3OCXA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase mutant d66n complexed with 2'-amp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
b'EHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein E
publication title Recognition of nucleoside monophosphate substrates by Haemophilus influenzae class C acid phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 95
structure length 246
sequence length 246
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ocxA00
4C4RA 2ZBGA 1YMQA 4CE6A 3CNHA 3KZXA 2YMLA 3GYGA 4Y2JA 4Y2RA 5AW4A 5ALZA 2B1RA 2FUCA 2R8XA 5AI4A 3HYCA 3W5DA 4F71A 5AICA 5AVYA 3NASA 3I76A 1RLOA 5ALIA 1NRWA 2AH5A 2CN1A 4IFTA 4YIKA 3OPXA 5AVUA 3DAOA 1RMYA 3L0YA 2YY6A 3IRUA 3ZWKA 3E81A 1RDFA 5AK4A 3SKYA 4BKMA 3MN1A 1EK1A 4BBJA 3K1ZA 3PCTA 4UAUA 1LVHA 1CR6A 3NANA 1T5TA 3KC2A 4G9BA 3UMBA 2C8LA 2YBDA 3QUCA 5ALLA 2ZBEA 2B1QA 1EK2A 1RMTA 3KOOA 1JUDA 4DWOA 1J97A 1L7MA 1QH9A 5AVZA 1U7PA 1Z5GA 2GFHA 2OBBA 4UASA 2C8KA 2O9JA 1T9ZA 4Y2XA 2C9MA 2I7DA 5ALQA 1O08A 3ZI4A 3EF1A 5AM1A 1L7NA 2G07A 3SHQA 3N5KA 5A3SA 3ESRA 4UATA 3AR3A 4L6CA 2JAUA 2OM6A 4CF5A 1S2OA 1L6RA 2C88A 5AM3A 3L0CA 3RF6A 1ZOLA 3U7FB 2PR7A 3E8MA 3AR4A 4EX7A 2IOFA 2BDUA 2Q4TA 5AM5A 5A3RA 2IOFK 1Z4QA 3M9LA 1QQ5A 4Y2QA 3FZQA 1TJ5A 2RB5A 3QX7A 2OA0A 1Z5UA 4YIHA 1U2TA 5ALDA 5AHXA 2YN4A 4UMVA 2B82A 3EF0A 1AQ6A 5AVWA 1CQZA 4XE5A 4UM7A 2WF9A 1U2SA 3QLEA 4HGOA 4KYTA 2P9JA 3PDWA 1L7PA 2HSZA 5ALSA 3TLMA 4YCNA 3QU9A 3VAYA 5ALRA 3NRJA 5E0OA 3A3YA 4DW8A 3WGUA 2ZXEA 3ZU6A 2CFRA 5ALVA 3ZVMA 4XPZA 2FPSA 4Y2TA 3BA6A 2YMMA 2G80A 4NABA 3PGLA 4O8CA 3WKEA 3WGVA 2HEGA 3I28A 3MC1A 1RPZA 5ALEA 5A3QA 2B8JA 3E84A 3MPOA 4MUMA 3B8EA 3ZX4A 1VFPA 3R4CA 4E88A 4BYGA 4I9FA 3SD7A 3WK8A 4BNDA 5AW5A 3QU4A 4KX3A 5AKYA 4MWOA 4NWIA 1RKUA 1YNSA 3KBBA 4QJBA 1RKQA 3FM9A 2HF7A 2MSNA 3NALA 4UU0A 2GHQA 3I1YA 3U7HB 4NV0A 2ZOSA 1KYTA 2C4NA 3L8EA 4OFZA 2FPWA 5ALTA 1WVIA 3A1DA 4GIBA 5JJBA 3L5KA 2D2VA 4C4SA 3KDPA 3IJ5A 5AKHA 2P11A 1Z4OA 2HOQA 2W43A 4Y2VA 2I33A 2G06A 3UMGA 3DDHA 5AW2A 3A1CA 3WK7A 4NAVA 1WR8A 3AR7A 2EARA 4HGNA 3CZ4A 1TE2A 5ALKA 2AMYA 1QQ6A 1RMQA 2EAUA 4JDPA 5AK3A 1YS9A 5IS2A 4OHFA 1MH9A 4HGRA 5ALUA 3QGMA 1RLTA 3U26A 3QUBA 1PW5A 1RQLA 3R9KA 2P69A 1ZD2P 3N28A 1ZJJA 2W4MA 3NAMA 4Y2UA 3UMCA 1K1EA 2JAWA 4ZEXA 2R8YA 3SKXA 3ZVNA 3IB6A 2O2XA 3EWIA 4ZEWA 5AKXA 3W5BA 2YMQA 1FEZA 1YDFA 1Z4KA 1L7OA 5AKIA 1N9KA 5ALNA 3EPRA 4L6AA 2VKQA 3L1UA 2FI1A 4HAIA 4Y2YA 5AVVA 2AUTA 2JARA 5AKJA 5IT4A 1XPJA 1NF2A 4FE3A 1SWVA 5AKZA 3U7GA 2QYHA 3L7YA 3B9RA 1VJ5A 3AR5A 2ZBFA 3ET4A 4L57A 2FDRA 2YJ4A 4G63A 3L1VA 4HYTA 3PGVA 5AW6A 4EEKA 3N8GA 2G08A 4UM5A 1TJ4A 4CNQA 1RLMA 4KX5A 1U02A 4OD0A 5AESA 5AKEA 2R8EA 2WF7A 5AK6A 3QUTA 4XOUA 3WK5A 3ZTWA 2B30A 5AK5A 1Y8AA 3U13A 5AW0A 3L8GA 2FPRA 3N1UA 5AI5A 4AS2A 4GXTA 5AVRA 3AR9A 3FGOA 3OCZA 3P96A 2YMPA 1XVIA 4YGYA 3RFUA 4JB3A 1RRCA 1SWWA 1VJRA 4RESA 2HCFA 3OCVA 1TJ3A 2RARA 2MU1A 3F9RA 4KNVA 4UW9A 4I9GA 5AM2A 4IG4A 1F5SA 4EZEA 4UMFA 5ALFA 4EENA 3NUQA 3L8HA 3QU2A 3ZUPA 2RBKA 3OCYA 4FFDA 2I54A 1YJ5A 5ALOA 3FPSA 2HF2A 4YCMA 2FPUA 3L8FA 3U19A 2YFYA 1LTQA 2GMWA 2HHLA 3UM9A 3I6BA 2YJ5A 4UARA 1NNLA 3ONNA 5ALGA 3WK6A 1Q92A 4UAVA 2DQSA 2ZBDA 4KNWA 4J2TA 2HX1A 2I6XA 2I34A 4BEWA 2HDOA 5AW8A 1Z4PX 4XQ0A 3SMVA 4AP9A 1L8OA 3QXGA 5ALHA 3ZW7A 1YV9A 2ZG6A 1ZD5A 2WF6A 2CFTA 1IWOA 4H1WA 3FPBA 2JAOA 4KN8A 3WKBA 5AW3A 4OCZA 3W5CA 5AKGA 1L8LA 1Z4JA 1TA0A 2W11A 5AI8A 5ALXA 4UMEA 2WF8A 2X4DA 2FEAA 5AVXA 3U7EB 5AI6A 4BX2A 2YJ6A 3ESQA 3L0BA 5IT0A 1T5SA 3ED5A 2NO4A 1J8DA 1U7OA 2WFAA 1Q91A 2CFSA 2G09A 2GHTA 2OYCA 5AW9A 4HGQA 3M1YA 3R09A 1XP5A 2G0AA 1S8OA 4NFLA 1RKVA 2IYEA 1QQ7A 5AKKA 3QU5A 2IA5A 1Z4IA 5AIAA 3NIWA 2B8EA 5ALYA 2GO7A 1N8NA 3OCXA 1QYIA 3KD3A 2AGVA 4YCLA 2ODAA 3ET5A 2B0CA 5AM0A 5AVQA 3WKDA 2HI0A 2I55A 2IOHA 2EATA 3E58A 3WK9A 5AKLA 1ZD4A 2PKEA 2FPXA 2QLTA 4F72A 1O03A 5AM4A 5AVSA 3QU7A 4HGPA 4AS3A 3AR2A 2Q4RA 3ZWDA 5ALWA 2YJ3A 2P27A 3A1EA 1SU4A 1ZD3A 2BY4A 3D6JA 3WK4A 4YH1A 1Z4LA 4QQFA 1X42A 4UU1A 4ZEVA 1Z4MA 4BX3A 5AW1A 3QYPA 4CF3A 1Z4NA 4PNHA 4BEVA 2Q5EA 1RC8A 3OTQA 4Y3UA 2WHEA 2NO5A 3QUQA 5AVTA 2FUEA 2R8ZA 3B9BA 1ZRNA 3AR8A 2RAVA 3HLTA 3AR6A 2HO4A 4Y2PA 5AW7A 3FVVA 4C4TA 2JGAA 4UMDA 5AI9A 5ALMA 3OCWA 3ZVLA 4DCCA 2BDEA 3SLRA 4EX6A 3J7TA 5AIBA 3ZTYA 4J03A 3MMZA 2G1AA 5FP0A 1WPGA 3BWVA 1RQNA 3W5AA 4BX0A 4Y2SA 4RETA 4FYPA 3S6JA 1WZCA 1ZS9A 3QNMA 5T41A 5AI0A 3OCUA 2WM8A 3N07A 3DNPA 3SF0A 3WKAA 5ALJA 3ZX5A 4CF4A 1ZRMA 4DFDA 1Z88A 5ALPA 3WKCA 4BNDB 2WF5A 4EELA 2PQ0A 2NYVA 3DV9A 4B6JA
chains in the Genus database with same CATH superfamily
4NAUA 5JYEA 3ML1A 3DTVD 1X1EA 3FZYA 1LRLA 1QE0A 3GUCA 1E3WA 4U7HA 5FPSA 3ZLTA 1QFYA 3K5IA 1PR3A 2H0RA 5KTYA 1WO8A 3UK7A 5AW4A 5C8DA 1FXSA 4B83A 4TV9A 1XELA 5CXUA 5AVYA 3I76A 3C6YA 3IBTA 3T94A 1BCSB 5IKMA 4MARA 2OFXA 1H6DA 2QX4A 4HEA1 2PJUA 3RSSA 4FGZA 1T8UA 4URZR 2X5NA 2Q3DA 3B1FA 3G2PA 4MA5A 5TMPA 2PUDA 3H9BA 2G8NA 3F67A 4CT0A 1GD1O 1KEUA 3JZDA 4ES6A 5BW4A 5F98A 3GGCA 2SKEA 3HDHA 5KTRA 3S8YA 3UG6A 5DN6D 3VZCA 3PCTA 3BWMA 5DHPA 1Q6ZA 8ABPA 1M1NB 2JVIA 5HIAA 1HRKA 3KC2A 4A7PA 2CMGA 4PZDA 3DE0X 5DLEA 3N2IA 4O1MA 2IP4A 1IMOA 2H5IA 2Y05A 5EJ5A 3KZNA 2WWYA 1GVNB 3HUDA 4IIVA 4TWIA 4BGUA 5IJ0B 2WTEA 4F7DA 2VWGA 4G81A 4Y9DA 1GG2A 1UXOA 1UWLA 5JPCA 2G70A 3L4KA 1P18A 2VRWA 1Y3HA 1R6DA 2UZ1B 2DHEA 2KSQA 3EAGA 4MRMA 1ND5A 4E11A 2PYIA 3R23A 1G5FA 3BMOA 4UOZA 1EJ2A 3OFND 5CIYA 1QH1B 3WICA 1O08A 1QZTA 1T3ZA 1P2DA 3ENNA 3GAMA 4HLNA 3AESA 3PXXA 2PVPA 4IHJA 3CVVA 2RJOA 1A96A 1IVYA 3EGDA 3GX1A 2XUGA 3SHQA 1J23A 2R3SA 4IO1A 5JZSA 4YCCA 5K01A 5I7UA 4LYYA 3BH6A 1U2EA 2XYHA 1EGMB 4FONA 3ZWAA 2I03A 4G5XA 5FJJA 3IT2A 2VPIA 1WMDA 3QW2A 4ZVRA 4ZVQA 1R0LA 2I2CA 4EO9A 5HVNA 4ZO6A 4RZ2A 4LBYA 2VZ0A 1BMFA 4NENA 1UBOS 3IEMA 4DSTA 1L1RA 4OYYA 3DUFA 2UV8A 5EZ6B 2G76A 5BVGB 4HAYA 3V32A 5JOQA 3GCZA 5BN5B 4J49A 3RHFA 5DYGA 3VFDA 3ZI0A 1NP7A 4QOHA 1OFUX 3GK3A 3QP9A 4WXRA 3EIOA 3KXKA 4TYWA 4JP3A 3UOWA 2I3GA 4KQEA 4W1SA 5KNBA 1G8AA 5JMTA 2DH6A 4MZDA 2WU8A 3ZJTA 1Z4QA 3HYSA 2O8NA 3WIDA 1OGIA 2GJ4A 3EX7C 1QUFA 4ZJZA 1F4LA 2Q21A 1TKAA 4M1MA 1X1RA 1Z34A 3M9XA 4RS4A 4DBLE 4MVJM 2BEVA 3OEWA 7REQA 3WGYA 2JAHA 2AG0A 1E9VA 4BB5A 2VBIA 3GT7A 4J3FA 2NVUA 1Z6ZA 5A9RA 3RYIA 2ZRJA 4K3VA 1OU4A 1GPKA 4YMSA 2FWAA 5DF1A 1QO7A 4F93B 3OIVA 2MSKA 3Q3GE 1SOAA 2WAYA 2QAGB 1DXOA 3IHTA 2WY2D 5TEWA 4C0SA 2L82A 1Q1BA 2Z3VA 3F7MA 1L4YA 1YHYA 4ND3A 4YCBA 3KJNA 3I0NA 3VU0A 4K9PA 5E0OA 1CY8A 5DZSA 3G9XA 5JY1A 4U2KA 3FRHA 3GLIE 4PPGA 4QECA 5GIOE 2B5WA 2P9TA 5CBPA 3BGWA 1IN5A 4E5KA 2ACEA 4OLFA 5H9WA 2ZUSA 1K5PA 3OQ1A 2Y2UA 3I30X 4X94A 3ADBA 2HRCA 5P8WA 3UENA 5FPQA 4GHWA 1FP7A 2ZSJA 1FJHA 5L3ZA 3X2EA 4L51A 3OAAA 4CR8A 4YUAA 3HVIA 1F7UA 1VKHA 1Y34E 5HIMA 5JAHA 1DMSA 2ZB3A 5EZYA 1TYEB 1RE1A 2Z3WA 1Y6RA 1MX1A 1CEYA 3FWNA 1IB6A 3FTFA 3R9WA 1W87A 3IMEA 1DBRA 1JXAA 3DL2A 1J70A 2GN4A 1V4VA 3OJWA 4L02A 2FN3A 1SQ6A 3DE1X 3KHTA 3NTQA 2FZEA 1D2GA 3W3AA 1C14A 4HAUA 4MWOA 3CLKA 2JJYA 1RKUA 4UULA 4TZTA 3QV2A 4ATNA 4CWAA 2VAVA 3NV9A 5KYWB 4YLYA 3MWYW 3UOGA 3D4PA 4HFJA 2R11A 4UOEA 3FM9A 4TVOA 5TLSA 1GPLA 3ANMA 3GRYA 1NVUQ 3NALA 4UU0A 1PKEA 1I14A 4CMHA 3ANSA 4BZZA 5FWXA 2C83A 1XJ5A 4OIMA 4BEJA 2EFEB 1E5VA 1YZ3A 2CKDA 5L6MB 3EA0A 1KKMA 1WSWA 3B6JA 3EUWA 2SNIE 2GBPA 2RHOA 3KB2A 4OFXA 1QK4A 1GYRA 1SRRA 2A59A 1N57A 2FMHA 3C3CA 3FGNA 1KJJA 5CHEA 2CMFA 5EUMA 3MOIA 2XYRA 3PHLA 3FWHA 1RI2A 3BHJA 4DMRA 2WMNB 1ESZA 3G2MA 5FHQA 2WQ6A 1WHTA 1BCRB 2WT8A 1Q1AA 3HV2A 2P2NA 1TECE 2V3WA 3R77A 4Q9NA 5FTMA 1FNCA 3NT4A 4MKGA 4E13A 3GL9A 3CUSA 1R0CA 1F6BA 4PLYA 3FNIA 3O75A 4CLRB 2C99A 1NBMD 5G53C 1UXJA 3BBLA 3BTVA 5KOJA 2EAUA 4LCBA 4JUCA 3U3DA 5HBRA 5TPZD 2BTQB 3N8KA 4NZPA 2Z2KA 3ZHRA 1UK9A 4JUBA 5IS2A 2RH4A 1UPCA 3T3GA 3VA7A 3CEAA 3KETA 2AMLA 4FFOA 2WK1A 1RZRA 3U26A 3CUWA 1DP4A 1QSGA 1YR9A 3UVEA 2EG5A 3TDKA 1KEEB 2WHPB 3AVXA 1NR5A 2FEKA 4YDQA 2DETA 3QEMA 1C7ZA 2BDTA 1OZ0A 3TQSA 3EW7A 2UXBB 5FHRA 4CTKA 2BFFB 3Q11A 5GWXA 2XYPA 2OFFA 3P32A 3TAXA 3KR9A 5F5XA 2WWVD 4CKXA 2QMEA 5D6OA 2V5UA 3V8NA 3PHCA 5D87A 3SR3A 5K20A 2IEGA 1RM3A 1T34A 1NJ8A 1PR4A 2LIVA 4KYVA 2QU8A 3G1UA 3LQRA 4QOJA 4S1VA 3SXJA 4DZZA 2JLVA 3HJUA 1PR1A 2P41A 4ME6A 1G5HA 1RM4A 3ETJA 4CL3A 4U7DA 1WVGA 3NATA 3AX6A 3WLLA 2WZBA 1MO3A 3J81A 1CP3A 3M3HA 3PHHA 4P54A 5AKJA 5LQNA 2WWIA 6PFKA 1XPJA 2WI8A 2ZIEA 1HMPA 4AZWA 4PFQA 1NPTO 1P0IA 4KGZA 1LBTA 3IILA 4DXHA 4MUBA 5E9JA 2O2HA 4HDKA 4D96A 5JR3A 2CV1A 3HLKA 3I9MA 4TYYA 3V1KA 3OZCA 3GY0A 4PCAA 1PQ4A 4BNVA 2QTGA 4UBMA 5AJUA 1L8AA 4HS9A 5CU7A 3JU3A 3DTNA 1ID8A 2XD4A 3C3WA 1CU1A 1AK2A 4F46A 2YXEA 3EB9A 1Y4UA 1WS6A 1A77A 4MKZA 4CKCB 5IULC 2ZBUA 3U7QB 3OEEA 4Q82A 1SXQA 3T35A 1ZU5A 3AEKA 1KJ8A 3SQNA 3L0PA 4QSHA 2MWMA 4M49A 1DBIA 1GKUB 3O5AA 4N65A 5COAA 4G4SO 5AW6A 2ZSEA 1R8QA 4LPKA 5FA8A 4ZYVA 4N3CA 4KN5A 1ZR4A 5B6JA 5GZ6A 4QU8A 4EL0A 3TG2A 3V80A 2DSTA 3EAQA 3AEXA 4LC9A 2NPFA 3Q9LA 5JRZA 4G0XA 4DM4A 4Z99A 3EGXA 3U4MA 4E7PA 1K2VN 4NARA 2C78A 1IJKA 4OQYA 4AY4A 3K9GA 3DDOA 3DT6A 3ROTA 2WU3A 3P0HA 4DMFA 1G60A 4KI0A 3TZHA 3WWOA 3ZBQA 2PRZA 2D6FA 4A8HA 1KJQA 3FGOA 4NP6A 1TF2A 3FHCB 4DLAA 3U48A 2CZGA 2VXCA 1QE5A 1Z2NX 2VP0A 2Q0XA 1R0XA 4IO0A 1M8KA 5EE0A 2VJPA 3KTOA 5JXJA 5GZ3A 4HFMA 1BWQA 2HIAA 3MFQA 3OIUA 2IXTA 4FDTA 1HA3A 2OPHA 4R01A 1A5TA 2IZ0A 2W5UA 4J0HA 4HQRA 4A0GA 5DW3A 1J24A 5I45A 3ISVA 4MKRA 1REQB 3K16A 5DBIA 3SSOA 3NHFA 2WB2A 4ZTZB 3D6AA 2W48A 1U0EA 2XDQB 4K9NA 1Z07A 1ZLXA 2J09A 3FTQA 2NYRA 3O31A 3KQSA 3MAGA 1IJFA 3NKVA 4HH1A 3NIBA 4ZI7F 2GGSA 3E1KA 3KSUA 4XSHA 3LDAA 2ZUEA 3LUGA 2CJWA 2CYCA 5GVSA 1TLFA 3JWIA 2X0NA 2I62A 4K1XA 4TRNA 1CRWG 5TMDA 1SVMA 3D6TB 3R4VA 1E8DA 3I6BA 1OHHD 4WT7A 1Q0RA 1YCFA 3HEAA 4IZOA 3VM6A 1J99A 5BYKA 2DLDA 3C1OA 2O50A 2XXAB 4EVRA 2FMTA 5FAKA 3KXIA 1NNLA 3M5WA 2OENG 5BNFA 1CP2A 2GN8A 4FR2A 4IIJF 1NC3A 3P97A 3G0IA 2A8YA 2DQSA 3QVLA 4AUMA 4LHSA 1E3QA 1ML4A 1XLVA 4OXXA 5C81A 2EL9A 2E85A 5SYAA 1EM6A 4LF9B 2DKFA 3GJSA 2PU5A 1E2UA 3KWJA 4PS0A 1T1RA 4RJLA 4DJFC 5KREA 3MQ2A 1CXZA 1XJWA 3O1JC 2WJHA 1JVSA 2O8EA 4ESVA 4GRDA 1BN6A 3T4EA 4P8RA 2A78A 4QPPA 4UBIA 4C78A 2O8DB 3QVKA 4HNTA 1WUTA 4A8JC 4C5BA 3VI4B 4ANFA 1ENYA 1L8OA 3D31A 2JLWA 2GM3A 4AMBA 4D99A 1VP3A 3K9QO 1T0UA 2QZZA 5C8YA 3GVXA 1JSXA 2QN6A 4EVIA 5HUHA 2W4IA 1IWOA 3GLUA 2HZBA 4FBGA 1B3RA 1BFKA 3KZCA 5DT2A 4CLOA 2H1OA 1UJ6A 3WQQA 3AJAA 3ZCTA 1CZKA 1VCIA 2PBZA 2BHNA 3FKQA 1JFVA 2I4RA 5E0KB 3KOWA 3TZCA 1OB2A 5D7BA 4FNAA 2XUAA 1C0LA 1WUYA 5E95A 1XTPA 4GPD1 4DTCA 4F2HA 3IDFA 5ITSA 2WILA 1D04A 2ZRLA 4MUNA 2VSFA 1P5RA 1XRNA 5EOVA 4AJJA 1MTOA 5FNVF 5LJLA 2X1VA 2VCHA 1QLWA 3LNCA 3O8BA 4MJ7A 2I3BA 4R8LA 1Z6TA 1ZM9A 2G28A 3HJBA 2DVMA 3T9CA 5F4BA 5A5EA 2NTJA 1FZTA 1YRWA 1YUBA 1ZRSA 4Z4FA 4BEBA 3S29A 2PY6A 4GICA 5CB4B 2OVFA 4W4TA 2LUOA 1H0HA 3E9ZA 3OU2A 4IF6A 4CTNA 2HYDA 2GZHA 1RPTA 1ETHA 3V7YA 3N2EA 4TXNA 1IRXA 2CK3A 4X1KA 2NUAB 4RAQA 3N58A 4GYKA 4RORA 4YT2A 5HUQA 3AZQA 4R2LA 1HTTA 3RYHA 1LI7A 1WSBA 3FCAA 5JS2A 3WZLA 2ZR0A 2QRMA 4GQBA 3PYLA 5C34B 3ECCA 4L75A 3ILHA 4RZ3A 4EL5A 3KUUA 4MUJA 3LUPA 3OT1A 5EPOA 4JP8A 2YW9A 5CXXA 3T7IA 5IF9A 3VQTA 4HH0A 2FQXA 4HHEA 1CK4A 1PL6A 1E9EA 3RU7A 4DR5B 3Q1LA 2KWIA 4UBNA 2AE2A 5I9SA 4CMIA 1SC4A 5F77A 5K2OA 4G1MB 1XTQA 2QT9A 4IJWA 4MB0A 3D0OA 1H4QA 2HI0A 2I55A 1DAPA 4YUWA 1W49A 3TIGA 3UAGA 1JZQA 3X44A 4IY1A 1A0OA 1U3DA 1Z08A 2JG3A 4NR0A 1TM7E 3PIDA 4JIGA 4C89A 3FPAA 4HGPA 4QNNA 4IR7A 4K05A 5CJPA 2EGHA 1WF6A 3A26A 2HMUA 3WTCA 5K8JB 2C58A 3BXGA 4DKXA 3T15A 2WFZA 4TVBA 3GP3A 1NX9A 1X87A 3KBOA 3ABSB 1Y80A 2O0HA 2VC2B 2XVXA 5E38A 3RVQA 3NEYA 1RVDA 3LXUX 3SZRA 3GLGE 4N5HX 1MO6A 1KTVA 5EERA 3JVUA 2HJGA 1T0BA 2HTFA 4PWYA 3WLTA 4J75A 4E4YA 2HLPA 3M81A 2G9UA 2HA2A 4BV9A 1ZK1A 4ILEA 5DGDA 3CH6A 2NUTA 1T4BA 3QXXA 2ZEJA 4GNKA 4QL3A 2ZYSA 1TZMA 3P94A 4PGHA 4MINA 4PICA 4PYLA 4RE5A 3W5HA 5A0TA 1AQIA 1X1QA 1JQ5A 1M1ZA 1YZYA 1U31A 3B9BA 4I7EA 5BOVA 2ZETA 3FVRA 1P7ZA 2QMYA 3CRMA 2V6GA 3BIJA 3IBFA 4Z3OA 5ELXA 4F6LA 4XUCA 4H31A 3OX2A 4O3FA 1I4EB 3FOEC 1TOAA 2D7JA 1ST3A 3AZPA 4PLCA 5KWSA 1K7XB 1R9NA 1W36C 2XNHA 2BLNA 3HDTA 3HADA 2FE1A 4RIFA 4LWPA 4EZIA 3SWWA 3IURA 4DNOA 2Z95A 3PDJA 4DLBA 4TRJA 3VH3A 3H83A 5A6SA 1Z2CA 2NU6A 4RIHA 2FQ1A 5K0NA 3T5CA 4JI2B 3HJTA 2WHYA 3ND9A 1DFIA 1XIVA 3QVVA 2GVDC 4LYDA 5CVJA 2O54A 3AIOA 2FW7A 3KSMA 2XLBA 4RD0A 3TX6A 5B36A 5JFTA 3UUEA 4W9NA 1ZS9A 2I6FA 1U8AA 2AI2A 4HJRA 1U5AA 1X80B 3KOXA 2AEMA 2TRSB 3Q6NA 4MW1A 1PZNA 5K5EA 3O8CA 3QE2A 2AKEA 4Z8XA 1B42A 2BH9A 4J07A 1GZHB 3X1MA 4CCYA 2WQ7A 2F1IA 2VNIA 2XR1A 4N54A 5MN4A 2B34A 4MMXB 4C30A 4BNDB 5IUJC 2GH1A 1EP3B 2PX8A 1QVVA 3JQFC 1W8DA 2PQ0A 2W6ZA 2XSZD 2ODWA 3FFXA 5PNTA 3DV9A 2H2WA 2HBZA 1TLLA 1F8UA 3OMLA 1Z5OA 1FZQA 1J0DA 3KQPA 4FNGA 4CIBA 2NSDA 4JQSA 1RABA 5JE8A 2C61A 5JISA 4RTJA 2FUCA 4DCPA 2P2SA 1E8MA 1K8YB 3OI7A 1CRQA 1X7YB 2IHUA 4CTMA 2VYFA 3AEUB 4N9WA 3DP7A 5D3MB 5J59A 3D8NA 2C7VA 2VHWA 3G8BA 5ESXA 4XWTA 4GDFA 4RELA 3IRVA 3KEFA 2R9VA 1XNQB 2PYZA 4WY2A 4MVCA 2AL7A 1ZY2A 1XQWA 2F1JA 2NAPA 4R2WA 2IOQA 3VTAA 3P2JA 4KLNA 1P1CA 4RA9B 8GPBA 4RPIA 5KVQA 5CFPA 1OI3A 1VSBA 3UV3A 1LVHA 3P9RA 5JAQA 4S12A 3HJRA 1HDZA 1MC1A 1QJ4A 4IJVA 4KXNA 3I5AA 5LQRA 3LPCA 4IIUA 4I1UA 1JN0A 4D8YA 3GPDG 1IOWA 1UJ2A 5IAOA 1I9CA 1UZAA 1PO7A 4UEWA 4B6QA 1C8BA 5LKRA 1AKUA 4MHOA 3LUJA 2DPHA 4I50F 4FYWA 1BMDA 4IIGA 4DJ5X 4HC4A 2Z5LA 1FPQA 4J8PA 2PV0A 1QBGA 3GP5A 3K9CA 3E2MA 3MA0A 3NHMA 3OH8A 4ZWNA 3UCFA 1X9IA 1UP7A 2ID4A 4X95A 1ZG3A 1TM1E 1KK1A 1T6ZA 1UBLS 2QQEA 2WA1A 4QXAA 1IFXA 2J4DA 4XXHA 4A73A 5H3LA 2CF5A 2EFJA 3OM1A 1WMFA 1FYFA 4I66A 5DX1A 4BUJA 3AR3A 4IXDA 1JPUA 5CCEA 1U4OA 1E3LA 1U7WA 3FPHA 4Q4HB 3GH1A 2WAMA 4BV8A 2IEIA 2UVPA 2ZVQX 3FI0A 4AZVA 2GD2A 4EYOA 2VDJA 4XJXA 3V9AA 3W2IA 3ZCUA 1IZYA 3EDMA 6CHYA 1CUCA 1P5JA 2G9QA 3PCRB 3VHRA 3VHLB 2H5JA 3UBMA 4RF2A 1UMCB 4UTOA 5HS4A 4BWYA 1JKJB 4ASUA 2WOOA 2ZPAA 4J4BA 1VRWA 3NRCA 2ZXFA 1GNSA 3G8AA 1Z38A 4ENTA 2O0JA 3O74A 2GEBA 4WQMA 5LYJA 4DJTA 2QTTA 2QUIA 3OICA 2ECOA 1FOEB 3NRBA 1Y5NA 2V54A 3N70A 3AFHA 4X8HA 4EF6A 2GI4A 3I53A 4CT5A 4LXXA 4HCJA 2CY0A 1YXMA 1LK7A 2HWXA 5DFAA 2YQ4A 4MUKA 1E1RD 4X5OA 5DEOA 3WL4A 1X8XA 3H2YA 4DRXB 5CDTA 5KX5F 1PR9A 1E1KA 1AO3A 2QYOA 2Y76A 4DJEC 1YMVA 5DOZA 2Z5VA 1YQ9A 1N5MA 3U39A 3Q0IA 2P9JA 2KQUA 1VSVA 4I4TF 1M6YA 4R3WA 3TI9A 1X1BA 1NVEA 3LWNA 3MWKA 4I5FA 1YONA 2HDNB 4N7RA 4Q1AA 4R2XA 4ZCLA 2WEKA 4AWXA 5A5VA 1NFQA 521PA 3VZSA 3DCIA 4U39A 1UEIA 3HCDA 4KWTA 2BR5A 1ZAYA 4MICA 1C1YA 2H7YA 5DLDA 2C97A 3CKLA 1Z73A 1BFDA 2OO5A 2PT5A 2DHRA 1IJBA 3SZMA 1LDEA 5CAEA 2JIZA 2V0CA 4A8PA 5J4YA 2R48A 4MHSA 1OXMA 4Q19A 3I4FA 1ZK0A 3MC1A 1BRTA 4RZHA 1FYVA 1Q7GA 4CQLA 1TCCA 4GM0A 4MEBA 1SUEA 5A3QA 6Q21A 5HQ3B 2VQDA 2I1QA 1NTOA 1KPGA 4WXPA 1VFPA 2EX1A 3ZUGA 3GLIA 1Y8CA 1FVFA 5KOYA 1AKRA 1IHPA 3L7MA 5H16A 4CMKA 2DY0A 3BJZA 2OCXA 4PBRA 4TS9A 5EXXA 2JEOA 3K0AA 4WKGA 4BUZA 3C6MA 4ND6A 4ZYTA 5HNKA 3F4KA 3L84A 4FYIA 2DX7A 5EQJB 1E92A 1QGUB 2B61A 4M1EA 4RLQA 1QWSA 4LZPA 4PGFA 4F97A 3ZQKA 1SEVA 3ELUA 1N33B 2W6JD 3AUKA 2ZP1A 1NDQA 2XECA 1KWGA 1U1CA 5CFRA 4QJBA 3QEKA 1NQUA 1NVKA 2D54A 2FLVA 1IAVA 3IUQA 1QONA 3HH8A 3B1JA 5E3HA 4O63O 4GGOA 1CYDA 2ECPA 4OFZA 2FG5A 3PITA 4YAKA 2CLDX 1JW9B 4FDMA 5B57C 4I8IA 2VJMB 3ICPA 4KDCA 4GIBA 4DQKA 4JJEA 4EKGA 3GHHA 3FY4A 5EUQB 2XMGA 2F8TA 5AKHA 3KKQA 2FEXA 4EEZA 3P8ZA 2OV1A 1WD7A 5CB8A 2Y0PA 5A9SB 3CNNA 3EMVA 3JALB 3R3XA 4LN1A 2GJ8A 4F1WA 2AI1A 2VDWB 4NAVA 2PTHA 4UE6A 4GECA 3UAVA 1GFWA 3DDSA 3CZ4A 2GYVA 4ED9A 2PLNA 1A97A 1ODLA 4N3AA 3DL7A 1SD1A 2AMYA 4PGAA 5JY6A 5K6RA 1ZISA 1T8YA 2DERA 4Y7CA 3IUBA 4DR1B 4GQIA 1I3MA 2EIXA 3UHAA 3K9NA 1DG9A 2BI4A 5JJIA 5ILOA 4PQYA 1Y7HA 1Q2XA 1IONA 3GLKA 3PEFA 3QKWA 4MZXA 3VI3B 5DI9A 5KKCA 1PW5A 1P4HA 3T5GA 2BI7A 3QV1A 4FYHA 1C9NA 3N8IA 4KE9A 5JS8A 4UQLA 2ZIXA 3PENA 3KZ1E 5FQNA 2MDTA 1K9VF 2O6LA 3I01A 2XUQA 3OLWA 4WUTA 3TEJA 1WL8A 3V3TA 3KDSE 5BQFA 3N2LA 4CM8B 2VYQA 4ZZIA 1EP9A 1FEZA 1MA0A 3MYRA 1TTQB 4PLHA 1MG0A 5JQGF 2PJRA 5BSFA 1NVDA 1IBSA 2HSGA 3KCNA 1N9KA 4O2AA 5EMJA 3P0EA 4JJ8A 4YRZA 2X0IA 4OGFA 2RH9B 1DJQA 1KAEA 2DBRA 1UQUA 1Z6YA 3GRRA 2YC2C 1RI1A 2WIAA 4EB0A 1T8WA 4FMCF 5L3RA 1WZ2A 4NYMQ 2NTEA 5JXHA 1ULTA 2QNBA 2ORIA 3WBKA 3IDOA 5IRCD 2DQYA 3U7GA 4JUFA 1VKNA 3KYDA 3BCUA 1UMBB 4I1IA 3U3RA 4ZJYA 3EVGA 4IZ6A 2YXPX 2BUAA 4Y8VA 4LZJA 1JI0A 3KR0A 5BYJA 3GUUA 5FUQA 2B7CA 2BGIA 3N6VA 5EWLA 2VXBA 2VYCA 1QKIA 2BJWA 3E7WA 3VUEA 1R6XA 1EFRD 2VYVD 2HFJA 1RJEA 5BSTA 4C6TB 1FYWA 4FCVA 4Q15A 3IPCA 5F2EA 3TIFA 1NDHA 4DILA 1I3NA 4X3CA 4E1AA 1E1YA 1Y7PA 1B15A 2VFAA 4L28A 4MQ6A 4RFVA 2I1VB 4DRYA 1V8BA 2H29A 2X8WA 3QTBA 4ITUA 1SC6A 4BKOA 3UH0A 3N8DA 4MGYR 3KJQA 4MIOA 4F8EA 2OUIA 1C7IA 1YU9A 3GPCA 4YRCA 3AEZA 5CLGA 1NMSA 4XOUA 3TFOA 1C1DA 2R7NA 4X6UA 4OUKX 3RVRA 3SU8A 3WZ2A 1T9AA 1WV0A 5LP6A 1EK6A 4RPLA 3L8GA 2PVCA 2WYOA 4FFBA 2RK3A 3TQOA 3HM9A 3SQDA 1LUAA 2J0UA 1D1QA 2VYNA 4P0QB 3CT4A 2YMPA 2RKWA 3A4YA 3I04M 3OUZA 5LZ2A 1V1MA 1NDUA 4UD2A 4YJGB 4RMGA 4A26A 3IQWA 4ZOLA 3PSAA 1XMVA 3O7MA 4GPBA 4ER7A 2I4LA 4MJLA 3B60A 3RADC 2GNOA 4TLBA 2VNHA 1JSCA 1C3OA 3BJMA 1A5ZA 3BQNB 1LDGA 2MU1A 1C29B 5DASA 1WPXA 3DHNA 4J6EA 3KLOA 5DO9A 3O92A 1OXBB 5EQDA 3Q5EA 4LCJA 3QPDA 5INTA 2IZ5A 2D3TA 3OZUA 3QH4A 1W48A 4CL0A 3OU7A 1SVLA 1U5BB 3RIMA 5FJIA 3TW4A 1I80A 5AXDA 1YWGO 4R2MA 3VNSA 4XGQA 3BJEA 3DBLB 7AT1A 3WA7A 1TD1A 3WSWA 1UF9A 2P2CA 1B8NA 1JHVA 1PT9A 1U65A 4JJIA 5H68A 5A4FS 1E1LA 4TQUS 4E5PA 3B6IA 2DBZA 2J32A 2EKQA 2GMWA 4OJNA 2E4WA 3JAWA 1U1GA 3QKUA 4IKEA 4OXKA 3UIEA 3UM9A 3K0CC 4RM3A 2PX6A 2QYTA 4BTEA 4IDAA 2XZLA 2C59A 4FZ5A 2O1XA 1W76A 5TVKA 2COEA 4WCFA 1Q92A 2RIPA 5EJ8A 1NXTA 3UJ6A 4FUTA 1U90A 3F90A 3N87A 3GW8A 2XDYA 4R9SA 3ZEAA 4JBIA 4LRWA 2QAJA 1RZUA 5GJCA 1YE8A 4C4TA 3DR3A 2PAFA 4X91A 5DX8A 2AQHA 1QANA 1Z5ZA 2NVBA 1UMDB 2JCSA 4IQ0A 5CTJA 4YUVA 2VP3A 4R1LA 3LX5A 4BEWA 4R5MA 5KWEA 1BH2A 1CUBA 1V96A 1XMJA 4W7IA 3U9LA 5C7OO 3EULA 4TT8A 2WWHA 5BV1A 1CUUA 4LDJA 2YOFA 4LBZA 2DKNA 2PZFA 5JNSA 1QYXA 2Q27A 3MB8A 3RU3A 4Y30A 3GZNA 1PX0A 4O0MA 2AE1A 2J9GA 4P36A 4F8YA 3COYA 2E55A 2JAOA 3K05A 2WM2A 2EWMA 5EI5A 4JI3B 1JEJA 5LQMA 3S8EA 2WTAA 1I0ZA 3YASA 5JAIA 1GZ3A 1M3SA 2XEXA 2XUKA 2WYHA 3CRVA 1C1XB 3U44A 2Y1EA 4ETMA 2DXIA 5LL6P 3D9QX 4ZVTA 3GT3A 5HRAA 1MB9A 1QZUA 4ZCMA 1P44A 1X7WA 2FEAA 1D2HA 4CCSA 2D5LA 1EX9A 3CO5A 4TWBA 2KJQA 1CS0B 2DQKA 2IZOA 5BSEA 3KHUA 3BS4A 3GEBA 2I1LA 2G9RA 2OQ2A 3OSUA 4XQEA 4E4RA 5H7XA 4G5RA 4A5SA 1DOZA 3R74A 1UH5A 4BWGA 3NNNA 3FUVA 1U7OA 1MQ8B 4GX5A 1ONNA 4XUEA 2VK1A 4R0NA 3BGSA 2QGNA 3KFLA 3OJEA 2BF7A 2KI5A 2EYQA 4NJEB 1VPLA 3KX2A 3I62A 1MNAA 4HNVA 4MUGA 3OZRA 4I4LA 4JCCA 3OEHD 4TX1A 2BBOA 4G0NA 4CGYA 3CLSC 2ALJA 3T3HA 1QPGA 4YJ3A 2HRRA 4C2UA 4MKFA 4RH1A 2EWVA 2NQ8A 3CLVA 3SZGA 1P61B 3LVRE 3OVMA 2JB9A 1BE0A 3OOJA 4Z7JA 1Y6QA 3IV6A 4QICA 1DPGA 3DFIA 1F12A 3FMVA 4RH3A 2BCJQ 3L8ZA 3KVOA 4WZBA 4A6XA 4KR7A 3LK6A 4OXRA 1XFAA 4QU0A 1P77A 3EUFA 3KJZA 1PLLA 1MB4A 2BMJA 3DGFC 5GINE 2YFKA 4PVDA 3JYLA 3MMNA 1P7WA 4ZCQA 1ENOA 1ID1A 1LLFA 3EXEA 2HXSA 3IVGA 4Q02A 4TS1A 1M0EA 1L5YA 1NIPA 1EGAA 2E89A 1FTYA 4H4DA 4KXQA 3B70A 2V4UA 4FKZA 3PD1A 1PTJC 2CUKA 2B6HA 2GF2A 2V7QD 1T2DA 1SU4A 1SHJA 3ACDA 4Y0AA 2SKCA 3SJBA 2YV4A 1YZVA 4DOMA 3LP5A 1I51A 2IDKA 4R2JA 4AIIA 3N6XA 2R6R1 5ENZA 2K7ZA 1WW3A 4DY6A 3IQEA 3UOAB 1WRBA 1X6VA 3B36A 4XAQA 3ZHYA 1ZGAA 2RHTA 2VH2A 4QBGB 3KZOA 4ARSA 2RMKA 2DUWA 1JB1A 4J0GA 3FRIA 3SFTA 3WNQA 4ZN6A 5AVTA 4CEJB 4RHUA 3DHYA 3W1EA 2X5KO 1EE1A 4MVJI 1PJ8A 1OMOA 2E4XA 3VISA 1C7QA 1Q14A 2E3JA 3AR8A 5F7JA 1M6HA 4Z9AA 1QCCA 1QXSA 3LT4A 2P9CA 3ZDEA 1JHYA 2FMXA 4AJHA 4MS3A 2I2WA 4QUDA 4RO0A 5GVRA 1DAMA 1T2EA 5KNLA 1JLKA 1DSSG 3UBTA 2AW3A 2AX4A 1SBZA 2O20A 1KE2A 2I76A 3FW1A 4C6SA 4P1ZA 3HWSA 4ZT6A 1WB9A 4BZQA 3WIUA 3WGIA 3B9QA 3T61A 4BFXA 3ZDXB 5HKLA 3EEFA 4Z4CA 3ESBA 1MHTA 1JSLA 1T2VA 3CUTA 3QF4B 4IGAA 4S24A 3RUDA 1YZUA 1V5FA 3T3IA 1I1OA 1X2EA 1WQ3A 1M2OB 4I8DA 4MR8B 3RWOA 2H8KA 4DLNA 2YNMD 2CSUA 1T8TA 2OG2A 2WLTA 1K6JA 3LJKA 4JJ6A 4NE7A 4KPYA 3N0TA 3GLGB 4FYMA 1U0TA 4WMLA 1P1KA 1CY7A 3T5MA 4FYJA 3TVYA 3UMYA 3K73O 1YJBA 1C7RA 3B6ZA 1P6UA 1J7KA 3C7CB 4OHWA 1TU3A 2QVZX 1FFBA 3L8YA 3ZXIA 2AFIE 4HPXB 4J4TA 1G2QA 4L5AA 4LSZA 4D81A 3NS7A 2H16A 3C7KA 4CG1A 2OAP1 3KJIA 1S6YA 4PE5B 3CIFA 3QBEA 1PSDA 4WN9A 4AU1A 1EFKA 1O9BA 2B3DA 1U2PA 3IUYA 1HX7A 3WB0A 4OX9Y 1YRLA 1JU3A 2J3HA 1U99A 2JLZA 3EXIA 2WP0A 5BW5A 1G66A 1H4VB 1SXPA 3INNA 1E6UA 2ZUUA 3OKCA 5ALZA 1Q0HA 4EKIA 1V7PC 1ZD8A 5AJXA 5BMVB 4EJ2A 4MMZB 1ZN2A 3LXXA 2GBCA 1CUYA 2GPSA 2Z08A 1L7QA 4R7TA 1QHIA 2HWYA 1JHZA 4XGRA 5K0JA 5JH7B 2QI9C 4C7JA 5TT1A 4C14A 3PXAA 3L0YA 3T9DA 5CVTA 4U2CA 3ZU4A 1N0WA 2ENWA 4LECA 1EPUA 1U1DA 1X70A 1BEZA 1CR0A 5AK4A 3ACCA 4MI1A 2F3SA 3RF7A 1RJFA 4YCDA 2Z6QA 3H8SA 4P4UA 3ROFA 1QF6A 2DWOA 3CONA 2JHFA 5EC8A 2ZI5A 2WDPA 4W8GA 4YAFA 4DREA 4C06A 1B2RA 2HT1A 3HCWA 2PGDA 3GUVA 2PNJA 1UDAA 1XJQA 4WY8A 2C2GA 1Y42X 3MRSA 1E58A 2XY4A 5DGIA 2Q2QA 3RKUA 5BMOA 4ZAXA 1J9ZA 3KHSA 1A3CA 4RNDB 4GBJA 3I05A 4CW7A 4EHIA 3GLHE 5AXAA 1A95A 3W6PA 1U7PA 5BSUA 3I5XA 1PDOA 3KT8A 3F5FA 3AFIA 4PO1A 2PZ8A 3K1JA 1G20E 5TF0A 5JC8A 2ZYAA 1T4CA 1H6BA 4MVYA 1JA9A 4IF4A 4NH4A 1JHMA 1M10A 4M54A 1FFHA 3DZIA 4P7BA 1BDJA 3I73A 4IIEA 1ZITA 5BWBA 2E5LB 5DDIP 2B4AA 2IXDA 3N5KA 2CVOA 3ESRA 4GD3Q 4FYKA 1P80A 5EJFA 5GM2A 4P83A 1OLUA 1X7XB 2O3SA 4ZYXA 4RDIA 3PICA 2AQIA 3TSAA 3BERA 3LO5A 4C20A 1NMXA 2CJFA 5AJWA 4DUYB 2ZB4A 1LCIA 1FFWA 1P1JA 3F2VA 5C1PA 4Q1DA 1PYGA 1UEXC 2C98A 4EY7A 5D3QA 3AY0A 3P45A 2OYSA 4JVOA 4P7JA 3RUCA 1GRNA 4HQKA 4TYMA 3AR4A 4LBVA 3BTOA 1XZAA 3WIEA 4E5NA 4C7OA 2WU4A 3H5VA 4JYPA 2FP4B 3LX8A 1D6JA 1WF3A 1ZICA 4IVPA 3VJLA 4BFSA 3FMPB 3KO8A 4QRDA 1K27A 1QHFA 2RONA 3GXOA 1E9SA 4QLOA 1TZJA 2AZTA 3I4LA 2ZTMA 2JGDA 3AKDA 2V4MA 1P6XA 4N0PA 3E6AA 5JJCA 2VP4A 2O07A 1KOFA 5CCBA 4NJOA 2YN4A 3A4LA 2B82A 3C8HA 3EAFA 2QD4A 3K32A 2IHTA 3OZEA 4MI3A 1J49A 1OAOA 1JSRA 3NBUA 1TJYA 2WTBA 1UCFA 2GILA 4QNMA 3PTAA 1KSGA 2NXJA 4AKGA 2J7PA 1QRUA 4C9BA 5LOVA 1O58A 3I6ZA 3P9NA 1YO6A 3PC7A 3WMGA 4GUDA 1AUXA 1EUCA 1UM9A 2FW1A 3EFEA 3AF4A 5JEDA 3P9KA 1CFZA 2Q1YA 4AX4A 4CU2A 5JS6A 4XX0A 1M2VA 2FPSA 3DH0A 3BWEA 4FTWA 4PLGA 2CE2X 1AC5A 2CLEB 3CF0A 3E3LA 3RC7A 1SG0A 4C22A 4IIBA 4WNIA 4NK5A 2J45A 2Y92A 4K9SA 2DCMA 1KYIA 4EJ6A 3ILXA 3I2GA 1KJYA 2LCIA 4TV8A 3B2EA 1KEVA 1QX4A 4UU8A 4TZ0A 2IS2A 1FDSA 2FOIA 5AOVA 2FY8A 3E82A 5KTKA 3D7LA 1LLUA 2CL7X 2G4VA 2X76A 1KJIA 2IYNA 3CH5A 1LDBA 2C2XA 5FKJA 3TUZC 4Y1FA 4A6PA 4D9HA 2ODEA 4FLFA 4EQ6B 6ADHA 4D9MA 1B0PA 3SX2A 1FS6A 4AG5A 3EVBA 1Z45A 1RTTA 1NBHA 2ZBPA 4PS1A 1R0YA 1SHLA 3QOYA 2QXYA 3D7MA 2NU7B 3OTIA 1FDTA 2HF7A 2REOA 3DBVO 2PMCA 3IDZA 1HXHA 4MYTA 1O3YA 2A1TS 4Q9HA 4H9GA 4KOEC 2CNLA 5LBTA 1SXGA 3GC6A 2GNPA 3W8RA 2MSDB 3NVKI 4OKIA 5FADA 1GN8A 2FTKE 3IQIX 3NXKA 3PUZA 5EWJA 3TR0A 2QMOA 2FMFA 4YRSA 3A1DA 3HYLA 1QDLB 2NU8A 3BIWA 3AFGA 1IDOA 1T4MA 1UP6A 4M9SA 4RVUA 3IJEB 1QM5A 3AV3A 1AHHA 1ZH0A 4ZAWA 5F51A 4YMGA 4GM4A 2JRCA 1EFPA 1JLMA 2D59A 4G65A 2ZTVA 4KXLA 1WUHS 3UMGA 3DE4X 1K5GA 4HFRA 1RIIA 4F3NA 1JX6A 1SHTX 2V6BA 1O97D 4PZ9A 3RBVA 1D9ZA 3LUBA 2YZKA 4L1KA 5I7OA 1PJRA 3UAYA 4UCQA 1Z7EA 3SSNA 1WUKS 3VNRA 4HG2A 1ZX1A 5DCLA 2XX3A 4B4OA 1JDBB 5JYDA 1KK2A 1C9MA 4QYMA 2W9XA 4CLEA 1YFLA 3UB4A 1PJCA 4QO7A 4B3BA 1UXIA 3L1JA 1ZIPA 3Q9SA 3GJ6A 3GVIA 3OZXA 3F0TA 1OH7A 4AO8A 1RYEA 4O4LA 5B1YA 1K1EA 1OT5A 4PYIA 1BU5A 2ZPTX 1JKXA 3IB6A 2EP5A 3K8QA 1H42A 3C4QA 2I7XA 1VLHA 3I2JA 3KUCA 1PR6A 2FVXA 2JEYA 1OF1A 3O0TA 1NONA 1NI5A 1VE3A 4JVNA 4S1WA 1SHUX 4ZP1A 4RL6A 2C92A 5CDYA 1QRTA 3Q3HA 4LZAA 5FNZA 2OWDA 4LOAA 4B5KA 4E94A 3R9XB 2WJGA 4EKDA 1HE8B 1DQSA 1JL3A 3S55A 3U16A 2C3MA 4UFPA 1U11A 2V6MA 2H1VA 3UKDA 3H8JA 1AZLA 5KEIA 2DT8A 3LDHA 4TWAA 4WFKA 4XM1A 2R8BA 2WINI 3DB2A 3HZHA 1FFXA 2JFFA 1FPMA 3N2NA 3CRZA 2BMVA 2RHHA 4TKMA 1ZH4A 4UTXA 1J2EA 5CA1F 5AKZA 3PNQA 2YJTD 4EY5A 3IE2A 2XRYA 1O5OA 2JBWA 4XD7D 3M6UA 1KBQA 2PBRA 3OTWA 1DC3A 4OK5A 1SUFA 4P0PB 4BO4A 4E3WA 2ZBFA 2WT9A 4EHBA 1E9RA 4S3MA 1SUBA 3STVA 1GM5A 3KHKA 1GGEA 4L57A 2PO5A 3EGWA 4LVOA 2DU8A 4B7XA 2GM5A 1DKOA 4CI9A 2GAJA 4G63A 4EUNA 1TMOA 5HKAA 1X15A 3PWSA 1GAEO 3NETA 4WCDA 3N8GA 3Q8WA 2VH5R 1ISSA 4L8LA 5FCDA 4DE5A 1VIDA 5SY4A 5E4FA 2IKQA 1PNRA 1DTSA 2IIVA 3IOMA 3ND6A 3WK5A 4WUVA 3UATA 1COWD 3C7AA 3FPEA 4DT1A 4BP1A 4RK6A 3CKKA 1VHDA 1JT9A 1ZD9A 2HQBA 3U4IA 3KVNA 3SZUA 5KYXB 1Q2UA 4HN9A 5DW0A 9LDBA 5LD2C 3JQ8B 1NXWA 4YGYA 2EJTA 4N5MA 5FWYB 3QG5A 1QV6A 3UY4A 2VSNA 3VPAA 2QBYB 2VVTA 3OO1A 1N5DA 1BO6A 2C7BA 3JQBA 4RXUA 1D9XA 1F2TA 2HCFA 3EFOA 4YLGA 4E5UA 1KVRA 3FMFA 4BN4A 2HV8A 2RARA 3IAEA 4OO3A 4MI9A 3TSCA 4BTVA 2PGAA 3TQQA 1PX2A 3KU4A 2W90A 1EYZA 2CDAA 4ZAVA 3A14A 3WGGA 4I4IA 4MUEA 3RIEA 3JQ7A 5EXPA 1N92A 2YASA 4W9MC 5E2IA 2H4YA 2LXNA 3T3PB 1SVIA 3IT3A 4KW7A 5REQA 1WUIS 1XXLA 2XMSA 4UVHA 1KP3A 2A57A 1ES9A 1Y4ZA 2AOVA 2R7KA 1C80A 1JEYA 1X2BA 3LW7A 1NR7A 2OKGA 4N49A 4NHEA 4FFDA 4EW3A 3UPUA 1ZIYA 2XCRB 1FUYB 3BZUA 3UKJA 2HPAA 3L1KA 4J4HA 3BQ9A 3V55A 1TEVA 2WUGA 3G5AA 4Q3DA 5LFAA 4H3KB 3A2LA 2M6KA 5KTTA 3EQ7A 5IZ4A 1JDZA 1V8ZA 1G6OA 1J39A 1LDYA 3ONNA 4LJ5A 4MMYB 1FDVA 2W00A 3T3EA 1UBJS 4MVJD 3TUJC 2O7VA 3ADCA 3ZHXA 3TRFA 1U0NA 3R3HA 5LMCA 1ZBDA 3LK7A 2QRHA 4ZZ2A 3R3YA 4RDHA 2EL7A 3RKRA 4AMGA 4CJXA 4A15A 3WMEA 2O4CA 2NU9A 1HDIA 2IDJA 1XF9A 2AC2A 2CXQA 5DCWA 1XHLA 3B3FA 4C87A 1Y4SA 1W2HA 1SA0B 3ZKWB 4Y0VA 1V0JA 3C3MA 1GNPA 3TB4A 2JGLA 1CE8A 1SXJB 3V8PA 4ZALA 3R44A 4BU0A 4XJSA 4A91A 2HMYB 3L6EA 3EXFB 5IBRA 4IIYA 5J43A 1AGPA 1E3WB 3I9NA 3T99A 2VUIB 5T8KA 2FW9A 1THGA 1T26A 3RYFA 4M98A 1QHYA 1EVIA 1ZIXA 2W11A 1PWZA 4Z54A 4TV9B 4WXEA 1NY5A 3A4MA 1LBIA 4HMOA 1M33A 2HU5A 4ONEA 5A02A 1USUA 4PO3X 4UMEA 3WWEA 2EGGA 3RV4A 4EI9A 1G59A 1PJ2A 2J0QA 2QTWB 2ZQZA 3TLJA 5G0SA 3LY7A 3SXUA 4JL5A 3T9AA 1XDZA 2AF4C 5JJLA 1KY3A 4M0KA 3GGJA 4N5NA 3K6SA 3HU1A 4DJAA 2VDQB 1L3BA 3GLRA 2JLCA 3LUFA 3PBKA 3W3AH 1S8OA 3MQ4A 4EUKA 2AT1A 2HT6A 3DYIA 4OYHA 3A10A 4EGSA 4MITA 4HDOB 5FUBA 1Z0IA 1YACA 3P2IA 5BQ5A 5FR2A 3AZOA 3Q8LA 1KI6A 3BBPA 3RJ9A 2C29D 3BFPA 4B6RA 4F56A 4MRMB 5H0IA 3SX0A 4TKZA 4IQ8A 3VR5A 4NCHA 2F43A 2J31A 2ZRQA 3BB1A 2IUUA 4ODIA 2ZJAA 1NYQA 2W6MA 4L5BA 4Q6BA 1SOMA 4ZK2A 1FC0A 5LKAA 5MN6A 3JAKA 2PGNA 4XUDA 3CE6A 4IHJB 3AESB 1A2BA 4M87A 1I3KA 5IHXA 1SBCA 4NATA 1PV4A 2BFMA 3EGDB 3ENKA 3HXLA 5EZSA 1Q6YA 3U1TA 4CM6A 3I1FA 2REQA 3N2KB 4IUDS 3R7NA 2AVDA 2CHQA 4HH4A 3K20A 1WX1A 3EDOA 1S1CA 3RRYA 5IX8A 2FPXA 4KK3A 2Q5OA 1OXXK 3RI3A 1H85A 1XPRA 1FMTA 1FMJA 1XE3A 1QC5A 3ZXSA 4KR2A 1WU7A 2IYOA 1Q22A 4M37A 1YB6A 1U3TA 1T13A 2YFQA 3G13A 3OLYA 4AJOA 4CLHA 2PNFA 3ELDA 1I0IA 2G6BA 1GWNA 1KVSA 4KQMA 1O94A 4DNXA 5G1NA 4YH1A 3CSSA 1GUAA 1TM4E 1A7JA 2O2JA 5BUSA 5CP8A 2BFCB 4EDHA 5B58C 4GWKA 2QJWA 1E2FA 4CHGA 4ZCTA 2EX0A 3PRJA 3OE7D 2JI8A 5K51A 4H7HA 2V7WA 3D7RA 3KVVA 2M6LA 3ITKA 3AL2A 3ZIAD 4IEEA 1HY3A 4U9IS 3EZYA 1M1YA 3ETGA 5AP9A 4F6RB 3A6FA 1AQLA 4KFCA 1WCWA 1YZHA 7REQB 1SVKA 4YUZA 2GPBA 3TH5A 3VYTB 1SOVA 3QPUA 2NVUB 4RMNA 2VBFA 4GPTA 1T1JA 3AR6A 1QIDA 5EP2A 4JX9A 1JWBB 1L4FA 4FXPA 4MQUA 4Y9UA 1B26A 2PA0A 3RODA 4J1TC 1C41A 1UIRA 3H5AA 4BL5A 4Q1FA 4EI2A 3NC4A 2A67A 2WWTA 3WLRA 4EH1A 1U1FA 3TIVA 4K28A 1FXUA 1YKGA 2PL3A 3A27A 3KQMA 4RD6A 2BFNA 3GT4A 4F86A 1LV7A 1QF7A 3H04A 1NMEA 2ONZA 4U7JA 2OTCA 4M0UA 1WPGA 4AZTA 1DUSA 2BGRA 4BPBA 2GD0A 2OXFA 4E51A 3O3NB 4GMHA 2CLKB 4QRHA 5G02A 1N2GA 3UHPA 1CERA 4TTTS 1D0IA 2W58A 2X3YA 3S1SA 2ZI4A 3WNVA 1N4DA 4BJ1A 1K5DA 2DPXA 2J0EA 3Q8KA 3R3VA 1FTQA 2R65A 1MUUA 4FMBB 4EMUA 3HHEA 4GT1A 1SXIA 3AY6A 2PUBA 2Z8YM 4I55F 2RDMA 4CM3A 1RAIA 4AZSA 1DRVA 3D2BA 5IDVA 2XA9A 1PQUA 5EIBD 2J5BA 2QSYA 3HXKA 2BFAA 4K5QA 1TC1A 2EQAA 3ZWYA 4LXGA 3VV3A 4PLWA 5ALPA 4KTVE 1QU2A 1Z68A 3M1AA 1KZ4A 4U63A 2W2MA 4LRQA 5JXWA 2CNWA 3HA7A 2XUHA 1P60A 1HMYA 3CSUA 1E20A 1RP1A 3TSWA 1NLMA 3UCEA 4LY6A 3JQAB 3H3JA 4E2ZA 4CTOA 3K3PA 5GAJA 4PLFA 3R6DA 1XU7A 2JANA 2B4KA 3O4IA 5AI4A 4PN3A 2WFLA 2AFIA 2BMFA 3QKIA 2ZUVA 4YV7A 1QMPA 2CDCA 3KE8A 1V5IA 1SUPA 3Q40A 4L2IA 4OSOA 5JMWA 5GADl 3DPUA 1AD2A 3AOEC 3QPCA 3PJEA 4JVMA 5AVUA 1KL7A 1TIPA 3AKCA 5AVKA 3UJNA 4DCVA 2IS4A 2EC5A 5EXSA 1Y8RA 2FUG6 3B1ZA 3RUFA 3FFTA 2J41A 3PX2A 1Q7BA 3SKYA 1WHTB 1YCGA 3BWYA 4H17A 1CV2A 4R3UC 4RZIA 4TL6A 1XEXA 4UPVA 2A33A 2OLEA 4OYRA 5SYMA 3CVXA 2P4SA 3CJQA 4RVNA 1IUOA 4D4GA 4TVSA 5KOJB 3A0UA 5JJ5A 5F9HA 4KLCA 4RZQA 5K03A 2EBFX 3NQ41 4BDTA 1JUDA 1YR2A 3A1TA 4TMKA 4JB8A 3I6IA 1Z3IX 4G0YA 3MINB 3H05A 3ABOB 2GF9A 3OZ7A 4ENVA 1PZXA 2ZYUX 3SGLA 5KTMA 1DEOA 4XIFA 3ZDDA 3GBVA 3OIGA 4U6QA 4JN6B 4J16A 3L40A 1ZW1A 3KB1A 1RE0A 4LSMA 3FGZA 3ND5A 2H17A 3L6BA 1R10A 2IIQA 4KFUA 4CEIB 1L7NA 1OXKB 1Z15A 1V1RA 5K3SA 3BKXA 5HYVA 2YJGA 1PG0A 1ONSA 3GLHA 1AURA 4MP6A 4B7ZA 4HP8A 1EWVA 5K0CA 1XZGA 1G20A 2VAWA 3BGVA 2H1LA 3KJHA 2N1MA 3GRCA 4NK4A 1YQQA 1TO1E 4GR4A 1CIPA 4IGFA 4KQKA 5DXJA 3RK0A 4EVSA 1DJLA 2FRDA 3FOFC 2XQKA 3MJCA 1ESCA 1XFDA 4C0KA 3EQ6A 3IA2A 2VF8A 2Y1DA 4MS4B 5ESWA 2ZPUA 3Q5GA 2NZJA 2NN3C 4HDKB 2IWHA 1HE2A 1L8XA 2LCFA 2V5AA 3B6KA 3BG5A 3EK2A 3W05A 2HGZA 3R9IA 3OE4A 2OWEA 3LIPA 5TXGA 4J0QA 3OZAA 4PXAA 2DBQA 4RABA 3EVCA 1Y1TA 3NTXA 3ZY6A 1CUEA 4YB8A 2NOAA 1CS4C 1A9SA 2GZ3A 4YCJA 3GUHA 3K92A 4K0RA 4B6OA 3DS8A 1A82A 1G7CA 3VPFA 3C43A 3KCQA 3EGOA 4JWKA 1QYRA 3SJAA 4EVQA 1DV1A 4IDHA 3ROMA 3KYIB 4UZFA 1L5OA 3T5PA 4W5HA 4QUEA 2GHRA 4GLOA 4RMHA 3N0VA 2IX3A 1NLYA 4HGOA 3A9CA 2WZQA 2VHEA 1JQEA 2BOVA 3PDWA 5F33A 2OECA 1SKAA 4I19A 4OHRA 2LWIA 4E21A 3I9JA 1N0VC 4CMGA 1UPFA 4YP9A 2NUPB 1Q83A 2JFZA 2W6OA 4GUAA 4DCMA 3HSKA 1P81A 2IZ7A 3WFJA 2ZRCA 1QFSA 2B36A 3WL6A 5B3JC 2XGSA 4X6LA 3NTVA 1JLHA 1H3FA 3A31A 2I4TA 3DTVA 3MZ0A 4Y67A 3NKLA 2BGTA 3DZGA 3M4XA 1YDMA 3PQEA 3RREA 2VLIA 2EQBA 3CBQA 4HSEA 4LQLA 3ZE0B 2BFOA 5F7OA 4JFAA 1DQNA 3GFBA 2EKZA 2VCEA 4BV3A 5IEJA 3IOYA 4EABA 1GGJA 1BIFA 2L2QA 3N74A 2RI1A 1NE2A 1L4BA 3FDZB 4QOFA 4U2EA 3DNFA 5EKDA 4NJMB 3V2UA 2IBTA 1Q16A 1E5DA 1ORHA 4MW7A 5IM4A 1N1MA 2Q4EA 4TTJA 5DN6A 1T5OA 2HBYA 1ARZA 4OGWA 5AJVB 4JEUA 1F2UA 1TYZA 3T1OA 4AWBA 1LW7A 2EF1A 4HLUC 5BSHA 4AY2A 3TTSA 4LNHA 1J9GA 2GK7A 3AL3A 1UC8A 3RH0A 2ZJZA 4US2R 2P9QA 2Y27A 1QPZA 4B76A 1JR3E 4QZVA 4IQ4A 5G3YA 3OOYA 5IYZA 2MJLA 3UH1A 4A4DA 1K68A 4F0JA 1RAAA 1IG3A 3FI9A 1DQPA 2ZAMA 3QF7A 1Z33A 2J46A 4UNSA 5HF9A 3L5OA 2PWPA 1WR8A 3OFNA 2E9SA 2O8EB 1XKLA 2V9CA 2VIIA 3CG0A 1JFSA 1E6CA 4ZCPA 2F48A 2XF8A 2EBHX 1VMKA 2BBTA 3BWDD 3VH2A 3KQOA 1K4YA 2GPAA 1OZFA 1XPOA 3KSAC 2J4FA 4PSUA 1N25A 5ITWA 2HPZA 3NH9A 1YZNA 1KDPA 1GUDA 1GCUA 1S9HA 3PFHA 1DCKA 4P81A 4BNMA 1L7DA 3D1JA 1ZJJA 3WLIA 5KNCD 4RW0A 1JHAA 3OQVA 4W5NA 5DM4A 3SOZA 4U3JA 1E9AA 4Z9BA 4MRRA 2DQZA 5K0GA 4EG4A 2FA9A 2O2XA 5SZJA 4DMHA 1EUDB 1WKBA 2D62A 5E1MA 2YMQA 3I32A 5ABPA 4OLJA 2GK6A 3F3KA 2WR8A 2C20A 1K0UA 1LPOA 5LIPA 2FSFA 4R1PA 4UOQA 5HF6A 1OBCA 4GOXA 3HKDB 4JEMA 3G23A 1KO4A 4RZUA 1O9GA 1ZJ6A 5CDUA 2OG1A 3X2FA 3EW9A 3O6VA 2KE5A 1NVGA 1V5WA 1UKBA 4B3SB 1YNOA 1P5HA 4BUCA 1LSUA 2BN4A 3IP6A 1E2KA 1Q15A 2X41A 3T0FA 1GQQA 1MJHA 4FN5A 4QDXA 5ELLA 1Y1LA 1IBCA 1E0SA 1RRMA 3WRYC 4KIUA 2Q07A 3U5TA 1IOZA 2QYHA 1KQFA 5BR8B 1GSOA 2PCJA 3LHIA 2QDKA 5LNK6 1GG8A 2Y1FA 1M75A 3QWFA 5C4MA 3PNVA 3BRWD 3L1HA 4R7ZA 3ZIDA 5I6DA 3HXQA 3TN7A 1I7PA 3QELA 1QZZA 3NT5A 5EVJA 3KG2A 421PA 4OMFG 1M73E 1TF5A 1XZLA 4C0HA 3UAZA 4E7OA 5CDGA 3ZHSA 4M8NE 5J4KA 2FPPB 4Q3OA 3VJMA 1U04A 2EJUA 4MAAA 3GU3A 3H4VA 4Z3KA 5ICSA 4TM8A 2G08A 2H5LA 4I1OA 3ILVA 1QOPB 2BUCA 3EEYA 3ZV3A 4Z5XA 1D2CA 2HA5A 1M34A 1QPBA 2HU7A 2GEKA 1RXVA 1IM8A 2GLXA 2R8EA 5FL7A 2ODNA 2GEFA 1HZZA 3SQXA 2DOKA 1QYWA 2WYVA 5AK6A 3V34A 1OH5A 3IA7A 3HWRA 3PE6A 3IHLA 1NULA 1PS9A 4WW0A 3UG7A 4OI0A 1HE3A 1XPUA 1K4MA 2GBLC 1EUZA 3ZZTA 1G98A 3P20A 1I2CA 2AYZA 4YP0A 4IDDA 1Y6GA 4DMLA 4EJSA 1JIXA 2WA2A 5J2TB 1WKVA 1L0BA 2XNSA 4X6XA 2X8BA 2GCOA 2VNAA 1DWQA 2ECKA 3D4IA 4MLZA 5K3BA 1MEEA 3P9QA 3ROQA 4F5WA 4CIYA 1TVEA 3UJ3X 2NUTB 1ZK2A 1PV1A 3KUXA 4REQB 4AXBA 5TQ0A 1E4VA 4QM7A 3H65A 1QO9A 4PY2A 3MJRA 4CL8A 4LKRA 2QK4A 3AF2A 4X44A 5IKOA 1CUHA 2RE8A 5LA6F 3V1MA 4EGAA 2GKSA 5FNVA 4GWGA 4OQNA 3Q0EA 3NUQA 2CNDA 2BFBA 4M0CA 3A9RA 3O90A 3W5IA 1RFGE 4D8UA 3IR6A 3FB1A 4IGEA 1MB3A 3AP3A 5J63A 1JEQA 1N4AA 1SCNE 3PB3A 4BWFB 5EJAA 2R5WA 4B0PA 3M5PA 2I6QA 2BM0A 2JATA 1U2ZA 4NBTA 1NBMA 1DG1G 2YFYA 3ZY5A 4LGYA 4BNYA 3QHPA 1BC5A 3QVOA 5IAJA 2Z5FA 5TPZA 3GXBA 1F4PA 3U3OA 4J94A 3LPMA 3DO5A 5A05A 5A6SB 4B1FA 1V16A 5KKNB 4PHGA 3HUEA 2VHJA 4F85A 5KUTA 2BKEA 1D1PA 5EKUA 2D0DA 2JASA 5E8RA 5JRJA 2PGLA 4JOBA 4YNBA 4ZO9A 1SY7A 4Z4GA 1G41A 1MX9A 1YVRA 4HNSA 1KHHA 3ISTA 4QE3A 3GMTA 3VJKA 5LU9A 4KDRA 3UHOA 1M0TA 2PDAA 5CVCA 4DUZB 2GWRA 1DTWB 4N48A 4J7XA 7ABPA 2B4QA 5KYKA 3G7UA 1UWVA 3OZTA 4CCYB 4D3ZA 1L6IA 4XWKA 2GQ0A 3GUZA 3L06A 3C3YA 1C2YA 1G3UA 2QXTA 3AYXB 4AJEA 5B2ZA 5EN4A 1ABBA 1JIUA 4FFVA 2CHFA 4DC0A 1WEHA 4DR3B 1I24A 1WXWA 2LD4A 2P5TB 2QN2A 1AQJA 4A2CA 1E1CA 5KQPA 4CMJA 2R00C 4I5DA 5E8JA 4O4JF 2FUNB 4YBRA 4P32A 1YZGA 4NFYA 4UBOA 1GNRA 3AIIA 4WESB 5I3ZA 4GX1A 2VJLA 4QDTA 3DQZA 2QVCA 4E2WA 5JZBA 4G0ZA 4DCNA 1P7CA 1GZDA 4OKNA 1A9YA 2CXSA 5KWIA 3MLBA 2C4KA 1VJ0A 1YSCA 3TQFA 3E61A 3ESQA 1R8XA 1R0BA 4W5WA 3EVNA 5LLDA 1UBCA 1Z39A 4ZT7A 1IB0A 1OWPA 3L02A 2D13A 1T25A 1W35A 5F76A 2BRUC 3VYWA 1J8DA 1JTFA 4CEHA 1XALA 1XN1A 2E6KA 4NZYA 4URYR 4YAGA 1JYFA 4BECA 4WLOA 1HFKA 3F5MA 2V7PA 1F8YA 2Y99A 3U40A 2XCLA 2O19A 3K53A 2AMFA 3QWIA 1YQXA 4HBGA 1RYFA 3RG8A 4BJ6A 3ELBA 1G4HA 1LSSA 4LYAA 4MLDA 1OE0A 4Q5IA 5AMXA 3RU9A 1GZ5A 2ZI3A 2FEWB 1WCYA 3AVPA 1S2LA 2RHRA 1C4KA 3L0ZA 4BB6A 1R6TA 1N6OA 3OJFA 4YR9A 2H00A 3N39C 4Z7QB 1W36B 1QYIA 4WVLA 2VCYA 1OA1A 3CVOA 1HTWA 1HNZB 3LLCA 1BYUA 2RBGA 3STYA 4ZKDA 1FE8A 1R8JA 3ZIUA 5BWOA 3DYBA 4LISA 2XQFA 4WKBA 4U7TB 4G0VA 4BOYA 2RK6A 1RJWA 4IX1A 5KWJA 4AKHA 1R74A 4MP3A 5IHPA 3L7DA 5IVDA 2C7QA 4OLAA 1MX5A 1ZIOA 2FJUA 5AKLA 1ZD4A 4ZHQA 4KO1S 4RSMA 3CNLA 1GGFA 3TXAA 4YALA 3K6JA 3NHBA 2CC2A 3D02A 2X4LA 4G9GA 1T0PA 1U8YA 3DC7A 1L9XA 3GLFE 3TOZA 1L1QA 3GDOA 2J7KA 2PUJA 4JB0A 4RTKA 1XT6A 3TOSA 3CZCA 4RXMA 5CFQA 2ZI7A 3NAGA 2BISA 1OBVA 3D5TA 5LYJB 3WLMA 2QG6A 4PZLA 2ANCA 4X00A 4X93A 4I6GA 1QIJA 1MOQA 1QFJA 2WHEA 4A9AA 3LT0A 2F2TA 4MW9A 1WP4A 3ENZA 1YOVA 3COSA 2BEWB 4TQAA 5CLIA 4NOMA 1P74A 2G36A 3ZCRA 2VJDA 3Q98A 4ID9A 2FOXA 4Y2PA 2V8BA 4AKTA 2NXWA 3NHYA 1W9MA 4PCLA 1LBHA 4AG6A 1G0NA 1LRJA 2QSZA 2MSWA 2BKAA 2QGFA 2JH8A 1M2KA 3LQ1A 5AI9A 2GTIA 4G5YA 1CR2A 5ALMA 2RGWA 4K40A 4DCCA 3J7TA 1NUTA 3VBCA 4EATA 3GJQA 4WE3A 1H69A 1P73A 4GBMA 4IOJA 5CLHA 4L9AA 5BWMA 3W9YA 3BH0A 4LRUA 3SK0A 4DMGA 4JV5B 1VI5A 3CURA 5NLLA 1W0KD 2AS0A 2ZITA 5I9BA 3TD2A 1M0SA 1X8JA 3S68A 3MQFA 2VTKA 1M2EA 3S2SA 3KZVA 2X2FA 3GMIA 4D56A 1V43A 4GMKA 3FHTA 5L3QB 4GMGA 3DC2A 1Y9EA 1N5RA 3IMKA 3K1AA 4EY4A 2GAAA 3OOHA 2W2QA 4KUGA 1CD5A 4DB2A 4AL4A 3L7OA 3WGTA 4D4MA 4B7AA 3Q10A 4M9QA 3S1LA 3VVBA 1Z8DA 3HU2A 4IOKA 5DGCA 3USZA 3O2JA 4Q4JA 5C80A 1D03A 3CEMA 2GRAA 4XYMA 3E9YA 1ZMOA 3L9XA 2SCUB 3I8SA 4UEQA 1Q0PA 3M1LA 4NX2A 3HKEA 4HVTA 1YD7A 2OKCA 3IT0A 2RFLA 3NGMA 4HDNB 4NE9A 4YJHA 3SX4A 4ZJUA 4H0NA 2PS9A 1A8IA 1A2KC 3M34A 3NBZC 4ZANA 4AXXA 3E9QA 4P53A 2B5VA 1XRJA 4DDWA 1C2TA 1H3EA 2C4WA 3V9PA 2GXQA 3EEQA 4U02A 5KJEA 2PSHA 4DAEA 1NRWA 1DEKA 4CKYA 4CM7A 4LX0A 5JCJD 2CV0A 4K8RB 3TMKA 2FDXA 4UAGA 4O1HA 4F11A 4TLAA 1CDDA 3I92A 4GEKA 4HEQA 2JD1A 4CI0B 4MQFA 2GCEA 4AJLA 4BLQA 4XOIA 1L5NA 5TEVA 3DZFA 3NP9A 2JFWA 4DG9A 3QMVA 3OZBA 1BOOA 4RIGA 4V3CA 1VKOA 2PXCA 3RTDA 4WNAB 4UM9D 4WCVA 1BFUA 3HUTA 1SKQA 4DCSA 2Q8NA 1QUEA 4PO9A 2Y8EA 4CR6A 1CB0A 1TU0A 1X13A 1ZSYA 1GQOA 2B1QA 2VJCA 3DFZA 3VC1A 4KQWA 3IAM1 1G18A 1OZGA 3O03A 4LS3A 4X6YA 2BVNA 1L1EA 5EZYF 2C04A 1KVUA 1U6JA 3L7AA 2OBXA 2GS9A 3GFQA 1JEEA 3OWHA 4I4TA 3PFGA 3CU5A 1W2GA 3M8KA 4K1LA 3F8WA 4PC3A 4WA7A 3QIVA 4M1KA 3KEMA 2R68A 4IKPA 1JFTA 2ZRNA 3N0WA 3WYAA 4H27A 3HNPA 3VSEA 4JU9A 2QRVB 1NR1A 4E31A 3Q3CA 3EGVA 3PNPA 2I22A 1RYYA 1KJ9A 3CINA 1TYAE 1G17A 2XE7A 4M7WA 4O2AB 1N3BA 1NVVQ 4LC0A 2BL4A 4IDBA 2AMVA 3RUHA 1RP7A 1L7EA 2EVWX 2ETVA 2JDID 3AERA 3ZU3A 1RYDA 3EZ7A 4O2RA 2BT4A 3CPEA 4FHGA 1A9PA 1MZVA 3JSAA 4NYJR 4PLVA 4F38A 3ZDAA 1UJNA 2J3JA 2OT3B 3CR8A 4EPYA 5J2UF 4D6PA 4LSGA 2YHIB 4GZMA 2HUPA 2Q3FA 3GRFA 4DIEA 1WETA 3JPYA 4WASA 1EA7A 4EX7A 1KO8A 3EF3A 1F4VA 2P0EA 1EJ6A 5BYAA 1MPTA 4JBHA 2CD9A 4M0FA 4L8WB 2HNBA 3GFVA 1CT9A 1GCGA 5AK0A 1VIYA 4DVJA 4TN5A 1NVFA 1MVLA 1V11B 1L4MA 3FYUC 4RTPA 1T0JB 3DDCA 1KDOA 5JECA 1O8BA 3W4IA 1NW4A 1RJDA 2QN8A 3KOUA 2DWCA 1EVEA 5F23A 2ZRKA 1VRCA 3LXRA 4AUEA 3EOBI 3OZGA 4ZICA 1C30B 2O0KA 4QUJA 1C5KA 1FX0B 1G3IA 1QO0D 1G7TA 1K08A 5T5QA 1ZOIA 3T5DA 5JC1A 4M86A 3H5IA 1M1XB 2XMCA 4XVCA 1NW8A 5GTDA 2VTBA 3BZBA 4NNOA 4DV1B 3DBOB 5EUBA 4CETA 2XB2A 5FEMA 4G0UA 2JLAA 2WSMA 4RPCA 1WHSB 3HR8A 1S2IA 1SG9A 1C1DB 3RWBA 2PSJA 3FA2A 3A3YA 3JR7A 2VUUA 1OX4A 2XSZA 3CF6R 3TLYA 3ZU6A 3ZVMA 1BWRA 4Y2TA 4F4IA 3VVCA 1TMYA 2GJAA 4V24A 1P91A 1U0OC 4G0OA 1QOQB 2J0UB 1ISRA 1WBJB 4MYUA 4RYDA 3SMQA 2H2IA 4PX2A 3MTDA 3V2GA 4G24A 2QJRA 3AGPA 4KE7A 2V65A 1S2DA 4MUMA 1JTVA 1LJLA 1NN0A 2CFOA 5B6PA 5T4FA 1QGZA 4BYGA 5KCMA 3MXTA 1II9A 1AS2A 2EOAA 2WUWE 3QUAA 4WLEA 3SD7A 4HDSA 1JH8A 4AJ9A 1E9FA 5IASA 1TU4A 1XD2A 1JFLA 1VZ2A 2XCSB 4OHKA 2ATEA 5JXGA 1NBIA 3PT9A 1Z22A 1PE0A 4R2HA 3NONA 1POXA 3OD1A 3OECA 1II8B 5DSXA 3GRKA 4MO2A 4GYJA 4B2PA 1YJCA 2PKRA 3GGDA 4L78A 3AHIA 3OTHA 4F6CA 1UP4A 2FZ5A 2IKSA 3DLBA 2IYPA 3BULA 3U7HB 5IKXA 4NV0A 3LSYA 4YV0A 3MILA 3UKOA 2VPQA 3G0OA 3JAWB 1YIOA 1GGHA 1PBTA 1N2CA 2PLWA 3WRXA 4KNYA 4A82A 1RYHA 3RFFA 5BSMA 1CQWA 4EO4A 2G4CA 4OGGA 2W0MA 1EE2A 1XQ1A 3W79A 3HUUA 3KDPA 5EQTA 5LIRA 1YHZA 4U5XA 2GPYA 1XVAA 2HK9A 4ZODA 1GTG1 1SCQA 1T9KA 1YR3A 2JLQA 1NYLA 3R0ZA 4PPYA 4R40A 2MYNA 5CM9C 5HCUA 1SN7A 4RS3A 2G5CA 3QVXA 1E4YA 4U8HA 3UWOA 5HMMA 3KPVA 4CMEA 1BXGA 1RQPA 3NUZA 4P4TA 2D1TA 3ZVRA 1J0CA 4IXTA 1B6TA 5DP2A 4HQOA 4BATA 2VOJA 1G55A 2MOKA 3GJTA 3QGMA 1MU0A 4YJKA 1NN5A 1IULA 5BN4B 2JLXA 2P69A 1E0DA 2QD5A 1OQAA 4EPXA 4LZZA 5FBLB 4Y9TA 1OCEA 2PQ6A 2JAWA 4F7WA 1YA8A 1PEKE 1ZXXA 2R8YA 3ZVNA 1NBWB 4N3BA 1JFFB 2C2OA 2MTBA 2POCA 4BAGA 2P6NA 1ODTC 1EX1A 1QGYA 2HRZA 4JHLA 3OWOA 1SBHA 3UF0A 1ZA1A 3M6AA 3UT6A 5JSZA 5F2OA 4KXFB 3AM5A 4W8OA 3TRDA 1A2OA 2IT1A 2O14A 1RLJA 4HL6A 3CGGA 5BO5A 1THZA 2XCTB 2A0XA 1EFAA 4YPVA 5HQJA 5DI3B 3HCCA 1RKXA 2QR5A 3HYNA 1NFFA 1Z06A 4RIIA 3BB4A 4WBSA 1GTSA 2ODTX 1E3EA 5F3DA 1Z0DA 2AUTA 2LBPA 2V3VA 4KGXA 5KAMA 1E1RA 5DM0A 4DLSA 5C1DA 2XKBA 3PFKA 3SF8A 3MTAA 3QLTA 1C3LA 1NF2A 4G4SP 5JPIA 4A5OA 3VU8A 3WLQA 2JAQA 2YWEA 2D8MA 3QXJA 1GU7A 3BX1A 4PZUA 4N3NA 4EB6B 4WBXC 4YJ3B 3WLEA 3LO8A 3HL0A 1Y9ZA 2FVYA 5GGYA 1XUOA 5JZMA 2VHCA 1RXIA 3W78A 2OZLA 3IAHA 4DV4B 1HE5A 4MV1A 5FI5A 2V1UA 3DFMA 2BTEA 2QVLA 2Q28A 4G1BA 5C8YF 3CTMA 3OX1A 3GELA 3HBLA 1U0FA 4WZBB 1NM5C 3M1IA 3SC2A 3ZE8A 3WL3A 4BDSA 3U4QB 1OZAA 1P1FA 5ENVA 3VKHA 4IRXA 1QIHA 3ZE2B 4DGSA 1UKVY 4ETWA 3GEEA 1TJ4A 4PGMA 5ES3A 4JOCA 3LT2A 1GZ6A 1E7QA 1UXHA 3BDVA 2PANA 4AUKA 1XU4A 3AI3A 3NMUF 2YY7A 4FWIB 3H1BA 4QBIA 5G0VA 2WF7A 4JYBA 3OMXA 4MAMA 3TQRA 4TUYA 4F12A 4QYIA 4GXQA 3KM0A 2WUVA 1JVBA 3LMKA 4NQRA 3TLBA 1U8TA 4B6FA 3K94A 3TQIA 2JFNA 3GA0A 3K96A 1G5RA 4JUDX 1WDLA 1ZUHA 3QLJA 3M70A 1CF9A 4TM7A 4DA4A 4BXOB 3ZGZA 4UU7A 4RC9A 2CYAA 2RHDA 3RFUA 3B3JA 3ZHTA 1LW6E 2I3ZA 3GJYA 4AFNA 1NNI1 4B6GA 1Z2OX 4QDKA 4E5SA 3IT1A 2JBAA 1VYTA 3STWA 1UOOA 2FPMA 5ES4B 3E9NA 4LZLA 4RIEA 1SIWA 1A7UA 2OD9A 2H1SA 4X3OA 4X41A 5CFZA 3L4EA 4BMOB 4P5PA 4IG4A 1F5SA 2GZ2A 2O5VA 3DMDA 2NVWA 2XKAA 3DWFA 3TAHA 3U4AA 3MB5A 3RK1A 4PYJA 5C2JB 4JBGA 1AT1A 3K1TA 3OF2A 4MV8A 3S7ZA 5IJ9B 1L4GA 2PXXA 4PZ0A 5FF9A 1XAGA 4MTCA 3BJRA 4TYQA 4W99A 3FPSA 5EGNA 4HZIA 5GONA 3SICE 4AJ1A 1T43A 1VLQA 2H31A 5JSHA 3DAFA 4P3KA 5E9QA 5IT9A 1DNPA 4DNPA 1CUJA 5CVEA 1EUQA 3T9EA 3UXMA 4BO9A 4Z9FA 1TMGE 4YMLA 5KOIA 3IVXA 2AC4A 3TCXB 2OM2A 1IOVA 2C3OA 3V4VB 1X7ZA 2HFKA 3T52A 1SB9A 3W3ZB 4HEA6 2A0UA 1P9LA 3U6KA 1TAQA 2I6XA 4JY7A 4DQ0A 3PDUA 1ECGA 2QORA 2WTXA 5ENDA 3MJSA 4KJZA 5EJMA 4Z0HO 3PQFA 1RXUA 5KNDD 4L3VA 3TSYA 1KMMA 1LBQA 3CEPB 4IVQA 1WCIA 3UUFA 1AGNA 4B9EA 1XMIA 3KTDA 1QMGA 2P9EA 4D7AA 4O0LA 1BS2A 4ABTA 3TD9A 1KSJA 3JRXA 1KY2A 1JNXX 1GL9B 4EM6A 2PQMA 4U2GA 4NCXA 1B3BA 1E0KA 3C2QA 5A7GA 5LMNB 2YYSA 4KN8A 3VSAA 1Q3KA 3EXIB 3GF4A 3JATA 3LZ6A 1WD5A 4O4HF 2UUOA 4XW2A 1TA0A 3I58A 3IP7A 3TRJA 3GAFA 5K8VA 4FZVA 4AO6A 4X1YA 1JILA 4YBZA 5D2CA 4B85A 3R75A 4D9JA 2YW2A 2MSEB 1K63A 4B3MB 1P33A 2WF8A 4IVNA 4LJ8A 4UNIA 2XMPA 3SI7A 2XOXA 2O2YA 4HAXA 1NI3A 5G4KB 1R9JA 4LNUA 1ZH6A 2FMIA 4M1YA 3UJ8A 1XJCA 3ED5A 1GNLA 3Q7QA 1EFRA 1WM1A 1TRHA 2VYVA 5KO2A 2IPNA 1HLFA 3FZEA 3MRXA 2CL6X 4RGBA 4UKDA 3Q3IA 1U3FA 4WGFA 4PQFA 3PUIA 2PL5A 3EXHC 4OH1A 1WQ1R 2UAGA 3FNHA 3HPRA 5C37A 3DZCA 4R83A 4FPXA 4GVPA 5ER6A 3LDFA 1Z4IA 4ZCSA 3JVVA 3OIFA 1KA9H 1H9BA 1GRQA 3DZ8A 1TT5A 4LY9A 3DZHA 2Z58A 3HP7A 5TSDA 1KDYA 1V3VA 1YI1A 4JEIA 1DKLA 2DWQA 1HF3A 1WWKA 1NSTA 2XH8A 4PRLA 2ACVA 5IJXA 3C3DA 1W1UA 4XZ3A 4NOKA 3U7JA 4ER6A 2B99A 2ZYDA 3A4TA 3IPAA 1T8PA 4KUEA 1T5IA 1I7NA 4IBOA 4QXPA 4LNAA 3QW4B 1KI3A 3IH5A 3UWMA