3OCXA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase mutant d66n complexed with 2'-amp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
EHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lipoprotein E
publication title Recognition of nucleoside monophosphate substrates by Haemophilus influenzae class C acid phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 95
structure length 246
sequence length 246
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ocxA00
1J8DA 2CFTA 2CFSA 5ALDA 3QU7A 3EWIA 3UMGA 1TA0A 3K1ZA 1ZD5A 5AIBA 3CZ4A 4NV0A 4J2TA 5IT0A 3ZTWA 2IOFA 3I1YA 1TJ5A 3KD3A 5AVXA 3WK4A 3QU2A 3A1EA 3EF0A 3KZXA 5AW6A 4NFLA 2PKEA 4JB3A 2IYEA 5AKHA 4NABA 3NASA 2HX1A 2OA0A 4Y2XA 2Q4RA 2R8XA 1ZD4A 2AMYA 2YY6A 3MPOA 1NRWA 2JARA 3KBBA 4Y2YA 1RRCA 4QQFA 3AR9A 2YMPA 2R8EA 4CF3A 2EAUA 2GMWA 3HLTA 4BNDA 5AKXA 4DW8A 4BKMA 1O08A 3WK9A 3A1DA 5AICA 2B30A 3B9BA 1RQLA 3ZI4A 4YCLA 2B8JA 3L7YA 5JJBA 3W5CA 2C8LA 3NUQA 3U7GA 2P11A 3OTQA 5AI4A 5A3QA 2FPUA 1RLOA 2HCFA 3CNHA 2FPWA 4I9FA 5AI9A 3WK6A 2QYHA 5AI6A 1JUDA 4NAVA 5AM5A 3WKBA 4KNVA 3N8GA 3U13A 1WVIA 4OCZA 1Z4JA 3ZW7A 5ALNA 5ALVA 3ZVMA 2ODAA 3NANA 2YBDA 3L1UA 4E88A 1RMTA 4AS3A 5ALJA 3U7HB 2G06A 4UASA 3M9LA 5AW1A 5ALRA 3I28A 4IG4A 2I34A 4FYPA 5ALHA 4OHFA 4MWOA 4UAUA 1Z4OA 3ED5A 1VJ5A 4BX2A 5ALOA 4UATA 4GIBA 3OCVA 1YJ5A 3UMBA 5AVUA 4UMEA 4PNHA 3AR6A 2YJ5A 2FPXA 1YV9A 3WK8A 2FPSA 1RLMA 4Y3UA 5IT4A 3N1UA 2G80A 2B82A 3U26A 1X42A 4Y2QA 2GHTA 3W5BA 1VJRA 2HOQA 3ZWDA 4Y2JA 3W5DA 2WF5A 5AW0A 3QXGA 1T9ZA 2YMMA 2OBBA 5AW2A 3N07A 5AVRA 1YNSA 4GXTA 2ZOSA 2WFAA 2I54A 4HGNA 1RKUA 2CN1A 5AW8A 4DWOA 1L7OA 2FUEA 5AK5A 3ZX5A 3OCYA 4G9BA 1ZRNA 1Z5UA 2ZBGA 3MC1A 5AKZA 2GO7A 2HSZA 2IA5A 2ZBEA 4UAVA 5AKGA 4EX7A 3U19A 1L7PA 1QQ6A 3DNPA 3QU5A 3ESRA 2YJ3A 2RBKA 4Y2VA 3BA6A 3DDHA 2B1RA 5AW5A 1S8OA 4UM7A 1Q91A 3PDWA 5AVYA 3AR5A 3ESQA 1LTQA 2RAVA 3B9RA 5AM1A 5AM2A 2AUTA 4FFDA 4CE6A 5AI8A 2NO4A 1U7OA 2HHLA 5ALQA 5AKEA 5A3SA 1Q92A 1RDFA 4XPZA 5AVSA 3NIWA 1EK2A 5ALWA 1LVHA 1NNLA 3ONNA 4KX5A 4AP9A 1U2SA 4EEKA 2ZXEA 2JGAA 2CFRA 1ZD2P 3DAOA 2C88A 2HEGA 3KDPA 3ZTYA 3OCZA 2WHEA 2AGVA 3MN1A 3J7TA 1EK1A 1WR8A 5ALLA 3QNMA 3L8FA 2BY4A 5ALFA 3QUCA 1RQNA 3L8EA 3NRJA 2IOHA 4FE3A 5AK6A 3S6JA 4YIHA 3QU9A 5IS2A 2ZG6A 4HGPA 2WF9A 4IFTA 3IB6A 1N9KA 2FDRA 4DCCA 3ET5A 4EZEA 3AR2A 2I33A 2C8KA 1TJ4A 1L6RA 1RPZA 2W11A 2PR7A 3FZQA 2JAOA 2HI0A 2P9JA 3FGOA 2HDOA 4JDPA 4EELA 1K1EA 5ALZA 3I76A 2I7DA 4UU1A 3WKDA 4OFZA 4ZEXA 1RLTA 2QLTA 5AW7A 3FM9A 3OCXA 3L8HA 4BX0A 3NAMA 3SKXA 5FP0A 5AK4A 2R8YA 1RMQA 1Z4KA 1YS9A 1U02A 3EF1A 5AKKA 5ALSA 1QQ5A 1Z88A 3SMVA 3ET4A 4Y2UA 1ZRMA 2FUCA 2HF7A 3FPSA 3ZUPA 2C4NA 1YDFA 3NALA 1ZOLA 2C9MA 1J97A 3F9RA 2YFYA 5AKYA 3TLMA 1XP5A 3KOOA 3R4CA 3RF6A 4UARA 2W4MA 1Z4NA 3UM9A 4MUMA 4UMFA 2WF8A 2B8EA 3KC2A 4DFDA 2JAUA 3WKAA 2EATA 5AKIA 3SLRA 2RB5A 2WF6A 5ALMA 1KYTA 4EX6A 2MSNA 4YH1A 3OCUA 1AQ6A 1U2TA 3N5KA 3QU4A 4L57A 5AHXA 4XOUA 4KN8A 3ZWKA 2YN4A 4H1WA 1L8LA 4L6CA 3W5AA 4HGRA 1SWWA 2I55A 3L0YA 3OCWA 1YMQA 3FVVA 5AVTA 2O9JA 1CR6A 1ZD3A 1F5SA 2YMLA 4I9GA 3QYPA 3U7FB 1RC8A 3L5KA 2GFHA 1QYIA 2D2VA 2Q4TA 4YGYA 4RETA 4UMDA 5AM4A 2G09A 1RKVA 3E81A 2FI1A 3E58A 3WK7A 1SWVA 2P27A 4BBJA 1L7MA 3AR7A 3A3YA 2PQ0A 5AVZA 5ALEA 1WPGA 5AW9A 5T41A 1N8NA 1MH9A 1L7NA 3B8EA 3ZVNA 3QGMA 4YCNA 5AW4A 1XVIA 4BEVA 5AVWA 4ZEWA 1TE2A 3HYCA 4QJBA 4AS2A 3RFUA 5AKLA 4XQ0A 1T5TA 2I6XA 1U7PA 3QX7A 1Z4PX 2JAWA 2Q5EA 2EARA 1T5SA 4C4TA 1RMYA 2HO4A 5AVQA 2BDUA 3QUQA 3PGVA 4CF5A 4Y2RA 3VAYA 1Z5GA 5A3RA 2DQSA 3IJ5A 2OM6A 2B0CA 2G0AA 3M1YA 1ZJJA 4HYTA 5ALUA 1QQ7A 5AKJA 5AI0A 3QUTA 4KX3A 2G08A 2RARA 3QUBA 4NWIA 3AR3A 1XPJA 4B6JA 3WK5A 3I6BA 1Z4QA 3ZVLA 2BDEA 1RKQA 3WKEA 4F71A 4O8CA 4HAIA 3U7EB 1SU4A 3E84A 4Y2SA 4CNQA 4UU0A 1CQZA 4HGQA 2OYCA 3A1CA 3L0BA 4Y2PA 5ALYA 5AM3A 3P96A 2B1QA 3AR8A 1VFPA 1Z4LA 1ZS9A 2WM8A 4EENA 4BX3A 1IWOA 2YMQA 2YJ6A 4G63A 4YCMA 3PCTA 2GHQA 5AIAA 3WGUA 4XE5A 3SHQA 3WGVA 4C4SA 3SF0A 3UMCA 3E8MA 1Z4MA 2FPRA 2ZBFA 3OPXA 4KYTA 5E0OA 1O03A 4BNDB 5AI5A 3N28A 4UMVA 2AH5A 4J03A 3ZX4A 5AESA 2P69A 4Y2TA 5AM0A 2VKQA 4UW9A 3BWVA 5AK3A 1S2OA 3R09A 3WKCA 4BEWA 3EPRA 2R8ZA 1Z4IA 4L6AA 3IRUA 3L1VA 1TJ3A 5ALIA 3AR4A 4YIKA 3L8GA 5ALKA 2W43A 2YJ4A 5ALGA 4OD0A 4C4RA 2X4DA 3D6JA 3GYGA 3MMZA 2HF2A 4UM5A 3L0CA 2NO5A 3PGLA 3QLEA 5AVVA 1NF2A 1PW5A 4KNWA 4HGOA 3SD7A 5ALXA 2NYVA 1QH9A 5ALPA 5ALTA 1WZCA 3FPBA 3ZU6A 2FEAA 1Y8AA 4RESA 2O2XA 4F72A 5AW3A 3DV9A 3SKYA 2IOFK 2MU1A 3R9KA 4ZEVA 2ZBDA 4BYGA 4CF4A 1FEZA 2WF7A 2G1AA 1L8OA 2G07A
chains in the Genus database with same CATH superfamily
5HHTA 3W1EA 1N1GA 1Z8HA 4R71A 3FPJA 5DGTA 2CFSA 3FLMA 2DERA 5ALDA 3MWGA 1ESZA 3P8ZA 3MBKA 4J7CA 4EJ6A 1TXGA 5ED0A 8OHMA 2AMFA 4JQOA 3ZK9A 1L5HA 3V8NA 3GNTA 4I7EA 2NVWA 4PN7A 1LI4A 3PQ3A 3F97A 4P38A 1EGVB 1IB0A 3NFYA 4HK4A 1G8SA 4D8YA 2EYQA 1JHYA 3V6MA 2IBSA 5BW6B 1LV8A 4OQFA 3LY7A 4U2GA 4Q9IA 2G1UA 2PWYA 5AKHA 3CGWA 4YUAA 1M66A 3PDUA 2ZJBA 5CCEA 1EFUA 5CFPA 2Q4RA 5E6SB 1VKOA 4WSOA 1ZD4A 4HMQA 3ABIA 1PVOA 1AUXA 2GCPA 1F2TB 1PVVA 4KMSA 5KO2A 3KPVA 2H59A 2QG4A 1B26A 5DTJA 4CIVA 1SXGA 4U2FA 1MD9A 5DM2A 4GLOA 2RH9B 1HO3A 4DCJA 4DBZA 5F23A 2Q6TA 2C5AA 2P91A 2W93A 4YRSA 2G5CA 5IT9A 1KQPA 1R6VA 4INAA 4WXHA 1S7GA 4LHSA 2HM7A 4R5MA 3K0FA 1FUUA 1QGAA 4TPKA 1C50A 3R3JA 3HM9A 4QXAA 2AC2A 2A86A 1JIKA 4R1QA 3UB3A 4PQRA 1D2MA 2H2DA 5CFZA 1OE0A 3GAMA 5JDCC 2D2IA 3QKSB 3O2NA 4RD3A 1DXOA 3KQNA 4MA0A 4R51A 5BORA 2HDNB 1B8NA 4ENQA 1TTPB 1E7QA 4J07A 4NONA 4UBIA 3UMRA 3LUGA 1BXKA 1I3OA 2J0QA 3DHYA 2RGAA 4E33A 1H8ED 3ESAA 3BWCA 4E6EA 5TQJA 2MYTA 4EHBA 1J0AA 1SUEA 1T36B 3P32A 5HP4A 2ZYSA 3H6HA 1KXJA 1HKHA 1GSAA 1IFXA 1RMTA 3FROA 5ALJA 3RVSA 5DCLA 5A03A 1I01A 2CXNA 2H1HA 3HWSA 3IIMA 4UASA 5FI1B 5JAHA 1T0PA 3KEGA 3ZCUA 1U0FA 1VJCA 2BKLA 1P5HA 2GD2A 3RUHA 3QA3E 2O4CA 1UBOS 4IG4A 5LIPA 4JR0A 3WSTA 4UAUA 4UUQA 1HYEA 4HDMB 1VBKA 1DAPA 1E1YA 4PWYA 5I7WA 2HWKA 4K9RA 4OFWA 1FVOA 3MA0A 5AVUA 3JQ6A 3U4AA 3OEYA 2H07A 1IXZA 5DRYA 3QW2A 4HC4A 2MWMA 2YS7A 1JILA 2QYOA 1BC5A 3LCJA 5GTDA 4QGGA 1H85A 2OR3A 1ILWA 3LRXA 1O5TA 4TGLA 4E7OA 5G41A 2REQB 1KP9A 2LWIA 4D8UA 3K9QO 4Q3OA 3MJTA 1W30A 3IBGA 2QQ0A 1IEQA 1G17A 2JH9A 4BY9E 1MOQA 5AW0A 1PG0A 1TVKB 1ZKMA 2Q5QA 1NX9A 4WKCA 2XEDA 1UBCA 1P45A 1BA2A 2VTEA 1YNSA 1UKEA 2GEBA 2VJOA 2VF7A 1H9AA 2W37A 3RS2A 3W5SA 4DLNA 1O9BA 4MVJF 4CR7A 5CDUA 1NVBA 1W87A 3C3JA 2EW2A 1A97A 3K09C 1Y81A 3M6FA 3OIUA 4AL4A 5AW8A 3K6SA 4HH0A 3VVLA 2WZCA 1Q50A 1PEAA 1NN3A 2WIAA 3GNQA 3SHOA 2F59A 3LUFA 1DDIA 1NXQA 4KQKA 2ZR0A 1XQYA 1RZVA 1RE1A 4EB6A 4UUPA 1Y1LA 2GZSA 2ZBGA 1RHKA 1X1CA 3MTGA 5F33A 4DSTA 1VGVA 2VK2A 2D06A 3DXYA 3OLWA 4BVAA 5K2OA 3U4GA 2XYQA 3F6BX 1US8B 5BW8A 1AF4A 5BVGB 4BO4A 3KHUA 5JMWA 2VJDA 4CM3A 1N2SA 2XBUA 2Z9BA 4G1UC 5EMKA 5CX1A 3WNCA 3U19A 1EP2B 1XDGA 2L42A 3DNPA 3PSHA 5KC9A 1PLLA 3OX2A 4WW0A 1U0NA 2BEVA 5DHPA 5BPHA 1FTGA 2J0UA 2AW5A 5EWLA 5LL6P 3C45A 4LZJA 3GA7A 4TS1A 5HIAA 4EGAA 4RYDA 1M34A 4LWQA 4TS9A 2X5KO 2WAAA 3SQWA 1ZAKA 1DAEA 2UZAA 3OZFA 4DDVA 1ADJA 2VXBA 4RGVA 2OB2A 4NLLA 1TZKA 5CRIA 2IQIA 2X2OA 5IWAB 2IX3A 1QQAA 1JLRA 1QB7A 1E1CA 2FLKA 2MYPA 4J90A 1KOJA 2I7XA 4M0UA 4WNIA 3LSTA 1QIIA 2J4FA 2WB2A 2ALJA 4X44A 3W2GA 1ZA1A 1BQ4A 2P1DA 2ZBRA 4N7RA 4FN4A 1YCDA 3D3EA 4D3XA 3ICQB 2DFVA 2QSUA 4GYWA 3M1AA 3U62A 3PZBA 2FSGA 3L84A 2BFWA 4WIAA 2P41A 2YJTD 4R2LA 4XCVA 4E1BA 1GRVA 3F47A 4R1MA 2ZKLA 3IQDB 1XDUA 3HDQA 2P30A 5HMLA 1NJ2A 2APJA 1O8CA 2WWFA 2I2FA 2LPMA 4ND2A 3F5MA 1JKMA 3PPIA 4G07A 1AHPA 3L4KA 3JQGB 1KKLA 2WZQA 1KC3A 1MJGM 3PWSA 2WI8A 4IIJF 1BE1A 3P7MA 3QVGB 3U5ZB 9MHTA 1ZCZA 1TJPB 2WJZB 1C1DB 1QDLB 4D9GA 1GL9B 1TPYA 4DYHA 3KOWA 3HDVA 3RC3A 2NZXA 2VDJA 2Z98A 2QJFA 3HRHA 2A78A 2EKQA 3OY7A 1XRNA 5JSQA 4EYQA 3F3MA 2HTFA 4BJ5A 4IOLA 2A59A 2C7OA 3HO1A 3HKEA 2BKXA 5JH7F 4YIHA 4NCBA 2DUUA 3C98A 3LF2A 1T9HA 2JNWA 3ANNA 2WVHA 5CT4A 1YZKA 4D8VA 1TZJA 3HJHA 4QTTB 2RJ3A 3UVEA 1GXSB 3B53X 3HU5A 3VJRA 3DB2A 2NSJA 1F1BA 3WRWA 1V9SA 4C30A 5J23A 3L1KA 1ACMA 1DU4A 1DT5A 3G5LA 3TEJA 4MUIA 1EJBA 3RS4A 2IPOA 1WHTA 1Z5ZA 3PHGA 1KZYC 4J0KA 4LV8B 4EH1A 2P9JA 4X3CA 3GZJA 4YCBA 5ARDA 2ANBA 3BXPA 5IMBA 1NKTA 2D4HA 2IYWA 1FW6A 3CVWA 4G0WA 4EMUA 1BRTA 1OKKD 1O2DA 2Q46A 3A4MA 3HB7A 1D5CA 1HXHA 4IJUA 2DHRA 2AX3A 1MB4A 3TF5A 1O95C 1D1TA 1M1YE 1CJUC 1XEAA 4JGGA 5B3LA 3UYLA 2QF7A 3AVOA 1QLWA 4HPJB 2Y2VA 3SDSA 4YAUA 5LOVF 3OCXA 3T3EA 5IDXA 2WPDD 3FPEA 5FP0A 2ZRIA 3ZDYB 5AK4A 4DMHA 1NQVA 4XM2A 1KAGA 1C3XA 1LCIA 2QTGA 5ILOA 4YMSA 3IPRA 4I4LA 4JI8B 1QZTA 3LX8A 2ZI3A 1KNQA 1NZDA 4GBED 4EO7A 1NDUA 2JVJA 1O94A 3LHSA 3PXUA 1V2GA 5KHAA 1ZRMA 1P72A 3NHKA 4MYRA 4MRAA 3S2UA 3ZBPA 1ZU5A 4BMOB 3U0BA 5D1NA 1N6OA 1EE2A 2O0HA 5B57C 1P1IA 4KQ6A 5KREA 3DEIA 3BSFA 2ZTHA 3NZEA 4KNYA 1ZCBA 3FA2A 4UHJA 1U9JA 3D3WA 1HNZB 1CUUA 1JTEA 1MCZA 1LWNA 2A9RA 4YRDA 4E94A 2WLTA 2W4MA 1Z4NA 2YY5A 3E2IA 4J0EA 1RZRD 3FYTA 3F49S 4A8JC 4QPPA 1C7EA 1GPYA 4DFDA 1NBEA 1Y9DA 1TPZA 1ZMOA 3AGPA 5GZ3A 4Q12A 1R6BX 3SLRA 5B30A 1HZZA 2HTEA 1NTOA 2OAEA 3FWNA 1VSTA 5IDWA 1FP2A 3N86A 4B80A 1IQUA 4IW3B 4YI3A 2HRBA 4RH3A 5GY7A 5FL7A 2ZYGA 2BBTA 3JS5A 5TY0A 2ZE8A 3LHKA 4GPTA 4HN9A 2EFEB 4YA6A 2I55A 5HIIA 2JZNA 3MSXA 3P19A 5FWXB 1MA0A 3GOQA 3EW9A 4N40A 5F3RA 3PGJA 2VAWA 4F3CA 4CLHA 1NV8A 3DULA 2PUTA 4OHWA 1JTFA 2BHSA 4ZC1A 1EXMA 1J0XO 4M37A 2QLBA 4IXTA 1G8GA 2HB6A 5J2UB 1ENOA 4LSMA 4QTUB 1RLIA 1PZNA 2PLRA 3UJDA 3DVSX 3EDOA 4PXAA 4G5SA 3K9BA 1H05A 2P27A 3EZ6A 2IYRA 3O83A 3S68A 4UFNA 5L51A 5LD2B 3AEUB 3KDAA 1J9EA 1IK4A 3OJLA 1TYZA 5A4AA 5IABA 3FTEA 1BEUB 2DT5A 3VA7A 2VDQB 2HL6A 3C43A 5L3VA 2VYVD 3D7LA 3M4NA 4N7JA 1N5OX 3K94A 4I8DA 3I01A 2C04A 4C07A 5LYYA 4YCNA 1J00A 1O3YA 2O48X 4S05A 3E18A 4KLZA 1DFHA 2LKCA 1M6NA 2P2NA 1FYFA 4F4JA 1XYVA 2A0WA 1T5OA 1ISGA 3BULA 3NKVA 3F46A 3WMFA 4FDVA 1KAOA 4IJVA 3DGEC 1V8FA 4MKZA 5BT8A 5WRFA 5EKTA 4KWIA 2E5LB 2QBYA 4JA0A 5DF1A 1OSNA 4COKA 5JLJA 4MYTA 2LGJA 4HQLA 5HZKA 4C4TA 1U0SY 4IKOA 1VIAA 2ZJ6A 2CNBA 4UBLA 1A8QA 1KO1A 4I3HA 1CEQA 4C0HA 2GHRA 5AVQA 5JADA 4TV9F 1Z3IX 2IZ7A 2A67A 3SM3A 4BE4A 1RXEA 3UK7A 4IIBA 2FAXA 3HB1A 3VR2A 4E3WA 4UOZA 3DFUA 3T3PB 4DXDA 3BMXA 3QYFA 5FCDA 3FKQA 1GWNA 3M7IA 4OXQA 2BCEA 2P6RA 1V5EA 4LA4A 5COAA 1X92A 4Y0AA 4MVJH 5BO5A 2GBLC 4HFMA 2XYHA 2ZSEA 1NMXA 1QDEA 1NWCA 1XB2A 4QIHA 3CEPB 1Y8RB 2PT6A 1J07A 2AXPA 3HXPA 1GLNA 3L05A 1HZJA 3QFRA 4B8ZA 2IF2A 4D80A 2PBZA 3N87A 3ABSB 4PX9A 3VOSA 1TT7A 3DL2A 3ER6A 2XAAA 2YHIA 3GV0A 1N2BA 3KXIA 5JSYA 3P27A 1XTTA 4W7HA 3E84A 1F8UA 4ZU6X 3ROXA 3TSCA 4D6PA 4K9OA 3HDTA 1ZJYA 2VUSA 4ZMRA 4U7FA 2HK9A 3AERA 1A1SA 4CL2A 3P96A 1NF8A 2QUHA 2DFLA 4OA8A 3EUAA 3B6IA 5KDOA 4M1QA 4U6SA 1TTHA 4BMZA 4FB5A 2NU6A 1P1HA 2YJ6A 1AKTA 1SCKA 5AHWA 2MINA 4DBLE 3QVTA 2Q5IA 4NJOA 5IHXA 2GYVA 2FX3A 1GQQA 2QMEA 2SKDA 4RVHA 1ONPA 3TRHA 3U17A 1FCJA 4ZT2A 4D74A 1QKIA 1RLJA 2XITA 2ZAOA 3FKSA 4RZIA 2O57A 2QSJA 5JVDA 1M2JA 3FCSB 1Z07A 4NQZA 4DA8A 2NTVA 3Q8KA 3F3KA 3GUUA 1C0IA 2EP5A 1FDRA 1PR0A 2Y71A 4FOPA 3RAFC 1O03A 2GWHA 2VAMA 1ISHA 3OZXA 5AVKA 1IWPB 3GW8A 621PA 5HKAA 1QPZA 4RK0A 1AHHA 1PR9A 1OXMA 2XYGA 4AP5A 1E5QA 1ODLA 3AO0B 4HDSB 2H31A 1TK9A 2ZB2A 3GNLA 4PQEA 3CE9A 4ARBA 5FV4A 1R27A 2UUAB 4MTCA 1NXOA 3ORSA 1CQJB 2NXNA 1S2DA 4BEWA 1YVEI 3G8DA 4W4TA 1ACJA 1UXKA 3OD5A 4LMRA 1P3Y1 1WCIA 3O4FA 2VJPA 2QD2A 4I5GA 2MMGA 3UB4A 4FGKA 5MN5A 1GKKA 1TJ3A 2HQOA 3C48A 1AQUA 2Y0BA 4ND5A 5BSUA 5F1YA 4TWZA 4GXRA 1NC3A 1OASA 2ODBA 4M99A 3VNBA 2IP1A 5BOSB 4OBBA 2OZLB 4OD0A 3ZZUA 4MVXA 5HTKA 3O8NA 5CP8A 2VJYA 1EDEA 3U16A 1E94E 2VYCA 4MWEA 1YL6A 2QV0A 5DIFA 5DWDA 1T1SA 1U31A 2XHEA 1BMTA 1PUXA 2AOWA 4DNPA 4BNUA 1WOMA 4ZOCA 3S4YA 3JVIA 5CLLA 5K20A 5JJKA 1Y7TA 2C94A 5CK5A 4DREA 1EFRD 1QH9A 4MO9A 4DVGA 1U7DA 1PJ3A 3LCRA 2IT1A 1NE7A 1S7CA 2E4AA 3E1SA 2HQSA 3G59A 4J0QA 4KRXA 4RDCA 3ORFA 3B6KA 1ULAA 2MU1A 3DKPA 1SGWA 2E6KA 1ESEA 2WQZA 3DE4X 3PYLA 4WY5A 1ZWLA 2QR5A 4P9NA 1MHPA 4G5XA 4LXTA 1QCCA 3AVXA 4TXJA 3LOPA 3WLLA 2F55A 1P4HA 4JBXA 3DBLB 3LT1A 3R3SA 4V0OA 1EKXA 1UK8A 1ZXXA 2K87A 4XGRA 1DG3A 5K8TA 4HHEA 2HRQA 1L5GB 1EUZA 4HYQA 1GKLA 4EA8A 2CVOA 1V1RB 5KTTA 3AEKA 3NDPA 4Q5IA 3T4EA 4RNDB 3FPLA 2I4LA 2QDXA 4IILA 4NV0A 3K9GA 4MWBA 3DJFA 2QJWA 4XSVA 5JCJD 2O19A 4W5JA 4CHTA 2I2WA 4WA7A 3THYB 4ZTZB 3DZCA 1ZM4A 3PEYA 4KO1S 4BPBA 4AKGA 1CG6A 3HV2A 5AR1A 3VU3A 4GR9A 3KUUA 3RLIA 2V96A 4LDQA 5TSDA 2ORIA 3ML1A 4FBGA 4JB3A 3EXAA 4MHTA 4UVHA 4POOA 3K0SA 1N2OA 2C96A 1PJAA 5JNTA 2CVQA 4C08A 1PR2A 2IU3A 4WI1A 2VL7A 4LF7B 4BHTA 1I33A 4PZPA 2ACVA 3O8QA 3P2IA 4IOJA 3N0VA 2Q7XA 4QBIA 4I66A 2PKXA 4WINA 5CVEA 5CCDA 4U00A 5B1YA 3I53A 3P0FA 5JBQA 1NJSA 4PSDA 3Q15C 5E95A 5KYUA 2FE4A 4D56A 4X7PA 4CTNA 1JXOA 1YKGA 2IXBA 5HQ3B 2R8EA 2B7BA 3T3DA 2W6QA 2YVLA 4X1IA 3N6XA 1N57A 3WLQA 3OP4A 4GPEA 4F2DA 5LD2C 1TIPA 3WDMA 2AR0A 3AZOA 1A9SA 2H4XA 3E2PA 3EXG2 1G3UA 1TM7E 2ILTA 4G4GA 3A4LA 4HWKA 4UPVA 1DUSA 3RG2A 3T5GA 1RQLA 1FVXA 3NUQA 3LP5A 4F46A 4LHXA 4QDUA 4GM1A 1NVWQ 2VJLA 2FRVA 5ELMA 2JLAA 2MMCA 4C3UA 2OHGA 2QZ4A 2ADMA 4ASUA 3LDFA 4MMZB 3HJAA 3S99A 1SXHA 3GG2A 1ZLYA 1UINA 4YTEA 2Y27A 1E6WA 1Z62A 1HDOA 3KQMA 1EFPB 3K1JA 4OCZA 3Q2KA 2ESRA 1NQOA 1R0CA 2C54A 2JB9A 5COBA 1C7JA 3NEPX 3AC0A 3H1PA 5ALVA 1WMBA 4KIWA 4I1IA 1IZYA 2VQFB 3IKJA 3U80A 1IEXA 1PNQA 1W35A 3A2NA 4I9NA 3DF7A 3W78A 1QCZA 5HNKA 4QD3A 3DQZA 2XWJI 4XYBA 5FBRB 3UGTA 2I5PO 3PQEA 2DE0X 1T0BA 1OH5A 2QJOA 2F67A 3KJIA 4OMDA 3KZMA 2YH2A 2W8BB 5IM4F 4FFBB 3OSUA 4A4DA 3MAJA 3PRKE 1QGDA 4N8SA 1NXXA 4MQ4A 5ESDA 1YSCA 4I2VA 5CEEA 1HK7A 2AOUB 3LC2O 1N3IA 4LW8A 4M0PA 1VDMA 2O1SA 5K0ZA 1AH2A 2X5XA 2IEDA 2DZDA 1L5OA 3C97A 3OZWA 1PR3A 3EDRA 4LNHA 4Q00A 4RPCA 5FUBA 4U5XA 1SXPA 1ZNWA 2OSVA 2FJPA 3S1SA 3FCEA 3RRJA 3ZKWB 2ZJ8A 2KB0A 4DLPA 3ORHA 4BTVA 1UQUA 1XXHE 3JR7A 3LUCA 1GYQA 5LKRA 3QVXA 2C4MA 4QO7A 1Y5RA 1K4MA 3UJPA 3SE7A 3LXXA 1JWLA 4PWZA 4N1AA 4RK4A 4BNIA 1X3SA 2HOQA 2GN2A 4PIPA 3V8QA 4RSHA 4F3KA 2C20A 3GCXA 4PLVA 3AOEC 2R7MA 4OL9A 3ZWCA 3VO2A 3VU9B 3OQOA 2D5BA 3W8RA 4HD8A 2WFMA 4HLDA 2QRGA 4KIFA 3EEQA 3LMKA 4WD3A 4LWZA 3TG2A 2CLOB 4MW9A 4J0JA 5LBTA 2IWHA 4TQGA 4AULA 5FJIA 1YMVA 2P75A 3FNIA 3PJGA 3BZUA 1OWMA 3KCQA 4HB0A 4H9GA 4HOYA 1DTSA 4RAQA 2BFFB 1A2KC 2AFHA 3EEYA 3LC0A 4PPQA 1PI3A 4EUEA 1IZZA 4R05A 3MS7A 3TNLA 2YHAA 3TD9A 5BQFA 1RYHA 2ZYHA 4D3ZA 2JVKA 4FOOA 5TS3A 3G0GA 3MJCA 3N2ZB 1NUHA 2OZVA 4ZCLA 4A0FA 1SH7A 3ZIDA 5H83A 4QTYA 2KX7A 2HJSA 1DT3A 1XF1A 2OUIA 3KTOA 4QOGA 2XRFA 3DP7A 1JIUA 4KYVA 3Q3CA 1T3ZA 1EMDA 1X7XA 4WKGA 3ZNPA 2C3OA 2NSLA 1RWOA 4PG8A 2QNBA 1AHNA 3IVXA 4CV3A 3R3HA 2YJ3A 3A4YA 1NURA 4RYLA 1JEQA 5IYZA 3WAJA 3OZDA 4B0OA 1TF7A 4LHYA 1P9RA 2YV3A 5AUNB 5KU1A 1HTBA 3FNGA 3EHEA 3OLYA 4S0XA 2WTNA 1KNXA 5J5VA 1OLXB 1R9GA 3DYBA 5FV7A 5T5QA 4DJTA 1H4SA 2JI9A 2OECA 1CW2B 3QPUA 1RBYA 4FFSA 3DBHB 4KQGA 2FR8A 2IELA 1I7QB 5K4AA 2NACA 1VLHA 1W59A 2ZSFA 2IU4A 1QKKA 1SOVA 1XOIA 3OPMA 4BRZA 4B1FA 5AI8A 1W4LA 3MTEA 2ZYUX 4NZOA 4DQXA 1DHTA 3MCZA 5EERA 4ZCTA 1BHQ1 3NBQA 1M0SA 10MHA 1GNPA 4DHEA 3AGQA 3VHXA 1EK2A 1Q7GA 1W29A 2IDJA 1TYEB 2PX4A 4MX8A 4Q24A 2VZLA 3UGJA 3I0NA 1RM0A 3GROA 3CUYA 1R4NA 3C3YA 4QX6A 1DINA 1YJXA 5BW5A 4QU9A 4PXSA 1XCOA 1U2SA 3AYZB 4E21A 1U0BB 2FSIA 4OG2A 4P54A 4AJKA 3SK0A 1KETA 3MF4A 2O50A 4ZT6A 3ZHTA 4EIWA 2WW8A 2JFBA 4W8OA 3VM6A 1I10A 4IDAA 4L8WB 4OI2A 1ZVJA 4TYWA 4YV2A 4O4HF 4LF5B 4C4XA 3QLVC 2ENWA 2H1SA 1JFTA 1GZVA 3AP2A 3EXG1 1Y8ZA 1I24A 4LNAA 5U9CA 1XKXA 1N0VC 3WL8A 4F1JA 2WU1A 2XT0A 4XSHA 1Z0DA 2GWRA 3QIVA 5IF9A 5HFJA 2ZDGA 2R6ZA 3E4DA 4L0CA 3KVYA 5ILQA 4QAQA 5FNVA 1HDRA 2CSUA 4W8GA 4YQEA 3NWBA 4XB1A 4JGIA 5CBPA 3FFXA 1XU9A 2OBNA 4O4JF 3VZBA 5FT9A 1XFAA 3IRVA 3U49A 5EGSA 1REQA 3HZHA 2VP2A 2DPXA 2YBEA 3BSSA 3HNPA 3K2QA 4WZBE 3AR2A 4IMRA 3WADA 3KE8A 4WVLA 1KWGA 2BTEA 1JWAB 1JALA 3O8OB 2QVLA 1PUJA 1K6MA 1A50B 2XX3A 1F3LA 1XU7A 2AXNA 2QVCA 4CCSA 1ZKDA 1VBMA 4X61A 1EB8A 3NLLA 2HDOA 2TMYA 1SKMA 4PU0A 3ILVA 3REGA 1E5XA 3FCYA 1QV6A 2ZAMA 1SVIA 3QMPA 2J9FA 1IJBA 2Q2NA 2Q07A 1TQ2A 4NY1A 3R7LA 3IAUA 5HMMA 3ZK8A 2PY6A 1PW7A 1V0JA 1G18A 1K3UB 1XBTA 2YCLA 4DMMA 2ZRCA 4R98A 2CFOA 2IODA 4BBAA 4QYSA 2KYRA 1Q7CA 1V95A 3D7SA 1E1NA 3EBPA 1MFZA 3QBVA 3P1JA 5JFOA 4Q1VA 1SEVA 2ONZA 1ZGHA 4EDHA 2QP4A 2B4AA 4YB8A 4OLFA 3SMVA 3HJRA 1X7HA 3NHPA 1VKHA 1I4OA 3K0CA 4RTNA 1WUIS 3ZGVA 2O8VA 3LUHA 4KK3A 4RKWA 4V0RA 2OYRA 2NTJA 2R1VA 3EG9B 1N1DA 2ST1A 3TDMA 2QRNA 3OMXA 2Q7DA 2J31A 2QMHA 5JXIA 3AVUA 1KMNA 3ANMA 5H4GA 4KGZA 4XD7D 4OH1A 1PN3A 1Q6YA 2A0KA 2A35A 2OT3B 1J8VA 3PT5A 4L4RA 4PY2A 4RE5A 1JG3A 2X7HA 4PPYA 2QT9A 4HH1A 3BILA 3K30A 5DK4A 4C4OA 1R9NA 2QORA 3PVSA 1EP9A 1Z0AA 4U5QA 3SAJA 1IHXA 3V8PA 1ZN9A 1IM8A 1NVFA 1Q1NA 2FW0A 1HQKA 3N8IA 1EFLA 2FHSA 3DXFA 4Q6BA 2M32A 5I6DA 1XAHA 3LDUA 4WZAA 3W1VA 2WWYA 3GPLA 3LUKA 4ZVUA 2JCVA 3IT0A 5SYAA 1CUSA 3LCMA 4TL6A 1SB9A 4TQ9A 3STUA 1VLMA 3OQIA 4RA6B 5FTJA 4EKEA 5FWNA 3ZTTA 1TCBA 3FNBA 2GUWA 1NMQA 1DBVO 2X0RA 3MT9A 4GGOA 3V48A 2XUFA 3EA4A 4EECA 4A36A 1BHO1 4XX0A 2EHJA 4F7WA 3BB3A 4BV8A 1NMYA 3T3MB 4C4PA 4PZCA 1FX0B 1TMYA 1Z7WA 2QUIA 3IOBA 1Z0ZA 4YXFA 1NDHA 4YUZA 3MWDB 5JRZA 5IBPA 1GPLA 3G0CA 5EAIA 4LJSA 1Y5LA 5AM4A 2PUEA 3LTEA 5H68A 2OCXA 5GM2A 4A0HA 2UYCA 2AVDA 3E15A 3RT9A 4B75A 4DLBA 3AVTA 1U1DA 3OZAA 2NZVG 4XWYA 1U5BB 3AIKA 2VDMB 3EFBA 1J2EA 4PNEA 3HN6A 4I6EA 2WY2D 2WUEA 3MCWA 3EPLA 1VKZA 3CLSC 2K6GA 2RG7A 3ENVA 3JRWA 4AVYA 4X9XA 1U81A 2GZRA 3BIJA 2RCYA 3FR7A 4RIHA 1AN9A 2D0PB 4AJHA 4AJPA 5KNDD 4GPD1 4QODA 4BFXA 4XDHA 4PC7A 1N4DA 1FS5A 1Y33E 2RGUA 5EXTA 3RU3A 4Z4EA 4JJ8A 1MXHA 1Q1QA 2GBGA 1E5LA 2GTHA 2GJ4A 1XO1A 3HACA 1G6KA 1OI4A 3O7WA 4QJBA 3EJ6A 1THMA 4EGCB 4FJ2A 2XNDD 4PO3X 4RVGA 5HPYB 2EW8A 3G7UA 5LKAA 4PN3A 5IAAA 5DYTA 1YDWA 3V1KA 2EARA 1XZNA 4YFYA 5KOIA 4NBRA 2Z5FA 3OVMA 2I2BA 4ZU3A 5A2GA 1Q14A 4TLAA 4NPHA 3FBWA 4TZTA 2VHQA 4F11A 5JXGA 1P2FA 1U4OA 5IJWA 3J81A 3UG6A 1CUZA 3DLPX 3DE3X 3VAYA 1YKFA 1JL3A 1ZUHA 2YYYA 3OC6A 5MGNA 3LQKA 3PQ2A 4TUYA 1ECJA 4CG2A 2P8SA 4II7A 2Y77A 4L4YA 1WCWA 2GTIA 2BFNA 3IT1A 2C7GA 3N8HA 5CNIA 5CT6A 5HKLA 3W6ZA 2G70A 3FFTA 2W6IA 4FYJA 1XTZA 4DWVA 3JQBA 4IGIA 1QIDA 4B87A 1POWA 4OXNA 4CKXA 2Z8YM 4NH0A 5HCIA 4QARA 3AF0A 4EQ6B 1TU0A 2PZMA 3W3AD 1SVOA 4MW4A 4PHFA 3CN7A 1LK7A 3DC7A 3NTXA 1Z06A 2JI4A 3NCHA 5HDBB 2V5VA 1GP2A 1MJHA 2JAQA 5FI3A 1ICEA 1PZMA 1O6FA 3IDSA 4FBLA 1ZQ1A 1GG5A 3PHCA 4GOND 1GGHA 4PNPA 2NUBA 3O4RA 1EB9A 1QP4A 4HGQA 5JWHA 4JC8A 3SX4A 2WABA 1H9CA 1ISSA 2CJWA 2ZRBA 3KJXA 4Z4CA 4DEVA 2NZ2A 4GWGA 1WXQA 2R66A 3L1HA 3CMCO 5D8DA 3GP8A 1IN1A 3BDAA 5BN3B 1UFRA 3PFHA 4DZTA 4YREA 4FMDF 1G8MA 4B7UA 1PFGA 4HQRA 3W4KA 3M1LA 3WRXA 3SE0A 4D4IA 4ERXA 1ECLA 2M6RA 4NMHA 2YY7A 1AUQA 4NCIA 1TAHA 4JT4A 1U9IA 2W42A 2VYND 2JGLA 3UH1A 2ZREA 4RJJA 5ES4B 5EESA 2PO5A 4PTZA 4KHZA 3INTA 3KAJA 2Y0DA 2BBSA 3BIXA 4KK4A 4PO1A 5FPYA 2J5BA 3RVBA 4C1BA 2AMJA 4DNOA 1QUEA 3AKCA 3ZPXA 2ERCA 2AXQA 4HTFB 4R31A 2FV8A 2LUOA 3EWAA 1FQWA 4N5NA 3CNBA 4IWXA 4EKYA 5B53A 4KO2S 1YRQA 4Q1DA 5DDIP 1YS7A 2AR9A 4KRYA 1ZC4A 1D9XA 4JUBA 2QWXA 2ZIXA 3L4BA 4KODA 1IN8A 1RI3A 1G1AA 4L8VA 3D7MA 4LWOA 2D13A 3QVWA 1E2IA 2EFYA 2HPVA 2ZSBA 3PC4A 3SZRA 1Y8CA 4DC0A 3AT1A 4PEVA 5JS1A 5J3JA 2C4UA 1RTKA 4PSVA 2VHEA 2XF2A 2NYAA 2VRCD 3HMKA 1V16A 3Q1KA 4BCCA 4C4RA 4IHJA 1TZBA 1G4AE 1DRUA 4P3KA 3TTWA 4UFPA 1RHJA 2Q28A 1F2UA 2G1KA 4WKOA 4FGWA 5B1EA 5ED4A 3F5SA 3ITNA 4R7GA 2P5SA 2M9MA 4ZWNA 1NF2A 1PW5A 2R6JA 4KNWA 4Z51A 4D8XA 3NHFA 1YFJA 3TMYA 3PHHA 2A33A 4EY8A 1KMQA 4FDTA 1WZCA 3ABQB 4C0XA 1DNPA 2Z6UA 1Y8AA 2O2XA 3GLFB 3LCVB 2IOFK 1T9AA 2KWIA 2PZ8A 1F8FA 1OJLA 1MT3A 3C8UA 5IRCD 3A3OA 4MKGA 4BCDA 1FEZA 5DLPA 5EXPA 2YL2A 4RLHA 3UFXB 5G0TA 4WLNA 4WN9B 2XT9A 1OZFA 2GYUA 1H4QA 1GUZA 1IY1A 2XDQA 4TTQA 4KDCA 3LPAA 4RJIA 2Q4OA 2PZEA 3IAEA 1SKBA 3L07A 2I6FA 4AT1A 1KEZA 3R74A 1WUKS 1QBGA 4JROA 5HZHA 1NXPA 3KLNA 3SICE 1NVKA 2E5WA 4MLPA 1T0JB 1CS0B 1RWNA 4MQ6A 1JQJC 4K6HA 4PFSA 3KHKA 4FFLA 3M4JA 3KLOA 3KZXA 3QOFA 4Q7MB 2CVZA 2YHSA 3CFYA 4RM2A 3FMGA 2PCJA 3UAVA 2E21A 2ZJZA 3PUYA 2P4EA 4J3FA 3UOAB 3VZPA 2R8XA 2W0MA 3E3MA 5BV1A 3CEAA 4C2BA 4C7XA 1R3UA 1F06A 3GGGA 1B16A 4QOSA 2EQAA 3GLTA 5IJ0B 1TM5E 7ADHA 4P80A 1CSEE 5D6OA 4QPDA 5BR7A 3FMPB 1VP9A 1ZDMA 3LUJA 3V4RA 1WV0A 2DWUA 2JEOA 2QUKA 4LECA 4MJ3A 3M8KA 1E9RA 3ZCVA 5IXSA 1NX6A 2QW0X 2HY7A 5JC8A 1KAQA 3EVZA 4P7BA 5IFLA 2M2IA 1UPFA 1OBOA 1PK8A 1PQYA 1WJGA 3GRCA 4YAFA 5U1PA 3JAMA 1K3TA 3EC1A 2IDKA 5CEFA 3IXQA 1G21B 3OX4A 3Q98A 1UJ5A 2LCQA 3E61A 5K99A 1HT3A 4DLVA 3IPXA 2DBRA 5J4LA 1NG1A 3FOWA 5JCJA 2V0GA 1X1SA 1LBEA 2JFNA 4ND4A 4A0RA 2V6MA 1SXJA 2PT9A 2A6PA 1LW6E 5G1NA 3WK6A 1WMEA 2QYHA 1PT7A 2Q5JA 3RRNA 1CQIA 4KMOA 5DYYA 4C6TB 4L8LA 4KXFB 1SOMA 2OP1A 3A32A 3ICWA 4I8XA 1JLSA 5JO0A 2VNHA 2OM2A 1XQVA 1J6UA 2EFDB 5F7XA 2HW8A 1I3LA 1ZO8A 4LC9A 1K8RA 2ZI5A 1QFMA 5E38A 3MINA 1H1LA 1V11A 4HCJA 2F9FA 1G0NA 3Q10A 1LSOA 3DO6A 2DFKB 2QRLA 3L1UA 4KPUA 2O8CB 4HX2A 1RACA 2XIJA 3GLHE 3SNHA 2C2WA 3M9LA 3KR2A 1KQNA 2G83A 4UPEA 3PE3A 5K0JA 3O95A 4MTLA 1M5UA 3N2LA 1PJ2A 4N01A 5HJ2A 4BKRA 2Y1EA 3FPFA 2HIGA 5KZMB 1CB7A 4JIMA 1F20A 2BM0A 2MSCB 1DC8A 4K46A 2XLBA 5BSEA 3HWX1 4UATA 1NYTA 3RVKA 4MV9A 4BLUA 3AXTA 3B12A 3OCVA 1DAOA 4EUKA 5AVOA 3ZCQA 4CV0A 3FHOA 1PQPA 2YJ5A 2FPXA 5C8ZA 1ZR2A 3SVZA 1UM9A 2FPSA 3O0DA 3S3TA 2EDCA 1VSBA 3PR3A 4QGHA 3TLGB 4M1EA 5I5EA 3UG7A 5IVPA 2XMDA 5JIBA 4XIGS 5EVCA 5K09A 4MUJA 5LB4A 3RK0A 1B00A 2GHTA 3KHTA 3OPNA 4G24A 3W5DA 2V7TA 3CYFA 5SZIA 2GCGA 2OL4A 1MABB 4MR7A 1T3TA 1CRQA 5F21A 1GNTA 3E0QA 2NV2B 5E2IA 2I8LA 2ZLBA 4POAA 4ALKA 1LDYA 4NFSA 5L3RA 2PT7A 2W2LA 3O31A 4CM4B 3V55A 4LOHA 1B2RA 1R00A 4AZ3A 4D0RA 4V1CB 1OB2A 1Z18A 2CDBA 1FB5A 1JKFA 3H11B 4NJMA 4GQIA 1L8AA 2N1MA 1H1DA 3FRIA 4NBLA 2X1VA 5CPBA 4EGQA 3DFIA 1O94C 4DGQA 3ISVA 2AB0A 2CN1A 4IDQA 4R8MA 5EHZA 3G9XA 2JK0A 2JGMA 4E07A 3VSDA 2D5CA 2DECA 2VSFA 1UMDB 2ONKA 4BNYA 1PV4A 5CYFA 1XCGB 1X1DA 3B3GA 3D31A 1QGUB 2X1MA 3BXOA 3F8WA 3L01A 4ZP1A 3V33A 3NBYC 5DYIA 2J87A 2ES4A 3U4HA 3TX6A 1UZUA 2MSKA 3ABRB 4WZZA 1V3VA 2G72A 3CUSA 5FBVB 5J2TF 3QMMA 4DMRA 4RH1A 3NHJA 1N6RA 2DUJA 1KSFX 4Y30A 1V96A 2YOGA 1FNNA 1VHJA 3BRWA 1HZZC 3KSZO 3QU5A 5TF0A 1YQTA 3R20A 3C1OA 1L4EA 1JDBB 1MQAA 2QZ9A 5I4BA 3ZHVA 4X6UA 2OWDA 3ND6A 5J43A 4HNHA 1PL7A 1NNEA 3QE2A 3HFRA 1I5EA 4PGMA 4QBGB 2POCA 4QRDA 1N2CB 2QYTA 5LVAA 2FKAA 3I4LA 4ML3A 3FB4A 4UM7A 3SC6A 3DKKA 4AMYA 2AMVA 3B2NA 2R8PA 1DQYA 4FCTA 3TB4A 4GL4A 1J7KA 5AVJA 4Z7JA 5LQNA 3K9NA 1QYVA 2BFAA 3DVRX 3E4CA 2C7PA 4LHEA 1W5AA 3KTAB 3UT6A 1PJBA 1YB5A 1L5ZA 2RHRA 2QTLA 3H19A 3K5PA 1DOZA 1ZYUA 1RI2A 1SZDA 5BWNA 3OZUA 1LBQA 3PGMA 3PC8A 3UIEA 4MS3A 4HEA1 3MCVA 3D0RA 4DWJA 5EJGA 5E3JA 3RW9A 1J42A 1SD5A 2YWJA 4WLOA 3K0HA 4P4NA 3NC4A 4K0RA 1ZINA 4FW9A 2A9JA 1U0EA 3PXBA 3FRJA 2X7JA 3K6JA 4HLQB 2AFIE 1S3SA 3JQPA 2GZAA 3E9MA 1SM4A 2BTQB 3CPEA 3PTZA 4GSKA 2JCYA 3H3XA 3EEFA 3FNEA 3OCZA 4W1SA 3NBMA 1YFLA 3TTXA 2FDCA 3K73O 1DBPA 1E2QA 5JNRA 4XEUA 5GONF 3JQAD 4L9AA 3PQFA 3LC1O 2P2ZA 2H5IA 3GIDA 1BAPA 1K8XB 3T7DA 4B4OA 2DWCA 3KYCA 4ZRMA 3CRRA 2Q3CA 5BVHB 2QTFA 3GZNB 3WLHA 1PGPA 3AY7A 4JP1A 5IKEA 2KBFA 3A4IA 3BM5A 1PTKA 3RVLA 5I9LA 2I4IA 5DGIA 1FF9A 1DO0A 3QYJA 2H4WA 4DG8A 3VYUB 3DW3X 5DGDA 4KCGA 2P2CA 1G8JA 1NTRA 3ZE6A 4EG8A 4RD4A 1Y7LA 4JITA 3QVSA 2G4LA 4Z4HA 1QG4A 2VQDA 4EZEA 2PG3A 4U4AA 3IHKA 1KAMA 2BR3A 1C4OA 1K08A 3I37X 1CQXA 3NU1A 5DKFA 3WLIA 1G66A 4NEHB 5B3KA 1VL0A 1I9GA 3U3DA 2ZJ5A 2VPYA 2UUOA 3E05A 2QTCA 4EELA 5TC4A 1IBSA 2YS6A 2BBOA 2EBHX 4MDYA 5LYJA 5H59A 1Z28A 4CLEA 4ZJZA 4TKVB 3RVRA 1WDLA 4DDWA 4FM9A 2C5FA 1JNYA 1M73E 1SU7A 3S2ZA 3GLIA 1BGWA 1K9VF 1HNNA 1LQUA 2G77B 2H2FA 2RJNA 2WU8A 4BVBA 4Z4GA 4PG4A 2HCBA 2M6SA 4N5IX 2XJ9A 2C7VA 4NOMA 1E7WA 3NAGA 4E30A 4ZZ0A 1N36B 2F3SA 1LKZA 3CVOA 2DFTA 3GRUA 1YQQA 3L7AA 3PK0A 4JY7A 2JI7A 1C7RA 5T8KA 3WLMA 1UPCA 2VNSA 2L69A 3GQBB 4BGEA 2P79A 2QN9A 2Z2JA 4G1MB 4O5AA 3WDKA 5KSYA 5AYVA 4Z54A 3M6IA 4D3FA 3QEMB 1V4VA 3W6OA 3FTDA 1O58A 2YXLA 3PCXA 1Z5NA 5FUVA 1WVGA 2P2SA 3QHAA 3KR0A 2HT1A 2HPZA 4F5ZA 2AXEA 4HSGA 3K0AB 5DYGA 5CB4F 4BKQA 4E70A 1Z2OX 1S9DA 2C8VA 3VPSA 2IHJA 3NJRA 1GQSA 4ZYWA 2AD5A 2HZ7A 4OHPA 1DQZA 3G2KA 4ENUA 5A1JA 4WBNF 5LNK1 4I2NA 3EGXB 4LQDA 5ELLA 6CHYA 1JLKA 1MDBA 1S2MA 3VKFA 4XJXA 3I5YA 4YY3B 2YJGA 2YICA 3GJ5A 2IQ5A 3OZTA 3Q0EA 3CT4A 4AZSA 5BUQA 5B58T 3ZEIA 2QAIA 3G7SA 1IEWA 2W71A 3BF8A 3L7KA 3SYMA 4BIMA 4W5OA 4YLYA 4M9XA 1KP2A 1PHRA 3EXEB 3RTBA 2H4HA 4OUDB 2FTKE 4LJ9A 1T4GA 1XTRA 4L6CA 1KVSA 1J2YA 3AWIA 1AQNA 3OQ1A 3TIIA 4F96A 1U1CA 2Y3IA 1SU6A 2ZZKA 1P7WA 3H4TA 4IDNA 4KQCA 2P9FA 3JARA 2V55B 3V7UA 2VNJA 5BRAA 1P73A 1QZUA 1W4CA 4ZDJA 1U3UA 2A9FA 4G0NA 2ZJFA 4LVNA 2Y0CA 2NSYA 4HN2A 3REQB 2ZJOA 3EQ2A 3SSOA 2XZTA 1Y8QA 1HUQA 1GOTA 4OX9Y 3FOZA 1Q6ZA 4O1IA 2NPOA 3RYCA 2F3TA 3G2IA 5CNMA 3QXSA 4F9FA 5SZJA 2OAGA 3SHFA 2LBPA 1ZH8A 3FYDA 4Y1RB 4BNNA 2JLYA 2QLLA 4ZOEA 2ZM5A 3E9YA 1YGPA 4MP6A 2OY0A 3SWWA 3VQTA 4BEVA 4QUEA 4A7PA 3N0XA 3PSAA 3P2EA 4LGVA 5AVWA 2I03A 1Y6RA 3SQDA 4K3UA 4M8SA 1QTRA 4BATA 1HI9A 3DZJA 5GVSA 1UZLA 4BKOA 5TQ2B 3WLAA 4NCXA 3S28A 3T9CA 4XGKA 4C29A 4E7PA 5F9FA 1XD9A 4BAUA 1NVDA 1VE9A 4XARA 2NXJA 3I6MA 3CW2A 2IXEA 5FFFA 4H31A 1BHJA 1U8CB 2XYRA 3AJEA 1YR7A 2J9GA 2XQKA 1AKVA 5T3UA 3HEBA 1GU7A 5AQ1A 3LPNA 1Q83A 1QJCA 1TF2A 2ZR9A 1OCEA 4GW3A 1XCMA 3I04M 5ELXA 3BIFA 1HOTA 3I2JA 4TMKA 1DBSA 4RW0A 3K1YA 4RZSA 4TYPA 4XXHA 3MXOA 3HJBA 2OGWA 3JQFA 4XTRA 3TTTA 2VWHA 3IAS1 4LY9A 1XROA 4G65A 3AF6A 2VPTA 3LOQA 4MCHA 1EXDA 1OGIA 1T34A 4A2CA 3KSUA 2JIZD 2PT5A 1RRFA 4G89A 3K9HA 3RSCA 2WRZA 4A91A 1PCXA 4L07A 2BRUA 3B89A 1WHSB 3ZW9A 2DFNA 4C0BA 4RCVA 1G6Q1 3ROEA 5LP6B 4M9CA 2I65A 4OSOA 4KR2A 3D4OA 3QUBA 1YHZA 4W5WA 2BR5A 1NBMD 1MV5A 1V39A 1DAGA 2WB4A 3EC2A 3I2IA 3QVLA 2OEPA 1DKNA 4G97A 1ZBDA 3DBVO 1ULTA 5TS2A 2J6BA 2XMZA 5BN5A 2YJZA 2VXCA 3PUWA 4S1VA 2AEFA 4B3GA 4YALA 3BXEA 3L7DA 1SBQA 3N0RA 2WD7A 3L0BA 1DIRA 1I4DD 1LK0A 2B1QA 3RFUA 5DU2A 4CGYA 4P5PA 2R7AA 4I81A 1Z4LA 1U94A 3BCSA 4NFHA 5KWIA 2JIMA 1NVAA 1YR2A 2J3HA 4BX3A 3KEFA 3K1AA 4YJ3B 3PGXA 1S3GA 4O2BA 2P2YA 2QQFA 3GLRA 5EWJA 1NSYA 1AC5A 3HBNA 4WTOA 5GIPE 5K3FB 3UXYA 3WGUA 1I80A 1EUCB 2D8MA 1V45E 2KBEA 1MP0A 4GM0A 1W9MA 4I1SA 1XPOA 1E59A 5M3BA 1QX3A 2BJVA 3FMOB 3MBIA 4LQ4A 4D3DA 4YJFB 5IUKC 3C5VA 1Z56C 4IHQA 1QH0A 1O6GA 1VKRA 3NGXA 3E9NA 4EI7A 2AH5A 2A9KA 4OP2A 3HYTA 4R1LA 3Q3IA 2WEKA 4Q4AB 5GAJA 4URHA 5KQRA 3ADCA 1E0KA 2J59A 3NHAA 2R87A 3FJOA 4MB2A 3D5QA 2A14A 5ECWA 3MHPA 3KLMX 1N2XA 3Q7PA 1GL7A 3VOTA 1WMDA 2ZRNA 4DY4A 3ZZ0A 1KHTA 2AFVA 2GN4A 3AU8A 1DKPA 3A28A 2FP4B 2DMRA 4NR0A 4MWTA 5L4NA 2C58A 2PJDA 4YIKA 1Y6JA 4ZV7A 4O2AB 1UZAA 4NOKA 3SYKA 1SOAA 4RQBA 3TIXB 1ZRHA 5ICSA 2XR1A 4DLSA 1X8JA 2HLDD 5MGBA 1U8AA 4HGZA 1J99A 1SXIA 1YUBA 3PQ4A 4EPVA 1ST2A 5JAUA 3P9RA 3VSCA 2QE6A 1J7JA 2FEXA 4FZ3A 4ZVSA 4DC1A 2R25B 1GZ5A 3BWBA 4HTAA 1C1XA 2XOEA 1BX1A 3LG2A 2QU8A 1GA6A 2BH9A 1A9QA 1D2CA 1ISJA 3T9AA 3TTVA 2QRKA 1P0IA 3OBIA 4Z86A 5T4BA 2ORED 4IUYA 3RS5A 3IQZA 3P4XA 4DN6A 2CSXA 3SLGA 1JQ5A 2G6BA 4WNAB 1ZSYA 1IUPA 2J4CA 2ZRMA 1WW3A 4OXKA 3GMIA 4AN0A 3PHLA 4EI2A 3ILYA 1TKAA 3PEVA 4QHTA 2XUGA 5C5DA 3ESXA 3CLUC 3IESA 5H7XA 3GP3A 5ENVA 4BS9A 2B35A 1PSZA 1G5PA 3MB5A 4ALIA 4ZQEA 2WYUA 1ZD5A 5AIBA 4PZYA 1EP1B 3MFQA 3A31A 2ODPA 3ULKA 1Z6ZA 1YR6A 4ITRC 1DC5A 1E4OA 1E8MA 1G20E 2UVDA 3V4FA 4EKIA 3KD3A 4XH9B 3GRVA 1PEDA 4UHHA 4U2BA 4OAPA 5G0VA 2X19A 3WC4A 1YL5A 3OP1A 1TQDA 4GMKA 2TECE 1ZISA 3R9WA 2GT1A 4M76B 3KKLA 3E7FA 3ZGNA 4R3WA 4CLDA 1GZHB 1YIDA 2RAFA 4CXMA 1DC7A 5KOJA 1RYNA 2FR8C 2H4YA 4M0MA 5KVCA 1UMBA 3AI3A 4BDTA 5I7VA 2C42A 3GFTA 1Q0SA 4L16A 1RRCA 5JSFA 4W6QA 3AR9A 4LJAA 3SQMA 4DABA 2ARKA 3SYRA 4ZK6A 4WBXC 4EG5A 2JAHA 2ZRFA 3I52A 2MSWA 2NMVA 1MTZA 2YRFA 2C4VA 4WEOA 1H6BA 2VHZA 5C8YA 2FSVA 2VT2A 2X86A 5FADA 4EM6A 3BMNA 1PQUA 2OFXA 4QG7A 4RE6A 5KNBD 3PNMA 3ZI4A 3CC8A 2WJGA 3CN9A 1JG1A 4BVLA 1IOWA 4A8PA 4HVAA 2DPYA 1GRQA 5AI4A 3ZKAA 4CQLB 1OAKA 3O94A 5KYKA 1Q74A 2QPTA 2E4ZA 2FPUA 3R2JA 1NJ1A 4S1OA 5D5HA 3OQHA 1J2JA 2OCDA 1XTSA 5I7UA 1FNBA 3WNZA 1KMIY 5AM5A 5B2EA 5KNLA 2FFBA 3BQ9A 4OHYA 1F8YA 4I50A 2UUCB 2QLMA 2BGKA 4AG3A 5LZ5A 2HSWA 4QA9A 3NTLA 1M1NA 3ZW7A 2VPXA 2CNWD 3M4YA 1MAWA 2A92A 2PUGA 4QULA 4NSNA 4O4IA 5AJZA 3ZV6A 3B36A 9ABPA 3Q8LA 1L5HB 4JL6A 4LKOA 1BS2A 2PX8A 5DSTA 4MQEA 3S5UA 1NXSA 4A3SA 1IG0A 4FU0A 5IFKA 3GAZA 1YOVA 3DFMA 3P5SA 1HOXA 2LCIA 2F4NA 3DAHA 4DNXA 4UKDA 4WK2B 1QIGA 2QMZA 3F0TA 3TI7A 1S0UA 1J8QA 3EVFA 1BTOA 1Z15A 1B3RA 4OHFA 1H2YA 1PFVA 4W5TA 5IEBA 4RFVA 4HDRA 1NUUA 1TNDA 2E2WA 4GLJA 5K6RA 2FA9A 1BW9A 1N6PA 2BZSA 3I23A 5KNCH 4UVDA 3SX0A 4HDKB 1U8YA 2WIKA 3HXMA 3W7AA 3UCEA 3BJEA 5IDQA 2IZOA 4JJEA 4BEJA 4FGSA 4TMYA 1UP6A 3QSYA 3O8LA 3RS0A 4RD2A 2BLLA 3KG2A 1SBHA 2ZT7A 4MJXA 4X92A 3CUVA 1EDOA 5K8UA 2P9CA 3PEWA 3O8DA 4QXRA 2BGMA 3RVOA 3ZYCA 4F86A 3A4VA 3RYHA 1CWUA 3CPHA 4TL7A 3QEBZ 4DV5B 3GLQA 5FUXA 2OMEA 4GT1A 4HVLA 5BT9A 2VF5X 3FJ1A 2J9ZB 5EKSA 4DJDC 1B0UA 1MX1A 1NHWA 1WXXA 2UVPB 3C7TA 3G17A 5K7SA 5KU7A 3AF1A 2BI7A 2F48A 4WKPA 1VPTA 1C3JA 3QEKA 2PS9A 1JQ3A 3RQSA 4UVEA 4B17A 3WL4A 3A7EA 3B3AA 3N53A 3IIKA 1Z9BA 3K0CC 4L9WA 1P80A 3VOBA 4BB9A 2C82A 2QN2A 2OXRA 4QU0A 1XP8A 4YJHB 1WU8A 2D1YA 3VC2A 4DGSA 3MWKA 1FFSA 2W6JA 3BCUA 1MVOA 5F1OA 3EGCA 4TYNA 2V9CA 3G1TA 4X8LA 1MFPA 5JMPA 3BMCA 1F17A 1GDDA 2B25A 2EWMA 1YL7A 3RO7A 3RFXA 1ODTC 3EUFA 4EFMA 3WFZA 1NASA 2VJKA 3E8SA 2F43A 3KB1A 1P2TA 3HU3A 4AO8A 5LP6F 1QFZA 1EUDB 1U7TA 1K7FB 1LRLA 1ZITA 1OI2A 3H2BA 2C1ZA 2PGAA 1OLUB 1RI1A 1CZOA 3IBCA 4EKNB 3BXXA 4MVJA 1T8PA 3NFRA 2X76A 1U28A 3MERA 2VPZA 1U2DC 1CXZA 4MQFB 2XE4A 3ZHQA 3QKRB 1KMHA 1H0SA 1N2HA 5I9BA 2XSZA 1R0YA 2B1RA 5TB5A 2Q9CA 3RUIA 1QYDA 5ICEA 4DCPA 3WBBA 3TI9A 2QUJA 4LHVA 3FSEA 3X1WA 3O1IC 1YRBA 4C2AA 1RWKA 5JZ9A 4G9GA 4WESA 4JI1B 3KKQA 3E8XA 1PJQA 3NHRA 2OFFA 5CIYA 5FPTA 1KZ4A 2PWPA 4R2JA 3KV1A 3QPAA 3RJ9A 3VPDA 4MI3A 4XYMA 3K31A 4F9TA 2RAVA 4CM9D 4C21A 3L6OO 5DHUA 1ZM3A 3PNQA 6ADHA 1YRYE 3NP9A 1NR5A 4DQDA 3EZ9A 3KJGA 1PDOA 2IPAB 3G13A 1V25A 3K8YA 4K9PA 1JJIA 4IV0A 2PCLA 3VH1A 5I01A 3O8CA 3LWBA 3HCBA 3ZJ4A 3HZZA 3HUDA 2XDYA 1EFHA 4V3CA 1ENZA 5G02A 2H2GA 3R3YA 2ZVJA 4AICA 2A5YB 2X8AA 1GFWA 1WXDA 1NL3A 2C88A 2ZRJA 1RP1A 5EI5A 3FY4A 3T94A 2GM9A 2AHOA 1THZA 3IB3A 2JGIA 4E2XA 4R41A 4UTVA 4MLDA 1XTBA 1T4BA 4DA6A 5KTKA 2QG9A 3VR3A 1L5LA 1EG2A 3EH2A 3DHWC 4N0MA 5JZVA 4TSFD 3AJ9A 4HEA6 2F00A 3VGJA 4LF9B 3ETCA 3PQCA 5BSTA 5L8VA 2CFIA 2UZ1A 5J4YA 4LVOA 3RANA 3QE9Y 2IOHA 5KYYA 3RGWS 3DOIA 2IYZA 4AUEA 2CCKA 3RU2A 4D9KA 5DNDA 1UBTS 3FVRA 4XUEA 3M6UA 1AUVA 5IVIA 3FFBA 3ZXXA 1W2WB 3D0OA 2Y1CA 2ZULA 4NAHA 1CUYA 2WF9A 1GDHA 1HRKA 2FRDA 3KT3A 4L28A 1EUQA 4A1OA 2FDRA 4DR3B 2K4MA 4DIEA 1J1UA 3BL8A 1C41A 2PH1A 4EY5A 4Q9DA 1NP3A 1TJ4A 2EGUA 2RGEA 3ITDA 3O91A 4AKTA 4YP9A 5ICMA 2HI0A 3KZVA 3V42A 2AZTA 3VR6D 4HMOA 4P33A 1F0PA 4RKQA 1KIMA 1HT0A 3DE0X 3JQBC 4W7SA 1WEHA 3OU7A 4ZOLB 4ATNA 5CA1B 5FOXA 5LIRA 4OFZA 5FI5A 4EEXA 2G7ZA 2Q6IA 2BEUB 2DBZA 5FBZA 3ZZMA 2DRIA 5EFZA 5I9IA 3MTQA 4IF4A 4CFZA 2ZPUA 4MGEA 1WQ4A 2P77A 4BNZA 4HPXB 2OP0A 2R8YA 3ND7A 4M60A 4LE1A 4CQMA 1G38A 5JS6A 3U4QA 1TMKA 4U9IS 1FU7A 2A8YA 3ASUA 4TLLB 5AKKA 1YR1A 1GU0A 5ALSA 3CTMA 3NV9A 1KI2A 4MHSA 3WTBA 4WFIA 1JFFB 5KYGA 1RSZA 3WLJA 1JH9A 3B1WA 4F3YA 1T13A 1ZLXA 1B23P 1AZSC 4KU4A 3UK6A 3GRKA 4GFDA 4UM9D 2OOSA 1X0VA 3MUOA 4FSDA 4K5QA 4FSHA 1KPHA 1SQ5A 2JLRA 1KDYA 2WUWE 4JVNA 4YMTA 3F9RA 3VR5H 1D4ZA 1WMAA 2B4RO 3DVAA 3WRXC 2PDAA 3ZI0A 3EVTA 1YA6A 1YHYA 5EQFA 4MV8A 4UFOA 4YS6A 3KETA 1U9IC 5EZYB 3PCRB 3VSEA 3EZ2A 1SZCA 1X7ZB 2B8EA 2XF8A 1B93A 4TVSA 2YWEA 4FT2A 4LRSB 1HWYA 3N2KA 4ZAXA 3VDRA 1YZHA 1Q20A 4GYYA 1S3FA 1KI6A 2PSFA 4EX6A 2BGJA 1EX1A 2A9OA 2E4VA 1OWPA 2NX2A 2NZYA 3OT5A 4AY5A 1GJRA 1P3DA 4KN8A 3ADKA 2GRUA 1YB1A 2YN4A 2OSBA 1CJSA 3TEFA 4NXNB 3L4BC 1P7YA 1Z2PX 5DJ5A 2GOYA 1JQEA 1KO8A 1ZD3A 4DJFC 2I62A 4RJTA 4I9GA 1WXFA 3T7JA 4EW1A 5GZ6A 1YFKA 4F45A 3OLCX 3RHSA 5C1BA 1QDUA 2W2TA 1XYGA 1IBCA 4H7FA 4YGYA 4QXPA 1LGYA 1F60A 3B9PA 1S2IA 1R4MA 1DLJA 4IX9A 4I4TA 3BK1A 3RVQA 4YRKA 1NZFA 8AT1A 5E6RA 1HQDA 3RUFA 4JWTA 1ZG3A 2XGMA 3QX9A 1NVXQ 4BZXA 1A27A 1R8SA 1QAQA 1JA1A 2CNLA 2DTEA 4YJDA 3S1AB 4E5MA 2XRZA 4TYYA 1KEUA 1IXKA 3R1IA 1DLIA 2D2FA 4JLAA 1Z34A 4KUGA 3UKJA 4Y6GB 1HNXB 4C5BA 3PNLA 5EUCA 1EK6A 1QQBA 1A7AA 4RK5A 1LPOA 3O4HA 2FSUA 1MC5A 1VA4A 4ZMBA 2XD4A 3KNZA 2CXPA 1V5FA 3DFKA 2WZDA 4PBSA 1CC1S 2GJAA 3H1GA 4S0ZA 3A25A 3RAGA 1PWHA 1UKBA 3NUZA 4E5YA 4EABA 4H7IA 2GK4A 1NOJA 2JCBA 2YZNA 2PKWA 3E82A 5A4FS 3ZJ5A 4J49A 4EG6A 3ELWA 3MYYA 2NO9A 5JE8A 3BZBA 4JD5A 4UOEA 2N0SA 3IURA 4YRGA 2CC2A 3OFNA 2BUAA 3DMNA 3W05A 3IPAA 2C1EA 4MQ5A 4PZ0A 1U2PA 3ETHA 1ADGA 1MZVA 2R5FA 2XBLA 3TTUA 4KAFA 4REQA 4RTQA 1MO5A 3UAOA 4BNFA 4GM4A 2NUPB 4LK3A 1QV7A 1PIWA 1VB3A 3LP6A 3AJ8A 4ICIA 3TD2A 2YN0A 5IKMA 3DAYA 1FSZA 3OJWA 4OA5A 5JY6A 1QVAA 4KE8A 4QELA 1EX9A 4LJLA 5A3RA 4JH0A 4FUQA 1GPKA 5DNAA 3S2FA 1AGRA 1TYDE 1X7YB 2HRDA 3IJ5A 4M4SA 2VJBA 5EZQA 3I1IA 2EQ5A 1NMSA 3DCIA 3WLFA 1DMRA 1IQRA 2R8RA 2R68A 4YHBA 4AP9A 4F04A 3AG6A 3TFWA 3QE0A 1FP4A 3DWEX 2WWHA 1MU0A 3IIIA 3UC9A 5AKJA 1VL2A 1E9VA 1CPYA 1VMKA 1LLQA 1T5DX 3NNDA 4CV1A 1EK5A 2L82A 5IBQA 4F0JA 4Z2AA 1F8XA 4MB6A 3REOA 5CITA 4Q02A 3L40A 3A4NA 5B1IA 4FSXA 5LU9A 4MSUA 4TV9A 3USCS 1RC0A 2RGDA 2IYLD 1TL7C 2EJCA 4L3VA 5JSKA 2FSPA 2H2IA 3U7EB 5KJCA 4Y2SA 5D85A 3H84A 2WWXA 3VPFA 1MTOA 3IAS6 2WM9B 3IP5A 3V8RA 2LD4A 3ZQKA 1USVA 1R8YA 3CSUA 3FJYA 4AI6A 5JPIA 3NHZA 1SXJC 4UTXA 1FMCA 1LXCA 5TPZD 3ZH9B 2JKZA 1NI4A 2RGGA 5KTNA 1QNFA 4CCAA 4TKMA 4Q34A 2XKKA 1GEGA 5HE8A 1ORDA 1SC1A 3T7TA 5FBQB 3AVPA 3P45A 5AIAA 3U9TA 3NOQA 4F7DA 2M6KA 3TQCA 2X6TA 1BVYF 2PYIA 4K6FA 3IDQA 4CFYA 1CEXA 4TS4A 2UKDA 4US0R 1C9DB 2PGDA 2JBAA 3OJEA 3ZY2A 3M70A 3KDSE 3EA5A 1CRLA 4Y1EA 1PGQA 5DM1A 5JI2E 4KYTA 3PF8A 1E77A 3WHKA 1ZESA 2QNRA 3E5RA 3FTPA 2RB4A 1Y9ZA 4ND8B 4P4SA 1U7XA 3CVXA 2JHAA 1K66A 2VDKB 3AL3A 4C4AA 3B52X 2P69A 2EL9A 1KMMA 4YRQA 3VYVA 2HK8A 3N2GB 1XJCA 1XLVA 2MCFA 4Q4HA 1C7IA 1TADA 2JLUA 4KAAA 1PJ4A 2Q0HA 5E3IA 1A5AB 1IONA 5EUBA 1RAIA 2AW3A 5HGXA 3FSRA 4BP3A 4R8SA 2QTTA 1GGVA 2GPSA 3HB9A 3QLTA 5BNTA 2F62A 2WJHA 2WFLB 4MUHA 4ETMA 1XU4A 1GAQA 4AKSA 4DANA 2OFPA 1JSCA 5IC6A 5JD3A 1D8AA 2YV5A 3RVPA 1TO6A 3N2NA 1DJPA 4CKWB 4RFSA 4XUCA 1ZVKA 4IIJB 2V7VA 3NYRA 3PBKA 1P5FA 3WO1A 2RH8A 3BRSA 1JXAA 1QXSA 4ENWA 2JFQA 4JC0A 1WZNA 5H9VA 2IOQA 4PZLA 3TDKA 1X1BA 3JWEA 5ALPA 1OV4A 4M22A 4YUYA 2J32A 3UTDA 2AE2A 2SCUA 1GFIA 1USIA 2FPIB 3BKXA 3I6IA 3LPLA 2HO5A 1XVTA 3ONDA 1SVNA 4RESA 4WK0B 5FTWA 3UJCA 3FDZA 2X0IA 5KJ6A 4OHCA 1M75A 5I7RA 1CIPA 1P9WA 4FX5A 1G7CA 4NYMR 4EAQA 2JA1A 4JOSA 1P2GA 1PL6A 3JQAB 4EHJA 3HVJA 5JH7B 4BN5A 2VHTA 4CLOB 1KJWA 3EMDA 1CRWG 1C8KA 4ENSA 3G6KA 2VH2A 3A2MA 5LQDA 3TRDA 3H42B 4KQJA 3EWIA 1TA0A 1DV2A 4L76A 3O47A 3I2YX 4TM8A 3OSZA 2X2EA 5AUQA 5IK2A 3R7WA 4HV4A 2ZCJA 3CZ4A 5K4HA 5IT0A 1FFBA 3PFKA 2PD6A 1B74A 3KYDA 5IMSA 2P35A 1TJ5A 3HI4A 4HH4A 1GGJA 3U3MA 3ZQ6A 4AN4A 4ARVA 1FFAA 1TEHA 1SHZA 2JLXA 3R77A 4JP3A 2XWQA 5H8WA 4J76A 1BS9A 2XMCA 5FOSA 1OA0A 3AKYA 3GEGA 3VR4H 1UQRA 5LUAA 4Z4FA 2QMOA 4IP0A 3OA0A 1XE3A 1Z5OA 2J8ZA 2LCFA 5JD5A 3NASA 1YE5A 3DMTA 4FD2A 1OGYA 3I3SR 2WKWA 5G4KA 1ZN2A 4QZVA 4P3OA 3VNRA 2CWWA 1WB9A 2GN8A 3FDXA 5LOVB 1PYGA 1HYBA 2JIOA 5CH8A 2FFQA 4RDXA 1DJMA 1HORA 3DLAA 4Z0TA 2FUKA 2G36A 2OV3A 3PC8C 4L3OA 1ID8A 2XTNA 4BKMA 3U37A 1MX9A 1V26A 1O08A 1M3SA 4YWHA 4ZIRA 1JDSA 2ODTX 2Q1UA 3QXJA 4Q3EA 5DX0A 1RWWA 3GT0A 2DB3A 3F1KA 2ZRGA 5BY2A 3W5CA 5DNUA 1GADO 3LW8A 3A4TA 1GPWB 2YFQA 1UXHA 1Y3AA 1CUIA 2OB1A 2OGSA 1JB9A 3GN2A 1LH0A 1EIZA 3AVWA 4E5SA 1EDBA 3MW8A 1C9NA 3O75A 3T0GA 5EXEA 5BMVF 1NM5A 4RSMA 2W8ZA 4UXIA 4XWKA 4L2IA 4MCAA 1NKSA 3QPBA 2FKNA 4X7RA 1KDRA 2QU7A 3GL9A 1CHNA 1U0GA 3AMVA 3LX6A 4O25A 4BOYA 3T4XA 1SQSA 5AOAA 4YRFA 2GCOA 2ZGVA 3DZHA 3ZXUB 2VAPA 3RDPA 1GYRA 3D6FA 3I12A 1YDHA 3U7HB 2POQX 1G55A 1FLDA 4HVCA 4BRSA 2G82A 4EW2A 4ZKEA 5JYBA 3AEQA 4QLAA 4K6GA 4R8RA 5JAZA 3SQNA 1V1MA 4OGKA 1SIOA 4CDGA 5FAXA 1XFDA 4MPJA 5ENDA 3GJ7A 3R7AA 4C7MA 3OKFA 5KJ1A 2V6IA 4EHAA 3MJHA 3L41A 4JT2A 1YZYA 3SJBA 1N1EA 1OUMA 1E3IA 2IPNA 2QTAA 3CPJB 3ES9A 4DS3A 2P8JA 3PPWA 3PNYA 2A9QA 4LJ6A 1G64A 3V7FA 2VN8A 3T12A 5SY6A 1IM5A 4TXMA 1OH7A 3IP6A 2GNAA 1MB2A 2OZKA 2KQUA 3OIVA 4IQFA 4TLMB 5BXQC 3N5CA 4U3JA 5BQ5A 4D4LA 1EHIA 1NBWB 5IM4A 4UHDA 2O5RA 5T4FA 1HDGO 1VE1A 2WF5A 3R3ZA 2F1OA 4EL0A 3JWPA 2PLAA 3QEAZ 4NBSA 5F51A 4D41A 1T9KA 2OBBA 4DJAA 3GJ8A 5L3QA 4UTNA 2FUG6 4ZCRA 1QFJA 3H65A 3MS4A 5T8KC 4ZEMA 3ZXSA 1DCFA 1HG1A 3INYA 4HGNA 5F35A 4MUNA 5GMOA 3GRRA 4DR5B 1F8GA 4JVOA 2CFCA 5KKCA 3HBJA 4QYIA 1RKUA 5AXDA 1F5NA 1ZUD1 3FNFA 2OQRA 4ZCQA 3RFTA 2FUNB 1TFRA 4L4SA 3WNBA 3URKA 1E9BA 5C4MA 3OM0A 3OCYA 3QMWA 3OBBA 4RZQA 2BISA 3Q9LA 4JT8A 4O3FA 5H16A 2RHOA 3QVOA 4LXUA 2CDCA 4H35A 2R4TA 3UW3A 4CR8A 4R2XA 2HV9A 4PSKA 4E4YA 3EGDA 4CTKA 3FMIA 2EP8A 4U6NA 2PFSA 5AKZA 1J09A 5B4UA 2D4AA 4KBFA 4CEHA 3X2SA 4EATA 1WLSA 2PUCA 3BTVA 1MB3A 2V3WA 2WHPA 3HR8A 3JQ9A 1P4JA 4DE5A 3GGDA 5LA6F 2RKWA 4GDMA 4GGMX 3KSMA 2KLHA 3ZOKA 1MO4A 2CD9A 4DCTA 6ABPA 2CGEA 4RENA 4BU1A 1WUYA 2QTZA 3R40A 5AW5A 5B5SA 5ITSA 2OXTA 1C8LA 2O1XA 3JXEA 1AK1A 1XLTA 1QF9A 2R2AA 3UFBA 2O06A 4PGHA 4UZEA 4JDUA 1YI1A 5JRJA 1H6CA 4M1SA 2XQGA 2Q2QA 1O6BA 4KLAA 2ZE7A 3B2QA 1CHDA 3DCNA 3V2HA 3MT8A 2G1JA 2P9EA 5ECGC 4B81A 2VG8A 4FFDA 3W5VA 3R9XB 5DLEA 3K2BA 3RH0A 1DP4A 1N7GA 4YMLA 5HRCA 1M33A 1WDWB 2B8TA 3AOGA 2ZUCA 2CCJA 2Z5GA 4WOBA 2NO6A 1L7RA 1FUYB 1LS1A 2Q0QA 5ALWA 5AXCA 3D6TB 3CEJA 4MDEA 2PKQO 4K9MA 4H3VA 4L0DA 1YC5A 2Y2UA 3H5VA 7AT1A 4PNZA 4HXFB 1ZRSA 1Y4SA 2CUTA 3ZLVA 4D9MA 4I9UA 4QLOA 3IBYA 1DCMA 4AY4A 2EJBA 1N92A 3M2PA 2F8LA 2PU5A 4OFBA 4OK6A 5CG2A 3RADC 4UEJA 2BAGA 1TT5A 1KK1A 2R4QA 2VHYA 4EPRA 4F92B 3AM5A 3KLPX 2AGVA 1B15A 4IOMA 3BHJA 1UF9A 3R6GA 3TJRA 2HBQA 4TXHA 1WAMA 4XVHA 3MG9A 5FBKA 4EHIA 4YUWA 1T0HB 2H16A 1OX6A 1E32A 2D6FA 1KTVA 2AWNA 1KZ1A 3S2IA 3QUCA 4Z4QA 2Y92A 3OTHA 2BMWA 5EN4A 1X80B 2HMUA 3F7OA 2GUGA 3VPXA 3IODA 2QMYA 1Z6GA 2DP4E 3WTCA 3SFZA 3K70D 4COOA 4UBOA 4AWBA 4EZIA 3UAYA 3MELA 2I4NA 2J08A 1RZ3A 4Y6SA 1JGTA 2MSEB 4YBZA 1NN1A 2ONYA 1QV9A 2X4GA 2JAXA 4G1VA 5KWEA 3EMBA 3O8BA 4Y67A 4Z6KA 3EZLA 4JUIA 4AW9A 5KTPA 3HVHA 5F3WB 2HYIC 3DR3A 2K7ZA 3SIXA 4O4HA 1G98A 1R50A 1L6RA 5A4MS 3JQFC 3DTVA 5MDHA 5L53A 5C34B 2W2KB 3K6KA 3URMA 3GGPA 3KQUA 4A9AA 2V1XA 2VAVA 4L5IA 4L4ZA 3ACDA 4OHKA 5HKOA 1KE1A 4JJAA 1VSQA 4JQCA 1M2GA 5ALZA 3SJZA 3P9QA 4H3KB 4MLZA 3S7ZA 1IVNA 4AO7A 2BRUC 1JP7A 4IICA 3ZGZA 4DIBA 3IERA 1DL5A 1CD5A 2HJHA 1RAAA 4PANA 3VHXB 3BE4A 1BYIA 1JR6A 5JNVA 3UJ7A 1UEXC 5KQLA 5EJEA 4ALMA 2ZANA 3D8SA 1P6QA 3OT4A 5TEWA 3VZCA 2W2OA 4UBMA 2Y0PA 2R1TB 3RUAA 3SKXA 4J3NA 4Z1OA 3CZAA 4Y6PA 2VP9A 3PRYA 1YS9A 1FLAA 4G84A 3FOAA 1CEEA 2JLBA 3SC2A 4YK7A 1Z88A 3NTOA 4X71A 1R9MA 1USUA 2JBHA 4CM8B 4FR5A 3MMSA 3U56A 3EWSA 2HF7A 1XRSB 3OI7A 4ID9A 4O0MA 3TZQA 5HJEA 3VPBA 3JV7A 2C4NA 1TCCA 2BH2A 1UBFA 3TW8B 2I67A 4FOTA 4ZAWA 3OHPA 3L7CA 5KS2A 4TVOA 4Q39A 2RGXA 3GJTA 3WY9A 3A36A 5JJIA 1S4QA 1BVUA 2C07A 3TLMA 2JD1A 4ARIA 3I34X 3QBEA 1NXTA 4NKRA 2NXWA 3DOUA 4G8DA 3OETA 3UM9A 3U3OA 4WERA 1KR2A 4RV5A 1LBSA 1L4MA 1SVMA 1I1QB 2IOYA 3COYA 3KC2A 1DKUA 4GI2A 4HZUA 4WGFA 1Z12A 4FW8A 3SNKA 5PGMA 4A15A 2VDWA 5E1MA 1T6YA 2VTBB 3C4VA 2JIQA 2ZJ2A 3DNMA 2FZVA 4KQMA 2IS4A 3DOJA 2QZZA 1FDIA 2HSEA 1T8UA 4ZJUA 5LWQA 3HCDA 2X8JB 5DLQC 5IBRA 1E1MA 5DNWA 1ONOA 1Q19A 2CLMB 1UPUA 3V3KA 3ZWKA 5DM70 4MCIA 4D9CA 1D3AA 1JG6A 3CZ5A 4DLTA 4RZ2A 3TAXA 1KYXA 2V97A 1RYBA 1IRXA 4AYWA 5KQPA 1BN7A 5J63A 1HFKA 2NLOA 4D4KA 4QUIA 4D92A 1P7ZA 3L7JA 1CS4C 4L51A 4XJSA 1RTTA 5F76A 1OH8A 2H3EA 4LGCA 1MIHA 1HE1C 3I9KA 4HI0E 5GPBA 3MSCA 2PBFA 3C41J 4KAJA 2Q4TA 1WXWA 2BEKA 3OEHD 1WBBA 3QWHA 2QN6A 4JC5A 3EASA 4HB2A 2Y66A 1OZGA 4PPGA 4CPDA 5DN6D 5BUSA 1SCUA 3GK3A 2O59A 5JTUA 3K20A 4NP6A 3RROA 3B5JA 2ZUVA 3W2EA 1KEVA 4IUDS 1DUVG 4FHFA 4AJOA 1RRVA 3FIJA 3SIPA 4EBFA 2JA2A 2O5EA 2YX1A 3ZDZB 3CINA 3KPWA 4Q9AA 4YMWA 3RRMA 1X7WA 1U9CA 1P91A 2EZUA 2JFFA 5T41A 3T1NA 3TLXA 4B9AA 4EAAA 2YZMA 4F8EA 2D1SA 3IQGX 5E7IA 5BNFA 1J1IA 2O0LA 1IN7A 1QIHA 1ZMTA 1O6CA 1E0SA 2CNKA 2FFJA 3PNKA 4G5FA 1WF3A 3NM5A 4MRSA 1YUMA 3LKDA 2XYPA 3VHRA 1BN6A 4Z53A 4B83A 2I76A 4G86A 5E0KB 4EA7A 2WJVA 1G63A 2Y93A 6NULA 3A2LA 5AKLA 1MRNA 1RW4A 1OMOA 2P9GA 3EBOA 4PGFA 4FCCA 1UPTA 1YH3A 2ICAA 2P9QA 2QA5A 3MJVA 5LDHA 2X5JO 3HL4A 3EGWA 1YIAA 2JAWA 3UT5A 3NBFA 4LDZA 1O96A 5TXGA 1W36C 1MQ8B 1T5SA 2BF7A 4BRWA 1B6GA 2XCIA 2XUDA 4TMTA 3WBFA 3STHA 2JGRA 4MQBA 4AS1A 3H16A 1V6CA 1QH1B 1BFUA 1KGDA 3D59A 3X1DA 3R3VA 4FOLA 4MYSA 4OREX 3OZ7A 1RABA 3I30X 5AJUA 4ZU1X 4YV1A 4DXHA 2GD1O 3QTLA 1E1RD 1S2GA 4OB6A 3U7QB 4D8WA 3WICA 3OC0A 3G2JA 3IXLA 4DB2A 1MOZA 1PYDA 2JG3A 1U8XX 2B0CA 2ECQA 3S40A 1TM1E 3L02A 1MF7A 2G0AA 2IV7A 4DM7A 3U09A 4O2RA 1JR3A 1PVDA 1VLQA 2YQ5A 4DC9A 4DCNA 1DX9A 1KE2A 2FNAA 2VJMB 3NHLA 3DZBA 1WBJB 3PGA1 4WJKB 3QFFA 1HLGA 4OHOA 1B73A 2PGIA 1VDZA 4ARZA 4I0WB 1HE4A 4H7EA 2Q3MA 1V5GA 2FSVC 3SYNA 1W4RA 4F71A 5JS7A 1FFYA 1E3MA 3ETGA 1S2NA 4PTYA 4MR9A 1PQ4A 4C7BA 1VOTA 2O6HA 3RNLA