1YZTA

Gppnhp-bound rab21 gtpase at 2.05 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
155
Chain Sequence
b'AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-21
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 53
structure length 155
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yztA00
1G21E 3WYGA 4M1WA 3R9WA 3P27A 2OBLA 2P5SA 1KY2A 1XTQA 2OESA 3W3AA 1XD2B 3Q7PA 4NE2A 3NXSA 4HZUA 5KNDA 1RIFA 3DOFA 1E1RA 4K46A 5AJZA 3VR2A 2FSFA 3ZZUA 3PEWA 2YOFA 1GSIA 1VG9B 1HT2E 1JR3E 1XWIA 1NLFA 2CXXA 3D3QA 4QNMA 5FUWA 4EJSB 4XSHA 2GBLA 1KSJA 1BMFA 1G41A 3ZS9A 2YWEA 1Z2CA 2WPDA 4P4SB 4DEYA 4LSGA 3U3JA 5LB2A 2NO7A 1SKQA 4LHWA 1J70A 4XIGS 2XTNA 2XSZD 1ZM2A 2XNDD 1G3UA 2RGAA 2ZSAA 1N0VC 1E69A 3F3YA 3MWLA 2F3TA 2ZRNA 5IK2A 3LRPA 3AP1A 4FCVA 3ZD6A 1ETUA 1EX6A 4ZDJA 4HLCA 4GT1A 4CEIB 1AGPA 4MH0R 4M9QA 5B30A 3T1TA 5TVKA 3BBPA 3QBVA 1XD8A 4ZPXA 2WJIA 4OKSA 3BH0A 5JI3E 2G0NA 3ADDA 1XXHB 5BQ5A 3KKOA 3W6OA 1M7HA 2FNAA 1W49A 4ARZA 4KSBA 4YDHB 1YVDA 2EWVA 1S9HA 1OF1A 3JVVA 1E2NA 4QXAA 4Q18A 4RD0A 2ZE7A 2PBRA 1X1SA 2C04A 4LPSA 4ON9A 3AM1A 3LVQE 1GRNA 1HEIA 2TMKA 5EE5B 4D4JA 2ZPTX 3IDQA 3QKSB 3ADCA 2JJ2D 4DVGA 4PANA 3FHTA 1II8A 1YZTA 4TQAA 3TMKA 4V0NA 2A30A 2PJZA 3RVBA 4DUGA 3CNOA 4QGFA 2LKCA 3FKSD 2IYTA 2V1XA 2XX3A 2QRNA 1R8SA 1OT3A 3AVUA 1Z6YA 3GLIB 1OFUX 2REBA 2ZSDA 1Z6AA 2UKDA 2XJ4A 2DFLA 4C2UA 3A4LA 4B44A 4XTCS 3H1TA 1GP2A 5F2EA 1O87A 2ZANA 3UMFA 2VSOA 2FGJA 3QG5A 4DT1A 1ZM9A 2H5EA 1X8LA 1GRRA 4DLUA 3W3ZB 5LD2B 4UNNA 4URZR 3AF2A 3TR5A 2G1JA 5J5CA 2PX0A 4BLPA 2QTFA 1BO6A 2BM1A 4LI0A 3EIHA 5K8LA 2O8BA 4LJAA 2C03A 5AJVB 1OKKD 3FDIA 1F5NA 5L3RA 3QEOA 1E2GA 1LF5A 2F6RA 4TWZA 5HE8A 3TSOA 3GLHE 1G5RA 3I5XA 1OYYA 2F1RA 1HURA 4NCKA 5L3SB 2BMJA 3RS4A 2GESA 4ERNA 1KO5A 1E0SA 3BS4A 3KJIA 2RGDA 4HAZA 1RYFA 1COWA 4JBXA 2H57A 4CT4B 5KNBA 3R8CA 3B78A 3RHFA 2P6NA 3NHAA 1SVKA 2IYRA 1ZD1A 4D6PA 4RCYA 2Y8EA 2I1VB 1T9HA 5KPDA 4D0LB 3OHMA 4OHVA 1N6OA 1ELOA 2WIBA 4GMDA 3THXB 2QORA 1NY5A 1ZU5A 4B43A 1S96A 4F4CA 4UNRA 1PLJA 2QTVB 3P4XA 1ESMA 1N5KA 3CB4A 4AYTA 1AZTA 1DVRA 2AKAB 3GJ3A 5AUPB 2WKQA 1ZUIA 1J8YF 1K5GA 1AKYA 2DFKB 4R9UC 4HI0E 4TYNA 1P4SA 2RB4A 4DLZA 3U44A 1NL3A 4NYIR 5CYOA 3QG1A 4G5SA 2IUTA 1A5TA 5KDDA 3NC1C 5KHOC 3HU2A 1VMAA 3QJYA 1W5SA 2RKOA 1DAFA 3DHWC 4FXPA 1OFTA 4CF7A 1JJVA 3KUDA 4M9ZA 5KO2A 3P32A 4CEHB 2BMFA 3ZS8A 4JYCA 1MO4A 2CJWA 2FFBA 3CW2A 5FPTA 4Q4JB 4RKEA 2DCUA 3QF4B 4LBYA 1Z0DA 1KGDA 2ZRGA 2FJUA 2IXEA 5FL7A 5SZIA 3TSZA 1K6MA 2DR3A 2NO1A 2JJ1A 4N1AA 1IY1A 2ZETA 2DFNA 5GJCA 2NOAA 2WJJA 4JLBA 3IEUA 2H18A 4JJZA 2J9RA 2QPOA 2ZUDA 2JLWA 2IS4A 5KNCA 3QXSA 3EWAA 4BLOA 3R9XA 2FMXA 3PEUA 4C2TA 1TL7C 4II7A 4LX0A 4O3MA 1DEKA 1X3SA 2JLQA 2ZI7A 2XOKA 3TUIC 1BH2A 4WZBE 3EX7C 1TMKA 1XMVA 4QBHA 4B3CA 4A0GA 3THYA 3LLUA 2WKPA 2ZI5A 1G3QA 4LK2A 1US8B 2ZSEA 4IJMA 1OXUA 4IDNA 4MKGA 2FU5C 3Q9LA 3MMPA 3PUZA 3Q85A 1F2UB 3B8HA 2V7QD 2O8FA 3SBEA 1T0JB 3IO3A 4TYQA 2D7CA 2R62A 5DHAA 4LHXA 4EFNA 3CH4B 2IYLD 3BAFA 5DI3A 3RWMB 1OIVA 1D2NA 1WE2A 2BJVA 3NTUA 3Q7QA 5L3QB 5DHFA 3TKLA 3A1VA 5EP3A 4C7OB 2QRZA 3FPAA 2ZYWX 3SBDA 4DSNA 2JLRA 2XXAB 4JBYA 2GTPA 3CF0A 4A9AA 1MABA 5E3HA 5J4KA 2PLRA 1I4LD 5EZ6B 2J41A 2D2FA 3MFYA 2FZ4A 1G17A 5HKKA 221PA 3CIOA 4E5UA 4N3NA 2AK3A 4MYUA 4WXPA 1ZUNB 4C9BA 3OEED 4MYHA 3SFVA 4BFVA 3VNVA 2PCJA 3PUYA 3AVOA 5FPYA 4KAXA 3EC1A 1TU3A 4DEXA 3Q8XB 4JKYA 3WYAA 4EFMA 4M21A 3SFZA 4M9XA 4TSFA 1OFHA 1T5IA 4X8HA 1Z22A 3SYLA 1WP9A 4LJ8A 1QDEA 1IN7A 3FMOB 4D82A 2QT0A 1Z6XA 5G41A 2WMOB 4Y0AA 1JEEA 4FCWA 5J4VA 3G0HA 1GNRA 3BB3A 3PCRB 1OW3B 3PITA 3QUSA 4OK6A 1NBME 1PZNA 4R2IA 6Q21A 4M4SA 4CEJA 1JNYA 3OFND 2BEKA 4MRPA 4R71A 2IYQA 2O8CB 3DMDA 4A36A 3ASZA 4D81A 1E1QA 1Z8FA 2GETA 5C46F 2F55A 4IXMA 4W5JA 5GADl 3K9NA 3I4LA 4B3FX 4CRWB 3KJGA 2DPXA 4PR0A 1NKTA 5TXGA 4URVR 2V8OA 4UXHA 3TGPA 3GLHA 1MKYA 3A4NA 1Q1EA 2O8DA 3RANA 2QU8A 4Z54A 1QF9A 3GEEA 1NLZA 1M34E 1TUEA 3ZIAD 3GEHA 2IYZA 3AP2A 2ZUBA 2ANCA 4LHZA 4F93B 2W0SA 4RD6A 4ILEA 3AF1A 2DHRA 2ZRMA 3LH5A 1DG1G 3LDAA 1G8FA 1KO7A 3H2YA 5KSYA 3ONWA 2C96A 5FTMA 4EPRA 1RRFA 2PX3A 1IHUA 4RFSA 1KJZA 1DOAA 4IDQA 4OQMA 1RRPA 1X6VA 1Q3HA 3GQBA 3ADBA 1EG7A 3LNCA 1XTJA 5FOXA 2GF0A 2FE4A 2X77A 1GRQA 2ZIAA 2R44A 5JSZA 2WHXA 2QP9X 2VSXA 2WWXA 3U2QA 4YMVA 1U8ZA 1VHTA 4Q1BA 1M2OB 4IKEA 3TJZA 1LTQA 4O0MA 3VFDA 3TE6A 4DC9A 2OLKA 1QZXA 2Z4RA 2ZR9A 4ZKEA 1KK2A 3KJEA 4KHZA 2YHSA 4Z8XA 4LOAA 4FN5A 3REGA 1GM5A 2FX3A 1E1RD 3CH5A 3UG6A 2ZI9A 5C1BA 4RCZA 1KSFX 3Q3JB 4HDQB 1CJMA 3V9PA 2EWWA 3B1WA 4CVNA 3QF7A 4EJSC 3LAWA 4A82A 2VTKA 4KBFA 2CCJA 2RGCA 2VSFA 1BMFD 3WP0A 2WPDD 4GZLA 2AWNA 2BKEA 4IVPA 1OYWA 5GJWC 1NVWQ 1PUJA 1TPZA 2ZQ5A 1J99A 1Z08A 2I4IA 2OE2A 1P61B 4KBGA 5E7MA 8OHMA 2X2FA 5GVSA 4C0SA 2PT7A 5IK2D 4PHTA 4TMWA 4V0LA 1IN8A 1XMJA 5BYKA 3IEVA 3DM5A 5DYGA 4TQ9A 3ZQ6A 3K0FA 4A8JB 4DSOA 1LFDB 5BN3A 4DCTA 1RKBA 3GJXC 2VL7A 3DO6A 1WCV1 1P9NA 3TQCA 1BS1A 4PPGA 5A0FA 4FMCF 4BE7B 5H8WA 1UKEA 5IRCD 3T15A 3MAAC 4OI2A 4CZ2A 4DCSA 2XTZA 3NVAA 1E2DA 1Q20A 1S4QA 3CONA 1TX4B 2QMUA 5FTNA 4Q7JB 2EFGA 3P26A 4KLZA 1K8RA 2GK6A 4HLQB 4U00A 1YHNA 2FFQA 1I4DD 4TQUS 1GL9B 2EQBA 4IOKA 3R7WA 4EPYA 3QEJA 1JEDA 2RAPA 4QBGB 1FX0A 4DUGD 4MDFA 2F1HA 1L8QA 2IYYA 4HDOB 5JECA 1KY3A 1GL7A 4PC3A 1CJTC 3SQWA 1UBEA 4MYCA 1NI3A 2CMKA 3IBGA 3BH7A 1VKJA 2GEUA 5F98A 1YRBA 2QBYA 2CEAA 3HU3A 4LC0A 2VP5A 3ZYCA 1KTVA 3RRNA 3K70B 721PA 3KKQA 5LD2C 1T4GA 5DNYB 1W7AA 4QM7A 2IS1A 1SVIA 2ONJA 4HAYA 2JLXA 2DB3A 3DL0A 2HF9A 1N6IA 3QXHA 2MMGA 4A0FA 4ZI2A 1KO8A 1KI9A 2BJWA 3WYFA 3IKJA 4CGZA 4NPHA 1EWRA 3B82A 2IX3A 2YC2C 4NL4H 1G3RA 1AS3A 1N25A 4D4KA 3T35A 3U5ZB 4FMDF 1UBGA 1U8YA 2EVWX 4UNQA 1HUQA 1IM2A 1L4YA 1YR9A 1NBMA 4QBIA 3UMRA 3BFVA 5F9HA 3VKGA 1W4AA 3RS7A 1COWD 1HE8B 2IXGA 4JMPA 4E09A 3C8UA 1XNJA 1Z3IX 1P5ZB 1N6PA 1W46A 3CUEF 2JLUA 2XZLA 5FTKA 1N5IA 4PQFA 1DO2A 4CW7A 2NMVA 4JL6A 1E2LA 1AJEA 4MRVA 4XWAA 4Q66C 5JHGB 4PAQA 1QHSA 4AG5A 3CKLA 3LQRA 1NVXQ 1SXJB 2A5DA 3MSXA 1AM4D 1G6HA 4EUNA 2V3CC 2JDID 5FR2A 2ZRJA 2VF8A 4NCNA 3IPXA 2P3SA 4PC6A 4A6XA 1MRSA 4Q7MB 3SU8A 3KXIA 1FP7A 4B2IA 4PPFA 3DZ8A 2C99A 1SHZA 4US0R 1DAGA 1R0XA 4C0AC 2DWQA 3D31A 4KVGA 4PZLA 2C98A 4QJ4A 4B3BA 5B58C 4OJKA 3LD9A 4QGAA 3KDSE 1D2MA 3T5DA 5TDHA 3Q5DA 5CK4A 2A5YB 3A1WA 4ACAA 1RW4A 3P1JA 1J8MF 3A8TA 3GEIA 5JJIA 3BFKA 3MLEA 4DLVA 4HLUA 4Q47A 1CR4A 2AXNA 2J0UA 4Q00A 3QXXA 1HV8A 4LCBA 4P32A 5FL7D 4B47A 3BJIC 2YWFA 5AUOB 3JVUA 3SN6A 1RC8A 1GILA 2VIIA 4PSAA 5F3WB 2WV9A 4TL9A 1AIPA 1G8PA 2FPLA 4KFUA 4LHYA 2IT1A 5JJKA 1T3LA 4YLGA 1VG8A 1S1CA 2J1LA 4QGHA 3LBIA 5JWOA 3WXMA 1JBKA 2XOKD 2ZVQX 1KI6B 2QM7A 4NP6A 4RZ2A 5DH9A 2XZOA 3IGFA 1WF3A 1KI4A 1XZPA 4JZKA 2AD1A 5FBQB 4B34A 4R7ZA 1HY3A 1RJ9A 1CRQA 2P67A 1JB1A 3EC2A 1R6BX 5KPJA 2AKYA 4P4TA 3K9LA 1KO1A 1ZJ6A 1SVSA 2OCYC 1KO4A 4A2PA 1W48A 1B0UA 2UVQA 5BW8A 1MRNA 1GTVA 3UATA 1E2PA 4RJLA 621PA 4LPKA 3ZVRA 2FPKA 3U6KA 2XTMA 3GCGA 3U3OA 1NJGA 2Q9BA 2WWIA 3NH9A 5CK5A 3W8RA 1FQKA 3FFAA 5FH9A 2BBWA 4K8OA 1GZSA 3VX4A 2CHVA 4BLQA 4DLWA 2FDCA 2P5TB 1WBBA 2RMKA 4LJ6A 4CDGA 3NEYA 4IFEA 4AYXA 4EPTA 5FBLB 1R0WA 4IW3B 5JJLA 5DSZA 2FGKA 1Q1BA 2ZYUX 4F38A 4A1FA 4KXFB 4RZXA 4DDTA 3RC8A 1MO3A 2P6UA 1Q0UA 1Z28A 1Q21A 1XEXA 2Q9CA 2GJSA 1T5LA 5HKKD 4TTPA 2BVNA 4OYHA 4MITA 1GNPA 1YZQA 4X8OA 1VG0B 2VO1A 3QPVA 1E94E 4LYAA 1AK2A 3MWKA 4BZQA 4DCNA 2JGNA 3OIUA 1RFLA 1II0A 1ZD9A 3IO5A 4IDPA 3U3MA 3ZD7A 3ZVLA 5CJ2A 1PLLA 4GFDA 5SZKB 4TSFD 4D0GA 2ZITA 3ASYA 4PO8A 3ND8A 1U9IA 3SE0A 1LS1A 2R6GA 4EQ6A 3EZ7A 3B1YA 2R6CA 3AV0B 4H1UA 2A9KA 1S1MA 1UKYA 1G1MA 1UKVY 2IHBA 2V6JA 3AGPA 2W00A 2BM0A 3W90A 1IONA 1CBUA 1QHIA 2FSIA 3CF6R 4BEJA 5EE9A 3C5CA 3UIEA 1E1QD 1U0JA 4URUR 2VLIA 5DYIA 4DCUA 1NY6A 2MSEB 1K5DA 4BEBA 2AWOA 5AUQA 2ZJOA 4P0TA 1E2FA 5TB5A 4DB4A 5JWHA 5FOVA 1W0KA 3PENA 3CX6A 2VYFA 4DDUA 2KWIA 2ZE8A 5CB8A 5K8UA 3RYTC 2O8DB 2AN9A 2EYQA 4BFUA 2V54A 3IIKA 5JMTA 2FA9A 5HCIA 4PO9A 1M1YE 1VYTA 2QP3A 4Q1FA 4BZPA 4WA7A 3CRRA 4IEIA 1Z0KA 2ATVA 2QSZA 2OCBA 2QAGB 3GP8A 4Q9KA 1B23P 2BC9A 1OPXA 2N46A 4ASUD 1CKEA 3TIFA 4ZDWA 4ZCMA 1JPNA 3AVPA 3KKMA 4FINA 3PEVA 4DZZA 3QNUA 1LV7A 2OV2A 5FFMA 3L0IB 4LYHA 4B76A 4U5XA 3T06B 4QM6A 4KO8A 2VH5R 1VECA 4C3ZA 2WWWA 4QJ3A 1EK0A 1TQ2A 1OXSC 4A0RA 3GLFA 2GJ9A 4G01B 5EE1A 1G7TA 1JQLB 4BUJA 1W4CA 3WY9A 2YINC 4KV9A 4AKIA 2ZTSA 4DLTA 1XJCA 1TF7A 3CF2A 4BWYA 1UFQA 2OXRA 3KTAB 5FBWB 3L0PA 1DARA 1EFCA 1TQDA 4GSYA 4Q1DA 3VHLB 1I4TD 1S2MA 2ZR7A 5CYPA 3UANA 3Q72A 3NWJA 1MH1A 4LJ7A 4B6FA 1DAEA 2D06A 1NVVQ 2Q6TA 2WSMA 4UJ5A 1JPJA 4O25A 2IW3A 1IQPA 1R5BA 5TARA 2JASA 2O0KA 2YOHA 3KFXA 4RZ3A 1YU9A 1YZGA 1DG3A 4PSKA 2Z43A 2ZJAA 4B74A 2VPPA 4OK3A 4B2LA 1NN1A 5JS7A 3GMTA 2CK3A 1OFIA 2IHYA 4L8GA 2J59A 4AIIA 2BDTA 1W4BA 3IQXA 1L7VC 4DKXA 4OL0A 3ZJYA 4Q03A 4A8JC 3TRFA 4O2RA 1T91A 1BYUA 3QSYA 3EZ9A 1L4UA 2V9PA 1X8KA 4M8NE 2J0SA 1MO6A 4DDWA 2A5GA 3OE7A 2FZLA 1W2HA 1HA3A 2AL7A 2GCOA 3CX8A 5DE3A 3NDPA 2I3BA 3GJ7A 1BOFA 4HUQB 1IJEA 5KOYA 4GL2A 4F91B 4MRNA 3C4JA 3E2IA 1ZBDA 1PLKA 3TVDA 4B6EA 4Q4AB 4AWXA 5BXQC 5DN6A 4NYJQ 5HZKA 3K0CA 1RYHA 1ZNYA 2ZRDA 3AVXA 1QG2A 2Q0HA 2ZE6A 4TTRA 3K0AB 4B48A 2Z4SA 2CLDX 4Q1EA 3LWNA 2HXSA 2FFAA 2RGEA 2IF0A 2V4ZA 1SHKA 2XGJA 4P31A 3BWDD 4L9SA 3UWKA 4G1UC 4JL5A 4DLYA 4LC1A 1M6NA 4GP6A 3C7KA 3L0OA 4LBWA 1IJFA 4K81B 3RC3A 1TF2A 1WRBA 2ORIA 3B6EA 3KFVA 4TTQA 3PIRA 2Q3MA 2RHDA 4KODA 2ZSFA 1NN3A 5FR1A 3K70C 1QHXA 2BCJQ 2REOA 3KQUA 2W2TA 1NF3A 1VPLA 4JYBA 2H17A 1E2IA 1AKEA 4NKRA 4QOSA 3TBKA 1S3SA 3M4YA 3FOZA 3SS8A 3HWSA 2CDNA 4KFTA 1EESA 1VTKA 1Z63A 4FMBB 2XNSA 2KBEA 4Q4HA 5UKDA 4RD2A 2Z5FA 3ZQJA 4HSEA 2JDIA 1HQCA 2OO7A 3OZXA 5TV2A 4YQFA 1NBMD 2H7VA 1T3HA 2FG5A 3X1DA 2VF7A 4LDJA 1EFUA 1SGWA 1N0WA 4XWOA 5FPHA 1E9AA 1XP8A 2GK7A 3BC1A 5KSZA 4QFMA 3FWYA 1TEXA 1H65A 1KDPA 5JS8A 3BD9A 2C78A 4Q48A 4MRSA 2DYKA 5M04A 4TMKA 3RS3A 3WMFA 1SXJC 4M53A 4QHTA 3LO5A 2B92A 4QNRA 2GAAA 4G0NA 1SKYB 4IDHA 5C2JB 3U4QA 1IOZA 2PT5A 3DKPA 1CTQA 3QVVA 2CE7A 4NONA 2QQEA 2ZRCA 1XMIA 4HB3A 3FVQA 4OHWA 3OEHA 4F7WA 2XZPA 5L3VA 4I1VA 2QMEA 5KU1A 4M2LA 3D7MA 2XB4A 2YWGA 4MUAA 1OJLA 3D8BA 4ACBA 2FV8A 3B9PA 4WIAA 3LX5A 4IOMA 1NG1A 1IAQA 1E32A 1OIXA 3DPUA 4NCHA 1QHHA 1ZC4A 5EXSA 3RABA 3TAUA 4AYWA 1E0AA 4PQRA 4LV6A 3W5JA 5D3MA 2ZRLA 1KJYA 1VYVA 4H9GA 3THWA 1X1RA 2ZSBA 1EFRA 4OHYA 4PAMA 3NBYC 2D3WA 4EPVA 1SVLA 3WRXC 4MGYR 3M0EA 2VHUA 1W44A 1XTKA 1UBCA 3ZGXA 5B64A 4TT3A 1BYIA 1M7BA 1DTSA 1XXHE 1ZNXA 5J4LA 2ODNA 2F9LA 1IY0A 1SVOA 3FHCB 3EPJA 3DM9B 3PR1A 1ZNZA 2NQ2C 2EYUA 4LGMA 1KI8A 3OAAA 4B3DA 2GEVA 4PX9A 4EPXA 1QHYA 5E7IA 1U94A 3AKYA 5KTYA 2FOLA 2R65A 4J0QA 5AJXA 2VP6A 1XDBA 5IT5A 2RH5A 1R4AA 2O5VA 2NPFA 3U61B 4D4MA 1UDXA 2ZI4A 5LB4A 1WXQA 2L0XA 2ZU6A 3CLVA 4XJXA 3V4FA 5ELXA 4QC2A 4L4UA 3I5YA 1S3GA 1OIWA 2CVHA 4HDCA 3I62A 1DADA 2AHOA 2ERXA 2IYUA 1Q1QA 4DSUA 4GPTA 3GLIE 3PEYA 4A15A 5G3YA 1QBKC 4TMXA 1CU1A 1ZC3A 2UZIR 4FCTA 4HB4A 1AGRA 1GG2A 3N70A 4XTRA 3NHBA 4DRZA 3RRZA 1LY1A 1R5NA 2ZRHA 4I81A 2ZVPX 2DBYA 2FH5B 2GF9A 3AVQA 4BLTA 1RRGA 3NC0C 5G53C 1P9WA 3TLXA 1VCOA 5DO9A 4HB2A 4BQSA 2LCFA 5LPNA 2D2EA 4B3XA 3CO5A 4DXAA 1DS6A 3T34A 1T8TA 3BGWA 4FMCB 1TAGA 4ZIRA 2B21A 1GIAA 1R7RA 3GLGB 4PPQA 4NYJR 4E03A 2QNRA 1TEVA 2KI5A 5BN4A 1HT1E 2VBCA 3B1ZA 4JLPA 1RZ3A 3RLFA 4BZXA 2EFDB 2G6BA 1KDTA 2O8EA 1S8FA 3NBZC 1NIPA 4JL8A 3LLMA 3QE0A 5TMPA 3U3KA 3NKVA 1KHTA 1F2TB 2F43B 1RPZA 3QKRB 2VHJA 1FUKA 4ASUA 3E1SA 1SVWA 1ZW6A 5H70A 1QHNA 1W5TA 3I92A 4KVAA 4L5BA 1U0HC 3SJBA 2X8AA 3EPHA 5KDLA 1GDDA 4PZZA 4DHEA 2ZU0C 3ECCA 3GFOA 3EG5A 3ND9A 4OK5A 3X1YA 2HCJB 1DAHA 1KDRA 4RD4A 4BFXA 4HZUB 1W0KD 1ZIPA 3WNDA 2GVDC 2ZS8A 1RVDA 4TYPA 2F9MA 2WJGA 2HV8A 3NEJA 4LRWA 1DE0A 3GFPA 5DISB 3EPLA 1DAMA 1UEIA 3I8SA 1UEJA 4GP7A 3S1AA 1IBRA 1YZLA 2QAGC 1Q57A 1HH4A 4AURA 1U2RA 1N6NA 5C4MA 4FI3C 3R8FA 1FTSA 1KMHA 1UPTA 1Z0JA 2RHMA 3I72A 4KYIB 4PFSA 5CB6A 3KXLA 3ZH9B 2FWRA 2O0HA 5CM9C 5JRJA 2G77B 2RCNA 5HE9A 2NIPA 1CR1A 1NVUQ 2KB0A 1XD2A 3L82B 4URXR 3LA6A 1E9EA 3KQNA 4BECA 4HAWA 4B33A 2E87A 4EJSA 2VHTA 3SHFA 2HJVA 4ARZB 4HLDA 3EZFA 3AGQA 4JS0A 4BFWA 3O8DA 3EXAA 3LW7A 3X1XA 4LBZA 3AF3A 2ZS7A 5JBQA 1R5OA 4NYMQ 2R8RA 4GZMA 2KBFA 2CBZA 2W0MA 1ZM7A 4ZKDA 2Z83A 4JVNA 3A58B 4MGIR 4CEIA 2VRWA 3MD0A 3VR6A 4XH9B 1II8B 1Z0AA 4LHVA 1J7KA 1G4UR 2JJ8A 1TTTA 1G8HA 1WB9A 4L9WA 1XXHA 3K09A 2NZJA 2CK3D 1P7CA 4QKQA 5KSPA 2G0TA 4DJTA 3EA0A 1U90A 4FW9A 4B2PA 5SZJA 1TU4A 2ECKA 2F1IA 5EP4A 3HPRA 4DT1B 1RRCA 3UKDA 3QKSA 1CJUC 4A6PA 3I1FA 1BKDR 4A4DA 1UF9A 3OE7D 2HYIC 2V6IA 1H8HA 2CHQA 4JLKA 2QY9A 4ZI3A 2O8BB 2WVJA 1XZQA 2JEOA 2ZAOA 4C0JA 2IK8A 4WZ6A 3QIAA 4QBFA 3NBFA 3PXGA 3RAPR 3KZ1E 5FOUA 2FSHA 1IN6A 3N5CA 2HJGA 2W83A 3GLIA 1OV4A 2REXB 2ZYTX 4ABYA 4M22A 4I1UA 4URWR 3EIEA 4Q4LA 1NP6A 5DN6D 1FW6A 2ZEJA 3U7EB 4Y0VA 5AR1A 1A2KC 1I2MA 2WJVA 2ZJZA 3LVRE 3UMSA 1E98A 3ICEA 1W36D 1JQJC 1E9DA 3EAQA 4PO1A 1ZUHA 4MDEA 1FFHA 4UNPA 4IFBA 4NCIA 4PQYA 3RNLA 2BCGY 3L2OB 5LDDC 4M0LA 5JWRA 1ZIOA 2CL0X 5JCZA 2QMHA 4A2QA 1A82A 4P3YA 1P72A 4Z51A 1KNXA 2G88A 2H8KA 4A2WA 4GBMA 2VQSA 3QY0A 5AJYA 2CVFA 3SJAA 2IUSA 4KFSA 5L3SA 1GWNA 1E2KA 2W58A 1GITA 1R0YA 2ZYVX 5GJVC 3AP3A 4EKDA 5EJEA 4LYJA 3FKQA 4Z8YA 4EIWA 5EXXA 2RGNC 4XSGA 4LJ9A 4A0HA 2J7KA 3U44B 3LQQA 4IOJA 1G4AE 1QRAA 4XD7A 5C18A 4H1VA 5DIFA 1Z6TA 3ZZ0A 2VP4A 3C14C 3CZPA 2Q21A 3RWOA 3VR5A 3THXA 1NRJB 2VP9A 3GLFE 2ZUCA 1YRAA 2GA8A 2R6FA 2VA8A 5EXPA 5CITA 4TN1A 3AEZA 1ZYUA 3W6PA 2BBOA 4JIMA 2P65A 4BFTA 4TMTA 3RS0A 1P60A 5CIWA 2CJWB 2WSSA 4KSCA 2HF8A 1X86B 2D62A 1E9SA 1YKSA 2F1JA 2GCPA 2NTYC 3CRVA 4HUTA 5FOWA 1G3IA 1XCGB 3MGCA 4D0NA 1KOFA 2ATXA 2JIZA 3QPWA 1DPFA 3GJ8A 2Z0MA 1HQYE 3QBTA 4NMMA 1ONBA 4M1OA 1Q3TA 3NBXX 2C9CA 1CJKC 3SYNA 3LXXA 5J40A 1KDOA 1UBFA 5KYKA 1CR0A 4QG7A 1RE0A 2OM2A 4D26A 1XEWX 2V55B 3OEHD 4ZCIA 3FHOA 3FGNA 4MUBA 1U99A 1XBTA 3THYB 3IQWA 1M7GA 2ZJ2A 1Z0FA 1T8UA 2VHCA 3A1UA 3H0KA 4GNKA 4HLUC 1G18A 4Q4JA 4TMVA 3O8CA 3QF4A 3V00A 4DIEA 2R9VA 1H8ED 3MUFA 1FOEB 5FPSA 2XB2A 1N2CE 1X8JA 1YZKA 3EWSA 2CL6X 3RSLA 5GJBA 2O8FB 1Y63A 1HE1C 2R6DA 1MV5A 4Q5IA 1EFRD 4M1TA 3GJ5A 1TUIA 1E2QA 2ANBA 1D2EA 2WJHA 4QRHA 5DI3B 5FBRB 3K1JA 3EPKA 2FF7A 4TT3D 3HR8A 3CM0A 3IHWA 3KQLA 1YQTA 4F4IA 4PHHA 1R8QA 1YJ5A 1MABB 4RKFA 1US8A 4TMZA 4B32A 4Q19A 4NH0A 3OAAD 3ZZTA 2QAJA 4V03A 1VDZA 3KKPA 3IILA 2PZFA 1F2UA 1J2JA 3N2EA 1TQ6A 3H4MA 1N6LA 3AKEA 1EX7A 2QZ4A 1W0JA 1QG4A 4DCVA 1E99A 2PZEA 2RGXA 2IWRA 1D6JA 3UXMA 3P20A 2GZDA 3BRWD 3TUZC 1MR3F 2A7QA 4LY6A 1DBSA 5L3QA 1IXRC 4HZIA 4BGDA 2BV3A 2CCKA 1NN5A 2WKRA 4DBLC 4C7OA 3T12A 1ANKA 3SDZA 3I61A 2XXAA 4BLSA 2BEJA 4JSTA 1LF0A 5FUYA 4CEJB 3MJHA 1DELA 1FTNA 2WWYA 1ZMXA 4KYUA 3SI7A 2GZHA 1P3JA 2OLJA 3W8NA 4W7SA 5FL3A 3ETLA 2PL3A 4HB0A 2WM9B 1VHLA 2ODEA 2HT6A 4MKFA 4YDSA 4Z1MA 1VCMA 3T61A 2C2HA 1UAAA 2NO0A 3OIYA 4OQXA 3GLHB 3EA5A 3MRSA 3KB1A 2RGGA 5P21A 4IDOA 3P4YA 2C9YA 3DKVA 3O47A 4QJ5A 1BIFA 2OBMA 1TNDA 2O0JA 1FMJA 3NIBA 1YR8A 1YZUA 1OXVA 2OFOA 3LFUA 4M1SA 3NG1A 1XMSA 4C0KA 3OESA 4X8LA 2O8CA 3BH6A 2IBMA 4KFRA 421PA 1U8AA 5BWMA 2OT3B 3BOSA 4TLDA 4YC7A 1KI2A 2KSQA 1S0UA 4RFSB 1UDWA 1XTSA 4NYIQ 3B13B 1LS6A 3RS5A 3LV8A 2OFWA 4AKEA 3R20A 2ZJYA 2PEYA 2R6AA 3U7FB 1P9RA 1NG9A 3AVVA 5GVRA 3G82C 1CF4A 4BPBA 3ADKA 1KYIA 4NTZA 1JXMA 4LJYA 2ZS9A 5JSZB 4TZ6A 1OSNA 3GJ4A 3L8ZA 1GKIA 1VIYA 3ZVMA 3DEFA 4AI6A 4M1MA 1SZPA 2D4HA 5HCNA 2GHIA 3HJNA 1AS0A 1U98A 3VX3A 2E1RA 3WNCA 4AKHA 2MSCB 1G20E 2QT1A 1W4RA 1A7JA 1GNQA 1SQ5A 4OI4A 1KSHA 4CT5A 4P33A 1M74A 3T1OA 4AY2A 2NZ8A 2QQ0A 5K8IA 3B9QA 1P73A 3EIQA 3CR7A 2X19A 4MYTA 5HTKA 4DSTA 3V4RA 1WDTA 2Q3FA 4TLEA 4IHQA 5JCPA 2GBLC 3JZAA 2IC5A 2B6HA 2QI9C 5ANRB 3U7GA 1E9RA 1MT0A 4L15A 1P2UA 3L43A 1JXOA 4JLJA 5L8VA 5J4YA 2PMKA 4TLCA 5B2ZA 1Q12A 2JATA 4URYR 4C4PA 2F7SA 2OEPA 2PMDA 4M9SA 2GRJA 1GOTA 3F8TA 3B1XA 3H86A 3QVUA 5G40A 3SR0A 1FPMA 1LW7A 4I1SA 2GXSA 1NNEA 2QEQA 1Z5ZA 5BYJA 1KI3A 1XEWY 3K0FB 4W9MC 4HAUA 1Q22A 1E9BA 3WBJA 4YMWA 3WHLA 1GKUB 2EFHB 1XF9A 1T3SA 2QGZA 4NHOA 4YXWA 2QENA 4E22A 3HR7A 5E7JA 3MWJA 5CLQA 2JLVA 3SEAA 4AD8A 4I1OA 2YYZA 2JAQA 2PEZA 2QMOA 2WBLC 3WP1B 3FTQA 3Q5EA 4PAOA 3QXCA 1GUAA 3BK7A 2IA5A 4Q02A 1ZVQA 4D4LA 4DDVA 2QM8A 4A8JA 3CBQA 1C4OA 2WICA 3AKDA 3E70C 1E2JA 5DLQC 3R7WB 4PPNA 1XCPA 1A1VA 1FX0B 1FNNA 4F4JA 4MQBA 2PZGA 4IXNA 2IYXA 4OJQA 1UADA 1KZGB 3C15C 4TLAA 2OXCA 2OAP1 3SQXA 4EFLA 5CM8B 1NMXA 5JRZA 3HP1A 1Z47A 3GJ6A 4G5RA 4PHGA 3NH6A 2QBYB 2XEXA 2FPMA 2N42A 4I4LA 1KAGA 4B71A 3ZLJA 4C0QC 1VYUA 1NLYA 5JEDA 2QP4A 3IUYA 2HT1A 4GOJA 2AK2A 3RS2A 1H8HD 3K0CC 4WOPA 4D25A 3HPQA 2HCBA 5HR5A 3FFBA 1W36C 1XRJA 3SC3A 2QG6A 3B1VA 4MKIA 1CXZA 5FUXA 4U02A 4Q01A 1FMLA 1NMYA 121PA 1VIAA 3CRMA 4EAQA 4LV5B 2WOOA 2BBTA 1G3MA 4JLMA 2GILA 2HDNB 3PFIA 4Q7KA 4GRAA 1FZQA 4A92A 2EFCB 1ZNWA 3CPEA 3OIVA 1XU4A 2NGRA 2YV5A 4KI0A 1FL9A 3BE4A 4N0EA 4RD3A 3U6BA 1JR6A 3CRQA 4X8MA 3KX2A 3IBYA 4C0LA 3AVYA 4KCGA 1Q1ZA 3PUWA 2W6JA 4LBVA 2W2XA 2LWIA 3HYRA 3MCAA 2PJRA 3W34A 2CNWA 2CL7X 4PTLA 5TY0A 2IF2A 4FWIB 2QE7A 1P2SA 1N0UA 2QROA 1XPOA 5J4HA 2GXQA 1HTWA 3TVTA 1JALA 4DLSA 4JJKA 4WVFA 1N3BA 1CLUA 4Q7LA 2C77A 3IIMA 1G7RA 2G1KA 4XOIA 3FE2A 3BIFA 4NCJA 4GOKA 1XFAA 1O3YA 2ZRIA 3K8YA 4BFSA 1E3MA 2ZRBA 1GKYA 4B73A 2GKSA 1PV4A 4MGZR 4XD7D 2ZJBA 2GEDA 5EP2A 5IDVA 4UQOA 3A1TA 1E96A 3K9HA 2W6IA 4BFYA 3I32A 4TZ0A 1G16A 1SXJA 1Z6GA 1ZP6A 2HLDA 2IL1A 4G5OA 4TL6A 2ODBA 3CRW1 1KKMA 5BN5A 5B57C 2FSGA 3VAAA 5FUVA 2J0UB 1G7CA 2WSSD 2IEZA 3MWYW 3KJHA 3RDPA 3T1VA 1H8EA 1GL6A 4NBSA 1D5CA 3VNUA 2DWOA 2HUPA 4G5GA 3L0SA 4EPWA 5HZHA 2JIZD 3CZQA 2FFHA 2X1VA 2YOGA 3AUXA 4IRUB 3QPUA 4KU4A 1Q44A 4W5HA 3CWQA 3AQ4A 2WIAA 3LBHA 2J0VA 4JBWA 2ODWA 3EZ2A 1E2MA 4LZZA 1Z06A 1OH6A 3EW9A 3HDTA 4GI7A 1JR3A 3R9IA 1ZM4A 1SVMA 5FI0B 1RJ9B 2IUUA 1CEEA 1E2HA 2ORVA 4RD1A 3LX8A 1G6OA 2HYDA 4TLBA 1JJ7A 2JCSA 3TQFA 1QHGA 3M6AA 3QOFA 4V0KA 5FI1B 1EGAA 2NO6A 2G3YA 3H84A 4E07A 1F48A 2WWGA 3T1QA 5CDFE 5EE0A 1AQYA 1NVVR 1CIPA 3SOPA 2H92A 3I73A 4TL8A 5E95A 3G5UA 2IS6A 4PHFA 3A37A 4UJ3A 3K53A 5JEEA 5D3QA 3OF5A 1KI6A 2Q9AA 5FTJA 2UZ3A 4Q1AA 1U0LA 3CPJB 1LNZA 4ZO4A 4B75A 1JECA 3SYKA 2BOVA 1D9XA 2VEDA 1E79A 4LYFA 5CLLA 4Q21A 1DAKA 5AJWA 1KIMA 2IYSA 4LV8B 2BWJA 1XEXB 4D2IA 1KI7A 1EXMA 3K9GA 2CHGA 3CNLA 5EQTA 3VKWA 2ORWA 2P2LA 1MO5A 1ZCAA 1W0JD 2PLFA 2HXYA 1G5PA 2B8WA 4TL7A 1G8YA 4FWTA 3IIJA 2ZE5A 4POAA 4XVRA 3BORA 1NIJA 3TR0A 4JKIA 2GCNA 4EQ6B 4QL3A 4MGKR 3BERA 5H1YA 4DLRA 5JFGA 2H1LA 2QPTA 1AN0A 2YJTD 3PQCA 2OUKA 4UXIA 3VQTA 1F6BA 1N6HA 2J7PA 2ZI3A 5H68A 4LJ5A 1D8TA 1G8GA 2GJ8A 4OHXA 2XAUA 1UKZA 4KLNA 4WAUA 2EU8A 4XVUA 1ODFA 2C5LA 3VU9A 2D74A 3L8YA 5EUQB 1OH8A 1KKLA 4NZYA 4Z1MD 2QUZA 4C30A 2A5JA 1OHHA 2OBNA 4PZYA 1XCMA 1OB5A 5LBIA 1WA5A 1W2GA 521PA 4BASA 2WWFA 3LW8A 3QENA 4PC2A 5CJPA 2ZM5A 3PVSA 2ZRAA 3CX7A 3VR3A 2W2VA 1XJQA 3DDCA 2OHFA 2EW1A 1FQJA 1KK1A 4W5WA 1AZSC 3UK6A 4DWJA 1OB2A 4HAXA 2AR7A 2I1QA 2OG2A 4C0BA 2GJAA 1FUUA 3F0TA 4JT2A 1NSTA 1PUIA 2JA1A 5KUTA 1E6CA 2J5XA 1IXSB 3BB4A 3FMIA 1OH5A 1KMQA 2BMEA 2YC4C 3THOA 2FN4A 2QN6A 4RSGA 4AKGA 5A4JA 2GZAA 3B7GA 4CIDA 1E4VA 1NJFA 1A4RA 3TAHA 1AA9A 1XB2A 4JLDA 3C41J 1AQUA 1IN5A 4WXRA 2G9NA 2XITA 3UG7A 3GLFB 1P2TA 2WMNB 3E5HA 1SKYE 2XJ9A 3A6PC 1KI1A 4CYMA 2QAGA 1OXXK 2VP0A 4ESVA 4YONB 4YMTA 4FMDB 2IS2A 4JLVA 3J81k 1Y3AA 5KDOA 4R2HA 4DIDA 2XSZA 2XNDA 3JZMA 4JLAA 4V0ME 1CS4C 1Z29A 3C5HA 2LKDA 1TF5A 1LVGA 4GMXA 2G83A 5HPYB 3GFTA 1GVNB 1N5JA 2BMDA 2F3RA 4EDHA 3DOEA 4P4SA 1GFIA 1E9FA 2IXFA 2AX4A 1KNQA 5CIQA 4ITRC 4OQFA 1ZINA 2BBSA 1R0ZA 2JLYA 2GJKA 1S9DA 1QVAA 2QGNA 1V43A 1M8PA 3UWOA 3RRYA 3KTAA 1YE8A 2DY1A 1XD9A 4FIDA 4YMSA 4PC1A 4S2EA 3N2IA 2NG1A 2GXAA 2X2EA 2WOJA 1AS2A 3SZRA 3VKHA 2JJ2A 3O8BA 2J87A 1UM8A 2B7BA 3AF4A 4YXWD 1TADA 4IVRA 2GCOB 4HATA 2ZRKA 1EFTA 3AVTA 1NMZA 2OFXA 2CCGA 2RGBA 4HEJA 4XWKA 3FKSA 5EP1A 1II9A 5F9FA 1D9ZA 4LJ4A 2GNOA 3TW8B 5E4FA 1I2DA 4V0OA 5IHPA 3K09C 1WQ1R 1F60A 2OSBA 5JLJA 3WBKA 2Z6VA 4M1KA 2P6RA 5FOSA 5CDFA 3GPLA 4DB2A 2QPAA 3VTKA 1XEFA 3MG9A 2YNMA 1NKSA 4HYYA 2B7CA 2JLSA 3FMPB 2WAYA 3LY5A 2ERYA 5C4GB 1W36B 4OI0A 3RSOA 3REFA 2OCPA 3VMFA 3AB3A 4Q1CA 4UKDA 1NN0A 3SJCA 3T5GA 821PA 5J47A 2A78A 2NPIA 1OKKA 5JI2E 1MOZA 2WJYA 5G3ZA 2WTUA 2IWHA 4HUQA 2QA5A 5FTLA 3TH5A 1NSFA 2IYWA 1F3OA 3LBNA 5KSOA 3AKCA 5EZ5A 1R10A 2YZ2A 2ASEA 4R98A 3B60A 4Q4AA 5AK0A 4QHSA 2A5FA 3AH8A 4M1YA 4Q9JA 3WNBA 4WBSA 2P0EA 3BB1A 2YKGA 4ZDKA 2AD5A 3PV0A 3K0AA 3ZVNA 2H16A 3KXKA 4JSYA 4US2R 3ICQB 3B2EA 4OHZA 4DLXA 4Q4HB 4TYYA 3AF0A 3GJ0A 3X2SA 3GLGE 1CULC 3PUXA 1E0KA 3AVWA 2J0QA 3DMNA 4RFVA 3PG5A 1VCNA 2IEYA 2KE5A 2ZAMA 3U3RA 3QKUA 3I8XA 3M1IA 3K70D 2GDJA 2ZJ8A 4MA4A 3U7HB 2NO9A 4IOLA 3W5IA 1XJ0A 2W6JD 2OCAA 4Q9IA 5EXTA 4GOXA 2VHQA 4LWZA 1GAJA 2AXPA 2RGNA 2CNWD 2CE2X 2FEMA 2QSYA 4JT4A 3FMFA 2ZJ5A 1A2BA 3SHWA 2YWHA 1CP2A 1VG1A 2QE7D 4OQLA 3TNFA 2MSDB 4QGGA 1HYQA 3IHLA 4MKHA 4PC7A 4P4UA 3U4QB 4NDZA 1E0JA 3WHKA 3KB2A 4WW0A 4OBEA 2GVZC 4RY2A 3VHXA 1JI0A 4US1R 4O2LA 5DI9A 3VR1A 1DO0A 4BRWA 1W1WA 1WBDA 2EFEB 2ZR0A 1OXTA 2ZRFA 1KSGA 4LUCA 3TW4A 4JLNA 2A2ZA 1P6XA 3K0SA 2GAOA 1EWQA 3ZDQA 2J3EA 4GDFA 2ZRPA 3O8RA 2C8VA 2OZEA 2CLCX 2R2AA 2JLZA 1R2QA 3F5FA 2FEOA 1QHHB 4S35A 2E9SA 2W6ID 1V5WA 4Q9HA 1KZ7B 1PVOA 5D3MB 1SXJD 1ZU4A 1CRPA 5DGXA 2HLDD 3HYTA 5FPKA 4CEHA 1Z2AA 3EARA 3THWB 1ZD8A 3KL4A 4ZDIA 1KJWA 3X1ZA 4UXJA 5AUNB 3KQHA 3WRYC 3I3SR 4G3XA 1C1YA 1QVRA 1E4YA 4V02A 3U60B 2ZREA 3X1WA 4B35A 3BFXA 3QQ5A 2YVUA 4V0MA 4TYWA 3A4MA 2C9OA 4JVMA 4G5QA 1G64A 3A1SA 5EE3A 4Q9LA 3HU1A 3PJRA 4BFZA 5FBVB 3NDBB 2PCLA 3KQKA 3PUVA 2PH1A 2V7QA 4BRUA 1ZRHA 1JAIA 2JJ1D 3CPHA 4B3GA 3C16C 1EFHA 2K5UA 4ZV4A 3RRMA 5IF9A 2ZXUA 1W47A 1LB1B 5K8TA 3WMEA 1JR3D 5FOTA 4RVCA 4MRRA 1G291 1IY2A 1E2EA 4IEEA 2J46A 1Z83A 3B5JA 2DWPA 3KKNA 3SJZA 4AC9A 4N0DA 4RZUA 2BIFA 4JLOA 4NYMR 4PXAA 1JAHA 3QXJA 2BKUA 2OAQ1 3B85A 1IN4A 1G19A 4AG6A 1G7SA 2CLSA 2O52A 2D7DA 1PJRA 2GXUA 3EZ6A 1KK3A 3OEEA 4FD2A 2BHRA 3W6NA 4I99A 1YR6A 2ONKA 3LXRA 2Q3HA 2B8TA 1FNMA 1J90A 2WWHA 2AFIE 2C95A 1T0HB 1DAIA 1C9KA 1WMSA 1OLOA 4L16A 4C0HA 4U7DA 1FP6A 1E79D 4KITB 2DFTA 1Z07A 5JHHB 1XTRA 2SHKA 1ZM3A 1UJ2A 1KK0A 4ESHA 5JZVA 3GD7A 1L2TA 4BLRA 3FB4A 3OFNA 3K0EA 1CR2A 2GWHA 4HAVA 1N5LA 5A5GA 3TSWA 2KJQA 1YR7A 4ZIRB 1TQ4A 3QI2A 4XVQA 3DVLA 1ESNA 2ZI6A 4OQNA 2J45A 3VU9B 1XTIA 3QKTA 1U9IC 4F92B 2WAXA 4NU0A 2O8EB 2MMCA 1XX6A 2QTHA 4IVQA 3TUJC 1SULA 1YZNA 3OIWA 1P62B 4WZAE 2V1UA 5EUMA 1XPUA 2J7PD 3ZIAA 3W9YA 1E9CA 3D6TB 4OI1A 5SZHB 2OILA 4YMUA 4ZCLA 4KJZA 3EASA 1T6NA 3FYHA 4JVSB 4AK9A 3MJRA 2WZQA 1N6KA 3A36A 2HEIA 2IYVA 1OHHD 3CNNA 3DZDA 3GLGA 2A3RA 3TK1A 3VR4A 1Z0IA 1OE0A 3IPYA 1P75A 1SXJE 2AFHE 2N1BA 1G9XA 1XPRA 3CWZA 4D80A 4QHYA 3AUYA 1ZCBA 1OH7A 2ZROA 1F2TA 2F43A 2QL6A 1ZAKA 3S1AB 3QKRA 4PSVA 5AWFC 1N6RA 1KMHB 1U81A 4JVLA 1KAOA 1CJVC 2VP2A 3CR8A 3UPUA 3KUCA 3SNHA 3WMGA 1P2VA 4UNSA 1VCIA 1IXZA 1G5TA 3BXZA
chains in the Genus database with same CATH superfamily
3WDSA 3L02A 4RQBA 2OBLA 2V7GA 3W9UA 1XTQA 2OESA 1ABEA 3Q7PA 4NE2A 3JQ7B 5U4QA 3USES 1L7AA 4IV0A 1MC1A 1N1GA 4J9UE 1Z4MA 3NEPX 2GZRA 2YN0A 1BD3A 4BL5A 4D5EA 2B5VA 2DBRA 1VC2A 3ENZA 5AJZA 5J2TF 1JAZA 1JG3A 3ZZUA 3BIJA 3PEWA 2YOFA 1GZ4A 4GM4A 1GSIA 3DYBA 4P53A 1NLFA 3MK31 1F4PA 4C03A 4GXRA 1BMFA 1IHXA 2HKIA 3IT3A 3OKFA 1HWYA 4W9NC 4LV8B 1QK5A 3FF1A 2P62A 5FBZA 3U3JA 1OVGA 3M33A 1R12A 4BJ5A 3MMXA 3WYEA 1BCSA 4ZU6X 3VSBA 1ZM2A 4RETA 1G3UA 5G0VA 1N0VC 1E69A 1NULA 3DHVA 3F3YA 4LQLA 5KAMA 4EHBA 1YCGA 1C41A 5BUSA 1C7IA 1HT3A 4FCVA 4A8HA 4HLCA 1AURA 3LPDA 3PHJA 3PFGA 1N7GA 4Y2QA 1I4EB 2P11A 1FLDA 3KE9A 4HSEA 3LBAA 2VDUE 4MW4A 5AYVA 5DYYA 1YCFA 4KQXA 1JFVA 4IUYA 1N77A 4H3SA 3ADDA 3UAGA 1XXHB 5BQ5A 4XI9A 4Q3EA 3HZHA 4K0RA 4YJGA 4JR1A 5KYGA 1IWOA 2B99A 1S9HA 1ULBA 2ACKA 1E2NA 4OAPA 1GUZA 2Q46A 4CPDA 2CYAA 4RD0A 4DNQA 4L2IA 1XO1A 4J4TA 4Z4QA 2CDBA 2QVLA 5ESWA 4D4GA 5C81A 1HEIA 4YCSA 4Y7DA 5EE5B 5IVIA 2H4WA 3HJCA 1KDZA 1A4XA 4AZ0B 3DTYA 4O63O 4D4IA 3ITNA 2JJ2D 4FFRA 2Y6UA 4QU0A 1KP2A 5LUAA 3D6VA 1I8TA 4NLLA 3FWNA 4QPZA 4KB5A 4TQAA 4RS3A 4V0NA 3TGLA 4FGUA 2HRCA 4QT4A 4DUGA 3CNOA 1BGWA 4WK6A 3FKSD 1IPEA 3AR2A 3GZ4A 2VRCD 1ULZA 4JP3A 2QRNA 1NTOA 3L7BA 1OT3A 1C7QA 2X0JA 1QO0D 5ENZA 1H05A 2O2CA 4ENVA 1U4OA 1YK0A 3SCZA 2REBA 1BQEA 4R16A 4YJDA 4L8LA 4G1CA 4IIBA 5I5EA 5LQKA 2R4TA 5BNIA 4XTCS 5FCDA 4G1MB 1AKVA 5F2EA 1E6MA 4EKEA 2B69A 5ELMA 2FGJA 2EX4A 2H5EA 2XECA 1LX6A 1W87A 1X8LA 2YNMD 3CURA 3LP6A 3PE6A 4YAOA 5CRIA 2EJVA 5LD2B 4G41A 4NK4A 2ZTLA 4EI2A 1N34B 1XQXA 3AF2A 3MOIA 3TSAA 4Y1RB 5EVCA 2UUOA 4IYRA 2R7MA 3TLGA 4G37A 4NESA 3QE9Y 2O8BA 1C9JA 2G9ZA 4M6WA 4UREA 2GQ0A 4E4RA 1YGYA 1AV7A 1FFCA 2RGWA 3FDIA 5L3RA 1FYEA 3LHFA 4FD3A 4AICA 2FOIA 4TWZA 3ZJUA 2H1SA 3TSOA 4MUIA 2P3LA 1Z33A 2XUKA 3FUXA 3I5XA 3V1YA 2AOXA 2F1RA 4O4LB 4MWEA 4OOFA 2Q7OE 5AOVA 5BRAA 1KO5A 3A04A 1GGJA 2ZBFA 3HXTA 3O21A 2EKDA 2OYRA 3ZWMA 2H57A 2BUCA 1UBLS 3HS3A 1J9ZA 4NEHB 3R8CA 3B78A 5KNBA 2PUDA 4YYZA 1ZJZA 3W5BA 5B6PA 1MB0A 1ZD1A 4D6PA 4JWTA 4R69A 3K16A 2Y8EA 3ABSB 1XROA 4F04A 4LC9A 2CXPA 1FRNA 2W93A 1ELOA 1WMAA 3IP7A 2BEVA 4GMDA 4RUKA 4BVKA 3T7AA 2FFRA 4C1NA 4BXOB 3AV3A 2QORA 4DA9A 3GRUA 4RXMA 4RA9A 5ECWA 4F3KA 3M4NA 2A4KA 1S96A 5BXYA 4F4CA 4OHPA 3ESQA 2Y68A 4GM1A 1DQZA 1PLJA 2QTVB 3QVKA 5D2CA 3D02A 5B3AA 3UO8B 2O2JA 1JG4A 3T1HB 4CM8B 1AZTA 2VVTA 4ENWA 1DVRA 1R6XA 2AKAB 1BDBA 2WA1A 4NJEA 1ENOA 3JTMA 1U8EA 4LCJA 4HI0E 3RC7A 4HV4A 1XZDA 2DTXA 4HYTA 1P4SA 5E9WA 4BO3A 5HQ3B 1U6JA 1AUVA 3KOOA 1USVA 1CNEA 1AB5A 2PLWA 4II3A 4XM0A 4LKRA 5HF5A 1A5TA 4GUAA 1UJNA 2IHKA 1G8JA 4IXWA 1VLQA 1SB9A 4FDLA 2Y1KA 1L4BA 1MOPA 2ZIWB 3DHWC 3E1GA 1E6KA 3SLKA 2PVPA 3S40A 3QELB 1SWWA 1K7FB 1XDSA 3AEKA 3M6UA 5KO2A 1CVRA 4IH9A 5FO0A 3RBAA 4JYCA 5KX5A 1UBMS 1L1RA 2NUPA 1CUEA 4DYVA 1CQIA 1TRHA 4YRNA 1I6WA 4RKEA 3QF4B 1I2AA 1PK9A 1W5EA 3JQ8B 3Q2KA 1J0XO 1E3WB 1E2UA 2DR3A 2OHGA 4CJXA 3JWPA 1QGAA 1FDRA 2I55A 4AAYA 1GG5A 4PYIA 3IEUA 4QQFA 3DL2A 2VAPA 2ZUDA 1F8XA 4MUJA 4NBKA 4QBTA 4W99A 3RFXA 1RWPA 1S02A 3PEUA 4CHGA 4DEVA 4II7A 3UHJA 2JAPA 2NUTA 1KEUA 2C5AA 4P2GA 1DJNA 3S68A 1DEKA 1LW6E 3I5YA 1MEJA 2JLQA 1L8AA 2XOKA 5JSKA 2FHPA 3IQGX 2OA0A 3VH1A 3C6YA 4BVLA 1TMKA 1K68A 1K6JA 1LRKA 3GD5A 3KNZA 2B6NA 3Q40A 1W96A 4JA0A 5DHRA 3R8XA 3LLUA 4FGKA 2E49A 5AESA 1H23A 3HVUA 4LK2A 1YJXA 4IDAA 5GZ6A 1S7CA 3LKZA 1B8VA 4TZTA 4OPMA 3IQIX 2IPOA 2ZSEA 3BHMA 4RF2A 3VH2A 4GZ6A 4MKGA 1V1JA 5C8VA 3PUZA 3CG4A 4TRNA 4CLEA 1IXYA 3HTXA 2Z98A 4YQYA 4P58A 5K0TA 3F74A 1CFJA 3AMVA 3IO3A 4RF5A 4JOQA 1G8MA 3IBTA 4RDHA 5ESRA 2PKXA 5LLDA 2QRLA 4N41A 1Z9BA 1JFSA 2D59A 2JCGA 4GPD1 1N1DA 2AB0A 1LVUA 3COJA 3BAFA 1HE2A 3SF8B 5AM3A 2O3UA 1EVEA 2ZT8A 1E5XA 4B7UA 5L3QB 4NXMB 3MT0A 1CQJA 4BP8A 3QMPA 1MN6A 2ZYWX 3E18A 3L06A 3R6GA 2A88A 5E3HA 3DHYA 5AXAA 1I4LD 5EZ6B 1RJEA 1CY6A 3CVOA 2J41A 4YMLA 1G17A 2AI2A 4P5DA 4EVQA 1TJ4A 2PQ6A 221PA 5I7VA 5KOJA 5DK4A 4BYGA 1U2DA 5MGBA 3ZDDA 1ZUNB 1T9DA 1C8VB 4K9MA 3QM1A 1CW2B 4BFVA 5ALPA 1H4SA 1TCCA 2B34A 3HZZA 1TT5B 3UYLA 4ZYUA 4KAXA 4ARIA 2XRZA 2RAVA 3TQHA 2HWKA 1TU3A 2ORYA 4WLFA 3TJMA 4DEXA 4X63A 1RQRA 3WYAA 4Q6BA 1N57A 4M21A 4AG3A 4EFMA 4M9XA 2YMPA 1OFHA 4OKNA 4X8HA 3VR6H 5E2AA 3OPQA 4E5NA 1IN7A 4MUKA 3LQFA 3OWXA 1XPJA 1X77A 1Z6XA 1ZUD1 1RWXA 1VMEA 4XGKA 4ZP1A 1NQUA 1JEEA 3JR3A 3QJ5A 4G81A 1RYMA 1UC8A 4TROA 1WZEA 2WUDA 1J2EA 1SBCA 2EKQA 3P2JA 2OZLA 3PCRB 3QTLA 4DMCA 6Q21A 1BMDA 1GZ5A 2OCDA 4RVUA 1JNYA 2O8CB 2BEKA 2IYQA 5IDYA 3DMDA 4MV4A 1ECFA 1Z2EA 2CBGA 3LIIA 1Z8FA 2F55A 1UZUA 3VI4B 5CBPB 1QCYA 5GADl 2J9XB 3K9NA 1R88A 4CRWB 2W2KB 3F5MA 4M0EA 4PR0A 1D07A 1NKTA 1GPH1 2HJRA 4D8XA 5DT2A 1NJ8A 3GLHA 3SC4A 3TGPA 3NX4A 1BWSA 1IG0A 2YVKA 4NX2A 4ARCA 2OORA 3AEUB 1L4MA 2C2BA 4FR5A 4GICA 1KVQA 1QF9A 3D8TA 3FCOA 3N7UA 5IYZB 2A9VA 4AF7A 3DBRB 3M4ZA 3CQ9A 2LBPA 4I50F 5AK5A 4F93B 2BM9A 1PWHA 4FHGA 3KVYA 2AOTA 3HU5A 4F21A 3AF1A 2A0UA 3WLSA 4KWIA 2P1RA 4DNFA 1DG1G 4YI3A 5KEIA 3CE9A 4ZI7A 4Z4EA 1V45E 2P9JA 2P9GA 5FTMA 4DQLA 2EZTA 2PX3A 3L6CA 4CM5A 3I6IA 2DG2A 3Q7EA 2OO5C 2QHXA 4PHCA 4RFSA 3VR4D 4MVJF 4MRAA 3Q98A 4JBIA 1U3DA 1UIMA 1X6VA 1Q3HA 4W7HA 3DULA 3AW8A 2IKSA 3CCBA 3HB0A 2W8BB 5FWAA 5GQSA 2X77A 3SC2A 3NYWA 1GRQA 2R44A 1GU1A 3H9GA 4ENTA 1J09A 2RAUA 2WWXA 1A5SB 2IEIA 3U13A 3U2QA 1YS1X 4ND3A 3LGAA 4JQOA 1U8ZA 3ZE0B 3ZWCA 1VHTA 2HJWA 4I8DA 4EFKA 4L0CA 4II2A 3OZ7A 4U7TB 3OC0A 2GZSA 4HWTA 3VU8A 1LTQA 4O0MA 2XUAA 3OZGA 4DC9A 2OLKA 1XL0A 1QZXA 4YP1A 4WMLA 2ZR9A 2H0QA 2YHSA 4RY8A 3TNJA 3GWZA 5KNDD 3OJXA 5K0CA 1OZHA 4RA6A 2OO3A 3IOMA 3UT6A 3E05A 2A33A 1U8TA 4JD5A 4BMVA 4EJSC 4WY5A 1PD0A 2JANA 1PQYA 3L5KA 4KBFA 4V1CI 2CCJA 4D3SA 1SC6A 3BSWA 3BPSA 3I28A 4OLJA 1ONOA 1TM1E 2MIIA 1KMIY 4F4HA 3UZUA 5FQNA 4WDQA 4YRRA 4K87A 4ER3A 1NVWQ 1PUJA 1TPZA 4H18A 3U5TA 2B83A 4ZQBA 2IOQA 4V39A 1PJ8A 4KBGA 3WIEA 3HGMA 1VHDA 4C0SA 5JPIA 2ONZA 1RAGA 1FS5A 3AIOA 4LE2A 3UUFA 3KALA 2OBFA 5ED0A 1A71A 1LFDB 1G4HA 3ZC3A 4DCTA 2FN9A 3DQPA 3NBUA 3R23A 5EJ7A 1YSCA 4WZBA 5JTUA 4O4JB 4C88A 2XB6A 1SEVA 4BE7B 3D7KA 4KX5A 4MI9A 2BJHA 4DV7B 3NWPA 2XTAA 3M6MD 2J3HA 4MWTA 4YUZA 1NJ1A 3HJUA 4UVDA 4OI2A 3Q9NA 2XTZA 3A14A 1ZEJA 1K63A 4QBKA 4FZRA 3SJUA 2RBEA 1ECJA 3VBCA 3CONA 3UMVA 4JUFA 4BV8A 3NJRA 3U1BA 1TX4B 4TUYB 1DV1A 4Q7JB 5AVQA 3P26A 4OM8A 5LOVA 4RULA 3FPCA 4HLQB 1YHNA 2NYVA 2EJBA 3ZOKA 3EULA 5AM2A 1IM8A 1FXWA 2PM8A 2I66A 3O82A 3QHQA 3R7WA 3SVZA 1WPXA 4DG9A 2DH5A 1JEDA 4MDFA 1Z68A 2V3VA 2P9YA 3GEMA 2VK8A 3OA0A 3V6MA 2DSNA 5GZ1A 1GL7A 1VJ1A 4G1FA 2VJNA 5FF9A 3Q12A 2W11A 1PR3A 2QYHA 4EBBA 3WAJA 3TTWA 4YRZA 1NI3A 4MAMA 4LWQA 3CLTC 3RU3A 3BH7A 3T9BA 1C1XB 2QQ5A 5F98A 2B4QA 3UQYS 1PL8A 2EXXA 4QDTA 1IEXA 3LY7A 2VP5A 1PO7A 1JA0A 3VH4A 1F2VA 4DA8A 1TVKB 3CEHA 3KKQA 5EJ9A 4QM7A 2R751 2H85A 2OYSA 2VDWB 1VE9A 2DB3A 3M2TA 4Y9DA 1JAYA 4A0FA 3FCXA 1MV8A 4ZI2A 3U37A 1RZRA 1AXEA 2GERA 3CFYA 4RVHA 1QMGA 1EGQA 1YFZA 1B15A 2HPAA 2W6MA 3MD9A 4QOJA 3WYFA 3G02A 2X9VA 2YC2C 3HKBB 4Q39A 5JO9A 4RF3A 4A0QA 4TKUA 5AVWA 1N25A 4MHOA 2FW1A 2RG1A 4QECA 5HKOA 3F3MA 3LHIA 2BFCB 5HILA 1XCJA 2A1IA 3H4TA 3G2NA 4QBIA 2X1HA 4UNQA 3UMRA 1EDEA 4YIKA 2ZBVA 1LJUA 4C22A 2D1YA 3KELA 3LUAA 4D9CA 2DEUA 4UDYX 4AJIA 5ALXA 1COWD 4E09A 1YGPA 2HAEA 1XNJA 4BV9A 5DRTA 4F4UA 5A1JA 1N6PA 3V6LA 3CUEF 2C8JA 1GFZA 1ZN2A 1NPTO 1JFFA 2SICE 3W2TA 1N5IA 1QR6A 2JZCA 4PQFA 4PCLA 2IYOA 2RJ3A 5EWMA 4ZVNA 4CW7A 4EGQA 5CB4A 2MYNA 3HY6A 4JL6A 1E2LA 4G26A 5T67A 3EC7A 3BXFA 4MRVA 1EFKA 3GHYA 3CVUA 2QVZX 2QYOA 1M34A 3L8DA 1QHSA 1Y42X 3CKLA 5ABPA 1NVXQ 1SXJB 1FJHA 2AFHB 3UB3A 3SJ7A 1LI7A 1M0TA 1G6HA 1XG5A 2O23A 1XFDA 2JDID 2FPRA 3ZQUA 3NUGA 2G82A 4JYPA 2VF8A 3ODPA 1LK0A 1GQOA 2UXDB 2HSEA 4Q7MB 3KXIA 2FPOA 2I80A 1V7CA 4HWKA 3EBPA 4JBHA 4OUDB 3UQZA 2RAFA 2C99A 1SHZA 3G2JA 1YMVA 1E1LA 5CR9A 5LP6A 3MIIA 4RV4A 5DHTA 1RJGA 1QORA 3K1YA 4KVGA 2C98A 3Q11A 2R6R1 5KWEA 1IHOA 3TCKA 2ADFA 5B58C 4PO3X 2AQHA 4M7WA 4QARA 4Z0TA 4IQ4A 3IAAA 5THQA 1D2MA 1LDGA 3HKCB 3D4LA 3FNFA 3MNFA 2XF8A 3NRJA 5HM8A 3AWIA 4KK4A 5ADWA 1JIXA 3I2IA 4UUBA 1SBTA 2YHBA 4NMWA 4ACAA 1GD1O 1JNXX 3A8TA 4KIUA 2PJUA 4ED9A 3PBKA 4DLVA 4HLUA 1RQ7A 2AXNA 4S2UA 2VZ8A 3O8QA 4IR7A 5EJGA 4D9FA 2XMDA 2PH5A 4B47A 1ZVJA 5DBGA 5A6SA 1TT7A 4KOEC 1FYXA 2RK3A 1GILA 3M89A 3IELA 2AN4A 4QYWA 2IH2A 1SXPA 2NACA 4ZT4A 1NUPA 4R1OA 2EL7A 4YUWA 2XXJA 4CKBB 4KJXA 1WABA 3W5DA 3RRJA 1AIPA 3RUIA 2FPLA 4P7KA 3I1JA 1I36A 3VC1A 2OVFA 1Q2UA 2YHIA 4EEXA 4YLGA 1VG8A 1S1CA 2QN2A 4XGQA 4QGHA 5JWOA 4AIRA 5A9SA 3G2MA 3WXMA 4CLRA 1JBKA 2ZVQX 5FKJA 1KI6B 4A03A 1Z8NA 2NSJA 3AHIA 4TLLB 3IGFA 4K9PA 4MWZA 4F5ZA 1KI4A 1KQ3A 1NVFA 3E48A 2JS7A 2P8SA 3KQSA 3O3CA 1VL8A 4LDNA 3WDLA 5KYUB 2AD1A 5D1NA 1WMDA 3D0QA 2PQ0A 4BB9A 4M0KA 3WSVA 4HNUA 4ZQGA 2OV3A 2AKYA 2W9XA 1PDVA 1ATIA 2OCYC 3H5WA 1M2GA 3M6WA 2IPXA 4J8PA 3GEDA 1B0UA 2IW1A 4K3UA 5DTIA 3RRXA 3U17A 2UVQA 3KEQA 2I6GA 1MRNA 1GTVA 2WK1A 4JHLA 3HCRA 4Y98A 5ALGA 3UATA 1QP4A 3LBYA 4G0OA 4LPKA 5COQA 3ZVRA 3F6RA 3Q10A 3UT5B 2WUVA 2XTMA 4UE3S 1NJGA 5CK5A 3W8RA 1N2OA 2OXFA 4ENSA 1F4VA 5FH9A 4YPOA 3Q7SA 3Q5GA 3VX4A 1G8KA 4BLQA 2P5TB 4ZO8A 1PX0A 1UT6A 1PL6A 4BVJA 4Y6GB 4ZCTA 1LH0A 4IFEA 3ZDFA 3I04A 5DLYA 2ZJFA 1R0WA 4X1IB 4DIKA 5JJLA 2BFDA 5L53A 4AFNA 3KYJB 4NU6A 4A1FA 4JI7B 1HF3A 3VYVA 1BXRA 1MO3A 4YUAA 5HHTA 1JH8A 1Q0UA 3L7LA 2BF7A 3FPGA 5F77A 1SZCA 3T54A 3WFZA 1FNSA 3GY0A 1P0QA 1MX3A 4TTPA 4DM4A 1EUCB 1P77A 2HPZA 4BJ6A 3FTFA 2RG7A 3GHHA 4RIGA 2VO1A 6REQB 3QPVA 1YB1A 1R8XA 4YAGA 1AK2A 1KFBB 3L93A 2W42A 3IAS1 3P0RA 4BZQA 4DCNA 1RFLA 3IO5A 3U3MA 1ORDA 1W5BA 2PX4A 3ZVLA 1YIAA 2GLTA 4RSRA 1AF4A 4N4AA 4TSFD 3X1MA 5FYQA 3ZNPA 1NQTA 1RBYA 1SHJA 2EX0A 1EYZA 3E7DA 3E9MA 3EDOA 3ND8A 4PO8A 5AK4A 3LYHA 3SE0A 3ZD8A 4EQ6A 2HA4A 4KXLA 5C8YF 2BGNA 2R6CA 3E3MA 5K0GA 1GPKA 4XCQA 2GCGA 4JUIA 2WF6A 1LKZA 2UVPB 1G1MA 1UKVY 1JQEA 2BGLA 3VKFA 3LT4A 2W00A 1LSUA 2XVXA 3KZOA 1IONA 2FSIA 4NECA 3CF6R 5EE9A 2J3DA 3CZ9A 1TA4A 4XJTA 3RSZA 1E1QD 2ZOSA 2C4VA 3Q2OA 4JJ4A 1M76A 2FN3A 3PGLA 2ZJOA 4GMFA 1E2FA 3GGGA 4RJKA 1ODSA 5EMMA 1QJ4A 4P6VF 2HSJA 3MINB 3PJEA 4PWYA 4M1EA 3UAOA 2BGWA 4HDKB 2KWIA 2ZE8A 2EYQA 3C8MA 4LOIA 5CDUA 2OC4A 1NUHA 1M1YE 1UM9A 2ICAA 2WJAA 4CKEB 4Q1FA 3MWEA 5GWXA 1U02A 4JQSA 1J21A 5JAUA 2ATVA 4NAUA 4QLBA 3GRVA 5MGNA 1WG8A 4DCMA 3GP8A 1BQ3A 2BC9A 3A9RA 4MR9A 2XE8A 3TIFA 5COBA 1D2CA 4WN9B 4ZCMA 4MUYA 3IUPA 1ZK3A 1E3SA 2UV8A 3EVGA 3LIPA 1LNSA 2WYIA 3OWOA 1LV7A 3QLEA 3ZQKA 3NYIA 1V5EA 4MCHA 3L0IB 4LYHA 1W88B 2JFUA 3DV2A 4B1FA 4F2GA 3CLUC 2LIPA 1Z7BA 3H87A 1TVMA 3RHTA 3T06B 2EJCA 1RLOA 3V1TC 3DP9A 5DCLA 3IPRA 9ATCA 2D3TA 3FDFA 1T9AA 4EHFA 5A0VA 4HNSA 4LXIA 3CZ5A 5TQ2A 4DMRA 3HWRA 1DJPA 2BGKA 1HYHA 4IJ5A 4N12A 4BQEA 4L8WB 1G7TA 1G55A 2C2XA 1MO2A 2AJTA 2QD4A 3PKJA 3ND7A 4RFLA 1Y8AA 3ZCPA 3I1IA 1XCOA 1XJCA 2OC9A 3AJDA 3C85A 3CF2A 1ZISA 3L0PA 3EF3A 2GLXA 3TRJA 3JQBA 4GSYA 4B5KA 1PDWA 1QWOA 2R68A 1I7QB 4IPTA 1PYOA 1S2MA 3B36A 3CZRA 5EJ5A 3P9RA 1IUKA 3U4MA 2XCOA 2FVYA 1UBUS 1MH1A 4JU8A 4B6FA 3RYFB 2C9MA 2UZAA 4JITA 1NVVQ 4C7MA 1SXQA 2FXVA 4P7BA 1JPJA 2WYHA 3IUJA 5TPZA 1GFSA 4Q1VA 1Y1TA 1YA4A 1YULA 2FX2A 3IODA 1BDIA 2QNBA 1YU9A 3I9KA 3KYBA 4PSKA 3FAZA 3G5AA 3WL3A 6GPBA 1SMKA 1EUQA 1NN1A 4IXDA 3ZHUA 2GCIA 3UJNA 3K9WA 1NMQA 4NICA 1PT5A 2IHYA 3KZCA 4C87A 1UJ6A 4L8GA 3H18A 4WA8A 4PLFA 2YRXA 4CF4A 1HKHA 4AIIA 1TC1A 2BDTA 4CMHA 4J75A 4D4HA 3VHQA 2O2XA 4I5FA 1OI4A 3I0MA 1Q1GA 2PG3A 2B8JA 1U0OC 3ENVA 2BEWA 3FBGA 4Q03A 4A8JC 3PDCA 3QSYA 3FLAA 4ISBA 1ECBA 2O2EA 3V4ZA 1FDIA 2PAFA 3ZGYA 1X8KA 3F6YA 5B4VA 2AKEA 2Z30A 1MO6A 2YZNA 1N36B 2A5GA 4RDCA 2GCOA 5FXMA 2FE1A 1WZCA 1MU0A 2J9GA 5DHSA 4DQVA 4YIHA 4NJMA 3U19A 4KDEA 2QMQA 4ER6A 4F91B 3N0TA 1DEOA 3ZV4A 5F1PA 3TVDA 1KU6A 4O2AF 4RV9A 3RE1A 1M1XB 4YWJA 1GXSB 2WU8A 5EA2A 3DYVA 4KNYA 3OZDA 3TQIA 4F3TA 1IY9A 4NYJQ 5HZKA 4BAZA 1OLSB 3CLSC 1EB9A 3S29A 13PKA 1NRIA 4Y2VA 5JQGA 3ETHA 4NOJA 1VLJA 5M3BA 4KXVA 2H51A 3WGZA 1IC6A 4HVTA 4LGVA 1SCBA 1QYIA 5JXWA 1PW5A 1SHKA 3MPUA 2XGJA 4P31A 5I8WA 2C0PA 2INGX 5IARA 4LFBB 1GA6A 2QW8A 3IJPA 1LBSA 4GP6A 4JL5A 1PSWA 4ZOAA 5CFLA 4LBWA 2X3FA 1USGA 4Q9DA 1WRBA 2ORIA 3B6EA 2IGTA 3NBKA 1RXUA 3KFVA 4HVAA 4TTQA 3RVKA 2HR1A 5CXUA 3VJMA 2O2SA 1P1BA 4KODA 3K70C 1JU9A 1J5XA 2NU7A 3BL6A 2REOA 3M83A 1HNWB 4YPFA 1VPLA 4H0NA 4QOSA 2H17A 4NKRA 2JGDA 4QXQA 1N3IA 1Q2XA 4PN3A 3SS8A 1BA3A 1OT5A 3JX9A 4Y2HA 1AV6A 4KEAA 1TIPA 1VTKA 1CZRA 3QLTA 4L5JA 1K5HA 2CGEA 2QNIA 1V71A 1YB6A 3S2ZA 3RAFC 3U62A 2Z5FA 3OCZA 3VO8A 3ZQJA 1M6VB 1OGJA 3F8WA 2JDIA 1MTZA 1XVAA 3DE5X 2CXRA 3EXG2 3H17A 3KAJA 4NOKA 3D8UA 4LDRA 1XU9A 5TV2A 1NBMD 2JEZA 4GWLA 4H7KA 5IKEA 4DV3B 1T3HA 1G8SA 3X1DA 3ST7A 4IHAA 3DLAA 5E9AA 4QE3A 5H82A 2JFWA 3RTDA 4IGEA 5FPHA 5SYMA 4EYQA 1E9AA 1XP8A 4I2VA 1QP8A 2GK7A 1WULS 1MOQA 1QSGA 4QFMA 4BPRA 5KSZA 1TEXA 2C88A 1H65A 3FYUC 4HN2A 4EKYA 2EKPA 4L4RA 2C78A 3IALA 1SEPA 2O3SA 5M04A 3FZNA 4DFDA 4G2TA 4XSVA 3RS3A 4LQCA 3CV3A 1MJFA 4NPCA 1WEHA 4PZEA 4IDHA 2GKOA 5C2JB 3WO1A 1ORWA 2PT5A 2QG4A 4JXXA 3DKPA 4FC7A 1PWZA 4F8JA 1T4CA 2PKCA 3FWPA 3MRXA 2P2YA 3LDFA 4P36A 5AOBA 4KLAA 8AT1A 2ZRCA 4XGNA 1XMIA 2VT3A 1CHDA 5CXSA 3A27A 4RH0A 5E7QA 4K9RA 3WYCA 1MIOB 1EFPB 3RAJA 3GAMA 2XT6A 3LDGA 3ANMA 1NOJA 2ASVA 1QYCA 4O5AA 2VT6A 1OJLA 4UFNA 1JLSA 4J0HA 1U1EA 5E1BA 3QWHA 5ALKA 4D0SA 3NI2A 2JIDA 2IDZA 1EXDA 2ODAA 1IAQA 3RABA 3DHEA 4Q12A 4JI2B 2NSYA 3N8GA 1OBVA 2P27A 2GTHA 4JBNA 2PZKA 3G5LA 1E0AA 4AMGA 2IOFK 3SXJA 2ZRLA 3ZXUB 4CTNA 4L02A 3THWA 4OHYA 3LCRA 1NI4A 2V58A 4CQMB 2EW2A 1QZZA 2CSUA 4MMZB 1SVLA 4EPVA 4P34A 4MGYR 2VQ3A 1LX7A 2PU7A 3CNQS 3NCTA 2I3AA 4LNAA 2VDVE 3D3WA 3R41A 1DTSA 2PX6A 2X0NA 2J3IA 1Y1SA 1NYLA 2JIMA 4R3NA 5F1YA 3ZLBA 1IY0A 4D3ZA 3EBLA 1SVOA 3FHCB 4F85A 2ID4A 2OOSA 4DE5A 1ZNZA 3BF8A 4CMEA 2CZCA 3QWAA 3WZLA 3U1TA 4B3DA 3O9VA 1KVTA 2GEVA 2OY0A 5E7IA 4RMIA 1U94A 2VAXA 2IV3A 2EEPA 2FOLA 2YMQA 3NORA 1A27A 1JU3A 4JASB 3RVLA 1E92A 3DQZA 1KH1A 3G0BA 3UJ7A 2P79A 1SD5A 4TTTS 2BKXA 2RH5A 2BFWA 2PO5A 1Q7TA 1RWBA 2O5VA 4J0CA 3ICOA 4YCAA 4D96A 3U61B 1C9NA 1ML4A 1M73E 2ERCA 1YZYA 3C45A 4AMZA 2L0XA 2ILVA 4UD2A 1JDBB 2C1ZA 3AESB 3H6HA 2YTZA 4RIHA 3LUPA 1S3GA 2CVHA 3GH3A 4G5HA 4DSUA 3VA7A 3ER9A 4M83A 3FOEC 5IJXA 4GLOA 1PS8A 3HJGA 4QQRA 3WLJA 5LP1A 4A15A 3VNSA 4H7EA 4LI3X 4KC0A 4YECA 3G8YA 2QN7A 2O59A 1NUUA 4TMXA 1DKUA 1BOOA 1E7QA 4FCTA 4BOYA 5I9NA 3DNPA 3Q6IA 3M3DA 3AHCA 3AERA 3DBHA 4HB4A 1NU8A 2I0FA 4DRZA 1R5NA 3C43A 3OP1A 2ZRHA 2JLBA 3HCEA 1RRGA 1O96B 3QUCA 4Z0PA 3L05A 3AUSA 4ZVMA 1UOEA 5AVUA 3OLZA 1P9WA 4IIVA 3BMOB 3RVRA 3TLXA 5AXBA 5CNMA 1L5KA 5DO9A 5CT5A 2Y1CA 4CCAA 5LPNA 2CZQA 4K9SA 4DXAA 3DZIA 5CFRA 3T34A 2Y0DA 3WK9A 2AE1A 2PS0A 1TAGA 3ZN2A 2IOFA 3GROA 3J80A 1BHO1 3O3NB 4XYGA 4PPQA 4FFNA 4TWJA 1XAJA 2X9NA 2JAHA 4LY3A 2GFQA 3I2FA 3IBFA 3KJFA 3QOXA 3T99A 2VQEB 1GN9A 1R5JA 2EFDB 2ZB2A 3O4IA 1JHQA 1KDTA 1Q92A 4GX5A 1PFWA 5ALYA 1EM8B 1PJLA 4IEFB 4IF4A 1PX2A 3O2JA 3U3KA 2EEZA 3IJRA 3NC4A 1BX3A 1KPHA 2H1OA 1L5MA 4HXGA 4B3JA 1ZG3A 4BX9A 2NP7A 3QFRA 3E15A 1ZW6A 1J00A 3I92A 1KBOA 1FU8A 3PFWO 4KVAA 1R3DA 1R6UA 1CIJA 1RYDA 1U0HC 1YK1A 3GJTA 4L5BA 3SJBA 4A7PA 3EPHA 1GDDA 1GRVA 4ICIA 4B31A 3E03A 3T5BA 3BGVA 3SSNA 3E2MA 1AGNA 4KZPA 5FA5A 1PNTA 1X7YB 2A4MA 2WHEA 3HUDA 3X1YA 2R1TA 3S2IA 1DKMA 4GUDA 4RWZA 1SG0A 3CRZA 3URMA 4OHMA 4HZUB 3V46A 5AICA 4UOEA 1GAWA 1ODCA 3PD0A 4JROA 4O2BB 3VGJA 1RVDA 3WNDA 3GFBA 4KSYA 4DR7B 3L6RA 4LRWA 1LD3A 3GFPA 5ARDA 3T3NA 3SG0A 3D8SA 5I47A 1JLKA 1UEIA 4LZOA 5DLEA 4B84A 5KVAA 1UEJA 3A4IA 1GAXA 4F3NA 2QAGC 2OBXA 3SXUA 1Q57A 5B55A 2AYYA 3K96A 4ZZ0A 2YWXA 1GAQA 3BXGA 1KMHA 1Z0JA 5HJ2A 4IUBS 4BBAA 4PFSA 2Q62A 4UU1A 5CB6A 2RHTA 2VN8A 3GRZA 3HCNA 1K8YB 1G9SA 3T4UA 3TZEA 4TTSA 4RJTA 1XZKA 2YYSA 3H8VA 4KXYA 5AM1A 3KSBC 3X1JA 4AMYA 2C2KA 2G77B 2YL2A 3CIFA 3KQPA 1QU2A 1NVUQ 4NCAA 3P9KA 1DL5A 4EABA 4DT1A 1DDIA 3JQ7A 3ZHQA 1GLGA 3D81A 5F1KA 1T26A 1E9EA 3KQNA 3FWZA 4YX9A 1ZOOA 5E38A 5EKDA 4CV0A 4HYQA 5CHEA 2H07A 3M5PA 2YZGA 4FDMA 4TPKA 1Z56C 3CCFA 3TPFA 1Y8ZA 4IDBA 4ARZB 4HLDA 3EZFA 2HV9A 4M9CA 2JFYA 2X9LA 4JS0A 4BFWA 1E7WA 1K97A 3AHGA 4CM7A 4LBZA 3H5AA 5DEOA 1MQAA 2B2XA 4MVJI 3UMJA 5JBQA 1KRXA 4V3BA 1R5OA 1B2LA 4GZMA 4NYMQ 2ZUUA 4BQQA 3RGWS 1QK3A 1V6AA 1ZM7A 2PWPA 3DOJA 1UJ5A 5LXTF 5CH3A 3G23A 3GIWA 4NZNA 3MD0A 1II8B 4RIIA 1G4UR 4QXPA 1DQPA 4N3CA 1V37A 3G1WA 2JJ8A 1Z4LA 2R8XA 1AGXA 2XUOA 4IMJB 5ESXA 3BXOA 4ZC8A 5EY5B 4OJMX 1XXHA 1L0BA 4UVIA 3K09A 1FTYA 1NLUA 5DGHA 3V4VB 4YRAA 1JMKC 1OILA 3D8RA 4QKQA 2G1UA 2G0TA 3AJEA 1T29A 2J3MA 4FW9A 2A8YA 4QQNA 1NYTA 2ECKA 1V8BA 2FWJA 4O0LA 2PGOA 4R0VA 2F1IA 4XYLA 5EP4A 5B5SA 3HPRA 4ZOLF 4DT1B 3REQB 4AZ0A 1XMQB 4TS1A 1QLJA 3C5WP 1MRZA 3WTCA 4BTVA 5ICCA 1P2GA 3FLEA 4N9WA 5INTA 4A6PA 3I1FA 4LSZA 2HK6A 2MJLA 4QASA 1UF9A 4RK7A 4C01A 2HYIC 1U8CB 2EG5A 3ANTA 4FEEA 5BVHB 1H22A 3BD7A 3ZDYB 4DXHA 5FBHA 1XZQA 2ZWIA 1M72A 1ZRMA 2AQIA 2GRAA 2IK8A 5ECYA 3SIPA 4C0JA 4QBFA 2PRJA 3NBFA 3QU4A 5IZCA 4L9RA 4L0MA 4MQ6A 2IIVA 4XXHA 4B0PA 1ONSA 2XMZA 3N5CA 3OOWA 4RTKA 4HDMB 1OY1A 3P2IA 4I1UA 1L6RA 3AEYA 2HZBA 3L1KA 1NP6A 2NZUG 4Q4LA 1EK2A 1ZOSA 3U7EB 3ZY4A 3BWMA 1SQSA 4JENA 5AR1A 1VPVA 4ZVTA 2BMWA 4WINA 3QVTA 1JQJC 1E9DA 3PFKA 3PICA 4Y1RA 4Z7OB 5J5AA 2GN2A 2ZSJA 2Z6QA 1E1DA 1H2WA 4IFBA 4MLCA 5FFFA 1U1CA 3LLSA 4CE6A 5JWRA 2CL0X 3AILA 5LDDC 1L7XA 4Q37A 4Q24A 4A2QA 4DMGA 4E7PA 3O6VA 1X1DA 4P3YA 1K92A 1P72A 1KNXA 2H8KA 4L7VA 3QY0A 1WQ4A 2ZWPA 3SJAA 3TNDA 4MP6A 3FSGA 1Z88A 5KJEA 3K15A 4EKDA 1ZSNA 3LC1O 1R0YA 2ZXFA 5E2IA 4GP9A 2J85A 1IUOA 5F4BA 3HJFA 3WG9A 1H4TA 1NQVA 1BKYA 1J49A 1XI2A 2VBGA 1PEYA 2XY4A 3FKQA 4KNVA 4EIWA 2JKZA 1Y7PA 2J7KA 4XVCA 1WY7A 1ZSYA 5IFLA 3B6KA 3NDRA 3O84A 2IP1A 3TLEA 4AZVA 1Z6TA 2AEEA 4H17A 3ZZ0A 4UZFA 4NNPA 3HI6A 4UATA 3DL4A 2O3TA 1A96A 3PFBA 4FGLA 5JVDF 3GLFE 4E30A 2R6FA 4AY5A 5TIIA 1REQB 1M1YB 1F0NA 1U0SY 2JFOA 2QTVA 1LDYA 1FRFS 4HX2A 2JGKA 3KAQA 4Q4DA 4CM8A 2CJWB 2HF8A 4LNHA 1X86B 1ODKA 1E9SA 1RMQA 1OWMA 1LTHR 2NTYC 1ZICA 4JEMA 5FOWA 4HUTA 4JI1B 4JK3A