C3LA 1I7DA 2TECE 4NJEA 1ANKA 1B43A 1QV7A 1Z15A 3OTHA 5CVCA 2BCEA 4KSYA 3JRWA 1MKYA 2AN3A 2CLMB 4JI0B 2AOWA 3G5MA 4ODIA 4TUYF 2WJZB 3TH5A 4ZMRA 2G67A 3L77A 1NN5A 2ID9A 2YIVX 3B5IA 4NABA 5DX8A 1K9VF 3TLGB 5IU6A 2BGKA 2ZYIA 1QJCA 4RK5A 2G7ZA 2O2DA 5YASA 3H75A 5JE8A 3VC3A 1U9JA 2JDID 5SZJA 1ONPA 2PGIA 5I7SA 4RQTA 1UMBB 2XDAA 4TPKA 5DI9A 4DZTA 1MEOA 1Q0PA 5FBRB 4UHCA 4FFDA 1KIMA 2BI4A 2EU8A 4K81B 2GEFA 4M0EA 5EJ5A 1VGVA 5DFAA 5IYZB 1YACA 3SYNA 4OM8A 3WMEA 1ZBQA 3A1DA 3A4VA 4JNKA 5J59A 2C04A 2J0UB 1USIA 2HQOA 1P75A 3GGSA 1BEUB 3DO6A 2P6MA 4O4IA 1UEIA 5HFJA 2F7SA 1GN8A 2OT3B 1GR1A 3RT7A 3AHFA 1U90A 3W05A 4ASUA 3K70B 2UYYA 3KQMA 2P2DA 4U9UA 3OJOA 1P2FA 4JUCA 2FMUA 4J90A 3SEZA 4HX9A 2CSXA 4YP9A 3BWDD 1R0BA 2VA8A 3GMTA 3OAAA 3BE5A 1V7PC 1O4VA 4HGPA 5IAEA 5FYQA 3V4SA 2EKBA 4CG3A 1D5WA 2DYKA 4XIYA 3LSTA 3COWA 4LOKA 2XLCA 1B00A 1U3VA 1MIHA 3EFOA 3OPNA 4ML3A 3LO5A 3HY4A 3AEQB 1CUEA 1JXMA 2ZAMA 3AQ4A 3DEYX 4LY9A 2FFJA 4UVIA 1ZD1A 3PTAA 3HN7A 1M34E 4D3SA 4DSZA 3VX3A 3DZCA 3MUEA 2ORIA 3IDZA 4GD3Q 4UQPA 5A03A 1OLSA 1JLMA 2CNWD 2CXRA 2RAPA 4LJ6A 3CXRA 3OTQA 4AB1A 2R751 4DIMA 3WLIA 3AR7A 3ILYA 3GJXC 4AY5A 3THYA 2IUSA 1GAEO 3A1FA 3I37X 1VL1A 2BGIA 3HU2A 5AWFC 5BP7A 5AXAA 1Z0DA 3LF2A 4PV7A 5KSWB 3UV3A 2QTNA 4NZOA 4C0BA 3ANTA 2QV7A 2OLJA 4QYWA 4QPJC 1AK1A 4Q4JB 1L4MA 4P32A 4QTUB 2V96A 2MMGA 3GG9A 3MW8A 1IUNA 1DG3A 2XT9A 3VR4H 3ZD9A 2K7FA 2Y6VA 4X8LA 4IH4A 6NULA 2LIVA 2PKXA 3T0FA 3UY4A 3P7MA 1KK1A 2WIBA 4KZKA 2CXOA 3ZDYB 5ITVA 1JEYA 5HKKA 5I9IA 4EZIA 3PNQA 1MJ5A 2AHRA 3ZV7A 4DPLA 2I78A 2YWBA 3HWX1 1OTYA 2VLIA 4DPKA 1V5EA 3ETGA 5EL0A 1C0IA 4OL0A 4XFKA 3KYDB 3DD5A 2X8BA 3WGYA 2W7TA 3C1TA 1YBFA 2YS7A 3MQ4A 3NAZA 3VDXA 4Q5IA 1YL5A 3FKQA 5KNDD 3HKEA 1YI1A 3CXUA 4IDDA 1L5KA 3NTRA 3ZJ4A 1TI7A 2WM8A 3LXUX 3ENZA 1R2QA 1SZPA 2OP0A 2AYYA 1H8HD 4LNUB 1C1YA 3AR8A 4RV5A 4GZLA 4RD3A 4IOLA 4PLZA 4QELA 5DNWA 1A9PA 2E55A 1XXLA 1G2OA 2JI9A 2X13A 4X90A 6ABPA 3B7WA 4CPDA 3IIIA 1EEXB 1Y8ZA 2G06A 4GPEA 1TU3A 3JYQA 1V3QE 3TOXA 1D9ZA 2PM8A 1QTQA 2WLTA 3ZHCA 2ZYWX 1O6CA 3QVTA 1FTNA 1SUCA 3PFFA 5FF9A 4EUHA 5JNWA 4AICA 3RO7A 2AN4A 3I9FA 1EVIA 1IXRC 3MRVA 3R9IA 2BSXA 1L7MA 1WHTB 1R10A 3QMVA 3KHTA 1CJVC 1DQZA 4X6LA 4EG5A 2EARA 3IKVA 3CZ5A 5K05A 3UMMA 3LHIA 1PSWA 3MYYA 2IA5A 5AKXA 4PCVA 1ISSA 1KDOA 2YYAA 1IN8A 3EH1A 3FYHA 3T1NA 1N1GA 1WMFA 5F1YA 3EUFA 1CY0A 1TM1E 1K6EA 2FN3A 3CPSA 3PHLA 4DQUA 4PG4A 4YO7A 3V7FA 1SKMA 1W0JD 1VP3A 4FD3A 1PJ4A 4JSYA 3VO9A 3JW8A 1ZOIA 2VAMA 3GAMA 3I05A 4N5HX 3EUWA 4NESA 3WXMA 2R1TA 1RI5A 5LB4A 1L4YA 4V0LA 4YJFB 1WMAA 3KDAA 1TIBA 1JSCA 2R1ZA 4EK9A 3R0ZA 3U3MA 2E4XA 1NKSA 1WF6A 5GIOE 2PRKA 3H4MA 4HDNB 3K94A 5FNVF 3D3WA 2MYUA 1OXVA 3D8UA 3PIIA 3KJHA 2BRUA 4U6QA 1O95C 2E6UX 4ZO8A 4NG5A 1ZNZA 1VJRA 2GRAA 3L7BA 4GZMA 4OFZA 1L6RA 4BO9A 1Y89A 3A4IA 4ZMSA 4IGFA 4FGUA 3EA5A 4G09A 5EA2A 4HZUA 1PDVA 5CXQA 4NVRA 4MR7B 3MB5A 4AP6A 3B7GA 3IIEA 1N2IA 3EVDA 1ORRA 2GN2A 4ZN6A 2W22A 3Q6NA 5D3MA 2JLAA 3FVWA 1C14A 4PR0A 4A15A 3EDMA 3DGFC 2XMDA 2FPGA 4XRRA 5AVJA 2CJFA 3GG2A 3L0IB 4GOMD 3OHMA 4DTCA 4TLLB 5HRUA 1J1IA 4UTPA 1CRWG 1PZGA 1U7WA 4LQ4A 3WRWA 2ONZA 1AHNA 1LVHA 4D79A 2PUBA 1WHSA 1WSWA 1XZLA 4HNQA 1ZY2A 4OI0A 4F1WA 3EPPA 4FCCA 1W7AA 4JLSA 2PS0A 2P35A 1A9RA 1FFHA 3DDOA 4GP9A 2IXEA 1HSZA 4OA5A 1QPBA 1TF2A 4NBSA 4IG9A 6Q21A 1RYEA 1G8GA 3NXKA 5JYCA 4ER0A 1Y1TA 4WBXC 5DK6A 2H16A 1KH1A 1C8BA 2X6RA 1IY8A 1JVSA 1ZCFA 2HF9A 3NWJA 4IPTA 4MP6A 3OX3A 4OLHA 4TL6A 3MG9A 3UBMA 5B7NA 5HX7A 2VNIA 1FIUA 4TKUB 2GOYA 1K63A 1IHXA 2PAAA 1PN3A 4PC2A 1B0PA 1XT6A 2H29A 3F7TA 4CBVA 4OPMA 2OMKA 4O4LA 4W1RA 3TTWA 2I6SA 5TMDA 3KCNA 4CNQA 1WPQA 3RVKA 5ILQA 3V48A 4FW8A 1GZ6A 3A10A 4IVNA 1W2GA 2Y99A 2QE7D 2RHMA 4PZLA 1V4BA 5CRIA 3WGJA 3ELBA 3WGKA 2Q8NA 2J33A 3NNNA 2C83A 1WNTA 2BPOA 1KXZA 2HA2A 3KOWA 3PZBA 3R7AA 4BMDA 5GZ3A 2WMNB 3O4JA 3LKZA 1IZYA 4HMPA 4O2RA 5AI5A 2AEFA 3OT1B 4XVRA 2P4HX 4DADA 3EW7A 1E69A 1NUSA 3H3FA 3K16A 1GD1O 2FWJA 4PZYA 5ESXA 4CJXA 2V6MA 3D31A 4YI5A 1YVDA 3G59A 1RBZA 2XDWA 3WK5A 2YWEA 3FUWA 5KNDH 5TMPA 3NEYA 2JLXA 2JIQA 1VKOA 2BMWA 1EEHA 2I3DA 3H1GA 4RSMA 3ZLBA 2A1IA 1IM8A 2WUDA 3ZHQA 1RWKA 4CQLB 3KALA 5GADl 1KMIY 3CLTC 5C52B 5DGXA 2HA7A 3DBIA 2D54A 2QG4A 1PYGA 5GPBA 2D1TA 4RGQA 2QPLA 2WU4A 1S3FA 1LWOA 5EUMA 2G63A 3ICPA 1W4LA 1TD9A 4OMFG 2QHXA 2EDAA 3DL4A 3Q12A 4GR5A 5DDIP 3UJNA 3T15A 2GPYA 5JAHA 1CDDA 1SIUA 3JQBA 1UWKA 3G1UA 5LL6P 5KOJA 4QU5A 2WFLA 5A3RA 1UBJS 1GDDA 1MNAA 1I7NA 3ZU6A 4RHYA 2IHZA 2WJJA 5ES3A 2J9FA 3DHYA 3U13A 2PKQO 5A7HA 5LQCA 1YULA 5HTOA 2PD3A 3OETA 3PNBA 2FSIA 1OLXB 3BH0A 1Y9DA 5BVHA 2ZJ2A 1AKEA 3BMCA 3IVCA 1MB3A 4I1UA 3THRA 4B4KA 2EHJA 2G17A 2G8LA 2GKGA 1ZUNA 1X86B 1RTTA 1WXHA 4N3BA 4OXNA 5GONF 4DQ0A 5HNKA 3I09A 4WKBA 1SWVA 4CM4B 4QDUA 5FQNA 5BNIA 5TT1A 2RB4A 3AZPA 3REOA 1XHEA 3W3AH 2Q0QA 4K8OA 3RYIB 4J9VA 1U9IC 3W2HA 2H06A 2IEAA 4JU8A 3ZWWA 1UUFA 2V8OA 4OFXA 1M2OB 3F73A 3KB2A 2IDZA 1QTRA 1TA0A 1JDPA 3BDAA 3EBLA 4WXEA 3R23A 1ZHFA 4K6CA 1FP6A 1MZPA 2AUNA 2XT6A 3N0RA 3JWPA 1IHYA 2G4CA 2QLMA 5FBWB 2P67A 1Z26A 5DEIA 3A2LA 1IBCA 1YJ8A 2MWMA 2C4NA 1H65A 3B85A 2SICE 3JQEA 3FMPB 1OVGA 1VLJA 4FZ5A 4V0SA 2WNSA 3JATA 1QONA 4F11A 2MSWA 3B3AA 1R8JA 4NTZA 1L4FA 4LJ8A 5AW1A 2Y0CA 1M1YB 1AZTA 5ILOA 1NW9B 3H8WA 1IOLA 1G9SA 4NZZA 3L84A 4L4XA 3VNRA 4UOZA 1X9GA 2ACWA 1JKJB 1WX1A 2H4HA 3F5FA 1YTLA 5JPDA 1FLAA 1BE6A 1U1CA 2DBVO 3DBHB 4HUQA 1E4OA 2HQ1A 4IVRA 4MVJI 4WACA 1NTRA 3ZY6A 1QIFA 3PDIB 3CG0A 3GW8A 1H6AA 1KMQA 2VZLA 1AB5A 1VBFA 1G7RA 3WGNA 5GINE 2XKJE 1DUIA 1V8BA 3EDCA 3ZDFA 3IMKA 4BNJA 1XBTA 1RPNA 4YP7A 1MO4A 2X3FA 2PRSA 3FZEA 3GZTB 3K0FB 4HZIA 2R6FA 4RQBA 4CKZA 2R97A 2FW9A 3IA2A 3UWMA 4IGIA 2HEIA 3PFBA 4N0EA 2ZM5A 3GWGA 1O6BA 1LI4A 1D1TA 2CC2A 4H1VA 3SXPA 3X1WA 4LXYA 3ADCA 2H52A 2J0SA 2R8PA 4GMXA 4WKGA 4DT1B 5FUVA 3SF0A 2HREA 2UUAB 1W88B 2GVZC 1SHUX 3ASZA 3N8HA 3QENA 4BE9A 3G9ZA 5H16A 4QEDA 5FA8A 2NO7A 2WT9A 3CX3A 1U28A 3EEYA 3L82B 3R3YA 5BRAA 3EGIA 5K0EA 3IUSA 5FEUA 2O8CB 4YALA 4AO6A 3GGOA 5KWVA 4UVDA 2OXEA 5JSYA 3AYXB 3VZQA 4FMPA 1J6UA 2QM3A 3EVEA 1JAZA 3ZWQA 3WRXC 1VJDA 5LKAA 3QVLA 1HYGA 5TQJA 4L8LA 3SKXA 2PS9A 3RHTA 3I61A 6AT1A 1H5NA 4Y6SA 4P54A 1OH6A 3ZE7A 2CW5A 1RC1A 3QKSB 3QLVC 1UQTA 1NNSA 3SZOA 1NPYA 2FLVA 3D8NA 1FTYA 3HGTA 4CQMA 2O14A 3RTGA 2O19A 1XTZA 2CDAA 3C41J 1JLLA 3DYIA 1HE3A 1QV9A 8ABPA 4JUFA 4LSWA 1MO6A 4K46A 4EHKA 4J1TA 2X4GA 3TQFA 5EEGA 3RJTA 4ENRA 4RWZA 4L78A 1Y8RA 5EWJB 1XRNA 4JI5B 4RTJA 2PT5A 4ZYZA 1XZKA 2NU9A 2YFQA 1Z38A 2BZGA 1QZUA 3HCOA 1MH9A 1AHPA 2G0AA 2JJ2D 3NONA 3K92A 1RYHA 2NN3C 1J8DA 3KAJA 4H1TA 4LMBA 5CYFA 3UNXA 2QN3A 3OLYA 4FTWA 3W77A 3JVEA 5DYIA 4XX1A 1JZTA 4GSYA 2REXB 3EXAA 4H0FA 5LP6B 3ZVKA 1JWLA 1EFCA 2D5LA 2P0AA 3ROGA 3WAKA 4C3ZA 5KX5A 3TXAA 3C4VA 1L5MA 3QVGB 3BULA 3OM0A 3UJDA 4B84A 2HRCA 1I4EB 2I4IA 4FGJA 4GICA 3T5PA 4PHGA 2V0GA 4OHPA 4RMGA 1WKBA 1RPJA 2X0KA 2Y2UA 3MPUA 4R6WA 1FDVA 3HXOA 3L7CA 3HK2A 2IF0A 3GJZA 1V7CA 2P1ZA 1CZLA 1F1JA 1UIMA 3KELA 3ET5A 3KKMA 3QNUA 4DCSA 4LVNA 1SVWA 3KK0A 4XDHA 1R0ZA 2LUOA 4DBZA 1IWPB 1Z47A 5A1JA 4IIGA 1NY6A 5K1ZA 2I6QA 1P6QA 3ZIUA 1VL2A 2A0KA 3I2YX 1KI3A 5BMVF 2HJRA 3I5AA 2A5JA 2P4EA 4HYYA 4M46A 4JROA 4KHPB 3SS9X 1QHIA 2VTEA 2P79A 1V5FA 2VHUA 2WTBA 3Q5GA 3VR1A 1GAXA 1E79A 3ST7A 1D8TA 3OZCA 1E3IA 3TR6A 3TTYA 1KO8A 2G72A 5J43A 1ZVVA 2PL3A 5F2KA 3VV3A 4POOA 4H77A 1D1QA 3OE1A 3OU6A 1FY2A 2XTJA 3C24A 4KITB 3NTVA 1E8DA 4YV2A 3RANA 2SBTA 4TXMA 5FBLB 3VA7A 2VYND 3CSUA 5KAMA 4IAOA 4E08A 1JIUA 1IHOA 1U4SA 2GF2A 5E6RB 3QFFA 4U0JA 4WEOA 3LPMA 2R6CA 3KIPA 2B94A 4FUQA 4CKBB 2D1SA 1ZD3A 1W36C 3NDJA 2GN4A 4J7AA 5SV2A 2C4KA 3GCDA 1YJQA 3EQ7A 3R6GA 4RANA 3RB8A 1ZU4A 2JAWA 2DR3A 3QVJA 1PR2A 5L8VA 1RE1A 2P2GA 5HM8A 1ZBDA 2AN1A 2OV4A 1W47A 1IVSA 5JQGA 3J7TA 4CU5A 2RI1A 5AVXA 3QY9A 4ZDIA 3NI2A 1JHZA 1GCIA 1L4LA 1KEPA 1X7XA 2BT4A 1Q7BA 1VMAA 4J94A 4EG8A 1K2VN 1NNUA 3PLRA 4WJZA 3VHLB 3D9QX 1FJ2A 3HGMA 2BM9A 4K6KA 2AMYA 4DCTA 3S1AA 3TKAA 1X1TA 2WYOA 1KERA 1EE9A 1B15A 3RW9A 3RPEA 3HCBA 3L0PA 3BKWA 1DC8A 5EFOA 1ATZA 1L3IA 2XWQA 3L7OA 4J0HA 5EIWA 4UM9B 4YRIA 4U7JA 4YR9A 4EBBA 3SG0A 1A98A 2WU3A 3ZWCA 4Y1EA 2QRNA 4D46A 3HUUA 4ZODA 3F5MA 4O2AA 1WXDA 1F06A 1T5LA 2ZRIA 1C30A 4TTAA 1L4EA 4FD2A 5DLDA 3UAGA 4CRWB 5BR1A 5KOHA 4C6HA 4B6PA 4JQCA 2O2YA 3I9V6 4M55A 2JA2A 4H6VA 4ZT5A 1RXSA 3AHDA 4BBJA 3CNBA 4E13A 4CIBA 3K2EA 4AECA 1M72A 3RDPA 1JBEA 5DV9A 4RZSA 4ZVTA 4YCLA 3D1JA 5COBA 1AUXA 4MKGA 2VKTA 1R0LA 2D0PB 3ZHSA 3FXAA 1TYEB 2CHGA 2YYYA 1RZRA 2ZE5A 1A3CA 3GQBA 1R88A 5HOQA 3HR4A 3T34A 2Z6UA 4JEHA 1V6CA 1YRWA 4ZO6A 1LRKA 3O3OB 5C8XA 2FR8A 4RVNA 4EGQA 1PS9A 5CEJA 2ZOSA 4X9XA 3AGQA 4JLDA 1MXHA 1U5AA 1A72A 1NE7A 3GRVA 2XEDA 3KTDA 3HEAA 4IEFB 2BFPA 2BHSA 5H70A 3UUFA 1DOHA 1ZESA 3BGDA 3KKZA 3UJ3X 4JXJA 4DYVA 1UPBA 4NCIA 2ZEJA 4NE7A 1V95A 3SC3A 3UJPA 4EW1A 1PJRA 1ZRMA 4R9VA 3DMGA 1KIFA 5KVCA 3M3DA 1Z0KA 2QJTA 5TQ2A 1E7SA 1HNXB 2ONKA 3UK1A 3O21A 5IVIA 1QRSA 2WMOB 2C9BA 4U2FA 3BAZA 3MF4A 4Z2YA 4ZZIA 3NDRA 2G4VA 1SUEA 1TQ8A 2LKDA 3KTFA 1NQWA 1YH3A 4WDQA 5K20A 4FS3A 1DXYA 1H4QA 2IYTA 3M5PA 2AD1A 2JFWA 4DMRA 3OLVA 4JVNA 1VC2A 121PA 1JYSA 1Q1EA 2CNKA 3NB0A 3VU3A 1QIMA 1U2RA 2HJHA 3K71B 2FFAA 5TLSA 3W2EA 3L0CA 2W0SA 3AWIA 3VH2A 2XMRA 4TWJA 5DZSA 3A36A 3ZD7A 4D41A 4HSGA 3DR5A 1UKBA 3TEMA 2YV4A 4MHTA 5IAOA 2O59A 4G67A 3D4BA 1SWWA 5KYWA 3ER6A 1IB6A 2OUIA 2DHCA 2IW3A 3HJAA 1ZI8A 1OZGA 4RYLA 3IVRA 4I4TB 4GC9A 3LX4A 2VAXA 2VRCA 1KDZA 4JI8B 1OX4A 1MW8X 3BFKA 5LYJF 3E9ZA 1UWVA 4RF3A 4KXMA 2NU6B 3QU2A 2Y0EA 3M5CA 1CT9A 1U8ZA 1T9HA 4XD2A 5AJZA 2GZHA 2JCVA 2R79A 3DNFA 4KDRA 5CTJA 3ZR4B 3Q7QA 4DE5A 1MOZA 1D0IA 2PD6A 2FOLA 4LJSA 3WIBA 3QWFA 1HL7A 4NJEB 1LBEA 2XVXA 2IEZA 4YACA 3PC2A 3CVJA 3EZFA 4W9NA 1TKAA 4J4HA 3NGMA 2RGXA 1N5KA 1MX3A 4Q24A 1ZN8A 2CVPA 3PFIA 3ABIA 3KLNA 4IG4A 3IUNA 2QRGA 3PEFA 2IWRA 3FE2A 4CLDA 1QH8B 4DAOA 2QZSA 1XKXA 3IESA 1YB5A 2F1OA 1A2KC 1SKYE 1MTZA 3KL4A 2ZSKA 3RIGA 3D4LA 2F1RA 3LVFO 3CH4B 3BIFA 4E2FA 1N9ZA 3KQPA 1YKGA 1Z2NX 3DDWA 4ND6A 4REMA 3DLHA 5LQAA 3ZE6A 1Z4IA 4NMXB 3KOYA 1KYIA 2QAIA 2ZB7A 5IHPA 1RS0A 3CEMA 3B78A 2DCMA 3OE7A 2EX4A 2GARA 4JUBA 2A1TS 5HKBA 1Z6GA 2EW8A 3U44A 1ZN2A 2YQZA 3MBOA 4GYKA 2B61A 4EPYA 3B53X 5MGBA 3UUEA 2BFEA 3ESCA 4I5IA 1U3TA 5FUMA 1G291 2C94A 1UANA 1C3VA 1X8LA 1C1XB 1XJ0A 2GNPA 1NX6A 2NZ8A 4JJGA 5THKA 2HW8A 1HC7A 4BNDA 1AGYA 1N0IA 5IVKA 2JGAA 2XTNA 5T6BA 3A14A 3HVUA 3R3JA 4FKZA 3H8VA 4YCCA 2GILA 3WL5A 1V16B 2D1FA 2Z2KA 2QUZA 2XUJA 1K88A 3QNMA 1ULSA 2XCOA 4WUTA 4ZCLA 4E7OA 3TGPA 3N0XA 4PYLA 2AXEA 3RBZA 1Z7WA 1ZAKA 1YDHA 2CJPA 1BTOA 4DDHA 1FP7A 4RMIA 3I2FA 3DYBA 2H0AA 3CR7A 5DT9A 4ZDKA 3LIPA 2Q9CA 4YV1A 1U0LA 2FZGA 1HFEL 1OE0A 2ZQYA 4YECA 1YA4A 1O97C 4NHEA 1PTJC 2OENG 2JFUA 4DV2B 2XITA 3WYEA 5AW9A 3LBHA 4LFCB 3UJ8A 5JD5A 2I4TA 2OTCA 2OXFA 5ALOA 3DDSA 4TGLA 3OCCA 2XUPA 4IYRA 4DR2B 1QQ6A 4FINA 4V1CA 5J47A 3G2LA 2OHOA 2X8JB 1RCFA 4G0PA 4JJZA 3WTCA 1IXKA 1C7FA 1H0SA 4IIBA 3E9CA 2R8YA 2VPZA 1W94A 1SUFA 1O5IA 2N1BA 2DERA 3S2GA 3TNJA 1HLPA 2OKGA 4Q4LA 1YVEI 4PAQA 5TQVA 1ZH6A 1ZNQO 3OIGA 1MRSA 3WNBA 3HKBA 3AEYA 5HF9A 1H1LB 1R4NA 3X44A 4TYPA 3KPWA 3EC7A 3PI7A 1JEYB 4MW4A 1JDTA 5EZ6B 1NQVA 4G1VA 1TGVA 3C1OA 3RVMA 4JYAB 2REQA 3VR2D 3U48A 2IODA 2P11A 3UMFA 3IKMB 3BL6A 3AR5A 1D6SA 3KEGA 2B5WA 4ZAYA 2NO6A 2QMQA 5CDHA 4CXMA 4QBFA 1BSVA 4S3MA 3R7BA 2QR3A 2QVLA 3PHBE 1E9AA 2YMLA 3A6GA 3VDQA 2GCOA 4OI2A 2RJOA 4JJ4A 3H97A 3BCRA 3HKEB 3K8OE 4AK9A 1EXMA 4KR3A 1ACJA 3TSYA 3HV2A 3L7AA 3R7SA 1CX9B 2YVLA 5B7PA 4JP2A 1CEEA 1PFKA 4RFVA 4N03A 5DMHA 5EQTA 1R0YA 3TOVA 3QEJA 1XJQA 1V5GA 2XA1A 4WECA 3T0IA 5AW0A 2BIFA 4TMXA 1VHWA 2XTMA 3HFRA 3NTQA 4TS4A 2QTHA 1G3MA 3GC6A 4I5EA 2R5WA 4WAUA 2Y27A 2PZBA 3RVLA 1JWBB 4EB0A 3LH5A 4BMSA 4XVUA 3LL7A 1K4YA 4OM7A 1I4OA 4WZAE 1RBQA 4UU0A 1EK0A 2OV6A 3DZJA 1JDZA 4LC1A 5EHIA 5G0SA 2FU5C 4EW2A 5AI9A 3AUFA 1YQWA 2NYAA 4LRWA 5IJXA 4V0NA 5FH9A 5KVSA 2R9VA 4KAFA