4D6XA

Crystal structure of the receiver domain of ntrx from brucella abortus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
b'DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLDGLALLDEIKKQHPELPVVMISGHGNIETAVSAIRRGAYDFIEKPFKADRLILVAERALETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL REGULATORY, FIS FAMILY PROTEIN
publication title Snapshots of Conformational Changes Shed Light Into the Ntrx Receiver Domain Signal Transduction Mechanism
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d6xA00
4NV3A 3JVIA 5JNRA 3OQNA 5DLEA 2M1ZA 3K9CA 3LUDA 1BDIA 3H1GA 3I5AA 1JYFA 3DZDA 3KKEA 1Z18A 2PAFA 4IRXA 4EVSA 5TPWB 1YS6A 3FMVA 4MLDA 1YS7A 5FWXB 4O1IA 4MLCA 1ZDMA 2FMIA 4E7OA 2AYZA 4PEVA 5FBKA 4ETNA 2PKXA 1VLZA 2VYCA 2NUBA 4EGSA 5EWLA 1EFAA 1U2PA 4G86A 3EQZA 2CHFA 3RVLA 1SD5A 2OQRA 1TM2A 3CZ5A 4KK4A 3QLVA 5C5CA 2ZWMA 5KQGA 4RKRA 5CHYA 3CNBA 1BVHA 1MB0A 5B3JA 2GKGA 3CRNA 4TLMB 3E61A 5FWYB 3CFYA 2LP4Y 1DG9A 4YS6A 1SRRA 2WMYA 2NZUG 4Z4CA 2FW0A 3HVRA 3L49A 4KFCA 4F8JA 1FFSA 1JF8A 4LE2A 4RSMA 1U8TA 2LIVA 1J56A 2JRLA 3C3MA 3LUHA 3OO1A 4YGXB 2QVCA 1DRKA 1TVMA 1UDRA 2M98A 2MYUA 3BBLA 3HV2A 3LUGA 2FXIA 4XFKA 2QW1A 3BREA 5CNMA 4PE5B 1URPA 3QLUC 4KV7A 5KC8A 1DBPA 3FGZA 3I09A 4KVFA 3SAJA 3HK2A 1U2QA 1Z17A 4DN6A 4Q6WA 1NXVA 4PZ0A 4LDAA 3CG4A 2QZJA 3OMXA 4Z4FA 2WJAA 1QP7A 2RGYA 1W9HA 2JBAA 4Z4HA 4ZPJA 1L5ZA 2JVJA 2FEPA 4MGEA 5IX8A 3P9YA 5HQJA 1EHCA 1QP4A 2PMCA 3IPCA 3VNAA 2BGGA 2CWDA 1QMPA 1QKKA 2IPMA 2E4WA 2CHEA 2GX6A 4NICA 2FEWB 4QYMA 3DGEC 2W42A 2FLWA 2RDMA 3QEMA 4RK1A 4N47A 2L2QA 2GI4A 3T6KA 4RZSA 4EYGA 2B1JA 2FKAA 5KQPA 2E4UA 2HQRA 3QELA 4OLBA 4MS3A 4W5TA 5IEJA 3FFXA 1F4VA 5TQJA 4KRFA 4MS4B 1ZGGA 5JS1A 1P6UA 3F6PA 3M9WA 4L85A 4F06A 1NXSA 4WXMA 3LMKA 2F8TA 2MSLA 2IKSA 1RXIA 2O20A 4OLAA 1BA2A 3A3KA 5JNVA 3LOPA 1ABEA 5KI6A 1ZH4A 4IF4A 1OXBB 1KGSA 2HPHA 1MVOA 1FFGA 3KHTA 4RK0A 5D2CA 1BDHA 1ZY2A 2QR3A 5EWJA 3NNNA 1S8NA 1Z13A 3HEBA 3QX9A 5BRAA 1FQWA 3FDFA 3Q7TA 2HQOA 5TQ2B 2QU7A 1P6QA 1H9CA 2CD7A 4JAVC 2MSKA 3RVRA 2PUBA 4WXEA 3DLBA 5JS2A 4GNRA 4ZMSA 1ZITA 4JASB 5JNSA 2P4UA 3HCWA 4XAQA 3H75A 2MYPA 5TPWA 1YVUA 4ETMA 1AB5A 3MA0A 4KPYA 1E2BA 2Q5CA 3GT7A 4FE4A 1PEYA 4JA2A 4ZJPA 3A10A 5ABPA 2ID9A 1LK0A 3KS9A 1ZN2A 2MYTA 2R25B 5DTEA 3SY8A 2E4XA 3OQOA 3NNSA 5EWMB 4ETIA 3HDGA 1ZESA 4RKQA 4MR8B 2IDMA 1VKRA 4MQFB 4N76A 1SXIA 4WT7A 3F7NA 3MM4A 3RQIA 3EULA 3I42A 4P98A 2WB4A 2IPAB 3RVJA 4LE0A 4MR7B 1NXWA 8ABPA 5TQ0B 5DKFA 3IPAA 7ABPA 4LDZA 4OBBA 4RK7A 3IP5A 5F64A 1ZAYA 4Z99A 2J48A 4RY0A 4KZKA 4UHJA 5PNTA 4H60A 3CKMA 3QEKA 3M9XA 3NNDA 5KQLA 4RXMA 4KK3A 1KRWA 3KLNA 3RH0A 3GWGA 3DBIA 1Z16A 2IPNA 2QV0A 3F6CA 3LUKA 5IUNC 2RJNA 3R0JA 1EWVA 3N75A 4Z0NA 4RK4A 3KSMA 3JTEA 1GUBA 4YP9A 3UK0A 1U04A 4IGAA 2JVKA 1C4WA 1B00A 1JBEA 3LFTA 1JX6A 4FB4A 1L5YA 1RNLA 4MPTA 4E7PA 2GBPA 5BQ3A 1JHZA 2FMKA 4MQEB 1QP0A 4G0PA 1F51E 1JL3A 1P2FA 2RJOA 1QQBA 1YIOA 4G0MA 3KJXA 3LUJA 2OENG 4Z9AA 4ZMRA 5CNKA 3OLZA 3CTPA 3Q41A 4MS1B 2PUCA 4EVRA 1VPWA 3TD9A 4MS4A 2HQBA 1DBQA 3A0UA 1Y1LA 1DCMA 3NHZA 3O2QB 1ZVVA 1JH9A 2PUEA 2GWRA 3H1FA 1E6MA 2R48A 5CNIA 2YHAA 3LTEA 4B09A 2TMYA 3E3MA 3N0WA 4EUKA 2IPLA 4KQ9A 4YO7A 3EAFA 3IDOA 1NTRA 4WUTA 3D8UA 3GBPA 2YHBA 3HO1A 1FFWA 3K4HA 5TQ2A 5IUKC 2FN8A 3O1HB 4MRMA 2MSWA 1OXKB 3LUAA 3H5LA 5JNWA 5JNUA 1A2OA 1M2EA 4KNYA 4KREA 3L6UA 1M2FA 4EYOA 2VK2A 1W25A 5EWLB 1MB3A 1YMVA 1JDNA 3N0RA 5IEBA 2LPMA 3KYJB 1QQAA 4L4UA 1D1PA 3I45A 4FE7A 3RVSA 4N0QA 2KYRA 3HUUA 4LX8A 2JB9A 4NQRA 1YMUA 3CG0A 1CYEA 3ILYA 1KMIY 1U0SY 2IOYA 3VNBA 3JY6A 3OLVA 1A04A 1SXGA 1JWLA 1K66A 4MR8A 4GPAA 4NCBA 1GCAA 3KG2A 4JP1A 1APBA 1XWWA 4XASA 4Z4EA 1DCKA 3D02A 4MQFA 4OG2A 3N0XA 4Z4GA 3ROFA 4S05A 5DCLA 2WY2D 4YLEA 4WZZA 1LJUA 3QLVC 4G0XA 1QNLA 3FFTA 3G85A 4P1ZA 1JYEA 4W5NA 4JOQA 5T7BA 5B3JC 1R8JA 5TQ0A 1ABFA 3ROTA 2PUFA 4G0OA 4IILA 1XHEA 3HM9A 3H5IA 3QLTA 4D6YA 4RV5A 5FWXA 2B4AA 4Z9BA 3CLKA 3HJFA 3O74A 1NXTA 1ZHHA 1PNTA 5TE9A 1EWTA 2JBAB 3G1WA 1LBIA 4RK6A 3NHMA 2PUDA 3OLXA 4QICA 3O2SB 2X7XA 3C6QA 4W5QA 2WRZA 5ED4A 3HDVA 5C5EA 1IIBA 2E4ZA 1Z12A 4H3HB 2ZAYA 4F3TA 4UHKA 1E6LA 1ISRA 3JPYA 3RVOA 3RVNA 4MR9B 1PNRA 2QVGA 1NY5A 2A9RA 2PLNA 4G0YA 4MQEA 4RS3A 4YV7A 3HXMA 3KLOA 4IMJB 2QSJA 5FWYA 3QLUA 5DGCA 4ML3A 4RWEA 2E4YA 4CBVA 1KRXA 3OLWA 1JLKA 3HUTA 3O75A 4MS1A 4N03A 3H6HA 1AB6A 3N53A 5GOTA 5KQMA 3TB6A 3BILA 2E4VA 3BRQA 4OATA 1QPZA 1GLGA 3GV0A 3JS5A 1MIHA 3QX8A 3SNKA 4D6XA 5HSGA 4D74A 3CU5A 5EWJB 4PICA 2A9OA 1RZRA 4DADA 1ZGZA 1DBWA 2FEKA 2JVIA 3EQ2A 5CNJA 4JB2A 3TMYA 1D1QA 1E6KA 3HZHA 1YTUA 3Q9SA 4KMRA 2FLKA 1NXPA 2VUHB 3TO5A 5GQSA 3KYIB 2PJUA 2FMFA 4WWHA 3QK7A 4G0ZA 3CHYA 4RXUA 5HM6A 5KC9A 1USGA 3MYYA 3OM1A 4G0QA 4HNSA 4MYRA 3H5OA 2FTKE 3A0RB 3IP6A 5T3YA 4ZYLA 1USKA 3EDCA 2V0NA 1LJLA 2QXYA 4H3KB 5TPZA 4YRZA 1RZRD 2L19A 1JFVA 4F12A 4EVQA 4TMYA 4TN5A 3IP9A 4YCSA 2L17A 3RVPA 1K68A 2L18A 1ISSA 3LUFA 4RK5A 4KQCA 1TLFA 3JVDA 2PUAA 3W9SA 2F8SA 2PUGA 1EWKA 2JCGA 1RPJA 1XHFA 1I3CA 2P9HA 2AYXA 3OQMA 2FQYA 1RXEA 3C3KA 3IP7A 4PYRA 4EYKA 5KWSA 5BR1A 3JPWA 1Z15A 3O1IC 1Z2EA 3BRSA 4Q7EA 3GA5A 3OMWA 4XLTA 1D4ZA 1LBHA 1NXOA 1D5WA 1YK1A 5E3JA 5TPZD 3TX6A 1DZ3A 2H0AA 3UKJA 5IULC 4RY9A 1Z2DA 1DJMA 4NCAA 1SXHA 4MAAA 3C3WA 3N8IA 3UUGA 3KCNA 4IMIB 1JFSA 3O21A 4DQDA 4XXHA 1TJYA 2ID7A 2XDYA 3HS3A 4W5OA 4N41A 4O5AA 1QO0A 6ABPA 2H3HA 1PUXA 1DCFA 3OM0A 5JNTA 4YWHA 3RVMA 3F73A 1DRJA 4RY8A 2PL1A 2VUIB 3LKBA 2LBPA 9ABPA 2IYNA 3OLYA 1P8AA 3O1JC 1VRVA 5EWMA 2FQXA 2LUOA 4TLLB 3FFWA 4RXTA 3KTOA 2FVYA 4OTZA 1NATA 2DRIA 3EJWA 4M88A 2WJWA 2FMHA 4LRQA 2N9UA 1CHNA 2NT4A 1MAVA 4Y9TA 4RDCA 3OO0A 3ILHA 3T8YA 4MR9A 4XARA 2FQWA 4G97A 5FBHA 3S99A 3M6MD 1CEYA 1Z25A 4MR7A 4HYEA 1GCGA 4O1HA 3H5VA 1QO0D 3Q15C 3SM9A 3HSYA 4HNRA 1DC7A 4EYQA 1D2AA 4QPJC 3SQNA 6CHYA 3EODA 3GRCA 3Q7SA 3MF4A 3RVKA 2HJ9A 3DLHA 1JDPA 3LKVA 3T38A 1T34A 5IC5A 4S04A 4YR7A 4LZLA 1Z26A 1USIA 4Z4IA 5BRJA 3H5WA 3MQ4A 2NZVG 4MRMB 3CZCA 2R4QA 3B2NA 5IBQA 2R47A 3QEMB 3C97A 4W5RA 1M5TA 2A9PA 3GBVA 1A0OA 1TMYA 4RU1A 1BDJA 2PE5A 3QELB 1M5UA 1NXXA 4MS3B 1WETA 1DP4A 3GYBA 3CS3A 5HKOA 1C0EA 1PHRA 1EAYA 1YK0A 1BAPA 1HEYA 4HNQA 3EGCA 2I6FA 3NBMA 2PL9A 3H6GA 5IUJC 3RVQA 2JK1A 5I4CA 1JFTA 1DC8A 3LUCA 4Q6BA 3N6VA 2FSPA 3GL9A 1PEAA 3H5TA 2WWVD 3O2JA 3Q7RA 3H1EA 3T95A 3URMA 1FSPA 4QYWA 3MMNA 4LE1A 3DGFC 4N0PA 1ZH2A 2HSGA 3MIZA 2FN9A 3SG0A 2MYNA 4F11A 2NT3A 4EY3A 4JB0A 2A9QA 1GUDA
chains in the Genus database with same CATH superfamily
1E1CB 1RWKA 1OREA 3I9LA 3LUPA 1D07A 4JOSA 1IZYA 1UAYA 3AQIA 3B7GA 4MVJF 2O8NA 3LFUA 2QTVB 3ZS9A 2IRWA 4RTOA 1KZ4A 2ODWA 5EXDA 1ZWKA 4DR6B 4NBSA 3FFBA 3HB4X 1J42A 2J9FA 1NJFA 1MO2A 1WMEA 1A97A 5CW2A 5FJIA 1MW9X 4C4YA 4X20A 3CVUA 3U7RA 1Q1NA 2UVPB 5FBKA 1Z5VA 2NTJA 4LW8A 1STOA 3QUAA 1GUZA 2ZAMA 2Z2JA 3N74A 4WLUA 5HNKA 2AI3A 1UP4A 2VDUE 3X1ZA 3RHZA 4GKKB 2VPXA 4TRJA 1SD5A 3AJ8A 3TBHA 3DXXA 2C9ZA 4DRXB 1L4BA 3UJ3X 5A1TA 5F52A 1EXMA 2WF6A 2BEUA 3WDKA 2V9PA 1YMQA 1CJTC 4M8SA 4RKRA 2CFRA 4L4ZA 1JEAA 4KX3A 3R3WA 1QAQA 3CRNA 5EXXA 4WFQA 5ALJA 1ZD1A 4OQZA 1DG9A 3L8MA 1DO0A 2RHBA 3E9RA 3QIAA 2PGLA 4AXBA 1LLCA 3EH2A 1XLTC 2AR7A 2Y1LA 3TGLA 2EU8A 4HX9A 1ZIYA 4MUJA 4F0JA 1CG6A 1I2AA 3Q5EA 3G2PA 4HWTA 4DZZA 1OB5A 1J56A 2JRLA 3Q3HA 5TSDA 2AI1A 4GQIA 1F2UB 3SYKA 4D82A 4LJRA 3S81A 1R18A 4XFKA 1WTCA 4JHXA 5CNMA 5JWOA 3QLUC 4WGFA 3HK2A 2TSYB 5IZCC 3J7TA 2VJMB 5AW4A 1JIVA 4R98A 5FQOA 3LL7A 3TW8A 2TMGA 2CBXA 3IAHA 2J41A 1H2RS 1UK8A 3DZJA 2CKMA 1B6RA 1M1UA 2NYUA 4QDZA 2FEPA 4AS2A 2H7YA 2BTEA 1R0YA 1I1QB 1CUCA 1U0EA 2AEEA 4LA4A 4O2LA 2OG2A 2WFLB 3N70A 4QYMA 5K3FB 3B5EA 4YROA 3DGEC 3O91A 4RK1A 4DJ5X 4YRLA 2B1JA 5EE0A 1UMBB 4Y18A 5CTAA 4B4UA 1F2DA 2XWBF 2CFSA 1PZGA 2OD7A 5AW0A 2F1JA 2QN8A 3GZNA 3USCS 3BA6A 3I04A 1VRCA 3ORFA 1SUPA 3RK0A 4BC0A 4B6RA 1DO8A 4N9WA 1C9KA 4OQDA 3ZHUA 4EF6A 4TTVA 2ORIA 1TZKA 3QU7A 1MPXA 4HXFB 3A1DA 4JL8A 3TNFA 3ZGOA 3ZX5A 5JS6A 1BE0A 3CE6A 4ZO9A 3RODA 2KHZA 4IWXA 4U7JA 5K51A 3BWEA 5KOHA 2GZSA 5LZ8A 3NVDA 2IELA 1N6KA 5KNBH 4DGSA 1YQTA 1CR6A 1QG4A 2O06A 2CB0A 3MG9A 4HYQA 4WCFC 1MX1A 4CM8A 2Q5LA 2VCHA 2Q6IA 5TQ2B 1UOEA 4D9FA 2DAPA 1TZBA 3AVUA 4H2DA 1P6QA 3PP8A 3W4JA 4JEUA 2WIFA 3MGAA 1Z5WA 2MSKA 1X3LA 2VFAA 3MUOA 4W5HA 4ASUA 2GZ1A 4MYDA 4AWXA 2XW6A 1QRDA 1T25A 1X92A 2Q49A 3JVUA 5SY9A 4E09A 3L0DA 4XDYA 4N48A 3VH1A 3V33A 4XAQA 1W5FA 3E6AA 5LMZA 5TPWA 1AA9A 4IIUA 2XA2A 3L77A 4L16A 1QG6A 4B6JA 4B33A 5I4KA 3MJFA 5K3SA 3QX3A 1KAOA 4RPKA 4EYGA 1G16A 1WO8A 2B20A 1LX7A 4Q00A 1R0XA 2RK3A 3W5VA 2XVAA 3BD9A 3C6MA 4EG5A 1XL0A 4LJ9A 521PA 1E1RA 1ISMA 4ZRDA 2JD0A 1XWFA 2JLRA 2V97A 1YDWA 2O2HA 2CGEA 4FDLA 3E7PA 2B9EA 2F48A 3IR7A 3NALA 4TN1A 4DLXA 3F7NA 2D7DA 3ICQB 2AN5A 2B1RA 4INPA 3ILVA 2C1XA 3R09A 3NPAA 3E15A 1E0JA 3E48A 3I53A 1QU3A 5ICSA 3OZVA 4P2GA 2GTPA 4CT4B 5GJBA 2HAEA 1L8QA 3HDQA 2DETA 2AMVA 2X7JA 2GAIA 5DRYA 1MP0A 2VJOA 5SZHB 4J3NA 2BCJQ 2XQFA 4RK7A 2L42A 5F4BA 5PNTA 4EA9A 4HB4A 5SZJA 3AWIA 4ZOLB 1KFKB 4FYYA 4EUNA 4HAXA 2I91A 2FPMA 2CVZA 4P2BA 1P5HA 1RAAA 4DR1B 3L06A 3VX4A 5INTA 2PYDA 3DBIA 2W6QA 1PGPA 4MA4A 1R8XA 1LBQA 2FJ0A 2YFHA 4Q3EA 4MB2A 2HYIC 4QDOA 4FNGA 4MIEA 4URUR 5EIEA 5K0NA 3OVMA 2ZDGA 3TI9A 4AKGA 4PQEA 1FXWF 1YFLA 2FYTA 4YP9A 8ADHA 2VH5R 4YWJA 4DGQA 4AJ2A 4TSRA 3QU4A 4N0MA 5JMPA 3Q2IA 4IYRA 3UGTA 3LFTA 4HQRA 1VIVA 4AWAA 2GBPA 1EG2A 1SB9A 4TVSA 1P2FA 4QATA 4BDSA 2ERXA 1S9HA 2MJLA 3CZ4A 4MCIA 1HM5A 3QNUA 4UCQA 3RSZA 2P3LA 3F3YA 5G41A 1C30A 2VH2A 4CLRB 4U0KA 5JTTA 1DB3A 5ADUS 1PEKE 1C4KA 2BHLA 2ZYSA 4BNIA 1XQVA 1GPMA 3R24A 1T8PA 5BUSA 1J7KA 2EGHA 2I6GA 4MV1A 4LNAA 1SOMA 4E5KA 5DTQA 2C94A 4CR6A 3KB8A 1ESMA 5I51A 3AKZA 2PIDA 4IJVA 2P6RA 1Y7LA 1YB1A 1IWBB 1F14A 2H5LA 2P65A 1T10A 3IAXA 3OF3A 4QUDA 1UBKS 1ZVVA 1UC5B 2R48A 4GQBA 2YHAA 1V2GA 3TCKA 2H1VA 4ARZA 3VMMA 4H7IA 2C4TA 1IJEA 3A3OA 3FPGA 3O92A 4TVKA 3JR3A 3ZX4A 1QMGA 4NS1A 4JLVA 2JARA 4KAAA 4L9WA 2BJVA 4N6OA 3W34A 1N6OA 1ZM4A 1AK1A 3FUWA 3GBPA 3IBTA 3M82A 4GSYA 3B38A 5TF4A 3G5TA 7MHTA 2ZAGA 2QTBA 2VJAA 3G2KA 2DHDA 4HGNA 4B75A 4BNUA 4BVHA 4X61A 2OQ2A 3QYPA 1SUEA 2A8YA 3LUAA 3VOTA 4BNKA 1YHYA 2A5GA 2PV7A 5JLJA 4KREA 2MINB 3EEYA 4EYOA 4FHCA 3QXSA 2CNBA 2FAXA 1GAWA 2WSBA 3RUPA 4NPAA 3SJCA 2W2LA 1LSOA 3TR5A 2DH5A 1NIJA 2QYOA 4OMUA 2E3JA 3A11A 4LG1A 4OOEA 4A0HA 2W6CX 4FN5A 3UQZA 2AWOA 3ZE0B 5T6BA 4N0QA 4BYMA 1WP9A 2AJTA 3ZWNA 1B1AA 4XDGA 4BXOA 4MVJP 5DP1A 1OZAA 4R2KA 1QYWA 2HDNB 1UIMA 3SS9X 4AO7A 4KH0A 1Q17A 1A04A 4PM4A 3T9DA 5E4TA 4E1VA 1A9XA 5TS2A 3MTJA 2J9GA 3ORYA 3KG2A 1GUYA 4LDQA 5FNVA 3E8SA 4J4TA 3SDZA 2GH1A 1ODTC 2DMRA 4AS1A 1XEXA 1Z0SA 4UVEA 4OJMX 4YPVA 2G28A 2R85A 3GLGB 4ND5A 2O2CA 1R5OA 1M2VA 2AJ8A 3IAM1 3FDZB 4ERNA 2R1VA 1JLSA 3G0BA 5E7IA 3ZNOA 4HKTA 5T7BA 2FR0A 2C4UA 3UMRA 1SKBA 5IAOA 2CNWD 2CVOA 4HAIA 3PZRA 2OLEA 4C2BA 3UHAA 4OIFA 4IVNA 3CGGA 2C7QA 4DIOA 1D0VA 3A6DA 1DKNA 3NHUA 2QRJA 4Z5XA 1S89A 5A4DA 3DUFB 1FUYB 2K87A 4COOA 2WJJA 1EWTA 3C1TA 5IKPA 4LMAA 5ALNA 3DKKA 1FP4B 3D3JA 5FIUA 4BFSA 1GZ7A 3U4CA 1XP8A 3C6QA 1KH1A 1TCCA 3U81A 1SOUA 2DT8A 2AR0A 1HDYA 3ZGVA 1KP2A 1XJ0A 1R4NB 4LECA 3RI3A 3AESB 4DJFC 1CUVA 1P60A 2ZAYA 1AX9A 3EGVA 4CQMB 3CSDA 4KO1S 4Y98A 3RVNA 1IXYA 3QVXA 1EH5A 1KZ6A 4QOGA 1JRLA 3F3SA 4G0YA 4B3HA 4FFWA 4JVLA 1DV2A 4JNKA 2OCDA 4HRXA 4LSMA 3V1NA 4X7BA 2EWMA 1KZHA 3ZI0A 1L6IA 1YU6A 4C14A 3GA7A 3G5MA 3VU1A 5K3OA 5FBWB 4YJ3F 1ZSYA 1MXHA 3QSGA 4NEQA 3ZS8A 3ADDA 3CTMA 3N53A 3W8NA 4A6PA 2XUFA 3TRJA 2HBZA 1T29A 1TZMA 3FRJA 3QX8A 2INGX 2W43A 4GYWA 4EKNB 3CV3A 2C2GA 4BLSA 2JGLA 4RENA 1E3QA 1IDN1 2R2AA 5KCMA 1L5MA 4DG5A 2W4MA 5EE5B 3LAWA 1V8DA 4YQEA 2HHJA 5K8JB 3HXLA 4CZ2A 3HZHA 3AONB 1ZONA 1ENPA 2GAOA 3K31A 3RNLA 1A76A 1GWNA 2AJLI 2DKFA 3OQHA 4B2YA 4UFPA 3EDMA 3PLRA 1DIGA 4MI6A 5FF9A 4BO8A 5DYYA 1WG8A 1RSZA 3ESYA 4Q02A 2PMFA 3BTSA 3IOCA 1T2NA 1Z45A 2D2IA 2RKOA 3CHYA 3D7SA 4FDUA 4IQ0A 1KQPA 5EJIA 5K0LA 1J06A 5FFFA 4G0QA 3IUBA 1GPBA 4WD3A 3H9BA 1LEHA 1L7NA 4BLQA 3I9V6 4MVJM 2WDZA 5ITWA 1I4TD 1TO2E 4C08A 1Y63A 4RY2A 3TZLA 4O4JF 4BL5A 2CL6X 5JH7F 2R6GA 3ZHVA 3FJOA 4YMTA 4B0PA 1ZGBA 1ZSVA 4Q9LA 2FK7A 2PZFA 3JVDA 3WSTA 4EW1A 1XZAA 1U6IA 2W0SA 1KOFA 2YS7A 1EHIA 3GFOA 4GPEA 4KN8A 3PXUA 3U80A 4C0JA 4MJ3A 5KYWB 1D8AA 3UYLA 3GQBB 1J90A 4K8RB 4WZAA 2B30A 1Y7PA 3U7QA 2AN9A 2CNNA 2XNCA 1DAKA 4FZVA 2CK3A 3U3RA 1L8OA 1QH9A 4EO9A 4CL8A 2GNOA 4BKQA 1NKSA 1FE8A 2R6CA 4DJDC 1ZM2A 2BEVA 3KQUA 4J49A 3NM6B 1YJCA 4FFLA 1WXQA 3STYA 1V71A 2GO7A 2C4HA 2P6OA 4B3TB 4HAYA 4ZKEA 3UUGA 2OV6A 1VSQA 4IMIB 2J6HA 2YZKA 2PMWB 4I7EA 4JLDA 3ZGYA 1SU4A 4B4OA 3N2GA 4IFEA 2VYQA 1TGYA 1YR3A 3GEDA 5EKUA 2HMWA 1F0YA 2WHXA 4RZXA 3F73A 3HA5A 4RF4A 4INJA 4TPKA 4CTOA 3O8LA 4GC5A 3QVGA 5ALHA 5LBUA 3LKBA 3PRYA 3QVOA 1DTWB 3MD9A 3BH6A 1IUPA 5HS6A 1ITZA 3DMYA 5KJ1A 1V6AA 4TLLB 2XOXA 4G09A 4UPDA 2FZCA 3KTOA 3PVCA 2VPQA 4QYIB 3IHKA 2QMQA 1GKLA 4NG4A 4M88A 3WWZA 3OZXA 4J0HA 1QV7A 4LRQA 4BECA 3HLTA 4MUMA 2BH2A 3DE6X 4HK4A 2WC1A 4LHYA 1X0XA 2X9VA 4CG3A 4DRZA 4L9SA 2HGSA 4L8FA 4W6ZA 1FW8A 1SJ9A 4DIDA 1SURA 1H8ED 1TMGE 1UMDB 2GRJA 2ZI9A 1WUJS 1SUSA 4K3VA 4MJLA 3SM9A 3ETCA 3PCTA 3MF4A 4AIRA 3ELBA 3HFSA 2P30A 3UH1A 4F96A 4MWBA 1W2GA 2C7BA 3L1VA 2OHGA 2ODNA 4JHLA 4IIVA 4XJVA 1EUYA 3T38A 1JSCA 1J2EA 3DL0A 2V65A 3OWXA 4MVCA 4R0NA 1KKMA 5HEKA 3T7DA 1Z26A 4Q4HB 5AQ1A 4PPFA 1P39A 3BWMA 1E4YA 3LC0A 3H5WA 1QC5A 1M2KA 3FLAA 1WF6A 4KWIA 5IHPA 1IL0A 1DQRA 5J2TA 5TGDA 4RA9B 1X9IA 2M6LA 2EFHB 3BXOA 1JJBA 1C41A 4J1SA 4XRRA 5IT4A 5EQDA 4FLEA 3DWFA 1GU7A 5C4GB 1S8OA 4XGIA 4EHFA 1QUFA 1OFUA 5MHTA 2I3AA 4OYLA 3V7YA 3WLSA 4MO2A 5HUJA 4H1TA 4CM1A 2AQHA 1W47A 4XIGS 2RHHA 3D4NA 3K16A 1T5BA 5IUJC 3LS2A 1IY2A 1TZCA 4X60A 3V48A 3IILA 3GFFA 1ULZA 2WA2A 3CX8A 5ARDA 2VNSA 1YJXA 3RYFA 4X95A 3H5TA 3TL3A 2V8OA 1JXOA 1R2QA 2AXPA 3VSCA 1Z5NA 1R6BX 2IBMA 1IEXA 4G1EB 4EPYA 1JEQB 3GUVA 3L7OA 4HEJA 2RIRA 2JLXA 4RTNA 2QDKA 1Q0QA 2CXHA 1Y8RA 1OIWA 2FSUA 2KLBA 3A1SA 4R83A 4S1NA 3NYRA 2B8JA 3FSRA 4H3SA 4HGPA 4M1EA 4LVUA 3V8VA 1TI7A 1G17A 3GRAA 3DE5X 3N76A 2HNKA 3R9XA 1GFZA 2V4ZA 1VB3A 1RLIA 2JLCA 4IDOA 1GZDA 1ZL2A 1W76A 3NM5A 4DS3A 3E2PA 4LQCA 1Z37A 3JARA 3LBYA 1MFZA 1DTEA 1N78A 2QP3A 1BQ3A 4LJ7A 2F6RA 2QRVA 3PQEA 1USVA 3VR2A 4X65B 3CVOA 3D0QA 2DQZA 1RAFA 4DQXA 1EZZA 2VQSA 1GRVA 3RVLA 2WAOA 4P3PA 2WYVA 2Z4RA 1HT3A 1ULHA 1QHHA 2C2BA 3SXUB 2FQ1A 1W75A 4PNEA 5LYJF 3A9RA 3F6SA 2OHJA 2QL5A 4FFBA 3SYMA 4W4TA 2NU7A 1YASA 4Y0NA 1BMDA 3QFTA 1R6XA 1OJ7A 5GZ3A 1FTYA 1XAGA 4DA7A 1CEEA 2WIDA 3ZV5A 2W6NA 5EXPA 4DXAA 1PT7A 1PT9A 2GSWA 4KE9A 1Z7GA 4CDGA 2XRMA 3G89A 1IZ0A 3W3AD 4ECEA 4UPEA 4YS6A 2ZYHA 1Z6PA 1PTJA 4Y1FA 2WMYA 5JE8A 4L3VA 2FW0A 1JIQA 3NUZA 3T4PA 3I4CA 1BVRA 3L0ZA 2VTBA 4V0ME 1CJUC 1IEQA 4F4IA 4L07A 2RGEA 2Q2OA 3RTCA 1U8TA 3OWOA 3KJEA 3TXAA 3ZGNA 1KI9A 2DUUA 3F7TA 3IMEA 4H27A 1GSAA 1IXSB 3PC8A 4FYMA 3VU3A 4GH5A 2WR8A 2WU8A 3KYBA 2QY6A 2JI6A 3EIUA 3BB1A 1XQWA 2GCOA 5CPFA 3GDFA 3WLEA 4PZ0A 4HQNA 5HUQA 3B6ZA 3CG4A 2QZJA 4NDNE 1LRLA 3C6KA 3EQ9A 4PHHA 4RVGA 2KB0A 3B6KA 2HF7A 5B53A 4WADA 2J9ZB 5G0SA 4M98A 3UT0A 5DM1A 2PMCA 4FE3A 2C77A 3EEQA 3IBYA 1KBOA 4N3AA 3ZDZB 1GDTA 3QFRA 1DI0A 3HJTA 2R6AA 6YASA 3ABOB 5L9AA 3NGLA 2ZYIA 3GAFA 1O6BA 1EFDN 1P2TA 1IQUA 1V8OA 4HX2A 2CXQA 1RABA 1XZLA 4F9TA 1U3UA 3VYWA 1V26A 5DISB 1Y8ZA 3O84A 4KRFA 4XTCS 1ZGGA 3PDUA 2B1QA 4QAQA 2EKZA 1BJRE 5F3WB 3I8OA 1W19A 4E51A 2X42A 3N2YA 5CA0F 5LQNA 2NU9A 4Y2HA 5LU9A 1V8BA 4P53A 3NGXA 1RVDA 5TR9A 2JLSA 1P62B 1UJNA 2JLYA 4AAYA 1IZ7A 1RHRA 3G2HA 4OH7A 1Q21A 4RK0A 1AF7A 3K9BA 1NP7A 5FI0B 3QHAA 2VJNA 1XIVA 1HOXA 3OCCA 5AI8A 3K15A 5EHQA 4C76A 3QX9A 4CMEA 1PR0A 2H1CA 3FDFA 1ODLA 1RJDA 5L45A 1XZGA 1LPBB 3O38A 2IS2A 1B8PA 3P27A 5JRZA 3JW8A 5FPHA 3JAKB 3PF8A 2O3QA 2HLDA 4QTUB 2XUPA 2YXDA 3E9YA 3ASYA 3RVRA 4HG2A 1FYFA 1DG3A 1TLTA 4G8JA 5G1NA 5CLFA 3EHEA 1DFGA 3NOOA 1V4BA 4O8CA 4C07A 1T2UA 4PN7A 4J75A 3D6TB 2REBA 2W90A 4LGCA 1XCBA 5FAXA 2YYAA 4CIWA 3KPYA 1C3EA 4ZEMA 3GCDA 1E2BA 1XZEA 4BCBA 1E2DA 3TXYA 2RSLA 1G21B 1VHQA 2W4IA 3G0OA 3Q9LA 4P31A 1TQ2A 3CE9A 3TRHA 1R6DA 4ZGWA 2REOA 4QHSA 4Y9DA 2Q5OA 3REOA 1JILA 3I6MA 1ULUA 2MYTA 3O9VA 4A8PA 4DZTA 1LPSA 4ZQFA 3EEOA 4REQB 1CERA 4ZU3A 3TW4A 3DB2A 4JC8A 3FWHA 1G6HA 1IN8A 2O0JA 2ZRBA 3NDPA 1OBVA 4OB6A 3T1YB 1C1DB 3ZZUA 2LDXA 4RLQA 3D0OA 4J0EA 4JUDX 1PFGA 1MO5A 1VB5A 2RI6A 3HBAA 3QOWA 4MUBA 4G67A 4ND3A 1SRQA 1QZUA 3W05A 5L3QA 5EPUA 1ETHA 2AKYA 3KSUA 3MWGA 3OFNA 2WT4A 4ZQIA 5IFLA 5JASA 1US8A 1X1RA 5JNLA 2QVYX 1MW8X 1GGKA 4R1NA 2HK9A 4FILA 4AO8A 4Z54A 3T5GA 3AZQA 3ZZMA 2Z4TA 2BHNA 1ZAYA 1VMEA 5G02A 3OJEA 5ALFA 1QCDA 5UKDA 3ULKA 2XUHA 2DJIA 4Y2PA 3VPDA 2X3FA 4PYNA 3SLRA 2IBTA 3LCMA 3GGGA 5EXEA 3SQLA 3DKIA 4NARA 3LX5A 4E03A 5I01A 5DWDA 1U5BB 1U81A 3F4BA 1ST2A 1G8KA 1ACJA 2BFAA 3BRWA 3EZLA 2HIHA 3VDRA 3WZLA 4AURA 1T5DX 3GR6A 3I0MA 5HTKA 5TGTA 3TSCA 4UHCA 1G1MA 4F93B 2F62A 2GERA 1R9JA 2PSEA 2ZSBA 3OEWA 4WK6A 5AVKA 1A9SA 5EE3A 1GTVA 1G5PA 2EL7A 3SXJA 3VTKA 3ZCRA 1E2HA 2IYSA 2PGNA 3JQGB 1MORA 3H2SA 4D98A 1GUBA 2BAGA 4IM7A 2R96A 5K4AA 1QK5A 4U39A 3DBLB 3IQEA 3C45A 2ZTUA 1KS2A 1Y80A 4Z4QA 2Z6UA 1NF2A 3H4TA 2QENA 2J7PD 3UYKA 4DJAA 4UOEA 3SF8B 2FMKA 1JU4A 4XUEA 4YX9A 2LW7A 3EDOA 2DYKA 4G23A 1IVSA 3LQKA 3NBQA 3GJTA 3CGWA 4G0MA 4LBVA 4CMIB 2VSFA 5TJHA 2CJWA 3D2AA 4N3BA 5KSPA 4HMOA 2HK8A 5CNKA 1PAUA 3Q41A 1T5TA 4G25A 4PPQA 1TIKA 2FSGA 4MTCA 5DGHA 1UR5A 3F47A 3WX0A 4DIBA 3TL2A 5AW6A 2VJPA 5AKLA 3ENQA 4ND2A 4CMGA 3N5KA 5KX5A 2ZVDA 3K20A 3KELA 3NAMA 3DOIA 3CUUA 1VBKA 5F5LA 3ZHCA 2FZKA 1AD2A 4EPTA 1EP2B 4EJSB 2W7TA 4H7JA 1ZU5A 4J2OA 4EO4A 1L6RA 4OP3A 1TF7A 821PA 1NRIA 4LJ5A 1COWA 4WNYA 2PA0A 1AJEA 2HSZA 4A8JB 3D7LA 3I4FA 5LOVF 1V48A 2IHZA 1MPTA 2FE4A 2J8ZA 3KWLA 1EYZA 1ZJ6A 3HA2A 3O1HB 1W44A 4MRMA 3V2GA 3MHTA 1BQEA 1R0SA 1IHDA 1RKBA 4OSEA 3UA3A 1N6HA 4KNYA 1G8PA 3FKQA 5JLAA 4XOUA 4KI7A 3D54D 1KDRA 1YCDA 1MB3A 1IHUA 1NVDA 1QQTA 2B78A 4ROSA 3K70D 3IIEA 4BKMA 3NYIA 4X92A 1F48A 3QX7A 4LX8A 4MI3A 2M6RA 1A2QA 1Q15A 2OUIA 1N7HA 1NI3A 4KGXA 4BQFA 3PFIA 3ZJ4A 2HA6A 5H9WA 4FI3F 2C58A 3NBUA 2E55A 4ZT3A 1QHIA 4AMZA 2E9SA 2QUIA 2ZKIA 2YJTD 1DRUA 3N2NA 4PR3A 5ECYA 5HG0A 5E0OA 3ICOA 4CTMA 4LXIA 2G5TA 5J4VA 4FNAA 1FOEB 3HDYA 3R3VA 3FCOA 2ZSEA 5H8WA 1DPGA 1SIOA 1NJ5A 2NO4A 3KKNA 1UPTA 1NMZA 4UDYX 3AGPA 3IE2A 4YLEA 5AR1A 1VBMA 1KQ3A 5MN5A 1GQ2A 5CM2Z 4HGRA 1OLUB 5HKKA 5DNAA 4PAWA 1P0QA 2VHCA 4RWZA 1BEUB 1V35A 4L73A 3T35A 4EHKA 5IWCA 2V1XA 4JXZA 2QTVA 1GEEA 3EB9A 3EIWA 4IILA 4IRMA 3I6BA 4C01A 3HVJA 1NOJA 2ZETA 4GSKA 4N01A 1L5WA 4HDMA 5AT1A 1UZLA 4RV5A 1K4KA 1PTJC 4G8CA 4D9NA 2WYHA 4KO4S 2SBTA 1OV4A 2B7LA 2AZ4A 2IEDA 3PG5A 1TQDA 4FN4A 4KG7A 5ALMA 3H86A 3QWAA 3U17A 3WB9A 2XA9A 4QO8A 2ARKA 2CSXA 1Q3KA 1E7YA 3CH5A 4LYDA 5JVDB 1WV0A 2VF5X 4TZKA 3ICCA 3CPHA 3PC8C 2HA5A 1V3VA 2ENUA 3BHJA 3CN9A 4QICA 4HBZA 1E9SA 5AKIA 4Y2RA 1ORWA 4JBNA 3JD3A 1D8TA 1CR1A 2PQ0A 3USES 3H0KA 3KB2A 1WR8A 4RVSA 1CQIA 4EYSA 1H1LB 2WFAA 2ZBEA 1NSYA 5E6RB 4CI9A 2XTZA 3AM4A 3I6IA 3E9CA 1QIGA 3H65A 4Q5IA 2BKXA 2VP0A 2YHIA 1ATZA 1MH9A 5IM4A 4FKBA 2A9RA 3D9QX 3N8NA 1ORTA 2IP1A 4YV7A 1KAGA 5TARA 3VR6D 4JYBA 4UJ5A 4AJ9A 4UZSA 3O8RA 1NVGA 2YXEA 2FDXA 1I36A 1N5RA 3DHEA 1AUOA 2R86A 5NLLA 4TZ0A 2ZBFA 3U60B 3OLWA 1KRXA 1EVJA 1HGXA 1AB6A 1I7PA 2QM8A 4D41A 4JROA 4P58A 3BEOA 4RJ2A 4CJXA 3PJDA 7ADHA 3OCWA 1MIHA 1ZBQA 1PG2A 3AP3A 1DAFA 2R84A 3BPSA 3ZHSA 3DO8A 4EY6A 3CSUA 5GWXA 4YMGA 5G0TA 3A6PC 1O77A 3VFDA 1CNEA 2XIQA 3C6BA 3HR8A 1KKLA 3MTAA 4KLRA 4D9BA 3EY9A 1OE0A 3MJCA 4BMOB 4LJSA 4QU5A 4BE7B 3UXMA 2CLEB 2HADA 4BU1A 2OE2A 2VZLA 2C07A 2V4MA 4CMEC 2PH7A 2VK1A 3VVLA 3G2JA 2VP9A 2WFLA 3EZYA 4WWHA 3EMKA 3T0FA 1YB5A 3I01A 3TECE 1XCJA 3LXUX 4BTLA 2IH4A 2XTAA 1RADA 2XY4A 4A82A 3FYHA 3LY9A 1YL7A 2D2FA 2GN1A 3MRXA 2WFMA 4IDHA 4QASA 3UB3A 1UMBA 1QPBA 2VDWA 2Z1DA 4MV0A 1V95A 2WP0A 4KQ2A 2ERYA 1KC3A 3O4JA 1ZJZA 2BM9A 4QLBA 1L7OA 4U9HS 2JHFA 2CLFB 3B5IA 1JG4A 2WW8A 4OYHA 3L82B 4S1TA 4AULA 3DC7A 1VE5A 2E49A 3TSWA 2EHDA 2D2VA 1PDOA 3K9FC 5IDVA 1I3CA 1DIAA 1T24A 1Y6JA 2I4IA 1RZ3A 2B25A 4KQJA 1U0HC 3LQQA 3QKRB 2EG5A 3IBSA 3SNHA 4B43A 3FNFA 2HWYA 2VPPA 2XOEA 1SXJE 3GDHA 3F7MA 3OUZA 5BR1A 1BMTA 2BMVA 3OJLA 3OMWA 4MV4A 2YRFA 2F1KA 4FEYA 1IQRA 3KOXA 2QAGB 4QOEA 5KNLA 3ZWYA 4DIMA 2AG0A 4JP3A 4ZCRA 5JCZA 1HLGA 2HYDA 4H0NA 4MA0A 4PFKA 3RFVA 2ZIUB 3HS3A 1IM5A 2FOXA 2XMBA 2O14A 3BJMA 1QGAA 3IVCA 4L2IB 3DTVD 4O2BF 2NVUB 1E61A 2FJUA 3OH8A 4HLUA 4X54A 2IYEA 3THOA 4EQ6A 4HNHA 1T8RA 1P44A 5EIAA 4E4TA 1VG9B 2AX4A 3IAFA 4YRKA 3CB2A 1UEXC 4DA8A 4Y67A 3HJRA 1SWVA 4YJHA 5JYDA 4YO7A 3OC0A 1PG0A 2IYXA 3K05A 4C4ZA 1M76A 2PZAA 5I7OA 2AEJA 2LUOA 5JCPA 4JUAA 2YDYA 1EU1A 2WK1A 5BXQC 5JJBA 3HXQA 2BD0A 3A14A 4B6SA 2RGXA 2J6BA 4XQCA 3TR0A 1LLDA 1V6SA 2BFWA 3A4MA 3FX2A 1U4NA 2QYTA 3HADA 2AFHB 2WA1A 2XX3A 5DGTA 2XMQA 3IEIA 2DR3A 2W2NA 3T8YA 4DEYA 2UXDB 1AO0A 4G97A 5GV7A 3ZXSA 4NDZA 1TIBA 2YXLA 3QPDA 1ZUWA 1NULA 1XUOA 1ULSA 4Q82A 5FPTA 4R7ZA 3G8YA 4YRDA 2ZUFA 2BUCA 2YFQA 4HNRA 4QPJC 4BNJA 3ORQA 1JBKA 2WF8A 4EJFA 1TUBB 5A4JA 6REQA 1W0JD 2QD2A 2VZEA 3BDAA 4DNXA 3TZ6A 1DJOA 3LJKA 4INAA 1XQ1A 4FHZA 4WN3A 4GL4A 4WOKA 1T34A 3NFRA 2DR2A 1DAPA 3BXEA 2VK8A 4KUHA 3Q1KA 1ISJA 1KFBB 2C04A 1KMCA 3LYLA 4GF5A 4LNUB 2B3DA 5BW8A 4TM8A 2KPOA 3WMWA 2YYZA 3TXXA 4M6WB 2QTAA 3IVAA 3LQFA 3V2HA 5JZSA 4HTFB 4KN6A 1RPAA 5A4FS 5ALGA 3LDGA 4Y9RA 1P9LA 4GMHA 3STXA 1BDJA 3OTWA 3W8RA 3LV8A 4LJ8A 1P2DA 2G07A 4GBED 1PHRA 5EIHA 5L3RA 1B0PA 3QEOA 5D3MA 4E0BA 3TBKA 2NVBA 4XGQA 1W581 3QPWA 1WUYA 3NBMA 3JQAB 1O08A 2X5OA 1JA0A 3B7PA 3DDHA 4GI3A 2ZYGA 4ZO7A 3VAYA 3WO1A 4CLRA 4V0OA 1RMQA 1C8VB 2I8CA 3AZOA 3M7IA 3U3ZA 2HJVA 1SG6A 2FSPA 2AX3A 4LWZA 4ZYWA 1FVOA 2A57A 4DLLA 4QHYA 3QF7A 1L7EA 1ONSA 2EP5A 1P3JA 4NMLA 3G6KA 5T4EA 1XE3A 1WOYA 1HNNA 2FN9A 3KR1A 3SG0A 1O6GA 3E5HA 1HE1C 1AQJA 3BIXA 3L3BA 3R5JA 1G6Q1 3L1UA 4AUEA 1U2SA 1ZEMA 1T6NA 2WWRA 1GUAA 4NV3A 1KMHA 3IBCA 3NJ4A 4CCYA 3WFJA 1FFYA 3H2IA 2W83A 1RWMA 2ASEA 4U7PB 5DLEA 4QZVA 2G8LA 3EXG2 3ZY6A 4D1YA 1ILWA 3D8HA 5DOVA 4CETA 4I2VA 1QBKC 3GB9A 1ZCJA 2QE6A 4YAKA 2SCUB 2A14A 2OPHA 3IQXA 2XT6A 1VE3A 2XNHA 4GYYA 4Q9JA 2AC7A 3S2UA 1XAJA 1JNXX 2MINA 3R76A 3TPZA 1J25A 1QE0A 1UL1X 1YRYE 1G8HA 5KVVA 3AXSA 1BZYA 1E8DA 3GFPA 5C1PA 1J70A 3K6JA 3C5WP 1UJ2A 5T64A 1XYVA 1NVVQ 1Q7EA 2ZBQA 3EQZA 1BA3A 2AXQA 1RRVA 3ZDFA 2AYYA 2W2PA 3AW8A 5GV8A 4M9QA 2I54A 3WFIA 1QYIA 1LV7A 1UKYA 2B4QA 2ZWMA 3ONVA 1ACLA 3GGJA 2RGDA 3L8FA 4I5IA 1JHMA 2JEYA 2WDPA 3CA8A 1V5WA 5TT1A 4ZHSA 1V11B 2FWIA 1NVFA 3FAKA 4XA8A 3MINB 3T9EA 3L7DA 2P6UA 3BF7A 4MWEA 3IV9A 1XRMA 4AG6A 1FQJA 2FHPA 3SEFA 4BFTA 4Q9IA 1E59A 2PJDA 1CP2A 2XMPA 5AK6A 3HVRA 3GLGA 3G9XA 3WYFA 1FYWA 1B74A 2R6HA 3FDZA 2ZJ8A 3IEUA 3OLQA 5KYVA 2XJ4A 3F3KA 1AF4A 2LIVA 3JQ8A 3LK6A 3LCJA 1Y8QB 4J0GA 4KWHA 4YGXB 3RWOA 5FV4A 4E12A 3MT9A 3S70A 2HSWA 1EWYA 4K46A 3ROXA 3QY9A 3LHKA 4IVRA 2A5JA 2XB6A 3EVBA 5HMMA 2X0EA 3RDPA 1XCGB 2O8DB 3ZDCA 3DUFA 1ZD3A 4X8OA 4F8EA 2F67A 2YCBA 1W8IA 4R9NA 3S1LA 2ZJAA 3TEMA 4BLWA 1CVRA 1FP4A 3CLVA 4K5QA 5HQJA 1TKAA 2RHTA 1GGMA 2AQIA 2CWDA 1G5HA 4WKBA 3TK1A 4Q1EA 1DRVA 5ELMA 1G38A 4E32A 2VAWA 3P32A 4B2LA 4ZOQI 2IYTA 1R4NA 1VL0A 4CKBA 3F90A 2GI4A 4XVRA 4UC0A 1VJRA 1FUKA 1TUEA 1F5SA 2QJRA 3B2EA 4QJ4A 4GOOD 3IUJA 3CH7A 1XRJA 1O5OA 2EEZA 1NF3A 3VC7A 4AZ3B 1C1YA 1E63A 5EKXA 1NXSA 3KKKA 2DWQA 3M6VA 4I8XA 5DBGA 1HYEA 2CJFA 3KQLA 4K26A 3ZI7A 2SKCA 2HV8A 4L22A 2PU5A 2ZYRA 3A3KA 2W6IA 3G6WA 1VHTA 1WW8A 3AR4A 1RYFA 2FFBA 2Z98A 2C5AA 3D1VA 1ZINA 5A9SB 1BVUA 2VRCA 3H1PA 4V0QA 2ZRQA 5ALWA 3R7SA 1Z83A 3WY9A 3BFXA 1HNWB 5COBA 5EERA 1L8LA 4JEHA 2EDAA 1P7PA 1A82A 3BMNB 4J4BA 1W2WB 1WXXA 2O7RA 5JS2A 2QJOA 1UC8A 4M1TA 4Q9AA 4RGQA 4LS3A 4JGGA 4JOBA 5LZ4A 2FRXA 1P5RA 2MYPA 1UP6A 1K8YB 2FG7C 2R8RA 3OPVA 1XDGA 4YUXA 3FPFA 1YVPA 2MCFA 5E6SB 3NC4A 3IUMA 2WG0A 3L8DA 4QFBA 3D8BA 4W1QA 2H9AA 4OBXA 3A1NA 1IQPA 2ILTA 3GP3A 1QGED 2H59A 1M6WA 4US2R 1YQ9A 2Z6VA 4KPUB 4Q7QA 3BHMA 1HK7A 1HFEL 2CHVA 4OHBA 2WHQA 2QA5A 4OCZA 1U2GA 2HHAA 2PGDA 3D5EA 3I92A 2IDMA 3R0XA 4KR7A 4Z1MA 3MS7A 5JSYA 4WT7A 4ASUD 4HEQA 4FOLA 4HLUC 4IJMA 1RMYA 2C1EA 3KAPA 1W0CA 3MNFA 4F9EA 1WXHA 3A37A 4P98A 3TLXA 4RMNA 2ZVQX 4QBTA 2JH9A 5KYWA 1PN3A 2OYSA 4LFCB 4UM8B 1MAHA 3GEEA 3M2TA 4R6WA 3RVJA 4YRMA 5LDDC 1ND5A 4MVXA 3C98A 2HMAA 5KTRA 1GXSB 1WKVA 4J29A 3JAMA 4UQOA 2C96A 2EWVA 4O4IA 1ZOOA 1Z6AA 3LXXA 1OWNA 3MK31 3CKLA 4J0DA 3KJFA 3IEKA 5JAPA 1I0ZA 4EEKA 1S7GA 2ZREA 1E1RD 4KR9A 2FW7A 3VSBA 3DAGA 3RGWS 2DFVA 2YUIA 1KRWA 1LK7A 2PKCA 1UH5A 2JCYA 4E70A 3N86A 1BROA 1PQUA 1L9KA 2NO1A 3W7AA 2W8ZA 2GDJA 4FU0A 3I9V1 1LSUA 2X0IA 1GL3A 1XDSA 2SECE 1CY1A 4KE6A 5FPKA 3PX7A 1ZOLA 3WHLA 4Z0NA 5J47A 4M83A 4X1IA 3A1WA 3FPJA 1RM3A 1Y1KE 1DEHA 1M8JA 1TXGA 2R8EA 4Q47A 4B5KA 3SPXA 4GT1A 4RACA 1OA1A 1DTWA 3RS2A 3VV2A 2GAFA 2B5VA 2QHXA 3DD5A 3DMTA 4D26A 1YQQA 3JYOA 2AS0A 5JSQA 1P0PA 1Y4DE 2RJOA 3ZXXA 2OK8A 1TT7A 2RGUA 4J7AA 4Z9AA 4DUZB 1M33A 4EFDA 1RT9A 1U0NA 2ZRKA 3NOVA 4QELA 2VHTA 4WHMA 1BFDA 1NHWA 1RKUA 2BH9A 2BM8A 3LRTA 3CTPA 1U7XA 4JQCA 4X7MA 3GLIB 2H3EA 4N18A 1VPWA 1W8DA 5E4FA 4F5YA 2XWPA 3I32A 4D0NA 4FB5A 2ZT7A 1A77A 3ZWQA 3A9VA 1CSEE 1OFIA 1UMDA 3O2QB 1PR1A 1Y3CE 2GBLA 4B87A 4MCHA 3UIEA 1K3UB 3NWEA 4PYIA 4TYMA 3NHBA 1UFRA 2YVLA 2P0YA 3UJ7A 3WLHA 1E3WB 3MJHA 4KQ9A 1BE6A 4RJIA 2VJQA 2DUJA 4R81A 4WLFA 3GEMA 4YAGA 4M1OA 1B8UA 3AHGA 3A1TA 1EPUA 1FQKA 2GHIA 4KQGA 3UWDA 2JFXA 1CQJA 5G4LA 3SQWA 1TTTA 3RS3A 1KPHA 3K9GA 3ESAA 1G5FA 1ZXBA 5JNUA 3WLLA 3OKCA 4NONA 3QQPA 3QPAA 1T4GA 2PDAA 1M2FA 1JLMA 4BFCA 5K0GA 1AKTA 3N05A 1EG7A 4MWGA 4RAQA 5DMXA 4ZDWA 3ZU5A 5B2EA 1E9DA 1Q57A 1W25A 2XTJA 5EWLB 3WRVA 1JDNA 4KO8A 1QE5A 4N7JA 5LNK1 2ZRHA 1JTFA 5CGZA 2NM0A 5TMDA 2BDTA 3UJ9A 5AVUA 1B0ZA 1MJGM 1EFVB 3EZNA 3JX9A 4GR4A 2AE1A 4URWR 5B12A 3IEXA 4D0LB 3UXYA 4YACA 4QC2A 1RWOA 1ZQ1A 1Y5LA 3F8WA 3H2GA 4YP0A 1I5RA 2EBWA 5EZYB 5DULA 3V9PA 3BMCB 1TDJA 3ELYA 3OLVA 2IXDA 2P41A 5KSYA 3WSVA 1Z0JA 2V5AA 3MMSA 3P8ZA 3I3OA 1G2QA 3TEJA 2WV9A 1R5BA 1ONBA 1C3LA 1LFDB 3QQ5A 4G5HA 1NJGA 1Y1PA 5BV2P 4PX9A 3U0VA 3UK6A 2XCQA 4BY9E 1U1FA 2G4VA 2WJZB 3ZW8A 4B4WA 2XE4A 4EY5A 5JADA 2W2LD 3H05A 3SZMA 3FTEA 1FBTA 2YJ6A 3WGHA 1JYEA 2Q5EA 1C9EA 2G6BA 2XYRA 4KFSA 3CNEA 4GG1A 4MX8A 2VATA 4IEFB 4CUZA 4CLHA 2ZAOA 1UKZA 2QVZX 1XEAA 3F3MA 1WWKA 2A2ZA 2IZ0A 4B9AA 3IXMA 4LBWA 1IONA 3GLKA 2P69A 5FT9A 3VPAA 4AU1A 4NABA 1SBQA 5CK5A 1WIWA 4YRIA 1VIDA 2QKYA 3INTA 1ZC4A 1XQXA 3L9XA 1NNLA 2G1KA 3AYZB 4KO3S 3WOVA 3KQKA 3TFOA 4XDHA 3DNPA 5M3BA 3AW9A 5AK5A 3LNTA 4C0WA 2R7AA 4WZBE 2WRZA 2PHZA 3QV1A 3F6RA 5FL7D 2QR5A 5F98A 3C4JA 3EF1A 3FZNA 2A0XA 3ZCUA 1TEZA 1WHTB 3L84A 2GYUA 2YY5A 5MN4A 3K0FA 4HZIA 4OP1A 1PWZA 4D4IA 2GZ2A 2W9XA 4ZYZA 3KLOA 4XLLA 4PVCA 3EDYA 2OSBA 3B3AA 4V38A 3F2IA 3L7AA 3FCCA 4RSHA 3IR6A 3FZQA 4N03A 4KR3A 4G0VA 4H4EA 4BZPA 5EVJA 2WF7A 3BILA 2WBLC 4B84A 4DSOA 5B3AA 1M2NA 3DZHA 4I4LA 3WKCA 1LVUA 5KNCA 1JR6A 4NBKA 5HIKA 4L6AA 3SNKA 1GTRA 2HRZA 3ZE2B 3TRDA 5FI1B 4DPLA 1T3ZA 1PT6A 5J43A 1BS9A 2MHCA 3COPA 2NPOA 1U8ZA 3WNCA 2BHSA 2FEKA 3RUAA 4BPBA 2XCOA 2JF0A 3KPJA 3VBEA 3WP1B 2HMUA 1HXHA 3D6HA 2FLKA 4OHVA 3RU7A 4WY5A 3CW2A 3TO5A 1VSBA 3H16A 3CT4A 3L9WA 1JUDA 4ALIA 2D8AA 4D92A 4N3GA 2UVDA 1SIWA 4GDMA 2VNKA 4H0CA 3KLBA 4G0ZA 1V0JA 4PGGA 2G9NA 1ZUD1 1PLJA 3ZWCA 4BKPA 4YXFA 4F5ZA 3G2NA 3DHNA 5FEMA 2FZWA 2RGAA 1NVAA 1J99A 2X9NA 4FW9A 3LL4A 5T67A 4YRZA 2EJUA 2AKAB 2CKDA 4PG6A 4F04A 5B6IA 3U5TA 4CEJB 4C78A 2WI8A 2L19A 1ORRA 1MO4A 5FBQB 3LLUA 3EIEA 1VZ2A 3OCJA 5TMPA 2CL5A 4DKJA 3B9PA 2OLJA 3CB4A 3U4AA 4H7DA 1K3TA 1X1AA 2BMDA 1ZUNA 2GUWA 4PS0A 3I30X 1RPJA 1V96A 3RAJA 2UAGA 2UUAB 3IIJA 3KLPX 2VKTA 4UNIA 1II8B 3EX7C 1U2GC 4DLVA 5D86A 4E08A 2ANBA 4RZHA 1PG5A 4H77A 4CF3A 5DI3B 5ILQA 2MSDB 4UCXA 3SFTA 2RFLA 1HEUA 2H48A 2QRZA 4QVKA 3GCGA 3KJNA 4RZ3A 5E0KB 1M1YA 3SFVA 2QRGA 3E1GA 2WKPA 5MDHA 3R44A 3U7FB 3B1FA 2HJRA 4F4JA 3N8IA 1P3Y1 3OJCA 4II2A 5K09A 3P5SA 3SR4A 1ZA1A 3TQQA 4ARVA 5HOEA 1BE1A 4RKFA 1Z0DA 2R68A 2WQZA 3LU1A 6ABPA 3KHUA 3JRXA 1G21A 1IJBA 3L0BA 4NCKA 2C2WA 5AOVA 2PL1A 3VO8A 4BV8A 4Q39A 2CE2X 2CK3D 1VRVA 4MV8A 1ZVQA 3OA2A 3BWDD 1R4MA 2HMSA 4I36A 3ZVRA 2DC1A 4U7TB 1VPEA 4ON9A 1RWQA 5AVWA 2JGIA 1DKPA 4L0DA 3OO0A 4DCNA 3R3SA 4ND6A 1PWXA 5EAIA 3SIWA 4X9XA 2DKNA 1Z8NA 4HH4A 1T0PA 2X1MA 1UT5A 3H5VA 1I7SB 3PL5A 3HKCA 5LBIA 4N7RA 3AY3A 3CNNA 3DDUA 4G89A 1TQ8A 3SHVA 1BHQ1 2PG3A 3AEUB 4EYQA 4F5EA 3WAGA 1Y37A 2C99A 1J7JA 4BNTA 2O8FB 4QUHA 3L8ZA 1LQUA 4YQYA 1LLUA 2NZ2A 3IOEA 3LKVA 3NO4A 2HEGA 4YJDA 1JMYA 3LVRE 3LHSA 4F7WA 5AESA 4S04A 3OE7A 4Z3OA 1SHKA 4Q01A 4TRRA 1UBFA 3LKZA 3NP7A 2R1ZA 3S4YA 3PJRA 4JYAB 2GBLC 4NU8X 5H0IA 2YN4A 1U1CA 4YXWA 3HCFA 1GA1A 3IO3A 1L4MA 3JQGA 1QIJA 3QEMB 3W78A 4E2XA 1F1JA 2JH3A 3JXEA 2NTVA 1A0OA 3AM3A 1OCEA 2ZJOA 2W0MA 2A1TR 3BZBA 3DBLA 3ZG6A 3UUEA 2X5NA 5HCUA 4IFTA 1S9DA 2HA7A 1V3TA 3ELDA 3HJBA 4PRKA 3WL5A 1EAYA 1UK6A 4N49A 1BAPA 4XGKA 4BVJA 1HEYA 3RSGA 4CMIA 4M9RA 1NW9B 4B46A 1C7EA 1HFJA 1PJSA 3U09A 2QF7A 3KUXA 2AMFA 1C9JA 1DC8A 1RWXA 3PDIB 3RUCA 5I5GA 1RVV1 2BFEB 2OORA 5EP3A 5FBVB 3T15A 1EK5A 4XUDA 2H5IA 4NYMR 1BCRB 3NG1A 1YU9A 1BJKA 5A0FA 5CTJA 2QTRA 1HSOA 3RU2A 5HGJA 1U7WA 3JQEA 5J4YA 5LD2B 2NTYC 1FDUA 4UUAA 4CKYA 4FXOA 4F11A 1P2VA 3UV7A 4EJSA 5AW3A 1IAVA 1KEEB 3NYQA 4UU7A 1B3RA 2JLVA 3Q3CA 1B41A 4UTPA 4GP9A 4LHVA 4GPZA 2EHJA 2PX3A 3QI2A 3L8YA 3PWSA 4OB7A 1YQDA 2VNAA 3WGZA 4L5CA 1CC1S 1VMIA 1AZSC 2BWJA 1YR1A 3TIIA 4A8JA 3PWTA 2PAFA 4A92A 4LOLA 4B7XA 5ENVA 1HQKA 5FWXB 2MWMA 3RS0A 4GX0A 2ATCA 3QFSA 3V42A 4G8DA 4BKOA 2GT1A 2WU3A 1QDEA 3MOSA 3EE6A 1E4VA 2QLLA 2Z8YA 1E2PA 3W7BA 2B4TO 1GNQA 1SELA 4X90A 5EZQA 1EXNA 3RS7A 1MC5A 5CX1B 5AOBA 3MGGA 5DCUA 4RD3A 1HF3A 2CHFA 3DVAB 2VKQA 4WY8A 2FZVA 2KM1A 2G7ZA 4AC9A 4FEGA 2MT9A 2OGTA 3KOZA 3PTLA 4KK4A 3STUA 1U3GA 4GYJA 4PZYA 4U7WA 4YHHB 1I4LD 1AVTA 1GARA 3FVQA 3MJVA 4A73A 2GK4A 1ONNA 1OLXB 5IT9A 2D74A 3K8YA 2PT5A 1N6RA 1P2BA 1U0FA 3AV0B 4L95C 2YMMA 2VT7A 2I29A 3VR2D 3ESBA 3PJGA 3FRIA 4N82A 1GTSA 1ZC3A 3M9LA 3COZA 4GX1A 4Z4CA 1KDOA 2YV3A 4A1FA 3BN3A 4XUGB 4ZK2A 3D3NA 3SIXA 1OLUA 5J2UB 3M3PA 5U4QA 4WACA 1U6KA 3LUHA 3O26A 4I5EA 9MHTA 1WF3A 2HD4A 4X0EA 3M6AA 5FADA 1XB2A 3S8MA 3C16C 2MSNA 4KIFA 4GOXA 4LWQA 1URPA 5H3LA 3UT6A 2QJTA 4IH9A 5G0VA 1GGJA 3W2EA 1LWNA 1Z17A 4IHQA 4RELA 1WDKA 1J2RA 1NXVA 3W06A 4CIVA 2PRSA 4P08A 3N6XA 5AIAA 4DBLC 1OFTA 1MR3F 1CRWG 1W9HA 4UASA 2IF2A 1X7YB 2UUOA 4DT1B 2NW6A 3OIFA 1YH3A 4DMMA 5CB8A 2D8MA 4NAVA 5BNIA 2J3KA 4FHEA 1FTNA 1OOEA 3M49A 2Q1TA 1ELOA 2GX6A 3UWKA 4FCTA 3WLKX 3OU7A 2EFYA 3DBHA 3NHRA 3ZN2A 3OEHA 1HDOA 2Q41A 4TMWA 1NBMA 3U3OA 4OHFA 3E7DA 5HX7A 1FSGA 1NQUA 2AH5A 4J16A 3HFRA 4MS3A 4I1YA 1Q0ZA 3WNBA 2H11A 4WN9B 2HSJA 5EESA 4D57A 4R8RA 4YT4A 2P2ZA 3PKZA 2I8LA 5CA1B 3M9WA 1XDDA 1OAKA 4G4SP 1ZNXA 2E89A 3DT8A 4BMSA 4RPCA 4EFNA 2NUPB 5KU7A 3E70C 1RXIA 3JWEA 1SGWA 1QORA 2K7ZA 4LYYA 4UD2A 1JLHA 4OQEA 2GN2A 2IE8A 1ZY2A 2YHUA 1F2TB 5TMEA 3OT1B 2QZ9A 4DHWA 1P2UA 4D0SA 4HLCA 4YIKA 3LP5A 3OZ7A 5IS2A 1H05A 1IAQA 2CLOB 4Q4AB 1EFUA 1M2HA 2H0QA 3VH4A 2H5JA 2XQKA 3H84A 4NBTA 5AP9A 4S12A 4D44A 4ED9A 5EJ9A 4M0FA 2V6IA 1LFAA 4HC4A 4I55A 3K1ZA 4GNRA 4YRPA 3RSSA 3TE7A 1ZITA 3RREA 1GPNA 4BGEA 4DB4A 4LYEA 2PY6A 3HNPA 5D6OA 2ZVJA 3TTYA 2ABWA 1VM6A 4F86A 1YCFA 2HCJB 4IIYA 3BERA 2NP7A 3GT7A 3CM0A 4IQGA 1HNXB 2QX9A 3EOAI 3ZQKA 2RJ3A 3W2IA 2FWAA 2RC5A 3WTCA 1E66A 1G0NA 1BCSB 4GXTA 5DTEA 4Z1OA 3SY8A 3ZY2A 3DBRA 1EAMA 3BB4A 4QAJA 4KV9A 1VGQA 1GGFA 4S1WA 3AYXB 3DM9B 5FHQA 1SXIA 1WDWB 5ALTA 4OU5A 2HLDD 5LB2A 4QU8A 4S24A 4ITVA 2BLLA 3OE5A 4QDXA 1LRJA 2OXTA 1GHTA 2I4LA 2X1HA 3QVMA 4B40A 2BM0A 2O7VA 4HVAA 2GZRA 4M87A 4DMFA 1FW6A 2G3YA 3WSWA 3ONEA 1V1RA 2P2YA 3QKRA 4DPMA 2R9VA 4M0DA 5BW5A 5FWNA 3W5BA 1E3LA 4DVGA 1T5IA 3WMXA 3DWEX 3KWMA 3IPAA 1W36C 3BVPA 1Z4OA 3U39A 4JI1B 3SBDA 1UBCA 1WZUA 4YCJA 1CP3A 1QRAA 1KZYC 4EIWA 3A7DA 3NNDA 1TC2A 4P36A 3DQPA 3I2HA 3OKPA 2JEZA 1ZM7A 3DOEA 3KLNA 1T91A 3OOWA 3P2OA 4DA9A 3DMNA 1FQOA 2VCEA 1XTSA 4UOQA 1SU8A 1WU8A 3KQTA 1S0UA 3RWMB 3N75A 2BY4A 4MJXA 3OFND 4AG5A 2EL9A 4UBLA 1U2RA 2QTZA 3ZJYA 2JVKA 3PNVA 1QXSA 2QQFA 1N8KA 4QRIA 3CR7A 3ZU4A 3LF2A 3V9AA 5CXXA 3EIXA 2G09A 1OPXA 4OJTA 2LIPA 1G8SA 3RS9A 1FRFS 1CZNA 5CEJA 1UMCB 4OHPA 1ULTA 2G9RA 4POAA 1WB5A 3EUAA 5CM8B 1QQBA 2P6MA 2C4VA 4WX2B 3LT1A 1JKJB 3M6UA 3AJRA 4ZVRA 2EYUA 1K0FA 4OJYA 4FCCA 3A6FA 3BRWD 2WPDA 4XB2A 4DUGA 2J3DA 4EVRA 2JD1A 2GO1A 3EXHA 5CB4B 3WBKA 4C9BA 1CWUA 3RTGA 1VE1A 4U63A 3C2QA 4H7FA 1A1SA 1DCTA 1JQ5A 1L7BA 4QYSA 2GWRA 5FUVA 5CNIA 3I1IA 2IEBA 1TUBA 3GJ5A 2OORC 3E23A 3TEFA 4JVOA 4OFWA 5JPDA 1R64A 3LC2O 1GZSA 2CXPA 3K0BA 3KTDA 5A05A 4BMPB 2C7PA 2B2CA 3HU5A 3ECAA 1KTIA 2YIDA 5U4XA 2DQ4A 4YBZA 3C3JA 4C89A 3A2NA 1V9SA 4EA8A 4IZHA 1CJBA 2Q6LA 4NOMA 2XOKA 4M21A 4EJSC 1A7KA 3KFVA 5H82A 3AVYA 4V0NA 1YQEA 2CVPA 1P2SA 2D7CA 1DQSA 4IKPA 4YVFA 4LGMA 3PNOA 3DDWA 1EUCB 5HZHA 3IQWA 1W9MA 2EBUA 2LPMA 3FLBA 4HLNA 4E5SA 1A2BA 4MVJH 5M5BA 3L7YA 5LQSA 5IDWA 1H2WA 1OX6A 3VC1A 3VH2A 4ZMRA 1ZOSA 2X8JB 3JQAA 3VSAA 5TLSA 3C3YA 1OFGA 3LRXA 1COWD 1JHYA 2P5SA 3R5HA 4XX1A 1A3CA 5CDGA 3SC3A 3V3KA 1EK2A 1EX1A 2VH1A 121PA 3WJ7A 1R6VA 3DPIA 3GEGA 3I64A 1X7XB 3IUNA 2HJWA 3YASA 3OY2A 3ZTTA 3ZTWA 3QJGA 3LSYA 4WZZA 1KI3A 1G42A 3QVJA 2W2XA 1JJ7A 5ER9A 4ZI7A 8ATCA 3KOMA 2W22A 3EG9B 4G1UC 2JFVA 3M83A 2JLQA 4LYJA 2QNRA 3I61A 5LA6B 2CV0A 1B2RA 4OFZA 3N8HA 2WKWA 3I28A 4HQKA 3PJEA 4JBGA 2WUVA 1R6TA 4F2PA 1OXVA 1QGZA 5K3AA 2LGJA 3QENA 3TPCA 4D6YA 5BVHA 1X0VA 3BL8A 1FFXB 1M2GA 4PRLA 1E64A 4MUKA 4CMKA 2OV4A 1JFFB 3CX6A 3SK0A 5CBKA 1MX9A 3DG9A 1PSZA 3ED5A 1GIAA 2EJBA 2CVQA 3NETA 3R5FA 4OXNA 4ZVNA 4AY3A 1G41A 2HMYB 3GJZA 3O9ZA 4UEQA 3R23A 5D3KA 5EHZA 1NMQA 5ED4A 1YFKA 1D6MA 3MUFA 1W46A 3WL8A 4A0FA 3LVQE 5HKKD 3TMAA 2AV6A 1Z9BA 1Z12A 5KCZA 1KJ9A 1QBGA 3JCZA 4IIBA 1TPZA 3RVOA 1ZFNA 4PG5A 3JWPA 3UATA 5JISA 2G5PA 1YKSA 3G1UA 4PTYA 4JI6B 2R7KA 3RLFA 3Q88A 4E15A 1MB9A 2CZQA 4OXYA 3VPHA 2QQEA 3MINA 3L4KA 4MUAA 4C88A 4JKOA 5GONB 3C6XA 1JP7A 5E8RA 3IOMA 4JT2A 5JSZB 3A3NA 3EUEA 2Z2YA 3O75A 3T7RA 2OZLB 2WF9A 4L9RA 5E1OA 1SXJB 4DIEA 5KQMA 4J16C 2M32A 1KTVA 1QFJA 1G5TA 1RWVA 3E1KA 3G9QA 4OI4A 1WLYA 5DNVA 3THXA 4O2AB 2CXXA 2G04A 4HAZA 1Y8QA 4HWRA 1IY1A 4US0R 3T9BA 5J58A 2A9OA 3IESA 2Q29A 1GGHA 2ID8A 1II9A 2RHDA 4MIOA 1BYUA 2I2AA 5FOUA 4FONA 7REQB 2FMXA 2O8DA 3LA6A 5C52B 1FFDA 5DTJA 4WDQA 1A8QA 2GEDA 3EZ2A 3KXDA 2GJAA 4IVQA 4X91A 2W6OA 3MCTA 3S3TA 2A1IA 3UAYA 4URYR 3AIKA 2NZWA 3QW4B 3V4SA 5E3HA 1ZN8A 3KV1A 4KVZA 2Q1YA 3DPSA 4CQNA 2WSSA 2P3OA 3MCZA 3GGDA 3P1JA 2JBHA 1N9ZA 2FEMA 3K30A 4KB5A 4NCJA 4QGFA 5MFZA 3H5OA 4OK6A 4C87A 3KQVA 3IA7A 1FVFA 1ZZEA 4CIAA 1VHWA 1XTUA 1JFVA 3C8ZA 4PV7A 1H3FA 4OHMA 3IQHX 4G63A 3HYNA 2UZ4A 3ABQB 3WGYA 2L17A 2LTAA 4R2IA 4LXXA 1UWVA 5CURA 4BZWA 3E7XA 4IDEA 3LLVA 1KEUA 1DJLA 3KQMA 4BLUA 1TLFA 3ICVA 1TTQB 5HQ3B 4DR2B 1D0IA 2IV3A 1C9YA 1QTIA 2PKRA 4NJEB 1ZR2A 1YWGO 2AOXA 2TRSB 2A94A 1B8OA 1CUZA 1XHLA 4FEEA 5DH9A 2QB5A 1OSNA 1TKBA 3BM5A 1E3SA 3AG6A 1NLYA 3G0IA 3GRZA 4WPGA 1PW5A 2EVWX 4PZPA 3NRBA 5F2OA 4D4JA 3VM6A 3O6VA 4BNXA 2ZIEA 4BMCA 1LTKA 1WKCA 3OE1A 5C8XA 4ENTA 1CF2O 1OXMA 2QX4A 4K9DA 4P7JA 5JSKA 4RTMA 1AG9A 3MS4A 2O0LA 1EVZA 4PIMA 3UTDA 4BO5A 4NCAA 2HDHA 2VHZA 4R2XA 3V4PB 1M1NA 3KVRA 3KQQA 3NT5A 4EG8A 4HY3A 4WLEA 4HPWA 1OX4A 4KO2S 1UQUA 1Z5PA 4HT3B 4YAWA 4EKGA 5FNZA 2JI7A 2Y1XA 1W94A 2FSIA 4M1ZA 3F8TA 3W4KA 3ND7A 4KEAA 4ZAZA 3UAGA 5KNDH 4NPCA 1MU0A 5C37A 2A3NA 2X5JO 4L0MA 4EB8A 1H23A 4MCJA 5JAQA 2HZBA 4B82A 2PS0A 1I8TA 3L8EA 4DXHA 2XKJE 1DAHA 5JCJA 2YWFA 5HIJA 3EJWA 5K0TA 4Z9YA 1MAVA 1RHKA 4FFRA 2OKGA 5BN5B 3ZEIA 4FYHA 3C3XA 5EKTA 1SQ0A 3S99A 4HQOA 1Y33E 3EAQA 3FMIA 2WNIA 1JHQA 2XUGA 4LTDA 3OZRA 2IU0A 1X6VA 1G8JA 3SLGA 1JU3A 4GC9A 1DC7A 1CIVA 4LF6B 2XSZA 4WMLA 3ZY3A 2GA9A 5JJCA 1FSSA 1BO6A 1QLHA 1VCMA 2VP3A 2G6TA 3K8QA 3B20A 4QXQA 1IBLB 5F2NA 4CKZA 3STTA 5D6NA 1GL6A 3EXHC 4LF4B 1Z5OA 2WYOA 4W7IA 1M3SA 1S2LA 1VMAA 2GVDC 3IHWA 1RYBA 1S3SA 2VZ8A 3LQ2A 1ZQ9A 2R00A 1E5LA 1MV8A 4FYJA 2G80A 1WPRA 4LJLA 1EDZA 1IG0A 1WDTA 4PFJA 4Q21A 3AFNA 1BIFA 3WNZA 1WUHS 5BV1A 1S2DA 2VTKA 3WXMA 1XZCA 3H1BA 3KQYA 3A1FA 4ZJYA 5L51A 1P1JA 4A36A 1RCTE 2QL7A 1D2MA 4WEOA 1DP4A 4WY2A 4ZJUA 3RSCA 3VZDA 3H17A 2OM2A 3L6CA 1OGJA 3EGCA 3HKDA 4FFSA 4IWYA 5FTWA 4EG1A 3DS8A 2VF4X 1T0JB 2YBDA 6GPBA 4WBNB 4MOWA 1ZK1A 2PS3A 3CINA 4E4YA 3AIIA 1KMMA 3CX7A 5BNTA 3TNYA 2C4NA 4O4LB 3DGFC 2DBZA 2FX3A 3HJCA 1K9VF 3EGWA 4NZYA 4BUJA 3K4QA 1NC3A 3ZU6A 1HQCA 4N1AA 5JAIA 5H5JA 5K4GA 1TOAA 2GVZC 4GSLA 1JIUA 2Q3MA 2O5VA 3MTGA 2XQIA 4QVGA 5A5DA 2NYRA 4IXDA 5GTDA 1F20A 4AN0A 2V96A 2M1ZA 3LUDA 1VIYA 3PPIA 1UXGA 1HDIA 1SY7A 1VG1A 5TDHA 5IWAB 1VCIA 4HXEB 4II7A 2OOKA 2EX0A 1KSJA 4HRAA 5EYPB 1N57A 3FDIA 4WI1A 5KYGA 4R8MA 4EKIA 1JFRA 2DBVO 4EMBA 5D8DA 3B12A 5E95A 3U44B 4HQ0A 4RF5A 4PEVA 2N1BA 4ETNA 1DC3A 3T1QA 3IBGA 3ZEAA 4EB6A 4ALNA 4ND4A 5EWLA 4HUTA 2BFBB 1OT5A 3A8TA 5EN4A 5ALRA 4YPOA 3OCXA 2YUTA 4TTPA 4ZTBA 2FPGB 1EFVA 5K01A 3C5VA 2JFUA 5KTMA 3IKJA 3DV9A 3LCCA 3OHPA 1PL6A 3UJ6A 1P5JA 2JAQA 2G7MC 4I3GA 4D4KA 5C5CA 2XB4A 2JIOA 5KQGA 3BMCA 2ZEJA 1KBQA 2V7XA 2PGOA 3DMPA 1S2IA 3KTAB 3CNBA 1RQLA 4MP3A 5AHKA 3M33A 3VKWA 1BVHA 2P5UA 721PA 4F4UA 5H80A 1CT9A 2XGMA 1H4QA 3S2YA 4LCBA 4J07A 2HBYA 3MWFA 3OEYA 1H2EA 1CUXA 2A7QA 2OY0A 2YFYA 1SBHA 4H1HA 4FJ2A 2WINI 4FMCF 3ETJA 1CRPA 4DWWA 1AIPA 1W96A 3TL6A 1R12A 2CUZA 3L7JA 4XSVA 3I1JA 2NSHA 1A8IA 3HB7A 4RA6B 4HSGA 1WUTA 3IELA 5FRDA 3WZMA 1E77A 3RC8A 4GBMA 5KTPA 2A7XA 2FPXA 1LPOA 4BQSA 3KAJA 4LDAA 3BE4A 4LRWA 1FK8A 3E22B 4HS4A 4MCAA 5IX8A 3GAAA 3FWKA 1WDMA 1CZRA 1PZNA 2IP4A 1UZUA 2JC3A 3OQPA 4MAFA 3ZY5A 1T2CA 4OY3A 4B8YA 4K87A 1YA4A 2GASA 4H18A 5BQFA 1QMPA 2BKLA 2BDEA 2BF7A 1N2CE 3LBAA 5DLDA 3TRIA 4PLZA 3QMVA 3ZE1B 4B5LA 2H2IA 3HJGA 4QHTA 3UOWA 2AG6A 1GL9B 2WD9A 3P2KA 4OKIA 1WHTA 3KKMA 2HREA 2NAPA 1FFHA 3BSYA 4LYAA 3ZBPA 4KQIA 2NGRA 1B76A 4LHEA 1TU0A 2NTEA 4LXYA 2REXB 4MGKR 1YR2A 4D56A 1QS0B 1Z88A 1J0BA 2R6JA 3W77A 4J91A 3LD9A 1KNXA 1R9MA 4BC1A 4D9GA 2GESA 3N6RA 1WJGA 4KW7A 4O25A 2PKYX 3R3UA 1NJSA 2CVHA 2QN2A 5BOVA 3GMIA 1C7QA 3HB0A 2JLWA 2O8EA 2PK3A 4UTXA 3HFJA 5K8TA 1PWHA 2PXHA 1KWGA 3PEYA 2BHRA 3IRUA 4PW0A 1KGSA 1U0TA 2GPYA 1FFGA 2X9QA 2D1YA 2XUKA 3FNGA 3KDPA 3QPBA 1WPQA 3RBVA 4DWJA 3A2MA 2GK6A 5BY2A 1R10A 2WT8A 4S3MA 1YRQA 4HMQA 5D51S 5HFAA 1R50A 2CD7A 4ALLA 3FSJX 3GFVA 3U56A 3OTOB 1F8FA 5G1PA 1TU3A 3W7VA 4Q7MB 1SUFA 3DO5A 4CV3A 3N2IA 4EDHA 3O3OB 3AKCA 3O3NB 1I1NA 5L53A 4G9EA 1ZPDA 4JJ6A 3MA0A 4TWRA 1Z39A 1WW2A 1QFZA 3NWOA 2K7FA 2CVFA 2W6ID 3H3XA 5FL3A 5CIQA 4DM3A 3A9SA 2OBLA 1N6IA 3A6EA 2F59A 3VZQA 2P2CA 3PIDA 5BT8A 5DXJA 4Q19A 5T4HA 1P29A 1XXHB 4YAOA 3R8CA 3VGJA 4CEJA 1EUDB 1I33A 4Z49A 4UBJA 3K94A 4MR8B 1SA0B 3KKZA 1HWYA 1K0UA 4PX5A 5AH0A 1A1VA 3AEKB 5IYZF 2P75A 3SZLA 2PUWA 2O8CB 3RUIA 1J8MF 1OZGA 3C1OA 2ODEA 4RTLA 2VJDA 4PYQA 3LKDA 1MF7A 1DXYA 4B85A 5CT5A 3S8EA 2Q4RA 2Q50A 2C7RA 3Q3VA 5CYPA 3RIYA 4UZEA 3UT5B 1AO3A 4OI0A 2O8BA 2FPLA 1Z56C 2FA9A 2X4IA 2ZSDA 1BW9B 3ONNA 2KMLA 5I8WA 2BDUA 2FSFA 4DCVA 5F64A 5A6SB 5DI3A 4Z99A 1PO7A 1NDQA 5BOSA 5JYEA 1E0KA 1RRMA 3JQBA 1UOPA 3WGTA 1QDUA 3OEEA 3O82A 2O52A 4C03A 1RDFA 1XOIA 1PJBA 5ALOA 4YJ3A 4UNPA 2O8EB 3QG5A 4U6SA 1YI0A 1Q7BA 4Z1MD 3KZOA 2LE0A 2GBGA 6ADHA 2ZBDA 5I7UA 5H83A 2H16A 3R7WB 5F23A 2JGFA 4UBKA 1C5KA 1E7RA 2RJNA 2ONYA 3HG7A 2G1UA 2P0AA 2HX1A 1RRFA 2QSUA 4L50A 4EW2A 2XZOA 3AR5A 3WC4A 2JGDB 3GUUA 4I19A 5D3QA 1E96A 3AILA 2A78A 2Q7OE 3VJLA 4LV8B 4D96A 3TG2A 4I81A 4WECA 4L76A 3OM9A 2VAXA 1HFWA 2R00C 1RI4A 2C5EA 3JYQA 4AF7A 4MQEB 4DC0A 5B30A 5IDQA 1GDHA 3FSGA 1AN9A 2X2FA 5EMNA 4NOLA 3WAJA 3RW9A 2HO4A 4YJGB 5ALSA 2BFCB 4ACBA 1GR0A 5L3VA 5KX5F 3QIVA 5ITZB 1P17A 1J39A 4HVCA 4EO7A 5IXSA 5AFSA 4RYLA 1CETA 1TAGA 1SZPA 3T12A 4EJ0A 2ODTX 4QPDA 4M7RA 4MGYR 4NPHA 3V4FA 1NLFA 3K2IA 3O8OB 2HQ1A 4JYMA 3AEUA 4M99A 5AQEA 4XGNA 4BJ5A 5K6RA 3P0EA 4TS9A 2O8FA 2B94A 2X22A 1IIRA 2ZWPA 4P6VF 4V1CI 1GGEA 4YYZA 1CUJA 1JZSA 5GGYA 2ZJFA 1YB6A 2GZDA 4DE5A 1JMKC 1K7FB 1N5KA 1Q1BA 4CLOA 1KSHA 4EM6A 3GLHE 4FEAA 3HB1A 1UEIA 2ERCA 1D4OA 2G4LA 2ZRFA 2MSWA 1OXKB 3AUYA 3FTQA 4J7XA 5JNWA 3F49S 3FOZA 1A2OA 4A23A 5IVHA 5KKCA 3KR0A 4WZBB 2EF1A 4RQUA 5CDUA 5K6AA 4X66B 3U49A 4PLFA 5KIAA 2Q4OA 4R16A 3SS8A 3N0RA 2YC4C 4OMCA 2WJPA 3TS1A 1AZTA 3I9KA 4EZEA 2PS1A 1IFXA 1QCYA 4DYVA 2QVXX 4AN4A 1FTGA 2BI7A 3MOIA 3WGQA 4XPIA 3UENA 4NOJA 3HVKA 5FPYA 1T1JA 3PDIA 3HYLA 2BFEA 1SXGA 4KQKA 1KQGA 1SEPA 1C2TA 3CPJB 3ECSA 4HH3C 1BCRA 2FZ4A 3H2YA 4GVPA 3KB1A 1HO3A 3KWJA 3H6KA 2WVGA 3QHQA 4FFNA 5F33A 3UJAA 5C51B 1NUAA 3N0XA 3FNBA 2WY2D 1K8RA 2OGZA 3MPOA 4PLWA 4V0MA 1Z63A 1KNQA 3HEAA 5EINA 1NSFA 1E9AA 2CF6A 4D79A 2JH8A 2C31A 2NUTB 4UHHA 5IBPA 2YJZA 1U9ZA 1T2EA 4A0RA 4JT9A 2Q8NA 1OHHA 4G0OA 4R8KA 4RKWA 3IR5A 5IANA 1X8KA 5FWXA 2JATA 4BKUA 2JASA 2FY8A 3EFOA 1DUVG 1YZTA 1PNTA 2DPYA 4CF7A 4PONA 4DCSA 2YOFA 2FPOA 1DOAA 1PJCA 3TIVA 4AXXA 2WZQA 2WQ6A 4DG9A 5B6JA 3Q98A 1YJBA 5BURA 4FSXA 1M83A 3DMGA 1PS8A 2KX7A 3MTEA 1FYDA 2XCUA 3OUTA 3KCQA 3ML1A 3ZD8A 2OCLA 1UZNA 1W2HA 2NV0A 1JPJA 5DNDA 4TGLA 2GPSA 2I9KA 1XNJA