1YZTA

Gppnhp-bound rab21 gtpase at 2.05 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
155
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
total genus 53
structure length 155
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yztA00
4GP7A 1G3IA 3GJ6A 1EK0A 1NSTA 3B13B 3GLFB 4Q9LA 1E1QA 1E69A 1OF1A 4IOLA 1HT1E 4ZKDA 2ZSEA 2Q9BA 1S1MA 1XTQA 1T91A 1WQ1R 4G5QA 2HXSA 3SBEA 1B23P 3OEHA 1P9WA 1XF9A 2CE2X 4JJZA 2DWOA 3C14C 3EPJA 2FE4A 5IDVA 1HY3A 3KDSE 1OB2A 3W34A 2A5GA 3WMGA 5AWFC 3W6OA 3RC3A 3R8FA 3HDTA 4M9ZA 1PLKA 2GA8A 3DMDA 3CO5A 5AUQA 3U6BA 4QBGB 5B57C 2RGBA 4HUQB 1XNJA 1G7CA 1E2GA 1VCIA 4KAXA 1M2OB 1Z6GA 3IQXA 3IEVA 1TQ6A 4KFTA 1E2NA 4Q19A 2ZJ5A 4KBGA 3GLFA 2R65A 4FW9A 1ELOA 2RGCA 1R7RA 2H57A 4QRHA 1KDPA 1NN3A 2J1LA 4TTRA 4AI6A 4HATA 4Z1MA 3THYA 2CK3D 3IEUA 3VNVA 3HR8A 3BS4A 4FMDF 3ECCA 4P31A 3VNUA 1T3SA 1Q12A 3C16C 4EFNA 1IN7A 4PANA 4KVAA 2WV9A 3CNLA 1JNYA 2WJYA 3MWJA 2IXEA 4BUJA 5J4LA 2FU5C 4A15A 3HU1A 3THYB 5L8VA 5LDDC 3KQLA 4H9GA 1IY0A 3Q8XB 3AKDA 2V7QD 2ZUBA 5KO2A 1ZNXA 2DBYA 2ZEJA 3HR7A 5UKDA 2QAGC 5CM8B 1X6VA 2BJWA 4LJAA 1DAKA 3FMPB 4NPHA 3R9WA 5AUNB 4F4CA 5JJLA 4DVGA 1O87A 2ZSFA 4KLNA 3MJRA 1OXSC 4IOMA 1YR9A 2TMKA 3LV8A 2G1KA 3B2EA 4Q01A 1TF7A 1DG1G 2DFLA 2WM9B 1Q1EA 1N5JA 1KO5A 4JLKA 3IIKA 4P33A 2GILA 1TF2A 3LLMA 1DE0A 5EXTA 1XD9A 1VG0B 5EE9A 2HJVA 3AVYA 3QEOA 2OLKA 3TH5A 3ICQB 1P2SA 3O47A 1G64A 4N3NA 2OXCA 4WZ6A 4DZZA 1DAMA 4B6EA 3X1WA 2IS6A 2QPAA 4DB2A 2A5FA 4RD0A 2CBZA 4F7WA 2ZAOA 2O0HA 2HCJB 4EQ6B 3ZZTA 3NC0C 4D0LB 1FW6A 1MT0A 3WYFA 1E9FA 3I72A 2YZ2A 3DKVA 1LF0A 2ZVPX 1SXJE 4DSOA 2GRJA 1I4DD 2ZYVX 1W2HA 2FZLA 4A8JA 2PJRA 3PQCA 5CK5A 3FHCB 4XVQA 5GJCA 2OCPA 4IRUB 1ZNWA 4DDTA 1E99A 4V03A 4LC0A 1VCMA 1XZQA 1G17A 3AVUA 3U44A 1ZMXA 1ZYUA 3D3QA 4XD7A 4Q4HB 1VECA 1VPLA 4A0HA 2C96A 1JALA 2ZRIA 4LBYA 1UF9A 3PIRA 3KQNA 1ETUA 3ZYCA 4ZDWA 4QNRA 1KKLA 4NBSA 3KXIA 3UWKA 1MRSA 1E2FA 2NZ8A 2C9CA 1GUAA 4DT1B 3T1VA 2IXGA 3T61A 2CMKA 5DN6D 1YZKA 4U5XA 1XEFA 3CPEA 3Q5EA 1H8EA 3ZGXA 4XWOA 3IDQA 1N6LA 4MH0R 1ZU5A 1Z0AA 1ZC3A 3EW9A 3GFPA 4GOJA 4W5HA 3LY5A 4FCTA 1YR6A 3FGNA 3ZQJA 3PUYA 3AUXA 2W6JA 1Z0JA 2R62A 3HJNA 4PQYA 4D4KA 2WSMA 1YHNA 4M1TA 5F9HA 2WPDD 1P60A 4TWZA 1CRPA 1U98A 4MGIR 3AF4A 3K0SA 2ODNA 5DE3A 5EE3A 4ZCLA 3U6KA 3EPHA 3K9LA 3BFKA 3M6AA 3HYRA 3MFYA 4R2HA 4LHWA 5G53C 3RLFA 4TT3D 1NNEA 1W48A 4HAVA 2R6FA 3U3KA 3IQWA 3FMOB 4S35A 5EP2A 4I99A 2WZQA 5DO9A 1TL7C 3OE7D 3AVQA 1W46A 3BE4A 4OQFA 2NIPA 3QE0A 2VA8A 1KSFX 1E98A 1OW3B 3OAAD 1M7BA 3GLHB 3U7HB 2VL7A 2E87A 4PFSA 2VH5R 3UG7A 4PAQA 3VR6A 1MRNA 3SQWA 2P6NA 2C04A 1L8QA 3F3YA 4ERNA 2REOA 2IYQA 4TL9A 3JZMA 4FMBB 4GP6A 3AV0B 1OXVA 4ASUD 3ICEA 1E1QD 4FMCB 2IL1A 1WDTA 1AS2A 2OG2A 3NTUA 1OE0A 3CWQA 1FOEB 4HAXA 2ONJA 3RWMB 4NYJR 4NCKA 2WKRA 4PPFA 2XSZD 4Q9HA 1U9IC 1JB1A 1U99A 4JKYA 3CRMA 3A36A 2XXAA 2BMJA 1SZPA 3CBQA 5F98A 3BXZA 1QHYA 3N70A 4XWKA 4Q4JB 1OB5A 4X8MA 2XTZA 4DEYA 4DUGA 1Z0DA 1CIPA 4K46A 2I3BA 2IXFA 3IIJA 4TMZA 2OBMA 1KDTA 4DWJA 1SKYE 4AG6A 3SNHA 2Q6TA 3KL4A 2G83A 2Z4SA 3PVSA 2GZDA 5FL7A 3OFNA 4M1KA 2ATVA 2VHJA 1QHSA 4W5JA 1DOAA 1W49A 3U2QA 1JR3E 1MR3F 2ZE7A 2ZI3A 3KJGA 4LX0A 4NYIQ 5LB2A 2WAXA 4L15A 2FPMA 2VF7A 1JQJC 3IPYA 2J0SA 1RKBA 3BFVA 2QY9A 4HEJA 3CF0A 3A1WA 3WYAA 4LPKA 1NN1A 2EQBA 2F9MA 1PVOA 4BLOA 1YZLA 2WTUA 1XDBA 4LGMA 4Q02A 3E1SA 5F2EA 4UNSA 3ZVRA 2JIZD 4BE7B 3THXA 2R44A 4OKSA 4B73A 4Q00A 2HLDA 3Q72A 1GL7A 1XTRA 4I4LA 4F92B 3WBKA 4IEEA 4PHFA 2IYUA 4G01B 1EG7A 4OQMA 2FG5A 4DDUA 2AWNA 3RS3A 3U3JA 1L2TA 1MABB 1A82A 1T9HA 3BERA 1R10A 2RGAA 2CCGA 3T5DA 5KYKA 4TMWA 2QE7A 4LZZA 3AB3A 3K0AA 1BO6A 4B34A 3K70B 3W6NA 3I73A 3ZZ0A 4BLPA 5J47A 3LBNA 3EZ7A 1CR4A 5FUYA 3QNUA 3A4NA 3GJ0A 4JSTA 4R2IA 2YVUA 2OUKA 1EXMA 3BB1A 5L3SA 3QF4B 4HDCA 1P62B 5FUXA 3B7GA 1UJ2A 1XTIA 5K8IA 2F1IA 3RNLA 2ORIA 2ERYA 3QUSA 4JL6A 1UDXA 2REXB 3WBJA 4ZDIA 4URWR 3AVTA 1IN6A 1S4QA 1G8PA 2XZOA 4PC2A 3HPQA 1RJ9B 4QGAA 4BFVA 3S1AA 2QAGA 1EESA 2JIZA 5FFMA 1S3GA 3P27A 3CH5A 2AWOA 4WXRA 3RS2A 5AJYA 4JL5A 3ZS9A 1II8B 3TIFA 2QUZA 5HCNA 1XTJA 5J40A 3VR2A 2ZRCA 4BFYA 1UKVY 1DO2A 4AKIA 2CNWD 2A3RA 1W0JD 3GJ5A 3FYHA 1I2MA 1Z6XA 3TW8B 1XMJA 4HB4A 5FL7D 4ZI2A 2DCUA 1C9KA 4LSGA 2NG1A 2C5LA 1NVUQ 2NMVA 3ZVNA 2Z4RA 2EYUA 3HWSA 4JBWA 3B1YA 5CB6A 4HDOB 1TU3A 1ZBDA 2ZJAA 821PA 3ADBA 2IYWA 1SKYB 5H1YA 2HF9A 4XIGS 5EE1A 1P72A 3MJHA 2QMHA 1KAOA 4P32A 4A1FA 2JASA 4PX9A 4A2WA 3DKPA 3ZVMA 4C0LA 2C99A 5L3QB 3NC1C 1OIVA 1OIXA 2C8VA 4DIEA 3NVAA 1JECA 1G7TA 2GAAA 4ZI3A 2F3TA 4Q18A 1DS6A 2HJGA 3IBGA 1AQUA 1JXOA 1D2MA 2RGDA 1E79D 1AK2A 1N2CE 1VYVA 3U3OA 5BXQC 3A1TA 3KKMA 4QHTA 3P4YA 5B58C 5CJPA 4BFZA 1T8TA 1OKKD 5DI3A 4ILEA 4QOSA 5CM9C 2QPOA 5LPNA 1IONA 1E9SA 4GPTA 3EA5A 1Q1QA 1L7VC 2VSFA 4AYTA 2B6HA 1HYQA 2W6ID 3OAAA 4X8HA 2CCKA 2QI9C 4FCWA 4DC9A 1WB9A 2CL6X 2GCPA 1XX6A 4URUR 1MH1A 2C03A 1U8YA 1Z6TA 3R7WB 1ODFA 3FHOA 4QL3A 4ASUA 3GEIA 1FQJA 2ZJYA 5SZJA 2QTHA 4NCNA 1R8SA 1BYIA 2J45A 5AJVB 4ZDKA 2AK3A 4A8JC 1MKYA 1CEEA 3U61B 4OI0A 3D8BA 2FFQA 1AIPA 4JL8A 2IC5A 3K9NA 1XZPA 4YMVA 1K8RA 1NY5A 3PUZA 1E9AA 3LO5A 3EAQA 4KJZA 3H4MA 4GOKA 3SJCA 5IF9A 1VMAA 3THXB 2EFCB 4IKEA 2HUPA 4TT3A 1KMHA 2ANBA 2YHSA 2YWFA 1A2KC 2VPPA 1LS6A 5HCIA 1Z2CA 3L82B 3LBIA 4JVMA 4LJ9A 4LYAA 2VO1A 3B9PA 3LH5A 4GZLA 3ADCA 2QGNA 4OYHA 4MDEA 4MGZR 5FOXA 4AKEA 1GITA 1DTSA 4M1MA 4AKGA 1KDRA 2CEAA 3UMRA 3VR3A 5FBVB 5JCPA 4P3YA 1G7SA 4TN1A 3LWNA 3RAPR 3TW4A 3AEZA 2B7CA 5DIFA 2VP4A 2BEKA 2F43A 4A9AA 1N0UA 4AK9A 4A92A 1RRCA 1ESMA 1RW4A 1XCMA 4FMDB 4A6XA 1SVMA 1N25A 4BZQA 3OIVA 3TLXA 3R20A 4LC1A 3BBPA 1SVWA 4PTLA 3PFIA 5CIQA 4TLAA 4OHWA 2AHOA 1CULC 2PH1A 3LRPA 1J8MF 4LPSA 4AC9A 2J87A 3RABA 2GHIA 4NYMQ 1R5OA 3GLFE 1XMSA 3RS7A 1G3UA 1R0ZA 1XCPA 2ZITA 3RANA 4XD7D 1XBTA 2QG6A 2RAPA 2ZAMA 2WWYA 1K5GA 2ZI6A 1GL9B 2Q9CA 2V55B 2IHYA 2CDNA 4LBWA 3T06B 3C8UA 3ZH9B 1GL6A 1F6BA 2O5VA 3IBYA 3SJAA 3UKDA 3FFAA 2ZYUX 1ZINA 2JLRA 4HZIA 2KBFA 4IVRA 2A5DA 4QKQA 3GJ7A 4ITRC 2QU8A 1HE8B 2N1BA 1ZD9A 2UVQA 4KU4A 4Q7KA 3W5JA 3QKRB 2IYRA 4NH0A 3CX8A 5JHHB 3GJ8A 4NCHA 3LXXA 1PV4A 2IYXA 4IVQA 1SGWA 1AKEA 3JVUA 3W8NA 3RYTC 5SZKB 3SC3A 4BFWA 2PX0A 3DZ8A 3FMFA 5DHFA 1DG3A 3VU9B 1OFIA 1KY3A 4E09A 5E95A 3MAAC 3CPHA 2GCOB 2BKEA 4AG5A 3RRMA 1U9IA 2ZETA 4KVGA 1Z3IX 1XMVA 4DCVA 2V7QA 4C0HA 2XTNA 2EW1A 3LLUA 2P6RA 1WF3A 4KSBA 5J4VA 4PZLA 3NEJA 2AR7A 3ASZA 2Q0HA 1VKJA 2QNRA 5IRCD 2FNAA 4FN5A 1D2NA 1VYTA 5TY0A 1RC8A 4G5SA 2GAOA 3AVXA 1N0WA 3SYKA 5TMPA 1AZTA 1QBKC 4GMDA 4LJ8A 2PZEA 1E9CA 1PUIA 4G1UC 3GJ4A 3U7GA 1I4LD 5A5GA 1U0HC 3IHLA 3CONA 1CBUA 4QM7A 3THOA 1XXHE 3LVQE 5JHGB 1PLLA 3GLHE 5IHPA 1QZXA 4Q4AA 2PT5A 1E4VA 4JYBA 4NTZA 3TQFA 2JJ1D 3WP1B 1GWNA 5J4HA 1HT2E 1TEVA 1U94A 4LV8B 5E7JA 5FPYA 2NO7A 3F8TA 5CDFA 1VIAA 3L43A 1MABA 3PG5A 4ZKEA 5JRZA 4A8JB 3BH0A 1E9RA 3TSZA 5TDHA 5AJXA 1D9ZA 5HR5A 5KNCA 2DFNA 4G5GA 4ARZA 3AP1A 1R5BA 1IXZA 3V00A 3DL0A 4Q9JA 3SR0A 2KWIA 5FOSA 3VX3A 3Q5DA 3C41J 3X1DA 2H18A 1Z06A 1R2QA 2CHQA 4Z1MD 3G5UA 4JLOA 1W5TA 4C0KA 1Z2AA 1JAHA 3NIBA 2ZJOA 3DO6A 2XGJA 2QAJA 1KJZA 3R9IA 1Z28A 4M8NE 3LDAA 4BLTA 1B0UA 1HEIA 2C9OA 1NN5A 1YQTA 4PR0A 1S9HA 4HYYA 4DEXA 221PA 3EWAA 3P20A 4TQ9A 4F93B 5FOWA 4RKEA 1YU9A 3PUVA 5AR1A 4FWTA 3FWYA 2FFAA 1LVGA 3B60A 3LQQA 3X1XA 1Z0IA 4Q4JA 4BWYA 3L0OA 4MRSA 4HAYA 3X2SA 4XVRA 2FDCA 1GG2A 3WNDA 2BMFA 2Q3FA 4IOKA 2JLUA 4W5WA 4Q4LA 3CRQA 2Z6VA 3K8YA 3W5IA 3NBZC 2JLZA 4FMCF 1E4YA 2W6JD 4HZUA 2KBEA 2QN6A 3GCGA 4KO8A 1K6MA 1QHNA 4I1SA 4BEBA 2OAP1 4MKHA 3U4QA 4R98A 2I1VB 5FOUA 4O3MA 2WKQA 3D31A 2QRNA 4GSYA 2JJ2A 4JLJA 1G3QA 2ZU6A 4MYUA 4UJ3A 1CJMA 1XJQA 2CLSA 5DYGA 5HTKA 4ESHA 4TZ6A 3THWA 4LYHA 1K5DA 2IA5A 4HAZA 4QGHA 5BN4A 1NY6A 2AXNA 4O0MA 3RSLA 3V4RA 2FFHA 1ZP6A 4BLQA 2XAUA 2ZQ5A 5C2JB 5D3MB 2O8FA 1EFRA 1N5LA 4HB2A 2JA1A 2HYIC 1SVIA 3A1VA 3P26A 5TXGA 1D8TA 1KHTA 4LUCA 4M2LA 4HZUB 5K8LA 4BPBA 2WJJA 5JECA 3QXJA 4M1YA 3QBVA 4Q47A 4V0LA 4P4SA 2C95A 1HUQA 3PJRA 4B2PA 2PEZA 1KI8A 2GEVA 4JBXA 4PPNA 5DH9A 4YMWA 1G8FA 1NLFA 2XJ4A 3CR7A 5KSOA 2UKDA 3F0TA 5L3RA 1P3JA 5GVSA 3REFA 2R6DA 1Y63A 5FTJA 2YOFA 5KDDA 2ZJ8A 2EU8A 2J5XA 3WNCA 2V54A 5AJWA 4A4DA 2BDTA 2IS4A 2B8TA 3L0SA 4Q1AA 1A7JA 4DCTA 4BRWA 1MO6A 1UDWA 1NBMD 2V1XA 4EPRA 1E0KA 2QROA 1XRJA 2IUUA 2YWHA 4PZYA 2ZE5A 1AM4D 1VTKA 2BCGY 3QQ5A 1TUEA 1WXQA 4QJ4A 4B33A 4D4JA 5JS7A 1VHTA 2QP3A 1FX0B 1TQ4A 2J0UA 3H0KA 4XTRA 1ZM7A 1J99A 3AVOA 4OQNA 3RS0A 1G41A 1CXZA 1G5RA 4LBZA 2QSZA 3RVBA 3SYLA 4WVFA 1P5ZB 4KI0A 3K0FB 2WMOB 1Z22A 2OESA 2QM7A 2XZLA 4C30A 2ZUDA 1M7HA 2O8CA 4Z54A 4WXPA 5EUMA 1X86B 4HLUC 3DOEA 3SHFA 3A1SA 2GXSA 4DLTA 1GDDA 2W2VA 1H8HA 4DSNA 4PC6A 4L9WA 4UJ5A 5EXPA 2ZROA 4ACBA 1COWA 1LV7A 1QRAA 4MYHA 3TQCA 2VQSA 1JR3D 4NP6A 2JLYA 1LFDB 4E5UA 1G4UR 1FX0A 5CJ2A 3TR5A 2W2TA 4TQUS 1XD2B 2B8WA 2QP9X 3JZAA 3RWOA 2ZSAA 3FKQA 3QBTA 4DCUA 4EUNA 1KO4A 5KUTA 3ND8A 4TMKA 3TKLA 1NP6A 4B2LA 1IJEA 2J7KA 4WA7A 4FCVA 4ZIRB 2EWWA 3LXRA 5JRJA 1AGPA 3L2OB 5CITA 1JQLB 3CPJB 1T3LA 1CP2A 4V02A 4FXPA 3WHKA 4P4SB 4BZPA 3Q7QA 5B30A 4M9SA 4OI4A 4PHHA 3P4XA 3LX5A 4EPWA 2HCBA 4B76A 5D3QA 4OK6A 4JT4A 2GK7A 1D5CA 4ZIRA 3EIQA 3BORA 3SHWA 1DARA 2A2ZA 2ZS8A 3LFUA 1W36B 1VCNA 2ECKA 1Q3HA 1OLOA 3CRW1 2VP5A 3I5XA 2A9KA 4CEIB 4Y0VA 4XTCS 4NCIA 2EYQA 1NG9A 2JLSA 1G8GA 5LD2C 2JJ8A 3QXXA 1F3OA 2VP9A 4JVNA 4M9QA 3UWOA 3U44B 4B3GA 4B6FA 2WAYA 3FDIA 1BMFA 3QEJA 3GEHA 5HE9A 2W6IA 4US0R 1M6NA 3X1YA 4AWXA 4EFMA 3SDZA 2YNMA 3LAWA 4KYUA 1OT3A 2BBSA 1RZ3A 1GP2A 3HP1A 2ZYTX 2IW3A 3QXSA 3KTAA 3RRZA 4RSGA 4OHVA 3SZRA 3EIEA 1ESNA 1P2UA 2W0MA 1WBDA 3VHLB 2Y8EA 3KKNA 4YDHB 1C1YA 1T0HB 2Q21A 4DSTA 2G6BA 3W8RA 1GKIA 1OIWA 4OQLA 3QJYA 2ZE6A 5FBWB 2CCJA 3L8YA 4WOPA 4PHTA 1DAIA 4BZXA 3WRYC 1F2UA 5TVKA 4BRUA 4EQ6A 1P6XA 1VDZA 2BMDA 5KSZA 1QHXA 4KHZA 1E2KA 5DNYB 3BFXA 3KFVA 3MMPA 4CRWB 4YXWD 3GD7A 2HT1A 3N2EA 2XOKD 2IS2A 3AKEA 2ZRLA 2YOGA 1CLUA 2CLCX 1Z08A 3EZ9A 4KODA 4DLRA 2QMOA 3AF1A 2F3RA 3P32A 2FN4A 1P61B 3QG5A 2G77B 1E1RD 3GQBA 4M4SA 1FUKA 2WWHA 3BWDD 1NI3A 2OM2A 1HQYE 4BECA 1L4UA 4BLSA 4C7OB 2D2EA 4TMTA 3B1WA 1RYHA 3VR5A 2QT0A 2BCJQ 2FSFA 4J0QA 4ARZB 4G3XA 1E2DA 1Q57A 3CW2A 3C5HA 3CKLA 4O2LA 3OHMA 3SU8A 4B75A 1U0LA 1R0XA 1Q21A 4M22A 1W7AA 4O25A 1GILA 2GCNA 3K0AB 4E07A 1KI3A 5LBIA 2KB0A 3RDPA 1KK1A 1KI1A 2OSBA 2ZM5A 4MGYR 3E5HA 2DFKB 2GVDC 2GVZC 3V9PA 3CUEF 3GJXC 3LW7A 4BFTA 2V3CC 5CK4A 2IEYA 3CF2A 4BFXA 4A36A 1J90A 3E70C 3KB2A 4K81B 4B74A 4UKDA 3TJZA 5KU1A 2ZRDA 4Q4AB 1U0JA 4MYTA 2DR3A 3MGCA 2E1RA 2ODEA 2B21A 2PT7A 2X19A 3UXMA 4YQFA 1YZNA 1RRGA 1UM8A 2F55A 2QT1A 1AS3A 2FPKA 4MKFA 5LB4A 1LF5A 1JBKA 3TVDA 1IOZA 4BASA 1PZNA 2KJQA 3QKSA 1W0KA 2ZREA 2CHGA 1EWRA 2GCOA 3PUWA 3AGPA 3KKQA 4I1UA 3BB3A 5DYIA 2CE7A 4LWZA 1OHHA 1UBEA 3N5CA 1F2UB 3SI7A 3T12A 3ND9A 3B5JA 4PPGA 1TNDA 1GFIA 2F43B 3C4JA 4Q7LA 4RFSB 1GVNB 2GJ8A 3LQRA 2PCLA 3AH8A 1G1MA 1KOFA 3ZLJA 1BKDR 1NN0A 3KQKA 4RZ3A 2YJTD 4MDFA 3PUXA 5DGXA 1KNQA 4TTQA 5FOTA 1SVOA 3THWB 5SZIA 3DZDA 5KSYA 2ZUCA 2O8BB 4M0LA 3AKYA 3CIOA 1DELA 1NKSA 1OFHA 5M04A 2AD1A 3BRWD 3MWYW 1ZUNB 3T1TA 1U8ZA 1E1RA 1E2JA 4B71A 1LS1A 3OEED 4B35A 2B7BA 1UEJA 2K5UA 5CLQA 3WNBA 1XXHB 2RHDA 1AJEA 4DCSA 5KNBA 4Z8YA 2WIAA 1OXXK 3BGWA 3VHXA 2FSGA 1U81A 1Z0FA 1E2HA 2QENA 2DY1A 3SFZA 3H84A 5JLJA 3GMTA 1XCGB 3AF2A 4KCGA 4RZ2A 1S8FA 1Q1ZA 1FL9A 4GI7A 4TL7A 4IDPA 4YMUA 4TSFA 2QBYA 1KAGA 3DVLA 3RSOA 1N6HA 5FR1A 4OBEA 2XTMA 2IYSA 3H2YA 4LJ5A 2RGXA 1DPFA 4MA4A 2MSDB 1RRFA 3NH6A 1FPMA 1F60A 1X8LA 1US8B 4Q7MB 4YMTA 2BVNA 4WW0A 3UMSA 5FBQB 4XVUA 3E2IA 4EPXA 1F2TA 2Q3MA 5KDOA 4Q7JB 3OIYA 2ZI9A 3IPXA 1OFUX 4Q48A 4B43A 4U7DA 3B78A 3I8SA 2HF8A 2OCAA 1W2GA 1U90A 1UBCA 2ZI7A 2VIIA 4BLRA 5HKKA 1E96A 2CJWB 4QGGA 1XJCA 4YDSA 4QC2A 1DAHA 3B8HA 3QKSB 3EWSA 4KXFB 2ZIAA 1NF3A 2J9RA 4XOIA 2ZRJA 4UXHA 5CYPA 1US8A 4RKFA 4ZO4A 3NHAA 1UKEA 1UBFA 2G0TA 4HB3A 3VX4A 4URVR 1G291 2WIBA 1PUJA 2WPDA 3TRFA 1D2EA 4KYIB 2A5YB 5GJWC 4V0NA 2X77A 2JLWA 1Z07A 2NO1A 4IXNA 3GEEA 4JS0A 4DHEA 2W2XA 1M1YE 1JXMA 4HAWA 5BWMA 3TAHA 1G5TA 2DWQA 4Q1BA 4TLBA 3V4FA 721PA 3GLIE 2O8DB 1E79A 1L4YA 3SN6A 5C4GB 2QMUA 2XB2A 4AKHA 5JI3E 2ANCA 2IF0A 4BFSA 1W0JA 2A30A 2P6UA 2CNWA 1IHUA 5KSPA 1S2MA 1JEEA 2HXYA 2R2AA 2GTPA 2C77A 3I8XA 2IEZA 4HI0E 1FNNA 3U4QB 2LKDA 2AX4A 2JDID 2H8KA 2BBWA 2WMNB 3BAFA 3TUZC 3FKSA 4IDHA 5JJIA 2GXQA 4JZKA 4PAOA 4M53A 1COWD 1LNZA 4AD8A 5KNDA 1BYUA 1QDEA 2P65A 1KI6A 2D06A 4UNRA 2ZANA 3CRVA 5J4KA 1Z8FA 2GNOA 4LJ6A 1P2TA 1N6RA 1RE0A 3I5YA 4IFBA 1GKUB 1OPXA 2MMGA 3C7KA 2BJVA 2EWVA 4Q9IA 4WAUA 3B82A 5EP3A 2SHKA 2YV5A 3K0CC 3QXCA 4OQXA 1MO5A 1R0YA 5CYOA 5EZ5A 5DN6A 4CDGA 1EFUA 4FINA 1XFAA 3TAUA 1ZW6A 1TU4A 2R6CA 4JVSB 4PQFA 3AVWA 1UKZA 1E94E 2GXAA 4JLBA 4ACAA 1G8YA 1S96A 4LDJA 4KFSA 1OXUA 1YZUA 1TTTA 4HAUA 1KI6B 1XD2A 4DLWA 2C2HA 5TV2A 1CJTC 5JFGA 1KI9A 1KK3A 4GOXA 5FBLB 1QHIA 5L3QA 2FH5B 3KJHA 2YWEA 3AF3A 4CVNA 4NYMR 3OIWA 3B1XA 4PC1A 1WE2A 1GNRA 3QOFA 1KMHB 4EKDA 1GRQA 1OHHD 2DPXA 5BW8A 1T5IA 2QM8A 1V43A 2IT1A 1X1RA 4EJSA 3K09A 2F1HA 2V8OA 1W0KD 2X2FA 1XU4A 5C4MA 2WVJA 4Q21A 2KSQA 5A0FA 4GZMA 1BIFA 2HEIA 4B48A 1XXHA 2J0QA 1CRQA 1TADA 1G21E 1S1CA 4EIWA 1E2IA 1UFQA 4II7A 1OSNA 1TF5A 1Z5ZA 2OZEA 5EP4A 3UK6A 3GLIB 3NDBB 1W4RA 5JEEA 4EFLA 1TEXA 2AXPA 1QVAA 1CTQA 2Z83A 3CZQA 1AQYA 2ODBA 3NBYC 5FTKA 2IYTA 3IIMA 3R7WA 4CEJA 1CJUC 4RD6A 1AN0A 4C3ZA 1TQDA 1P4SA 1ZIPA 2YC4C 5JWOA 2GBLC 1YE8A 1RYFA 1SKQA 2D3WA 1V5WA 4MGKR 3RRYA 1SULA 2CL7X 2W0SA 1IY1A 4YMSA 3TVTA 5JJKA 4S2EA 2F6RA 2ZRAA 1SXJA 2YWGA 1OJLA 4NKRA 1E32A 4G0NA 5C46F 2REBA 4YXWA 4DUGD 3QPVA 2O52A 5CB8A 1E9BA 1ZM3A 1SVSA 4HLUA 1OH7A 2WWFA 1T6NA 2ZPTX 4M21A 2OEPA 4EPYA 2BBTA 3PCRB 3VKHA 4FIDA 4L16A 2VYFA 2VRWA 4DKXA 2O8EA 2JAQA 4HSEA 1P75A 1ZC4A 4X8OA 2OFWA 2J0UB 1W47A 3Q9LA 2OO7A 3AF0A 1RPZA 1QF9A 3ASYA 1EFHA 2KI5A 3EZ2A 3IKJA 5B64A 2GEUA 4LCBA 3OE7A 1KI7A 4TMXA 4JVLA 3G0HA 3KQUA 4IDNA 4C2TA 2H92A 4EJSB 4A6PA 3UPUA 4Q1FA 3UATA 3EARA 3CLVA 3R8CA 1RFLA 3CB4A 4NYJQ 2FGJA 1WA5A 2JCSA 4RFSA 2D7CA 1DO0A 3CNOA 2FPLA 4C0SA 2NO6A 4X8LA 2IX3A 2BV3A 5H68A 3W90A 2QP4A 3QF7A 2PEYA 4EPTA 5BQ5A 3K0EA 2RKOA 4IOJA 1EX6A 3CX6A 1CJKC 4BFUA 1X8JA 2L0XA 3D6TB 4V0OA 4CT5A 5JEDA 1DVRA 2GWHA 1XP8A 4LBVA 2OCBA 2YINC 3CZPA 2VEDA 3O8BA 3QIAA 3SFVA 4D80A 1H8ED 2CLDX 3MG9A 5KPJA 3KB1A 3L8ZA 3LVRE 3NH9A 3KKOA 5BYJA 3DPUA 2VF8A 4GT1A 3A4LA 3HYTA 1LTQA 4W7SA 5HE8A 1W4AA 3PITA 3IHWA 4GBMA 1R0WA 4PZZA 3EIHA 1KI4A 1OYYA 1G6OA 3AQ4A 1NLYA 5E7IA 1DAEA 5FPKA 1TQ2A 1E6CA 1HURA 1E9EA 1Q20A 1II0A 2WJGA 2VP6A 3M1IA 4PSVA 2BM1A 3NHBA 1KDOA 2IF2A 1P9RA 4PPQA 3H1TA 2GZAA 2D4HA 1GNPA 5EZ6B 3SS8A 4P4UA 1VG9B 1TUIA 1ZD1A 2ATXA 3FPAA 4HLQB 1FMLA 5C18A 1U8AA 3VKWA 3VMFA 4XSHA 2AKYA 2NOAA 4KV9A 4RD1A 1XD8A 3BD9A 5ELXA 4HB0A 2G1JA 2ZE8A 3MWKA 2O8CB 2JJ1A 1A1VA 4DB4A 4JSYA 4ZCIA 3WRXC 2BMEA 3GPLA 5FI1B 5KOYA 1JPNA 4OHZA 1IAQA 5LD2B 2H5EA 3PEWA 2YKGA 4DIDA 1E0AA 2WWWA 2QTFA 1A4RA 3S1AB 2FOLA 4A82A 2CJWA 1NJFA 4IDQA 1J2JA 1OYWA 2X2EA 3UG6A 2VSXA 2PJZA 3EC1A 4OHXA 2PL3A 3BIFA 1CKEA 3AGQA 3TSOA 4EDHA 3A1UA 1MOZA 2A5JA 2QEQA 2F9LA 4GFDA 1ZAKA 3R9XA 4OHYA 4QBHA 4D6PA 1W36C 1YZTA 1G9XA 1XEWX 1N6IA 4O2RA 5DHAA 5DI3B 5JCZA 1ZM2A 2IBMA 3AP3A 2QQEA 3W6PA 2OT3B 1KMQA 3FMIA 3TGPA 4R9UC 3KZ1E 2I4IA 1ZUHA 1Z83A 1YKSA 3VAAA 2Q9AA 1IBRA 3Q3JB 5EXXA 5A4JA 3D7MA 2FSHA 1XPRA 1N5IA 5GJVC 4AURA 1KY2A 3KXLA 3GLGE 5HPYB 4Y0AA 1KKMA 5SZHB 3NBXX 3QI2A 3U60B 5DSZA 2VTKA 4QBIA 3QSYA 5J4YA 2OAQ1 2MMCA 1VG1A 3B9QA 1EFRD 3EC2A 2XB4A 4XWAA 3VKGA 2O8DA 2ERXA 2Z5FA 1WBBA 4DCNA 5KDLA 5HZKA 4URZR 3T1QA 4Q5IA 5IK2D 5KTYA 4QBFA 1SVKA 121PA 5FL3A 4ZCMA 3AM1A 5FTLA 4NONA 2AL7A 3QVVA 4I81A 2XNDD 2XOKA 3DM9B 3LNCA 2V6JA 4LY6A 1W1WA 5FPSA 2BM0A 2FJUA 421PA 3FOZA 4DLUA 2GESA 1GZSA 1G8HA 2RGEA 2WOOA 4TTPA 1U2RA 2PMKA 2VHTA 2JDIA 1PLJA 1FTSA 1NMYA 1CS4C 4M1WA 2ZJBA 2ZJZA 3IILA 4IEIA 4PXAA 5F3WB 3PV0A 1II8A 4UNNA 4TYWA 2GJAA 2BHRA 4Q03A 4CW7A 4PAMA 2RMKA 3HU3A 1WCV1 4OI1A 3UMFA 3ZDQA 4LK2A 1QHHA 4JLMA 4D25A 3QY0A 521PA 4BQSA 4F4IA 4DSUA 1OH8A 2DB3A 4C0AC 2FA9A 4MUAA 3ZD7A 3MUFA 4G5RA 3NDPA 4EPVA 2Q3HA 3ETLA 3B1VA 1TAGA 3CR8A 2LKCA 2ZR7A 3EZFA 5CIWA 1EFCA 2F1RA 1NVWQ 2IYYA 2ZYWX 2G9NA 1G20E 1XMIA 3CWZA 3LBHA 4BEJA 4C0BA 1P73A 4DDWA 3EPKA 4NYIR 4IHQA 3MLEA 2OV2A 1KSJA 1X3SA 1NVVR 4D4MA 2RB4A 4CZ2A 3VQTA 1TX4B 2P67A 3X1ZA 1ZM9A 3HU2A 4CT4B 1A5TA 1DBSA 1KJYA 2DWPA 3IGFA 2NGRA 4WZBE 4QJ3A 3TSWA 1IN5A 2JLVA 4MRPA 1ZU4A 1JR6A 3KQHA 3OESA 2ODWA 1W5SA 4LJYA 1QG4A 1I4TD 3W3ZB 2W83A 2HT6A 1LY1A 2WJIA 3ZIAA 2R8RA 1FTNA 3FVQA 2F1JA 4TQAA 3CX7A 2EFEB 4M1SA 5JWHA 3SBDA 4ABYA 1SXJD 2NQ2C 1VYUA 5FR2A 1ZCBA 4FD2A 4HUQA 3K70D 2BC9A 3SQXA 1GOTA 3P1JA 1QHGA 2CL0X 4L4UA 1IY2A 2JATA 4I1VA 2EVWX 2IUTA 2P0EA 2IWRA 4JLNA 3BB4A 1P9NA 4V0KA 5JWRA 1N6KA 3CF6R 3ADDA 2X8AA 3DDCA 2R6GA 3EX7C 5GJBA 1NJGA 4B3FX 1IJFA 3WP0A 3QXHA 4C4PA 4JMPA 1H8HD 5KPDA 1KI2A 4XJXA 3KUDA 4D0NA 3TE6A 4RVCA 3QENA 1N6PA 2O0KA 1KSHA 3U7FB 2QAGB 4UQOA 4QXAA 1TMKA 4FWIB 1FMJA 1RVDA 2QRZA 2IYVA 4N0EA 4RJLA 1Z47A 5CDFE 4AY2A 1YJ5A 2BBOA 2UZ3A 4TMVA 4IJMA 3PEYA 1UEIA 1FQKA 4B47A 3LX8A 2QGZA 2VHCA 1QHHB 3ZS8A 1FNMA 4NDZA 2GXUA 1GSIA 3I92A 4E22A 2IYLD 1E0JA 1Y3AA 5EJEA 4ZPXA 4AYWA 1M8PA 2QMEA 4K8OA 1HA3A 3DMNA 2ZR0A 3AVPA 4D26A 1XEWY 3A8TA 4L8GA 2WSSD 1N6OA 2OILA 5K8TA 3BJIC 4IDOA 1NRJB 1YRBA 1TPZA 5FUWA 4RCZA 1W4CA 3FFBA 1G3MA 3AUYA 4JJKA 1SXJC 2GF9A 2PX3A 1D9XA 2JLXA 1KO7A 2V1UA 2NTYC 4Q66C 4PHGA 4Q1EA 5HZHA 5IT5A 4KFRA 2WICA 3KX2A 2NO9A 4L5BA 1GTVA 4D2IA 2X1VA 5AK0A 1EX7A 4MUBA 4V0MA 2VHQA 4WZAE 3K0FA 2FMXA 1JI0A 3EPLA 1X1SA 4OL0A 2ZSBA 3BOSA 3GLHA 3EG5A 2FX3A 4LYJA 4Z8XA 3PEUA 3W9YA 3FKSD 2VBCA 1NIJA 1SVLA 1XTKA 2O8BA 1DEKA 2QTVB 4LJ4A 4PSKA 4A0RA 2PZGA 4B32A 4D81A 3ZD6A 3DEFA 2VHUA 1GAJA 3K9GA 3WMEA 2XX3A 3EZ6A 3MD0A 3MCAA 3GJ3A 1ANKA 4LV5B 1S3SA 1Q0UA 1KNXA 3IUYA 4RD2A 2HLDD 5FOVA 2MSCB 4CEJB 5G3YA 1Q3TA 2XXAB 3K53A 5EUQB 1LW7A 4C2UA 1E2PA 1G5PA 2PLFA 4PO8A 4WIAA 3K1JA 4MRVA 2PZFA 3L0PA 4PO1A 3M4YA 2ZRKA 5FPHA 1KZGB 3QKRA 3NXSA 1YZQA 5JI2E 1MO4A 2HYDA 2AN9A 5JS8A 1NVVQ 1JPJA 2H16A 4GL2A 3FB4A 5AUPB 4QHYA 2ORVA 5DI9A 4DBLC 2PLRA 2OXRA 2YOHA 1NSFA 1ONBA 4URYR 4D0GA 4A2QA 5J5CA 3LD9A 2NPFA 4C0JA 1Z6AA 3FHTA 4CIDA 5BYKA 4US2R 2O8EB 2IYZA 4E03A 4NZYA 4B3BA 3QKTA 1IM2A 1ZRHA 3QPWA 1R4AA 4JT2A 3Q7PA 4MITA 2GETA 2XNSA 1G19A 2GK6A 4LHYA 4RZXA 3IO3A 4JLPA 2J7PA 5TARA 4NHOA 5E7MA 3B6EA 2GBLA 4TZ0A 3KKPA 4QGFA 1RRPA 4B2IA 4LV6A 3OIUA 3CRRA 4PC7A 3LW8A 4XSGA 4D82A 4NCJA 1JJ7A 2ZTSA 1T5LA 3BH7A 4KBFA 1Z29A 1OKKA 2I1QA 2V4ZA 2ZR9A 1AKYA 3U5ZB 4CEHB 3I3SR 2ZRMA 5HKKD 4XH9B 3U3MA 1WMSA 2W58A 1S0UA 5B2ZA 2AFHE 1FFHA 2QORA 2GJKA 1T4GA 4DLXA 4US1R 1GIAA 3RC8A 3EA0A 3NKVA 2P3SA 3LA6A 3OEEA 1HE1C 1AA9A 2NZJA 4CEHA 2EFDB 2WJHA 1G3RA 2CXXA 1EFTA 2GDJA 2N46A 4PQRA 5FPTA 5FBRB 1GKYA 4DXAA 3ZVLA 1N6NA 1YR8A 2EFHB 1NL3A 3A37A 3J81k 1SHKA 5H70A 2P2LA 4LRWA 2OE2A 4M9XA 4DDVA 2FF7A 6Q21A 4U02A 3GFTA 2MSEB 4U00A 3RHFA 2WJVA 3WYGA 4OK5A 5C1BA 3REGA 3VFDA 1KO1A 1XEXB 2D62A 1G16A 3TUJC 2DFTA 2J41A 3KUCA 2JLQA 4LHXA 2RGNA 2WWXA 1YR7A 4OI2A 4DRZA 2DHRA 1ZJ6A 2XZPA 1GM5A 1UAAA 2VP0A 1H65A 2OBNA 3K0CA 1KK2A 4EAQA 1F48A 2PBRA 2N42A 2J0VA 1G4AE 4YLGA 3EASA 3A4MA 1O3YA 4TYQA 1E2QA 1Q44A 4RD3A 3T5GA 4LI0A 3PXGA 4JYCA 4I1OA 5E4FA 3T35A 2GF0A 2ZS7A 2QZ4A 4GRAA 4MQBA 3VTKA 3FE2A 3BC1A 2ZXUA 1W44A 1R5NA 4JLVA 5P21A 1CU1A 1C4OA 1WP9A 2FZ4A 4BGDA 1T8UA 1LB1B 4QM6A 4HLCA 2C98A 3DOFA 1CR2A 3ZQ6A 1E3MA 3ZJYA 1AZSC 4MKIA 3TNFA 1E2MA 3TBKA 1VHLA 1ZD8A 2P5TB 4NE2A 4Q1CA 3JVVA 4B3DA 2G3YA 1HH4A 5EE5B 2PCJA 4F38A 2F7SA 4MYCA 1M7GA 2CHVA 4Q1DA 5GVRA 1AS0A 3QF4A 4NU0A 4UNQA 1I2DA 4TYPA 2AK2A 4Z51A 2ZRHA 3U7EB 4D4LA 2QE7D 2JGNA 4F91B 1XB2A 5FUVA 4HLDA 1NBMA 1CR0A 3I1FA 2RGGA 2ZI5A 1MO3A 4RZUA 4CF7A 3I61A 3GLIA 4RD4A 3QKUA 4EJSC 4KLZA 2A78A 2XEXA 3NWJA 3HPRA 5H8WA 5CLLA 1R6BX 1A2BA 4TLEA 4QHSA 1CR1A 4IFEA 5G41A 3RRNA 3VR4A 4H1VA 4TLDA 2Z0MA 3PR1A 1W4BA 5JZVA 2ZRNA 2ZRPA 3KJEA 5JBQA 2A7QA 4G5OA 1XEXA 3MSXA 5E3HA 3O8RA 1R8QA 2WSSA 4UXIA 3VR1A 1JEDA 2HDNB 2W00A 1IN4A 2IUSA 1NMZA 2OFXA 1UPTA 2WOJA 1GRRA 2Z43A 1UADA 2AKAB 1BOFA 3BK7A 1GRNA 2RCNA 3DHWC 3SJZA 2V9PA 2BOVA 2ZRFA 4GDFA 3QVUA 1MV5A 4IXMA 4P0TA 4N0DA 2J46A 4WBSA 4AIIA 1UKYA 3G82C 3GFOA 3SYNA 5BN5A 4QJ5A 3PEVA 2G0NA 1OV4A 3QPUA 4HUTA 3NEYA 2VP2A 3U3RA 3AVVA 4TL6A 4IVPA 4JBYA 4B44A 2ASEA 1HQCA 2ONKA 2OBLA 1XPOA 2GJSA 3IO5A 1BMFD 4A0FA 4LJ7A 1Z63A 1J70A 1ZNYA 1ZUIA 2RH5A 4P4TA 2J7PD 621PA 2FWRA 1E2EA 1KYIA 1P7CA 4C9BA 3OFND 4TYNA 2IWHA 3GLGA 2XITA 2B92A 2QPTA 2YC2C 5G3ZA 2YYZA 1G7RA 2ZRGA 3K70C 4LOAA 1N3BA 1XJ0A 3ONWA 1EGAA 1OH6A 4QFMA 3BH6A 4JLDA 1XWIA 1FP7A 5KHOC 2ZI4A 3T1OA 5FH9A 2BWJA 1QVRA 2ORWA 1N5KA 2GJ9A 4NL4H 4PO9A 1PJRA 3AP2A 3OEHD 2OHFA 3WXMA 2QA5A 3SOPA 1KJWA 1VCOA 2V6IA 1IXRC 1FZQA 2ZSDA 1DADA 2IS1A 2UZIR 2EFGA 2XSZA 4ESVA 4CGZA 2NO0A 4V0ME 1OFTA 5FI0B 4ZDJA 3GP8A 4CEIA 2QQ0A 5FTNA 3NBFA 3MRSA 1E9DA 1NBME 2FV8A 4TSFD 3CNNA 2HV8A 2OLJA 3AKCA 4YC7A 4MKGA 1E0SA 2FSIA 1J7KA 3O8DA 2WWIA 1JR3A 1KTVA 3DM5A 4DLVA 3M0EA 4OJQA 1HTWA 3MWLA 3OZXA 1KK0A 2RGNC 1F2TB 4RCYA 5EXSA 4MRNA 2XNDA 3A58B 1E2LA 3UIEA 2AFIE 2O0JA 1RJ9A 5EE0A 5EP1A 4B3XA 2JEOA 1BH2A 1UBGA 1X8KA 1KGDA 3ZZUA 2WBLC 2D74A 5IK2A 1J8YF 4JKIA 4PC3A 2FEMA 2P5SA 5DLQC 5TB5A 3RS5A 2FGKA 3WHLA 2H17A 4DLZA 3RS4A 1G18A 4W9MC 3CH4B 1KO8A 4DT1A 5JSZA 3O8CA 2G88A 3KXKA 2H1LA 3QG1A 3N2IA 4DLYA 2IHBA 1SHZA 4R71A 1CJVC 5K8UA 3CM0A 4L9SA 1JAIA 1XPUA 2D7DA 3ADKA 2IK8A 3PENA 1IXSB 1QG2A 2GKSA 2BEJA 2VLIA 4IW3B 1NLZA 2ZRBA 4JIMA 3SJBA 3TR0A 2PMDA 4C0QC 4MRRA 3TUIC 3K09C 3T34A 4KSCA 3A6PC 3WMFA 3WY9A 1Z0KA 3K9HA 4LYFA 3GLGB 4TL8A 2BKUA 2WHXA 4HDQB 4Q9KA 4F4JA 1ZCAA 2XJ9A 3KTAB 3I62A 2WWGA 3C15C 2J3EA 1NKTA 4OK3A 1YRAA 5AJZA 2DYKA 3UANA 2FEOA 5BN3A 5JSZB 1IN8A 1NMXA 2AD5A 4OJKA 4ON9A 2ZS9A 4N1AA 4DLSA 1S9DA 3KJIA 2LWIA 1SQ5A 4C7OA 1NG1A 4RY2A 3T15A 4CYMA 1FP6A 4GMXA 1P2VA 4LHVA 2VSOA 1KZ7B 5FTMA 5L3VA 1NIPA 4FI3C 4UNPA 4NMMA 1DAFA 4LHZA 1YZGA 1NVXQ 2QL6A 4URXR 2GEDA 3L0IB 3H86A 1F5NA 1SXJB 4R7ZA 4TYYA 4YONB 1CF4A 1KIMA 1XTSA 3Q85A 1ZIOA 4H1UA 1M34E 2ZU0C 2GZHA 3B1ZA 4QNMA 4A2PA 1FUUA 2BIFA 2ZJ2A 1Q1BA 1DAGA 4TLCA 4DJTA 4JLAA 1W36D 4KFUA 2QBYB 4M1OA 4QG7A 5D3MA 2O8FB 3FTQA 1N0VC 2FFBA 2H7VA 3SEAA 1T3HA 5L3SB 1JJVA 3NG1A 5EQTA 1AGRA 2R6AA 2WKPA 3I32A 1RIFA 4B3CA 3F5FA 4AYXA 3VU9A 1WRBA 1OH5A 2J59A 3EXAA 5GADl 2CVFA 4PSAA 1ZVQA 4RFVA 1Z6YA 1BS1A 8OHMA 5F9FA 4POAA 3SE0A 1HV8A 2OFOA 2KE5A 1VIYA 2C78A 3B85A 4Q4HA 1EWQA 1IQPA 1M74A 4A0GA 3ZIAD 5DISB 2JJ2D 4KITB 2CVHA 1D6JA 3TK1A 1ZNZA 2ZVQX 1OXTA 2C9YA 5AUOB 1T0JB 5JMTA 1II9A 3I4LA 2CK3A 1GNQA 5G40A 2RHMA 1G6HA 2E9SA 4ZV4A 1Q22A 2LCFA 2QSYA 1VG8A 2NPIA 3C5CA 3OF5A 3TMKA 4GNKA 2OCYC 1ZM4A 3W3AA 5ANRB 3KFXA 4UXJA 1KSGA 1YVDA 2D2FA 2R9VA
chains in the Genus database with same CATH superfamily
1JWBB 2QN8A 3GJ6A 3LBAA 5CVCA 3FDZB 4F85A 5IVPA 1QORA 3PD1A 1QFZA 4BJ5A 5AW6A 4XDZA 3CGWA 4PYJA 3AMVA 2BUBA 1S1MA 2MSWA 4MUNA 3WLNA 4AZTA 2MR5A 4WY5A 1JHMA 1OASA 1XF1A 5AW1A 2V96A 3FETA 3OEHA 1XNQB 2JARA 3OE4A 3C14C 2FE4A 2RB5A 1HY3A 2G5CA 3TZKA 5EJ4A 2IV3A 3AF6A 3W34A 3WMGA 3RHTA 3JYPA 5AWFC 1NU8A 1UMCA 4O2AA 4YGXB 4BC0A 4OHCA 1NVFA 4M9ZA 1PLKA 3FZGA 3DMDA 5AUQA 3U6BA 5DN9A 3H1PA 4YQZA 2OFFA 1CUDA 3UW3A 3ZW9A 3HDYA 3Q1KA 4ZI5A 2C2MA 4JEMA 5GINE 3IQXA 4ARAA 2BTOA 1NU6A 1JVNA 1TQ6A 4KFTA 2R65A 4DJDC 4HDRA 1R7RA 2JRCA 1IWOA 2H57A 1U6IA 1KDPA 2NNLD 1IC6A 2QM3A 3GF4A 2OHGA 4P9NA 1XG5A 4HATA 5IN4A 5LA6B 1I32A 5CH3A 3THYA 3HR8A 1JFFB 4FMDF 4IXDA 1QR6A 2ISSD 4ZVVA 3U81A 3T1HB 1VGRA 1Y4ZA 4D74A 3AR2A 3HO8A 4LYGA 3ZE8A 1UK7A 4F8EA 1OLSA 1HDGO 5IM4F 3LHSA 4EFNA 1IN7A 4MP3A 2IYEA 5CX1B 1VBFA 4MWZA 1JNYA 4R05A 1V6SA 2W6OA 1N2JA 1AUVA 1POWA 1KJNA 2ARKA 2HZ7A 4BUJA 4DJAA 5ITVA 1R0RE 5L8VA 1ECCA 2COEA 1UINA 1SC4A 4ETMA 2DBYA 3ENZA 5EJ8A 2C4HA 1KYTA 2AFHB 1H6DA 2Y9MB 3VR4H 3ZJ5A 3FNRA 4HMQA 4N12A 5JCOC 2HN9A 3CSSA 4F4CA 4DVGA 3M6IA 2CDRA 2HRDA 4D9IA 4PGGA 1OXSC 4C7MA 3ACCA 2ZTVA 1MQ9A 1Z75A 2WSIA 2WU1A 4KQWA 1C7EA 1QYVA 4OM8A 4WDQA 1BC5A 1P91A 1NNLA 3ADPA 3IESA 2R96A 1G2OA 3DF9A 1Y3BE 3SDSA 5JPIA 2AC2A 1X42A 3R7NA 4LOHA 3K6SB 1VCHA 4P33A 4YAOA 3ND6A 1UC8A 3VVMA 5JV5A 3S81A 3T5PA 5LBTA 3ROXA 1D0VA 8AT1A 5FADA 2ZG6A 3H97A 4HTFB 4R2XA 1VG0B 4NV0A 3HMQA 2HJVA 1VI6A 1LZKA 1R6UA 2Z8ZA 3EMKA 1KZ1A 3QEOA 4N6NA 3TZHA 4BYMA 4E32A 4HDNA 3NOXA 5K3CA 1U8EA 4EJ2A 3HLTA 4KGVA 4DANA 2IY9A 3KYDB 1BMDA 1PEYA 3WSTA 2B1RA 4QU5A 4FFBA 5F78A 5CBPB 1EUQA 3WWYA 2J9FB 4WZ6A 3EXG1 3TLMA 4B6EA 2OGWA 4H0NA 5BOSB 4DAOA 2GN1A 4L75A 2WSYB 3E9RA 1TYBE 2CBZA 4RD0A 4TXJA 5G0WA 5TRTA 3BA1A 3T5MA 3VMMA 2C3OA 5ICFA 4BLUA 4X45A 3AZPA 2IBTA 4Q6WA 5F5NA 4B31A 1MJHA 4JJ7A 3TRJA 4GQAA 3DKVA 4DSOA 1SXJE 5B3JA 2GRJA 1J1IA 3I2IA 5MN5A 3WZ2A 2PJRA 3I04A 2QTNA 2C4KA 4D8UA 4XVQA 2PWBA 5B36A 1EVIA 5ALXA 2QVCA 2AEJA 2VZEA 3O91A 4MV5A 1L5SA 1USKA 2HU8A 4NAUA 4LC0A 3NU1A 3VPBA 5EUBA 1I7LA 1XZQA 2JCGA 3TOZA 4BNUA 1G17A 3AVUA 2I9KA 3D3QA 4G0OA 5HKAA 1N9GA 1PL7A 3PVCA 3V3TA 1JDBC 2YXDA 4LSMA 5JR3A 1UF9A 1JNXX 1QF7A 3BBLA 2AZTA 3PIRA 2NVUB 2CFOA 2PZMA 1NURA 4OH7A 5JNUA 1YK0A 2ZP1A 3O4RA 1A97A 2W90A 2XVMA 3CLKA 3O90A 3KXIA 3VKFA 1MRSA 2CNLA 4XWGA 1D7AA 5FWAA 2C9CA 1U8CB 3UMBA 3R24A 3ZE9A 2CMKA 1V16B 1FNDA 4ZQCB 5HZMA 1XEFA 3CPEA 5I9IA 2GN4A 3GXBA 4KMOA 2EJTA 3OH8A 2NYRA 5KKAA 1ZU5A 2I66A 4MUHA 1RIIA 1Z0AA 3BPSA 1TFUA 4M1ZA 1BCSA 1GPBA 4W5HA 5MGBA 4HRAA 5EKSA 1L5KA 4YO7A 1YR6A 3C8HA 1DX4A 3JQRA 2OKGA 2PZLA 4NAHA 4YA6A 3PXCX 5EFZA 2J4CA 3ZQKA 4B9EA 2WIJA 5AVSA 1P4GA 5CUQA 2W6JA 2IPOA 2Q8NA 3HJNA 3ROFA 3VR3D 1U5CA 3IE1A 2WSMA 1TM3E 4BCCA 4GLJA 2BZ0A 2YBEA 4MGIR 3SSMA 1QGUA 2GZ3A 3UWMA 3WGZA 1E3SA 3LRTA 1Y33E 3MMSA 2W6NA 3H8SA 3HYRA 5G53C 1CZOA 4ZOBA 4X20A 4WXMA 3TL3A 3TNJA 4GE3A 3EFOA 2AUMA 4ALJA 4CIYA 4IR7A 4QYMA 3UMJA 3FRHA 3HNPA 1KRHA 1ZZEA 2WZQA 3GCDA 3KHKA 1KAEA 3AUJB 1IHYA 2BTQB 2I6XA 4JUCA 4OQFA 5DO9A 1SC3A 1KSFX 5J43A 3P96A 1AQIA 3OZEA 2CXUA 1ESEA 4C43A 2D0OB 2VH5R 3DFIA 3ANSA 4GUDA 3UG7A 2GASA 3RASA 2PX5A 2ATIA 3DTTA 3QVJA 3V8NA 2YS6A 3VR6A 1NQXA 4QDOA 1J8VA 1DQYA 2IYQA 1V39A 4FMBB 2VYQA 3AV0B 4HZGA 1PX0A 4RQBA 1OXVA 3WGTA 3TPCA 5FA6A 1E1QD 2IL1A 3RH0A 1IQ0A 4UDNA 3ZWCA 4OYRA 2OG2A 3T1YB 3CWQA 1JPUA 2Y1DA 3C3BA 4HAXA 2Z3WA 3RWMB 3WB1A 3AM4A 4CIAA 5JSHA 1RYDA 2AYYA 4PPFA 2FP4A 2WIFA 3C98A 1U9IC 3EAFA 3E05A 4Q9HA 1HK7A 1J24A 3JV7A 5D8DA 2OK8A 2CVOA 3E27A 1M1ZA 1G38A 2XXAA 3LC7O 2BMJA 1LDMA 1LPMA 3UC9A 3R5FA 4F4HA 4DV1B 1GN8A 5B6JA 4B3IA 4I9FA 1RBQA 1OB5A 4NZMA 4X8MA 4DEYA 4RYLA 1NDQA 3KEQA 5JE8A 5ALRA 1AF4A 4HWRA 3VR6D 1KDTA 1Y8CA 2AOUA 2I55A 1SKYE 4J0IA 5DASA 3SNHA 4AG6A 1XEAA 1GLVA 1QWSA 4GMGA 3TOCA 3X2FA 3W04A 5FAKA 3PVSA 1QB8A 3CJTA 1J20A 2HSWA 3D3WB 3OFNA 2C3PA 2VHJA 2FW9A 3F4LA 2O59A 1EPUA 2DUMA 1IUOA 2XUQA 5AYVA 3CVYA 3QEAZ 1VXRA 1MR3F 3UAGA 3WVNA 2ZB4A 2ICAA 2WAXA 4AWAA 4Y0NA 1JLRA 4KQGA 1FQOA 3VI3B 4D2IA 4DA0A 3P7MA 3V97A 3A1WA 3KS9A 3Q6NA 2AW5A 3PGA1 4OD0A 4XZ3A 1P7WA 3R7AA 5HKOA 1KVSA 1QFYA 5K45A 2DH6A 2OQIA 3MK31 1I01A 1E61A 3OKPA 2GBPA 4KE7A 4Q02A 2AA3A 5K09A 3ZVRA 3FYCA 5G0SA 4CE6A 2VK4A 4P7JA 4CHTA 4EVRA 3E18A 4YCCA 3R6GA 4P3KA 3THXA 2OZLA 2R44A 3OF3A 4OKSA 1EP2B 5DXJA 3SEQA 1EUZA 2Q7DA 3FPBA 2C8LA 3I45A 3FZNA 5JZ9A 3MAJA 5BR1A 3N74A 2Q6OA 4ZRNA 1UOEA 3ZE1B 3IP6A 1MA0A 4IIJF 4YP0A 3UWDA 2G9RA 3GROA 1L2TA 4O4IF 3IDZA 1T9HA 2ZUVA 1EQ2A 1R10A 4DSZA 4ZRMA 4TMWA 4IIFA 2QE7A 3AB3A 2PANA 1BO6A 2FUNB 4EG0A 1L4KA 1P4AA 1Z7WA 1P2BA 1BS2A 4U0KA 4UVGA 4B34A 4O2AB 4IX1A 5KNLA 3K70B 1Q15A 5BSGA 3FLEA 5EGSA 4R69A 5F51A 3FPGA 1JIJA 3EZ7A 1EWTA 1UQUA 2OV3A 3GJ0A 4JSTA 2JBAA 1JG7A 3HKEA 3CLSD 3BB1A 1DOHA 1Y82A 3QF4B 3UUFA 3ZHXA 5FUXA 4NCAA 4OXNA 1UJ2A 1XTIA 1MO2A 3T3PB 1S3IA 1JA9A 4NG5A 2AEMA 4JL6A 2VT6A 1UDXA 2CWWA 2REXB 1SN7A 2W2PA 3HJCA 3TR6A 1OWNA 3TAXA 3WBJA 4D9HA 4YV7A 2RIRA 3U7QA 2WA1A 4MJXA 1IN6A 4BB5A 5FWNA 1G8PA 1LQ2A 1YUNA 2LDBA 3DHYA 3KAPA 4YMGA 5T5QA 1XRSB 4DJFC 5IU6A 4QGAA 3JTMA 2QAGA 1UPFA 2BGTA 3D6VA 3CH5A 5FKJA 2E5LB 3RS2A 2ET6A 1KQPA 3AXTA 1PCXA 1EKXA 2DUWA 1W5FA 2DTXA 1N8TA 2FPPA 3FPHA 1ZSNA 3CUTA 3K32A 4JX9A 4DMMA 1AHHA 5J40A 4BBAA 7ADHA 3LXMA 1FLDA 1CQPA 3R5JA 4D3ZA 4KIUA 2CL5A 5EWJB 2FG7C 2CNWD 3KEFA 2L82A 2HJ9A 1U8XX 4W1PA 1KYVA 4RXMA 1ZI6A 3USES 2PUCA 1I2MA 1SC1A 1C8VB 3G68A 2DCUA 2RBEA 3OZTA 1Y5NA 4UHHA 2R84A 4ATNA 4CLOB 5FEMA 2DVMA 4BS9A 3BWMA 3KB8A 1JW9B 1FA9A 3K30A 2JAHA 3OTHA 3L6UA 1IL0A 5CR9A 4FEAA 2ETXA 2BHNA 4G6ZA 3Q15C 4HDOB 5AKZA 2ZJAA 4J2TA 4XI9A 3WQBA 4EVIA 4CKEA 821PA 4BGUA 4BNMA 5ALHA 2IZ0A 5H1YA 2HQRA 4DM3A 3H0EA 3B9BA 2QUAA 4XIGS 1P72A 4NEHB 1KAOA 4PFJA 1MAUA 2BFFB 4HDKB 2JASA 4LVUA 2QKYA 1VGQA 1RQGA 5CVJA 4YMIA 4A2WA 1F6DA 3V7WA 2C99A 3TTXA 4B4DA 3TFOA 2E4YA 1THZA 3A3KA 2C8VA 3G0DA 1BX3A 5FBZA 2PO5A 2VQ6A 3NVAA 1G7TA 4ZI3A 1KQFA 2HHAA 2VH2A 4UVEA 4ZK6A 3ZDCA 4NFYA 2W2QA 1DKOA 3IBGA 1JXOA 3ZD8A 4HTAA 1DBIA 2RGDA 4GZ5A 3U3OA 4E5VA 4EYKA 5ICMA 1RWXA 3KQSA 3FW1A 5JJBA 2OBYA 1QKKA 1JE1A 3CKYA 2HA7A 1OKKD 2WT9A 1YBVA 3KR9A 4EHAA 2ORYA 4WPGA 4JP5A 4JODA 5HDQA 3VPFA 2QPOA 1AXEA 3KPYA 2GAJA 3CH7A 3DLBA 4PIMA 1Q1QA 3FOEC 3HZHA 4EI9A 4X8HA 2XB9A 3VSAA 2CCKA 1RXSA 3PGVA 1ZRSA 5DM4A 1WB9A 4AICA 4LX8A 4DNFA 8ABPA 4JEHA 1NWCA 1U8YA 1FDVA 4CMBA 1ODFA 3ZUPA 3T9BA 1TVMA 3JWJA 4QL3A 5TGTA 1FQJA 3HO1A 2XTAA 4HNGA 4LRQA 3H6GA 2QTHA 4MEJA 4DV3B 4LKOA 5COBA 3QPCA 2J45A 5AJVB 2C9BA 1UMDB 2XQFA 4BAZA 4ZDKA 1F0NA 1CEEA 3PJEA 3RI3A 3E2PA 5LM3A 2FFQA 5CT4A 2W42A 3T54A 4JL8A 3ZCUA 4CF5A 3M5CA 2HJWA 4ENSA 1YB5A 4KMMA 4XRRA 4BNGA 4FTWA 4DMRA 4LJSA 1O0SA 2CSUA 1ZAYA 2NXNA 1TKCA 2EW2A 3EAQA 2P40A 3EBLA 3TZLA 3PA8A 1HOXA 1ORDA 2BRUC 3FD8A 3H4MA 4GOKA 5IF9A 3OTQA 4MDHA 3THXB 4RV5A 4IKEA 2Q7XA 4S1OA 3AOEC 5MFPA 2P30A 4HNTA 1T1JA 2ANBA 1TTPB 2X3YA 3C43A 1R6AA 4PNPA 4F2DA 4BAGA 2A3NA 1P45A 1Y6JA 1K06A 1OTYA 2VDMB 2AF4C 3L82B 1V8BA 4RF2A 1URPA 3NBMA 5C37A 2ZDHA 3D4PA 2QGNA 5HJ2A 5TSDA 3V1UA 3CU5A 4MDEA 2DJ5A 1FSSA 2IHUA 3NKFA 3OQNA 5FOXA 3PIDA 4E12A 4N41A 1DTSA 2HNKA 4YH1A 4UTRA 1LA2A 2JBHA 4LCJA 3UMRA 3F67A 1X7WA 3GC6A 2BP7A 2Q1TA 1RBYA 2EC5A 3HRIA 3AEZA 3EXG2 2D5CA 2VDRB 3DLIA 5DIFA 2VP4A 3JQQA 1RBZA 3IELA 2VEOA 3BHIA 1SNYA 1KJQA 2RHBA 3BD6A 2XRYA 4M8IA 4QECA 5EEGA 1J5EB 1RRCA 4UBJA 3UK2A 1ESMA 4LY0A 3ZN2A 1U9YA 4N54A 4ZTZB 4FMDB 3MS7A 2LIPA 4PWZA 4LA4A 4YGYA 4ZOCA 5K4AA 1AQNA 3RSQA 3ANYB 4GQIA 4BO7A 1UXKA 5K3OA 1FYWA 3HH8A 4RJJA 3KALA 3MTEA 2QLNA 4WT7A 1XPUA 1EXWA 4Q39A 2UUCB 1P74A 2X9LA 4AMZA 4Z5XA 5TF4A 5K8JB 4LPSA 2J87A 5G02A 2GHIA 3RABA 4B6GA 2F8TA 3GLFE 5ULLA 1G3UA 3LDGA 3W8FA 7MHTA 1DV1A 2AX3A 2NVUA 3OQVA 2QZSA 4Q7EA 1XBTA 1G98A 2H08A 3IMKA 3Q7RA 2ZAMA 4NEQA 2WB2A 1GZ5A 2ZI6A 4GEKA 4E1VA 2VI5A 4D96A 1PS9A 4AJ4A 4OHPA 5IABA 1IHXA 4EY4A 3C8UA 1U9ZA 3H5WA 3W9SA 1F6BA 3FCUB 1FU4A 1P29A 3IBYA 3OETA 3UKDA 2J32A 1DU4A 3VI4B 5IXSA 2YJGA 1I4OA 3T3DA 1B4DA 1Z3CA 1NMSA 1V37A 4I4TF 4N6OA 4DMHA 1WXWA 2OL4A 4MVJD 4ZMBA 3HVKA 4Q7KA 1Q7RA 1ZD9A 3HHEA 3FY4A 1VSUA 2X7JA 3QKRB 5CVDA 1V8ZA 3FX2A 4NH0A 5JHHB 1EMDA 2DR0A 3ENVA 3LXXA 2FLWA 1PV4A 4W1QA 5LP6C 3EFOB 1HWYA 3FXAA 5DDIP 1J4AA 5SZKB 3VC1A 4BFWA 3FMFA 1R1DA 3DT8A 1OFIA 1KY3A 1WY7A 1EAYA 1HOTA 3P0JA 3NR2A 2P4HX 3MAAC 2GCOB 1L3CA 2XUIA 1BVUA 4I1RA 3SXJA 1K66A 3L7JA 1J0DA 1U9IA 1M2FA 4KVGA 3WIEA 1FYDA 1NR1A 5DCWA 1J39A 2XTNA 2EW1A 4HEA1 4KSBA 4G9BA 3N0XA 3LYHA 1YI1A 1MEEA 2QIOA 2DQZA 1T5HX 2HCRA 4DR6B 4FN5A 4FFLA 5L9AA 3I58A 1SKMA 2WUFA 3TRKA 3AVXA 1U7ZA 2XF8A 1V8PA 1N0WA 3LC0A 4NOKA 1JV2B 1QBKC 2XE6A 3AL0C 2PZEA 3GRZA 4OEHA 5SY4A 4RORA 3FH0A 1S8AA 2IXBA 3U7GA 1IZ0A 2DUJA 4HAOA 4LZAA 4PS0A 3T9EA 3V42A 4ZTUB 5B12A 1JMVA 4QM7A 1C1HA 4TVBA 4S12A 1H3FA 1XXHE 2O3JA 3E9DA 3THOA 4QTYA 3OZDA 3CNBA 3P0HA 4G8CA 2JCBA 2G8NA 2ONYA 3VHXB 1U04A 5AVUA 4MTLA 1E4VA 4NTZA 4X95A 3WWOA 2YVKA 5BMVA 1N2CB 2JIMA 1P6QA 2RJNA 5E7JA 5FPYA 3WYBA 3H42B 2NO7A 2IELA 3JWPA 2CZQA 2XMPA 3BG5A 4PBTA 1NMEA 1XZBA 3P52A 4OB7A 1ZNQO 4AL4A 1N34B 2JGMA 5KTTA 3TKYA 1P1FA 4GM1A 2YJ4A 1C7RA 1C8KA 2XD9A 1D9ZA 2BKXA 2JKZA 3IHKA 2MYUA 4OB6A 5HQJA 3KOYA 2GSWA 4F3RA 2X3UA 3R7BA 1RMQA 1R5BA 1IXZA 3AP1A 1PFGA 2VJCA 3LYLA 3GH1A 2C2GA 4KWHA 4KR6A 1Z4QA 4EUEA 3COSA 3AIMA 3UT5B 4YO8A 4PICA 2XAAA 2AHRA 2F3PA 1Z2AA 4GMKA 2RHGB 1M66A 3ZCQA 4EJMA 1GPJA 2K4MA 5B1HA 2YXPX 2AOXA 3NIBA 4HDRB 1ADBA 1HQDA 5ISMA 1XP5A 2C59A 2H63A 4K6OA 4B83A 2AG5A 1IFXA 3U7QB 4QDJA 1C9JA 5IC5A 3VYTB 4XB2A 5ED0A 2CUZA 2Y1WA 1B0UA 2J08A 4PRZA 4GL2A 4YN3A 4BO5A 4BUCA 1YQTA 5ALVA 3KQPA 1CUWA 5E9QA 1D2CA 2PX4A 4LZWA 3OE1A 1Z88A 3ESDA 2VWGA 4HGQA 1R9MA 4NESA 1YU9A 4F04A 4PVDA 2ZB8A 2CV1A 3QNMA 1X9GA 4CMIA 3MCTA 2I2DA 3PQ5A 1W1UA 3CLSC 2IPLA 3D8SA 3X2SA 2XCOA 3KVOA 3ABOB 1QYXA 2BEUA 4YPFA 3WNDA 1EXVA 4RPIA 5KQSA 4HNAB 3NATA 1NTRA 4QICA 3T7DA 4DEVA 1T26A 2ODPA 3CRQA 3QOXA 2AG1A 5CDYA 5J9FA 4AJJA 1QR2A 3BGDA 2J5BA 1BU5A 4Y2UA 5B4TA 1KP3A 3GCGA 1RI4A 3EXFB 4HDKA 1K6MA 4AVYA 4AECA 2OAP1 4MKHA 2P2YA 1GJRA 3H4VA 5KNCD 1BA2A 2CXRA 4FYJA 3O2SB 4H7FA 5FOUA 3SQOA 3D31A 2QD1A 4P86A 1FIUA 4GSYA 1VPTA 2Z6AA 3USZA 2Q07A 1MHPA 4JLJA 4NFSA 3TEJA 3I9JA 4UJ3A 1XJQA 5HTKA 3EVAA 3A31A 3THWA 2YFHA 1K5DA 4YRDA 2GEKA 4QGHA 4C5AA 4O0MA 3RSLA 1UZAA 3NM5A 2FFHA 3NHSA 3SR4A 1W6UA 3JQFC 4ALLA 3FOCA 2ZQ5A 4ZD6A 4NECA 2I7DA 1JF8A 5DMXA 1PS8A 2O8FA 2JA1A 3GB9A 1V8DA 1ZCZA 3P26A 4OQZA 1PYOA 1Q95A 4U2DA 1PR1A 3OWOA 1AKTA 4HZUB 2WJJA 1YZYA 4UDYX 4DMGA 1A5AB 3N05A 5C1PA 4BPBA 4M1YA 4K6HA 4V0LA 4C20A 4GC9A 4IILA 4MR9A 4MW9A 4GX0A 3PJRA 3IDOA 4WBNB 2QMQA 3KKLA 2VC2B 5AESA 4PPNA 1ADGA 1QQAA 1NLFA 1COZA 1V3TA 2TSYB 3AETA 5L3RA 2D1FA 3MJCA 4E5YA 1I2CA 3NTLA 2GBFA 5K7SA 2AH5A 3ANLA 3LOUA 3ZHCA 3BMOB 4Z4FA 2ZJ8A 4S05A 3S2EA 3F6SA 1Q92A 3BJEA 5CIWA 2HV9A 1I2BA 3DHNA 4XIFA 3ZHTA 2IS4A 3WL5A 3HUDA 2QZ9A 1RYZA 3L0SA 5DKFA 3BULA 2JFNA 5K6TA 3H8WA 3I52A 2HRCA 1GD1O 3M83A 1FW8A 5KYUB 1E0KA 5DLDA 2DHCA 3L8HA 4M8SA 3IBSA 5MGNA 2M98A 4PZYA 1WF6A 2GHRA 2R7NA 3JALA 2BCGY 2J30A 3FCAA 4YUWA 1K92A 1WXQA 2X15A 1X70A 3IAAA 4D4JA 5JS7A 1ID1A 3S0JA 1FX0B 1WEKA 1CX9B 3UOWA 1T9CA 3CLUC 3DNFA 5EHGA 4CLEA 1G5RA 3SYLA 4E2ZA 4WVFA 4CCYA 1LGYA 1P5ZB 4NI5A 5AOBA 5IG2A 3SXUB 2QM7A 4C30A 2ZUDA 4K7JA 4Z49A 1M7HA 4HRYA 2Q27A 5EFOA 3COYA 4O4HA 5COQA 4QUJA 4HLUC 3HUFA 3DOEA 2GXSA 2Z5GA 1YAJA 1NXXA 2V65A 3A4YA 5EZYF 2FQQA 4H77A 3ITDA 4P2GA 4MI6A 1THMA 1LV7A 4IBOA 4ZGBA 3R0IA 4G89A 1QGUB 2RK3A 4E5UA 1NA5A 3T99A 1E89A 4QEDA 4XCVA 3VJMA 3FUWA 3KJFA 4DRXA 2QP9X 5ECWA 4C08A 3OQIA 5JBNA 1AV6A 1DL5A 4N7JA 3QBTA 4DCUA 4EUNA 1GA1A 1D1SA 1KO4A 2O8VA 3PNKA 1D0SA 3ND8A 5C5CA 3ZCVA 4ZEXA 4C4SA 4JU9A 4HEHA 4D3DA 8ATCA 5CDHA 2X7XA 4B2LA 1IJEA 1L1RA 3FWKA 1J49A 3LXRA 1A9QA 1AGPA 1UWKA 3L2OB 1DCTA 2PMWB 1VE5A 2L42A 4ZVNA 5I48A 2QLTA 1CP2A 4V02A 4BE9A 1ENPA 4MR9B 3QVXA 5B30A 1GTMA 4FHGA 4OI4A 3R41A 3LUAA 4PHHA 3P4XA 3WKEA 4EPWA 2JK0A 2HCBA 4B76A 3C85A 2C4VA 2P8JA 2PYIA 4PW0A 1WX1A 5F5XA 2FW6A 3GRYA 3PT9A 2PMEA 4A10A 4ZIRA 2QQFA 2A2ZA 2PUJA 4CMGA 1W36B 1EFPA 4QIHA 4RJTA 4RIFA 5LOVF 4ZGWA 5JJ5A 2VP5A 5M29A 1X7ZA 3DBRB 4QAJA 3I5XA 5JW6A 4Y0VA 4NCIA 2ZJFA 4IH1A 5F7OA 3BQMB 3P5SA 2JLSA 2XYGA 3QXXA 4JVNA 4G41A 3UWOA 3T0GA 4LFAB 4B6FA 2B69A 4R2MA 3UHFA 2W48A 4HGRA 5HE9A 3GPDG 3W5DA 4E21A 4EFMA 2OHVA 3SDZA 1ZH2A 2YNMA 4DG9A 2ZYSA 5F4ZA 3PD7A 2H2HA 4UMVA 3IEPA 5KQLA 2Y1OA 3DE4X 3HP1A 1Y1RA 3PRHA 4M6WB 4I55B 1SBYA 1LV8A 1R27A 4RSGA 3AU8A 3QQPA 4P83A 1ESNA 2Y2UA 3SZRA 1LLDA 5FWDA 2I9PA 5JCOA 1XSEA 4N49A 3ORFA 4OUKX 3JPYA 1L5HA 3VHLB 1CQZA 1YZ3A 4YDHB 2OYRA 4R31A 4KOAA 3I30X 3LOQA 1QP8A 1EEXB 1X39A 3ESRA 2WLSA 3QJYA 1NNI1 2J3QA 1MU0A 2TMDA 1ZOLA 2ZE6A 4ZO7A 5FBWB 4GI2A 1PFYA 3PX3A 4LS3A 4WOPA 4ND1A 1HKHA 3WRYC 3G1UA 1F2UA 4FYPA 1GPNA 2PV0A 4IZIA 3DW3X 5TVKA 4EQ6A 3CN9A 4RU1A 2XR1A 3BFXA 4CRWB 5MHTA 4OFXA 5KREA 4ZAVA 1FNSA 1B15A 4FOTA 3TIIA 5K0BA 2HBRA 3O8OB 1VKOA 1W88B 4O1HA 3B6MA 3EUFA 4HOYA 5A4FS 3R0QA 4F60A 2G4LA 3EZ9A 2HR1A 2VK8A 4G0YA 3P32A 2FN4A 2H65A 1VE3A 1E1RD 2WNHA 8LDHA 2BKLA 4DDWA 5C35A 1FK8A 4GOND 4WOKA 5LZ9A 3FNEA 1MFPA 2WWHA 3CPSA 3DAHA 2EF1A 2HU2A 4BL5A 4BVLA 4BLSA 1WWKA 3X1KA 1EVZA 3B1WA 1L4FA 3TL2A 4KN8A 2XUFA 4G0XA 5JATA 1IB6A 1NQWA 2PQMA 1Q57A 1Q6YA 2OFPA 3G0OA 3IPRA 3PVZA 1ZG3A 3AZQA 1KEKA 4B75A 4OJMX 4BNHA 5I4CA 4XLLA 2POQX 3K1TA 1YL6A 3LUFA 1DBVO 1GPWB 1U0LA 3GEBA 4P8RA 4GKJB 4V0QA 4YAEA 3OBBA 1PR4A 1V71A 2GO1A 3NUZA 4B6OA 1IUKA 3MRVA 2Q1YA 4YMLA 3GG9A 2NU7A 2GM4A 4AT1A 1IQUA 2ZM5A 1NPYA 3I23A 2DFKB 4IUYA 1KERA 1JFFA 1C3LA 2AJCA 2A67A 3N2ZB 2OG1A 3UICA 3LW7A 4DPKA 4Q3BA 3GGSA 1ILWA 4E70A 1W5AA 3CF2A 5JSYA 1E6KA 1GA6A 4HKTA 4NHEA 3CE6A 1J90A 3QOWA 3KB2A 3RYFA 1G20B 3RAJA 1Z5NA 4Q4AB 3OT1B 4KIJA 4YRCA 4EHIA 1EVKA 2E1RA 2ODEA 4P3NA 2XCTB 3RTDA 3PWZA 3M2PA 4FHZA 2F59A 1SWVA 2NU8B 3UXMA 1LZLA 3EFHA 1X80A 3F4BA 3RIXA 3SZUA 4WA8A 4Z1OA 2DG2A 3FG9A 4NMXB 2DKNA 1UM8A 2H54A 4FXOA 5KTKA 4C01A 5FFFA 3W5UA 2FPKA 5LXTB 2VAXA 2OQRA 2FHPA 4F2PA 5DEIA 1Y1LA 4HNRA 3TLCA 3TVDA 1PZNA 3QKSA 2YUIA 4B6JA 3CUSA 5ADUS 3A28A 1G8JA 3AR5A 2GCOA 2Q4RA 3WY9A 1LNQA 1WDWB 2ID8A 3G7SA 4I1UA 5DHRA 2AJDA 5EIFA 1GPLA 1UBEA 3N5CA 4JA0A 5DNEA 5F73A 4GOMD 1PN3A 3D1VA 1M0TA 1B6RA 2HCTA 2F43B 3C4JA 3KLNA 3Q6MA 3GAFA 1XAGA 2GJ8A 2HNBA 4RUKA 4RXUA 4YQEA 1G1MA 3T1NA 4X3PA 3O8OA 3R0VA 1BKDR 2I87A 2EEZA 3I6MA 4OHKA 2FRDA 1K3UB 2XBMA 1G9TA 2AFIB 4MDFA 3PUXA 1DPGA 2OGUA 1PTJC 5EJ2A 5BO5A 4DIMA 4DFDA 3HJTA 2BJHA 2ZAGA 2UVPB 4KXUA 5SZIA 5TS3A 5KSYA 2NN3C 4K0RA 4L0QA 2DMRA 5JNTA 1N9KA 3AKYA 3MLAA 1U7XA 4Q9AA 5M2QA 4CN8A 1NKSA 4BTLA 1OFHA 2DFDA 2DFPA 2C92A 3QLUA 3RTBA 1Z56C 4ENQA 1U8ZA 4Y6LA 5D7NA 5JSFA 2C00A 5B58T 1I94B 3QEMA 2B30A 3OEED 1FP4A 4R3NA 2GERA 4R40A 3O94A 1UEJA 2GUGA 1U0TA 1VRVA 5CLQA 4U0JA 2RHDA 3VZCA 1AJEA 3ESYA 4DCSA 1DWUA 4KXYA 4Z8YA 1QP4A 5AHKA 3H5TA 1OXXK 3C7CB 5KJ6A 1CETA 2G1PA 4BLQA 3ABIA 3K20A 4G0UA 1KIAA 1RRVA 1Z0FA 4UCWA 2DY1A 1O03A 3H84A 1R9NA 5I9SA 2PS3A 5JLJA 1J07A 4DVJA 1KMIY 1T9DA 2VUHB 3AF2A 4GI7A 1FL9A 1E8MA 4DG8A 1KAGA 2HMSA 3DVLA 1N6HA 1V5IA 5FR1A 4OBEA 4GGMX 4FS8A 1ULHA 5JTUA 1RWPA 5F9MA 1RRFA 3CZ4A 3D8HA 1HYHA 4JI3B 5CLFA 1C3JA 1OLXA 3IPCA 4DW8A 3EGDB 5DCYA 2BVNA 4LTDA 1JHOA 3DBHB 4OSEA 4EPXA 5KDOA 3TQTA 3OIYA 3ANTA 2YVQA 2ZI9A 1K7YA 2ENWA 3H11A 3NVDA 2PLNA 1XDUA 3EH1A 3TZQA 3VJRA 3QFFA 1M33A 1WUJS 2OCAA 3L4JA 5CT8A 2ES4A 1L7QA 1C4XA 1QK5A 1QO9A 3IXMA 3NVMB 4QBTA 1U90A 5K2OA 2ZI7A 3W77A 2X8JB 2PXHA 1E96A 4H15A 3C1UA 4YDSA 1E1CB 4QC2A 1DAHA 3B8HA 4ZVQA 3WFJA 5D5PA 3WLOA 3Q7EA 4MGHA 3ZIUA 1XWFA 4CUJA 3JAMA 2JNWA 3DE6X 3I83A 2H4HA 3EWNA 2ZIAA 4UXHA 1NM5A 5EKDA 3ZCXA 2CUNA 5CYPA 5LQJA 4IX9A 3OI7A 4RKFA 2A9VA 1EM8B 1NPDA 4X92A 4Y67A 4ZO4A 1UKEA 2XNKA 2G0TA 2Q3CA 3T7TA 4HB3A 2GKOA 4NXNB 3JWHA 4JP1A 5AKGA 5K0FA 1AY0A 1RYYA 3T38A 1H2BA 2VXYA 1D2EA 4M89A 3TRFA 2ZAIA 3ZBUA 3LUHA 3L7CA 5GJWC 3C6MA 5H3LA 4CU5A 4Y6OA 4C6HA 1EINA 2JLWA 2WFMA 1NHGA 2GVNA 4IXNA 3GEEA 4JS0A 5D3ZA 4BWFB 4HAWA 3WLEA 2OSVA 5TQ0B 1XZDA 3TAHA 4Q1BA 1RLIA 5BWMA 2DOKA 3V4FA 3GLIE 3RVLA 3SN6A 3KOXA 1P4JA 2V7TA 1PEDA 1PIWA 5JI3E 3NM4A 1W0JA 5FI5A 2CNWA 2QRKA 1ZJJA 3EY9A 1QPZA 1S2MA 2HXYA 2UUBB 4ID3A 1L5YA 2HLNA 2WFLB 3R75A 3S4YA 2A1TR 4EY5A 4LF6B 1ZMRA 3PFWO 4G85A 5DXFA 2AX4A 1R4MB 1VDMA 2QUKA 2WMNB 1BTOA 1IPHA 1YS1X 2A59A 1MB2A 2HBQA 4PBSA 3AOEA 4NLLA 4ZVOA 2C07A 3I1IA 1H69A 1COWD 2WD8A 2WHPB 2ZAYA 1Q0PA 5E6RA 4NBWA 1U5AA 3BE8A 3HU5A 1BXZA 2ZANA 3NPMA 4P36A 1KE1A 3DJYA 3CRVA 3QRWA 6PFKA 4LXIA 3OZFA 4HRVA 4PE5B 3TMAA 1Z8FA 3MJFA 1YQWA 2LUOA 2GYVA 3A9TA 4IFBA 5B1SA 3LQYA 3ZHUA 4EGJA 1XZNA 4UEOA 5EP3A 4U6SA 1CNMA 3E9EA 3H1BA 4NMLA 1WMBA 4OQXA 3UF0A 4MWOA 5EA2A 4BNWA 2C2OA 1XFAA 2ID9A 4JVSB 3F6EX 1QH1B 4FQ7A 2GPNA 4PQFA 4UAVA 1I1QB 4Q3KA 5EWMA 4IRMA 1CHDA 1RHKA 4U7JA 3WK8A 1P1JA 3NDIA 3S40A 1ZJ5A 1NW9B 3JCZA 4JJ4A 2GHQA 2C2HA 1H2RS 1TRHA 2P9GA 5CCDA 1YIOA 3A70A 4MVJI 1CD5A 4WK4B 3HN2A 4LMRA 1YF3A 3H6HA 4O4JA 3H2JA 4PBRA 4UEWA 4C29A 4CVNA 2F8LA 2Z09A 4ER0A 1YRHA 1PDOA 3QOFA 3ZWPA 4G9EA 4EKDA 4OAOA 4TKLA 1CUZA 1T5IA 4TTTS 4RETA 2IT1A 2XXBA 4FNOA 4JITA 4WK2B 4BC1A 4EJSA 1W0KD 1XU4A 3VV2A 5H82A 1OXBB 4Q21A 3OP4A 1TZMA 5JH7A 5HQTA 4B48A 1KVTA 3HCDA 1XXHA 3DDWA 4TWAA 4Z0HO 1PQWA 1CQWA 1EUYA 3UENA 3HM2A 2J0QA 2FMFA 2WM2A 3CNEA 3D7NA 4LE1A 1QWOA 3UMCA 2JLAA 1UFQA 3BZWA 3VGJA 1UAGA 4EIWA 2XB8A 1V2GA 5EP4A 3C8DA 3RFCA 4J2HA 3N39C 4UEQA 4HH3C 1U1FA 1QVAA 2Z83A 3EIXA 5HS6A 2WJZB 3MGAA 4MP6A 4TSRA 4Y3UA 2IYTA 2PBZA 1SXPA 3C6XA 2WG0A 3V1TC 5L51A 1FJXA 1AN0A 1OZ0A 4O4JF 1FCJA 1TQDA 4AZVA 4YP7A 2GBLC 2AS0A 1RYFA 2D3WA 4ER7A 4JUFA 1TYEB 2HRQA 3LU1A 1SULA 4K3VA 2VRCD 3C74A 2VJNA 2NU9A 3GLTA 3HGMA 3VDQA 4CL8A 1O9GA 3ZDAA 1PE0A 4IWYA 1OR8A 3FBGA 4RE6A 1GTG1 4NBNA 2FZVA 1L5LA 3ONFA 5FO1A 1A4XA 3UJBA 3HBMA 3PHCA 3F2IA 4HLUA 5F2OA 4O4LB 3L1UA 1XQ9A 3M3HA 3VPHA 3SICE 4DKJA 1HMYA 2UZ4A 2BBTA 2R5NA 2Z1MA