4D6XA

Crystal structure of the receiver domain of ntrx from brucella abortus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLDGLALLDEIKKQHPELPVVMISGHGNIETAVSAIRRGAYDFIEKPFKADRLILVAERALETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL REGULATORY, FIS FAMILY PROTEIN
publication title Snapshots of Conformational Changes Shed Light Into the Ntrx Receiver Domain Signal Transduction Mechanism
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d6xA00
4S04A 2CHFA 2VUIB 5TPWB 3HJFA 2CD7A 2QR3A 1J56A 1A0OA 1GCAA 1QO0A 3MMNA 1PNRA 1ISSA 5IEBA 4W5TA 3M9XA 1USIA 4RY0A 3UK0A 1QP7A 2FMFA 5KQMA 3QLUC 1Z25A 2CWDA 3HK2A 2JCGA 4Q7EA 2F8SA 1YTUA 4MRMB 2LP4Y 1K66A 1T34A 3OO1A 4KVFA 4RXUA 5F64A 3GBPA 5DTEA 3H5OA 2IOYA 3O2SB 2HPHA 3QEMA 2JBAB 3LUGA 5C5EA 1DBQA 1EHCA 4RK4A 2HQBA 3KSMA 4OLBA 4YWHA 2OQRA 1GUBA 2R25B 1ZGGA 3IP9A 5BRAA 4QYMA 1URPA 2PAFA 5CNJA 5HQJA 1AB6A 1FFWA 2A9PA 2MYTA 3EAFA 4FE7A 1SD5A 3HVRA 2HQRA 3BRSA 4MQEB 2JVKA 3E61A 5B3JC 1F4VA 2YHAA 3LUKA 4KPYA 3F6CA 2FN8A 1SXIA 3KG2A 3LUFA 4L85A 4IILA 3I45A 2PUDA 3H6GA 1DC7A 3CFYA 3JPWA 4KREA 3H5TA 1JFVA 3GV0A 1YK1A 3TX6A 4EVRA 3OMXA 3URMA 3RVOA 3N0XA 2FN9A 3JVIA 3N75A 4PYRA 5FBHA 4TN5A 4WZZA 2MSWA 3I42A 4XXHA 3CNBA 5IBQA 1RZRA 1JFSA 4N76A 4E7PA 4F11A 3NNDA 4WXMA 5DKFA 3FGZA 2W42A 2FEKA 1VLZA 3H5VA 5JNTA 3MM4A 4JA2A 2JRLA 5FWXA 3G1WA 3A0RB 4Z9BA 1APBA 3CLKA 2NZUG 5T7BA 1JDNA 1U0SY 5ABPA 1BDIA 4Q6BA 4G0XA 3CS3A 3SM9A 3LUAA 4O1IA 3HCWA 3EODA 3GT7A 4CBVA 5TQ0B 3N8IA 4F06A 4P98A 3Q7TA 3LOPA 1M2FA 3O75A 5KWSA 4RK0A 5FBKA 4WXEA 2MSLA 5JNRA 3A3KA 8ABPA 1C4WA 1Z2EA 2MSKA 2RJOA 1F51E 5T3YA 3HDGA 4YRZA 2WMYA 3F7NA 4HNQA 3CG4A 4LE1A 1CYEA 5JNSA 1ZVVA 2GX6A 3LUDA 2P4UA 5TPZD 3F73A 2PUGA 2VYCA 1DG9A 3MQ4A 1D4ZA 4JB0A 2YHBA 3KJXA 2R48A 5TQJA 1NXWA 3MYYA 2VK2A 4TLLB 5EWJA 3LKBA 1EFAA 5KC9A 4KV7A 3FFWA 3H5WA 4IGAA 2HQOA 5DGCA 4NCAA 6CHYA 4MS4A 3KKEA 3G85A 4OBBA 3HUUA 3TO5A 3T8YA 5KC8A 3OLVA 2FVYA 1JH9A 1L5ZA 2RGYA 4ZJPA 3RVSA 3GBVA 3OM1A 5GOTA 5ED4A 3CTPA 2NZVG 3BBLA 3IP6A 2HSGA 3CZCA 5CNIA 4F3TA 2GI4A 5EWLB 1IIBA 4LZLA 3NHMA 1QQAA 1YS7A 3IP7A 1Z2DA 3C3WA 1MB3A 1EWKA 1ABEA 1QKKA 4N47A 4JOQA 5KQPA 2FQXA 1XHFA 5JS2A 5EWMA 4G0YA 3Q7SA 4LRQA 5I4CA 4DQDA 1KMIY 1YMVA 1MB0A 1E6MA 2PUEA 3HUTA 3T95A 1P6UA 2RJNA 1I3CA 3A10A 3GA5A 1ISRA 3KLNA 3RVMA 1ZAYA 5IX8A 4YS6A 4G0OA 1USKA 2IPNA 2FTKE 4RV5A 4MRMA 2CHEA 2PE5A 4O1HA 4YR7A 4N41A 2FEWB 3CZ5A 4PE5B 4ETNA 3EJWA 1CHNA 3A0UA 4MR7B 5C5CA 4JB2A 3K4HA 1Z13A 1JWLA 1D5WA 3Q41A 1RXIA 3RH0A 2IPAB 1JX6A 1JYFA 4YLEA 1HEYA 3GL9A 3D8UA 3JVDA 3HM9A 1AB5A 3KCNA 2IPMA 3VNAA 5FWYA 4RWEA 4KFCA 3NNNA 4KQ9A 1XHEA 2L19A 4MQEA 4G0PA 1SXGA 4LDAA 1PEAA 4QICA 2E4UA 3QX8A 1ZGZA 2N9UA 3C6QA 2L18A 2GWRA 4EYGA 3OLXA 5JS1A 4LE0A 4DADA 3RVPA 4HNRA 1Z15A 4MS1A 2Q5CA 4YO7A 2E4ZA 5CNMA 3TB6A 2DRIA 2OENG 1NY5A 1ZITA 4MS3B 4KK3A 1QPZA 3I5AA 3P9YA 3TMYA 2NUBA 2A9OA 1EWVA 1OXKB 1S8NA 4GNRA 3UKJA 3Q9SA 4KK4A 4HYEA 3H5LA 3L49A 4HNSA 4QYWA 1L5YA 1RNLA 3DLHA 3N0WA 3H1EA 3QEMB 4RZSA 1DBPA 3DLBA 2QW1A 1NXVA 4G0MA 4RXTA 2QU7A 4YP9A 2PKXA 1PUXA 4EGSA 4W5NA 3EULA 1TLFA 4N0PA 1PEYA 3K9CA 4MR8B 3CG0A 5KI6A 4PICA 3FFXA 5TQ0A 1LBHA 3HXMA 1QO0D 2JVJA 4IF4A 4FB4A 3O2JA 4RU1A 4NICA 3HDVA 2JK1A 2V0NA 1E2BA 3QELA 3HO1A 4LX8A 3QEKA 3RVKA 3FFTA 1DJMA 5DCLA 2E4VA 1D1QA 1Z17A 2KYRA 4LDZA 1Z18A 2GKGA 1M5TA 2HJ9A 1R8JA 2IYNA 1JL3A 1P6QA 2QVCA 4IMIB 4RS3A 4XLTA 4S05A 3O2QB 4Z9AA 1LJUA 4M88A 1NXOA 1YK0A 1GCGA 4MLCA 3HV2A 4P1ZA 2GBPA 5IUJC 3E3MA 4EVQA 3B2NA 3IPAA 1MVOA 1LK0A 1NXSA 3JS5A 4MQFB 3JY6A 3O74A 2B1JA 4L4UA 4Z4GA 1DCFA 1ZDMA 1K68A 2LUOA 3FMVA 4WUTA 3RVNA 4KZKA 4LE2A 4KNYA 1NTRA 1Z26A 4ETMA 3MIZA 3OQOA 1LJLA 1DBWA 2FLWA 1YVUA 5TE9A 3HSYA 2WJAA 5GQSA 3DGEC 1D2AA 4ZMSA 1JLKA 3JPYA 3O1IC 1JDPA 2H0AA 2XDYA 1D1PA 1Z12A 2ZWMA 3KLOA 2PUBA 2BGGA 2ID7A 2FQWA 3BRQA 5E3JA 4KMRA 1DZ3A 3EGCA 3LFTA 3O1HB 2FSPA 4ETIA 4W5OA 1OXBB 4EY3A 1DC8A 1Z16A 2PJUA 1YS6A 2JVIA 1CEYA 1E6LA 3EQ2A 4H60A 4Z0NA 4OG2A 1GLGA 2MYUA 4NQRA 1RZRD 1DRJA 5IUNC 3OQNA 3D02A 4NV3A 5TQ2A 3ILYA 1PHRA 1PNTA 2M1ZA 2PMCA 4OATA 2A9QA 3C3KA 3LKVA 3LUJA 4XAQA 3SAJA 3BREA 4Z4IA 5BQ3A 2A9RA 4MR9B 1U04A 1M5UA 2QV0A 5TPWA 5EWJB 1NXTA 4W5RA 4IRXA 4TLMB 4G0ZA 4N0QA 2TMYA 3C97A 2QSJA 3KHTA 2FMKA 4Z4FA 4MYRA 4UHJA 3T6KA 2FMIA 1ABFA 3KTOA 4MR7A 1NATA 4PEVA 2L17A 2FQYA 3OM0A 2ZAYA 1QP0A 3FDFA 3H1GA 3IDOA 1DCMA 2B4AA 1Y1LA 2JB9A 3KS9A 4WT7A 1ZY2A 1DP4A 4RSMA 4YGXB 2PUCA 4EYOA 1WETA 1KRXA 4F8JA 2PUFA 2JBAA 4QPJC 3H6HA 5JNUA 3CKMA 2LPMA 3H5IA 4UHKA 3QLVA 6ABPA 1KRWA 4ZYLA 1MAVA 1C0EA 3LMKA 5EWMB 5D2CA 5CNKA 4JASB 4PZ0A 1JYEA 2IDMA 4RDCA 4KRFA 2ID9A 4D6YA 1VPWA 3LUCA 1SXHA 3CRNA 3DGFC 3S99A 5CHYA 4ZPJA 3RVRA 3OLZA 3NHZA 1USGA 4JP1A 3HZHA 4MS3A 1QMPA 4D6XA 2NT4A 2QVGA 2X7XA 3BILA 1DCKA 3SG0A 1DRKA 1EAYA 3HEBA 3I09A 3NBMA 4TMYA 3N53A 2IPLA 4D74A 3N6VA 3DZDA 3VNBA 4EVSA 4XFKA 1RPJA 1TJYA 5IC5A 3CHYA 3JTEA 3O1JC 4Z4CA 4G97A 1FFSA 1A04A 3RVQA 2M98A 1RXEA 4YCSA 1TMYA 5TPZA 1JFTA 3Q7RA 1SRRA 2MYNA 4MR8A 5FWYB 3C3MA 4IMJB 4EYKA 4RKQA 5BR1A 2FW0A 5IEJA 5IUKC 3Q15C 2LIVA 1EWTA 1ZHHA 3SY8A 3QLVC 2IKSA 3TD9A 3R0JA 3RVJA 1YMUA 3H1FA 5HKOA 4OTZA 1MIHA 1TVMA 1E6KA 3EQZA 3GRCA 4MS1B 5KQGA 5KQLA 4W5QA 4JAVC 1JBEA 1QQBA 3NNSA 3IPCA 3F6PA 4RXMA 3DBIA 2FEPA 3ROTA 5HM6A 3SNKA 1GUDA 1FFGA 3GYBA 4RK6A 3GWGA 4EYQA 1LBIA 2I6FA 1JF8A 4FE4A 4MGEA 4MPTA 1VRVA 4H3KB 4MQFA 3OQMA 3M9WA 3QK7A 4ZMRA 3SQNA 1NXXA 1BDJA 4ML3A 3T38A 2WB4A 2L2QA 1NXPA 2PL9A 3RQIA 3QLTA 4KQCA 5FWXB 2LBPA 4B09A 1M2EA 5JNVA 4RK7A 3KYJB 3H75A 3QELB 1BA2A 2F8TA 3ROFA 1XWWA 4O5AA 3MF4A 2WY2D 2WJWA 2FMHA 2P9HA 2J48A 3N0RA 3OO0A 1ZH4A 2RDMA 1YIOA 1FSPA 3RVLA 5JNWA 4G86A 1FQWA 1U8TA 4RY9A 3CU5A 4YV7A 5IULC 3OMWA 7ABPA 2WRZA 2E4WA 1QNLA 2O20A 3UUGA 1UDRA 4Y9TA 4RY8A 5EWLA 4G0QA 1P8AA 2WWVD 4Q6WA 4DN6A 4Z4EA 2R4QA 1W25A 4N03A 9ABPA 3M6MD 1B00A 4MR9A 4XASA 4XARA 1U2PA 1ZESA 2R47A 3W9SA 5DLEA 3QLUA 3OLWA 4E7OA 3EDCA 3O21A 2VUHB 1BVHA 5HSGA 1KGSA 2FKAA 5PNTA 1TM2A 2NT3A 3ILHA 2E4YA 2AYZA 2PL1A 4RK1A 4MAAA 4Z99A 1JHZA 4MS4B 1W9HA 1ZN2A 3QX9A 4F12A 5BRJA 2E4XA 2FLKA 1ZH2A 1BAPA 2H3HA 2QXYA 4H3HB 1U2QA 1VKRA 2FXIA 3LUHA 4NCBA 4Z4HA 4EUKA 5TQ2B 1QP4A 1A2OA 4WWHA 1BDHA 3OLYA 2PLNA 2PUAA 4OLAA 4MLDA 2AYXA 4RK5A 5B3JA 3LTEA 4GPAA 2MYPA 4RKRA 3MA0A 3KYIB 2QZJA 3IP5A 1H9CA 1P2FA 3L6UA 3HS3A
chains in the Genus database with same CATH superfamily
2O2CA 1BU8A 3C6KA 4TL6A 3UY4A 3KB6A 2C5FA 2ATVA 2WYIA 3UT6A 5KYXA 1ZJWA 3ZI4A 1HYHA 4Q4HA 4Q7LA 3CT4A 2PMDA 4Q9DA 1IWOA 1HE8B 3SBDA 3PX7A 1I6LA 1IEQA 4ZA2A 4ZVQA 4RA9B 2OQIA 3PUVA 3FWYA 3WGYA 4QNNA 3WV5A 5CYGA 3OEEA 1M6WA 1FFBA 3HCDA 2JIOA 2WT8A 4XYBA 3ZWAA 2DBQA 1MDBA 4N1AA 1K06A 3NI2A 1WZEA 3H5OA 3FM9A 2XWPA 3O2SB 2VPIA 3EEOA 3KEOA 5JAQA 1NRWA 3L7BA 4ZCMA 1TKAA 3QTTA 3DL0A 4LYHA 2OQRA 4E5UA 4DV6B 1N4AA 1EVJA 2ZBUA 3QBVA 2PAFA 1AQUA 1NSTA 4XVHA 3MPOA 2BBSA 3PFCA 4JUDX 4A1OA 1NR5A 4YUXA 3MCZA 1WNFA 3OJXA 1M9NA 4GBJA 2Z56A 3DKKA 1L7RA 2DQKA 3OF2A 4OKIA 4PHGA 3BX1A 1DQSA 2QHXA 2FN8A 2WUFA 4R1UA 2ZPUA 3I45A 3W2TA 3PFIA 5L3SA 3CFYA 3WSTA 1T29A 2AN9A 2G06A 4O63O 4UUQA 1GRVA 5E7MA 5DI3A 1GU1A 1Y3HA 1ZJYA 2V1XA 4F8YA 5F21A 5IANA 5F4ZA 3SX0A 4O4HA 3D0QA 2V9ZA 2UYYA 3ROXA 1VBFA 3I01A 3OWOA 4E70A 4ZDKA 3C7CB 3PQ4A 4PYRA 4V0MA 1I8TA 3GHHA 3HJBA 4UNQA 4YRKA 2ZWPA 1GDDA 4NENB 4JSYA 1FL9A 1YJ8A 4LTNA 2ZATA 1Q1ZA 5EQJB 3T1OA 1PVOA 3NNDA 3HGMA 4WXMA 1HDRA 3B8EA 3MJTA 5HJ2A 2IK8A 3GEGA 3W1VA 1XZEA 1OXUA 2R8BA 2XMRA 4N7RA 3SSOA 1DNPA 3TW0A 5LL6P 4J0HA 2DPMA 2XYGA 4I4CA 1NBEA 4L28A 4E08A 1O94A 3ANTA 3KB2A 3R3SA 5IYZF 3RWMB 4QJ3A 5CLJA 1B8VA 2CDBA 3U7FB 3TLKA 3NUQA 3RIGA 1Z0UA 3SHQA 1G5HA 2FWMX 4FOOA 3CQ9A 2QQEA 2PANA 2VHZA 2ZAGA 3MBOA 4IOLA 4JCOA 4WXEA 5IRCD 5JD4A 5F7JA 2MSKA 3I9MA 1FSZA 1W8DA 3T52A 2IGTA 3OZIA 5GZ1A 3IUJA 1WHTA 4DMLA 5D7NA 1PZGA 3KALA 5IJXA 4J7CA 4LE1A 3GT3A 3LBNA 1NW4A 1LVUA 3CINA 3LO5A 2G08A 2GR9A 1C7QA 4RVSA 1O95D 3WHIA 1JLRA 1HT0A 3KKPA 3O4FA 3QSGA 4GBGA 1JEQB 4C0SA 1OWPA 3O8RA 3CSDA 2OV6A 3A4NA 2VDMB 4PC6A 1L9KA 4UHHA 5HEKA 1SC4A 3WJAA 5JJLA 1ADFA 1KZHA 5EY5B 1O96B 1GNTA 3VR6D 1JHVA 2WBLC 5BSWA 3HBMA 3MYYA 1C7IA 2R2AA 4MOWA 4EAQA 2PMBA 4B84A 5LJIA 1MJ5A 5BV8A 1EWQA 2W58A 3CW2A 2WTNA 2PR2A 3EDYA 1PZMA 3JXEA 4GWLA 3T3DA 1XXHE 3RYFB 5BVGA 3OZAA 1K6EA 3PTAA 1JALA 2HQOA 2V7WA 4NKRA 1ADBA 1K5PA 3HUUA 4OA8A 4EBFA 1JIVA 1M7GA 4O4IF 4EYSA 2VG8A 4F6LA 5AVTA 5KC8A 3KFVA 1XEWY 3E1GA 2H54A 4LBYA 5FKJA 1WXHA 3WYDA 4KWTA 3I9V6 1QDLB 3OKAA 1CZLA 3G3EA 4A8JB 1P8JA 2EV9A 3KZXA 3EG5A 3DR3A 3OAAD 3ZG6A 5DNAA 4LZLA 4QEDA 2RHJA 4LFAB 1QKKA 5CFNA 1GZ7A 3LVRE 1IVNA 3Q8WA 4MUFA 2GSDA 5J1TB 1PW5A 3GYGA 3Q5EA 4TKUB 1UODA 3PJFA 2J3DA 4XGKA 3ROPA 3KJGA 4ZQHA 3C8MA 3K9BA 4P5EA 5IDWA 4ZDJA 2EBFX 4CKCA 1P6UA 5TF0A 3HCFA 3R75A 3K70C 1JI3A 1A7KA 1MC5A 2ZXFA 3K32A 2FTKE 2FYTA 2VFAA 3H9BA 1JMKC 4KPUB 2PSHA 2YY6A 3I2GA 1Z29A 4DM3A 2HK9A 2V65A 4MJ3A 2UUBB 1Y6JA 1C1DB 5EFZA 3WRXC 1VI5A 1DG1G 3K4HA 2C07A 3T94A 5JAHA 3EA4A 5EJ5A 4ECAA 5CFOA 4BTVA 2ZB3A 3DBLA 3OQPA 3PQFA 3OBIA 5H9VA 1PD1A 3NYRA 4YP1A 5K05A 2YWRA 1UAYA 2J8ZA 3D8UA 1JXOA 3FZEA 4OFZA 3C3DA 4M53A 3RSCA 5AUPB 2OCIA 1F2DA 2GVDC 2O3JA 3FN4A 3OP1A 4HBZA 3ZU2A 1T4MA 1ECBA 4DTIA 4LC9A 5BQFA 5C5IA 1JA1A 2H2FA 1RYZA 1XFAA 4XOUA 4RWEA 2BSXA 4IIDA 4M0PA 3UFXB 2OSBA 4ZVPA 5AD1A 1TO1E 3E7FA 2JLAA 3DPIA 5EJ6A 1TRHA 4LDAA 3SE7A 4LHYA 2UYOA 4JB8A 1V8FA 3HEMA 1FS4A 1WTAA 3JD1A 3U44B 4H0NA 2WJ3A 2QVXX 4DIFA 4DUPA 1GXSA 1R0WA 1I6WA 4GPIB 5CNMA 1T9KA 2W0SA 4O29A 3W6ZA 2VZ0A 2F3PA 3G8YA 2FWBA 2YN2A 1GAWA 4JNCA 3VHXA 2PLFA 3KOOA 2OBNA 2NUAB 4URZR 4CIVA 1XZBA 5EVJA 2ZB2A 4HYEA 1W88A 3A4MA 3T3HA 4Y7CA 1WZ2A 4RBNA 3RS8A 3O91A 4PNPA 4A6XA 2EFDB 1TU3A 2PJZA 2ONJA 3FTNA 4ITUA 2NZYA 3UV7A 3DAPA 4RACA 2QU7A 3A9CA 3WHKA 5DRYA 1X8XA 4HNHA 1BROA 1WCWA 4G8BA 2QD1A 1TF5A 3HJGA 4UZEA 5I5EA 2WU4A 5FFFA 2FDRA 3NAMA 1PT7A 3K2QA 2JHFA 3O84A 2FUG6 1YB5A 4PICA 2J6CA 2PZBA 2IW1A 3FAKA 7ADHA 3P2IA 1ZD2P 2ZE8A 4IGKA 2WWFA 3HDVA 4R9SA 1C9KA 2W42A 3RC2A 3L7NA 3H3FA 3RS5A 5BW4A 3DNPA 3PPVA 4LDRA 5HF5A 3C70A 4E2FA 5ALYA 1Q1AA 1FJGB 4RLHA 2YHSA 3SSMA 5DGDA 3L77A 3K8QA 2KYRA 4WZAB 3OEED 4MICA 3IURA 4QIHA 4ZEMA 1JL3A 3GFVA 1FYFA 3BE8A 3CRMA 3L6OO 3NJ4A 3G2NA 2GFQA 3I9NA 3O2QB 3TVYA 2NU8B 3UW1A 4DLSA 1OTHA 4M88A 4AIRA 3FR7A 2WWYA 4PLGA 2YV5A 3GMSA 4LJ9A 3CO5A 5IUJC 3G0HA 2O2GA 5DCWA 2ZQ5A 3FVTA 1YI0A 1RLUA 1BD3A 3AY0A 3U6KA 1PQWA 2W0MA 4UUPA 1RI2A 2Q3LA 4QJIA 5H1YA 1GKUB 3RVNA 5BSEA 4TVKA 2ZRGA 5B4TA 2W93A 3QQPA 2NGRA 3N8KA 5IH7A 4JL6A 1NPDA 4X60A 2MU1A 2X3YA 5DM70 3EZ2A 1DBWA 1DUSA 1ZN9A 4MYCA 1GTL1 2P9EA 3SKXA 1W59A 5GQSA 4CDNA 2GUGA 3IQGX 1WMFA 3DGEC 1E20A 1I4OA 1RT9A 4ZI5A 4DMMA 3DKVA 4DCJA 3PYMA 3G7SA 4HN9A 1IJEA 2ORWA 2YHUA 4ITVA 4ZAZA 3USCS 4QREA 2AF3C 1UH5A 3WNDA 1H66A 2WT9A 4QDXA 1U1IA 4HB0A 3A4IA 3VJKA 1BFDA 1PR2A 1TVEA 2PGXA 2CW5A 3NDIA 3IUPA 5JD6A 1GG2A 3OQNA 4TL7A 2G1UA 5K20A 5TQ2A 4WFJA 4HAOA 1HKHA 5DN9A 4R98A 5JZSA 1BX1A 3HCOA 2A9QA 4NBKA 3OCCA 2FR1A 1KOGA 1C1XA 2EKBA 2OHGA 4FBGA 5J5CA 2XNKA 1OT5A 1QIHA 1O94D 1W35A 4N39A 3K70B 4HEA6 4GZLA 1VJCA 2ACWA 2RGNC 3BGSA 3KFLA 3GFBA 1I0LA 5B3LA 4Q7JB 1OIWA 5K0ZA 1E5TA 2I3ZA 2PLWA 5LMZA 5AW5A 1JSRA 2G83A 4FR2A 4UBJA 3BQ9A 3X3HA 3IBCA 4W5WA 4MYRA 5H83A 4GZ3A 1PR1A 2C8JA 1XTKA 4KN8A 3GCXA 4LHWA 5FOWA 2D1SA 3R5JA 4F38A 821PA 3IO5A 1M74A 4P38A 4RA9A 1IBLB 4PG4A 3FDFA 1N2GA 3HU2A 3IDOA 4NEQA 2PSDA 2CV1A 3LLMA 2WVHA 1HE2A 4J2HA 4QUEA 4YGXB 1ULBA 3K8YA 5E2IA 1QIGA 3I30X 5BNIA 2RKBA 3U3XA 1SUEA 4JC0A 3RFUA 3W9YA 2PR7A 3FMPB 1OFIA 3H5IA 3FE2A 3QNMA 1E94E 5KVVA 2ZRDA 3D6FA 1XWFA 1PLKA 3NP9A 4PN3A 3UWDA 4ZYLA 2XCTB 1Z8DA 1YIAA 1PWXA 2QDXA 3X1XA 3GLKA 3BA1A 4BRSA 4ND3A 2C5AA 5EE3A 2IDMA 1H6CA 3L0ZA 4GL2A 5EP2A 3IBGA 4D80A 1I0IA 2OXFA 4LJ4A 3ICOA 1R16A 1MO5A 3IUNA 3JQRA 4QUDA 4LYGA 1C30B 3R6WA 4B2LA 2V7XA 1EUDB 4NOJA 4MS3A 4D6XA 1A82A 2ZUUA 2IYYA 5CHEA 2Q49A 3TSAA 2W7TA 1QIMA 1XQ1A 2VF8A 4HB3A 3X2SA 4DKXA 1FZQA 1ZMRA 3VPHA 4M8LA 4GSKA 3O8QB 4L73A 4I6GA 3Q1LA 4NOKA 3LFHA 4P7BA 3AR8A 2O2YA 4DJEC 3VA7A 1HDEA 4EVSA 4E03A 5KOJB 3GLIE 1UBSB 1H5NA 3QP9A 1GGMA 1LPSA 3L0SA 1PRYA 3C5HA 3HYTA 4MDYA 1K2VN 2A33A 2C7GA 2J6BA 1HZZC 1OQAA 1Y37A 2R6GA 1SKBA 2HA7A 3ZHXA 1L5MA 2R7MA 1SU6A 3RYHB 1ZL0A 2OKGA 1V6CA 5BR1A 4CIBA 5G02A 4X66B 1NOIA 2WPDA 3GCZA 2A9JA 2GBFA 1O0SA 2PV0A 2WKWA 3JQEA 3K9HA 2G67A 2JHCA 3GC6A 4RGYA 1YCHA 5EP4A 1AV7A 3GUYA 5FPYA 3AFOA 5DM0A 2ST1A 3KYCB 1Z4LA 3WLKX 3GP5A 2W90A 2QX9A 1CV2A 2Z09A 2BM9A 3MIIA 1BE0A 4I4TB 4HHEA 1LSUA 3ET4A 5J3JA 3QSYA 5KQGA 1S2IA 2ZI7A 4P5PA 3O93A 4D92A 4HJXA 5A5EA 1DXYA 2GJSA 1RJWA 4YP5A 4K2AA 1FMCA 1RYEA 4D4GA 3EWIA 1WKVA 1H0KA 3DT9A 3HB5X 5K0NA 5H3LA 4YJ2A 2O8BB 3KNZA 1YB6A 1EGVB 5DVZA 4MVJP 1VHDA 2HT1A 3E7DA 1HY3A 2V97A 3R6DA 3I1FA 1JEQA 3W7AA 3RC3A 4EJMA 4K9RA 2YR0A 2DHDA 5DHTA 1F8XA 2XQIA 1O96A 4JVLA 4V3BA 4WH0A 5J43A 3I39X 3TEFA 5KUTA 1LEHA 1XN4A 3BG5A 1E1CB 4FMPA 4HJRA 4X93A 2QORA 4CM5A 5JZVA 3WBBA 1WMBA 5IVPA 1PHPA 4GDFA 1IVSA 3EVAA 4MO9A 2A5YB 3PX2A 4G37A 4P9NA 3HA3A 1P44A 4J16C 2NYUA 3RYFA 4YO8A 4EATA 1V1RB 2VZ8A 1VBNA 3B78A 2VDNB 4PG6A 3VR5A 3ROFA 3MJ4A 3AXSA 3D7MA 4FYYA 1UKCA 4BUZA 5JY1A 3ENVA 4EHBA 2C5HA 3KLBA 3AVVA 1GPNA 4LTMA 1RU3A 1SR8A 4W1SA 3RREA 4M60A 1FQWA 2I99A 3VOSA 5IULC 1DC3A 1OBVA 1T4CB 3RLIA 3EYAA 3GJ4A 4LHEA 1L4NA 2G04A 4PFKA 2GH1A 3TAHA 3L8HA 4FTWA 1T8WA 3PKIA 1W25A 5GGYA 5TMEA 3ZWWA 4RTJA 4NSNA 3ANNA 4EA9A 1RP1A 2UVPB 3OPXA 2QLTA 4JHLA 5KYUB 1TCCA 2JZOA 1KGDA 1CDOA 4TKUA 1NVMB 4I1VA 4HQRA 4RGQA 5BURA 2VP5A 1JR3E 4Z1OA 4GQAA 1BVHA 1ILWA 1PJSA 4XUEA 2ALJA 4OLHA 4KJXA 4MWOA 1NVTA 4IIGA 4ANFA 3LXMA 4J1QA 1HXHA 1DOAA 1E61A 1NSYA 1G4AE 3CX8A 4K6HA 2QPAA 4KPUA 4MVCA 4UM9D 3TTSA 4Z99A 1QS0A 5C34B 4YCLA 1EXDA 4IX9A 1ZRSA 4LY9A 3RC8A 1C1DA 1EEHA 3ETHA 1F0PA 1BCRB 1B2RA 1ZH2A 4ISBA 4AFNA 3I5MA 4QUGA 2QM7A 5J1SB 1DC5A 4OXRA 2WUGA 1I2BA 2PQ2A 3AJ9A 3W04A 4DL9A 1BD4A 4HSGA 2V7PA 2XB6A 4PTZA 2WUDA 4I50B 3SBOA 1QK3A 4RZXA 1F14A 1WD7A 3VKFA 4DXDA 5JQGB 3J7AC 3LNTA 1SVWA 2B8NA 3UFXA 3MA0A 2ZREA 4ZAGA 1KI3A 2QW8A 1GWNA 4HH1A 1RAHA 5KBYA 3QEOA 1KSJA 3BPSA 1J1UA 1DPGA 3IJRA 1R74A 3KT8A 3OCZA 4DILA 3U44A 1OIVA 3V8RA 1TQ2A 4JROA 3IRUA 1E3DA 2O2JA 1RYFA 3FNHA 3KZ1E 4PPFA 4TV8F 4X94A 1QP7A 4HYYA 4RLSA 2JLYA 3NKFA 2MMGA 4LJ5A 2WSBA 5D86A 3WWZA 2A59A 1ZNQO 3NGXA 3GN1A 3QXXA 4KXLA 4A82A 2NUAA 3L8FA 1JQLB 1H0HA 3DBRB 3ZYCA 2D3WA 4LK2A 1KP9A 4YRAA 3I9OA 2PRZA 1NC1A 4DDKA 5JUWA 4LRUA 3DMTC 1MB9A 3WR5A 2X4IA 3VYVA 421PA 3EIUA 4D3XA 1AB6A 2OCXA 3WDSA 3E5RA 1V9CA 1O0BA 3IHWA 2V5AA 3BRSA 3FROA 3RS9A 3HA2A 5CDHA 4PQGA 1IK4A 3N5KA 2O54A 1F60A 2A0YA 3AB7A 4R3UC 3U7JA 3OCXA 4YASA 1O7JA 1SRQA 3PB3A 2IV3A 1Z0IA 3WMEA 2JNWA 3EIXA 3I4FA 3KJHA 4Q9KA 3QVXA 2ERYA 4RVDA 3SNHA 4YRLA 2G7ZA 2FWPA 3RWBA 2IQ5A 4IZHA 5DBGA 2VA8A 5FPKA 1M2GA 2BFWA 1GA4A 4E7PA 3DF9A 1Z0FA 5BQ5A 4DWJA 2P30A 4MW1A 4X8OA 1YS2X 2H1FA 4JENA 4ZOLA 4FSHA 3OIGA 1KFCB 3GZTB 4Q21A 1SKAA 1ISJA 1P9LA 4DLUA 4UNNA 4DG5A 1APBA 1I2CA 3NC4A 3I61A 3TE7A 5JAUA 1J1IA 2JKZA 3SGLA 1QTRA 1BDIA 3BEDA 2PEYA 4A8PA 4LYEA 5SYMA 1DAHA 2HQ1A 4JOSA 3K0CC 2A0XA 2BMEA 4XQ9A 3TSOA 3ZCXA 5KVCA 3EAGA 4NBLA 4E88A 5BVHA 3L7LA 2IUYA 4R05A 4QNMA 3G1TA 1ZMBA 3GJ7A 3VAZA 3VM6A 2YWFA 2ONCA 4JXKA 2QIOA 1RPNA 1VRWA 2DWQA 2GPWA 3F46A 1WM1A 3G49A 4J4BA 4S2UA 1KJJA 1OYVA 4NPAA 3ZDXB 4BMCA 2YVLA 3K05A 2XMPA 2QTNA 3PCRB 3HWRA 1IN4A 1RPZA 3TIIA 1ZUWA 3B6KA 1NVVR 1MAWA 1U3FA 5DTJA 1HLFA 1WUJS 5TY0A 2GBLC 2KHZA 4XIGS 5TMBA 2HFJA 3U6BA 3E22B 3ITEA 5EI5A 4EZBA 1D09A 3AFIA 3WGUA 3OQBA 4F45A 1PTJC 5KNDA 2DBVO 4JYCA 1P5RA 3ORRA 2WPDD 3QOXA 4RA6B 2I7TA 4R16A 3DA8A 4C7XA 3AJ8A 3SYTA 4EOGA 3RU2A 2B82A 5JBNA 2BHLA 2DUNA 2RBEA 2VEOA 3KT6A 4AWXA 5J2UB 5LA6A 2R60A 6CHYA 4IFIA 1TQ8A 4L0DA 5LMCA 2O0LA 4BKPA 1PJCA 1ZN8A 1OIXA 3P1JA 3P20A 3WB2A 3NOQA 1Q95A 4IOKA 4X41A 2WHPB 3W5HA 4IKPA 1LU9A 4BAGA 5B6PA 3AM1A 2NPFA 4HEJA 1XZAA 1VPLA 4Q4LA 2C3OA 4P0PB 2JBHA 2NZVG 2DBYA 3ZD9A 2Z3ZA 1JVBA 2B5VA 3CZCA 3KQKA 1FDIA 5G2OA 1Z75A 2F9LA 3IELA 4OKSA 2BDEA 2JIBA 4D0NA 3K0FB 4PPQA 3N6XA 1YZTA 5LJLA 4UBOA 2HLPA 2KW5A 2PGAA 5DNWA 5DX8A 1R1DA 1NN0A 4YROA 2MSDB 4CHGA 1P1FA 1TXGA 1TYZA 2ZWVA 1JDBC 2FHSA 4F9GA 2PZLA 3Q7SA 4ENUA 1I5OA 2DP4E 2HIMA 5JSHA 1MB0A 4HH4A 2B3DA 4UUMA 3GDOA 2YZ7A 1FFHA 2BGIA 1KFJB 4KB5A 1QYRA 3WBKA 1NMXA 3FBTA 2G7MC 2SICE 2WUVA 3DFIA 4ZCQA 3HA5A 4G01B 5AKLA 3Q9LA 3VR5D 3WLIA 4NBRA 5LM3A 3I34X 4D43A 5E7IA 3ZYZA 2OFOA 1ZI9A 3DMRA 2ES4A 3N5CA 3S8YA 4ALIA 1YNOA 2HI0A 1JBKA 4KUHA 1B0UA 3QJGA 1M6VB 2CLEB 4F84A 2DSTA 1ORTA 1JSXA 5KOJA 2PBLA 3CY6A 3M6LA 2IPAB 4D3YA 1JYFA 1XDZA 2ONYA 5DTMA 1MRSA 2M32A 4DJAA 5KAMA 1ESMA 3U7IA 3WK5A 2WW8A 4L4SA 3JYLA 4UOQA 3TW4A 1YF3A 4P83A 4B3BA 1XT6A 4K9MA 3CPSA 2IYQA 4V2UA 4BTLA 3O8CA 1V9LA 4WCDA 2VCYA 2RHCA 2ESRA 1MP0A 1FB5A 5F7OA 5CX1A 3PFGA 5BP7A 3RIEA 2A4KA 1S3IA 3KELA 2J9YB 1BZYA 1ESNA 2H17A 3KYCA 4EI7A 2XUGA 1DIHA 3P52A 2J9XB 4CM7A 1V41E 4CM8A 4ZI7F 4XQGA 4OFBA 4NZNA 1REQB 3NBUA 5FCDA 4K6GA 5BUQA 5I7RA 2XVAA 3OF3A 4GQIA 2JJ1A 4K28A 1QRUA 1XQVA 2QRVB 4GMXA 1I7QB 4AI6A 3AUFA 4D3FA 2R86A 3M1YA 3SU8A 3ITKA 4NU0A 3TNFA 5K0GA 1J8VA 1L8OA 1N8TA 4KK4A 1NLUA 4QEZA 2TSYB 1T6XA 4YCJA 4YQFA 4CG0A 2PQ6A 2WU8A 4FFDA 1GRCA 5IJAA 4YT2A 4CI9A 4WXRA 1IHYA 2QW1A 4QYXA 4Q1AA 1AIPA 4UCFA 1KAEA 2NYAA 5FULA 1DKOA 5JHHB 3CUYA 3ZHYA 1Z6AA 2JGJA 1D2CA 1WZCA 4EQZA 2IBTA 2GCOA 3CLHA 4WGGA 3TI9A 1CQPA 3IVAA 4ZO6A 3JZAA 3N3AC 4J1NA 1LBHA 1QTIA 4MP3A 3UUWA 1O9HA 4DSAA 3B9RA 5BQOA 3MS7A 1UFRA 1DO8A 2FX5A 4YMUA 4J0JA 2JA2A 2P75A 3CT6A 3OC0A 3HP7A 1MW8X 4X90A 1U81A 1PAUA 4ZQGA 2WP8J 1P29A 2P68A 2E4VA 4B3CA 5EQTA 1QX3A 4WPGA 1M5TA 1UT6A 2W2LA 1KO4A 1M8GA 2VDPB 1F0YA 4MW2A 2V74B 1EFKA 3H17A 1T5OA 3VVBA 3V6LA 4CDMA 1EDDA 1XEWX 1QGED 1NVAA 4IFBA 3ZTTA 1Y98A 2BR5A 3Q0TA 4IDDA 4IF6A 3A6JA 2WV9A 3D1VA 3WWYA 2LV8A 2FP4A 2RGNA 4YT8A 4CN8A 1E32A 2C88A 4PG5A 1M10A 2PMFA 4UVIA 5KYUA 3S2SA 2CNKA 1UK7A 3VPBA 4PQRA 2I2AA 1T2NA 1E59A 2I2WA 3T3MB 2JFQA 3E7PA 2VUSA 2YV4A 4HUQA 4LWQA 5AKIA 3OQOA 2B7LA 3QTLA 4ZGWA 2VF2A 1MTZA 3BCUA 1JLKA 4E11A 2YTZA 3D0OA 2C2MA 3O1IC 1QGDA 2XDYA 4QXQA 2AN3A 5AI0A 5ED0A 2Q5EA 4RF5A 1KEKA 3HDQA 1MAUA 1D4FA 3E9YA 1U5CA 3HLYA 1IPHA 1Z16A 4AWAA 2JGIA 4LEIA 1WW3A 1IWPB 1EMDA 3VKUA 3MHTA 2P5YA 3VTAA 5TJ9A 1JDBB 3K8OE 3KKLA 3OJFA 1CUVA 2WHXA 4EABA 3FCUB 1W1UA 1KL7A 1NBOA 1O08A 2DQZA 3M1AA 4ND7A 2PMCA 2IEBA 5HG0A 4CV2A 2ZRCA 3AR7A 2ZJFA 1UANA 3ZK9A 4OH7A 1OZFA 3EPJA 4F72A 5KYNA 1KO8A 3E3LA 4M1MA 4NDZA 3KQOA 3HB4X 2V9PA 4JODA 2DF8A 3BKXA 1J7KA 3PJGA 3ZY5A 4BFCA 3ZV4A 4ZO4A 1U3GA 1T0JB 4O2BB 5EHXA 1K7EB 4UTXA 4YXWA 3FF4A 3B5IA 1KAQA 2EG5A 3NTRA 5B30A 2UAGA 4L15A 1FDOA 3V4SA 4BNVA 1HZZA 2DM6A 3BMQB 4UMVA 1YR9A 1ZD3A 2W00A 1QAQA 4GI3A 4BNUA 1G64A 1J25A 1BQ3A 1Z3CA 1Q6ZA 3SK0A 2OQVA 5CH3A 2GJ9A 4GZ5A 5FNVA 4IH1A 2RC6A 5LZ5A 5KNDD 2QYSA 1RAEA 3AYXB 5B7GA 4CR8A 3LMKA 4BRUA 5JEEA 3H4VA 3U4IA 3M9LA 1LW6E 1JHOA 1IEVA 1Z62A 4K9DA 3FXAA 1XQ9A 1W4BA 2IUTA 4N3BA 5EMLA 1GZ5A 3VH1A 4EUNA 1VPWA 1J0DA 1G4UR 4PO1A 3MK31 4ZPJA 2N46A 3ZXIA 1QHHB 2X22A 5JXWA 3WLEA 4CNBA 1GNLA 3UAZA 2MHCA 2XZTA 1IY1A 1MA3A 3FHLA 3A2KA 2VP3A 5DASA 3ZLBA 5A9RA 1IRIA 1DWUA 4NYIR 3T3GA 3MUFA 2E18A 2YJ4A 4PIMA 5J47A 2IPOA 5TEWA 3PEEA 1V7ZA 5L53A 4TMYA 4GR9A 2XUDA 1XPOA 2FCRA 4XFKA 3QI7A 2IH5A 4QYSA 1PFQA 4R9UC 1G66A 3HGQA 4E1BA 3WNQA 1BFUA 5HDQA 4YAKA 1RCFA 1Z6XA 2A7XA 2HNAA 1K97A 1NJSA 3ZCRA 5L7TA 3UHAA 3K1AB 5FYQA 2L0XA 2G07A 3UT0A 2LKDA 4PC3A 3TZKA 2BSAA 1NVEA 3GJ6A 2EFEB 1XRRA 2RJ3A 2ZJ5A 3P4XA 4TPKA 1Q17A 4OP1A 4QLOA 4R9NA 1KY5A 2EU8A 5IUKC 1KVUA 5CJJA 3QBDA 1TEHA 3ABRB 1EWTA 3HEAA 5EA2A 1L4GA 3O8LA 1EB8A 2RONA 4IS2A 1XU9A 3I53A 4ZOBA 2O8CA 1RJGA 3VXKA 4A2PA 3MJEA 4OTZA 3IHTA 3QXSA 4M0DA 2PGLA 3S68A 4E4RA 4F1KA 2D3TA 4FCVA 4DUZB 1JHXA 4OUKX 3HLTA 1MXHA 4ZYVA 3R8CA 2RE8A 1MO6A 4QT4A 4MVJG 4RVNA 4KQKA 4JN6B 5B5SA 2RHWA 4KHPB 3PGJA 4OHXA 3B89A 1H0SA 4HNAB 4UBLA 1OBCA 2IY9A 4ZHQA 1AKUA 2QENA 5HM6A 2WYOA 1D8AA 3VR6H 3SFZA 1CUAA 4EPRA 3TFQA 1LBIA 5D3MA 4IIXA 3GJQA 4JQCA 3IBSA 4B4VA 1LSJA 2CVHA 2QQFA 1NJ5A 1OFUA 4DSZA 3FAZA 3QUAA 4MGZR 1R6DA 3R9KA 3V7UA 1T0PA 3LWNA 4RA6A 2A0FA 4FUQA 1A9OA 2FZEA 2OK7A 3PG5A 4Y6GB 5JAPA 2J0QA 5GV7A 2ZSAA 4TM7A 1DXOA 3UWPA 3L79A 1L4UA 1WRBA 2QTCA 2AHOA 3OT4A 4NESA 1QORA 2QL5A 4U8HA 1P9RA 1EFDN 1ODTC 1TDJA 5J9FA 4NDNE 3UH0A 3H75A 4C4ZA 5GJBA 3QELB 1C3OB 4UUAA 1U0LA 1XRMA 5C8ZA 4O5AA 1UK9A 5FJJA 4L2IB 3TLEA 1E7RA 2JJ1D 3OD1A 4WESB 3P4UA 5FUBA 2HA5A 2WHPA 3UMVA 4AC9A 16PKA 2HSJA 3OO0A 1EQ2A 4NX2A 5IBPA 4BN5A 3G88A 5HGXA 2AMLA 2KE5A 3NC1C 2H85A 2G9RA 5EZYB 2ORED 2QRKA 3CU5A 1FDVA 4CIYA 5AHKA 1JDUA 1QNLA 1U2DA 2GARA 5GJWC 4BV9A 1OKKA 4XZ3A 5ETJA 1LX7A 2VOEA 3GEIA 3WWDA 3K0FA 3W77A 1MFZA 4BS9A 3ZZMA 1XF9A 5NLLA 2QLNA 2X5NA 4WLEA 5TGTA 1PVDA 3GJTA 3IBYA 4BVEA 1NFQA 4D81A 2H1RA 4X8MA 2PDAA 3FDXA 3TZQA 3FNRA 4GP6A 4KIFA 3WYBA 4HXGA 4C89A 2PS0A 3AR6A 3CZMA 3AWDA 1JIIA 2FKAA 1L3CA 1QIJA 5D51S 5TT0A 4DC0A 5AQ1A 5HQ3A 2ZSHA 3AR9A 1KAGA 1S1CA 1NUUA 3DO5A 3HR4A 1ZR4A 3PDIA 4KO4S 1HLGA 4B31A 1WVIA 5AOVA 3COZA 1BJRE 1DCTA 1NYQA 1FRVA 2W2LD 4H1WA 1YDWA 2GAAA 3HQ4O 1NVDA 1M6VA 1WB4A 1YACA 4MQ5A 2QXYA 2VDRB 5D3ZA 1KA9H 5KYVA 2PCLA 2HIAA 4IV0A 2HJVA 4HVLA 4NCBA 2RH8A 1DOZA 2JLCA 1OX5A 4BX8A 1IN5A 1KBOA 3PYXA 4RM2A 4QFMA 1QG6A 1U1EA 3AHJA 4DDUA 3VYSB 4GPAA 3NVMB 2NUTB 4E4YA 4E2YA 4ZJZA 1UK8A 4Y9DA 3OCJA 2IU3A 3HB9A 2F9MA 3U4QB 1P2FA 2WIDA 2MSEB 3Q7PA 4LYJA 3WIVA 3NRCA 1JVSA 2CD7A 1F2UB 3O5AA 4LPKA 2OSVA 4JQSA 1NZFA 2XLBA 2ZP1A 1V1MB 1I4TD 4BP3A 3PQEA 1B43A 4LYAA 4TZ0A 2XUAA 5KQMA 2OWEA 1REQA 1W94A 1XNRB 3WSWA 3OPYB 1QFXA 2C04A 3IT0A 1OBHA 5AW3A 1P9WA 2QRVA 3T9BA 1AGPA 1JKJA 1K66A 2CXXA 3TOCA 3GP8A 4WHMA 1DDIA 3ZZNA 1YUBA 3MTBA 2VF7A 4F96A 1B6GA 1IDOA 2ZAMA 1ETUA 1YE8A 4ZAXA 4YONB 5KTSA 5KPJA 2GNPA 3GIWA 4H27A 3AEYA 3K0CA 1IATA 2R0QC 1YULA 1Y1RA 1Z22A 1G60A 5T6MA 3D6VA 3C8DA 3KUXA 4YAIA 1R3UA 2QGNA 3HO6A 4AS3A 2AIRA 4JLVA 1RYDA 3R7DA 2PPLA 1SD5A 1S2NA 4C3ZA 4CN9A 4EY4A 5JXHA 2V5UA 4OHZA 4ZQFA 3QQ5A 4HD8A 3STVA 5JARA 3NHAA 1FP7A 4H31A 4UTOA 2IYWA 1SU7A 3URKA 2IBSA 4YXWD 4ZU1X 3AL2A 3N74A 4CCYB 3H5TA 1SCAA 2X3UA 3CRZA 1JHUA 1EFVB 1G8JA 3FUCA 2GBLA 3CNQS 3LHSA 2OFPA 1HQCA 4JMLA 4UATA 1GKIA 3FW1A 5KHOC 4JJZA 1BWQA 3G0BA 3KQQA 3SX2A 1COWA 2D0DA 5GMOA 2ZXUA 1LLDA 2EX1A 1XQXA 5ECWA 4HXFB 1H1DA 1PTJA 5K0CA 5F9MA 3R3ZA 4X3OA 3KKZA 2ILTA 4EF6A 4ZFNA 1WJGA 1IOWA 1B8PA 4JQZA 5CVVA 1G8SA 4NOLA 2AG6A 3FGZA 1H4QA 2B8TA 2XD9A 1VLZA 4CMGA 3EFHA 4HAZA 2OL4A 1RJEA 1X1RA 2RHTA 4F04A 4WOJA 3F4KA 5ABPA 1V8BA 1XTZA 4GX0A 4Y2QA 1R4MB 3KFXA 1XP8A 121PA 1MF7A 1T9GR 2CFOA 4G0XA 4ZRNA 5M5BA 1YAHA 5LP6C 3VC3A 4BNFA 4N4AA 1ZOSA 4V02A 2HK6A 2PVCA 2C95A 5EGNA 2R66A 5TQ0B 4B73A 2FPKA 3Q7TA 1UC4B 4US1R 3BN3A 5DBOA 1XFDA 3IAUA 2OOSA 3AOEC 4RK0A 3UV3A 2BE9A 2Q3BA 2CXHA 5A1TA 1L5OA 2XZLA 1M75A 2I8AA 2HRZA 1UPBA 3BB1A 3MS4A 5AXCA 5C0OE 4BO6A 2B1GA 1Z6YA 2JRCA 1QF7A 2BFOA 2PS9A 4RULA 2XYVA 2J87A 3CUEF 4JC8A 3UMYA 2WVJA 3D2LA 3DV0A 1ZOOA 1VG1A 2FPLA 3NOOA 3COSA 3TL2A 1ZUD1 3DVAB 1AHIA 3PKJA 5FJIA 1DG9A 3TI7A 4M4SA 3H65A 1HC7A 2XQKA 5CA0A 5KTTA 3DLPX 1NXWA 4M36A 3ISJA 4EHLA 5DN6A 3P96A 4MV5A 1AUQA 4F4DA 3GGPA 3ZXUB 3PFBA 2XE7A 4C08A 2Q9BA 4MK4A 2I3AA 2EKPA 1LBTA 1KEWA 1CJTC 3TR5A 2ZB4A 4IQFA 4KWEA 4N8DA 2Q4TA 2IA5A 4TVBA 4Q3OA 3TO5A 1D2HA 1KYYA 4O4IB 5I6DA 4DXAA 4AK9A 2ZJ0A 2NZJA 4D9KA 1MC4A 2YWJA 1M5RA 1GPMA 4ZXFA 5C7OO 1SBZA 1PKEA 2W4QA 3BMQA 2GPNA 4PZCA 4TTAA 3IVXA 3RK1A 1L8QA 2W22A 3NQ41 4KFTA 4R8SA 2D1QA 4EYEA 3B3FA 8LDHA 4J0FA 4NWIA 3H9CA 1YU6A 1LUAA 3MCWA 5CT5A 1J24A 2CHUA 2YH2A 3MB8A 3IP7A 4H2DA 1X3SA 4M1QA 2JKYA 3FGOA 4L02A 4R54A 1DIGA 4H7PA 5B4VA 1M2WA 1KEZA 4CPDA 1I7PA 4XWWA 4GVXA 4RFSA 4Q34A 4BMYA 2A1UB 2CHQA 1CZKA 2FG6C 3KXPA 3MN1A 2QPTA 1IUNA 4DQDA 4KFUA 4HR7A 3ZLJA 1NRJB 1U6IA 1CNMA 2IS1A 3AK4A 4FXOA 1S9DA 5JZMA 1QHHA 1ISRA 3IIIA 3QM1A 1W44A 3RUIA 3G1UA 5E3IA 1USKA 3P71T 2H6EA 3ANSA 3AERA 4AL4A 1L7XA 1YVEI 3L46A 3B3QA 3MGGA 2H5LA 3P2EA 2Y6VA 2IHNA 2ATIA 4INAA 4ZJUA 4DV7B 2AG0A 3TLCA 3ILVA 1ODLA 3EXFB 4ECEA 4QGSA 1FJ2A 2GO1A 3BXPA 3TZBA 1ZKDA 2WAAA 1D5WA 4V0QA 2YXDA 4GKVA 2DFNA 2W9XA 1OKKD 1XD9A 5MGNA 5E38A 3WA7A 4GUDA 4DWOA 1NIJA 3GUCA 2BH2A 1NOJA 1X19A 4LF9B 3DMYA 1QANA 3MD0A 3K1AA 3A9UA 1IBSA 3U3OA 2ZUSA 4F91B 1OLOA 4TUYB 1EWYA 4QNRA 3OZGA 2GJAA 5CYPA 3MXOA 4K03A 5AW1A 3DE0X 1CJCA 3TVDA 1GA6A 3DM5A 4M21A 5H81A 1PFYA 3EW7A 2ZIXA 3O38A 2B2XA 4MYTA 2GN1A 2RAFA 3JALB 3H2SA 4IUYA 4B4DA 2HPZA 4EKIA 1AKWA 3RVPA 2DKNA 2B8WA 3LG2A 3WGHA 3PNQA 4BUJA 5ALGA 1ZITA 5H9WA 1ZL2A 1J8YF 1XDGA 3GFPA 1QPZA 3OETA 2VWPA 1M8FA 2NUBA 3HVUA 4HNAA 3UHPA 3ZV7A 4EUFA 2HMWA 4V0KA 4D98A 1K98A 1NPTO 3SR0A 2YRFA 2C5EA 3N7UA 1B42A 2ZT6A 4BNNA 1F2TB 5HA5A 3FVWA 4B6QA 4OCZA 4I8DA 5K3EA 1T6YA 1UOOA 1G41A 3IQHX 3DAHA 4WLOA 3A9VA 3L8ZA 3EEFA 3QKTA 3WWCA 3ZNOA 1HE1C 2VYQA 2J07A 4YP9A 5HBRA 1RQPA 4EG8A 5LP6B 1JKXA 5DV9A 3WDLA 1AHNA 1R8XA 1T8TA 1U0JA 3K9CA 1NQVA 4MVJD 1R0XA 2PX2A 2REXB 2V7EA 3A6HA 3K9QO 3SZUA 3AO0B 5KI6A 1TGYA 2GEVA 1WF6A 3JCZA 3NHRA 3JWEA 3ZDAA 1NQ5A 1WSAA 1L5NA 3R6LA 1WBBA 4QXPA 3SHFA 4AYXA 1Z7YA 2Q3CA 1E2BA 3QELA 4JDUA 4GLOA 3DP9A 3WG9A 4N0MA 1EFHA 4L2IA 2YWCA 3UV6A 1VMAA 4WESA 1GSAA 4B7ZA 1AZWA 5IN5A 4DJ5X 2EBHX 3DEIA 1D2MA 3P0FA 2IYNA 4OBXA 1QONA 1Z8HA 2JLRA 3RSSA 1SXPA 5K4HA 4QZVA 1S4QA 4OP2A 1LJUA 4FI3C 5EZYA 1ZNZA 2H18A 2AJDA 2YX1A 3S1AB 4B3XA 1GCGA 4ZCTA 3O47A 1YQDA 2BYTA 4B3GA 1WSDA 4I1YA 2HDHA 2WSMA 3VPAA 2C8KA 3B2NA 3GJXC 1IOLA 3OCVA 4J07A 4NYIQ 2P7IA 4F3KA 5KX5F 4L72A 2W4IA 3LBIA 2H1WA 4FOPA 1P2GA 2NVWA 1TC1A 4B3IA 3KQWA 3WNCA 1AMOA 1KR5A 2GN8A 1NTRA 3QE2A 4AS1A 3V1NA 1LJLA 3OG9A 5EYPA 2WJAA 2W11A 1KK2A 3NBYC 1D6MA 3QBTA 4JP2A 4YTEA 3TL3A 1D1PA 4D8WA 1IWBB 1E1LA 2IP2A 1RAIA 3WLHA 4LC1A 4QQFA 1VMKA 4V0OA 4B80A 4LRTB 4HBGA 1UKBA 3QHQA 4W5OA 2DFDA 1QHFA 1E0SA 4CLRB 4L51A 1COWD 1TQHA 3K6JA 2PJUA 1YS6A 3PD0A 3O83A 1T8YA 5FWAA 2C57A 3EQ2A 1L6IA 4K0RA 1IJBA 1J99A 3PI6A 3ZWBA 1I51A 1AN9A 2GCPA 2J9RA 3FNIA 3ZHVA 4B40A 5JU6A 4HUJA 4KVZA 2B34A 4WXHA 4IS3A 1JLLA 3P0RA 4PSDA 4FDTA 4P33A 3H8WA 3QX3A 3C3KA 4L16A 2UUOA 1YSCA 1EFUA 3AFGA 2NUTA 5G1OA 1E5LA 1XI2A 3D31A 1VL0A 3V1KA 3C6BA 3NG1A 1CDEA 4MR9B 4Q37A 1KMHB 5BQ3A 1KQGA 3KZVA 2AZDA 1YE3A 4FGZA 4F9EA 5A2QA 5JYEA 5KPDA 3AF5A 2ZIEA 3E9DA 4J7XA 3QU4A 3V3TA 3ZK7A 4LJSA 4M8NE 3C3BA 3RV4A 1R18A 1RMYA 1V1MA 3ANYB 3U9LA 2B4QA 3WGLA 5IBCA 3O9VA 4KE6A 1IZ9A 4O4LF 1FVOA 4PEVA 5ALIA 3PC8A 3N7TA 5ICFA 3T3EA 5JWOA 1H5QA 1ID1A 4W82A 3VPSA 4I3HA 1R8QA 3N2IA 4PCLA 3FOEC 3S2EA 3QW4B 4LY6A 1RCTE 4CMHA 4F8JA 4PO8A 3L4JA 3KUKA 4JI8B 1E3SA 2ZJOA 1NVBA 2JATA 4TXNA 4RJJA 2I9KA 3M5DA 1EHIA 4CNQA 1XIVA 3H7AA 4LOJA 2QTWB 4EL0A 3E84A 3LQ2A 1TAHA 4MJXA 1YRLA 1Q0QA 1Z0AA 2P79A 2VRNA 3CZPA 2QRJA 2Q2VA 4GSLA 2WZBA 5DN6D 5IJ9B 3QBEA 3W5IA 1RRKA 2PEZA 3PNLA 2RMKA 4MIYA 1ZXLA 3BHNA 4IUCS 2AKYA 5KWEA 1YBVA 5E95A 4RZUA 5FL3A 3S6JA 3KAPA 1C9JA 3U3RA 4GX1A 2BMJA 2WFLB 1QF6A 2D74A 3OOYA 2NT4A 4UDYX 3SYNA 1H2WA 3B6MA 3DLAA 3H0KA 3CLTC 3GRVA 4BFUA 4CCYA 1IXRC 1J9EA 3BILA 3LPNA 2IDJA 3DBHB 3HEBA 4ZRDA 3D2CA 3F8WA 1U6KA 4MVXA 3ICCA 1ODSA 3DZDA 4ZWNA 3QMWA 1N6LA 1YQTA 4CV1A 1CFZA 1A8IA 4Z3KA 2HL6A 1N8KA 3JAKA 4Y6RA 3SMQA 1V39A 2Q8NA 1QC5B 2M98A 1E1NA 3GJ5A 3PA8A 4BCBA 1Z28A 3BBPA 2AG8A 4D79A 4EARA 5C7YA 3GEMA 1KC3A 1WIWA 2MDTA 1DWOA 5DLPA 4PVCA 4A73A 3KDSE 4Z9YA 3KKMA 3T1QA 4O2LA 4XFDA 1R4MA 2FZCA 4M99A 2BKLA 5IYZA 5JJBA 1R0YA 4C29A 2AR7A 1PZXA 1VI2A 2XR1A 1G19A 3TQFA 3I2HA 1ZUIA 3IUMA 2C96A 1E6KA 1T0HB 2F1HA 2X8WA 4PSAA 4X24A 2ASVA 3HXPA 2WWXA 5F5XA 3WGMA 4DY6A 1IQ0A 3K7EA 4J29A 4DCSA 1A8HA 1N5LA 4WK0B 4JI6B 4BIMA 3UJBA 4ZVMA 4ZYWA 4YUZA 1GQ2A 2RB5A 2WJJA 2QN9A 1JHYA 1C41A 1BGWA 1N2CE 4ZODA 2FEPA 2VPXA 1K8XB 2WQZA 3RUEA 1H2BA 1A27A 1U31A 2YUTA 3OECA 1KHTA 3GVHA 3TN7A 3UAYA 4FSXA 1O6CA 1G8MA 3DVAA 1K0FA 1LPPA 1N4DA 1O4VA 1ZWLA 2P35A 1MJFA 2E1RA 3CWCA 4UBNA 2YXLA 4PSVA 5LUBA 4JZYA 3VZDA 1I7SB 3E1SA 4CTJA 4UKDA 2R5WA 4FEEA 4EW1A 4EG1A 5E7JA 3DEKA 5LNK1 1PR4A 2IIPA 2XWBF 3GH3A 3H2HA 3OPNA 4DQLA 4FP9A 4EHJA 5K09A 3GY0A 4IHAA 3CLVA 1SBHA 2Q0SA 3EMKA 4I5GA 5JSZB 1XLVA 5LZ9A 4PHTA 2GM3A 2BMAA 1JIJA 2AE2A 3KQPA 2FMHA 3L1KA 1GILA 2HU5A 2J48A 1AF7A 4O4IA 4LV5B 4QFCA 1G63A 2CCGA 4JIMA 3TINA 3VI4B 3VR4A 4D82A 4Y6LA 1YIOA 3RVLA 1DPFA 2NUPB 3FX2A 1ECFA 3IILA 4L6AA 4WKGA 1P8AA 2WWVD 4Q6WA 4DCNA 4Z4EA 2R7KA 3IL2A 1WO8A 2I78A 1UUFA 3HABA 2RGGA 3SS7X 2OAGA 2RGUA 3F4BA 3O0DA 4GOJA 2P2ZA 3MWFA 1AMNA 2JCSA 3UEOA 3W3ZB 4W99A 3VR5H 5B3AA 4L9AA 3SR3A 1RC0A 1RHUA 1M83A 1SG0A 4OHCA 4R51A 2BMDA 4WNCA 2FJPA 1SCUA 1NNLA 1CUDA 2AW3A 3OJCA 3TNYA 2H9YA 3EIHA 5E0KB 3T1NA 3TKLA 4LJRA 1GPYA 4TT3A 1II8B 3ZC3A 4F9TA 3T5PA 4AQ7A 1R6VA 3ZWOA 4D7AA 3WKDA 4B6EA 4FLFA 1BIFA 2EFHB 1EK0A 3C87A 2Z5VA 4F12A 1E7WA 4MHTA 2PV7A 3ENQA 2FWAA 5PGMA 1J0CA 1QV9A 4A1FA 4YV2A 1F9AA 3UK1A 2UUPA 4W63A 2FZKA 1B1CA 2GASA 4FGLA 1UXHA 3PGLA 5CA1B 3EF3A 1BOFA 4ODIA 5BSMA 1P72A 5HX7A 4RPGA 4B3MB 3OZWA 4EECA 1BDHA 1QOZA 2DUUA 1CW2B 3D6TB 4H77A 3UJCA 2FF7A 3B3JA 1KZGB 2D1YA 1RXVA 4NRDA 4F93B 3IUYA 3RD5A 4PXAA 4NFSA 1YC2A 2HQSA 5JAZA 3GX1A 4WUVA 4H7KA 3BDAA 2QR3A 3CRVA 4KACA 3SQLA 5CM9C 4ZK2A 1N75A 2D5IA 3F5DA 3MMNA 3ZKWB 3JALA 3U19A 2JLVA 2ZG6A 1P17A 1RS0A 2V03A 2XCRB 3M9XA 2HCJB 2CXRA 2OO5C 4PLVA 3HK2A 3PEFA 1Z68A 2CMDA 4DIKA 2EHDA 3R3VA 4P22A 5HYVA 1TJ4A 3WGTA 1T3ZA 3TTVA 4O6VA 2P7HA 4LGCA 1CT9A 3OZSA 4N40A 1KI2A 1RW4A 5KB3A 1CS0B 5EN4A 3VOTA 4IQGA 3HKEA 2HA3A 5FLXA 4DWVA 1ZLYA 1U1CA 2H2HA 3ZE0B 2D6FA 1E0AA 2ZFUA 2H48A 3RRFA 2CB0A 2R8YA 3JVVA 3LT2A 4J1SA 2ZR9A 1NRXA 4TTPA 5AXBA 3RDPA 2ZJ7A 2V54A 1CQIB 1T1IA 4UU8A 5C7IO 4GMDA 2LE0A 2A9PA 5DYNA 2BL4A 4M0LA 2CFIA 4ZU6X 2C20A 1SHUX 1HNNA 4J3FA 5H59A 4AN4A 4HV4A 2C9DA 2CNOA 4UULA 3J80A 3HVRA 3MOGA 2X0IA 2ACEA 2YHAA 2FVXA 1N5KA 3IMCA 3K1ZA 3OTQA 2XVXA 3LK6A 1E6EA 5TGZA 4DLLA 1EJBA 3H1BA 3MWKA 4JLBA 5A3SA 3D6JA 5HZHA 5CTJA 3H6GA 1FVFA 5K8TA 1GSHA 1FU8A 4FR0A 1K7YA 1XX6A 4U2DA 3H1AA 1MHPA 1JFVA 2QMUA 1DXQA 1L7BA 1RKUA 1UBGA 1GEGA 1YK1A 2IXGA 2OXRA 1SUWA 2QN1A 2YWXA 3FWNA 4EY8A 2B6NA 4H4CA 2C99A 4OBEA 3HDHA 4E0BA 5G0WA 3BSSA 3DO8A 4RVGA 2HTFA 3LSYA 3D43A 4ZVTA 4PM4A 5LQKA 1SZPA 3TGPA 3CNBA 2C4WA 1MB4A 2ODEA 3EXIA 5CGQB 2K87A 3A1SA 4RPLA 4ZT4A 3MT9A 3OI7A 2VHYA 4G1UC 3JAMA 1QOPB 4F85A 3AJAA 1DFGA 3BD7A 5YASA 3VYWA 4DIOA 3VMFA 4XX0B 2C7QA 2IRWA 2P4HX 4BBZA 1PJRA 1ZOIA 1I4LD 4RVFA 4GPEA 2COKA 2WG0A 3IT2A 2R8RA 4RIGA 5EJGA 1CY4A 2J3KA 3PL1A 2HA2A 1OFUX 1BYUA 3BH6A 1TVKB 3F98A 3R0IA 1JFFB 3TRJA 3EXG2 3M8KA 1AZLA 4XWTA 1GPKA 2ICAA 2GXQA 3EZ9A 2B7BA 3L8YA 1CRPA 3NW9A 3IIMA 5J2TF 4FJ0A 1U7XA 1YC5A 4OMDA 5FBLB 2MJLA 4CQJA 2GMWA 1S6YA 4WY8A 1RM3A 2BLNA 2CBGA 3UT5B 5C9ZA 2RHOA 3ABOB 5JMPA 4DCVA 3T5CA 4CLRA 5JCPA 5KYYA 1P1CA 3INNA 4AM8A 1JU3A 3IB3A 4NCHA 5AVQA 4CODB 2HU8A 1HDXA 4V1CA 3RRJA 3UMBA 4F1JA 1XTVA 1U7UA 5CR9A 1GPUA 4H7JA 4OVKA 3LY5A 3SIPA 1SOMA 5E4JA 4W8HA 3A32A 3UMRA 5DNCA 4N8EA 3IKTA 1GA1A 2PUGA 1B4DA 1HDIA 2P2GA 3MQ4A 2JHAA 3TTXA 3K9WA 1HYBA 1EDZA 2FP3A 2GZDA 4G4SO 4G56A 2V6GA 2CVQA 4M1SA 3S2IA 9GPBA 1QG4A 1F0NA 4B6OA 2Q3HA 1G9XA 2QZZA 4D56A 2KBFA 2J33A 3PDCA 3PSHA 1ZWKA 5J23A 1L3BA 2FUEA 2RG1A 4LFCB 4B8ZA 1HNXB 1TD9A 1D8TA 4IHJF 4AY3A 3GLFA 4CKBB 5HHTA 1YR8A 2PA0A 5JCOC 5IXSA 4MVJI 5KMGB 4Z4QA 3F1LA 1Q1NA 3VBCA 3NALA 4ESOA 2VHJA 4UEOA 1VCHA 4X1IB 4Q4CA 3QNWA 2ACKA 2JFPA 4OFXA 1QG2A 5KNDH 1Q7GA 2P6RA 1MOZA 2AA3A 4MA5A 3BBLA 1BQ4A 1ESDA 3AM3A 4F5EA 4U2CA 2AN5A 4ZO9A 1E2QA 2CLLB 3AI7A 4QQRA 3MYRA 4BHTA 4B3DA 1ENZA 1TKCA 2C82A 3ZX5A 4BX2A 1NVKA 4ZN6A 1X80B 1GZSA 4KYUA 4LVUA 1ANKA 4ALKA 3GJZA 2OP1A 2X0DA 1GTRA 3DLIA 2IZZA 1I1OA 4J6EA 5EPUA 3T7IA 5B2EA 4H1UA 4JYMA 5BN5B 3VR2A 3C5VA 2IOFK 3KQUA 2A30A 3N2KB 4JBWA 4KYIB 1E1MA 3W2EA 3THRA 3GW8A 3VQTA 3B52X 1TYDE 2LXNA 5IX8A 1T13A 2WFLA 4MRMA 4CFYA 1YO6A 2XCOA 4QG7A 5LZ8A 5IMSA 2FEWB 3D4NA 3VR4D 1VZ2A 2WC1A 1Q74A 3PTLA 3UOGA 3V6MA 4EX7A 1LDYA 5EJ9A 4BLRA 1Y1KE 5SZHB 1XAGA 4JOCA 1M7BA 1CZHA 4GI2A 4YLEA 1O6BA 2NMVA 1HEYA 1LK5A 5C37A 1N6HA 4LF6B 2H1LA 5K0FA 3GRRA 4BQPA 1ZU4A 2XUHA 3RAJA 3T7AA 1EGMB 1XYVA 4RVCA 5LOVF 1CEQA 2OG1A 3LWDA 4KQ9A 5JIBA 1U0GA 2WSYB 1M8KA 2AXQA 3ZW8A 3IUBA 3A6PC 4O33A 3BFXA 1JDZA 2NADA 1GGFA 3C6QA 1Y7TA 3O8BA 3AEUA 2GF2A 1U2EA 3B82A 4TT3D 5TX7A 4EYGA 3HMQA 3AVOA 4EK9A 4DADA 1P31A 1P9NA 1TQ6A 1P7VA 2P0AA 3ZJ5A 4YO7A 1IBCA 1V37A 1C3LA 1QGYA 4HDAA 4ZI7B 3UF0A 2G1AA 2H07A 3CW8X 2QX6A 3SZGA 5L6LB 1YJXA 1SELA 2JLQA 4DQUA 2Z6AA 1VSVA 3TMYA 4EP1A 1KP2A 3VVMA 2J0UA 3V00A 3H6KA 4BQEA 1MA0A 2X19A 3JATA 4L5JA 3GUVA 3LIPA 1EFTA 4YMTA 3UB3A 3PC7A 1L5YA 3QZUA 4DANA 5IH3A 1V4NA 2WQ6A 1STOA 3II6X 5DU2A 1KPGA 4IPTA 5EJ2A 1U99A 3BGOS 1LRJA 3GG9A 4JLMA 2PKXA 1BHQ1 2IVZA 3L0BA 3L7OA 3F7OA 3R7WB 3EULA 1VCMA 2XF8A 4ASUA 3CG0A 4G5OA 1AXGA 1K75A 1KK1A 1E2DA 4GLJA 4GL4A 2C5LA 1MOQA 3ADOA 1FDTA 3HTXA 3WGZA 4IZ6A 5HJ5A 1PX2A 3A14A 3LW7A 3EB9A 2CV2A 2OZVA 1VLHA 4I4NA 1KKLA 3CEPB 5JSZA 2R84A 5FXMA 4TOIA 3BH7A 1DT3A 3JAWB 4KUGA 4CF4A 3K4QA 1ULSA 4K40A 5FOUA 2DBZA 1CPYA 2H06A 1HORA 2J4FA 2F1KA 2NUPA 5HCNA 3ROKA 4BX0A 2P8JA 1RVDA 3FRJA 3A70A 2H2AA 3MBKA 3NHJA 4QRIA 4PANA 5CAEB 3W9BA 1GUYA 4G5XA 4CMCA 4K81B 4FYVA 4D97A 2A9FA 2C83A 1T5BA 4ZO7A 2BVNA 1X1CA 4G81A 2D06A 4LF8B 4H0CA 1VSUA 1ZDMA 2BY4A 7MDHA 3KL4A 1FVHA 3FH0A 3TLZA 1HG0A 1C0KA 5MDHA 4RF4A 1XCLA 3MIZA 3TRIA 1KJYA 1II8A 3EH1A 2C61A 1XSEA 2VNSA 3TSWA 2CVFA 3ZQKA 3C5WP 2ZULA 3FLBA 2WIFA 1SZDA 2BGWA 2DT8A 3DXFA 4L0CA 1V43A 5EERA 4JI7B 1MT0A 5EUQB 1AS0A 1DZ3A 2DFKB 2KLBA 1QZUA 5LNK6 1RJDA 1P4SA 2FZVA 4Z86A 4GLBA 4BRWA 3DDWA 2JVIA 2OAEA 3JX9A 4IRUB 3DZHA 1U7TA 5JBQA 3H87A 4ROTA 4PLFA 1SU8A 3EFBA 3JQ7A 1CDZA 1Q15A 2M1ZA 1PNVA 1JR4A 2R7AA 3HFGA 2CLFB 1FP1D 3TG8A 1Q2UA 1SHLA 1N77A 3MILA 4A2QA 2QJTA 4GGPA 4KITB 3DWEX 2Y1XA 3QIAA 3U31A 4CKWB 4Q4DA 1PNQA 3D6MA 3LYHA 1ZJ6A 3O0TA 4FMDF 5JW6A 1SUPA 2F1JA 5DXFA 5EKSA 5JJ5A 4G2TA 4QYTA 521PA 4DPKA 2IEZA 1NY6A 2JJ2A 3AP2A 4PS0A 5H68A 1XWIA 1J21A 4M37A 2NPIA 4RF2A 1LTHR 3KT0A 2TMYA 1R5JA 2VDVE 3EVFA 2FMKA 2J41A 3RHZA 4TV8A 2LD4A 5AESA 3BERA 3RJ9A 2W2VA 3WMGA 4RO0A 4MROA 3QTBA 4FJ2A 3ZJVA 2G6BA 4JT4A 2RG7A 1Z5NA 3WV4A 2XKKA 4Q93A 2QNIA 3KZKA 2CXTA 1CS0A 2HXYA 4PGMA 5AVWA 2B8EA 5FBRB 3RK0A 4A0RA 2FRXA 5IDYA 1YZLA 4QBHA 2J7KA 5BV0A 2I66A 4DR4B 3CH7A 1SC1A 1JRLA 3Q40A 3RJTA 2ZYWX 1JPUA 4K9NA 1ZR2A 1IK6A 1HK7A 1PW7A 2VYNA 3ZIUA 2D0OB 1NDUA 3KUCA 2ZUVA 5ALXA 3PF9A 3B12A 5KVQA 4JLPA 5KREA 3DGFC 4YCNA 1AGYA 2KLHA 4G67A 4HO1X 4OQZA 1RMQA 5LQUA 1TTPB 1TIKA 2O7QA 4K9KA 4RPHA 1FF9A 3T41A 1EFLA 5JMOA 4RGVA 1AUOA 3TAXA 2R87A 4HFNA 4IHQA 2CUTA 2VJLA 2C0QA 3HBFA 1KPHA 4NE9A 1SO8A 4RZQA 3WMRA 5AUQA 3ZX4A 5E6RB 4M9CA 4NULA 1E9DA 1U0OC 5ADVA 3QXCA 4RH3A 1KKUA 1S2GA 1DTWA 3LCJA 3ZU4A 3EQ7A 4B75A 3O1JC 3W8DA 4RD6A 2HHJA 3PXEA 1XD2A 2YWBA 2O2DA 1CUJA 2ZVJA 2X1MA 3KYBA 3QKIA 4JSTA 1U9IC 1ORRA 2NP6A 4I08A 4IUBS 2Q4DA 4BPRA 1Q1GA 4JVSB 3OH8A 3THYA 4H3SA 3ND8A 4REOA 2HIGA 1NUSA 1GQFA 3CLSC 3TSCA 3VR2D 2C9BA 1PKXA 2Z3VA 1GARA 3R7LA 3L5OA 4V0ME 1QCZA 1TVKA 3HADA 4TYQA 1JFFA 5HK9A 1JEYA 3RVJA 5EIBD 4PCAA 1NAHA 2JFXA 5ESRA 3WP0A 4U9HS 3SOZA 3D6AA 5IJWA 5KTNA 4E1AA 5BN4B 1Z5ZA 1NNSA 2GYVA 2YXBA 3X1DA 3R23A 4YK7A 5CFMA 3TEMA 3GEBA 5KOHA 2ZUBA 1JXAA 1YB1A 3G82C 3ITDA 2AOXA 3IPCA 3FMFA 3FKQA 1VL8A 1T6NA 3NNSA 4GOMD 3UT5A 1OCEA 1KAHA 4IV5A 4TGLA 3QHAA 2DULA 2RIPA 3W2FA 4IEEA 2DQ4A 1NYTA 4NATA 2Q2OA 1KS9A 4EDFA 1U1FA 2D5LA 4GKAA 3KEQA 3JASA 1VRVA 2BFCB 4H3KB 1ZISA 2DOKA 3FCSB 4WQMA 5D84A 5C3UA 4J3NA 3TSYA 4BJ1A 5EZSA 3TLJA 3OT5A 5DW0A 1C8VB 1WE2A 2V6MA 3SEFA 3HLKA 2JAHA 4ARZB 2GS9A 1UINA 5L7WA 3B1JA 4E2ZA 3E0QA 3LT0A 5LWQA 1N92A 3BYZA 2GEUA 5ALLA 1FSFA 1WZIA 5B55A 4W5JA 3ZE2B 1UAAA 1P5FA 5I48A 3P0EA 5IM5A 5JDCC 4AYTA 2D4HA 4XGRA 1ML3A 4QSHA 2A5JA 4MARA 3GRZA 1EVYA 3QXHA 4C0LA 5KMGA 1TTQB 1NNI1 1N5RA 3A6ZA 2GZ2A 3BD6A 2G77B 3RAGA 4BQNA 1E2GA 4TYYA 4ON9A 2G1KA 1OILA 4PQEA 1F20A 1TM1E 4P4LA 1U8TA 1R4NB 2IYZA 2FR8C 2PH1A 4TS9A 3F6RA 1ZGAA 2O20A 4AX8A 4C2BA 2IYVA 4QUHA 4RY8A 1IZ8A 4TZKA 3FR8A 5IFKA 4RVHA 4X62B 4TXMA 9ABPA 1X80A 3OC6A 1B00A 2WINI 2FXVA 3E9QA 2WD9A 4ASUD 1Q21A 4J9UE 3AGQA 2HV8A 4XPIA 5J4KA 5EIOA 1NV8A 3PE4A 3WLSA 4GZMA 2Y27A 5IBRA 3V48A 4REMA 4XM0A 3GLGA 3RFVA 3N2KA 5DGXA 1BRMA 1MX9A 5I9SA 1TYBE 4II3A 4G4SP 3EDOA 4PX9A 1BVRA 3F1KA 3IEXA 1SKYB 3IAAA 2R6FA 4GOLD 5ALWA 3UKOA 2YV2A 4E21A 5HF6A 2DYKA 4B32A 2X6TA 2PU5A 4UD6A 4OSEA 4BN4A 4S1NA 4D42A 3NUGA 1XVLA 4A26A 2FWJA 4KLAA 1LH0A 4XQEA 5LQNA 4QM7A 2NU9B 4WLNA 4F5DA 4QUIA 2IZ6A 2Q4EA 3RYIB 3EIQA 2FXIA 3AHDA 4NPCA 1HYQA 3R3YA 5D6OA 4HYTA 1X9GA 3K0SA 3RBVA 2ZRPA 4D9BA 1GAEO 2G0TA 3C1UA 5AKEA 3HY3A 4AU1A 4PZEA 3F6SA 3F5SA 1SVSA 1E18A 2UUCB 3MJHA 2PH3A 1N57A 2WWGA 1G5FA 4KKVA 3DKPA 4FFSA 1QIEA 4B2YA 3CLRC 1ZJZA 2XDWA 1ATIA 4IIJF 3EZNA 4B4UA 1YQXA 5B64A 3SSNA 1W2GA 2D2EA 1KZ4A 4C20A 2YIDA 4FMBB 1G0NA 1I10A 3S2FA 1KDVA 1PZFA 3ZUGA 5IKEA 4KEAA 5FD8A 4ZI7A 1DLIA 1FXWF 2PWYA 5LU9A 4INZA 3KB1A 1X7XB 1VPEA 2PIDA 4FX5A 4TYWA 3LLUA 1NW9B 2QJOA 1BGXT 2J5XA 2QQGA 2WIBA 4CQLB 4KVGA 5KCMA 2QG4A 2I8CA 1N8NA 3EOAI 4GI1A 4BZWA 4PAQA 2AJ8A 3CN9A 4MVJH 1TZKA 2C2GA 4UFNA 4M0UA 3KEGA 3LUGA 4J76A 1NMYA 2QM8A 4OJQA 3K30A 3CCBA 4RK4A 1OA1A 3ZHZA 1LF5A 3DPUA 3QE3A 3E27A 5JWHA 2XV1A 1Z0SA 2VJPA 1USWA 2CJFA 4BQFA 1TUIA 3TLXA 4YECA 3R7WA 2EAUA 5BRAA 1ICIA 1VKZA 1DUVG 3HWX1 3LPAA 1G21A 1FFWA 4MPPA 4MRVA 4N6GA 5BUCA 1ACMA 3VU9B 4K9PA 2B0JA 2BIFA 4MQEB 2JJ2D 2R44A 4Q9JA 1HH4A 1JNYA 4OI0A 3MT8A 4FMCF 1ZZEA 1J2YA 2OD7A 1A9SA 3IOCA 1DZIA 3A11A 4NI5A 2FRDC 5U9CA 4WBNB 4AJ9A 2JAWA 1K6JA 3WGJA 2HRDA 3BORA 5HOEA 1HM5A 2VK1A 5AK6A 4FYKA 1RWKA 5FL7A 1WW2A 4PC7A 2MINB 3AEKB 4KWHA 5IT5A 4JBHA 2C58A 1D9ZA 2C54A 3LQRA 3N75A 4C22A 4EI9A 3TWOA 4O2AB 3PHCA 4I1SA 1V5EA 4N76A 1Q1EA 1A2KC 3V7NA 4LZJA 4CLOB 1EK1A 1FMLA 5CAEA 3BGWA 3K15A 3ZWCA 3TXYA 1DKMA 3JQ9C 3OY2A 2QGFA 2V96A 3ERCA 4RD0A 2WVAA 2VYND 4PWYA 1UAGA 2DPYA 2I4TA 3QX7A 3SYRA 1ZI8A 1AQIA 2NZUG 2OLKA 1JDNA 1P7YA 3CVOA 3DVQX 3H9GA 2QMHA 1UFQA 3SQOA 2Q5HA 3GDGA 5EKXA 4IWXA 4IIHA 4WCVA 4DBLE 3UAVA 3PWTA 1KJIA 1R2QA 1R12A 3A9RA 2X1VA 3ZVKA 3DE7X 5TV2A 1MZPA 3O75A 5HE9A 1JTEA 4O0MA 1C7ZA 2V3VA 4PRZA 1YKSA 3EEBA 4OQPA 1C4WA 4Q18A 4TMFA 5IKOA 2IOHA 4Y6QA 1JJVA 5P21A 2ECPA 1X7GA 1Y3DE 3FNGA 2DR2A 2P1RA 4FQ7A 4UAGA 2RGEA 1KI7A 2G0AA 1MH1A 3DUWA 1XEAA 1HURA 1O97C 5JT1A 4ESVA 2VRCA 5KSPA 5TPZD 4EZIA 4G5FA 3C3XA 3OZTA 4L76A 4LJAA 4X9XA 2D8MA 3UC9A 3IX7A 4IL5A 4TXLA 1WHSA 3WB9A 1IHOA 4L07A 5CDYA 4CKWA 4FFVA 3K1YA 4R1TA 2XH8A 2O0KA 2IYEA 4I81A 1GADO 1Q7RA 3DBVO 5FIUA 1V1JA 2F7SA 3LS2A 1P7WA 3DFKA 3HR7A 3MQFA 4RORA 4DLKA 3EBOA 5I7UA 2HJSA 1EI9A 4HDKB 1G8HA 1ZXXA 3L1IA 1ZGBA 2V4MA 2W6IA 2PRJA 4YRRA 4AJOA 5DGCA 2VR1A 4ZKEA 5EE1A 4DLNA 4PNZA 4MRSA 5EG5A 3ROGA 4FWTA 2B61A 4G85A 1WMEA 3BWVA 5EQDA 3TPCA 4AAYA 5D5QA 1JH9A 1N7GA 1IXYA 1DAKA 3ESQA 4RV9A 4CL2A 1NQOA 3HB7A 4CMIA 4AS2A 5I8ZA 1XHLA 5DPMA 4U7TB 1V16B 2GD6A 1GV0A 4IJWA 3SZ3A 1XMSA 1MPXA 2XE4A 5F76A 2X3FA 2AC4A 4KXVA 4ZYXA 1J8QA 2PMEA 2QTZA 2P1ZA 2OV2A 2C3YA 4PZ9A 3WLAA 4X64B 2YL2A 3ZDFA 4NZPA 1WSWA 2FQXA 2O59A 2HADA 1EZZA 1FQOA 3GLHA 4CTKA 4GX2A 4NG4A 1NLZA 1V5GA 1YDEA 3LH5A 4K46A 2PUEA 3KWJA 3R5KA 2EFCB 2IYPA 3GA5A 4GKKB 1O2DA 4H59A 4YS6A 5AFSA 2IPNA 3PFHA 2JIZA 3P9PA 3U4GA 1LK7A 5E1OA 3LHFA 3I01M 2HMUA 4ETNA 1TYAE 2H1SA 1PLLA 1Y34E 3VO2A 3K35A 4MR7B 3COVA 4I55B 4A6PA 3GRAA 1EGHA 1T9ZA 3C24A 1ZK0A 5JASA 5E6RA 1LRKA 4FOSA 4X7RA 4LVCA 1RXIA 5EKTA 1D04A 3VPFA 3RH0A 2IWRA 4CZ2A 4MWBA 4IJQA 1SVLA 5D01A 2CBXA 1K63A 3B3GA 2QUKA 4LNHA 4HP8A 3F6BX 3NU1A 3SVZA 4LJYA 4QTUB 5C8VA 1D9XA 3OCUA 4HNTA 2LKCA 4RQUA 1S2LA 2WOOA 4GF5A 1DKRA 4HRXA 1Y5RA 1U98A 2OLEA 1SXGA 1SVUA 4OX9Y 2WWTA 5B57C 2Z9CA 3FMIA 3IHKA 3QX8A 4H18A 4XFJA 1M1YB 3LU1A 2Q4BA 1E5DA 4Y0VA 2Z1DA 3AINA 3PENA 5KNLA 1RZ3A 3VR0A 2ZBEA 5BN4A 4HNRA 4OSOA 3G7UA 3G5UA 1FQJA 1JQKA 1XCOA 2DRIA 3GXOA 3NWEA 4XDGA 3TAUA 3WRYC 1PV2A 2VDKB 3IT1A 3T9DA 3WYFA 1L7OA 1G5QA 3PC2A 1OXKB 5T4EA 5DHRA 3SF8B 2XMCA 5FPSA 3E7XA 1OAKA 1S2OA 4YALA 4DR7B 4DLTA 3H1EA 3MMXA 1K8QA 4J0GA 5BOSB 3LOQA 1DBPA 5JS7A 3EPHA 1M66A 5AHWA 3KVOA 2FNAA 1RBZA 2RK3A 3EXAA 4QFDA 3U3JA 4EKNB 2BZ0A 2O2SA 1PFUA 1VA4A 2VP4A 3I0MA 3ONWA 4V1CI 3DULA 3ZJTA 4C2UA 1TLFA 2G09A 4B3FX 1I3KA 3AMVA 1EUZA 1FFXB 3EG9A 1NC3A 4NU5A 5B1EA 1Q3KA 3MNFA 1KERA 5C4MA 5E1BA 1UMDB 2Z2JA 1ORWA 4FFNA 5DYGA 5HDBB 4RU1A 3F6YA 3KSBC 3TRKA 4Q1EA 1UKVY 2HF8A 1XG5A 1G7RA 1GPH1 2FQ1A 3RUHA 3PVCA 4GM1A 3FDZB 5TS2A 1KIAA 4LDQA 3QWAA 3CLUD 1TIBA 2GYUA 2OY0A 4CMJA 2QX8A 1JQ3A 4HDMA 4IMIB 4JBXA 4EFDA 5LSAA 2G36A 1RCUA 4PCVA 2HUPA 1R4NA 2X58A 1V7CA 2HEGA 4Q9IA 4YI3A 3OWHA 1LQTA 4OK3A 4EVQA 3X1YA 2C5BA 1Z4JA 5HRUA 1AA6A 2ZUFA 2YW2A 3JY6A 2BD0A 2KI5A 1CG6A 2G8NA 3INYA 4J49A 4L75A 4EEZA 4JZKA 3TR6A 4I9FA 4X54A 4N01A 2BISA 2CLIB 4G23A 4IQ0A 1RYYA 4MV7A 5ITWA 2SKDA 3JRXA 4MMYB 3T9AA 5IAAA 1JWBB 2XLCA 2H2DA 2Y76A