4D6XA

Crystal structure of the receiver domain of ntrx from brucella abortus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLDGLALLDEIKKQHPELPVVMISGHGNIETAVSAIRRGAYDFIEKPFKADRLILVAERALETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL REGULATORY, FIS FAMILY PROTEIN
publication title Snapshots of Conformational Changes Shed Light Into the Ntrx Receiver Domain Signal Transduction Mechanism
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d6xA00
1L5YA 5KC9A 5T7BA 2J48A 2QSJA 1E6KA 1U0SY 3KCNA 5IULC 3M9XA 2Q5CA 1QQAA 4MS4A 3O2QB 3I42A 3VNAA 1DZ3A 5CHYA 2L2QA 2B4AA 3W9SA 3OMXA 2IPAB 5FBHA 4ZYLA 4RK0A 4RZSA 1FFWA 2FMFA 1FFGA 2JBAA 1APBA 1W25A 3KKEA 5F64A 2QV0A 2QU7A 3CG4A 4PEVA 4DQDA 3C97A 4HNRA 1PEYA 1DCFA 2LBPA 3HM9A 2MYTA 3GL9A 1I3CA 5JNRA 4G86A 5KQMA 3HDVA 3JVDA 4LDAA 1JX6A 2NT3A 2WJWA 4MLDA 3IP7A 4EVQA 2FMIA 1NXVA 2A9QA 1JBEA 1LJLA 3FFWA 3HZHA 1JH9A 3F73A 1BAPA 4IILA 3Q7TA 1H9CA 4G0PA 3FMVA 4KRFA 1A2OA 3DBIA 3KTOA 3HUTA 4KZKA 3CKMA 2V0NA 2L19A 1JYFA 2QW1A 3C3WA 4WXMA 2M1ZA 5TQ2A 4MR9A 3KSMA 2N9UA 4RKQA 4RY8A 1VRVA 1QQBA 3CFYA 3NHMA 4L4UA 2NZUG 3RVLA 4PE5B 4RSMA 5TQ0A 4Z4CA 2YHBA 2QZJA 3KHTA 5KWSA 1NATA 1NXOA 4PYRA 5DCLA 2WRZA 3KLNA 2HSGA 4RK6A 3N8IA 1BDHA 2MYNA 3O1IC 3H5TA 4Q7EA 2LP4Y 4W5RA 4RV5A 5IX8A 3QLTA 4H3KB 4OLBA 1TJYA 3QLVA 3LOPA 4EYKA 4RK1A 3IDOA 1ZHHA 4EVRA 1QPZA 4EYOA 3H1EA 3DLBA 1Y1LA 5EWLA 3HVRA 1VPWA 4Q6WA 1E2BA 3HEBA 3ILYA 5T3YA 4E7PA 4MQEA 3RH0A 8ABPA 5EWMB 1OXKB 4NCAA 1RPJA 1S8NA 1P6QA 4P1ZA 4KVFA 1SRRA 3CG0A 3N0XA 2WB4A 3CNBA 3MMNA 4RDCA 4KMRA 3T6KA 5HSGA 2PUEA 3MIZA 4F8JA 7ABPA 2HPHA 1BDJA 3EULA 3QLUA 5TQ2B 4MR9B 2HQOA 2GI4A 4W5QA 4M88A 4MS3B 4Z4FA 1RNLA 3RVJA 4KQCA 1RXIA 2RJOA 3GRCA 4JASB 3MQ4A 3O1JC 3H5OA 1VLZA 1Z25A 2PAFA 1FFSA 1EFAA 3L6UA 4KQ9A 2H3HA 4KK3A 3SNKA 3OQNA 2P9HA 4MRMA 1NY5A 4WWHA 4HNQA 3O2SB 3T95A 4Z99A 3LUAA 1CYEA 4F06A 2W42A 1PUXA 3MYYA 4D6XA 3UK0A 3I09A 5TPZD 1SXHA 1PEAA 5EWJB 4MR7B 2R47A 3QELB 3EODA 4JAVC 4LRQA 4RS3A 4IF4A 5TE9A 4EUKA 2H0AA 4W5TA 3C6QA 4JOQA 4RY0A 1KMIY 4B09A 4Y9TA 1M5TA 1XHFA 5DLEA 4N47A 3RVSA 1D4ZA 1ZH2A 1NXWA 2FMHA 2NUBA 5IUJC 5JNTA 2NT4A 3O1HB 4TMYA 2B1JA 4KV7A 4MR8B 3H75A 5B3JA 4G0YA 1Z13A 4ZMRA 2FSPA 3G1WA 4Z9BA 5IEJA 5KQPA 4MQEB 2E4VA 3FGZA 4GPAA 2FXIA 2IPMA 3Q7RA 1C0EA 3ROFA 3N0WA 4YO7A 2JB9A 3TD9A 3GBVA 1T34A 1XHEA 4G0QA 4Z0NA 3H1FA 4MQFB 5IUNC 3NNDA 3CZ5A 3OLYA 3TMYA 3TO5A 1MVOA 3CZCA 2PUBA 2PUCA 1AB5A 3H1GA 1TLFA 1PNTA 4OBBA 1P6UA 1EWVA 2IOYA 3IP5A 4YCSA 3K4HA 1KRWA 3EQZA 3IP6A 1RZRD 4ZJPA 3GBPA 1NXSA 3OLVA 4IRXA 5EWMA 5FWYA 5ED4A 4OLAA 3IPAA 4MRMB 1QKKA 4YS6A 3RVQA 4W5NA 4G0ZA 1D1QA 1NXPA 2JVJA 5FWXB 1USKA 1ABFA 1URPA 3E61A 2IDMA 5FBKA 3RVOA 3H5VA 4ETIA 1YTUA 3RVPA 1ZESA 2KYRA 3T8YA 1ISRA 4EY3A 1DBQA 3NNNA 3M6MD 3LUHA 4MS3A 3SQNA 1Z2DA 4YP9A 3C3KA 2AYXA 3BREA 1L5ZA 4IGAA 4WT7A 2F8SA 2IPNA 3QX9A 3HS3A 2WWVD 2R4QA 3RVMA 4XFKA 2PLNA 3BILA 3UKJA 3GYBA 3VNBA 4Z4EA 4OTZA 1NXTA 3LUGA 3EJWA 2PUDA 2JVIA 3H5LA 4S04A 3E3MA 1EWTA 1NXXA 5ABPA 4OG2A 4Z4IA 4Z4HA 4RXTA 1DC8A 2MYUA 4MPTA 1GUBA 3H6GA 1Z16A 3JPYA 5EWJA 2ID7A 3MA0A 3BRSA 3N75A 3QELA 2PL9A 4LE2A 3F6CA 4MR7A 4XASA 2MSKA 3SM9A 1F51E 3TX6A 4UHKA 1BVHA 3M9WA 1ZN2A 3LUJA 2QXYA 3TB6A 4KPYA 1M5UA 1RXEA 1BDIA 1ZGZA 2FLWA 5C5CA 3N0RA 4MR8A 4EYQA 2RDMA 1U8TA 2P4UA 3OO1A 1QP0A 4ZMSA 1C4WA 2PMCA 1YK1A 2A9RA 4RK7A 5FWYB 5JNWA 2E4ZA 5CNIA 5CNJA 1AB6A 2AYZA 5BRJA 1KGSA 2CHEA 2JRLA 4TLLB 1PNRA 4P98A 1USIA 1GCAA 1MIHA 2RGYA 4YRZA 1JFTA 1Z15A 1P8AA 1CEYA 4KK4A 3KLOA 2HQBA 1DC7A 1U2QA 1USGA 4O5AA 4MQFA 3N53A 1F4VA 4CBVA 4GNRA 5JNSA 3HCWA 3LFTA 1D1PA 4TLMB 1LJUA 2FQWA 3D8UA 3ILHA 3OLZA 2JCGA 4XARA 2TMYA 4MGEA 4YWHA 1IIBA 3O75A 1SXIA 4FE7A 1ABEA 4D6YA 5TPWB 4EGSA 5DGCA 3N6VA 2FMKA 5IC5A 1JWLA 3EGCA 1NTRA 1U2PA 3CTPA 4LE1A 4ML3A 1PHRA 2FN9A 3OO0A 1LBHA 3HSYA 1YVUA 3NBMA 5FWXA 2RJNA 2ZWMA 3CLKA 2FQXA 1DBPA 3DZDA 4DADA 3RVNA 3JPWA 1DCKA 3F7NA 1YK0A 1QO0A 1MAVA 2PUGA 1FSPA 3HO1A 3LUCA 4H60A 2LPMA 5JNUA 3DLHA 3D02A 3RVKA 2YHAA 2GBPA 1GLGA 3KG2A 9ABPA 3LUKA 1ZITA 1K66A 4PZ0A 2R48A 1ZDMA 2R25B 3K9CA 1DJMA 1ISSA 3QLVC 4MS1B 1EAYA 3HDGA 4N0QA 2PKXA 4RXMA 3CU5A 2MSLA 5DTEA 4RKRA 4YV7A 3EAFA 1OXBB 1DCMA 4RWEA 2VYCA 2FVYA 2PUFA 1U04A 3OQMA 4KREA 2GKGA 2IPLA 2MSWA 2E4YA 4YGXB 2OQRA 3RQIA 1DRKA 3KYJB 4HNSA 5I4CA 2QVCA 3H5WA 3JVIA 4WZZA 4EYGA 3A0RB 3URMA 3F6PA 3C3MA 5E3JA 4RXUA 2E4XA 3LMKA 3HXMA 3QLUC 5BR1A 3SY8A 2M98A 4G0OA 3LUDA 4LZLA 2QVGA 3ROTA 1YS6A 4WUTA 4XLTA 2PJUA 1CHNA 1DBWA 1FQWA 3OM1A 4G0MA 2HJ9A 4Q6BA 4JB0A 2IYNA 3CRNA 3LUFA 2WY2D 2VK2A 3OLWA 4WXEA 3GWGA 5CNMA 3NNSA 1QP7A 2GWRA 2JVKA 1E6LA 3HUUA 1HEYA 3IP9A 1TMYA 1Z12A 3O2JA 1DP4A 1Z18A 1JHZA 1QMPA 3QEMB 2L18A 4EVSA 2FN8A 4UHJA 3H5IA 1Z17A 1MB0A 3KYIB 3JS5A 4KNYA 3GT7A 1SXGA 2LUOA 3QK7A 5TPWA 4RU1A 3GV0A 2DRIA 5KI6A 2PE5A 1K68A 2E4WA 5BQ3A 2CWDA 4YR7A 4KFCA 4FB4A 4L85A 3P9YA 4H3HB 4O1HA 5D2CA 4LE0A 5B3JC 5BRAA 3A0UA 1WETA 2JK1A 4RK4A 5PNTA 1GUDA 1DRJA 2OENG 5TQJA 3MM4A 1J56A 5HQJA 1ZGGA 4RY9A 1B00A 4D74A 2WJAA 5KQLA 3Q7SA 6CHYA 2QR3A 1JDPA 4G97A 4N0PA 4NV3A 2NZVG 5CNKA 3HJFA 1VKRA 3QEKA 2LIVA 2A9OA 4MS1A 2MYPA 2FEKA 3OQOA 6ABPA 5GQSA 2L17A 1A04A 3Q41A 3R0JA 3SAJA 3IPCA 2ID9A 2VUHB 3EDCA 4ETNA 1GCGA 4ETMA 3NHZA 1JLKA 4MS4B 1ZAYA 3HK2A 4XXHA 1P2FA 5C5EA 3I45A 2E4UA 1LBIA 3JTEA 3EQ2A 2JBAB 3CS3A 3A3KA 3Q15C 1EHCA 3LKBA 1SD5A 1TVMA 4IMIB 3DGFC 2PL1A 3OLXA 1QP4A 2CD7A 1M2FA 5JS1A 3UUGA 2GX6A 3OMWA 4JP1A 5KC8A 4LX8A 2BGGA 3Q9SA 1QNLA 3QX8A 4NICA 4NQRA 3A10A 1YS7A 4F12A 3LTEA 1Z2EA 2I6FA 2FW0A 3BBLA 1ZH4A 4QYMA 1ZY2A 3H6HA 1A0OA 1M2EA 5IUKC 2F8TA 3KJXA 3O21A 5KQGA 2FKAA 3MF4A 2O20A 5TPZA 4G0XA 5JNVA 1ZVVA 2PUAA 4FE4A 1D5WA 1W9HA 3JY6A 5HM6A 3DGEC 4N03A 1JFSA 4F3TA 3SG0A 4W5OA 2HQRA 4MYRA 2CHFA 4YLEA 1TM2A 1YIOA 2FEWB 3HV2A 4LDZA 3GA5A 4N41A 2FLKA 1XWWA 4Z4GA 3QEMA 1JYEA 3S99A 5JS2A 4JA2A 1JDNA 1EWKA 1JFVA 4O1IA 4Z9AA 5HKOA 2WMYA 4MAAA 4JB2A 4NCBA 3L49A 3B2NA 1Z26A 2A9PA 4DN6A 1LK0A 5TQ0B 4E7OA 3T38A 2IKSA 3OM0A 3G85A 3I5AA 5IBQA 4PICA 3O74A 4IMJB 5GOTA 3RVRA 4QYWA 4XAQA 1JF8A 3LKVA 3FDFA 4MLCA 4QICA 2X7XA 1YMUA 4TN5A 2VUIB 3CHYA 1KRXA 4RK5A 1YMVA 3BRQA 5IEBA 1E6MA 4S05A 2FQYA 2XDYA 4F11A 2FEPA 1QO0D 2ZAYA 1JL3A 5DKFA 1D2AA 1MB3A 1UDRA 3KS9A 3FFXA 4OATA 4ZPJA 1RZRA 4N76A 3FFTA 2FTKE 1DG9A 4HYEA 4QPJC 5EWLB 1R8JA 1BA2A
chains in the Genus database with same CATH superfamily
1KK0A 2OV1A 5IKOA 5ALNA 3DJFA 3OEED 3I4FA 3KU1A 4UHDA 2Y6VA 4AJ4A 2JLZA 5IC6A 5CLJA 4R5HA 2BUCA 1GP2A 2QSZA 2PANA 4KZPA 3OA2A 5EPOA 3ZI7A 2P3QA 3HCAA 1F48A 2J9YB 2FUNB 4JJKA 3KT0A 4MRAA 4YMUA 3ENQA 4KR0A 1MX3A 1RTKA 1Z5NA 2Q4OA 3B1WA 1L0BA 1F17A 1WB9A 2WYIA 5D86A 2R8YA 4UUQA 2D2FA 4WN3A 3T7TA 4DMCA 1HLGA 4EKYA 1P7PA 2Q2VA 3SHTA 4PN3A 5JALA 1R88A 3L5OA 5CIYA 2JH8A 2CLDX 3VZBA 2PKYX 5DBHX 5I5GA 1BXRA 1KEKA 1Q44A 2OXTA 2FMIA 4HYQA 2A9QA 2R6AA 1K5DA 1O94C 3TXAA 4OMUA 3LF1A 1RZ3A 4EA7A 1N6HA 2NYAA 2JW5A 2XYQA 3H7AA 1XLVA 1EAMA 1R5JA 3MOSA 4OLFA 2I7TA 1O89A 4B3CA 4DMHA 3VDQA 3DBIA 3N74A 3ZU3A 1GZ6A 2JF0A 4M0LA 3ND5A 1YNSA 3OZUA 2Z04A 3WYFA 4OJQA 2ZJFA 3PHCA 2XUAA 5C81A 2FF7A 4RKQA 4Z1MA 2XAUA 3HA7A 3UMBA 2VXYA 1HDIA 3OE7A 1A8QA 2VQEB 1YC2A 3CFYA 2DUJA 3WBKA 4R1SA 2QN8A 4PHTA 3ZIAA 4A6PA 1WKCA 1RXSA 1WVIA 3VH2A 1P0QA 1HMPA 1KO8A 1PR6A 2GCPA 1RFLA 1WABA 3MWYW 1PJCA 2HJGA 4JJ6A 4BNJA 1VYVA 3N6RA 1T9ZA 2QP3A 4GX0A 4YAIA 2QNIA 3IA2A 3PTAA 4N3GA 5IX8A 3OOEA 5KWJA 1S2DA 5TS2A 1FLAA 1Z4NA 1XTVA 4EI9A 4H3KB 2FPIB 2OD7A 2IUUA 4EUEA 1ZVMA 1FYDA 2BTQB 2H2AA 3KOUA 2D2EA 4QFDA 4AY3A 4BPBA 1AOXA 1A72A 1NG1A 2DG2A 2AI3A 4GG1A 6ADHA 3UMVA 1QV9A 3EPRA 4LNAA 5IDQA 4ABTA 3JATA 3AV3A 4QFMA 4P0PB 2VT6A 3RGWS 3SQOA 2HXGA 4BN0A 4O8CA 5KTTA 3WJ2A 4BRZA 3AY7A 2OB2A 3AHEA 4ZU3A 2P7IA 3M3PA 1HKHA 2O6HA 3GEDA 3HABA 3C85A 3EPLA 1OREA 3NUGA 2HIHA 2YVQA 3O8OA 1AK9A 5CB8A 2GNAA 4BQNA 4RSRA 1HX7A 3EEQA 5LCXA 4IDDA 1Y7LA 4JR2A 2YUTA 4PSCA 3RU7A 1J25A 3H05A 1LNQA 3ETJA 1Z0IA 5DHAA 2O8FB 3ZGNA 4TTJA 4MGYR 4U4AA 1ZBQA 4B40A 3LQRA 3D43A 3N7TA 3CLTD 3I9LA 4LJRA 4QLBA 3GRCA 5BSFA 2BFOA 4Z1OA 3O1JC 5GY7A 1N0WA 1VLZA 3W6ZA 2HT6A 2G67A 1PRYA 4MIOA 5G4KB 2XE6A 1H2FA 4F3RA 2ETXA 1A2KC 2HLDA 3CF4A 2I4RA 1KMHB 3UFBA 5IWCA 4Y1GA 3GFQA 2PKEA 4YQYA 5I9MA 1AH2A 3LPCA 1X7ZB 2WF7A 4IIJA 1BHQ1 5F23A 4P93A 4ZCSA 5EJ4A 3RSZA 1JVBA 2HAEA 3G5MA 1U8AA 1WPGA 4ZV7A 3ZX4A 1Q3TA 2QVLA 4MR7B 2QROA 4CIWA 3M70A 4OJKA 1LX7A 1R0RE 3FI0A 3CLSD 5I8PA 1JBQA 2PYDA 5D3MB 2JGIA 3GCDA 3K70D 4HT3B 2COKA 5GJBA 1NULA 4R8LA 4D3ZA 2G5TA 1R2QA 2OHGA 2C5FA 1Q0SA 5H9WA 2PH1A 4HDRA 3TD2A 3OPVA 4P31A 4LTMA 1UJ4A 4YDSA 5DGTA 2NT4A 3GVPA 4PQEA 3W77A 4JEUA 1KDZA 3U4IA 4JHLA 4KPFC 3ZG6A 1C29B 3MS4A 2KPOA 4BECA 5GZ1A 4A0SA 3F2IA 2NTYC 1AC5A 2L69A 2PGOA 4S1PA 3IALA 3C3CA 3KSAC 3CKKA 5BSEA 5HS6A 1RLJA 1TDJA 4PC3A 3BA1A 4TLDA 3U7IA 4B0OA 4DVGA 2NUPB 5BQPA 4Z0NA 1AMUA 3H1FA 1DO8A 2W0MA 5HYVA 4BVLA 1HYGA 4Q7JB 4Q3OA 5E4JA 3VJLA 2J45A 3PDHA 4QT4A 3KXDA 4DA9A 3G0OA 1BJRE 5AKHA 2XA1A 3CLUC 1RXUA 4WQMA 1P6UA 1YZUA 2FR1A 2XOKA 4B3SB 4NK4A 4J0KA 3FTFA 4JELA 4LFBB 1NKSA 2WV7A 5K6RA 2HJHA 2BGLA 3E0QA 1N9GB 4P36A 3MFQA 3AM1A 3V8QA 2AIRA 1SUPA 2JVJA 2NU8B 1UFQA 1G42A 1TKCA 2VF2A 5AVXA 3UHFA 1EYZA 1UT6A 4ETIA 1TM4E 4TXLA 1O4WA 1WXXA 4FFLA 4R7GA 4B3XA 4D43A 1Q6YA 2YS7A 1E3LA 4W4TA 4EPRA 2AOXA 1C9YA 2K2WA 1L5ZA 3N7UA 2GUGA 5IJZA 1DKOA 5C7LO 1YBVA 4E22A 4Y2YA 2G28A 2R4QA 2XHZA 3BXHA 2OL4A 1HOTA 1JDJA 3ZZMA 3LUGA 1UWKA 4TKUB 1EM8B 2Y67A 3JRXA 3U7FB 4JFRA 4QO8A 1CVIA 1Z2AA 3BH0A 4X8LA 3RUAA 3UWKA 4JXZA 2DWUA 4Z4HA 1SXJD 1IEVA 1T2FA 3B2QA 3ZHZA 4C6TA 2FOLA 3ZDAA 3HDJA 2IY7A 3T5MA 1NQWA 3UJ6A 5JI2E 1UBHS 2MSKA 3SM9A 3TX6A 4YI3A 1L5HB 5HJEA 5JH7B 1S2OA 2BFCA 4QPCA 5A0FA 1MTOA 1W4CA 3WLFA 3CO5A 2OHJA 5G53C 1GSAA 1NV9A 4QBHA 4IO0A 1FIUA 1O5IA 2QUHA 1MC4A 2FLWA 3DE1X 5ADVA 3ZEAA 3GNSA 1ZCFA 2WF8A 4QAQA 3VU1A 1CXZA 1I6KA 1U8TA 5LOVF 4OV6B 1WSBA 4YPOA 5JIBA 2ZSBA 3NATA 2QYTA 3EDMA 1E9EA 1T35A 5G3YA 4I50B 3UT6A 1R0YA 2RGYA 2A14A 5LOVA 2I4TA 1HLPA 2WF9A 3FF4A 5FOVA 4FT2A 4IF6A 2HMSA 2C4WA 2YV5A 2EL7A 1PL0A 3QMWA 4YJ3B 2OVBA 1UMKA 3L06A 4Q9HA 1QCZA 4M76B 4C3ZA 1TYDE 4BMZA 1DU4A 2ZJ0A 3JYOA 1R5OA 5DK6A 1D8AA 4IFEA 4Y3UA 4N65A 1U0JA 4QRIA 1UC8A 3G5AA 3DNMA 1U8EA 3RAGA 2RD2A 2PBLA 4PAGA 5GJWC 3PFKA 2W6IA 3EGCA 4HKTA 5IAKA 4FYHA 4ZV4A 2IW3A 2O0JA 1OR8A 5BN1A 2B3TA 1QBKC 2VTEA 1CUJA 3LX6A 2EZUA 3P94A 4LHVA 2EFYA 3I01M 1VMKA 4M8KA 3KQYA 4EX7A 5ICSA 4CN9A 3WKAA 1PZGA 1FYVA 1KAMA 1HT3A 4B7ZA 4R2XA 3ESBA 1EFVA 5K6AC 4GYWA 13PKA 3HO1A 3LUCA 2HK8A 2LPMA 4CTMA 1D07A 4TOIA 2VNAA 4CV0A 4PC6A 5AI8A 2WK1A 4G2NA 4ACAA 4XB6B 3PNSA 3OEEA 1ZDMA 4U7TB 4QQRA 2D1SA 1CUYA 1YUBA 3EDOA 3LA8A 1OBHA 3K31A 3EUFA 1I51A 1KEUA 4ZMBA 3SXUA 4E5DA 1BE6A 5CGZA 5KYNA 4B9EA 4F45A 2AFHA 3T7RA 1DCMA 3QNWA 3TE7A 5JISA 1HPLA 3V1YA 2AC2A 2HNAA 2PUFA 4WNAB 3CC8A 3D4OA 1RYZA 1FX1A 1P1IA 1T5IA 2VRCD 2ODTX 1G55A 4HTAA 2QQGA 1CHDA 1YO6A 2OBXA 1T3SA 1U3CA 3JARA 2Y99A 4PZDA 2BHTA 4V0KA 4WERA 4TVKA 3RQIA 5KHOC 1YGPA 1W0KD 4KLRA 1ODIA 1PFUA 1HURA 2AWOA 5KDDA 4W1QA 4EYGA 5TF0A 1KI3A 2ZRCA 2ZYHA 4Q9AA 5NLLA 3SR0A 3I04M 5BYKA 5L6LB 2A1UA 4MHTA 2R6R1 1T13A 3OIUA 2C4MA 1YJBA 3TRJA 3UPUA 3D6MA 1LX6A 3J80A 1F2TA 5IDWA 1TEHA 1JB1A 2AFIE 1OLUB 2W2QA 4FD3A 5CK5A 4S0XA 3QITA 2WIAA 1OXXK 1WA5A 1KO5A 4UMDA 3F78A 4JB0A 3UAVA 4DMRA 4HAWA 4X3PA 4I5GA 3S2SA 3HZZA 5DH9A 1SD2A 3UFXB 4JUAA 3CURA 4RHYA 1HDEA 3ETCA 4Q93A 1VYHA 4MVCA 3DE4X 2ZYVX 4CLRA 3T1YB 2OC9A 3IHWA 3NR2A 3RNLA 1JYSA 4N7JA 3RUIA 1VPTA 4LPKA 3T7EA 4YMGA 1ENPA 1EP1B 4MKFA 5DISB 5HOEA 1JEAA 2Y2VA 3ZZ0A 1I33A 1OU0A 1UCFA 4HTFA 3SC3A 4F4DA 4WBNF 3SC4A 3C3AA 1G2OA 4ETMA 1KDTA 1NA5A 5TPWA 1XIVA 3LWZA 4YUYA 1KEEA 2JIBA 5CB4F 1RRVA 2JHCA 3L04A 1DJLA 1XWIA 3W8RA 3DD5A 4LOKA 4GPZA 1QYVA 1JR3D 3IMKA 4UZEA 4A26A 2IXEA 3LE8A 4C9BA 4NDNE 1E64A 2AC4A 2I4MA 4O1HA 1G9TA 4RA9B 4FS3A 5D2CA 4LDRA 2FPGB 3ODGA 1UWCA 2FN3A 3GFBA 4NCJA 1J56A 4CKXA 1RI3A 1TUEA 2GEKA 2YNMA 2H52A 4MWBA 1MX5A 3F7MA 3E3OA 1VCMA 3QVLA 3T9DA 1P4JA 3HN7A 2WJAA 5F35A 5FWAA 3NW9A 1I36A 4IICA 4CMAA 1N1DA 3WKEA 4AS2A 2BF4A 2XGOA 3QEKA 4GM4A 4AY4A 1SZJG 3R5SA 3KJNA 3R5TA 4JU9A 1DIOB 2WKSA 3NIFB 4G23A 4G0VA 1FMFA 4MYHA 1SB8A 3QKSB 5IT0A 1L4EA 2NADA 1GA1A 2B8JA 3C1UA 4PCAA 4YGYA 5D5PA 4UFOA 2O2SA 1NRIA 3RBZA 3TTYA 5IH7A 2XGGA 3IVAA 4I5EA 5FD8A 4ERNA 1L5MA 4IG9A 2EBFX 3A1EA 4GKVA 3D3JA 1MX9A 1QWSA 1ZIYA 2C7BA 1JNYA 4UREA 3A4MA 3SZRA 1Y3AA 3L1UA 5ECYA 1WXIA 4YRTA 4ER7A 3UB3A 1G7SA 1H2HA 4MEBA 5A05A 2PL1A 3FLMA 2ZROA 4EITA 2QUZA 1OAAA 2F1JA 1G59A 4ZDJA 3Q9SA 1W49A 2O5CA 3QVSA 1X1DA 2D13A 1PWEA 3ITEA 4NICA 3RJ9A 3TZBA 3UYKA 1N5MA 1O08A 2HOQA 3QWFA 4TMFA 3WYBA 3LTEA 4FE3A 3ICEA 1QH0A 1G8HA 1VL2A 4J2TA 3RSFA 5KSYA 2FZLA 5IVKA 4A1FA 1N3LA 1X74A 3C4JA 3G3EA 4MK4A 1IJBA 4O1MA 2HB6A 4ZVKA 1H1DA 3DCNA 2BDUA 1WO8A 2JI8A 4A23A 5JNVA 1NG9A 1QIMA 3TOCA 4HVCA 2MMCA 3GC6A 1OLXB 2DKOA 3GJ8A 2W2KB 1PWZA 2DECA 1TZCA 1AKUA 1O5OA 3HV2A 4IHJB 3PNBA 4V0MA 3TLJA 1GU7A 3SE0A 4E07A 3T5AA 1V0JA 3KSDO 2WTUA 3GMDA 1Y33E 1YCGA 3JQGB 4GFDA 4NOKA 5CR9A 3PXUA 1T5LA 3GLHE 3I8OA 1KK1A 1RTTA 5ERYA 4IM7A 3H2ZA 3WGMA 4EG3A 3NJ4A 3NALA 4UBIA 5LA6F 3AINA 1Z5WA 1YKFA 4MV7A 2IGBA 3UG7A 3ICOA 5KUTA 3CUYA 4KAJA 3WXBA 3MTAA 3D8RA 2MSDB 3E53A 5K3FB 1GNPA 4CIDA 1LTKA 3BH7A 1JEOA 2QI9C 4GAEA 4UATA 5FNVB 2G04A 4HDKA 1YI1A 4YCNA 2VWGA 1T3ZA 1Q1QA 3KZOA 3RBXA 3GI1A 3ZYZA 4DNPA 1TM5E 2YINC 3BGWA 1XJWA 4IHQA 2A5JA 3RD5A 3GFOA 1EFPA 1MOQA 1VGQA 5CX1A 2BFPA 1BS9A 2R8OA 2HSEA 3GDOA 4BBZA 1TZBA 1PJ3A 2FQYA 4BB6A 4F11A 4FZVA 4WXPA 4TV9F 5DM2A 1EG2A 1JQKA 2QJWA 1SUSA 2CXXA 1QO0D 1WETA 1MB3A 2FFHA 3HKBB 4LRTB 2MJLA 4NCNA 4XR4A 4CF6A 2AEMA 2B4TO 2EKQA 3S55A 3QH4A 4UDOA 4DA6A 4N0DA 2GYVA 3W8EA 2I54A 4IJVA 4GPEA 4IOJA 2B25A 1O6CA 2J48A 4F2DA 4CMJA 5AVRA 3NCHA 5IJAA 5LD2C 5IM4A 1QF6A 2GD1O 4JLBA 3RJMA 5CHYA 2NUAB 5E8RA 2AOTA 4MMXB 4XE5A 5FBHA 5J4HA 1T26A 2Y1LA 2WC1A 1PYOA 4AM8A 5FV7A 4FW8A 1APBA 4L5JA 2J3JA 2VHYA 4LKOA 2RAFA 3KKEA 4HX2A 2GBGA 1GFIA 3L8EA 5REQB 3HDQA 2BJHA 5DNYB 1DCFA 4JIMA 2DPYA 1N8SA 1H1LA 1P9NA 3DMTC 3PNOA 2XCSB 5T41A 2P40A 3ITNA 2ZCUA 3HU2A 2J6CA 2BFDB 2AG8A 5H82A 4MUKA 4QPNA 2EXXA 2AA3A 2FX3A 2VA9A 2Q50A 3BVPA 3LCVB 3TKLA 1F8UA 3RRZA 4IIVA 1JH9A 2R7LA 4BVJA 1EP2B 1HGXA 1FU8A 1DKRA 3AXSA 4AD8A 3UK2A 2ATEA 1LRLA 2PVPA 3K73O 1NL3A 3E22B 3M2PA 2H8GA 3Q7TA 5CLFA 1S01A 3LYUA 1A1SA 4LV8B 4L9AA 3C24A 1G5PA 1NYQA 2QW1A 3C3WA 3H2JA 3KZKA 1X0VA 1ISIA 2VJOA 4GW3A 1YQWA 3MBOA 4R0NA 3SBOA 1KU0A 2EGGA 2ZIEA 3BIWA 3QPDA 2JPDA 4PV7A 4RY8A 4TX1A 3T4XA 5JOQA 5FUWA 1Q1NA 2FK7A 3CVJA 4NBRA 3H4TA 1G20E 2H7VA 3BRCA 4O4JF 5ALTA 4L9SA 2VTVA 4QPZA 5IP5A 5CFRA 2L42A 1ULBA 1I0ZA 5K0GA 2QZJA 1ZRHA 4JDPA 3U5TA 4UAGA 3E18A 4BEBA 3D2LA 2WRZA 4PR0A 3RTAA 1SCDA 3AWDA 3DMGA 1JDSA 1DWOA 3NEYA 4O4JA 2JCBA 4X6XA 1BCSA 2QLLA 3I8XA 3IEIA 4BNUA 5HGXA 3KHSA 4JOBA 1N9ZA 3E1KA 1QU2A 3DPSA 4G4SO 2CYAA 1E1QD 4JLWA 4KN6A 3VPGA 2R1VB 1UH5A 1J2JA 1JXMA 2O48X 5KREA 3ZQKA 5L40A 4DR4B 7REQB 3BCUA 5ICFA 3FDZB 3D4IA 4WK4B 4Q18A 3NUQA 3MLAA 3L84A 3UOGA 1UZAA 1OZHA 2D2XA 4TTRA 4RLFA 1E5DA 3W04A 1J42A 4L0MA 2I2AA 4B3TB 1R3DA 1CR1A 2EQBA 4JXKA 2GDZA 3C5EA 3EF3A 4HX5A 4Q7QA 3PU6A 3QE0A 2WIBA 1PV2A 4B43A 2HX1A 2VJBA 2O57A 1VPWA 5GPBA 1CC1S 2OCLA 4U2CA 2DY1A 1HG1A 3QIVA 2ZBGA 3P0RA 2PX3A 3NGXA 1VFPA 8ABPA 1FL9A 2XTAA 1JG3A 3RU2A 3ERCA 3EGXB 4MWDA 3UOWA 2ZSFA 1VPDA 1XZCA 1BVYF 2WKQA 3A9UA 4P1ZA 2Y3IA 3PBKA 3PPXA 1UT8A 1SKUA 2WDZA 1W94A 1N6OA 1CJTC 4U3JA 1L5OA 1N5KA 3QLUA 2C84A 2ZSJA 3FPLA 2NVUA 4PO9A 3RUHA 1FRZA 5CP8A 3LI2A 5BMVB 3BG5A 1SWWA 1GCUA 3V8VA 2HZ7A 2HF7A 4L9WA 3X1MA 4N7RA 2ZJ3A 3SDZA 4CR6A 4G84A 1FFSA 2C0PA 3RSHA 2CKMA 2H1LA 5LFAA 3KKKA 3OM9A 3AVVA 1Q50A 3II6X 3FPHA 2FW1A 3DF7A 4V3CA 1YRBA 5FL7A 4BV3A 2VRCA 3DEKA 4RQAA 4RTPA 3PJGA 3CUSA 1U3TA 2XEDA 3V4OA 1ZUNB 3AG6A 1LDMA 2D54A 1I01A 1SXHA 3P9RA 4HLUA 5TSDA 4EWLA 3GUUA 1H69A 5J43A 2SCUB 3DYIA 3N2EA 1L8LA 3AU9A 3QPCA 5HQTA 4G26A 3CVYA 2H0AA 3BMCB 4P83A 1L7MA 1AXEA 1NR1A 4JEMA 3VM6A 1XKTA 4JLNA 2BKVA 3BE5A 1TXGA 1PT7A 1Y1TA 5J4LA 5H3HA 1IMOA 3PNMA 2P3OA 4N47A 4PGFA 1K8ZB 3BKWA 3K09A 1U0EA 3OTIA 2F6RA 3UHOA 1V11A 5M29A 1HFJA 1VLHA 4G1UC 4NLLA 1RWVA 5AKJA 1IJFA 4RLQA 2JA2A 1OIWA 1G0OA 5KQSA 1FNBA 5I47A 2WSSD 2QJTA 1M1YE 2ON6A 4KX3A 3CUUA 4TWIA 5CJJA 3FZQA 4LC9A 2J5XA 1Z5PA 3JQFC 4UM8B 4LS3A 2HHHB 4WLEA 1ZJWA 3OESA 2EBWA 3ONWA 2FPRA 3REOA 2YCBA 2H7CA 3IP3A 5BYBA 2H4HA 2ONYA 1OKKA 3AU8A 2WWTA 3IUJA 1TLFA 1Z5VA 5JNTA 5EE0A 2DMRA 1F4PA 3IJ5A 3OZFA 3AIKA 1T4GA 2OVFA 1RCTE 5L6MB 1P9OA 2WAMA 4LMAA 1MD9A 5C9ZA 1BKSB 1JR3A 3GBPA 1Q2XA 1X80A 2G1KA 3QTTA 1X7YB 4OAQA 4ZD6A 5GZ6A 1JXAA 4D3XA 2Y8EA 1FFBA 3F90A 4KODA 5B3KA 5CAEA 3V1TC 2HI0A 2ZJ4A 2OBFA 4ECAA 2WT4A 4KIFA 4Q47A 3HYNA 4PCLA 3ORSA 1LRKA 2C2YA 4B3IA 2OP0A 4UMFA 3WHPA 5FV4A 3JZAA 2A0WA 2O1EA 1FA9A 2BMWA 2PCJA 3GGJA 4GM0A 4MCHA 4DJTA 3M6MD 3CINA 4PFSA 4AY5A 3SQNA 4GPIB 5KYXB 1E89A 3SJAA 3VKVA 4IVQA 4QGAA 2H29A 3F49S 1RLTA 1NJFA 3TSZA 2W7TA 4IJKA 3PF9A 4EQ6A 4JT2A 2NO6A 3NC4A 2ZS9A 5EYPA 1SQGA 4EJSB 1H4QA 5JYBA 3NHPA 5WRFA 2Z4RA 1KIFA 1V16B 3VSCA 1M2VB 4RPHA 3W6UA 2O8CA 1TW3A 1DMRA 3GRKA 3KE9A 2JZNA 3L7CA 3HMKA 3OIYA 4LJSA 4CKWB 2ONJA 3PQFA 1NFRA 2G71A 3DO5A 4G41A 2PKQP 4KDEA 5THXA 5ADWA 1G1AA 1ZD3A 5H4HA 3VJKA 4CR7A 5LPNA 1EXWA 4GOOD 6AT1A 2FP4B 2H2DA 1FBNA 2Q2OA 1NVEA 2RGNC 2PJDA 1JPUA 4ZI7F 4YV1A 3I5UA 2BONA 1YDEA 1GNVA 1IATA 1X7WA 2BELA 4BVKA 1GAXA 1UBTS 5BSVA 3KUCA 4UULA 1A7KA 1BE0A 5CLLA 4M4SA 2BHSA 1LSOA 4XDHA 4YI5A 3WWCA 4CU5A 5BVHB 4ZI7A 1ZCZA 2ORWA 2F9LA 4IDFA 4IQ0A 4JBYA 4MVJP 3KFLA 3ONDA 4NMHA 4B7CA 3R74A 4ENVA 1NP7A 2XVMA 3UAGA 3ZWVA 2RGGA 3PWKA 5CNJA 1IY0A 1Q0QA 1Y82A 3OCYA 3TZHA 4MUJA 4I2VA 5BXYA 5CFPA 1ZO8A 3Q8WA 4FKZA 5E2BA 1Q7TA 2VUSA 4RMIA 1WCWA 4PXAA 1SHUX 3AEUA 4CQLA 3PQ2A 1B26A 1WCIA 4ZRDA 4YAOA 4BO1A 3EC1A 2J1LA 5C34B 1G5RA 1G21E 4CMHA 2Y9MB 4KLCA 1RWPA 3BMOA 1EU1A 1S3FA 4FFSA 4XJXA 3ORRA 3D8UA 3B20A 1HYHA 3I12A 1X7DA 1OA1A 2JCGA 3HO8A 4CLDA 4CKBB 4K40A 4TYYA 1EQUA 2WJJA 1Z83A 5P8WA 5BN3A 3DKKA 3OWOA 1FCJA 1IFXA 3FOFC 4BIIA 4BGUA 3ZCXA 2FMKA 1JIVA 1NVMB 3ORFA 3AOEC 2F3SA 3BJRA 4QYIB 4UM9D 1PHRA 5JWHA 3SVTA 3K1YA 3ZCRA 2XB4A 4JP3A 1CQJA 3WWZA 4J0CA 1DVRA 4CT0A 1QGUA 4MRVA 3ZCSA 3K0FA 5AVWA 1UQRA 2PH5A 3O0TA 1MW9X 5HHTA 2G72A 1QO0A 3U6BA 2DT8A 3BN3A 3RU3A 3G2PA 4HS9A 3EDRA 3DEIA 4ZAYA 3SEQA 1BQ4A 3KVYA 4CU2A 2G83A 4OF4A 2DUWA 2FEMA 2H1IA 2J3QA 2GBCA 3ACCA 3JALA 3TOZA 4QDXA 1MO4A 3OQVA 4F8YA 4NOJA 3FNHA 4PSDA 5MGBA 1Q0HA 5K8LA 4ASUA 1T91A 1TQ6A 1UADA 2MSLA 3FCAA 4HX9A 5FPHA 3P32A 4REMA 4CI0B 4E4TA 3ROKA 1F8GA 2Q27A 3O3OB 3UWMA 3KSZO 3BWXA 3Q3EA 4J1QA 2G9RA 1NJ5A 1ZVQA 2B83A 2RAPA 2VA8A 2YWGA 2H07A 5EESA 1B6RA 3GPCA 3P8ZA 4OXQA 5AJZA 1E99A 3EE6A 1JJAA 2O3JA 5DHPA 3WIDA 3QPUA 1FSGA 2QTAA 3SIXA 3V9PA 3B1KA 2NO1A 4X7BA 3QF4B 2EF1A 1THTA 1Z5GA 2LW7A 2RFLA 5FTKA 4D80A 1L3IA 3AH8A 5E3JA 1GZHB 2BKLA 3EEFA 2E4XA 5ED0A 5E4TA 3HXMA 1E1RD 4B6SA 3NH9A 1KA9H 4CEJB 2ID8A 3D8SA 1XZKA 1QOZA 2M98A 2VYFA 2OWDA 2VBGA 3AJ8A 2DFVA 3MSXA 3KQWA 5JDIA 4LDQA 3EXFB 3T99A 2PJUA 5HE9A 3A6GA 3FTEA 1SZCA 5ES4B 2BTEA 4LZNA 1I2BA 5KKCA 4KDCA 4BLOA 4P4SB 4ON9A 5EZ6B 5I8ZA 5FIUA 3ZWPA 1DEOA 2KBEA 1CJUC 1OOEA 4HZUB 3E3LA 1UPTA 3SXPA 1EGAA 1HEYA 3PENA 4OBXA 3S5JA 3SFZA 2X77A 1QRUA 3DONA 4XB2A 2UZIR 4LCEA 1W59A 4MUAA 4OGFA 2CXRA 3WGYA 2C57A 3GEHA 4G89A 2UYGA 4K9DA 3F6BX 3COVA 2UYHA 1C0LA 4BVAA 4ERXA 4X44A 4RO0A 1GUFA 5E38A 4M38A 3FWZA 3DOUA 3HLTA 3ED5A 3UXMA 2HQSA 1EXNA 5EZYF 2V45A 3AETA 4GUAA 1E1QA 3KXIA 4I99A 4TYQA 2EWMA 2IIPA 5M3BA 5BQ3A 5CB6A 3BX1A 3U0VA 3P7MA 2O3RA 5AJXA 4J2OA 4M0DA 2IEGA 4QIHA 3G0GA 3SE7A 3A3YA 3TEJA 3DPIA 5EZYA 1FPQA 1SNYA 1C3EA 4B17A 2GEJA 1U4NA 2HD4A 1A69A 4IIYA 1JXOA 2GA9A 3LPAA 3DZHA 3EVNA 4EJ0A 4CGZA 3GT4A 4RENA 2YIVX 5JJCA 2E55A 2O8BB 1BA3A 4TVOA 4I4TF 4NXNB 2NZVG 3AMVA 3PNLA 1ZU4A 1E2MA 1UM9A 2Q29A 3MJEA 4PHCA 5ARCA 1PCXA 1IXYA 4LQ4A 2PX5A 1IMJA 2ZYDA 3EGWA 1WBBA 2C5LA 1DJMA 1C4KA 4EVIA 3EZ6A 4JI7B 1ZM7A 2ID9A 2WTNA 3AVPA 3FF1A 3Q3GE 4I4TA 5CRIA 4AJNA 4AKGA 3EZYA 4BQIA 3IKMB 4JX8A 3UENA 5AM0A 2IJGX 4ER5A 3KQLA 3FAKA 2ACWA 1ZAYA 1E6UA 4HSEA 2Z9BA 1N5RA 3JW8A 3MUEA 5H70A 3PVZA 4G37A 1FNCA 1P2FA 1Q19A 4RH1A 5EHGA 1GR1A 1ZMRA 3ND6A 5D8DA 4BKMA 4HGRA 1QRAA 3K6JA 5LNK6 1M2FA 1OFHA 2ODPA 1LQTA 5GV7A 3FR7A 2QAGA 3JZFA 1MJ5A 2CXNA 3IUYA 2FRDA 3CPSA 5LWQA 2QMHA 1Y81A 2PL5A 3A10A 4U9IS 3SP1A 3ZE0B 821PA 4JUCA 3ZQ4A 1RAHA 3E48A 3OWHA 2AN3A 4LPSA 5DE3A 5DNUA 3PR3A 1EQAA 1BXRB 1QQTA 2QN6A 3I73A 3PPYA 3TGPA 1V8BA 4L16A 5KSZA 1TKBA 5DTQA 1ZH6A 1SOWA 4JBWA 2O20A 3ENVA 1CQZA 1EX7A 1FNMA 3R0ZA 3DUFB 1LVHA 1GU1A 1U98A 5T57A 3ZVNA 1IN8A 1CIPA 1L1FA 4TV8B 1BGWA 3G49A 2ZS8A 3FUCA 5LQAA 2FU5C 2CHFA 2F8LA 1UDXA 2ZRBA 1CPYA 2NWQA 1PTJA 2Z5LA 4D3YA 1R9NA 3GDFA 2DULA 4D92A 4NSNA 3F6EX 5CDTA 5SYAA 1ZH0A 2E87A 5KYGA 5AKYA 2NVOA 4LJ9A 1NF2A 5AVKA 1H1TA 2RC5A 2ZUDA 4Y0NA 1IAVA 5C32A 2WMOB 4I1PA 4O1IA 4Z9AA 3TBHA 3T9AA 2ZRKA 2R7AA 1PWHA 3K2IA 1ESDA 2W6PA 1HFWA 4EYSA 1EQ2A 4HG2A 2NV2B 3GAMA 4P35A 2WSSA 2GYWA 4C1NA 1H5QA 4KC0A 3G85A 3I5AA 1DX4A 4PICA 1BFDA 3M3HA 1RXVA 4MQUA 4O63O 2G4VA 2RKOA 3T4UA 2CZQA 3H2SA 2OV8A 1JF8A 4C06A 1PFKA 121PA 3B6KA 1LWOA 2DJIA 2VJAA 4XM0A 3N8GA 3URKA 2NO5A 1RM4A 3LLUA 5JMWA 1LW7A 3MYRA 4PZZA 1K7SN 1IN1A 1J20A 2GLXA 2FEPA 4CM1A 5K2MA 1THGA 2EEPA 3DF9A 1ISGA 1AQUA 3KS9A 3P9SA 1M8KA 2E3JA 4ENQA 3L6OO 4QXOA 3R75A 1FXWF 4MVJE 1YHZA 1MDBA 3QEJA 2X0EA 3JATB 3NBKA 2B37A 3V6LA 2ABWA 3L4JA 1Y1RA 3L0DA 1OTHA 1PV1A 1Y37A 4LOHA 3WJ7A 2QF7A 2H2IA 3D3WA 3I6MA 3L40A 2IU3A 3DHYA 5B58T 1FXWA 1RHMA 3IE1A 2QU8A 2YJ4A 3OURA 5AK0A 2IPAB 3T3MB 2GDJA 4YP7A 3RWMB 1GQFA 3O8OB 4C1BA 4DLWA 2UUCB 3KR1A 3HVJA 5HQ3A 4PCUA 4WY2A 3G9XA 5EP4A 4HHEA 5I7AA 3SXJA 1T9GR 4WJKB 1V45E 3WL8A 3WSWA 3A6EA 5BYJA 1ADFA 2PZJA 3M83A 9LDTA 1ZLXA 1KZYC 1T0JB 3DMHA 2XDQA 4RVSA 4AMZA 2B8NA 4B3GA 2H3EA 4W5JA 3TJZA 2DHCA 3BERA 4RSGA 3UOAB 1FP2A 3AYZB 3JQ9A 5EZSA 1PFWA 3IIEA 1JR6A 5CITA 4HZIA 4R1TA 4U7GA 1FEZA 1A4XA 4F93B 3EQ7A 4F84A 1UBOS 4K9MA 3HR8A 1R6BX 1OAOC 2QTZA 2DE0X 4IIJB 3JQAB 1XZFA 2LCQA 3SN6A 1M2OA 3WB1A 3GDGA 2J87A 4IUYA 1JHOA 1X3SA 3SR3A 4LA4A 1XRNA 1NW5A 3QFCA 2C7VA 1H05A 3KSMA 4JBXA 3TJMA 1V43A 2W4MA 5ALLA 2Q1WA 4M83A 3LCMA 2OXCA 1DQSA 3OP1A 3CH5A 4QOJA 4B7XA 2BHRA 2HCTA 2VHTA 4X6YA 5HFAA 5TLSA 1SOMA 3SCZA 2EYQA 4HDRB 4N3NA 2YHBA 5KWSA 3FRHA 1A5AB 4M8IA 4URHA 4YRQA 4BO7A 1GZ7A 3VDXA 3EQ8A 4CFSA 4I4NA 2EEZA 1K3UB 4OK6A 5D6NA 2IDKA 3TBFA 3X1DA 4AB1A 4HSGA 3CGWA 1QUEA 4D9CA 1GDHA 1KERA 2KLHA 1ZZGA 3MW8A 4YT5A 3O1IC 2XY4A 3HH8A 3I30X 1RCFA 1EVIA 1YVDA 4BFTA 2VT3A 3BXEA 2J8ZA 1JHPA 2YJ3A 2QI9F 3T3DA 1LWNA 3I1YA 1N7IA 2G1UA 1XCJA 4EBBA 2ZB8A 2HIGA 4IDGA 4CFYA 5KHAA 5FAXA 1TJYA 4EYOA 3PYLA 3AR6A 1ZL0A 2G0AA 3CSDA 4ZT5A 3IDOA 3DH0A 3RF7A 3JQQA 4PZLA 4B74A 1QGED 2H1SA 3W1VA 3PNVA 1OTXA 3DLBA 1ECLA 1M2KA 1P4GA 2DCUA 2OCIA 1CZHA 3RFVA 5FTLA 2HIAA 2DU8A 3UKDA 1U0BB 4XIGS 3TIFA 3TZCA 1YR8A 4PIPA 3HEBA 5BOSA 5CYGA 5JJ5A 4DV5B 3ACBA 4EA9A 1E1KA 1IY9A 1NTOA 3EPPA 4K46A 5C3MA 4YLGA 3QSYA 3P96A 5J23A 2EERA 1IYZA 4DXHA 1L3BA 3W2IA 3LDUA 5FPTA 3PYMA 4MVWA 3L6BA 1FVXA 3HYCA 4OJYA 1MG0A 4IV5A 5BWCA 3A1FA 4HAUA 2YZKA 2OZEA 3F47A 4FGLA 5LQSA 4DQ0A 3A6PC 5DULA 3TX2A 2JFNA 1DPGA 3PC8C 2PVCA 4D9HA 2FZCA 3TLXA 4JP5A 2B35A 2CVFA 3AYXB 4KAFA 1PD1A 1SUFA 1YRQA 2EJWA 2IEIA 2O2YA 4NBSA 4OYYA 3W7BA 5CCXA 5IVHA 2R44A 1I4DD 1RNLA 1H6BA 1Z0AA 2QG6A 3H97A 3LXXA 1R50A 1UQTA 2I71A 2OLEA 4IHAA 3K8YA 2RJOA 3VR5D 3SZ3A 2FVXA 4URVR 2UZ4A 2IXFA 3CLRC 3D7SA 4YYZA 1ADBA 1NW3A 3AHFA 4UKDA 2QTVA 4YBZA 2OFFA 1PVOA 2MSCB 4I7EA 5DNEA 1BC5A 5K03A 3V55A 3ASUA 3ZCVA 3ZQJA 1CY8A 4MRMA 4DUGD 3U4HA 4WWHA 3WGLA 2ZETA 1X1TA 1F12A 2P6OA 2IEDA 3IMEA 1EINA 1V6SA 3B1ZA 4M6WA 1TI7A 1YZTA 1PZNA 3KQQA 1DINA 3NRCA 4BO9A 1MHPA 1PEAA 2BDTA 4C6TB 3P2MA 3X44A 1B1AA 1QUFA 3BSFA 4FONA 3ZE8A 1N2IA 1VDMA 4L27A 2ASEA 3BUSA 1E2PA 2BFCB 4OP1A 2ZE6A 3KAQA 4DQLA 1RYNA 1VG8A 2SHKA 1KNQA 2BFAA 5AIBA 1E1RA 3V4FA 2YYZA 3NHKA 5AIAA 3Q2KA 4NMXB 2WNHA 3HEMA 4BCBA 4DC0A 1GPNA 1ML4A 1NW4A 1NXWA 2Z83A 3RSQA 5HX7A 2P77A 2ISSD 1XDWA 2VK1A 3WDMA 4DR5B 1IXRC 5H3CA 2PSSA 5JJLA 1GIAA 2XUHA 4QTUB 3SEZA 3LQ4A 5IEJA 4N01A 5AVOA 3N6XA 2VQDA 1PR4A 4IFTA 3C4VA 4L6AA 1XTSA 4F0JA 4QJIA 5CVVA 5CYPA 3VTZA 1WZCA 3FLBA 1ZZEA 5LOVB 2WU0A 4Z9FA 2JLWA 1IEXA 4G63A 5DYNA 1JR4A 2OQIA 2XH8A 2PG3A 2YS6A 4HGPA 5EKSA 5ALSA 2JRCA 3OZVA 1WPQA 1XHEA 2VXBA 3FXAA 1VI2A 5AESA 1KTIA 4IQ8A 4FM9A 2ZANA 4ZRMA 1U6IA 4D0NA 1WRBA 1XCLA 3H2KA 4NIMA 4WBXC 3TO5A 2FRVA 4C3OB 3SZUA 5KTMA 4CIAA 1AB5A 4NU5A 4OBWA 3WO1A 1QE3A 3VR4H 5CDFA 5C1IA 1XZMA 3Q85A 3GD7A 2PD4A 1Y1KE 3IBYA 4ZZIA 4OLAA 1NVBA 2G77B 4WMLA 4L6IA 5EUCA 2GHTA 1K88A 1QKKA 2GARA 4G0ZA 3GIWA 1AD2A 1D1QA 1S4QA 3TM4A 5FWXB 5K8JB 5G0SA 5B1SA 4C05A 1KDOA 4H7FA 4ZT2A 5K0BA 3BQ9A 4QFCA 3SKVA 3QY0A 1WXHA 3FRJA 1DTEA 3TUJC 1FRNA 1Q20A 2KYRA 5HUHA 3LWBA 1AT1A 5I7UA 4YP0A 3CMCO 2YZ2A 1EFVB 1X87A 4H35A 2ZRIA 2A86A 2IHYA 4XWTA 5EXTA 1EUCB 5DI3A 4TQ9A 3T61A 4A0HA 2WWVD 4M8LA 3ND7A 2WFLA 1D4OA 3C7AA 3EEBA 4OM8A 3HJTA 2ES4A 3HYLA 2PUDA 3L8YA 3SSOA 3QZUA 4K9PA 1V7CA 2NUTB 1OBOA 3VU0A 3SXUB 4J6EA 5HZKA 1M34E 2AFHB 4UAUA 4BMCA 2YN4A 1BTOA 1HE2A 1BMQA 2OBNA 1P5HA 1ZJJA 3PA6A 1JJBA 4UDNA 3RRFA 3S3TA 3VQTA 2O2CA 1J06A 2I6XA 1S9DA 2WINI 1V3UA 1ZL2A 3CVOA 1VJRA 3O2NA 3JARB 3CF0A 3K6RA 4INAA 4RIGA 5H16A 2C31A 2XRYA 3PWZA 4F3YA 3PGKA 5DNCA 3PWSA 2Q6TA 3PLRA 3M82A 3TZQA 4G4GA 2VSOA 1HG0A 1T2UA 1CFJA 1DRVA 4R4JA 3DD1A 2WM3A 5TXGA 1L5LA 2A0XA 3N0RA 3NTOA 2A1UB 3IKVA 2D1QA 1VRCA 2WT9A 1OU4A 4JMLA 3PHGA 1R8SA 1YK1A 1UKYA 1F2TB 1PZEA 4BGEA 3RC1A 2R9VA 1YOVA 4U9UA 1P1FA 3WK9A 1WCXA 4DDTA 1N1GA 1Z15A 4AMBA 5DSZA 5H7XA 4U6QA 5AVZA 4XJVA 4IP0A 3RE1A 1RKQA 2GN1A 4NNOA 3UC9A 2WZQA 3ZU2A 1RJDA 1EK2A 4IS3A 5IHXA 3B6ZA 2GTHA 3OPYA 1HC7A 1YQTA 3B48A 4K9SA 4BGVA 2REOA 1GAWA 2FQWA 3C70A 3NM6B 4BN4A 1QKIA 3AI7A 3VOBA 1LZLA 1LS1A 2QL5A 3UZUA 5F3RA 1J09A 5ALEA 4Q4CA 3QFFA 4EMSA 4ZKDA 3BGIA 1V7QA 4EGSA 5TPWB 1Y42X 2P9ZA 1YCHA 2BN4A 3D1VA 3O4FA 4NNPA 2VRWA 1KEZA 1NNUA 1NDUA 1U2PA 2FFAA 3O92A 4HWSA 2Q6OA 1P2GA 2WZDA 4KNWA 4UBLA 5B30A 3HCPA 1WULS 2VDMB 1TQHA 3O4HA 1EPUA 3GU3A 3CRQA 3AERA 3LDHA 1DCKA 2A35A 2H2FA 2JFUA 2ZT5A 1H3FA 5AW0A 1T15A 1C9JA 2XUFA 1E96A 4JU8A 2EP5A 3PQDA 1VE1A 2BKAA 1RWNA 2P78A 4YK7A 3LQ2A 2WPDD 4WK0B 5I7HA 2QTGA 1VJ0A 1QAQA 2B61A 3B5IA 5BMOA 1GKUB 1KHHA 2BH2A 4IBOA 2I87A 2QLTA 1JMKC 1ISSA 4G07A 5AM1A 3O94A 5CPBA 1THMA 4DR1B 4R16A 2PKRA 5HTKA 2Q5IA 3ISVA 2HPAA 5DB4A 5ENDA 4UOEA 3QU7A 1EVLA 1KJ9A 5ER6A 3Q8LA 4BMNA 3D5TA 4FC7A 4W9NA 1RYMA 1Z4OA 4PLHA 1R7RA 3L05A 2QR5A 3AG5A 1ZA2A 2AG1A 2KBFA 4FN5A 1Z28A 4M0EA 4RJLA 4XQCA 5KTPA 3U0BA 3ZBTA 3SQWA 1UF9A 4EECA 2EZ9A 4RTOA 4X63A 4AMUA 1VMDA 3RSLA 3WX0A 4JV5B 3I2GA 1V1MA 3GPDG 4L1KA 4NYMQ 4EO9A 4D26A 4ZO8A 1ULSA 2E82A 1E9SA 5CD9A 4RXUA 1H8HD 4DLAA 1U6KA 2QVZX 2EKPA 3S1AA 4X8OA 5TY0A 1JJFA 4K6HA 4D5EA 1KYVA 1VL6A 3HFSA 4KDRA 3SF8A 5ILOA 3WYNA 621PA 3QQ5A 4XSGA 4LZLA 4P6VF 1D2RA 2QVGA 2WSYB 3ZHTA 3QF7A 4ND6A 1WEKA 4UEOA 1AXRA 4WUTA 3OM1A 4G0MA 4YJHB 1LXCA 1SU8A 5FX2A 1WIWA 2JGJA 3WGTA 3DOIA 4IINA 4WLOA 3LUFA 3QNMA 4PWZA 1L4YA 2A1TS 2GN2A 2GTPA 2I67A 2UZAA 3IQGX 4RUKA 3UA3A 5ITSA 3TW0A 1O9HA 2GWRA 5DNDA 5FDFA 1FDUA 1J33A 3AR2A 5I9BA 3D81A 3JWHA 2P2LA 3PPWA 2I2WA 5CW2A 3J81A 3K70B 2P6UA 3Q9LA 1PJ2A 1HF3A 2AOUA 5HRAA 2ZQ5A 4DM7A 3U09A 2BGIA 2QA5A 2YXDA 3T34A 2DQ4A 4LC0A 3U17A 4OQPA 5EXSA 4CYMA 4KNYA 4UAJA 2YQZA 4XWGA 5JPDA 2J3LA 3LHSA 3QK7A 4Q4LA 2GRUA 4XIFA 1VBNA 1PBTA 3ETEA 3BK1A 1NC3A 1JEYA 3WAGA 4AYWA 4FMCF 3NGLA 1BNCA 1E9AA 2D5CA 1ZAKA 1VLLA 2VBIA 3OA0A 2CWDA 3NIBA 4IJ6A 3ZXXA 1A76A 1F6DA 2YWRA 2AR9A 1E1CA 3GGOA 4PLYA 3SHOA 5A7GA 4DV4B 5B3JC 3IPYA 1ZM3A 2CY0A 5HG0A 1KMCA 4M0FA 3L1IA 3VSBA 1CRQA 5ALWA 3WHKA 3PZRA 3TW8A 2ZRFA 5CX1B 4BIMA 4DRXA 1ZKDA 2CVHA 3EISA 2ZITA 3IOBA 3PC3A 1DEXA 1CZNA 2VCEA 4K3UA 3RUDA 5CB0A 1XNRB 1WDKA 2GZMA 4N82A 2BBTA 3AQ4A 3EMDA 3NAMA 1GGEA 2BSAA 2P9GA 2ZRAA 3K0CA 4P92A 5CNKA 4DJJA 1UBFA 4EB8A 3L46A 3DR5A 3CRRA 4DR7B 3RRNA 2Z5VA 3I28A 3L7NA 3SHWA 1AU9A 3NYRA 1GA4A 1WZNA 1OYWA 3E3AA 1T8PA 4ZZ3A 4LRWA 2BV3A 4AJJA 3D3EA 3U3RA 3QXCA 1B4DA 3B1YA 4KVAA 4ISBA 4YMIA 3A4IA 1VI5A 1WZEA 3P5BA 4QOIA 3VAYA 5HGJA 2PLFA 2AOTB 3FYUA 4JENA 4B76A 5TARA 1WXWA 1C3OA 1YQEA 2GO1A 2OV3A 3D6JA 4B3HA 3ITKA 1NFQA 4NBKA 5I51A 1RQPA 1TVMA 3CCCA 3HCCA 2QXUA 3NVDA 3ORQA 4ZPXA 2IOFA 3SDSA 3ZV6A 4HK4A 5LMZA 1H1LB 3A9RA 5TVGA 1E4YA 2GFHA 4ZYZA 4DIDA 2G9VA 1KRHA 4GI7A 2ZEJA 2GASA 2I6FA 2ZSIA 1M8FA 5FYDA 4DSTA 3DPUA 1Z0JA 4DUGA 2CBGA 3ZTYA 1X7GA 3LIIA 4RGQA 5EKTA 2BEUA 4D99A 3GVCA 4EJ6A 1IPHA 3F1KA 1SXJB 1TB4A 1Z5UA 2X8AA 1CF9A 3BZUA 4PXSA 4XDYA 5CURA 5GONF 1T0IA 1ZK2A 1R5BA 2YN2A 5CDHA 3CSSA 1UJMA 1K92A 2ZIXA 1MENA 1SUWA 2G5GX 4IH9A 4BN5A 1CULC 4MYRA 1E69A 4K8OA 4KQFA 2V9PA 4MRRA 1CR6A 2ZT8A 3NASA 1PG5A 1UL1X 4DLVA 4ICIA 2Z56A 3FCOA 3UGTA 1CWUA 3LLCA 2WAAA 2XE4A 4JI8B 2Q1UA 4O2LA 2HXYA 2QT0A 1CUCA 3GNLA 5ESXA 4DA4A 1U2GC 4FCWA 4ZQEA 2FZ4A 3M34A 4ZCLA 3UJ3X 2FPPA 4E5PA 4G01B 1AG9A 1NI3A 1OE0A 1EK5A 3A05A 2FFBA 1YL6A 3AONB 2Q28A 2Z09A 3L82B 5FI1B 2VDWB 3EFOA 3HXKA 4AWBA 2HK7A 5DXJA 2YYAA 3H65A 3WLSA 3AKDA 2PEYA 4C21A 1ESNA 3BL8A 1UR5A 4FPXA 1Q5PA 4KFRA 2DUUA 3RBAA 2E7ZA 2WIFA 4A0FA 2IYUA 3ZK9A 4A7PA 3DOOA 1A82A 2X3UA 4K2HA 2TMKA 2VUIB 3CHYA 4LGCA 2ESRA 4MW1A 4O5OA 4E11A 5KU1A 2VDRB 1TEXA 1KK3A 2HYIC 3IBSA 1GUZA 2XCOA 2AQKA 2PK3A 5GGXA 5T4BA 1SQ5A 4NJEA 1JL3A 3ZYCA 2XQGA 5DXAA 1YV9A 4W8GA 3K92A 4BEJA 2Q7DA 3U3XA 1UMBA 4TWAA 1TJ4A 1YQUA 3AFMA 4BE7B 3ZJYA 2VJYA 1L8OA 1LBSA 1BA2A 1F60A 2EW8A 4PTYA 4BVEA 3FX2A 5KC9A 4EK9A 1M76A 3SWWA 1ZOPA 2VP2A 2YFQA 3OQ6A 1WZIA 1BYUA 3HA5A 4J0JA 4G85A 4F5DA 1TYCA 1DZ3A 1MAUA 2H2WA 1YKGA 1P73A 5AI5A 5EIWA 4FI3C 4LHEA 4ZYLA 3IAXA 4PO8A 4YO8A 1SCUA 3QBDA 2FV8A 2Y1WA 2NU6A 4M98A 3IVXA 5CT6A 3PQEA 4EL5A 3IDAA 5EERA 2R6FA 4ZHQF 2I9KA 2K7ZA 4H17A 3IQWA 3OHSX 1EEHA 3GXOA 1LTQA 4MHOA 4U3JB 5A0VA 1VL8A 3ZWNA 2NVUB 1GQOA 3V6MA 4RCVA 2PYZA 3A11A 4EZEA 5LIRA 2VTBB 2EJBA 1KR2A 1OXUA 1SIOA 5C80A 3U7JA 4ZHQA 3GP8A 1FZTA 4RS4A 4ZQIA 2UXBB 3FYDA 4ZQBA 1A9OA 1PL7A 2ZIAA 1XF9A 2CLIB 2YFYA 3HCRA 3D4BA 1HZJA 2QGZA 4JGBA 4M9UA 3V4ZA 3RCBA 3KB8A 3QFHA 2QN9A 1ZX1A 1RPAA 3OIGA 4GZ5A 2C54A 1WD7A 1H3NA 2H65A 1QO9A 4IGEA 5DW0A 1O0CA 4BZXA 2XYPA 1KI8A 2F4VB 3BXFA 3HXPA 4BZZA 2CV0A 4OXRA 3COWA 4E0BA 1H5NA 2CVOA 4I0WB 1B0ZA 5D87A 3ZDYB 2WJVA 1IJKA 2WMNB 4BFXA 2Q7OE 5FTMA 3EFHA 5DSXA 1HDYA 3WO0A 4K9LA 2NP6A 1WKBA 3Q88A 3R44A 3DDNA 3EUWA 2YZ7A 3IQFA 2FPXA 3FN4A 4RD4A 4FGWA 1GTZA 1R4AA 4XGKA 1Z6ZA 3HXLA 1V11B 3JYPA 1KVRA 2P9CA 1ZJZA 1GPH1 3CX4A 1GOTA 1U1CA 3PFNA 4GMGA 1A2BA 5L7TA 1B6SA 2PT6A 4W5HA 3TCXB 1OXMA 3FZGA 2FA9A 3I0ZA 4FFMA 2QRUA 1XZBA 1ONOA 4RVFA 1VLJA 3GIDA 3V46A 3GFFA 2ZM5A 2C1ZA 2J3IA 5CT8A 2MYNA 1QHGA 5F78A 4I2NA 1TPZA 2WYUA 4RV5A 4CMGA 3IEMA 4AC9A 1F06A 3LW8A 1I9GA 3QLTA 3QTBA 1W87A 5LZ7A 2DUMA 4Q21A 4GYYA 4RM2A 5A5DA 2ZB3A 4RA6A 1QONA 3DWIA 2X0DA 1Z2OX 4YYEA 2G3YA 2N0SA 1C7ZA 3FPGA 3HY6A 3QLVA 1CU1A 1QHYA 3TNFA 4MTCA 4EKNB 4BWVA 2PM8A 3OHMA 2GPSA 2PPLA 2RB4A 4PBRA 3ADBA 3UMFA 4F21A 5LZ8A 4LDNA 3WWDA 3KV1A 4P4NA 1QPZA 2W43A 4UEQA 3V1UA 3FOAA 1YR7A 4HC4A 3VTFA 1ORDA 2Q9AA 1TM3E 3ILYA 5E6RB 3RG8A 1X80B 3E5HA 2GZRA 4J75A 3H5AA 4CVNA 3BDVA 5CAEB 3DDCA 4R3WA 3IEVA 4TL9A 1M6WA 1RHQA 4F9TA 3R5KA 5BPFA 2FHPA 3FA2A 5IBPA 3UVEA 2V54A 4G8CA 4B4OA 3V5NA 3DDOA 2VF7A 2WPDA 4UVIA 3LK7A 4ARCA 1L4MA 1PP4A 1GUYA 4TGLA 4U8GA 3ELYA 5EXEA 4B8YA 1MB2A 2LE0A 4K3VA 1JW9B 4GZ3A 3D6AA 1OMOA 3S28A 5L3SA 3INGA 3D4PA 3C7CB 4EQ6B 2XNDD 1VDZA 3PHLA 2IOQA 4E21A 3CLVA 3S8MA 5BW6B 3B5EA 2QORA 2R97A 1L1QA 4PFQA 1HQDA 2WLSA 2H3HA 5AXDA 5I4BA 4AT1A 3KQMA 2VJLA 1NY5A 3SI7A 1QYDA 2O8CB 4XFJA 2W70A 1ISJA 2QSUA 3ER9A 3DAFA 4KYTA 4UCWA 2Q5EA 4KQJA 4LBYA 1F2VA 3AKCA 5FWNA 3EF1A 5IVDA 1WDMA 2AEFA 4BCCA 4E15A 2DPGA 3RG2A 4EUKA 4IF4A 2JAQA 4LHWA 4Q16A 5LN1A 1KDVA 4ZZ1A 4FWBA 3M6LA 2WIKA 4Y9TA 5LC1A 5A04A 3MCAA 3BSYA 2QRLA 3LSTA 1X7WB 3SMQA 3S8YA 3EHEA 1ND5A 4GVPA 4Z86A 3BJIC 1DXYA 2DTXA 3GJ0A 1JA0A 3Q7IA 3FSJX 5FHRA 4I36A 4IVRA 4P4TA 2PUWA 4ZKEA 3MGGA 1F0YA 3TUIC 4DIOA 2W2XA 3HJBA 4CUZA 1YDMA 4RNDB 1BWSA 3CY6A 2JGRA 2LDXA 3D8TA 1EHYA 3AUFA 1SU7A 4QPPA 1G19A 2X6RA 3MB5A 3FNFA 5G0VA 5LZ9A 1GU0A 5L45A 4X5OA 2IUTA 3C5CA 3FBWA 4D57A 4PINA 1KGDA 4CQLB 2GN8A 5CFQA 1WCIB 2W6QA 5LP6B 3W3AH 2PX8A 1ZD2P 3K9WA 1AQJA 3BMOB 1ULUA 2ANCA 2CLSA 2Z95A 3CZCA 5H81A 3T1OA 3V3TA 2XBLA 3ISTA 4FMDF 2ZW9A 4IXMA 4K9QA 1Z6XA 5B1YA 4LYHA 4OBBA 4N9WA 3VH1A 4WADA 3KEQA 4COKA 3VJRA 3A6LA 1ADYA 3UJNA 2VQSA 2X13A 3OEHD 4YCSA 1KRWA 2RK3A 4PQFA 1T10A 1LDYA 4FFBA 1Z7EA 2H4FA 4KFSA 4MJ3A 4NCHA 4DLKA 3IPAA 1CLUA 3DE5X 2DTEA 4K6GA 1CQJB 4NRDA 3DP9A 3ZBQA 4L0QA 5KYWA 4JKIA 1WJGA 3LL4A 4M1SA 1QHEA 1D6JA 2H5JA 5CVJA 4F5EA 4INPA 4KSCA 2UZ1A 1T1JA 1N7JA 3NKFA 4QGGA 4TTTS 5DYWA 1BMDA 1ITZA 3GPIA 3HGMA 4DE5A 3FJYA 4G9EA 2EFGA 4GIBA 4IGAA 5CEJA 3ED1A 2GZ2A 2Q3LA 6YASA 3MXTA 3R6TA 4HWPA 1XDGA 1XMPA 1FDWA 1K4MA 3ZVLA 5J3JA 5K0SA 2XVXA 4NECA 3SJUA 3ST7A 2OCKA 2D59A 4Y18A 2TMDA 3I2YX 3HE3A 2PMBA 3AILA 3OZRA 3RYHA 1TF7A 3OF3A 3E3MA 3K9QO 4PO1A 3N0VA 4GP9A 1VM6A 1JG6A 4IQGA 3MLBA 3TH5A 3R20A 4IX1A 1G2QA 4J1NA 2BKEA 1N6IA 2F2TA 4KO1S 5TV2A 5KNCA 1GGMA 1U81A 2G40A 3EOZA 5JAUA 2XA2A 5BR7A 2OCDA 4D9IA 5HBGA 2FKNA 1F51E 1UWLA 1N3BA 5LQNA 3H18A 2HU5A 1K86A 1RLIA 2TRSB 4OH1A 3RRMA 1TTQB 3RRJA 2WVGA 3V1LA 4P8RA 4RJKA 1H0HA 4BNLA 1P0PA 6REQA 3N58A 1CEQA 5DWDA 2CUKA 1LI4A 1WUYA 1LK5A 5AM4A 5BWLA 1WV0A 3KB1A 5CT4A 3WLTA 1SVSA 1GZ5A 5C5CA 2VJPA 1RQRA 4HR7A 3TG8A 1M8GA 4F91B 1N5OX 1VJCA 2HU8A 3BE4A 4WX2B 2I78A 3W5IA 4IFBA 2WE8A 2BYTA 2OORC 3DB2A 5B4UA 3G79A 5FR1A 2XIQA 2ACEA 3NJRA 4TLLB 4WL0A 1K7FB 1XJCA 2IF0A 1XTQA 2XQKA 3PV0A 4MVJG 4Y2PA 2GEVA 2QJRA 2FPSA 2YMLA 4FX5A 1GTJ1 2AHOA 5LQDA 1USGA 2AN1A 2FI1A 5F3WB 4E94A 1XRPA 1ZQ9A 2X1HA 4M0CA 4MQFA 1W76A 4QOFA 1AKQA 1F4VA 1YJQA 1XR3A 1XQXA 1S3GA 2LVBA 2ZR7A 3V2UA 2Y0DA 4WLVA 1LJUA 2Y1XA 3E58A 2RHDA 2XWQA 2ZWIA 4S1WA 4C0SA 4HMPA 1U2SA 2JHGA 2DH6A 3ZKAA 2CFRA 2Q1TA 4BNDA 2BMJA 1MB4A 2I3ZA 2VUTA 3M1LA 3ON5A 3QWIA 4GWLA 5FADA 4DUPA 2IYWA 3HKDA 2IYPA 3IFSA 3IIJA 2RG7A 1JWLA 1X1SA 3AETB 3OJ0A 4HUTA 3NFYA 3BM5A 5J2TB 3S2GA 4DNXA 5BORA 2R11A 2O0LA 1YZNA 2Q3JA 3HSYA 3JZDA 1D5CA 4RFSA 2X6QA 3A4TA 4UE2A 5HRUA 1MRNA 4JSYA 5EJAA 2OM6A 2QL9A 3TQRA 1DBPA 4DOMA 4UZSA 2MDTA 4LXUA 1RJWA 2ZAOA 2R87A 2PRZA 2VTDA 3O91A 2QL7A 1IHDA 2CXOA 2FW7A 2YIJA 4L8VA 1VHJA 4CKCA 2ETVA 1VHWA 3BULA 2W0SA 5D3KA 4PAWA 5J1SB 2HWUA 3BAFA 3WFJA 2O6LA 2X0JA 3QYJA 2BFMA 3ZXSA 5FFMA 3IPLA 1UBGA 4CM9D 5I9IA 5JXIA 5U9CA 2D2VA 3L0BA 1GRVA 5KNLA 2HMAA 4WFQA 4YY3B 2WUDA 2GK4A 1C1DB 4XVUA 3P2JA 4F92B 2ZQZA 2W48A 3U61B 3OQPA 4E2YA 4RWEA 3I2IA 3W4JA 3Q9NA 1U04A 4HN2A 5HCUA 2J5KA 3TW4A 5A4DA 3AKEA 1ST3A 3ZY4A 4BNNA 4DCMA 3N2KA 4B81A 3E3NA 4QFBA 1NOIA 1ESCA 2OQRA 3ICCA 4HAZA 1KMMA 4PX2A 3QJYA 1KY2A 4HNSA 4Y2QA 521PA 5IXYA 3H5WA 4LMRA 4PONA 4IDHA 4ME6A 3TQHA 1QMGA 2QAGB 5IKXA 1XI2A 2O5VA 3UC5A 1SG0A 5AM2A 2RGRA 4FYJA 1JKIA 1E7YA 1VHTA 2C92A 3D7LA 3EZXA 3H86A 2B21A 3DOHA 3P9CA 4TMKA 5IBCA 2H1HA 5BO5A 3ROEA 1YQ9A 5LLDA 1EA5A 4BJ1A 3SSNA 1D2EA 5TGZA 2C2OA 1KOJA 2XNHA 1KJYA 3QBJA 2BM8A 4H9GA 3WL3A 3WGIA 4YAEA 4F5YA 3OE5A 1V8OA 1ZOLA 1ISMA 1NT2A 3K53A 1PLKA 4HLNA 3F4BA 1G38A 2HV8A 2JVKA 1MT3A 3G9TA 4MUNA 1I80A 5SYNA 1TMYA 5J2UF 1WP9A 4FUTA 2RHWA 1ZICA 1NOJA 3K0KA 4FBMA 5JWOA 5I4IA 3TI7A 2NVBA 2ZSAA 2O8EA 3AUXA 2W2OA 1NUQA 3RSOA 5J2UA 4MLZA 2AG5A 5KNBH 4GOJA 4Y30A 2H0RA 1CBUA 3R8CA 4J0DA 1VPEA 2X3FA 2CL7X 2WEKA 1XQ6A 5CDSA 3CNNA 4DILA 2V0GA 1DQNA 3FOZA 4GSYA 4KXUA 3VOSA 2DWOA 3A27A 2XZOA 1U7TA 4L85A 1IXKA 1L5WA 1QTRA 2A4KA 1DLJA 3O38A 4LE0A 1FFAA 1W44A 4KG7A 2Q5QA 1G6OA 3A0UA 3FPKA 3OT1B 3PXDA 4R3UC 4WA8A 5A6SA 2FSSA 1N4AA 4EGFA 2ZTHA 3KLPX 4XPIA 2R86A 2AMLA 4MI3A 4EUHA 2ZRMA 3ABQB 2VYNA 1Z73A 1FMJA 3THXB 1W5TA 3GQBB 2QR3A 3R2JA 3D3NA 3P2KA 2QUKA 4ND7A 4V3BA 5DX8A 4YDRA 5EJ6A 4RHUA 5G40A 3LGXA 3IVMA 1G66A 2GAOA 4FXPA 3UM9A 4W6ZA 4PIVA 5DTIA 9ATCA 6ABPA 1FW6A 4HAXA 2PD3A 1ORVA 5PGMA 1GGVA 5E1OA 1T5OA 4GOMD 3WAJA 3WMGA 4WDRA 3OOYA 4B87A 1AE1A 3AEXA 1KZGB 4YREA 1P81A 3WIEA 1PGJA 1RYBA 1GKYA 1F38A 1K1EA 4LZWA 1GWNA 3KWLA 4UHBA 3K6SB 4MYUA 1EHCA 4IMIB 3T5TA 5HQ3B 3KUXA 4BMSA 4ZOEA 2H48A 4PNZA 1H2WA 4Q1FA 1MMFB 1XN4A 5DW3A 2IY9A 2C4NA 2XNDA 3K2QA 2EZTA 3OPMA 4HPXB 2BMAA 2XDQB 3BB3A 1L9XA 3LCUA 4DLPA 1RZVA 2OV6A 4CDNA 1Z2EA 5I7VA 3BBLA 3IBTA 3FAZA 5C51B 2AW5A 4W9RA 3KOMA 1CYDA 1ZY2A 2OXFA 4LUCA 3PRHA 3HJGA 1JHRA 3KXPA 4A8JA 3BXGA 3DVRX 2VO1A 5FFNA 2PUAA 2XJ4A 2GHQA 2PLRA 3M6UA 1W9HA 2AW3A 4JN6B 4MA0A 4DA0A 3GHHA 4XGRA 4UPEA 2F43B 4QOGA 1K27A 1OFVA 1UEIA 4X1KA 4YALA 1EWYA 5K3AA 5TQVA 5KTRA 4N41A 4JEHA 4OHCA 1XWWA 2IA5A 2RH8A 3FVRA 2EHJA 3K05A 3TCKA 3L8GA 4JEIA 3E1SA 3DFZA 3FPCA 1WW2A 2G82A 1H4TA 3SJZA 4WECA 5J5AA 5AKIA 2BCGY 2BEWA 4XVQA 4FYIA 3ADOA 4BASA 1ATIA 3GQVA 3LF2A 4ZU1X 4OL0A 3MHTA 1FSSA 5FEMA 3M1IA 3TD6A 1U2ZA 2H5EA 2IKSA 2YJGA 4UHCA 4C76A 1PE0A 4OMFG 5E2IA 1L3CA 4WRRA 1RP1A 2CBXA 1FTNA 2NNWB 3I76A 4BO4A 5K8UA 4HDSA 2YR0A 3PJFA 4U5QA 5AUPB 1YMVA 2B9EA 3V9AA 4NYMR 3U7EB 3VPCA 3HXOA 1O8CA 3NEAA 3VU8A 3FPBA 1GT91 1RAFA 3M6XA 3MEQA 1E79D 3PHIA 4OK3A 3REQA 1XGKA 3BFVA 1D1TA 2DPLA 3OEHA 5C8XA 4LRXA 5CXXA 4MVJF 3E70C 2AUNA 4I9FA 4M99A 3TTTA 1F2UA 2AV6A 1FNDA 2P35A 3KFVA 5A3QA 4UM9B 4ZREA 3ZQUA 2I7VA 3WQHA 1PLLA 4AN1A 1UDBA 1E7RA 4HH4A 4RTRA 4B82A 1WVGA 1H66A 2X5KO 5C1BA 5FWDA 1ZA1A 4OMCA 2A67A 4W1RA 1GRQA 3OMXA 3DWFA 3O8LA 3RF6A 1EHIA 4G6ZA 4BBPA 4UU1A 1QVWA 3KOXA 3UICA 4F4UA 3Q40A 1Y4AE 1Y9ZA 3ES9A 4DHWA 1N4DA 1DT5A 4U2KA 2J32A 4GLJA 4WY5A 4CL8A 3ROMA 2VCHA 3ABOB 5E0KB 3U49A 1OFUA 5KTKA 4HO1X 4PHGA 4JC0A 2RHJA 1GITA 1VP9A 5MGNA 2ZPAA 5KHLB 2VAVA 1KSFX 1SC6A 2F7SA 3FHOA 2VOEA 1KP3A 2PUVA 4YJGA 3PF8A 1DWPA 3ZOZA 4FFWA 1NXVA 2QTVB 1Q83A 3O4JA 3OTOB 2RHTA 4JLPA 4FK8A 3WL5A 4TLCA 4A6XA 4B4UA 5B6PA 5CBPB 3THWA 2ZR8A 3OKPA 2BRUC 1UKAA 4LY3A 2OAP1 3NU1A 5CYOA 4DIUA 1H9CA 2KHZA 4HDMA 1VIVA 1PJAA 2I1LA 1S7CA 1TKRA 2FUG6 1FLNA 3TN7A 4M6WB 3R7FA 3BMXA 1WVMA 5EJMA 2QP4A 3L6RA 1U9IC 2BWJA 2P6NA 1BRMA 2POQX 2V59A 4DGSA 3B9QA 5HTOA 3VZCA 4AQ7A 2A3NA 3VR6H 5T8KC 2OP1A 4X24A 4U7HA 1DKQA 1BZYA 3NYQA 3GK3A 5ES3A 1CZLA 1MG5A 1PUIA 5CMLA 1N1MA 4DMKA 1QVZA 3GZTB 4RSMA 1GQSA 4X91A 1VBFA 3D6FA 4XUEA 1CY4A 5DCLA 5KO2A 1LV8A 2WM2A 5AJYA 3KDAA 1RSZA 4BTVA 2W6NA 1BRTA 3QE3A 4K9KA 2NZJA 4KCGA 1I2CA 3NETA 4AULA 1BEUB 1FDRA 1R15A 2W83A 2CXTA 3EARA 3ZE1B 4IDCA 3T9EA 2WICA 1FUUA 3OY2A 1V41E 2OOKA 3SNHA 3TQFA 3PT5A 3ZGZA 3TSOA 1V47A 1V6AA 3HGTA 3ESAA 2FZVA 4B75A 2FAXA 2G0NA 1BE1A 4MYSA 3UIEA 3M6AA 3BL5A 3RYFB 3INYA 1V5GA 1DOAA 1NZDA 3HFRA 3HKCA 4PQRA 1GGJA 1FQJA 3G02A 3BIFA 3C16C 4M1ZA 4MA5A 5EWLA 5EMLA 4U2FA 4UNQA 1TLTA 3KYCA 4DZTA 2VDNB 4FKBA 4BNIA 2D74A 2Y6UA 1M1UA 2BOVA 3A6HA 3WZLA 1ORIA 2B92A 3RC3A 3IURA 3W8FA 721PA 2P2SA 2F64A 2YVUA 3HL4A 4UDYX 5CXSA 8LDHA 4X64B 3FDJA 4DV0B 2OUKA 4HCJA 3RTBA 1SQ0A 2QX8A 4OH7A 4C4AA 5JZOA 5HSGA 5HK9A 2XQIA 1QS0A 3MIZA 4F8JA 3BF8A 2ZYWX 3KDSE 4JGGA 7ABPA 5F7XA 1DBRA 2X23A 5ALZA 5A9TA 3D8NA 2QJFA 1LUAA 4FI3F 3K1AA 2ZKLA 4G5XA 2X5JO 3GG2A 1CY6A 1AN9A 2O1SA 4NS1A 1C5KA 4R81A 1RXIA 3GRZA 5E7JA 3F96A 4PAOA 4Y8VA 3SU8A 3WGNA 5CVCA 4CM9A 3UMMA 5DI3B 2C29D 3A28A 2XQVA 1FFEA 4H6WA 1W29A 2CNKA 4PAMA 3MG9A 4JJGA 4FYVA 5F7JA 3G1UA 3H8SA 2YUIA 2JFBA 2I62A 1WQ4A 4MNTA 5TT1A 4WNYA 3ZW8A 3OQNA 3HJRA 1BD4A 2ZWVA 3AQIA 4JVOA 5LM3A 4ZFNA 1OFUX 4DMFA 2B7LA 4JUBA 1SVOA 5KSWB 3D1JA 3U56A 5TPZD 1NN0A 1Z62A 2EX4A 2IUEA 2LCIA 4NFYA 3RIHA 2E1RA 2OXIA 2R47A 1Z36A 1U7WA 4MV3A 2NP7A 4AS3A 3ZD6A 3B1XA 4KR3A 1FMTA 4L4ZA 4R2JA 2DY0A 3DO8A 4OQ4A 5ILGA 5FORA 1M5TA 3QKIA 1XHFA 5DHTA 3U9LA 3IVRA 3C74A 5JW6A 2BMFA 5FA8A 5J59A 1AMNA 2OK8A 4K6OA 1SOVA 2YH2A 2ZBEA 1JAIA 2CXHA 1YA6A 3KKOA 2PRJA 1ODCA 4KFUA 1L4NA 5BT8A 2Y92A 3DT6A 3IT3A 5I9NA 3KQHA 1V1RA 1NZJA 4TLEA 1ZOSA 1LLDA 3FGZA 4TQAA 1IB6A 1YOVB 2W6JD 5KTOA 2ZUUA 3P9KA 4ZQCB 5KEIA 1NQXA 2VP5A 1Y34E 1U99A 1P1HA 5HEKA 1QYRA 1FJHA 1RKVA 4YP5A 3OEWA 4EPTA 2JHFA 5KINB 1JQAA 1IPEA 2NIPA 2P90A 2PR2A 1B15A 4BNTA 1R9JA 2DXIA 1WOMA 2C2XA 2IHUA 4HFNA 1LPNA 3OPYB 5FUVA 1HV8A 2W8BA 5LNK1 1ZW6A 4WCFA 4AS1A 4FHGA 1ZUIA 4R1PA 1PNQA 3WYGA 4Q3AA 3W5CA 1VI6A 1EK6A 1QFXA 3LAWA 4DMGA 3O0DA 1T2EA 5CTAA 3IS3A 3ZW9A 4J4HA 4DYVA 3KQUA 1PT8A 3EIUA 2VF5X 4ZC1A 2KMLA 4IIFA 4Q00A 2H5IA 4GHWA 2MMGA 1VBMA 5K9ZA 3X1KA 4MMYB 4OQZA 1VCHA 4GPBA 1BWRA 3RRBA 3ZR4B 4UXIA 1X7HA 1NBIA 3Q3HA 3VYTB 2OFOA 2VZ8A 4M9QA 1SOUA 2W2LD 3VO1A 1F20A 2VPZA 3MCZA 1N8TA 4I55F 1JSRA 2VRNA 3KPVA 3UJ7A 4KXYA 4URWR 1P0MA 3C4QA 4WKGA 3R8FA 4F3CA 5LL6P 1BN6A 3C3KA 1QDEA 2SKEA 4E4YA 3QEAZ 4I55A 1W4ZA 2EW2A 1GRNA 1TO2E 4Q1CA 2Q5JA 2JAUA 4WBSA 1JXQA 3IP1A 3RVMA 1EDBA 1YB6A 3VNBA 5EXPA 4OTZA 3DCJA 3HEAA 1F6WA 1OB5A 2AE2A 2XNJA 4M60A 2ZU0C 3KVRA 1LGYA