4R69A

Lactate dehydrogenase in complex with inhibitor compound 13
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
331
structure length
325
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 112
structure length 325
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r69A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r69A02
1UP4A 5FFFA 4QT0A 5BT9A 3MWDB 4YRDA 2X5KO 4HKTA 1LLQA 3CINA 4N5LA 4B3HA 3ZWXA 4BO2A 2YFQA 3HDHA 4R4JA 3WYCA 4JGBA 5L4NA 4KUHA 1CJCA 3OHSX 2DPHA 2O3SA 1F17A 1TEHA 2AQHA 5TNXA 2Y93A 1Q2XA 3I6IA 3FR8A 1NQOA 2AE1A 2YYYA 4MP3A 5L53A 1T1RA 1NAIA 1QSGA 1A7AA 1H94A 4GX5A 5KKAA 5HM8A 1XU9A 2DQ4A 3I52A 2ZK7A 4CMBA 1YBAA 2QIOA 4RDIA 2VWGA 1Q0HA 1UR5A 3HJAA 1N7GA 5JY6A 1X7HA 1PS9A 4CMJA 4CR8A 1PEDA 1ZMOA 5G0VA 3OBBA 3AUUA 1PL6A 3OSUA 1HDRA 4RLHA 1MG0A 5ENDA 4NK5A 3N74A 3UF0A 2PD6A 4ALIA 4J91A 4YJHB 1W6UA 2NVUB 3KYDB 1NTOA 1L7DA 1UXHA 4MVJI 4YBZA 1Y8RB 4CLDA 2FPGA 3VPHA 2EJVA 4D3DA 3DXFA 5I7EA 3ZHZA 2DAPA 4CV0A 1R16A 5JDIC 2AHRA 1LSSA 4ZGWA 4NIMA 4NPCA 5AXDA 1VL6A 1ZK3A 2RAFA 4JLWA 4R51A 3BZUA 3PYXA 2CSUA 2OP0A 3DZFA 4UREA 4XR4A 3JQAD 3KSUA 2BD0A 3QVOA 1H9BA 4W9NC 2Q4BA 1I10A 1YE3A 4PRKA 3CZMA 5CPBA 1J0XO 3KHUA 3M1LA 1GYPA 4O59O 5JW6A 4GI2A 4IS3A 3AI3A 1ZEMA 3C85A 4DRYA 1N9GB 3P2YA 4Q3CA 3VTZA 1B7GO 1VE9A 3AUAA 3EY4A 4RPGA 4A7PA 4BO9A 3QLJA 3VZSA 1U4OA 2D1YA 2EGHA 4E5YA 5TQVA 3HDYA 1IUKA 2X9NA 4JP2A 2E49A 3GVCA 3RWBA 3UVEA 4PN3A 1P1RA 2B4TO 3C8MA 1N7HA 4XQEA 1Z74A 3QVSA 1LLUA 2QZ9A 1QORA 4PLYA 2X6TA 4E5MA 1DFIA 2NNLD 1YWGO 1GR0A 2PK3A 2ZYAA 4FQ8A 1DRUA 1GDHA 2IE0A 2YFHA 3HDJA 3NGLA 4KWHA 5A9RA 1ZK0A 4BNVA 4J1TA 2YV2A 1PJTA 4AICA 4YT8A 2PZLA 2ZB8A 1PWXA 1XHLA 1P1KA 2P91A 1KOLA 5U1PA 1LTHR 3JQBC 1R4NB 1IPEA 3JQ8B 4L76A 1WWKA 4D79A 3JV7A 3QWBA 3E18A 3EW7A 1PGNA 2DBRA 1NM5A 1DIGA 1H2HA 2PFGA 4LMPA 2X22A 4Z9XA 1J5PA 4GGOA 4ALKA 4BNGA 3IS3A 1H6CA 2HU2A 1R0SA 4OO3A 3VVBA 4K6FA 5JAIA 2JFHA 1HDGO 4PG6A 1CETA 3D4OA 4IGFA 1NPYA 3OIDA 3W1VA 4E3ZA 3IKTA 3DB2A 3ZV5A 2EWMA 3WICA 3BAZA 4ZN6A 4JBIA 2JHFA 2VN8A 2D3TA 3HDQA 3OJLA 3D7LA 2A92A 3RIHA 1B3RA 2EKLA 2E37A 2O23A 1E1MA 3ZNOA 2NUAA 2PKQP 3R3JA 5CFZA 2BH9A 4FJ1A 1IHXA 1LLDA 1PGJA 4BV8A 4DC1A 2DVMA 1V3VA 3V2GA 1IE3A 1NFFA 1Q7GA 3PGJA 3TRIA 2NM0A 4LVUA 1MC4A 4BO3A 1AXGA 4BNUA 1GZ4A 4BKPA 3PJGA 5HWSA 1PJQA 3I9LA 1A4UA 3H5AA 3UW3A 1P77A 1YH3A 3VDRA 1GU7A 2FR0A 3RFXA 1GEGA 3JQFA 3GGPA 3IUSA 2P2SA 1R0LA 1KS9A 1WZEA 3EVNA 3QVWA 3AM3A 4HUJA 2GN9A 3B20A 1PL7A 1EDZA 2OXIA 3D3WB 3ON5A 4XR9A 1NXQA 3I1JA 3QQPA 4GX1A 2HMTA 3F46A 3ZNNA 1U2GA 1LDYA 1UXGA 2HRZA 3CMCO 4BHTA 3KLMX 1MX3A 4E2XA 5A5FA 4OXNA 3KZVA 2QG4A 2X4GA 3U4DA 5I7FA 3A4VA 4I8XA 5IDQA 3NV9A 4UEOA 2Q1WA 3WX0A 5L9AA 1EBFA 1P44A 1OC4A 3V2UA 4HNGA 5A02A 1DC5A 4X54A 1EQ2A 5JNLA 5CDYA 3W4KA 1LDMA 5JS6A 5IAAA 1JDJA 3I4FA 5KNLA 4YJHA 2YY7A 1MXFA 5DOVA 5F1PA 4XYLA 2PGJA 1C1DA 1M6WA 3STHA 1K6XA 1R0KA 3CH6A 4ALJA 1RJWA 4U6SA 2E6UX 3WGOA 4EITA 1JN0A 1Y8RA 3NDIA 4GBJA 4A03A 4Q3NA 3PDUA 1ZJYA 2PZJA 2Y1DA 3FHLA 3VPSA 4LCJA 5TLSA 3OH8A 5HTOA 2ZTUA 1SO8A 4D7AA 1G0OA 3WGIA 1N92A 4FFOA 3NX4A 4E2YA 2J3IA 1FDVA 3WGYA 4MIYA 5IXYA 1J6UA 3F5SA 4WNCA 1UAGA 4L8VA 4XEHA 1LRJA 3RBZA 2D0IA 2P5YA 4R5HA 4HADA 4J4HA 3RJ5A 2HMSA 4HBGA 4XRRA 3WQQA 2YJZA 1WXDA 2QRJA 4B7CA 1T2FA 4L9RA 1H6DA 3L6OO 4EUEA 4YPOA 4ONEA 1X13A 3RASA 3U4HA 4OSOA 2GNAA 3NT2A 3RAJA 2HMWA 4FBGA 1PGQA 5G4LA 1U3WA 3GF4A 3V1YA 4NDNE 3AU8A 2YDXA 2JKVA 3PQDA 2NVWA 3ANLA 1BWSA 3U62A 3V8BA 2CVZA 5JYEA 2FPIA 5CAEA 4MJLA 3IC5A 4JX8A 3M1AA 3DZHA 2EKPA 5TS3A 1XG5A 2CNBA 4TWRA 3ZCXA 3KSDO 1RM3A 3FBTA 4G5HA 2Z5LA 2W2KB 1U7HA 4AJ1A 5I8WA 2FN7A 2G5CA 2GASA 1A72A 5L51A 2POQX 4E21A 4EJ6A 1E3LA 1A4IA 3B70A 2O2YA 2IODA 4BO8A 1JKFA 1LDNA 5JAZA 3FPCA 5G0WA 1U3UA 4FFLA 2DBQA 4WGGA 3JQ8A 3JD0A 3PGXA 2ZQZA 3QIVA 4XX0A 5T67A 2QZZA 4R5MA 3OMLA 1LLCA 2Y0CA 2DC1A 3LT0A 1YL6A 2Y0EA 4OSPA 2YZ7A 5GZ1A 5CG1A 1HZJA 4PG4A 3W6ZA 3U49A 2VWQA 2GGSA 2R2GA 1VKNA 5C7OO 4RVDA 4FOSA 4HX5A 2RH8A 3RFVA 1E0DA 1T2CA 3GVIA 4YT2A 3ENNA 5CDTA 3KB6A 4DXHA 1E1LA 4RF5A 4R3NA 3JD4A 4Q3AA 1MG5A 3PHIA 4BL5A 1GUZA 1ARZA 4QEDA 3BHJA 3IQDB 3PLRA 1F8GA 5TX7A 3EAGA 4JIGA 3ZZNA 2ZQYA 3UAGA 1UZLA 3QHAA 5K6AA 2IEDA 1MB4A 1O5IA 2Q4EA 4OOFA 1E7QA 1NPDA 2Z1MA 3AM4A 5ER6A 5FWNA 1HDXA 5COBA 1DBVO 1ISIA 4IZIA 1C3VA 3X2EA 4NG5A 2DM6A 1YB1A 2O2SA 2SCUA 5KWEA 2Q49A 1T26A 3G0OA 1DHTA 5GZ3A 2GPTA 1VJ1A 6ADHA 1L1FA 5CHEA 3D5QA 2NTVA 3S2FA 4W7HA 4M86A 4IUYA 3V5NA 4P4GA 4ZU3A 3JQBA 2PD4A 2VCYA 3DHNA 1XSEA 2C7VA 2IEBA 2NLOA 1NHWA 4NR0A 2AQ8A 2H63A 2V7PA 1ZNQO 1WAMA 1GEEA 1DIHA 2V6GA 4D0SA 3K92A 3ETGA 4RF2A 3D3WA 2DFDA 3GPIA 2OBNA 3LC2O 5EQDA 1YBVA 5T5QA 2H9IA 4FIZA 5L7YA 1CIVA 4D44A 1FJHA 1ZXLA 4YTEA 1NQ5A 1AE1A 1DIRA 3ZW8A 3DZIA 2LDXA 1PZFA 3B1FA 1NWCA 4NU6A 1A71A 3Q11A 4BKQA 3H3JA 4BKRA 1I2ZA 3W8EA 4BV9A 4PGFA 3SBOA 5IF3A 4FFNA 1C0LA 3NDRA 4DWVA 4E31A 5BQFA 4FCCA 4NBRA 3ZWAA 2AG8A 2EW2A 2VHZA 4D0RA 1CEQA 4TKMA 3D4PA 5KVVA 5DCWA 1CRWG 3NT4A 4F3YA 2C82A 2ZCUA 2I9PA 3U0BA 4IXTA 5I7VA 4TKLA 2VRBA 5EL0A 3BTOA 3O9ZA 4RQUA 1C1XB 4Y67A 4UEKA 4E0BA 1BW9A 2ZTMA 3JD1A 4DGSA 1B15A 4BVAA 4RVGA 4BQRA 4J4TA 3FTPA 1GUFA 3BMNA 3L4SO 3OEWA 2R6JA 1GUYA 1P0FA 2EHDA 1ONOA 4KDFA 4IIVA 4EUHA 4BS9A 5L45A 3Q9NA 4O1MA 6LDHA 1F14A 1QYCA 3WJ7A 2JD2A 1W73A 3FWZA 4CLXA 4IY1A 1P1IA 2P9EA 3VDQA 2FWMX 2XXBA 3WMXA 4INAA 1XU7A 2AG5A 1I33A 3PYMA 4WK6A 3O26A 1U5AA 5JMPA 3T7CA 3UKOA 4BNLA 1PJLA 4BNJA 1E3WB 4DA9A 5CG2A 1I3LA 4M55A 3CPSA 4JP3A 2C54A 4A73A 3JQ6A 2H6EA 3JQ9A 1Z6ZA 2QYSA 2X5JO 3GDFA 3AFMA 2EXXA 4S3MA 4MKZA 1TLTA 2HRBA 5F1KA 2Y99A 1BXZA 2X0RA 2WD8A 5HS6A 4UUOA 2EP5A 1KEUA 4BGEA 2G76A 4BNNA 3AWDA 4P22A 5F3RA 1PIWA 4IDBA 4U6QA 2C2XA 2I3AA 2JCVA 4URFA 4W7IA 5EIOA 3SLGA 3VOSA 4LMRA 2JD1A 2HJRA 3OA2A 4PLPA 4DQXA 1PQWA 2UAGA 3NTRA 3U3XA 2FRDA 5EERA 4P4LA 4UVHA 2XPCA 2BGKA 4ND4A 3PXXA 5LCXA 3RKRA 5AVOA 1AHIA 1MFPA 4YJGB 1PJ3A 1K2WA 4XYGA 2ILTA 1YJ8A 2J5QA 5KCZA 3GAFA 3NDJA 3C7CB 4II3A 3DBLA 3H9UA 3IP1A 4CQMA 4NBUA 2HCTA 1PZEA 4ND5A 2D8AA 1BDMA 3MOGA 4R69A 1R15A 4E13A 1VSVA 1EFLA 1DRWA 3TDKA 1MA0A 1KC3A 1SAYA 2NSDA 1LI4A 4R3WA 1SOWA 2VRCA 4QX6A 1I30A 4DPLA 3WWYA 1EUZA 2WMDA 4R16A 2AQIA 2HK7A 4DIOA 1ZZEA 1I01A 3E6AA 4BMSA 3HWRA 3A28A 4BO0A 4Y6RA 1K3TA 3WBFA 1JLLA 3WGZA 1B3BA 4BNYA 1E7MA 3MJSA 2OOSA 4GH5A 4XGNA 1BG6A 2YW9A 3FI9A 1BSVA 4XDYA 3JYPA 2NVBA 3TSCA 4J90A 1LJ8A 3LSYA 2VHXA 3OIFA 1R66A 1LNQA 4D42A 4BNKA 4QO7A 3AI2A 1BDBA 5U4QA 4CM8A 4U5QA 3JYNA 4BKOA 3DTYA 7ADHA 4CJXA 1UXJA 4D43A 1HLPA 4EEZA 1P1JA 1IZ0A 1F0YA 1JWBB 2C29D 5HBRA 4CLOA 1EMDA 4WLVA 3E82A 3F4BA 3CSDA 3O8QB 3GUYA 1U5CA 4W82A 1PQUA 1PJ2A 1GCUA 2IZ1A 3DL2A 4J16A 2I99A 3ETDA 1H93A 4FJ2A 3FF4A 2ZB4A 3KO8A 4ZQGA 4WJZA 1YOVA 2BFOA 4PVCA 5ITWA 2E48A 1DFHA 4FN4A 4BNIA 4K6CA 4MVJG 2FSSA 2GN6A 1ZO8A 2RBEA 4CUZA 2WYUA 3VVCA 2Q2QA 4RVSA 4FS3A 2Y66A 4R41A 2HKIA 1EBUA 4CM6A 2A9FA 3INGA 3GVXA 4QO8A 1GQYA 4B7XA 3EGOA 3CMMA 4BNHA 3KYCB 3WG9A 4WNIA 4B3JA 1HSZA 3COSA 3QY9A 2HK9A 4Z6KA 4DMMA 3JQAB 1A27A 2NU8A 3Q0EA 4XKJA 4CM7A 4GMFA 4Q3EA 4UVIA 4CM5A 3CKYA 4MVJP 2VYVA 4YYZA 5AXCA 1T2AA 3D64A 1AUPA 5HRUA 3HSKA 1SEPA 3SJUA 1LC3A 3QJ5A 3ZWWA 1JVSA 2X58A 4OM8A 3ZNQA 4CMEC 1X7DA 2X9VA 2B4RO 1X1EA 4CV1A 1EVYA 2WSBA 1IYZA 1P1FA 4DQUA 4BIIA 3ORFA 4W4TA 3F3SA 2BF7A 2Q50A 3JCZA 2P4QA 5C7LO 3UFXA 3OICA 1K6IA 4KTTE 2RCYA 3DONA 1U8FO 3QRWA 3WXBA 1V3UA 2ZKLA 2I67A 3RUAA 1BTOA 3RUEA 3VH2A 2TMDA 1ZCJA 4PLZA 1RKXA 2HQ1A 4HXYA 2ET6A 1QLJA 4CMCA 3VPFA 2VTEA 1X0XA 3P2OA 4ZRNA 2OHXA 3HNPA 1WZIA 3DOCA 3BTSA 3NTQA 4AJEA 1Q1NA 4EUFA 4YRBA 1O8CA 3H9GA 4IMRA 3VH1A 3PEFA 3OFSA 4ITUA 2GO1A 4Q39A 4XIJA 3RUFA 1ZIDA 1MXHA 2BGLA 3H2ZA 1ZW1A 2ZYGA 1D1SA 3DBRB 4FFRA 2ZTVA 1U7TA 1LUAA 4J6FA 1DPGA 2NQTA 3F47A 3FSRA 3PRJA 3B1KA 3GEGA 5I9NA 3S8MA 3WWZA 3I9JA 2PZKA 2CMDA 1P9LA 4K1LA 2CF5A 4KQXA 4RZHA 4WUVA 2FP4A 3UCXA 5L4LA 1PL8A 4YJGA 3DOJA 3S1LA 3ASUA 3GH3A 3OEYA 5BNFA 4BQPA 1T2EA 1HYEA 4DC0A 3L07A 2AXQA 3WFJA 4DLAA 1R12A 4N18A 1V35A 1GQQA 5THQA 1LX6A 1HE3A 2JAPA 4MIOA 3MJVA 5A3VA 4AJIA 1X14A 1O94A 3QV1A 5L7TA 4XGKA 4RQTA 3TZCA 3WBBA 3ZWVA 4GKBA 1KY5A 3F1LA 3HFGA 2AW5A 1JWAB 1YXMA 3JQ7A 4BO7A 1JW9B 5DULA 2I3GA 1J49A 1ENPA 3UGKA 4L4SA 4PFJA 5KKCA 4XD2A 3JD2A 2I5PO 4PIVA 2CFCA 1VKOA 3E5RA 1KBZA 4CM9A 4EDFA 4G2NA 4EI2A 4UULA 3AUTA 3K30A 5KJ1A 5IZCC 3IKVA 3PQFA 5COQA 3VTFA 3ITKA 3W6UA 1EVZA 2J3HA 5BSGA 1V3TA 2VT3A 5KJ6A 4LW8A 1Z73A 5C5IA 4WLNA 3F6YA 4RPLA 3ZN2A 4JXKA 2JL1A 4Z3DA 1I2CA 4DPMA 3LK7A 1VRWA 2IXAA 1X15A 1QYDA 4ZVVA 4BOYA 5JDCA 2BGMA 3GA0A 4YAIA 3ABIA 4ALMA 4CUJA 3F4LA 1ZMTA 3H6KA 3DAPA 2FSVA 1KVTA 3KTDA 5DP1A 4DBVO 3NJ8A 5G4KB 4A5OA 5ICMA 3ADPA 3LU1A 2NTJA 1NVGA 4RVUA 4EEXA 1SCUA 4IMPA 2OBYA 2HMVA 1S7CA 4AG3A 5BSHA 3PHLA 1V6AA 3SJ7A 2BMAA 5ER9A 5U9CA 4IDEA 3ZW9A 1F8FA 2DUWA 1HWYA 4KZPA 4MPDA 4IS2A 4IJVA 1CQJA 2A35A 1XEAA 4WCDA 3RU9A 2GERA 5TT0A 4IDCA 1YDWA 2DT5A 1NASA 3D1LA 3ZI0A 4CMHA 1HE4A 1AXEA 1BHSA 3IIEA 1E6EA 1ZBQA 4PZEA 4ND3A 3FCOA 1G6KA 1TB4A 5JLAA 1UZNA 1F12A 3GN1A 3TL2A 4ALNA 2D4AA 2Q2VA 2X23A 5B12A 3ZWYA 3GDOA 3NYWA 1DHRA 4YACA 3JQDA 3L6EA 1IPFA 1ISFA 4NZ9A 1BMDA 4B7UA 5H82A 2X0IA 3JTMA 4GX2A 3E03A 1AHHA 2W2LD 1DDOA 1DO8A 4OKNA 4TVOA 1NFRA 5CEFA 2DBVO 3DR3A 4IQGA 5DP2A 4BGUA 4YJFA 3GG2A 4QQRA 3H7AA 4DLLA 3EDMA 4WLFA 3H9QA 2GCGA 3NGXA 1YS4A 4KQWA 2OGUA 4NFHA 4Q9NA 1BXGB 1DSSG 2QW8A 4OQYA 8ADHA 4KP7A 4TSKA 4CQLA 1VL0A 2B37A 3WR5A 1I24A 3V1UA 5JAQA 2BFMA 4CV3A 3VZQA 2DKNA 2Q46A 4ZQBA 3TF5A 1RPNA 4MVJA 3CXRA 1ZKMA 2FY8A 1YJQA 3LVFO 1IL0A 1Z75A 4MVJM 2GN4A 4TVBA 3IJRA 4XYBA 3JQEA 1T1SA 3Q9UA 3PI7A 1R37A 4I08A 5A04A 1QXSA 4MP6A 5JY1A 1H2BA 4K28A 3GGOA 1JAYA 4J2HA 5F5LA 4UVEA 2FPPA 3RUCA 1HTBA 5A1TA 4TMFA 2IDZA 2VUTA 4FFPA 3FNFA 3DEYX 3PP8A 5JFOA 4QUKA 4ID9A 1Y8QB 1XR3A 4M54A 1LDEA 3ZWBA 1N8KA 4HWKA 3GNQA 3U4CA 3V2HA 1XDWA 4MVJF 3ZHYA 1DIAA 1QG6A 4NBVA 1XKQA 1XQ6A 3DDNA 1V0JA 2P4HX 1WNTA 3H65A 1VPDA 2NU9A 1TT5B 4YVFA 2JHGA 4LSWA 5BR7A 1CYDA 2VNAA 1KVQA 3ANMA 2NVUA 5CPFA 3KYDA 1N2SA 2GZ1A 5BNIA 3CE6A 2H5LA 1U9JA 2ZATA 1U3VA 4CMEA 4XQCA 1EUCA 3OQ1A 5T8KC 4WKGA 5JAMA 5TF4A 2GD1O 1DXYA 3FNHA 3QVXA 2O3QA 3TJRA 4BGVA 4BO6A 4GKVA 4IJUA 4XB1A 4I5FA 5TSDA 5KVQA 3LLVA 3RUHA 1KVUA 2YDYA 3TOXA 4AJ2A 1PS8A 3L9WA 4G65A 4YT4A 1PX0A 4CM4B 3G3EA 4KTVE 4GGPA 3GN2A 1EE9A 1LDGA 1I5RA 1RM5A 2VT2A 3M6IA 3VH4A 4BUCA 5FEUA 1EQUA 1ONNA 2GF2A 3AOEC 5DBGA 3PJEA 1C0PA 2X7HA 4NBWA 3TZKA 1JAXA 4Z3KA 1VJTA 4MKXA 4DYVA 4EBFA 3I4CA 1MGOA 5GY7A 3NTOA 4KWIA 3GR6A 3WYBA 3I9MA 1N9GA 5ITVA 1SNYA 5J23A 3WLFA 3K96A 4DL9A 4J43A 3IP3A 3Q3CA 4Z0TA 1YKFA 1UJMA 1IOLA 4WCFB 1R4MB 1XYGA 4GPD1 1ZSYA 3K5PA 2AEMA 2GLXA 2D2IA 3GZNB 1PSDA 3IJPA 4RGBA 3OJEA 3SXPA 4CUKA 4P38A 1B8VA 3BMQB 4N54A 3FD8A 3DMTC 5HS4A 1FMCA 4BNWA 4MINA 3RCBA 4RF3A 1GL3A 1VJ0A 1XQ1A 1ZK2A 4YR9A 3GMDA 2ZB3A 3GY0A 4L73A 4CL8A 3JQGB 5FYDA 1UDCA 1PGOA 3ZV6A 1O9BA 5IDYA 1BVRA 1R4NA 2BHLA 5JE8A 1NBOA 4DQVA 2DU8A 3ZHXA 1PJSA 2Q1TA 4W9NA 4YJDA 3X2FA 4PLFA 1RWBA 3ZU2A 2PZMA 3PIIA 1ZJZA 1NQTA 1VI2A 2UYYA 2WD7B 2YQ5A 3E9NA 3MEQA 3RROA 1UAYA 3C7DB 3S55A 1IULA 2O50A 4I9HA 3UICA 4CLRB 3CIFA 3LZ6A 4GQAA 2DBZA 1E92A 5T57A 1U28A 1UDAA 3JQCA 4DPKA 3WSVA 2PWZA 2WWRA 5EPOA 4AJPA 4XRGA 3WS7A 2CD9A 4JCOA 4CR7A 4OXYA 1XWFA 4O5OA 4MP8A 1OAAA 3RU7A 2EIHA 3HZZA 1E3JA 1PR9A 1HLDA 2UVDA 2DUUA 4HFJA 4MVJH 1E3EA 3GFBA 1OFGA 2PR2A 1FDSA 1E6WA 1HT0A 3N7UA 3PK0A 1DLJA 4FJ0A 4KUGA 3KETA 1PWZA 2GDZA 1DJQA 5JXWA 4R68A 5GZ6A 1ID1A 4B4VA 4HV4A 3ADOA 4QFDA 1NNUA 1O6ZA 2PH3A 3LF1A 3BMCB 1W8DA 4FR5A 1RYEA 2VUUA 2WDZA 2YQ4A 4JBGA 3UXYA 3W8DA 1MFZA 1A9YA 2QHXA 3ITDA 2DTXA 4P4NA 1Z82A 4OIMA 2WM3A 4CODB 3HN7A 1HSOA 3GHHA 3DWFA 3QWFA 1IZ9A 4AJHA 3OIGA 2HLPA 2BLLA 3EHEA 3Q2KA 4Y8VA 3GEMA 5KJFA 1Q0LA 2FOIA 5CEJA 3AJRA 2O7SA 3O4RA 3W4JA 1FDTA 2O4CA 4AVYA 3BHMA 4J4BA 4L75A 2R00C 1UP7A 3GAZA 3I9OA 5A4DA 5G0SA 1RYDA 3FRJA 4GVLA 3TWOA 5TT1A 4WECA 4YRAA 1EVJA 3GK3A 2NQ8A 1SZJG 3JYOA 1X0VA 4CLHA 1Y8QA 2QX7A 1DOHA 4H16A 1RM4A 3GMSA 4WLUA 3GLQA 3G1UA 1QV6A 4MDHA 5EJ2A 4RL6A 2VYNA 4E6PA 4LCEA 4RV9A 3H9EO 1T24A 3AW9A 5CEEA 2QYTA 4OQZA 4RPKA 4F46A 3K2EA 2B35A 3PJFA 3M2PA 3QVTA 3RVDA 1HE5A 3KOUA 4DIBA 2YUTA 4EJ0A 4KUEA 3K8ZA 4YEDA 4XJSA 2PKRA 4AJ4A 4EJMA 3WSWA 3RD5A 4OHUA 4CQMD 1DAPA 1W4ZA 2JAHA 3K73O 2J3JA 3TN7A 1WLYA 1NVTA 1LU9A 2E4AA 2YHIB 4LSMA 1U2DA 4YB8A 3I3OA 5T6BA 4XCVA 3GT0A 1MC5A 2VRCD 3FN4A 3OQ6A 3RI3A 1YQGA 5MGBA 3CEAA 2PLAA 3WIDA 1QLHA 4CR6A 3OJOA 1ISMA 3RBVA 4LRSB 3TZQA 4YDRA 4GX0A 4LGVA 3NKLA 2EG9A 3LC1O 4NJMB 2VWPA 5IN4A 1KIFA 5I8ZA 5TGDA 3ZU5A 2IXBA 1NPTO 5AXBA 1Y5RA 3WGHA 1I3KA 2OUIA 2Q45A 2X0JA 1G1AA 3AUSA 4ZD6A 4FB5A 1G0NA 4IBOA 3P7MA 5IG2A 3ZV4A 5EQFA 4RVFA 2DTEA 3T7EA 1FK8A 3DBHB 4ZRMA 1I8TA 3GFGA 4I5DA 1K6JA 2C5EA 3HN2A 3GZNA 2BI8A 3CUKA 2B36A 4U8GA 3RSHA 4C4OA 2NV6A 3D3EA 4CPDA 3VC7A 3MJ4A 5DBIA 5T8KA 4ILKA 3MJEA 1SEVA 1GPDG 5L3ZA 4L4RA 2W2KA 3ONFA 4OH1A 4J0FA 1Y9EA 2ZTLA 3W8FA 1VSUA 4RJTA 4XWYA 3H2SA 3KRTA 1B14A 2Q1UA 4I5GA 1K89A 3Q2IA 1JA9A 3OQBA 3DOOA 4PLHA 1KVRA 3INTA 2ZB7A 5JCJA 2Y1OA 1YVEI 4BGIA 3B1JA 4UUMA 3HFSA 4RDHA 5LDGA 1PS0A 1KYQA 1U8XX 1N1GA 2D59A 3K6JA 2WD7A 1DEHA 2Q99A 4MOWA 1H6BA 1BVUA 3PHJA 3GC6A 4I1IA 4CM1A 9LDBA 4RF4A 4YWJA 1H0KA 2X8LA 2VWHA 3MJCA 1QV7A 5ENVA 3K9QO 3PHGA 1ISGA 4JN6B 5TRTA 1P1HA 2PD3A 4CL3A 4GWGA 4J1QA 1NHGA 5CDSA 4Q3DA 4R1TA 3FNGA 3L4BC 2Y1GA 4E5NA 3F9IA 1GV0A 3MWEB 2D5AA 1EE2A 3DMTA 3VPXA 1I32A 4JQCA 4A2CA 1YQDA 2VYVD 4IINA 4UVDA 2CVOA 4S1VA 5JO9A 3ZHBA 1XIVA 1Y9AA 2V6FA 1PJBA 1Y5MA 3CTMA 3AU9A 1EFKA 4J9VA 3RC7A 3DMYA 3U9LA 3PTZA 4J9UE 3GEDA 4J7UA 1LC0A 1IY8A 1M67A 3H3FA 4UUNA 3PDJA 1OMOA 1SMKA 5L4SA 1QR6A 5JDIA 1E6UA 4NFYA 4XZ3A 3KEOA 3E9QA 3AY6A 3GQVA 4E2WA 4B8WA 1YGYA 3QP9A 4GAEA 4BNXA 4JROA 2A4KA 1UXKA 1OI7A 4YCAA 4O0LA 3VHRA 4GLOA 1LEHA 3T4EA 3MTJA 2HAEA 2EGGA 3VKVA 5ES3A 5CDGA 1SB9A 4FPXA 4B4UA 4WEQA 3OETA 5KOIA 4Y6SA 4R54A 5IJZA 1Q7BA 5COAA 5IN5A 2WJPA 3ZWCA 2H1SA 5A9SB 2IZ0A 4BB5A 4BNTA 3RBXA 2Y05A 2Q3EA 2ZYDA 1P45A 3UOGA 5ADHA 4R1NA 3WJAA 1C1XA 1D3AA 1I3NA 3NT5A 4KDEA 2HJSA 3Q1LA 5F1OA 5KTKA 2DTDA 3QWAA 3SVTA 5AOVA 3ZNPA 1KEVA 5B4TA 4WLOA 1HDCA 1D1TA 2YV1A 5B4VA 4OKIA 2BFAA 4YA6A 3JYQA 5ILGA 1L7EA 1U4SA 4WASA 1QYWA 2PNFA 1M76A 2OL4A 3EZLA 3E9MA 1ZVMA 1YO6A 2PGLA 1Q0QA 1GPJA 2B69A 4ZHSA 3I6QA 1JTVA 4DVJA 1R6DA 2HDHA 1J4AA 4IJKA 3RQSA 3H5RA 2G82A 4BMNA 3UUWA 2G0TA 2NU7A 1HL3A 1QYVA 1SPXA 1TVEA 2JCXA 3NEPX 4II2A 4A10A 3M2TA 1ZSNA 4ZQHA 5JSFA 1E3WA 3QE3A 4PG5A 4TROA 4YT5A 1EUDA 3KLPX 4IDAA 1NWHA 3DBVO 4ND2A 3TQHA 3VKUA 4A27A 2VUSA 4IDGA 3ZGYA 2IZZA 3NAQA 1NFQA 1YQXA 1T2DA 3DBHA 2NACA 4NBTA 5B1YA 4ND1A 3C1TA 3EVTA 3OM9A 4O6VA 1NQAO 5EMHA 2AEJA 3HB5X 5C3MA 3SC6A 1DAOA 8LDHA 5BNTA 2EP7A 1JKJA 5L7WA 3DC2A 1ML3A 3NUGA 2A94A 2IYOA 1M6HA 4PVDA 4EGFA 3ZWNA 3GUCA 3S2EA 3BHIA 3K2BA 3R1IA 3SX2A 3EZYA 3AOGA 4N5NA 1Y6JA 3KUXA 1QMGA 3EMKA 4Z0PA 4OAQA 5DT9A 4CMGA 2G17A 5I9LA 3OA0A 2PA3A 1ZH8A 3EYWA 1ZSVA 4JK3A 1AGNA 3WFIA 4D41A 4NH4A 5IDXA 4IZHA 4TZTA 2X1HA 1C1DB 2VHWA 2NTNA 3FWNA 5L95A 2C07A 4J3FA 4ZQFA 2BKAA 4GLLA 1KEWA 1VM6A 2B0JA 3MCVA 4FGSA 4BKUA 5KVCA 3ZWPA 5KVSA 4NHEA 5B4UA 1SC6A 2WYWA 1JQBA 4HFRA 3SC4A 4EZBA 3LT2A 3JD3A 2NU6A 2PKQO 3DZKA 4R01A 3RKUA 5JC1A 1UZMA 4YAJA 1ADGA 1P74A 4OMUA 4E5KA 3KV3O 3O03A 2X9GA 1P0CA 7MDHA 4PRLA 2VHYA 4TZKA 3H4VA 1YDEA 4AJNA 4NJOA 4ZA2A 4XQ9A 2BELA 2IRWA 1DC4A 5EN4A 1MV8A 2O3TA 4FGWA 4Z9FA 4AL4A 2J8ZA 1MP0A 1HZZA 1NP3A 3C7AA 4WE3A 4WPGA 3TNLA 3ZU3A 4HY3A 4FD3A 2Z1NA 2I65A 3F5QA 3WQSB 2OP1A 3B6ZA 3FPLA 1M66A 5H81A 4IQ0A 1TXGA 1ZFNA 1UH5A 2X5OA 4MVJD 4BO1A 1NVMB 2BI7A 2Q2WA 3UCEA 5C37A 4I5EA 4XDZA 2O4UX 1EZ4A 2WYVA 4IXWA 3PFFA 4Q3BA 1VL8A 3O8QA 4BMVA 3GPDG 1HE2A 1N5DA 4GWKA 3AY7A 3ZH2A 5K6AC 4XQGA 1FF9A 3C1AA 1YRLA 3LF2A 2RIRA 4D45A 1PTJA 2HUNA 2B4QA 3DZBA 4FOOA 1MLDA 2EF1A 4GSLA 2VQ3A 4U7WA 4E12A 4E5PA 3WNQA 3MOIA 3PJDA 1PU2A 4PLGA 1PZHA 4A0SA 1H5QA 1ISJA 2CUKA 2YHUA 3RFTA 3BA1A 2XF8A 3GNTA 3L4BA 4E4YA 5IZ4A 4GL4A 4ROSA 3JSAA 1KY4A 4W6ZA 4TRJA 5AXAA 4DMLA 4Y98A 2FR8A 1WPQA 5LC1A 4ZICA 1TA4A 3D4NA 4Z0HO 2UV8A 4NI5A 5DDIP 3OECA 1GFSA 3KYCA 3GVPA 5LDHA 2VZ0A 1TI7A 4WLEA 3WNVA 4L4XA 4O63O 5A9SA 1FXSA 2G1UA 4M1QA 3JQAA 4L74A 3RC9A 4YXFA 1DLIA 1E3SA 2GZ2A 2Y67A 4NNJA 5F21A 1VC2A 1I3MA 2FZEA 4J7XA 1E1KA 3FTNA 3ENKA 1YB5A 3T4XA 2VZ8A 2PY6A 2C0CA 5FI3A 1WDMA 3PLNA 4R1UA 1GD1O 4J0EA 1VLLA 3ROMA 3FBGA 4N7RA 3AK4A 2EEZA 4E32A 2XAAA 4JJIA 3LT4A 2P5UA 2BFPA 1YONA 1EK6A 3L77A 3E1KA 3EK2A 4PZCA 1LSUA 3C3XA 2DLDA 4IDFA 5DNAA 1CF2O 1E3IA 2NADA 4YQYA 1SOVA 5JO0A 3HB4X 3LYLA 5TC4A 1KETA 1D7OA 3KBOA 3NRCA 2BRUA 1HXHA 1LSJA 2UUPA 1A5ZA 3HADA 2C59A 4JNKA 4M49A 1GAEO 2W98A 1BGVA 2FZWA 3LDHA 1HF3A 1IB6A 1H9AA 1HRDA 3WYEA 5G0UA 3KEQA 1UXIA 4GSKA 1NR7A 1QP8A 1ENZA 5ILOA 4F6CA 4LVCA 1AN9A 4PLTA 4E30A 4P8RA 3DAFA 1SB8A 4QECA 2B83A 4RO0A 1NX6A 4QTZA 3ST7A 5BSEA 1ZEJA 4U0JA 3DBRA 4WCFC 3AM5A 4F45A 1C0KA 4OOEA 2CZCA 1QKIA 3DQPA 4RVHA 4DBZA 2XOXA 5A05A 1OZAA 1U3TA 1BRMA 1C14A 4IGEA 1XCBA 4UAGA 1RM0A 3DAGA 3SEFA 5TJ9A 3VZRA 5AQ1A 3OJ0A 3ZU4A 1JU9A 3I9NA 4A26A 4PLWA 1C0IA 1A9ZA 1GYRA 3GG9A 3MJTA 4D46A 2B5VA 3BTUA 3S2GA 1Z7EA 5DF1A 3ROPA 2OMEA 3JQ9C 5AYVA 2EERA 3MTGA 2VOJA 2Z95A 1LXCA 1F06A 3TFOA 3CZRA 3UCFA 1BW9B 2W2LA 4JJGA 3IUPA 2GYYA 5G0TA 3GRPA 9LDTA 4PLVA 4ESOA 5JMWA 3BMNB 3TZHA 1WDKA 2Y1FA 3BMOB 1D4FA 4J2OA 5IFLA 4FDAA 5FI5A 4LISA 4TRRA 1ZUD1 2OORA 4NMHA 4CM3A 2IYPA 4IDDA 3OF2A 3PQEA 3KM0A 4LK3A 1EVIA 1JVBA 1GZ6A 4IJWA 4D3FA 2JD0A 4XYEA 1ZK1A 2C7GA 2JFFA 2EW8A 2VOEA 4NFSA 3KSZO 5TJHA 1GYQA 4E33A 3EUWA 4FC7A 4HP8A 3G79A 3PWKA 4ZJUA 5JYDA 5K9ZA 3KXDA 3LC7O 3WTCA 1ULUA 3L9XA 4YAGA 4HFMA 4M89A 2VZ9A 4UUPA 4WOKA 1HDOA 1WVGA 3INRA 4C7KA 3G17A 4J1SA 2AEFA 5FF9A 3K31A 5G4KA 2GUGA 1NYTA 1SBYA 1XLTA 5DN9A 1PQPA 1B8PA 1KC1A 1DC6A 5JC8A 4RCVA 3RC1A 4MVJE 2AQKA 1QYXA 1ZK4A 3JYLA 1ISHA 4CMKA 2O3UA 3ROQA 1E7YA 4IPTA 2P9CA 5F5NA 3ULKA 5TIIA 4Z9YA 4BNZA 4QSMA 4H7PA 5HA5A 2WE7A 4LN1A 4J49A 2VYND 1I0ZA 5IZCA 4EYEA 3VAZA 1P31A 4M87A 4CMIB 3L0DA 2C2YA 2GR9A 3DBLB 1HETA 1Y1PA 4L0QA 5GMOA 4CQMB 2GRAA 4CV2A 5JPIA 1LBEA 1GZ3A 2Y1EA 3AFNA 1T25A 1I2BA 4XIYA 3TFQA 4EW6A 3P19A 2RHRA 1LQTA 1BXKA 3ZDFA 2X86A 1YL5A 3ETEA 5JCXA 3GVHA 4JJFA 2JJYA 3GHYA 1Z45A 3UN1A 5A9TA 3WDSA 3A9WA 1H6AA 2VNSA 3H5NA 5A5EA 1Y7TA 2PV7A 1BXGA 1LA2A 4RZIA 4TQGA 1W0CA 3PYLA 3DZGA 2Y1CA 3LT1A 4PCVA 4PZDA 4OGWA 3PHHA 2PGDA 4RPHA 3TZ6A 4BO5A 4C7JA 3VPGA 2FMUA 4KOAA 3ONDA 2O7QA 1YB4A 3OJFA 3UHAA 3VZPA 3ZWMA 1DJNA 3GRKA 3L6DA 2EV9A 3PFWO 3PWZA 3R3SA 1PGPA 1A7KA 3I9KA 2ZJ1A 4CM8B 1M75A 1JKIA 1EEHA 5H83A 5THKA 2YV3A 5C7IO 1I36A 2RHCA 4N5MA 1OOEA 4CLOB 5DZSA 4YAKA 3HE3A 1LRLA 2I76A 1HYGA 1ORRA 3EC7A 1K0UA 2CDBA 4UVGA 3IMFA 5I9MA 2QQ5A 2I6TA 1HDZA 4D3SA 3C1OA 3E5MA 4PG8A 1YOVB 1PJCA 1GTMA 2JCYA 3U09A 1S6YA 1DFGA 1TT5A 1ADFA 4UEJA 2OZPA 3C24A 3DFZA 1ADCA 3A06A 4GMGA 4I9UA 2CDAA 1B8UA 1LDBA 2VHVA 5JBIA 5KJCA 4WOJA 2J3KA 3WB9A 5IDWA 2WEKA 3ICPA 3IL2A 2W4QA 3AI1A 1T4DA 2PH5A 1CQIA 4XYMA 2AE2A 3TPCA 1IHYA 4IIUA 2ZIZA 2JFGA 5JCJD 2NWQA 5K0ZA 3P5SA 1P33A 4Y6PA 3TOZA 3ONEA 1O0SA 3ASVA 1WP4A 1Y81A 2VTDA 3V1TC 2GSDA 1XELA 4XGIA 4CM4A 3PPIA 3ANNA 4YAEA 3HHPA 3FNEA 2RH4A 2DPGA 5T64A 4DLBA 1OC2A 4XJTA 3DO5A 1HDYA 2Q1SA 4TRMA 3WGGA 5G2OA 4NK4A 3IOYA 1B26A 3Q6IA 4DYDA 4R9SA 5L40A 4RPJA 4BB6A 3S2IA 3BMOA 3GDGA 4FC6A 4W99A 3UH1A 3PWSA 3ICCA 2P9GA 3MZ0A 4QFCA 4ALLA 5A06A 5CP8A 1YBMA 2OFPA 3DFUA 3HG7A 2V6BA 1LRKA 4AJOA 4WCFA 1E7SA 1R4MA 4J1NA 3SLKA 4FSHA 4FW8A 2O48X 1V8BA 1ENYA 1DIBA 4NQZA 1M2WA 3FR7A 3H8VA 3I83A 4HFNA 3BMQA 2FHSA 3TL3A 3G1TA 2AA3A 1OBFO 1UDBA 4K26A 2CY0A 3NJ4A 2D5CA 4DIFA 3HUDA 1E7WA 3D0OA 2W8ZA 5DOZA 2F00A 3JQGA 3A14A 2Y68A 3QWIA 1HYHA 1KVSA 3BTVA 3BYZA 2J5RA 2X0NA 3E48A 3IAHA 3WTBA 1HEUA 2UDPA 1ONPA 1DB3A 2F1KA 2J6IA 3AOEA 3KYBA 4CMAA 3DHYA 1Q7CA 4F6LA 3VH3A 1E5LA 2LDBA 3WGTA 1KERA 2CDCA 1CERA 4MO2A 3GNSA 1ADBA 1B0AA 1UUFA 3RJ9A 4AFNA 3GZ4A 4CLRA 2Y0DA 3GOHA 3BIOA 4U0KA 1B16A 1FDWA 3RUDA 4R9RA 4MKRA 5MDHA 2QRKA 4DTIA 1UP6A 2WTBA 3PVZA 5EINA 5JDCC 3R0IA 3HQ4O 3RUIA 2EKQA 2ZJ0A 3BXXA 1WMBA 3E8XA 2HK8A 4FFMA 4CMIA 3W4IA 5ICSA 1V9LA 2CF6A 3WOHA 4YQZA 3RC2A 2P68A 2PTGA 3I5MA 3QWHA 4MIEA 5CDUA 4GVXA 4IM7A 1PJ4A 3JQ7B 3U5TA 3AY3A 5DBFA 4R1SA 4J7CA 3WLEA 2I66A 3KVOA 3DTTA 1XA0A 2TMGA 4BNFA 3WQRA 4H3VA 1K5HA 3BMCA 1GCOA 2V6MA 4M8SA 5DCUA 1NAHA 3QW2A 4AJJA 4AJLA 1O89A 1ENOA 3QSGA 4H15A 2CVQA 1LQUA 4B3IA 4B4WA 5IXSA 1PZGA 5BSFA 1GQ2A 3PIDA 2WE8A 1U1IA 3N58A 4DREA 2O3RA 4OXKA 4KMSA 1X7GA 3I23A 1EK5A 1ULSA 5EESA 4CLEA 4BO4A 2HSDA 4XA8A 4OYRA 2E82A 4AJKA 5A03A 3PZRA 4IQ8A 4XB2A 1QRRA 4PLCA 4OJNA 1GV1A 3ZV3A 3R6DA 1WDLA 2V65A 4PG7A 5KJEA 2J5KA 1PR3A 5B37A 3WMWA 4Y9DA 4WEOA 1DRVA 1T4BA 2O3JA 1CWUA 2EJWA 3JQFC 1XGKA 2W90A 5DCYA 4OL9A 2C20A 4QXMA 2HO5A 1E5QA 2QRLA 1YL7A 1GY8A 3PZBA 1KEPA 1E7RA 1Z7BA 3D5TA 3ROKA 2B5WA 5I7SA 3LQFA 3O38A 3F1KA 4B79A 1E77A 2FR1A 1MUUA 5A3JA 2AMFA 3WIEA 4E2ZA 1D8AA 1NR1A 1ZXBA 1WW8A 3QA9A 4TRNA 4DUPA 1O95A 3WGQA 1B2LA 2UUOA 2YHIA 3GGGA 3IDSA 3ZWOA 4BNMA 4B8ZA 4YJFB 1WMAA 2DFVA 1CDOA 2R00A 4HNHA 4RORA 3DHEA 4I9NA 3A1NA 1EDOA 1X1TA 4RLSA 5KIAA 1LSOA 2OO5A 2ZCVA 3LLSA 1DC3A 1HKUA 2GN8A 4NJMA 1TT7A 3DZJA 4B4OA 1E1NA 3OP4A 4JBHA 4K9DA 4NU5A 1N1EA 4CM9D 4ZQEA 1FDUA 2C5AA 4CQLB 2XXJA 4LRTB 3G49A 3U4IA 2HMUA 1P3DA 4G81A 1GADO 2GZ3A 3H9JA
chains in the Genus database with same CATH superfamily
5KWIA 2I6XA 1UMCA 1B4DA 4QT0A 2OEPA 4YRDA 1PJAA 3MGCA 1MO6A 4QUAA 3ZWXA 4X8OA 2G06A 1VRVA 1W2HA 5E4FA 3M6XA 3W3AH 3WYCA 1EJ2A 1PK7A 4JKYA 5AVQA 5L4NA 1C30B 4KUHA 1CY0A 5JVDF 4MPRA 1MDBA 3L7YA 4MULA 4EABA 5AW6A 3NHSA 2AQHA 2ETXA 2FPPB 2RKOA 3AB7A 3NFRA 1WX1A 1WU7A 4K81B 4YJ2F 4KE7A 3EEFA 3BQ9A 3KQHA 1N33B 3LXXA 1OLOA 1T1RA 2YH2A 1O87A 2CLLB 4R1OA 4GX5A 5HM8A 3CLTC 4B6SA 5ELXA 1EX6A 4HDNA 3BEDA 4S2UA 1U90A 5K0JA 1SY7A 1C1YA 1CU1A 1N4DA 1YCGA 1UBCA 1WUJS 1BCRA 2QORA 3HJAA 2AJDA 1N7GA 3EUAA 5JY6A 1X7HA 1PS9A 5IM5A 2VDRB 5DNCA 1ZMOA 5G0VA 2WD9A 3CF0A 2NU9B 3P4YA 1T5OA 3ZGVA 5ENDA 4IP0A 3EARA 3SM9A 1JHPA 4O2RA 4BWYA 4PTLA 1AT1A 3D6NB 5KU1A 5EHIA 1KDPA 1L7DA 4NZZA 1P0QA 5KTPA 3C15C 4MVJI 4YBZA 5DISB 2PS1A 5AJHA 3EQZA 2QTWB 5C8VA 4UFOA 4MA4A 1DT3A 3WL5A 4XIFA 1M54A 1FEZA 2NXNA 3AWIA 3QKIA 4CV0A 3P2KA 1R16A 2P8JA 2VDNB 4JB8A 3FCAA 421PA 1LSSA 4H7JA 3GJSA 4ZGWA 3PRHA 5JPDA 4QGBA 4M1WA 1O77A 3KFVA 4JLWA 2QBYA 1E8MA 2RAFA 2QNIA 4MUMA 2XMSA 1L5KA 5FBRB 1ZRMA 4WOPA 2VLIA 3PQ8A 5FUWA 2CSUA 1STOA 3JQAD 2RHWA 1SZDA 1H9BA 3PNLA 1RMQA 1DQZA 3RWMB 1RAFA 4PRKA 3AF0A 4ZCMA 1RMYA 4PGMA 3ZVRA 3KHUA 5LKRA 3NM4A 1PJRA 2BW0A 1HMYA 4X64B 4HQLA 4GI2A 4MQ4A 4IS3A 4QASA 1D6JA 3QIAA 4CTNA 2Q0SA 3DE0X 1L7PA 2P2LA 3P2YA 5EKUA 5HIMA 2GF9A 4FYVA 3OT1B 1DRKA 3NETA 4L8YA 4PSCA 1ES9A 3QLJA 3KQUA 1BRTA 1Q1AA 4NU0A 1W5FA 1G59A 3TKAA 1NQVA 1HMPA 2JLSA 3TW8A 3IUBA 3UA3A 3OZBA 1IUKA 2PXAA 4NEHB 1C7FA 2X8JA 3H97A 3PPYA 1U0OC 5ED0A 3SVZA 3KR0A 2WU4A 3G0IA 4HS4A 4JYCA 5TEVA 4AMUA 1SN7A 5ECWA 1RPZA 1A9RA 1JSZA 1IUNA 2IOYA 4PYQA 3E7FA 4PBRA 1Y33E 1Q1BA 2ZYAA 1DRUA 2PRYA 1Q6ZA 2YFHA 4MGYR 3HC7A 3SGLA 2VJKA 5C34B 4DN6A 4TYNA 3PPWA 2JLYA 1OBVA 1RFLA 1S1MA 1D2EA 1CNMA 4YT8A 2CXHA 4P7GA 3TPFA 3L0PA 1MQ8B 1T6NA 1UK7A 3JQBC 1R4NB 1PFGA 2J3EA 2Z6VA 1WWKA 3TTSA 3JV7A 3QWBA 3OCCA 3EW7A 1PGNA 1NM5A 4EGSA 4LJSA 1N2XA 2X22A 2IYFA 5CFNA 2ORWA 4GSYA 3FIJA 5E9JA 4ALKA 1KMQA 1WCXA 1S3IA 4FILA 3IS3A 2UZ0A 3EC2A 4M1OA 4FE4A 4DNOA 2G7ZA 4FWBA 1HKHA 2I8LA 1BH6A 2ZVDA 3HN6A 3L0CA 4TS4A 1DUSA 4G23A 4OO3A 1X7ZB 2I55A 4N4AA 4U1RA 3TB6A 5IW8A 2QU8A 3VVBA 4C3OB 1OH8A 1HDGO 4NV1A 2I2XB 1FMTA 1OX4A 4IGKA 2FA9A 3SXUB 1YZKA 3O0TA 3PNKA 4BRWA 2Q6VA 4DLPA 3I2KA 4E3ZA 2RGWA 4KR6A 3MD0A 4FX2A 2O5CA 2EWMA 1C8KA 2B2XA 2AUNA 2E1PA 2IYNA 5BOVA 2I3BA 2JHFA 3UMSA 4JWTA 3L7BA 3IELA 4P08A 2FPSA 4JDPA 4PZUA 2XZPA 2ZSAA 3VHLB 1E1MA 2HV8A 1AKMA 5GM1A 1UKBA 1W1WA 2AMLA 2FMHA 2K87A 2ZRPA 4PAWA 1EXMA 2OHGA 3G7UA 1JH9A 2A7XA 4TVKA 3AUFA 3V2GA 1A76A 1NFFA 2NM0A 4ZXFA 5LOVB 2JBWA 2NYAA 2LCQA 1AXGA 3D0KA 1GZ4A 3KUKA 3MG9A 4LX0A 4BO3A 5IN4A 1T5SA 3F9CA 5EEHA 5HWSA 3SDZA 1VGRA 1GN9A 4ZREA 4QOJA 1YH3A 3GLKA 4P0TA 4N41A 2YCBA 1GU7A 5H7XA 3S7ZA 1XDZA 1CZLA 4KN9S 3IUSA 2P2SA 1R0LA 3OM8A 5LXTB 4PRZA 5AVXA 2OENG 3AM3A 4RSRA 1VSBA 5CLFA 3AHCA 4GHWA 5CVVA 3CVOA 5DN6D 1OA0A 2JCSA 2Q6OA 3ANTA 5KSWB 5C8YB 1EDZA 3PCTA 2FQWA 1K63A 4MTLA 2LKCA 5HCUA 2BCEA 1TCAA 3RVBA 3K35A 2O2IA 1DO0A 3RW9A 2RHLA 1RJFA 1NXQA 4FDUA 2ST1A 4G85A 2F8TA 2VDVE 4G1FA 4JL8A 5AOBA 3ZNNA 1T4CB 3D4IA 1W9HA 3IVXA 2JK0A 1W0KA 2Z8ZA 4IL5A 1PYDA 1FDIA 4B9EA 1NXWA 3BXOA 5KOHB 2QVCA 3CMCO 2B1IA 4E2XA 1BROA 5A5FA 3FKSD 2QG4A 2X4GA 3KZVA 1KAQA 4IXMA 2HIGA 3A4VA 2C4MA 4S05A 4R8SA 5IDQA 3NV9A 2WJWA 1L9XA 3WX0A 2VKTA 1Z4OA 4PX2A 4ZTBA 4PAGA 4PZPA 3V2UA 4K7JA 2O6LA 1E2BA 3CX7A 3KDAA 4G9BA 4G01B 2HC9A 2VVTA 3NIWA 4O8CA 3CZCA 2LKDA 4ID3A 1GGNA 3WL4A 2BI4A 4JYMA 1JDJA 3WXMA 1TMYA 3QEJA 4YJHA 1F6WA 5DOVA 3VJKA 4OQDA 1C1DA 1M6WA 1Z6AA 2WU8A 3STHA 4A4DA 4EFNA 2H0RA 1QIFA 4MGZR 4U6SA 4OLBA 1GSAA 2P62A 1JN0A 1Y8RA 2CE2X 3H1TA 1WL8A 3VQTA 1GL9B 1ZJYA 4MAFA 2XB9A 4QT4A 3NC4A 2XZTA 2BM0A 2BMFA 2H18A 2P5TB 2XOEA 2ZIAA 2AUTA 4D4GA 1EK2A 3OH8A 4Q4LA 5KSPA 2ZTUA 2WUEA 1L5ZA 1XF9A 4PFKA 3TUJC 3WGIA 2LE0A 4FFOA 3T1NA 1L5RA 4LXQA 1CPYA 4JL6A 4FEYA 2J3IA 1TM3E 3TLCA 4E2YA 5JJKA 3E9YA 3EIOA 3DL4A 4RK1A 5IXYA 1CZHA 1QIDA 2WIGA 4WNCA 1I9CA 2ZTHA 4L8VA 3RBZA 3HXMA 1VXRA 3IDZA 1Z26A 2XQJA 3QUAA 4HADA 4J4HA 4URYR 1W9MA 2BUBA 5AVJA 3TI7A 5JXHA 2NOAA 2YJZA 1WXDA 2QRJA 5K45A 4B7CA 3V4PB 5TMBA 1VLVA 1E60A 1HNZB 2G1PA 1RWKA 3NIFB 1YIOA 1M6NA 1OU0A 3TLGB 3ZGOA 3ZLVA 4EUEA 4ONEA 2IP4A 2WWIA 1YZTA 3GLVA 1X13A 1Q0TA 4KO8A 1IOVA 3WK5A 3PUKA 4A91A 1ZY2A 2XNCA 5IC6A 3UHFA 2JFQA 3DB1A 3NPAA 2PT6A 1IM8A 2HMWA 3SZRA 3V97A 1GPWB 4KMRA 1U3WA 2DBYA 3KAKA 3AU8A 3OQIA 4LWQA 1RVV1 5KDLA 4PC6A 3UBTA 2H7YA 2HI0A 1W0JA 1FYVA 4QC2A 1WOMA 1BWSA 1KQ3A 1DAEA 4LXXA 3V8BA 1NY5A 5JYEA 5J1SB 2JLWA 5SICE 2EKPA 4LTMA 2CNBA 4KC0A 3AINA 3FBTA 1KIMA 2Z5LA 1ZNZA 1QFMA 2W2KB 1ZD5A 5SZKB 2MINB 2FN7A 2G5CA 2PAFA 2OK7A 4MW5A 5F7OA 1M33A 1SZPA 4XWOA 2QB5A 4DUGA 4X6YA 4O4IA 5DYNA 1TQ4A 4HN4B 4Q7QA 2Z3ZA 3W79A 1NBWB 4BO8A 1A97A 1QFJA 4F5ZA 4B71A 4IFIA 1MC1A 2B7BA 1DG3A 4X6XA 2C5GA 4UXIA 1KSGA 3ADDA 3SEQA 3BFXA 4G09A 1IEVA 1OWNA 2HREA 2GNOA 1QNLA 1ZNYA 4RDCA 1UPBA 2IYQA 1M2NA 3BSWA 2DC1A 4U6NA 1JH8A 3X1DA 1AMNA 1UFOA 2C2GA 3AGQA 3FWYA 5LNK1 4OYLA 1H3FA 3H0KA 1BOFA 2F9MA 4DLYA 4L9SA 1JPNA 4I1PA 3OUTA 2JEOA 5ALNA 5DTEA 3RFVA 2Y6VA 5KTRA 3EA5A 2LBPA 1PT7A 1YASA 2X1LA 4MWSA 4RF5A 2AKEA 4X20A 5BQPA 1SU4A 3RGGA 3TG8A 1O58A 1MG5A 2ZOSA 3LKZA 3PHIA 1VG0B 3MQ4A 3CO0S 3UT5A 3II6X 3GL9A 4RLQA 1IWPB 3ND8A 2EKZA 2JDIA 3U3OA 3PLRA 1F8GA 1JJIA 3TBKA 3ZZNA 3ZKWA 3CBGA 3WWDA 2J0QA 2OY0A 3UAGA 1FNMA 2WA1A 5K6AA 2IEDA 3OPMA 1G19A 4TLDA 3K0CC 2Z1MA 1HDXA 1DBVO 1N2JA 4MUIA 1X1SA 1C3VA 1Z2NX 4G0ZA 2BE9A 4K1XA 3JVVA 4LGCA 3TGWA 4NG5A 3HTXA 1Z3CA 2RSLA 3R3XA 3FJYA 3HEMA 1RI3A 4MV8A 1DHTA 3ZUPA 6ADHA 2WVGA 5ELLA 4D99A 1L1FA 1W96A 3D5QA 3MJDA 5CHEA 1O9GA 1K7XB 2NTVA 1UT6A 3V5NA 2R7LA 3QI2A 1IATA 1RCTE 2ZQ5A 1QIJA 3JQBA 3PXUA 4HWRA 1M8KA 3NM5A 3T1OA 2GAFA 2PD4A 1JBKA 5SZHB 3DHNA 1XSEA 2ERYA 4NZYA 3R7FA 4DLKA 2NLOA 4E94A 1NHWA 3BJEA 3RUPA 3S2ZA 2AQ8A 3H13A 2V7PA 2O7VA 5JNUA 2H4YA 3CT4A 1GEEA 3WKCA 2HN9A 4BVEA 1VI6A 1N25A 5FUBA 3RH0A 2OVBA 1IZZA 2KMLA 1QX3A 2R7NA 3DCYA 3L8HA 4JA0A 4BE4A 4S04A 4RF2A 4ZKDA 1JFRA 3R4CA 3D3WA 3TBFA 3AT1A 2HMYB 4RZ2A 1IM5A 2OBNA 3DFIA 3AV3A 5EQDA 1KWGA 3K1AB 1YB6A 1HDIA 3EQ7A 3PF8A 4MPJA 4BU1A 5AKKA 1MJNA 3R7WB 4WBNF 1HX7A 1AKTA 1NQ5A 1NZFA 1I2MA 3DZIA 4HWGA 2QTTA 3B1FA 3C39A 1NWCA 3U2QA 2JK1A 4I1YA 1KZYC 4DBLC 1GVHA 4GRDA 3STUA 3O3OB 2I34A 1I2ZA 1KTIA 4PGFA 5IF3A 4LHXA 4D8WA 4FFNA 2ZYIA 4QJ4A 1UFKA 4LRYA 5BQFA 3B38A 3RQIA 3TLAA 3ZWAA 2SKCA 2VHZA 4CE6A 3ZPXA 3DKIA 5KVVA 4IIJF 1E1CB 2LV8A 2PSJA 3OEED 4MZXA 3NT4A 4RZ3A 5TVGA 3UOWA 2ZCUA 1UMDA 2NU8B 3DTVB 4NFLA 3U0BA 1A2OA 4TKLA 5EL0A 3KR9A 3TG2A 1Q1EA 1COWA 4E0BA 4LBZA 2ENWA 1A98A 2VXBA 5DGTA 4ZVUA 2ZTMA 3JD1A 2IHZA 2QUBA 3QEMA 2P1DA 4IH9A 2JJ8A 2HIMA 2BSXA 3MOSA 2I22A 4Q9KA 1NKTA 2QXTA 3KAPA 4RMJA 1Y0BA 4GR5A 1G5QA 3PDCA 3LP5A 4MYTA 4V2UA 2ATCA 5DWDA 5EP2A 1GUYA 2EHDA 5C3UA 3ZI7A 4BS9A 3O8DA 4H0CA 1M73E 1O6GA 3Q9NA 3TCNA 2HW8A 4O2LA 3W77A 1QYCA 1C7ZA 3QKRA 1Q6YA 4HB2A 5DX1A 3KQOA 4J76A 4YWHA 3E05A 4MR9B 1W73A 5CYPA 3LGSA 1LBHA 2QR2A 4R6WA 4F21A 1U8CB 4UTRA 1NT4A 4AF8A 3QFTA 2FPWA 2NAFA 4BQFA 3OE7A 4Q7LA 4EO4A 5JZMA 4C2BA 4GKJB 4INAA 3WYDA 1G4AE 3H5VA 1AGXA 2G5PA 1R0ZA 4G0WA 1I33A 3PYMA 3PGVA 3O26A 3UKDA 4BNLA 4PHHA 1PJLA 4BNJA 4GL2A 2HY7A 1EUYA 4Q93A 1X7YB 3UV7A 3FH0A 1NBEA 2PDAA 2BP7B 2C54A 1MKYA 1QYRA 4A73A 3GWGA 1UFQA 1XZPA 3GDFA 3HHEA 2Q1XA 3VSBA 4XWWA 2EXXA 3GLHB 3QUBA 1TLTA 2HRBA 2IYVA 4U7JA 1KP9A 3O1HB 4UUOA 5LP1A 3MELA 5F3RA 3UC5A 2AR0A 1D9XA 2VJCA 2ODWA 4PPFA 4IDBA 1VHTA 3I12A 4DPMA 1U80A 4W7IA 5EIOA 4Z2YA 2JD1A 2O0HA 4BDTA 3BRSA 3HABA 3OA2A 1GLGA 1PQWA 1WE2A 2CDNA 3PT9A 4I3FA 4OLAA 5FUXA 3VC3A 3ZTTA 5C7YA 2EZTA 4P4LA 3UJ7A 5KNLA 4L57A 4FKMA 3PR3A 3PXXA 1M2OA 3AMVA 1BDHA 4N5IX 1U2TA 2WJZB 4YJGB 2CV1A 2QJFA 2PV0A 3KKOA 3R0QA 3SMQA 2VBCA 5GJWC 3DMPA 4XYGA 5BQ5A 1URPA 1YJXA 2FTKE 2J5QA 4ZVOA 2ZDHA 2JIDA 3NDJA 3C7CB 3NASA 5IX8A 4QVIA 2C7OA 1E5VA 4II3A 2C3OA 3FTQA 2QX4A 4TMKA 1A88A 4BAUA 1MPTA 4ND5A 1GDDA 4NOJA 1USKA 1BDMA 4OU5A 4TKUA 1R15A 2X0DA 2AI3A 3IJ5A 3N9IA 2NXEA 3TDKA 1Z5WA 1US8A 3EEQA 2XYRA 3DCJA 3FWHA 3OFJA 3P2EA 3VBEA 3QYPA 3ZXXA 3MINB 1I30A 3WWYA 5ALJA 4L0DA 2XD4A 4R16A 1W1IA 2XZDA 2V45A 4A6DA 3IIMA 3PSAA 3FVRA 4RSMA 1UQUA 2A0WA 4ZC1A 3HCFA 4DIOA 1YBFA 3G68A 3I62A 1E2IA 4HB3A 5J5CA 3OLCX 2VDJA 3HWRA 4W6QA 1AZWA 3K4HA 2XVAA 5DTMA 3S1AB 3E35A 2YY5A 2K2QB 2O1XA 5CGZA 4B33A 1UEIA 3ADCA 5EY5B 1BU8A 4UJ5A 3WGZA 4BNYA 4CKCA 5DGXA 4BLTA 2VNJA 1G3QA 1WVIA 4QAQA 2H3HA 3MJSA 4GW3A 3U61B 4XGNA 2HRDA 1G3UA 2FJPA 2J41A 3FI9A 3R41A 4GNKA 4XDYA 2NVBA 2BKLA 3HA7A 3ICQB 3D3JA 1LJ8A 1J5XA 3CGWA 3Q41A 3SJZA 3DR5A 3LSYA 5IUJC 4KGDA 4CG3A 2VHXA 3OIFA 1R66A 1XAIA 2IDMA 4PQRA 5DW3A 5ULLA 4GP6A 4CLOA 4YHHB 3TD2A 4D42A 3H86A 3WMRA 2QRPA 1CF9A 3KVYA 4NONA 1WVMA 2J46A 1ZGBA 4NX2A 4MGHA 1UXJA 1P1JA 2WY2D 2QNBA 1IZ0A 2AGVA 2UVPB 2Z3VA 4FDMA 1CUIA 5HBRA 5ICGA 4I4TF 3FZGA 4WLVA 3F4BA 5DM4A 1OHHD 1SCAA 1ESZA 3LBHA 3O8QB 1G21E 3PUZA 3LY8A 5TARA 2ILVA 1GCIA 3EBPA 1GCUA 2IZ1A 4BB9A 4X66B 2R5FA 2I99A 4RTOA 3OKAA 2GBFA 3FF4A 3HY6A 2L2QA 2ODPA 2ZB4A 2A30A 1XMPA 4DJJA 1GPMA 2BFOA 5DCLA 4MV0A 3O4IA 5FWYA 1DFHA 2Q41A 3D2CA 3KVVA 3DDHA 4F2GA 3UJDA 3FWKA 3GFFA 5KWJA 4D96A 3DYBA 2VPTA 3A10A 4F93B 2ZI6A 3CR7A 3GJ7A 3L1VA 4CUZA 5BY2A 4P93A 5KAMA 1MN6A 5HKAA 5KYXA 3VVCA 3R9XA 6CHYA 1Z4NA 1ZR4A 2BTEA 1EBUA 1NVKA 1WTAA 4JBYA 1KJ9A 3CLSD 3QU5A 2B25A 2XOKA 3EGDA 3HU3A 3ZVLA 1QS0B 4CRWB 4E7PA 3KSAC 4JNCA 2IYUA 4QO8A 1GQYA 5AJVB 3OZVA 1NQXA 5DBHX 3WV4A 5CBKA 3EIHA 3MT9A 2JAXA 1JR6A 1FUEA 4KV7A 4B3JA 4Q12A 1MTOA 2XB2A 3QY9A 4C0XA 4Z6KA 1BAPA 3QE4A 4ZAZA 2G9VA 3LG2A 2L17A 4HEJA 5E0KB 4JD5A 3NWPA 1YS2X 1C41A 1L4EA 1JHMA 5J5AA 4CM5A 3CKYA 2XCUA 4JUCA 4MVJP 1O6FA 2VYVA 1R3UA 3IUJA 1JVNA 5ECGC 4DT1B 4EA6A 3PQCA 3K7EA 4EFKA 2OSVA 3A9SA 3NHMA 2IUSA 5HRUA 4C4YA 3COJA 1SEPA 2MSEB 3SIRA 3VPCA 3QJ5A 1JVSA 5LZ4A 1XD9A 1W5TA 1W4RA 4UU0A 1EVYA 1P1FA 4UMDA 2PAAA 1I4LD 1QVWA 2ZSFA 4PSVA 3TFWA 1MOPA 2FG6C 1YS9A 3BF7A 5EGNA 1PT8A 1CZRA 2WU3A 4DLZA 3ZHVA 2QNRA 4IW3B 2P2YA 4RFSA 2RCYA 3DONA 3FZQA 4MS1A 3K0KA 3PT5A 5CA1A 2REBA 1RQGA 2IHYA 5FQOA 3VH2A 1OIVA 1TUGA 4B9AA 1DE0A 3FGOA 4PO1A 4EY7A 5AVKA 5BVGB 2HQ1A 4HXYA 3U1TA 3AETA 2ET6A 2R44A 1L5MA 4FSDA 2GTPA 1BHQ1 4UU7A 3UMVA 4EIWA 4NJEA 1X0XA 1E2HA 3A6HA 3D43A 3P2OA 3CNNA 3LZDA 3HNPA 4PQFA 4W5WA 1WZIA 1CY6A 2TRSB 3NTQA 1Q1NA 3AKCA 5LMNB 5E7JA 3H9GA 3FHTA 3EH2A 2NUTA 1M8PA 2F2TA 1KSFX 4K2HA 5HIAA 5KDDA 4LKOA 1DDIA 4GBMA 4H1HA 5FBZA 5HP4A 4PAMA 1JR3A 2C9ZA 3ZHOA 2ZYGA 5ALVA 4FFRA 1WB5A 2G36A 2IU6A 3AEQB 1U7TA 4CG2A 4E15A 4C0JA 1TFRA 1DPGA 3PRJA 4GI3A 2PUFA 1IMJA 1EWQA 3FHOA 4GM4A 4HYQA 4JJZA 3WWZA 2Y1WA 4A16A 2FW9A 5J47A 1BZYA 1PNTA 2VH1A 3E5NA 2G0AA 1ORTA 2O1WA 3IEUA 3O47A 4K1LA 1BYUA 1E79A 3Q3IA 4KJXA 2CF5A 2FSFA 3UXHA 4A3SA 1G8GA 4DDMA 4B1FA 1XTTA 4UE3S 3V6LA 2FP4A 4S1NA 2IQIA 4RA9A 5HDBB 1PL8A 1R00A 2AJBA 5KPDA 4I4IA 4K5QA 4I50F 3IB6A 4JT8A 1F9EA 5EZSA 2F8MA 3DOJA 3EDYA 3GEPA 3GH3A 3OEYA 3S1LA 2XODA 1HYEA 1OJLA 5CCEA 4OI1A 1WXXA 3H6HA 2AUMA 3UXEA 3OE1A 1K98A 1OLUB 4YMTA 2R60A 2C8VA 4D4LA 1GQQA 4B84A 2JAPA 1KZHA 4YCCA 4L2IB 4WKPA 4DGQA 2Q9CA 3KWFA 3UJHA 1O94A 2WSMA 2XV1A 4MDFA 2BISA 3AHFA 3TZCA 2DXIA 1Y7IA 2D7JA 4C0QC 4BPBA 2ZUVA 1YXMA 3PEEA 5AVRA 4PYJA 5JADA 3OZWA 4BO7A 2C8JA 1JW9B 3BXHA 4H1VA 4R0NA 5K4AA 5REQB 4B6JA 5KYTA 4KXFB 4DWJA 2I3GA 2I3DA 1J49A 3UGKA 5J43A 1FRZA 4PFJA 3EZ2A 4H17A 1Q3HA 2IIQA 3NIDB 2GBCA 3DO6A 2LZ0A 4JODA 4C6TA 5KQMA 2JGDA 3IOCA 2CFCA 1FQKA 1KBZA 3A6ZA 4C6HA 4Y1FA 4JZKA 4EY4A 3K30A 3KOYA 4RJIA 3T38A 5KJ1A 1WU8A 4CI0B 5IZCC 5LPNA 1CR0A 3IKVA 3PQFA 3L1UA 4M9RA 5COQA 4AO6A 4BWFB 3LZCA 1G4HA 1IHPA 5B6JA 1EFVB 3W6UA 1MCZA 4EHLA 1TIPA 5BSGA 4FMBB 4JOCA 1JI0A 5CLHA 4DS3A 2H57A 5AT1A 3Q8XB 3VX4A 1Z73A 2VF5X 4DDTA 5C5IA 3WNBA 2QZSA 2BHRA 4ZQCB 1QNFA 4Z3DA 1AQYA 1EWVA 2DQYA 3GROA 3QUTA 3EFOA 1VRWA 4EUSA 2YWGA 4MEAA 4NPAA 1KF0A 4ZVVA 3QBJA 3K0AB 1Z0IA 2BGMA 4JC8A 1R9MA 1GL6A 1MRZA 2WSIA 3WISA 7REQB 4ALMA 4N5DA 4C4XA 1JLHA 2CL5A 2X42A 3QOYA 4G56A 1KVTA 1P75A 3KTDA 1L8OA 3MN1A 5DP1A 3NJ8A 4KVFA 4DBVO 4Z5XA 1YKGA 4G0VA 3JZFA 3KX2A 2NTJA 3K1TA 1R64A 1TTTA 1HLGA 1RU3A 2FOXA 1P0MA 4IMPA 4B3BA 3OFVA 1SD1A 5K0TA 3PHLA 3O2JA 2OV3A 1SKQA 1RWMA 2BMAA 2G71A 3C4QA 5ER9A 1SA0A 4R8MA 1QK3A 3FLAA 1F8FA 2FVYA 3WIOA 4GZ6A 1HWYA 3ZW9A 5AFSA 2QLMA 4AYWA 3THWA 1CVRA 3HKDB 4WCDA 3RU9A 3AR8A 1IG0A 3L7AA 2Z5GA 3H9BA 3T3PB 3OKCA 4KQGA 2C3PA 1HE4A 5CX1A 3GLIA 2AOTB 3WZ2A 1G6KA 3UT6A 1Z28A 3BULA 1F12A 1BQ3A 3GN1A 3QX9A 3U3KA 1CE8B 1LPMA 2Q2VA 2PUJA 2X23A 3RAEC 1E1DA 4UD2A 1MO4A 1FFAA 5THXA 3UJ6A 5D86A 1PKEA 2FEPA 1ISFA 3L6EA 4NZ9A 4RV4A 5AKEA 5H82A 2X0IA 1ORIA 4QELA 5ISMA 3I2IA 1QE5A 3EVBA 2W2LD 1AB6A 1DDOA 1NI5A 4KACA 4KE9A 3OLXA 4QQ8A 2P6PA 4TVOA 1NFRA 2D54A 2JZCA 3ZJ5A 3H2JA 2PLRA 2PBZA 4GOLD 2DWOA 4A2WA 5HNKA 3PUJA 3H7AA 1S4MA 3B9QA 4KBFA 4RACA 3VNQA 3EDMA 3NGXA 3G8DA 4NFHA 3TOVA 3UB2A 3UMFA 1RYNA 2H4XA 4HQOA 4OQYA 5JNWA 3T61A 4YRCA 1UBOS 4IIBA 4X92A 4ZXPA 3GCZA 2E1RA 5D3QA 4AF6A 5D1NA 1I24A 1JEQA 4WVLA 3WR5A 3UWMA 4DARA 2FN8A 3QH4A 4D9CA 2IEYA 2FE1A 3N75A 1RPNA 4MVJA 1ZKMA 2FY8A 2NN3C 1YJQA 2P90A 3PC4A 4JLMA 1D0IA 5B58C 1A8HA 4KXVA 3AVUA 1G17A 2GN4A 2FCRA 4TVBA 3IJRA 5L6MB 2QD5A 2AD1A 2RONA 3K1YA 4M38A 1T1SA 1KJNA 1O7JA 3M6MD 4LMBA 1H2BA 4KYTA 1KKMA 5F5LA 2BAGA 4OI2A 2FPPA 5A1TA 3W06A 4PWYA 4TMFA 1U2ZA 3FYHA 3U7GA 2XNDA 4MUAA 2IUFA 3C5EA 3EF3A 4FFPA 2XDQB 2F62A 4AP5A 3PP8A 3FFAA 3JPYA 5G3YA 4BAGA 5FTMA 4HVCA 1PQYA 5CVEA 1C4WA 1Y8QB 1A5TA 3KQLA 2BUAA 1Z6TA 2CL0X 3ZWBA 1LDEA 1HOTA 3MERA 5H80A 1N8KA 3GUZA 3GNQA 4C87A 4LX8A 3Q8MA 2VSNA 3ZHYA 3DOFA 1DIAA 2QTCA 3L7KA 1U8UA 1XKQA 3DDNA 3EXFB 1V0JA 3KQPA 5D84A 3ZTYA 2XWSA 1SG6A 3H65A 3M33A 1VPDA 2FK7A 2NU9A 3E22B 4MV6A 4MMXB 4NZMA 4KITB 1TT5B 2CBXA 4X1OA 1TZMA 1CYDA 4R1QA 2W48A 1XZNA 3DE2X 2QD4A 5IKPA 3I8XA 3RC8A 5IARA 2OFFA 4TYPA 1U9JA 3WQBA 3QEBZ 3DLBA 4HOYA 3R44A 3DMFA 4RX1A 2Z2YA 1H2ZA 2XDYA 3K5WA 4OFZA 3HXKA 1WY5A 1DX6A 3QVXA 1NDQA 4BGVA 5CH8A 2QD1A 3QVGB 4PCLA 1VOTA 3ZDXB 1W76A 1ABFA 3A37A 4HMQA 3ZOZA 2YMLA 2BTQB 3U60B 2RK3A 3RUHA 1ZGZA 1Z5OA 3A3NA 4BUZA 1PS8A 3H5OA 4Q3KA 5JWRA 1UKVY 2WUWE 4YV7A 2OVFA 4DDWA 2A1TS 1R5NA 1SHKA 1XTKA 3GLGE 4BUCA 2AR7A 1VL1A 2GRUA 2QVGA 4DR5B 2BH2A 1EQUA 1ONNA 2BEUB 2GF2A 2JATA 1H5NA 3C98A 1SWVA 3PJEA 5FOTA 4EG6A 1XRMA 2WM9B 2GUWA 5IH7A 4EBFA 4CCSA 3CBQA 1JECA 1XPJA 5GY7A 3W0LB 3AR5A 3FGPA 2BDUA 5BWMA 2JLRA 4M0EA 2D4HA 4O2AB 2CXUA 5K8IA 1SNYA 1Z5NA 5FPKA 4URZR 4BBZA 5H9WA 2OMKA 2DHEA 2FUG1 3FRIA 4K0RA 1ODIA 3IP3A 4MUJA 4Z0TA 3GWZA 4PO3X 1UJMA 5A0FA 1RYZA 3HBMA 1R4MB 3K4QA 3HJGA 3PE6A 3VZCA 1DQSA 2IHTA 4F8YA 5LVAA 1ZSYA 2C9OA 1KO4A 3FPFA 2D2IA 2PBLA 4UOQA 4OYHA 2HBZA 2ZSJA 4IUBS 4MV9A 3SXPA 1NDUA 1QHNA 1SUDA 1KE2A 2YX1A 1B8VA 4X7BA 2V9ZA 4FB4A 3DMTC 2JGRA 4CFZA 1BDJA 1L8QA 3RCBA 3STXA 4QNNA 2R3SA 3KP1A 3RPEA 2YWEA 5FCDA 4YR9A 3GMDA 2AN1A 2CLMB 1XTUA 1QCYA 2JFWA 4LHSA 3R9KA 1L5SA 4EL0A 3NWBA 4TWBA 1SU7A 3LOUA 1JP7A 1UDCA 3KHTA 4FDVA 3TW0A 5IEJA 2FFBA 4ZVRA 1LCIA 5BR4A 4C3UA 2YY6A 5IDYA 3RLFA 2G1AA 1APBA 1R4NA 1TM5E 4BBJA 2OO7A 1YGPA 2Q1TA 3BWCA 4GZMA 3M9LA 2VFAA 1YQUA 4POAA 4KW7A 2ZRDA 5IKMA 1RWBA 3ZZTA 1Z6PA 1ZC3A 1N9KA 2QX9A 4B6FA 2UYYA 3MXTA 3T5DA 1XZQA 3MEQA 4EHIA 1UAYA 3E7XA 2V9CA 4RHEA 1JKMA 4I9HA 1FP7A 3CIFA 3LZ6A 4CFSA 1HM5A 3DPSA 2DBZA 4C21A 2DWQA 5T57A 3IQXA 4DPKA 4YV1A 2PWZA 3WIVA 4NICA 5LB2A 5J3JA 3CQ9A 1X7ZA 2Y1XA 2ZAOA 2P3SA 4JQYA 1QVZA 4L3OA 4D97A 5IRCD 3PCXA 5HVNA 3RSCA 4EJSB 1YRAA 1E3JA 1PR9A 4IJMA 1ZVJA 1E2EA 1G3IA 1KK1A 1P61B 1MB9A 1X8LA 1U9CA 4MWOA 4MVJH 1E3EA 4M7WA 4MA0A 4V02A 5G1OA 2ATEA 2W2PA 4YCLA 1E6WA 5FPYA 4KK4A 4U9UA 1FLDA 3TVYA 1SQ6A 2W6NA 3N8KA 3T0FA 3KETA 2WA2A 3T5GA 3UGTA 4C5BA 3REGA 2GDZA 5C46F 3R2JA 3TCXB 1Z34A 1E61A 3IH5A 2CHGA 2JFPA 4B4VA 4EVRA 2QZJA 4HV4A 1AQLA 3ADOA 3WQHA 3U81A 4EO9A 1NSTA 4OFXA 2VUHB 4M88A 2AXPA 4HAOA 4LNHA 1W48A 3MTBA 1DTEA 3KU4A 4XJXA 2QN8A 2WDZA 3PFBA 2FFHA 2UYOA 3W8DA 3LPLA 3MCAA 3IIIA 3H8SA 1VB3A 2VHCA 4X90A 2DHDA 4YV0A 4DAOA 5LXTA 4NNOA 3ICEA 2WM3A 3T52A 1XMSA 4CODB 3KEMA 4E1BA 4JLPA 1K7FB 4HH3C 3V7NA 3I1FA 2IV7A 4CCAA 4AJHA 3HKBA 1YE8A 3C6MA 3OCYA 4PF1A 3V7UA 5C53B 4ZYUA 4EW3A 1V2HE 1L5VA 1V1MB 2ZBVA 3EHEA 4JEMA 2CLCX 1C3OB 4KWEA 4Y8VA 1QK4A 4HNQA 1U4NA 2COKA 5FWXA 1Q0LA 2FOIA 3INNA 1AK1A 4CIXA 2HF8A 4K9NA 3O4RA 3CX3A 3KEGA 4U2KA 4ZT7A 5EE1A 3V00A 3VOAA 4AVYA 3I92A 4L75A 2ZJ6A 2KB0A 4RHXA 5JH7B 1T4CA 3GAZA 5JAPA 5IVDA 1FDOA 4FIDA 5JFTA 5A4DA 3ZLJA 1WXFA 5G0SA 2XE4A 1RYDA 4IIYA 4L5AA 5KOHA 1M1NB 5TT1A 4WECA 1Q3TA 3WV5A 1FXUA 1Y5IA 1M7HA 2NQ8A 1A5AB 1N5KA 1O54A 1ZGHA 2B82A 3JYOA 2Z8YM 2XQGA 4CLHA 2JLXA 1K97A 5CTJA 1W1UA 3TQIA 2QTRA 2RHMA 2Z04A 3ORSA 4MHOA 2FMKA 2ZBUA 3FOEC 1DJOA 4S24A 1E59A 1TUBB 4HJRA 1M2KA 2VYNA 3R8XA 1WMDA 2C8LA 2KYRA 2RJNA 2WPDA 4LCEA 3FYCA 4ZJPA 3CSUA 4OQZA 3ZHUA 1N5MA 1VYVA 4BP8A 4UEWA 1CY8A 5AW7A 3OSZA 1ZD9A 3M2PA 2ODBA 5TMDA 4L5CA 4DIBA 1V7CA 1J8FA 3Q5EA 1KYYA 4KUEA 2VSXA 2VAWA 1CZUA 1U0EA 4XJSA 2CNOA 2L18A 5LLDA 2JJMA 3FMGA 1TMKA 3TLXA 5F3WB 1K0FA 3TTVA 2I4TA 3H0EA 3H1GA 3QLEA 1WLYA 5H16A 1VYHA 1EB8A 3JAWB 1N0VC 4X60A 5KNDA 4LZOA 1X86B 4KO4S 4LSMA 3PPXA 1XTBA 4YB8A 2AHOA 3WYGA 4DSNA 2QMEA 3GT0A 2C78A 5T4BA 1ETHA 2WB4A 2WG2A 3OQ6A 3BCRA 1YQGA 5MGBA 2PLAA 3CR3C 1WHTB 1ZESA 2A88A 2HOQA 5DNEA 5JVDB 4CR6A 4LRSB 1YRWA 1A96A 3RG8A 3BGIA 4LGVA 4US0R 3W04A 5M3BA 2HTFA 3VGPA 5BR7A 3CH4B 4NJMB 2GJSA 2VWPA 3ROGA 4PYLA 4GUDA 4JY7A 5TGDA 2IXBA 3M9XA 4YJ2B 4Z51A 1ZD1A 3GZTB 3TLGA 2X0JA 3AUSA 4WBSA 1KI4A 5F73A 1ILEA 4C0HA 1EUDB 1SVIA 2JVIA 1OKKD 2QLLA 2I7CA 2LP4Y 4I14A 1RZRA 2PZ8A 5LP6F 4B76A 4MV3A 3DEIA 3T4UA 4LOLA 3T7EA 1FK8A 4CCWA 4UFPA 4XOUA 2XVMA 2PBRA 5ALPA 5C18A 4ZOLA 3GFGA 3RFFA 1GLVA 3HN2A 3K9WA 4YASA 3GZNA 2C3UA 5T4FA 5F64A 5BO5A 2XADA 3IV7A 5F35A 1FNDA 2B36A 3GIDA 2XCTB 4CPDA 3D0RA 3ZDDA 3F0TA 1XMOB 3MJ4A 1E4EA 1UK8A 2C95A 1DINA 2HF2A 2HHJA 3MJEA 4MWEA 4WXPA 3CUSA 2PLWA 2W2KA 1ZNXA 4IQ4A 4RS3A 3L2OB 4X41A 3LXMA 5KOJB 4LF7B 4OH1A 1Y9EA 3M4NA 3W8FA 1VSUA 4RJTA 4P86A 1Z4PX 4BC0A 2AR9A 5EIAA 1B73A 1ISSA 2DKFA 2YHAA 3Q2OA 2GBPA 1POXA 1SGWA 5HK9A 2O9JA 1KTVA 4PLHA 1P6QA 5EUBA 4WK4B 5JCJA 3LM8A 3OFNA 3FWPA 1YVEI 2P2NA 4E08A 5EG5A 1FXWA 2A9JA 2YR0A 2B7LA 2GETA 2FDRA 1QHXA 2NXCA 4XCXA 1HEIA 1PS0A 3SG0A 1KYQA 1U8XX 2D59A 1R6XA 3HPRA 4UM9B 4JJKA 1JZSA 4KYIB 4QUBA 2Q99A 1DWPA 4BE7B 2IX3A 4II7A 4F71A 5AI9A 2VP5A 2X3YA 3PHJA 4CM1A 3KU1A 4F5EA 4WDRA 9LDBA 3MHTA 4YWJA 3HMKA 4NZOA 2QJWA 3MJCA 1X94A 3PHGA 5JARA 3N3AC 5TRTA 2YYAA 4BX2A 3BBPA 1P1HA 3BQNB 1P6UA 5IWAB 1NHGA 5CDSA 4R1TA 1L7AA 3DE1X 3ME5A 1E0JA 2BM8A 3AEKB 5IK2D 4RZXA 2W4MA 2ON6A 2QVBA 4NP6A 5TR9A 4NKRA 4Q1AA 2R97A 2FFJA 3DMTA 2FR8C 2N47A 3GX1A 1L6RA 4K9RA 4FNOA 3CX8A 2QG6A 3HMQA 4UVDA 1YRYE 5JO9A 1PT9A 4KYVA 2H7CA 2YJ6A 4MPPA 2BYTA 1J8YF 1JG4A 1YA6A 1A4XA 3V1KA 1TEXA 1Y5MA 1VE6A 2P2CA 3NBMA 4JX9A 3AU9A 1RS0A 3G89A 3HBFA 4E5SA 2J87A 3UQZA 5EAIA 5L95A 4J9VA 3RC7A 1MOZA 5GOTA 3X1WA 4CCYA 5CXQA 4H08A 3TO5A 1YK1A 1LC0A 3RTAA 3UUEA 4EG4A 4D0NA 1M67A 1DAIA 1KH1A 5KUTA 1OMOA 4WZZA 1G291 1SMKA 5B3AA 4IKEA 4BMZA 1E6UA 1K5PA 3EQ8A 2R6GA 1L0BA 3KEOA 2MSCB 1Y1TA 2N1MA 2FKAA 2VPPA 3A31A 3AY6A 1ZDMA 1ZPDA 3OOYA 4CIYA 4I3HA 3ZDRA 2XD9A 4AO7A 1H3EA 3LPCA 4B8WA 1Y63A 3UB4A 1KZ6A 4GAEA 1JHYA 1N0WA 2PVSA 3R7WA 1LS6A 3ZLBA 4YCSA 2OV2A 3A2MA 4YGYA</