1YZTA

Gppnhp-bound rab21 gtpase at 2.05 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
155
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 155
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yztA00
4ON9A 1OH5A 2WOOA 3PUVA 2OFWA 2EFEB 1KI9A 1EFCA 1U94A 3E5HA 4EFMA 2P6RA 1ZIOA 3BH0A 1G21E 2GZHA 5HZHA 3FGNA 2EFGA 2F6RA 5HCNA 5GJBA 3VR1A 1ZMXA 3GFPA 2P3SA 1GRQA 5JSZA 1Z6XA 2OBLA 3FMOB 2RGNA 4X8MA 4Q9IA 3SDZA 1TAGA 1VG1A 5J4LA 1KI6B 3GJ7A 4FCTA 5M04A 4Q9JA 3AGPA 1ZNZA 3BFVA 1ZD9A 4LHWA 1E2IA 3T35A 1T3HA 1N0VC 1M7GA 2VO1A 3CF6R 4A15A 4NYIR 4B74A 1MOZA 2VPPA 5LD2B 4I1VA 1ZCBA 5BXQC 2XB4A 3GJ8A 2FH5B 4AKEA 2JATA 3DZDA 2F1IA 4PQFA 5DNYB 2OXRA 2BC9A 3LV8A 4DUGD 5TDHA 1E9RA 1J90A 1D2MA 2FFBA 3H2YA 2JLZA 1FZQA 4GRAA 3NC0C 2B8WA 2H8KA 3D3QA 3MWLA 4LZZA 1U8ZA 3GFOA 3KUDA 1DAIA 2ZVQX 4QBGB 2YKGA 3IPXA 1LVGA 2R44A 2ZI6A 2QAJA 2QT1A 4KVAA 4Q47A 1MH1A 4TYNA 4TMWA 1SVKA 4MITA 4B73A 3WMFA 3M1IA 4DLVA 4U02A 1JEEA 1KO5A 3IGFA 2XEXA 1TMKA 5FBVB 3SYLA 3IPYA 2QMOA 2HF8A 4HI0E 3QIAA 4BLPA 1X8JA 4E09A 2WPDD 1KY3A 2WJYA 1Q1ZA 2FE4A 2GJ8A 1WXQA 3DMNA 4D25A 5CK5A 1GRNA 2HCBA 3QKUA 2ZRAA 4NU0A 2WWGA 1NI3A 3A1VA 3GEEA 2RB4A 2KE5A 1XB2A 1GG2A 1JJVA 5DI3B 4F4IA 4HUQA 3S1AB 1KI4A 1DBSA 1SKYB 5KPDA 1HV8A 4NCJA 4WBSA 1ZU5A 1CRQA 4QGAA 3WP1B 1HT2E 4ZKDA 5KOYA 3LWNA 1C9KA 1LF5A 2HV8A 3SYKA 3U3OA 1H8HA 1W1WA 4M1SA 4E22A 5D3MA 4DCTA 3QEJA 4P3YA 4JKYA 4O25A 3R7WA 1WP9A 3NEYA 5FTJA 2ZS7A 4D4KA 1IXRC 1OHHA 2WSSA 3TUIC 3K0SA 1QF9A 1XTJA 2V54A 3HJNA 5DN6A 2JJ2D 2V3CC 4CEHB 3I62A 3OF5A 5EUQB 1IN8A 1OW3B 4MGZR 4Y0AA 4A6PA 4BZXA 4GP7A 3GLGE 2LWIA 2C9OA 2YOFA 1OFHA 2J46A 3MWKA 4M22A 2BMEA 5FR2A 2R6AA 5J40A 3AVOA 2RHMA 2QQ0A 4GOJA 1JPNA 2C78A 4OQXA 2QA5A 3AVYA 1UBEA 1PLJA 5BN4A 2FA9A 5FUXA 1SHKA 1OXXK 5LPNA 5FUVA 5FBLB 2N1BA 3LX8A 2J3EA 2J7KA 4P4SA 1BO6A 2VL7A 4Z54A 3QQ5A 3AB3A 4W5HA 2IHYA 5A5GA 2W6JD 4B2LA 2ZSAA 4QHYA 2XTMA 3K9HA 1OFTA 3Q9LA 5TVKA 4W7SA 1EGAA 3RS7A 3V9PA 4TQUS 1E0KA 2JJ1A 2NQ2C 3I8XA 1N5IA 1GWNA 2DYKA 5CYPA 3B6EA 4B6EA 3IDQA 1MABB 1ZJ6A 2YWGA 1XMSA 2CXXA 2QP9X 4NH0A 4BFTA 1TQ2A 4DVGA 3GLIA 2JLXA 1I2DA 2I4IA 4FMDF 3RVBA 2QZ4A 1NLFA 2GESA 1XEFA 2DPXA 3T12A 4YMTA 2W00A 1WMSA 2PLRA 3U3RA 2AK2A 5IT5A 1F2TA 3CPHA 3N70A 3B78A 2EQBA 2AXPA 3HPQA 4PHFA 3THYB 2F1HA 2PZGA 2ONJA 3SOPA 4DLWA 2NO6A 5D3QA 1N6KA 4EPXA 1ZUIA 2REOA 3ZQ6A 2Z43A 5JJLA 2YNMA 3GLHA 4C2UA 2ORIA 4V0LA 3TKLA 3I61A 3PXGA 2AN9A 5TY0A 2O0HA 5SZKB 3WRXC 1P5ZB 1E79D 1N6LA 3QKSA 4D80A 5KNDA 4GI7A 3EX7C 1G6HA 2CL0X 3EPHA 3RSLA 2ZJ5A 2QENA 2ZE7A 3E1SA 1RYFA 3L0OA 4XD7D 5LBIA 1DAMA 1R8SA 3IUYA 4HDQB 2ZRGA 5J5CA 5L3VA 2WHXA 3P1JA 4A92A 4US1R 1CEEA 2GVDC 4FMBB 1N5JA 1D2EA 4WZBE 5EP4A 3LO5A 4S35A 2QRNA 3U2QA 1FNNA 5UKDA 4NONA 4GL2A 2FGJA 2P6UA 4AKHA 4PQYA 1E2MA 1ZM2A 2A7QA 3EASA 3T5GA 4BECA 4AURA 1UJ2A 4FINA 1KI8A 1SKYE 5FBWB 4HLCA 4M9XA 1NIPA 3ZQJA 1T9HA 1QHHB 2WMOB 3RABA 1Z8FA 4I99A 2FMXA 3QEOA 5JSZB 4GPTA 3ZGXA 1JEDA 3KUCA 1L4YA 1DTSA 1FMJA 1I4LD 2ANCA 1JR3E 4LYAA 3BBPA 5KDLA 3VX3A 4DC9A 4GSYA 3PEWA 1VCNA 2F43B 4YC7A 2WKQA 3KX2A 1QHNA 5FPYA 3T1TA 3RC8A 1GITA 3WYGA 5FOTA 1G3RA 3CO5A 4PANA 2IBMA 1G3IA 4EPWA 4DSNA 4DDTA 1PJRA 4G5QA 4B71A 3P27A 5CIQA 3C16C 2IL1A 2ZJBA 1JQLB 4B44A 3DO6A 2IYWA 1K5GA 2VHUA 3FMFA 1XZPA 1UFQA 2BMFA 4LYJA 5H70A 1NIJA 4K81B 3ETLA 1NSTA 1FL9A 4E03A 1UKVY 5C4MA 3GP8A 1BKDR 2REXB 4F7WA 4F93B 1WF3A 1HQCA 2W83A 1E1QD 4C4PA 4EUNA 4R2HA 1L8QA 4WA7A 5JJKA 2N46A 4HB0A 5F9FA 4JL8A 4EPTA 3KQNA 2HJVA 1Q0UA 1VCOA 2IXEA 2ZJAA 5FH9A 2GILA 1CP2A 4OKSA 3O47A 3Q72A 821PA 1ZP6A 3Q7QA 1MO3A 3FFAA 2CE7A 3IHLA 1KGDA 1IY2A 4LJ7A 4TYQA 5IK2D 4IHQA 1EESA 2ODWA 1UKYA 1II9A 1JR3D 3SI7A 1RRPA 3PEYA 1ELOA 1GVNB 3LBNA 1VTKA 3RDPA 1ZM7A 1KY2A 3FKSD 1GUAA 1RKBA 1Z0AA 5FOXA 2W0MA 4HUQB 5B2ZA 2R8RA 1XPOA 4L9SA 5E3HA 1OE0A 2C77A 3EZ6A 3MG9A 2J45A 4TN1A 4O2LA 5D3MB 1RC8A 1G41A 4TT3D 3R7WB 3KJGA 4IXMA 1MO4A 4WIAA 2D2EA 1LTQA 5EP3A 1Z22A 5AUNB 4JLMA 4QNRA 2NO7A 4C0LA 1NSFA 3A37A 1GL7A 1KK1A 2Q3FA 4GOKA 1A5TA 2O0JA 3TR5A 1DVRA 5JCPA 1AS2A 3TAHA 4CW7A 1E2PA 2YZ2A 4LJ9A 3UK6A 4AI6A 1E0JA 4A2WA 1UEJA 2AR7A 2YINC 1S2MA 3OAAD 1Q1EA 3OZXA 2OG2A 4JKIA 1NN3A 5G41A 1YZNA 2DFTA 3K0FA 2V1UA 1Z3IX 3W3AA 1ZCAA 2PMDA 4P4SB 4HB3A 4ZDJA 4D0GA 2QSYA 4TLAA 3VFDA 2OILA 2WIAA 4FW9A 1VYVA 2CJWA 4ITRC 1XU4A 3MLEA 2ZRIA 3WY9A 2OCBA 2C96A 2J5XA 3QKTA 3E70C 3SU8A 2ZI9A 3B60A 3RS0A 1BYUA 3AKCA 3HU1A 5CK4A 3T1OA 2IC5A 2QMHA 3LRPA 4MKHA 1DOAA 1E96A 1G3UA 3GLIB 2YOHA 5FL7D 2IW3A 3UMFA 2DFKB 4DXAA 2EFDB 3Q85A 1G5TA 4OK5A 4ESVA 3PJRA 1GILA 2GEUA 2WOJA 4LJ6A 5CDFE 5KU1A 2DR3A 5SZJA 1W4CA 3WBKA 4C2TA 2JLYA 5JECA 4L5BA 1F2TB 1CBUA 1I2MA 2FSGA 1YZQA 1EFUA 2JLSA 1G19A 2OBNA 3KFXA 5CIWA 2D4HA 1CJVC 1KO4A 1GSIA 1JI0A 1E9EA 1XMIA 2A2ZA 3TH5A 4CEIA 3Q8XB 1P7CA 3FOZA 2IS1A 2VP5A 2ZAMA 4Q7LA 5JRJA 2GF9A 2QMUA 4BFVA 2ZEJA 3GLHB 3W8RA 1FP6A 5JWOA 2CCKA 2GXUA 2PJZA 4Q7JB 2X1VA 3CONA 4HLUC 2IUUA 1OH6A 2NMVA 1G3MA 4NCKA 3QKSB 4DIEA 2CL6X 2IK8A 3VR6A 2G9NA 1AIPA 1KI1A 4DWJA 2VLIA 1US8A 4DHEA 3LBIA 4TMXA 4CEJA 2AHOA 5EE1A 2IWHA 2IS4A 5EXXA 1WQ1R 1E79A 4LGMA 4UQOA 4XOIA 4LI0A 5DYIA 4Q4HA 3CX8A 1J70A 1ONBA 3KKMA 2QUZA 2ZANA 4BZPA 4Q21A 4H9GA 3C41J 1P6XA 3SYNA 2BM0A 1GKUB 1JNYA 3K0EA 4B75A 2GXAA 2CE2X 2NO9A 4HDCA 2XZLA 3W5JA 3EWAA 5L8VA 3UMRA 3DOFA 2ZJYA 3X2SA 2ZQ5A 2JLUA 1NY5A 4RY2A 2V8OA 1CR4A 2JIZA 1JAHA 3QE0A 2PLFA 2GJ9A 3U7HB 5H1YA 4KYIB 2V6IA 1N5KA 3WHKA 4WW0A 4N0DA 1YRAA 5FTMA 1Q1QA 1UADA 5DGXA 3T61A 3SJCA 4JLPA 2Z6VA 4U7DA 3QPVA 4BUJA 2BCGY 1GNPA 3VX4A 5TMPA 5EE3A 3IO3A 1UBGA 3MRSA 4Q1DA 1OJLA 2XNDD 1DEKA 3X1YA 2G0TA 3PFIA 4XWKA 2RMKA 3BB4A 3EIQA 4IVPA 2GRJA 1RRGA 3W6OA 3NH6A 2VP2A 2X8AA 1FTNA 2P65A 4AK9A 2JLVA 1X6VA 2XOKD 4Y0VA 1VG0B 5E4FA 2X2FA 5F2EA 2J0SA 4HLUA 4IDQA 4JVSB 5FL3A 4BLOA 2H5EA 1Z0DA 2FX3A 3BIFA 3CF2A 3NG1A 3PV0A 4HAYA 4LBYA 4CVNA 1OLOA 2IF2A 2HT6A 3KJIA 1KDPA 4ARZA 2JLQA 3CF0A 4MRNA 4BLSA 3T15A 5B58C 1E2JA 1SHZA 4JBXA 4Q00A 2QT0A 3AVTA 4GT1A 621PA 2G3YA 4WOPA 3TMKA 5EP2A 3WNCA 3TVDA 2QTHA 2ZS8A 4YMSA 1AJEA 4MDEA 1ZM4A 1E1QA 2G1KA 5AJYA 1GRRA 4ACBA 2ZU6A 1X8KA 2ERXA 2Y8EA 3D6TB 3ICEA 2IHBA 5DI9A 1WE2A 3CNNA 5CITA 3LQQA 1A1VA 2Z4RA 1Z0JA 2NZ8A 3ZS8A 4TLDA 3LW7A 1M6NA 3I73A 4JVMA 4EQ6A 1OHHD 3GJ6A 5ELXA 2VP0A 4NYMQ 2OCYC 3NHBA 2V7QD 4TMTA 1S0UA 3NKVA 4BRWA 5FTLA 3B85A 4L8GA 5EXSA 1YZTA 3NDPA 1ZAKA 1N25A 4B3CA 1ZRHA 4BLTA 3FHCB 3GLHE 3QBVA 1EWRA 2R6FA 4TMVA 2GWHA 3L0PA 4R9UC 1KKLA 2QGNA 4BLQA 1D2NA 1Z0IA 3FKSA 5HTKA 3DEFA 4RZ2A 2DB3A 1IY1A 5BN5A 1IM2A 5K8TA 2IA5A 1ZC3A 3MAAC 2J1LA 4DDUA 2IYLD 4JVLA 4TMKA 2ATXA 3L43A 2B6HA 2G77B 3K70D 3AF0A 2XJ9A 1YR7A 2JJ1D 2H57A 2PEZA 4YDSA 2ZI4A 1Z08A 4TT3A 3THWA 3BERA 1R4AA 4OJQA 1YRBA 3IQXA 4TLCA 1Q3HA 3A4LA 3ECCA 4PC1A 5EZ6B 1R5NA 3ZIAD 1XCPA 3R9XA 1NLZA 1E32A 1W5TA 3U60B 1G4UR 4LBZA 2XB2A 2W58A 2ZSEA 1XF9A 1XJQA 2ODBA 4QBHA 1Z2CA 4XIGS 3WBJA 1TX4B 1VYTA 1E2HA 2GKSA 1A4RA 3K0FB 4NE2A 4YONB 3VR4A 3QNUA 3ADDA 5K8LA 2OM2A 3QF4A 5JBQA 2W2VA 2QG6A 4M1OA 3NEJA 4Q4AA 2VF7A 2R65A 3R9WA 1W0KA 2GTPA 4NYMR 4A0FA 1DELA 2CJWB 2QSZA 3A58B 2IYRA 2FF7A 4RD0A 4Z8YA 1PLLA 1G5RA 1RJ9A 1NJGA 1W49A 2QMEA 5FFMA 1E9AA 5FI1B 1M74A 2PBRA 1S3SA 3UWKA 3R8FA 2HXSA 4MUBA 5IRCD 4MQBA 2NOAA 1CJKC 4HB2A 1XD8A 4Q03A 3KTAA 1H8EA 5FL7A 1KOFA 2KBFA 2BBWA 1WDTA 2ANBA 1ZUNB 2GA8A 4NHOA 4AG5A 1G18A 1KK0A 2Q21A 2R62A 1Q22A 1BOFA 3QOFA 2GAOA 3CNLA 3Q5EA 3LNCA 4C30A 4IEIA 1T6NA 4CEIB 2MSDB 2Z5FA 3G82C 1N3BA 3WRYC 3ZVNA 2CHVA 2FSHA 4PSAA 4ABYA 2P0EA 2P5TB 3RWMB 3THXA 2D3WA 2QEQA 2R2AA 4FMCB 2BV3A 1DG3A 4A9AA 2A78A 3AKDA 1W4RA 2RGXA 4MGKR 2O8DB 3U61B 4D4LA 2AX4A 1US8B 2I1QA 4CEJB 1G8FA 3IKJA 4FWIB 3KKPA 5AUPB 1C1YA 4XSHA 4Q4HB 3WMEA 3M4YA 1GNQA 3VKHA 1G8HA 2ZI5A 5H8WA 4OHZA 4EPYA 2E1RA 1DO2A 3IBYA 3UG6A 4CGZA 1A2KC 2DWOA 4IFBA 4AYXA 3VR3A 3W8NA 1YR6A 1U98A 3AQ4A 2XXAA 1KMQA 3LDAA 2D06A 4B3BA 2XTZA 3SZRA 2JDID 2FDCA 3EZ9A 2VSOA 2CVHA 4Q48A 2IEYA 1K8RA 4PZLA 521PA 3ZVLA 4S2EA 4D4JA 1ZIPA 4XH9B 5EJEA 1W36D 2IUSA 4NCNA 4JVNA 1P3JA 3TQFA 4A4DA 3OHMA 2OCAA 2HEIA 2QM7A 3SQXA 3V4RA 2QQEA 3LW8A 1E1RD 2RGGA 3QPWA 2XNDA 1NLYA 2KB0A 2ZUDA 3MWYW 4B48A 1PZNA 4DDWA 3U6KA 3LAWA 1PLKA 1TQ6A 3GD7A 4RD4A 5KSOA 1AKEA 4EIWA 1KO7A 5EUMA 5TARA 1G3QA 1K6MA 4PR0A 2XOKA 3TR0A 3ND8A 4OI2A 2GXQA 1M8PA 4IKEA 2C9CA 1E0SA 3CPEA 5FTKA 2CLSA 4I1SA 3NBFA 4ARZB 1N6NA 5AR1A 1T5LA 4JLNA 3DPUA 3AUXA 3CLVA 1U9IC 4QM7A 3AM1A 1MR3F 1COWA 3CBQA 1RPZA 4D2IA 2VQSA 5AUOB 3K70C 2HF9A 2FGKA 2XJ4A 4KBGA 2X19A 3DM9B 4JLVA 3MMPA 3SQWA 2KSQA 4AYTA 2GJAA 1TU3A 4TL7A 4YXWD 4KODA 4OQMA 3QXXA 2QNRA 4G01B 3SN6A 421PA 3P20A 1FUKA 5KPJA 3T1QA 4US2R 3KKOA 2VRWA 5AJXA 2OAP1 4RJLA 2UZIR 2XZPA 1NVWQ 1Z47A 3U3MA 3WYFA 5K8IA 4IDHA 1Q1BA 1VYUA 1DAHA 4EQ6B 5EE9A 1LS6A 4Q7MB 5G40A 1TNDA 1KI2A 3PEUA 3OE7A 5HKKA 2DFLA 4MDFA 1EK0A 4KFRA 2IXFA 1J8YF 2GNOA 3CX6A 2ECKA 2PT5A 2V7QA 1SVIA 3NHAA 1DAKA 4RKFA 5B30A 4QKQA 4LYFA 4UNPA 2RGEA 3AF1A 2J0UA 4EJSC 3FHTA 5JS8A 3IBGA 3TUZC 1KMHA 4TL9A 3WYAA 2JGNA 3X1DA 2IEZA 4MKFA 4QBIA 4D0NA 5DISB 1Q20A 2OFXA 2AKYA 5JCZA 2R9VA 3H86A 1Z29A 1U9IA 4DB4A 3THWB 3B9QA 2V1XA 1KYIA 2GEVA 2DY1A 1QHYA 1EFTA 4M8NE 2V4ZA 3W9YA 4FCWA 4DSOA 1JXMA 1TEXA 1R2QA 4KO8A 4PPNA 2RH5A 3MCAA 1JJ7A 2YVUA 3CR7A 4G0NA 4RFSA 4HAWA 2ZM5A 3HYTA 1AS3A 3ZIAA 2QN6A 1K5DA 3T5DA 2CHQA 2UKDA 5LDDC 3L8ZA 3QF4B 1R5OA 2VHQA 1Z63A 1MV5A 3RRNA 4Q4AB 1YZLA 3GJ4A 1L2TA 4G5OA 1IY0A 2HDNB 3UIEA 1P9WA 4A2PA 4HAXA 3KKNA 1R5BA 2OLKA 2RGAA 5FUWA 1IONA 2GCNA 2A3RA 3QUSA 1U2RA 1RJ9B 4QGFA 4WXRA 4DKXA 2QROA 4NP6A 4PPGA 4JLOA 5J4VA 5DYGA 2ZETA 1G8PA 1XCMA 3BH6A 4PAOA 1SXJD 5KHOC 3U5ZB 4L16A 2OO7A 4EJSA 2CDNA 2MMCA 1DPFA 3KTAB 4MKIA 4CZ2A 1KIMA 3ADCA 3GQBA 4L4UA 5JHGB 2WJHA 1NY6A 2VP6A 2C99A 5EXTA 4C0HA 1Q57A 1E6CA 1NVXQ 3PEVA 3GJ5A 3EXAA 1SVWA 4E5UA 1RRFA 1NMXA 2OUKA 4ZPXA 1P9NA 1W36C 2X77A 3PVSA 2WAYA 3T34A 4W5JA 1E2LA 1QDEA 4PQRA 2NPIA 4FMDB 1TF7A 1MT0A 2CNWA 2BKEA 2QORA 1FQJA 3THXB 3NTUA 2OSBA 2JIZD 5JJIA 1NKSA 2EYQA 5CJ2A 4BFSA 1U0LA 2GF0A 1JPJA 3GEHA 4LUCA 3A4MA 1QZXA 4LJ8A 3FTQA 1IAQA 1SVLA 1MO5A 1BIFA 1N5LA 3AP1A 4NCHA 4C7OA 3ZS9A 1VPLA 3BGWA 3NDBB 1A7JA 1G291 1QHXA 1NVVQ 4BFWA 3QXJA 3LXXA 5AUQA 3BRWD 2P5SA 1E2GA 2OFOA 1KSHA 1YR8A 1VMAA 1G6OA 1SVMA 4JL6A 4PC6A 3F5FA 2Z0MA 3DL0A 4U5XA 2RGCA 4LYHA 4KCGA 3TLXA 2WZQA 2J9RA 4W9MC 2NTYC 2ASEA 4ZKEA 4AY2A 2XXAB 3VU9A 4DBLC 4Q4JA 1XEXA 1LS1A 3MUFA 1ZW6A 4US0R 5DSZA 2ZUBA 4WZAE 1QRAA 3UG7A 4PSVA 2EWVA 3LLMA 4AC9A 4URWR 2FSFA 3LY5A 3N5CA 3K9GA 4Q02A 2JDIA 2XNSA 4HZIA 3I72A 2VHTA 3P32A 1O87A 3A1SA 1X8LA 3IO5A 2W6ID 1I4TD 4RKEA 1MRNA 3EZFA 1AGPA 1XTKA 2B7BA 4OI4A 2Z4SA 3PENA 3I3SR 4PAMA 2VA8A 2ZI7A 1BH2A 3SS8A 1Z6YA 3RS3A 1AM4D 3AEZA 4ASUA 1ZNWA 2AL7A 3B1WA 2IYZA 1E1RA 3JZMA 4HZUA 3LXRA 3SFZA 2PH1A 4IOJA 4WAUA 4RFVA 1OXSC 2ONKA 3QG5A 4ZO4A 3QY0A 3RS2A 2CK3A 1I4DD 4Q1CA 5BN3A 3CWQA 1PVOA 2NG1A 4LJAA 1N6RA 1E4VA 1NVVR 5L3QA 3P26A 1BYIA 1OKKA 4MA4A 4HAUA 3Q3JB 4ZCIA 5FOWA 1P73A 4BQSA 3TNFA 4LHZA 4C0SA 3AGQA 2GHIA 2GDJA 4KFSA 4BFYA 2GCPA 4PC7A 5AJZA 2ZRCA 1EX7A 1G64A 1IXZA 3FKQA 3U3JA 1KZ7B 1OXVA 2JCSA 4M2LA 2FEMA 3TUJC 3K9NA 4LBWA 2EWWA 4F92B 1KHTA 2VP9A 2IS6A 2ZSFA 1F6BA 3BB3A 2EW1A 4LSGA 5B57C 4KLZA 1WB9A 1N6HA 2FWRA 4KXFB 2IYQA 2RGBA 4YXWA 4CIDA 2FFHA 2R6CA 1R8QA 3K0AA 4JLJA 2F55A 1KKMA 2ZYWX 3NBYC 3WNBA 2JLWA 5CB8A 1U8YA 3AVXA 3ZD7A 2BM1A 3EPLA 2OZEA 3BORA 3B82A 3VTKA 2RGDA 4TYYA 2BBTA 4FN5A 1FP7A 1KAGA 2JLRA 1KO8A 3WXMA 4V0KA 5JEDA 1XTIA 3LFUA 2J0UB 2V9PA 3H1TA 1LFDB 2FPLA 4KJZA 4O2RA 4UXHA 5E7IA 1V43A 2BDTA 1JQJC 2QAGC 1YQTA 1AQYA 2FN4A 1SXJC 1KMHB 4P4UA 4N3NA 1P9RA 5FTNA 1FOEB 2BKUA 4WZ6A 4IDPA 2QPTA 2KBEA 1W0KD 2GEDA 5B64A 3REFA 2ERYA 5DLQC 3SJBA 4UNRA 1QBKC 2DWQA 2GETA 2E9SA 4JLDA 4LJYA 4KSCA 4BFXA 2YWFA 2FFQA 1YVDA 2DCUA 3K70B 5F98A 5HCIA 2EVWX 3IIJA 2H7VA 1D8TA 5C46F 2G0NA 4HDOB 1NN0A 3C14C 1OH8A 1UBFA 1G9XA 2C03A 4RFSB 1R7RA 2ZRBA 1H8ED 2WJJA 2YV5A 5H68A 1YJ5A 2BMDA 1P61B 3JVVA 3U4QA 4G5RA 2FG5A 1FQKA 1G7RA 3F8TA 1E2KA 1ZM3A 1X1SA 2H92A 1ETUA 1Z2AA 4YMWA 1G8GA 2P2LA 3TW8B 5J47A 3KQUA 4CDGA 4TQAA 4P0TA 1Z07A 4OQFA 3TAUA 1NJFA 3PG5A 2NIPA 3CWZA 4MRRA 4HEJA 4G3XA 3I8SA 3EIHA 4Q9LA 2GVZC 5JHHB 4LV6A 4TSFD 4EJSB 1E69A 3PIRA 2QAGA 3FVQA 2FZ4A 1SXJA 1W48A 3BXZA 1C4OA 3Q5DA 5GJCA 4KI0A 3KQHA 5FOSA 2MMGA 4Q1FA 2GAAA 1NP6A 1F2UA 1IN6A 3CRQA 1TPZA 3SHWA 4C0AC 1N6IA 4ZDWA 2VH5R 4BGDA 2XZOA 2BEJA 3GFTA 5JFGA 4QGHA 1E9SA 1HEIA 4M21A 3EZ7A 5EE5B 3RNLA 3A6PC 4M9SA 1KK2A 4ZIRA 4MRPA 2QP3A 2G1JA 3EA0A 4OQLA 2VIIA 3NVAA 4MRVA 4JMPA 5KSYA 2IWRA 2ZR9A 3SFVA 1EX6A 3GPLA 1WBDA 1W5SA 3HU2A 3CRW1 1S96A 2GZAA 2PZEA 4IOLA 4PZYA 1VG9B 4DSTA 4EPRA 4N0EA 3NH9A 1AKYA 4A0GA 2IX3A 1W0JA 3CKLA 2ZXUA 5FI0B 3I5XA 4C7OB 4IW3B 5JWRA 1R0WA 4Q18A 3MSXA 4AD8A 2F1JA 4YDHB 2G88A 4K46A 2HCJB 3E2IA 1NBMA 4B32A 3U6BA 1VDZA 1IN7A 3QVUA 2ZJZA 1HUQA 3VU9B 2Q9BA 1Q44A 1W47A 4Q4JB 1XEXB 1W7AA 1IOZA 1VCMA 2KWIA 2QE7D 3DDCA 5DH9A 2QI9C 4DLRA 2IYUA 2Q9CA 4B3DA 3BFKA 4PHGA 3V4FA 1NRJB 1GL9B 3QENA 2OT3B 1M7BA 3CNOA 1Z83A 5HZKA 2O8CA 3KXLA 2C8VA 3TIFA 3CUEF 1PV4A 1IN4A 5E7JA 4V0MA 3KQKA 2J59A 4JSTA 3FFBA 1XZQA 3ASYA 4JZKA 1COWD 3ADBA 4RD1A 4TQ9A 1UKZA 2ZSDA 3I1FA 5K8UA 1WRBA 1O3YA 2Q0HA 2BJVA 1W36B 2GK7A 3VNVA 4B3FX 1ZNXA 3TJZA 4B76A 2D74A 2ODEA 1CR1A 4W5WA 1IHUA 2W6IA 5JI3E 2XSZD 1JB1A 3DMDA 4HZUB 1J2JA 1U81A 4DCUA 4CF7A 2E87A 3CRRA 2O8BA 4LWZA 2TMKA 3BH7A 3GLIE 1ZU4A 5ANRB 1VIYA 2MSEB 2V6JA 4MGIR 3EAQA 3RC3A 5EE0A 1LF0A 1SGWA 4D82A 1DO0A 3AVWA 3UATA 5L3QB 3NBZC 4RZUA 5JZVA 5HKKD 3OE7D 3SBEA 4M53A 4OHWA 3CM0A 1OH7A 1QG2A 1UM8A 1YZKA 3I5YA 4PO9A 1JXOA 2BBSA 3SNHA 4RD3A 2NO1A 3A8TA 2WWWA 3C5CA 4G5SA 4ACAA 4B3XA 5CB6A 4OI0A 3BB1A 1TQ4A 221PA 2H1LA 3A1UA 2CCJA 3QXHA 5JLJA 3I32A 2ATVA 1CJUC 4QXAA 1DE0A 3TQCA 2X2EA 3UMSA 4DIDA 2Q3HA 5JI2E 3LA6A 2Q9AA 1HH4A 4PC3A 1ZVQA 3K0AB 3RS5A 2REBA 2ZROA 1Y63A 1DARA 4B6FA 4RZ3A 1M7HA 3B9PA 3NBXX 2A9KA 2J7PA 3THOA 4P4TA 2ZRLA 3AP2A 2O0KA 4BFZA 3CH4B 3IHWA 3QXSA 4KFTA 3WMGA 4ZI2A 1RW4A 4MKGA 2ORVA 2ZVPX 1OPXA 2XX3A 4Q01A 4DCNA 3QSYA 4G1UC 1XPUA 2FNAA 3CRMA 1P4SA 1AK2A 2WV9A 1WA5A 1FUUA 3QXCA 1XTSA 1S1MA 3NWJA 3LX5A 2W2XA 4MYTA 5BW8A 1U99A 4LDJA 2VP4A 4CRWB 3B2EA 2AD5A 3TGPA 2PMKA 2IYVA 4M4SA 2G83A 5SZHB 3HU3A 1W46A 1NVUQ 4C0JA 3B1XA 3X1ZA 4O0MA 2QRZA 3RS4A 1T0HB 3ZZ0A 1AS0A 4JT2A 1XCGB 3GJ0A 5GVRA 4JIMA 5IF9A 1J8MF 3IIMA 5C18A 1VECA 4RD6A 5EQTA 1U8AA 1NMYA 1R0YA 3UPUA 4L9WA 1N6OA 3PUXA 3O8BA 2YYZA 4KVGA 1HQYE 1E99A 1II8A 3PQCA 2QTFA 1Z6GA 1XPRA 1OT3A 3RLFA 3A1TA 1RIFA 1IJEA 4GZMA 6Q21A 3GCGA 4JJKA 2WWIA 2DFNA 4FMCF 4LPKA 1GKIA 5A4JA 2FEOA 1GP2A 4LRWA 2QL6A 3DKVA 1D5CA 3TW4A 2WKRA 2CNWD 3FYHA 4AG6A 1ZYUA 3L2OB 2CHGA 4MYCA 2ZRMA 5A0FA 2FU5C 2XTNA 2IT1A 2R6GA 1FTSA 4P33A 4DRZA 4FCVA 4NMMA 2ZRDA 2VHCA 5FOUA 2QAGB 3MWJA 3SJAA 1G4AE 1SXJB 3D8BA 4FWTA 5LB2A 3QVVA 3QBTA 1GL6A 1T0JB 2WIBA 3FPAA 3HR7A 4PPFA 4DLTA 4TSFA 4V0OA 3X1WA 3JVUA 3L0IB 1E9BA 4V0NA 2SHKA 1F2UB 1JAIA 1F3OA 4CT5A 4AWXA 3OIUA 2WJIA 1CJTC 1II0A 1X86B 3U7GA 1OYYA 1YKSA 2LKCA 3OFNA 4BEBA 1ZM9A 2FV8A 4ZIRB 2FZLA 2WWFA 1D6JA 4RVCA 1CULC 1GOTA 2IYTA 5BYKA 5CJPA 3ZDQA 3B1ZA 4ESHA 2PJRA 1Z0FA 1TF2A 1XJCA 2ZRHA 2O8EA 2HXYA 2Z83A 2BWJA 4QFMA 1QHHA 4QBFA 4JL5A 1S9DA 2BOVA 2ZI3A 1Q3TA 4EKDA 3REGA 3FDIA 3N2IA 5KTYA 2OE2A 4WVFA 1EFRD 3PITA 1G8YA 1T3LA 3EPKA 3W6PA 2KI5A 1UDXA 4E07A 2F3RA 4ASUD 2F43A 4AYWA 2Q6TA 2FJUA 3UXMA 1SULA 5GJVC 5FPHA 1KTVA 3QI2A 3CRVA 5KYKA 2XAUA 3DOEA 4D81A 4OI1A 1J99A 2CK3D 2BEKA 4ZDIA 2K5UA 2O8CB 3X1XA 3D7MA 5CDFA 2OCPA 2QE7A 1OKKD 4UJ5A 1CS4C 2NZJA 2VEDA 4HAZA 4POAA 2ZYTX 3VNUA 4URXR 1M2OB 2BJWA 1IN5A 2AWOA 2WJGA 1BS1A 2J87A 3ZLJA 3SHFA 3TVTA 4LHYA 1F60A 3OIWA 1A82A 4HLQB 1OXUA 4RCZA 1TEVA 4LHXA 2ZE6A 3BJIC 1E94E 1XXHA 1S9HA 2FSIA 3HDTA 1HA3A 4NTZA 3CB4A 5TV2A 1NN1A 2O8BB 4HUTA 3FWYA 4GDFA 3DHWC 1YZGA 5C1BA 1LB1B 2XSZA 1XFAA 4M0LA 1JECA 1Z28A 1Z6TA 1GFIA 3IIKA 4URZR 1DAFA 2WM9B 5JRZA 4DB2A 1KI7A 2ZE8A 1NL3A 4LJ5A 2WSMA 3BAFA 1W44A 3VHLB 2GCOA 4XTCS 1ZNYA 4PX9A 5FPSA 4JYCA 3CR8A 1Z06A 3K9LA 2D62A 1QG4A 3RSOA 1E98A 2JASA 2G6BA 3MJHA 4LCBA 3H4MA 4R7ZA 1IXSB 1S1CA 2ZS9A 4UXIA 4B34A 3D31A 4DLZA 3WNDA 3HPRA 1G7CA 3QF7A 3V00A 4Q19A 2QBYA 1E2QA 2GXSA 4N1AA 3KJHA 2V55B 1RVDA 1SXJE 4A36A 2D7DA 1SVOA 4C9BA 4WXPA 4YMVA 1VHLA 5KDDA 4QM6A 3ZD6A 1AA9A 2ZRFA 4OQNA 3AV0B 4X8HA 5E95A 5SZIA 4MRSA 4DJTA 1F48A 1ESMA 4TZ0A 4A1FA 1B0UA 1OYWA 1P62B 2ZR7A 3FE2A 2IYYA 4NCIA 3G0HA 2P67A 1CTQA 4Z1MD 4LPSA 3LVQE 2UVQA 1XJ0A 1T8TA 4TTQA 4DLSA 3TK1A 4OK6A 1FFHA 2PT7A 3RHFA 5KDOA 1TUIA 2D2FA 5IHPA 4OL0A 1BMFD 1OB2A 1P75A 3AF4A 4V02A 4IRUB 3KL4A 1CJMA 2IF0A 1GIAA 5KSZA 1HE8B 1V5WA 4QGGA 2ZTSA 1D9XA 1KSGA 5FPKA 1R0XA 3PUWA 1MO6A 2CVFA 3L8YA 3AVVA 3B1VA 2VHJA 1IJFA 4FI3C 2YC2C 4UJ3A 2FOLA 1NBME 4Q1BA 3RWOA 1NN5A 3AKEA 4II7A 4DLYA 1E3MA 2RHDA 1CLUA 2QGZA 4TL6A 3ZVMA 1AZTA 5HE8A 1FW6A 3AF3A 2PCLA 1DADA 1YE8A 3EARA 4JSYA 3W6NA 2MSCB 3RRYA 2WTUA 5F3WB 2NO0A 3MGCA 3J81k 1II8B 4UKDA 3GLFA 5AK0A 3AVPA 2RCNA 3VHXA 4DT1A 1KDTA 4XWOA 4V0ME 4A8JC 1TTTA 3PR1A 4H1UA 1ZUHA 1KJWA 3C8UA 1P2VA 1PUIA 3OEED 2PL3A 3ICQB 5GJWC 3VKGA 1N6PA 3K09C 3VR5A 1OIXA 4ZV4A 4P32A 1KNQA 3C5HA 3IEUA 4M1KA 4OHYA 1R6BX 3U3KA 3VR2A 1G17A 1ANKA 1RZ3A 2J0VA 1QVAA 4Q1AA 3UANA 2H16A 3CW2A 3C4JA 1UPTA 3HWSA 5BWMA 5C2JB 4B33A 2A5YB 4PAQA 4HSEA 1KNXA 3ND9A 3RAPR 4FXPA 4MGYR 1W0JD 4IXNA 1VKJA 2AXNA 1EFHA 3K0CC 3C15C 2GJSA 4TLBA 5KNBA 2A5GA 1Z6AA 1UEIA 3AVUA 5KNCA 4RSGA 1XNJA 1OXTA 4JLAA 5FOVA 2J41A 1NBMD 1XDBA 4ZI3A 4LC0A 2HLDD 4DDVA 1CXZA 2CMKA 2I3BA 2VF8A 1GM5A 5FBRB 2EFCB 1GNRA 1JR6A 3CIOA 4JYBA 2ZE5A 2L0XA 3QKRA 3OEHA 3OIYA 4OYHA 1LW7A 1F5NA 2B21A 5FPTA 2HT1A 4M9QA 2ZIAA 4IJMA 1Q21A 2ORWA 2O8EB 3PCRB 5JS7A 4R71A 3PUYA 1HYQA 5CM8B 1E4YA 4OHVA 1OSNA 1XX6A 2WMNB 4KSBA 4Q66C 4TYWA 4A8JA 3F0TA 4XVRA 1TU4A 1W4BA 4QNMA 4YLGA 1W2HA 5AJVB 1G16A 1T3SA 5GVSA 4LX0A 2ZJ2A 3K09A 4EPVA 4BWYA 3T06B 1QHIA 3A4NA 1OIVA 3AVQA 1MKYA 2JEOA 3CPJB 4MYUA 4PHHA 5L3SA 2LKDA 2EFHB 4MH0R 2YC4C 3W34A 1EFRA 1HE1C 1FMLA 2ZRJA 1UDWA 3K8YA 2HYIC 4AKIA 3SE0A 4F91B 3HYRA 1J7KA 3SJZA 2VTKA 1R10A 2XITA 3VKWA 4QOSA 2IYSA 1YZUA 4BEJA 1G7TA 2ZPTX 3ZJYA 2WAXA 3K0CA 3UWOA 3KFVA 4NPHA 1CR0A 4KHZA 4DZZA 2EYUA 3R20A 4L15A 2OV2A 5G53C 3AKYA 4DCVA 1RYHA 1FX0A 1GAJA 4DLXA 3LD9A 4U00A 4I1UA 1OFUX 1CRPA 3EPJA 1D9ZA 3BWDD 3KB1A 3EIEA 1AN0A 4IOKA 4XTRA 4KITB 3QPUA 1U0HC 1HY3A 4DUGA 5FBQB 2OLJA 2CBZA 1SQ5A 1XXHB 5P21A 5G3YA 2BIFA 4BZQA 4LV5B 1N0WA 2WWHA 3O8RA 1LV7A 3LVRE 1M1YE 1LY1A 3LQRA 3P4YA 3ASZA 1HTWA 1OV4A 2WWXA 3T1VA 3BK7A 3I4LA 2DBYA 1NG9A 2WKPA 2B8TA 3DZ8A 2J7PD 5AJWA 1RFLA 4G5GA 1XD2A 2JAQA 1XEWX 1H65A 1NMZA 4D6PA 3LH5A 3AF2A 5TXGA 4A6XA 4LJ4A 4LBVA 2GCOB 2A5FA 8OHMA 3RYTC 3TSWA 2IXGA 3DVLA 2WPDA 4OBEA 1YR9A 5L3RA 3W90A 4EFLA 3U7EB 2ZYVX 3W3ZB 5FR1A 1U90A 4D4MA 3W5IA 4M1YA 3MFYA 1XBTA 3VAAA 2QBYB 2BVNA 1T8UA 2YHSA 2ZYUX 1GZSA 4KAXA 4ZDKA 1NF3A 2ZAOA 3VQTA 1L4UA 4PO1A 2F9MA 1UBCA 4D0LB 2CL7X 4OK3A 4O3MA 5CLQA 1MRSA 4F4CA 5EXPA 1CF4A 2VSXA 3GEIA 2BCJQ 1QHGA 5HE9A 1L7VC 3ADKA 1TL7C 4JT4A 721PA 3U44A 2PX3A 2RAPA 4Q9KA 1ZD8A 4LK2A 1E2EA 2BBOA 2ZSBA 3R9IA 4J0QA 2F7SA 3RRMA 1AGRA 4UNNA 1X3SA 2OHFA 1W2GA 4OJKA 4TLEA 2FPMA 3BOSA 2F1RA 4X8LA 4JLBA 4IOMA 3RRZA 3BFXA 4C3ZA 4BASA 4JBYA 2EU8A 3A36A 3H84A 4ZCMA 1T5IA 4F38A 1KK3A 4RZXA 2JJ2A 4Z1MA 1FNMA 2PZFA 3KXIA 4Q5IA 2AFIE 1CR2A 5DO9A 4EFNA 2OEPA 1CU1A 2QTVB 4P31A 4B2IA 2ZRKA 3HR8A 1DS6A 1XEWY 1Q12A 3TRFA 5J4YA 3EA5A 1BMFA 3FMPB 1XMJA 3A1WA 3IQWA 2HJGA 4QJ4A 4X8OA 2W0SA 4B47A 5KSPA 4YQFA 5J4KA 1E2DA 3BE4A 3OESA 4D26A 1ZBDA 4TTPA 1LNZA 4IVRA 1P72A 2WJVA 1SZPA 5LB4A 4C0QC 3IEVA 3BC1A 4QG7A 3QG1A 3FMIA 2W6JA 5EP1A 1P60A 1Y3AA 1S8FA 2VBCA 1XD9A 3GLFB 4CT4B 4DSUA 1IBRA 1G7SA 1ESNA 4UNSA 1SKQA 3VMFA 4LV8B 4DT1B 2ZRPA 2OXCA 4URYR 1RE0A 1U0JA 1X1RA 3KJEA 4HATA 2F9LA 5LD2C 2BHRA 5BQ5A 4H1VA 4QJ5A 2O8FA 5KO2A 2YWHA 1ODFA 3PUZA 1YU9A 4ZCLA 3OFND 1EG7A 3ZYCA 3CX7A 1KI3A 2FFAA 4I81A 5F9HA 1ZC4A 3P4XA 4EDHA 1UAAA 3NXSA 3OEEA 4C0BA 4AIIA 1KDOA 1P2SA 3EW9A 4ILEA 3K1JA 4OHXA 4Z8XA 3ZZTA 2QPAA 2P6NA 5HPYB 1XXHE 3KQLA 2R6DA 2A30A 1XTRA 1KJYA 3QJYA 2PX0A 1E2NA 2ZJ8A 2HUPA 3GLGA 4FIDA 2GJKA 1VCIA 1YHNA 4XVUA 2JJ8A 5C4GB 3R8CA 2O8DA 2GBLC 4TMZA 4I1OA 3L82B 4URUR 4Z51A 1A2BA 3EC1A 1GTVA 1N0UA 1RRCA 4PSKA 4IEEA 4GMDA 4BRUA 1KJZA 4M9ZA 4MUAA 2NGRA 3TE6A 4XD7A 4QRHA 2CEAA 1Z0KA 5DHFA 4XJXA 3ONWA 1OB5A 4R2IA 4KV9A 4KBFA 4UXJA 1PUJA 4JS0A 4IDNA 3SC3A 4BLRA 1KI6A 1UF9A 1ZD1A 3QKRB 2CLCX 3O8CA 4MYHA 1G5PA 2HLDA 4B2PA 2D7CA 4Q9HA 1W4AA 4PXAA 4Q4LA 3U7FB 2LCFA 3OIVA 2ODNA 2YWEA 3L0SA 4KU4A 4A2QA 3O8DA 1VG8A 3CH5A 3SBDA 4DEYA 1GDDA 1XMVA 1TF5A 2PEYA 5DHAA 4A8JB 3G5UA 1VHTA 1Z5ZA 2C95A 2J0QA 4M1WA 4UNQA 4XSGA 1UKEA 5EZ5A 3RANA 4HB4A 5L3SB 3I92A 4NBSA 4EAQA 5FUYA 1GKYA 1DAEA 4RD2A 4CYMA 2IYXA 1P2TA 3NC1C 2WWYA 1T91A 1E2FA 1OF1A 2O5VA 4TTRA 3AUYA 4URVR 1XTQA 2BMJA 1ZINA 4Q7KA 4PZZA 3LBHA 4TL8A 2C5LA 2FPKA 2GBLA 3K53A 3M6AA 4TWZA 2YJTD 3MJRA 4A0HA 1KSFX 1E9CA 1AZSC 1QHSA 1NG1A 2WBLC 2F3TA 1FX0B 4R98A 3H0KA 3WHLA 4B35A 4JLKA 4KLNA 1OIWA 5E7MA 1KZGB 4PFSA 4I4LA 4QHTA 2OESA 1E9FA 5JEEA 4PTLA 2B92A 4M1TA 4YMUA 5GADl 4K8OA 1G20E 5CM9C 2A5JA 1SVSA 3GLFE 4PC2A 4A0RA 1G1MA 1TQDA 2QPOA 2KJQA 3B5JA 5DI3A 1XP8A 1WCV1 3S1AA 4NKRA 2NPFA 1KO1A 1H8HD 4GBMA 1IQPA 1XD2B 3BS4A 4GP6A 5CYOA 1FPMA 4NYJQ 3KZ1E 4XVQA 1WBBA 1TADA 1XRJA 3DKPA 3SR0A 2ZJOA 2WSSD 1T4GA 2B7CA 1JALA 4BE7B 5DN6D 4HAVA 4IFEA 1KSJA 5IK2A 4PO8A 4BPBA 4AKGA 1E0AA 4KFUA 5AWFC 1JR3A 4IVQA 4DCSA 3CZPA 2W2TA 4TZ6A 4XWAA 1CKEA 3FHOA 3EC2A 4JJZA 4KYUA 4CEHA 1DG1G 4FD2A 4HLDA 4LOAA 3UKDA 2C9YA 2PCJA 2CLDX 3TSZA 2WVJA 2ZRNA 4DEXA 3WP0A 3BD9A 4A82A 2QP4A 4C0KA 2OAQ1 3B1YA 2YOGA 3GJXC 2WICA 1AQUA 2AFHE 2H17A 2O52A 3U44B 5J4HA 2UZ3A 1TUEA 3HP1A 4Q1EA 4QHSA 3M0EA 3ZH9B 1NKTA 1EXMA 5IDVA 2C04A 1VIAA 1B23P 1R0ZA 3F3YA 3TSOA 4GMXA 4TYPA 4QL3A 3JZAA 4JBWA 3MD0A 1CIPA 2CCGA 5HR5A 1QVRA 4GOXA 1XWIA 4LHVA 4V03A 5JWHA 2AWNA 2ZR0A 2HYDA 1HT1E 4BFUA 2IS2A 1MABA 3EWSA 5KUTA 4B43A 4NZYA 4PHTA 3LLUA 1OFIA 2C98A 4LC1A 4NYJR 2DWPA 2QY9A 3U4QB 1N2CE 4GFDA 2JA1A 2H18A 3B7GA 4F4JA 3OAAA 3C7KA 2IUTA 4NL4H 4DLUA 2RGNC 2AK3A 3GJ3A 1EWQA 2A5DA 4GNKA 3DM5A 3THYA 3FB4A 3IILA 1NNEA 3B8HA 2DHRA 2C2HA 3GMTA 5JMTA 2GK6A 4B3GA 3KXKA 5DE3A 4QC2A 3AP3A 5DIFA 3SEAA 1HURA 2GZDA 4IDOA 3CZQA 1JBKA 3KDSE 3KB2A 3Q7PA 4NYIQ 2O8FB 4ERNA 2AD1A 3B13B 1M34E 2ZITA 3ZVRA 2VSFA 1E9DA 3NIBA 4HYYA 5G3ZA 4M1MA 3ZZUA 1DAGA 5TB5A 4GZLA 4LY6A 4PPQA 1KDRA 1S3GA 2Q3MA 2VYFA 2N42A 3OEHD 1KAOA 3TBKA 2QU8A 3KKQA 3EG5A 4NDZA 2ZU0C 3AH8A 2QM8A 2OBMA 3N2EA 5BYJA 2RKOA 3EZ2A 4RCYA 2I1VB 3GLGB 1P2UA 2XGJA 5CLLA 4QJ3A 121PA 1S4QA 2AKAB 2ZUCA 2ZREA
chains in the Genus database with same CATH superfamily
4LWOA 4ON9A 2EIHA 2WOOA 1YOVA 3PUVA 2OFWA 1KI9A 3QKWA 3LWBA 4QG3A 1C0IA 4EJ0A 2WFZA 2I29A 1CY2A 2Z1DA 4ZGBA 3HQ4O 2XD9A 1ZMXA 2Q8PA 4DM3A 3LQ4A 3OQ6A 2P3SA 4I55A 3BMNB 5JALA 1DZ3A 4C4RA 3HUUA 4FE3A 4X8MA 3ZWDA 4N4AA 3LC1O 5A6VA 4E1AA 1AHIA 1TAGA 1TLTA 1VL0A 4Z6KA 1KFEB 3GN1A 5HDBB 1JDJA 5KWSA 2XMBA 3L4SO 2DMRA 2R4QA 1NUHA 2IY9A 3EOAI 1YSCA 3FOAA 1P1IA 3ERCA 3TB6A 5ALLA 2ADFA 1NI5A 1R8JA 4FYPA 2DR2A 4NY1A 1E2IA 2J9FB 3T35A 4P22A 3FB1A 5A4KA 4I4TB 2NZWA 3CF6R 4NYIR 2XE4A 5LD2B 2VPPA 4IJQA 1F0PA 4I1VA 2WNSA 2VH1A 1MJ5A 2XB4A 4PO3X 3T3GA 3VU3A 1WUTA 5MN4A 3KXDA 4NR0A 1P33A 3DZDA 2L42A 2ZXEA 3DLPX 3EXHA 2BC9A 5B3JA 5JO9A 4EHJA 2Y66A 2EL9A 1FF9A 1T8SA 2JLBA 2VJCA 2FFBA 5AI9A 1RLMA 4B7XA 2B8NA 4ZOCA 4JI4B 4ERXA 5JPDA 3AUAA 3WFIA 3SSAA 3WJ2A 1OX6A 4YJFB 1YBFA 1T3TA 4PM4A 1PTKA 4TYMA 2Z8YM 2XB9A 4RC9A 2PRKA 1C50A 2ZI6A 3CH6A 5DASA 3UUEA 4KVAA 1ABFA 1CHNA 2OHXA 2JK0A 1UOEA 4TYNA 3UV3A 1Q7EA 3EHDA 1C0KA 4MITA 4MVJM 3WMFA 4HNTA 1EE9A 1YK0A 2PU5A 4NLLA 5C1PA 4DLVA 5EWMB 3R75A 3DOUA 1UFVA 3TNJA 3RC7A 3ZX4A 1JEEA 1TMKA 1VOTA 3GZ4A 5FBVB 4CKZA 3OX4A 3HXLA 4JJAA 2FR8A 2C20A 2HF8A 3CLTC 4ESEA 2QLLA 3BBLA 3BD6A 2B8JA 3ESDA 5EMJA 3FZGA 1MAWA 1Q1ZA 5JSKA 5DCUA 3TTUA 3UAYA 3LPMA 1PWZA 1MW8X 1VA4A 3MT9A 4D25A 1V48A 1GRNA 1I80A 1H6AA 1P5HA 3B52X 4NU0A 1SQ6A 1NI3A 3A1VA 2XMPA 2KE5A 1PK7A 1JJVA 1T1JA 3GR6A 4HUQA 2QL5A 5DI3B 3S1AB 4GXNA 2I6SA 1DBSA 4IRXA 4OUDB 1HV8A 3NIGB 2AEFA 2IZOA 1U5BA 4DUYB 2O1SA 2YICA 4FEGA 3GQVA 1KETA 1C9KA 4E22A 1NMSA 3DNMA 3FIUA 1U2GC 3QEJA 3UOGA 2K7FA 4JKYA 5WRFA 1GAWA 3T7KA 3ZYZA 3JQFC 3W1EA 4Z4IA 4F97A 1OHHA 1TJPB 4G1CA 3DMFA 4DUZB 3HB4X 1LK0A 1QAOA 2JJ2D 2QLMA 5DN6A 3T3OA 5C31A 1BVUA 1IQ0A 4IUDS 4M83A 3T3NA 1SU8A 4Y0AA 4A6PA 4BNKA 3VBEA 3OE4A 2LWIA 3PJFA 4R3UC 1ZZGA 4R83A 5A7GA 5FWYB 1I7PA 2J46A 2BPOA 3RS8A 1XALA 4KZPA 4TV8F 3MLBA 1JZSA 2NUAA 1DKUA 2DECA 4GOJA 1KMMA 1XN1A 2VHWA 4K88A 4OQXA 1G6Q1 3AVYA 1PLJA 1X7HA 1OXXK 5LPNA 3IMCA 5FBLB 4BMYA 1URPA 3LX8A 4GLBA 4FSHA 1F1JA 4RVSA 2OGZA 4W5HA 1HL7A 5D3ZA 1G38A 5I3ZA 2ZSAA 1U3VA 2XTMA 3CN9A 1OFTA 4YP1A 4EY3A 4KXYA 1LBIA 5T7BA 1EGAA 3Q8LA 1XN4A 4JQCA 3V9PA 5EVJA 4X00A 2JJ1A 3I8XA 4LFCB 4OG2A 2YJ6A 2QX8A 4Y9UA 5CYPA 4A8PA 1M2JA 2XNJA 3B6EA 3LDUA 4KGZA 4RGVA 4PBSA 2R5FA 3U0BA 2FRDC 3MBIA 1ZJ6A 4RPGA 3RQSA 1HXHA 5KX5A 5FA6A 2NU7B 1JR2A 4AKTA 2JLXA 2AOUB 1H4TA 2COUA 4HPJB 4L4ZA 1Y3IA 2I4IA 1G42A 3I83A 2AQIA 1QORA 4FMDF 2QZ4A 1U1CA 3KVRA 3RVBA 2GESA 3LLCA 3GRCA 3QFRA 5A9TA 4BWVA 3VNBA 4OOFA 5B2EA 3T12A 2JCBA 1WMSA 4DMLA 4XXHA 1YRLA 2AK2A 3H5AA 3X1MA 1F2TA 3CPHA 3N70A 3O4HA 2AXPA 3ZWYA 4L7VA 2CFSA 3HPQA 1EQ2A 2R5WA 4H3KB 1JEOA 2DT5A 1RCUA 3R5TA 3J7TA 3H6KA 3KD3A 2V6MA 2NO6A 1YDFA 4DLWA 5LLSA 4DC0A 5D3QA 2H65A 3KVVA 5AVJA 4LF4B 1JDNA 2DPMA 1N6KA 3BQNB 3QUTA 4HN9A 4RLHA 1HEUA 3M70A 1JH8A 3KG2A 3VZBA 3U7RA 5C8ZA 4F56A 5DNEA 3IEKA 4V0LA 5GY7A 3DNFA 1DSSG 1HE4A 2FP4B 4LXIA 1NC3A 4FFPA 4W8HA 1LC3A 5FIUA 2HR1A 3WRXC 3JVIA 2FN3A 4JK3A 2RHHA 3PQ6A 1UBRS 1J8FA 2I33A 5ELMA 2QENA 4O0LA 3RFVA 5BWCA 5IUNC 1DAMA 1R8SA 1AKUA 3IUYA 1A0OA 1VE1A 2HSZA 5J5CA 2JGIA 3DP7A 2FUNB 1AB6A 5REQA 1QP7A 1RKVA 2CKDA 4YJDA 3OFKA 4EF4A 4I8XA 1GL3A 2C00A 1VLMA 2XYRA 3L01A 4HDKA 4MIOA 1VBFA 4KE9A 2QRNA 2Z2JA 3K96A 3EZLA 4LYEA 4Y7CA 1GZDA 1LFAA 2R8YA 3QZUA 4NONA 4R9SA 4CDRA 2PRZA 2FGJA 2P6UA 3OPNA 1UUFA 2FXIA 5DEOA 4WEOA 2IE8A 1C14A 1GTG1 1TMYA 4BBZA 3GUHA 4AURA 3GVPA 4PGHA 4M0FA 2BJHA 2WZBA 5FBWB 3DC2A 4GH5A 1CNFA 3BGSA 4DGQA 4JEHA 3RHSA 1UPBA 3ZQJA 1U5AA 4QPNA 3GD5A 1RWWA 3E8SA 3RABA 3KU4A 3NWOA 3TTYA 1SQ0A 4FJ2A 3KUCA 3G8YA 3KZOA 1FMJA 1IBLB 2ZBRA 5EJ7A 1I4LD 2Z9BA 2OQ2A 5D00A 3BBPA 1ZICA 5KDLA 3SJUA 4GSYA 3VX3A 1VCNA 3ICPA 1JFLA 2WKQA 1ZOLA 1T4CA 1YI1A 2I2FA 2ZIFA 3PNPA 2PZKA 4QU5A 4BV3A 4EHNA 3LWZA 3PPIA 1XRRA 1IVYA 5TF0A 3UJNA 4GR5A 2CFRA 5C35A 4DSNA 1A8PA 4DDTA 3WGYA 1IUNA 5CJJA 4YALA 4DMMA 3U1BA 3R5SA 1DLJA 3SYMA 1QR2A 2D5IA 2A0FA 1FK8A 4D79A 4BMCA 4B44A 2MYPA 4FDVA 1D5WA 1XZPA 3KPYA 5JXHA 4LYJA 2AMJA 2FUKA 1SUCA 3Q8WA 4S0ZA 1PNVA 2PPVA 2FPXA 1NSTA 5TC4A 1SXGA 1ZHHA 1KMCA 3EGIA 5B3LA 1UKVY 3V4LA 4R2XA 5IAOA 4A0QA 4F7WA 2JFVA 5CVUA 4Y98A 4Q15A 1KF0A 1WF3A 1IMJA 2ZTMA 2W83A 3PNQA 3UPDA 1PX0A 1QLWA 3OLZA 4MWGA 3DOHA 1M6YA 1YUMA 5JJKA 1P6QA 2N46A 3EH1A 5CA1A 1NASA 3LL7A 4EPTA 1XYGA 3P8ZA 1SKMA 2BHTA 5IFLA 1Q0UA 3TLCA 2IOYA 2ZJAA 2JAUA 1H94A 2J08A 1BAPA 4RVFA 4BKOA 2OHOA 1CP2A 1ZA2A 3MAGA 4FR0A 3O47A 4Q34A 821PA 1ZP6A 3LTEA 4EELA 3BZWA 3L4KA 2PUVA 3SK0A 2YY5A 4LJ7A 2ZBPA 1R6XA 3TRKA 1E0DA 5IKEA 1P4HA 3FGPA 1NXPA 4MW6A 4XUDA 3DYVA 2EZTA 3CY6A 5LQAA 2I3AA 1RRPA 5A4MS 2WZCA 4IP0A 1WNTA 2VTBA 2QVYX 2C5EA 1JIUA 3TQSA 2BHSA 1BW9B 2KLHA 1YBVA 3ICCA 4FT4A 4YJ2F 2BM8A 3QH4A 4XE5A 4ZCTA 5LP6F 5E1MA 5AW4A 5ADHA 2W0MA 1FFSA 4AJEA 1EU1A 4B4DA 1SUFA 1VI5A 3R0IA 2PSDA 1ZIXA 3PDIA 3MAJA 1OE0A 3LCRA 4J7UA 4K9QA 1UBMS 2C77A 4WACA 2WG2A 3MG9A 5AQEA 1U6KA 1Y5LA 4ZO7A 4CCYB 1AGXA 1BDBA 2VDVE 4O2LA 2H4JA 2BAGA 3WV4A 2FRXA 1U65A 4XUEA 1MB3A 2QTCA 3R7WB 5KYXB 3BCSA 3H8JA 4IXMA 5KVQA 5JDCA 2Q9UA 3H9CA 1X1AA 4PLVA 5B1EA 1IPHA 2A94A 1NQWA 1GN8A 1XIVA 1JT2A 2R7MA 2QTGA 3SVZA 3T94A 4KAJA 1TK2A 5AUNB 1UJ6A 4QNRA 3PFBA 3IEXA 2VZ8A 4MV5A 5FWDA 1TKBA 3EY9A 4YO7A 2O0JA 3SHVA 3EG9A 4IXWA 1GQOA 4CM4B 4CW7A 1XZLA 4NQZA 1LBQA 5AJTA 1VYHA 4LJ9A 1DFHA 2IU3A 5BSMA 4CLEA 4EEXA 5BMVA 1YQQA 3FYUA 1S2MA 1GEEA 3OAAD 5JPIA 3OZXA 4JKIA 5CVVA 1QRRA 5D3KA 5J2TF 1NVDA 5HBRA 5BN4B 3W4JA 4CIYA 3TI9A 3H5OA 5KHAA 1I3MA 4L5YA 5D1NA 3NP7A 2AF4C 3RE1A 3H17A 2G06A 2JLAA 3AILA 5LNK1 4D0GA 2QSYA 1A69A 3C1OA 4I1IA 3TSCA 1AKNA 4GQBA 4JNCA 1E1DA 1N75A 1YQ9A 1ZMRA 4MQFA 3S2UA 3DTNA 2WPNA 4XLLA 2OCBA 4FS8A 2J5XA 5CYFA 4WKOA 3RYIA 2R1TA 3PQ2A 5HVNA 2JF0A 2VBIA 3C6ZA 5DMXA 4QVKA 5AJUA 3C48A 4HNHA 4ND1A 1G3UA 5LJIA 1X0XA 1GXSA 2IW3A 1JDUA 1Y37A 4CV0A 5I9IA 5EWLA 1CQWA 2M6RA 5C81A 4I46A 2GSWA 1CP3A 2Z3WA 3DKKA 3QLUC 1GILA 3ETNA 3QTTA 4QPPA 5KU1A 3LZDA 2IBSA 3RAEC 5LYJA 2LP4Y 1ODKA 4IF6A 4KVZA 4CUZA 4DSZA 3IALA 4DF3A 3A27A 3MS4A 3WGNA 5JECA 1ZUNA 2JLSA 4GI1A 2VLBA 5CIWA 3OG9A 2GAIA 1I4EB 1Y3BE 1DJLA 3JPYA 4H6XA 4KWHA 2WE8A 4RTMA 1KO4A 1GSIA 1JI0A 4NF2A 3TH5A 3TLYA 4CEIA 1UOOA 3SXUA 3V48A 4CF4A 4HH1A 1P7CA 4JCOA 4J94A 1YMUA 3GLHB 3W8RA 3SJ7A 2N3ZA 2PJZA 2GXUA 3HXTA 3MMNA 5EKDA 2NMVA 1P5FA 2I78A 4NCKA 2MOKA 3QKSB 3A2NA 4DIEA 1W4LA 3VR6A 1AIPA 3THRA 2P7IA 4ARAA 2CJPA 1VPEA 4TMXA 1JHXA 1L7BA 3I9FA 1UXHA 4B0PA 5EXXA 4PONA 4DM4A 3P9KA 5IANA 4LGMA 1YB4A 2R00A 4OXQA 4K6OA 5DU2A 3K5HA 4QTZA 3TOVA 3CZ5A 3HFGA 2QUZA 3TLGB 4PVDA 2QTAA 4ZQHA 1YQXA 5I4CA 4NCBA 4MRAA 1VXRA 2BM0A 5EC8A 3WKEA 1ZBQA 1JNYA 1B73A 1B1AA 1M2NA 3HDVA 3RM3A 2CE2X 1L3BA 4HDCA 2XZLA 2VKQA 5L8VA 3UMRA 3R74A 3TZ6A 5L6MB 3X2SA 2ZQ5A 4REOA 4RX1A 1NY5A 5FP0A 3S8YA 1VL1A 3STVA 1RMQA 3U7HB 2XYVA 5H1YA 5BW4A 2R84A 1N5KA 3R0XA 5HK8A 3KQWA 4OLHA 3NRCA 5IZCA 4N0DA 4MWBA 2X2PA 1YQDA 3D64A 2VUIB 1UADA 2QRQA 1OWNA 4WDQA 5INTA 1U2SA 2Z6VA 2VJMA 3TPCA 4BUJA 4UEQA 1UP4A 1E58A 2BDUA 2GBPA 2PDAA 3JAWB 3WWEA 1UBGA 4TROA 2ZUWA 1CDOA 1ULHA 1WZUA 3BGOS 4WNYA 1OJLA 4HC4A 1JXAA 3C6KA 3QU9A 3BRWA 1CZOA 2FRVA 3DMTC 4IM7A 3RH0A 4XWKA 1AXEA 1ZIDA 2J6CA 3EIQA 1XC7A 3KUKA 2IQ5A 1RRGA 4N40A 3B20A 1W88B 4QUKA 2R0QC 3HGTA 4FYJA 3ZXSA 4EW1A 2X8AA 1FTNA 2P65A 1XTUA 1ZWKA 3LRXA 2FW0A 4AK9A 6ADHA 1EXVA 2FWAA 1FSZA 5K6AA 3I58A 1F9EA 1XTTA 2X5JO 1IULA 1JHRA 3SZMA 5DCWA 2P8JA 2ZJFA 4QT4A 3W5AA 1Y6JA 2Y1OA 2FX3A 1SRRA 2IYOA 2WIDA 3M7IA 4LBYA 4C2BA 1G2OA 3VDQA 5L6LB 1N9GA 1CIVA 1ZAYA 1C3XA 1IY9A 2JLQA 2D5AA 3KYDB 4ARZA 1PI3A 2QL9A 3T15A 2YZKA 1UBJS 2HUNA 4M1ZA 4WNIA 3OU6A 5AW8A 3O4JA 2BISA 4DXHA 5AW1A 4IJUA 3FI9A 4GL4A 4MKXA 4Q00A 6YASA 2BEVB 3ZV5A 3G49A 2OWEA 3P5BA 3HYNA 2WV7A 4Z5XA 5AVVA 2OV1A 4M98A 4LZOA 3DUFB 1U7WA 5EP2A 3EODA 2QTHA 2ZS8A 1BDMA 3OQOA 1EVEA 4NFYA 3UJ7A 1R0CA 3KETA 1ZM4A 2G1KA 5JARA 5GOTA 4XZ3A 2OCKA 2RBEA 1RU3A 3VH2A 4BO5A 2PWBA 3L79A 3A28A 3D6TB 2X76A 2IHBA 1L7MA 1WE2A 3ENWA 3CNNA 4LSZA 4UATA 3ROKA 1NT4A 1BX0A 1TK9A 2WT4A 5AK4A 1A1VA 1CUDA 1Z0JA 2FJ0A 3ZS8A 1G59A 3PQ3A 4JVMA 5ELXA 4J7AA 5LM3A 2O2CA 3DMPA 4LG1A 4NYMQ 1C7ZA 2OCYC 3T4PA 4AX8A 5KC8A 4P4LA 3GGDA 1S0UA 3Q3EA 5AMXA 3A26A 3FYSA 1NE2A 1U28A 4L8GA 4DGSA 1I7SB 1OMOA 1YIAA 1SUIA 2P4SA 2YZGA 4JB8A 4EY6A 2BSAA 3D5QA 4FFSA 1Z2DA 3JR3A 4CIWA 2AT1A 2BFDA 3BEDA 3QBVA 2NYAA 3VPSA 2VT2A 4X60A 5ER9A 3G1WA 1MOQA 2PYZA 5IT9A 1DUVG 1HNNA 5HKOA 5KTMA 3WA7A 3DA8A 1D2NA 4UPVA 2PGOA 4AO6A 5DRYA 4L4SA 3ZY4A 1SJ9A 5FJIA 2IGBA 5JSHA 5K8TA 2IA5A 1ZC3A 2PRIA 4M7RA 3A2KA 4JI5B 4YXFA 4AICA 3CUYA 4DDUA 3PC3A 2HA4A 3COPA 1V8BA 4JVLA 2ATXA 1KYTA 5CT6A 2B6HA 3K70D 2G1AA 5GV7A 3AF0A 4EZIA 2W98A 4G0QA 3PTZA 1XDSA 4CG2A 1DC6A 1J56A 1MOSA 1R4AA 2OO5A 4XR9A 4OJQA 5HZMA 3N0VA 3ELWA 3S7ZA 1OAAA 2PRSA 4GQAA 4LNHA 3V8VA 5BUQA 3MIZA 1NJ5A 1VIVA 3A4LA 1DCFA 3GPBA 4PC1A 4WFQA 5BNIA 3NV9A 1E32A 3U60B 1PCXA 1G4UR 1W94A 5FYQA 4YI3A 4NBNA 3RYHB 3A6GA 2ODBA 4AJ4A 2O7SA 4QBHA 1Z2CA 3ASUA 3GELA 4XIGS 4AN0A 4BV9A 5FUBA 5ALQA 2GKSA 3ZHQA 1A4RA 3K0FB 3Q15C 4NE2A 4YONB 1I7NA 3QNUA 1A5SB 2W6MA 5THKA 1QP8A 2H2IA 2WKSA 2QG6A 1NI4B 3H5RA 1PT8A 4X71A 1DZIA 2IIQA 3W5DA 3R9WA 1ORDA 2RB5A 1EE1A 2QSZA 2C7VA 1YCFA 2JFPA 3Q6MA 2G5PA 2PL9A 4WGGA 4TV8A 3DBOB 2BTQB 3FDZB 5A9SA 1HOTA 2EGGA 1NMQA 2PLWA 2YNMD 1V1MA 1P1BA 1NJGA 2ZIXA 1W49A 1ZX1A 3R6GA 3R7LA 4F5YA 1QRTA 1E9AA 1AK1A 4DR2B 5DHTA 1I3NA 1Q2XA 4NOJA 2AUNA 4D43A 1M74A 2B2CA 3V7NA 3SS9X 3B3AA 2HXSA 5IRCD 3A32A 2WM8A 1L4MA 1GGNA 2J9GA 4HB2A 1XD8A 4PSDA 5E4TA 4KR9A 4HMPA 4TGLA 2KBFA 4CIVA 2H7CA 2I34A 3CC8A 3LHKA 1VJ0A 1NW5A 2CNOA 1C9YA 1NVGA 3OOEA 1LTHR 1FEZA 2GAOA 4L2IB 3EGOA 3LNCA 1R88A 1WLYA 2EHDA 2IHKA 3W8DA 4YT8A 1T6NA 2EJWA 4IH4A 4Z9FA 2L18A 3PCXA 4JDUA 4IQ0A 5IAGA 5TMEA 2PTHA 1M10A 2EF0A 1L0BA 3KSMA 2P5TB 4PSAA 4ABYA 4RYLA 2QEQA 4MWTA 4FMCB 2ACEA 2BV3A 2XUOA 1N2GA 2YTZA 1DG3A 3C3EA 3DEAA 3LCVB 4P9NA 4RV9A 4RBNA 3AKDA 4TTJA 2RGXA 2X22A 4CLOB 2Q6IA 4MGKR 3VUFA 1D4OA 4IYJA 3COZA 3H9UA 1US8B 5CCXA 2I1QA 4CEJB 1BJTA 1G8FA 1P3DA 4MV7A 1IYZA 3KHSA 3NHMA 3HXPA 3UH1A 2AR9A 1VJRA 5CLIA 2X0IA 1CUAA 2PD6A 1G4HA 3UT0A 3ZDFA 2WUEA 3UENA 3R7BA 3VKHA 5H8WA 4MVJH 2A9PA 3N3BC 1S4MA 3MLAA 1X2EA 1JQAA 1PWXA 1A2KC 2I7CA 2DWOA 2QR3A 3M8KA 4RH1A 3VR3A 4MJ3A 4BNDA 1U9ZA 1L1FA 3FPLA 4MIKA 1U98A 3ZWAA 2XXAA 1LBSA 2AE1A 2W4MA 1PJ2A 3C39A 4L51A 2Z98A 5FX2A 2Q6VA 3JQRA 3EZ9A 2Q50A 2BEWA 3N86A 1HC7A 2IUFA 521PA 3K94A 3MN1A 5DV9A 1GNTA 1X42A 2W8BA 2PX2A 1AY0A 2ZB2A 4JJIA 1VGRA 4QU9A 1ZIPA 2EP7A 2HPZA 4K9SA 4D4JA 5EJEA 4NCNA 4J4TA 5ALIA 3TQFA 5C5DA 2ZUFA 1KVRA 1P2GA 3OHMA 4C5BA 1CQJA 4BWGA 2HEIA 1H2AS 2QM7A 5CDSA 3AFMA 2JW5A 3KR0A 3UHFA 1NLYA 3TSAA 4E7OA 3KLBA 1UP7A 2ZUDA 1G8SA 4DDWA 3DAGA 1GCIA 4DMRA 4DN6A 1JV2B 1AKEA 4U7TB 5HQJA 4EIWA 3RSGA 1KO7A 1L7DA 2A0KA 2GEBA 3F6SA 1I2BA 2DU8A 3TR0A 1I4WA 3FD8A 3URKA 4RFLA 4J7XA 5KKAA 1CK4A 1XLVA 1T2DA 1U1FA 3O3NB 1T5LA 1D07A 4JLNA 1HDIA 1QYWA 4YCJA 3O4IA 4ZQGA 1W6RA 3FJ1A 1YL5A 3CLVA 1DKQA 5JY6A 1GKKA 1MR3F 3QHPA 4ZO6A 4WV3A 3NAZA 5B53A 4D2IA 1DC5A 3TGWA 5FI5A 4CPDA 3TD2A 5GONB 1ZI6A 4XCVA 4I14A 1H22A 3SVLA 4ETIA 3RK1A 4J0EA 4B45A 4IIGA 1H9BA 2Y9MB 4KODA 1ABBA 3UJPA 5ITVA 2AH5A 4MUKA 3D6JA 1JHOA 3K8OE 3P20A 3QOYA 2C4UA 3KT8A 3EXFB 3I0MA 2O3JA 3LHFA 2HHJA 3ITDA 1FRQA 4UTXA 2SKEA 4X97A 3FGZA 4K5QA 2Q2OA 3IPAA 3PKJA 4NPCA 1EFAA 3WYFA 2XF2A 4XIFA 3X3HA 3ANNA 1Q1BA 4EQ6B 1DAHA 1WZNA 2PSFA 1FDWA 1WB5A 1FYEA 3EISA 4HEQA 5EE9A 2GYUA 3UGKA 5G40A 1CCWA 1TNDA 3PEUA 3OE7A 4K3UA 2PIAA 3N5KA 4FDLA 2ZJ6A 2XH8A 3SBOA 4BAZA 5IEJA 1UT8A 5EMNA 3DD1A 1E8MA 2CDRA 2GNOA 2JGDA 2YWDA 3ANLA 2WTNA 3NHAA 1R66A 3PR3A 4R8RA 1DAKA 5KNDH 4KXQA 1P1HA 3QVGB 4RKFA 3OH8A 4N7MA 4Q9NA 3RIXA 5B30A 5AVRA 4JBHA 4LRQA 3HTXA 1H2WA 1XUOA 2J0UA 2FTKE 1D1QA 2ZSUA 4ZVOA 3JYHA 5G4LA 4X7BA 2XA1A 1HFWA 3RUAA 3FHTA 4V2UA 4RIEA 5BN5B 4KXNA 2J31A 3C3KA 3LF2A 4PGAA 1NLMA 1I1HA 2YHBA 2C5SA 4UE3S 4L74A 2IEZA 4HQ6A 1S2GA 3FLMA 1E5XA 2ADMA 2G17A 4R7TA 4QBIA 4YQEA 4YJ2A 5DISB 5DBFA 1GR0A 2GD2A 4DA7A 1L9KA 2AKYA 5K6AC 3IVXA 4BNNA 4HG2A 3RYCB 1Z29A 1BU5A 5AKZA 4C89A 4DB4A 1EWTA 2ZBQA 2PK3A 1FFEA 1KYIA 1FS5A 1N2BA 2GEVA 4IQ8A 4NBLA 4D0RA 1CUWA 4KXXA 1EFTA 2CXRA 2PZLA 4DSOA 1JXMA 3AEUA 4JEMA 1R2QA 2XYHA 3MCAA 5H9WA 3ZOZA 5KKNB 1HF3A 1HDZA 2YVUA 1M2KA 2DPLA 3CR7A 1L5VA 3K5IA 2I2CA 2ZM5A 2OQVA 1TO2E 3HYTA 1D0VA 1V1RA 2X0NA 1REQB 3F3KA 2QN6A 1K5DA 4G0PA 2CHQA 4GKKB 2UKDA 5LDDC 3ZC3A 1R5OA 4RJ2A 1Z63A 3UWSA 1MV5A 1CRWG 3EBOA 3MJFA 3N2KB 4N3AA 3UB4A 1NXSA 1MB0A 3Q9UA 5T41A 1XTVA 1YZLA 3GJ4A 4LMPA 1IY0A 1MB4A 1U04A 1QCDA 5KQSA 1SXIA 4QFCA 1TD9A 4HDRA 1IONA 5FXMA 2B5WA 2V7VA 1U1IA 3C70A 1U2RA 3QUSA 5LKRA 3OT4A 4DKXA 2F8TA 1LLCA 1WUIS 4NP6A 4PPGA 4TWJA 5DYGA 1COZA 3ZI4A 2MTBA 4PAOA 1CW2B 5KHOC 3U5ZB 4RK7A 4L16A 4D3YA 1QTRA 2O19A 4EJSA 2CLHB 1DXHA 2AJTA 3MTBA 2FEWB 1YDGA 2MMCA 1DPFA 3U39A 4ARCA 4CZ2A 2PUJA 5JDIC 1FNDA 1EJ2A 1SQFA 4GF5A 3GQBA 4G0XA 3KE8A 3K05A 3M3PA 4L4UA 4NEGA 5GIOE 3ZCTA 2C99A 1U7HA 1WUYA 2HF2A 4C0HA 1Q57A 1E6CA 1VFNA 5ILQA 4OKIA 1FSPA 3E1GA 1VFPA 4TM7A 4E5UA 1RRFA 1QGUB 3AI7A 3KTDA 2FZVA 1GZ4A 2X77A 2O1XA 5JQWA 1QYDA 3WL4A 1E2LA 4C6SA 5EIFA 2D1RA 4PQRA 1B8OA 2NPIA 3NT5A 1R64A 1TF7A 1EI9A 3T7EA 2BKEA 1EJBA 3EGXB 3THXB 3NTUA 2JIZD 2HZBA 1A7UA 3DEZA 2GPTA 3F9RA 1Q0TA 3H4IA 3VGPA 5JJIA 1CVIA 1NKSA 4EHKA 1RI5A 3TLZA 3VPGA 5ARBA 2H2GA 1NXXA 3LJKA 1O94C 3NI2A 5KZMB 1P0FA 4E14A 2XDAA 4RVHA 3WB0A 4F9FA 3EPRA 1SVLA 1MO5A 2FPPB 1BIFA 1SIUA 2OUIA 2P90A 1DXQA 2OGWA 2QRKA 3AP1A 4NCHA 1RM3A 5EG5A 2QM3A 1QPZA 1KYWA 3NDBB 1O77A 2P0YA 1G291 4XM0A 2QJRA 1USKA 3QXJA 1X1DA 5FQNA 1EIZA 1OI4A 5AUQA 1RXWA 1FYDA 1E2GA 3IBSA 3RK0A 1YFLA 3T0GA 4JL6A 3F5FA 3ONEA 3DL0A 3F6PA 4IIJB 1JSXA 4BKRA 4POOA 1CJCA 1JYSA 2WZQA 1RBMA 1K75A 3FNHA 4GM0A 2EKQA 2QK4A 3JD4A 1OA0A 1D1TA 3DTVD 3FROA 1DNPA 4JLWA 3ZEIA 5LQMA 2JJQA 3W6ZA 3RG2A 3UT5A 5DSZA 2C3YA 2RG7A 3FSGD 3CZMA 4X95A 1BEUB 2VXCA 1RCTE 3DAPA 1N2HA 4I2NA 2BGWA 1SD5A 4B3IA 4CCWA 2WVHA 2G8NA 1T1EA 5HK9A 1JN0A 2FMUA 1SC1A 3V2UA 2FSVA 3DE3X 1J97A 3INRA 4N3GA 4XJTA 3LCCA 1J24A 2X6RA 2Q27A 4EUEA 3LKVA 2W6ID 4RKEA 3WOVA 4BNXA 3AERB 4UUPA 3PENA 3I3SR 5M29A 2GN4A 3TZQA 3AR9A 4TXNA 3YASA 2WK1A 1QFXA 1Z6YA 3RS3A 3SS8A 4DNXA 1ZG3A 2Z6UA 2V0NA 1RPJA 3LNTA 1AM4D 1U9CA 1IY8A 3DV2A 3OOHA 3LOUA 1N92A 3R44A 4HR7A 1I6MA 4UFPA 2NV0A 1WKVA 1PL6A 1WHTA 1QZUA 1OXSC 1V11B 2WJ6A 4CKCB 4ZO4A 4YRZA 5KVSA 3B9RA 1X39A 1Q14A 4Q1CA 2Q6KA 5BN3A 1IHOA 1WSBA 2HGZA 4XWTA 3WLNA 1XHEA 2VNJA 4MVJF 2L2QA 2NG1A 3GC6A 1N6RA 4GI5A 5CU7A 1IZYA 5L3QA 1BYIA 1OKKA 1OLXB 3UJAA 2VQDA 5EZYB 4W8OA 2XKKA 3LT1A 3GXBA 4ZCIA 3L7NA 2RGUA 1QRDA 3RRJA 2GHIA 5BURA 1PQPA 5L4LA 2WF7A 1T2EA 4M87A 4JYAB 5F64A 3WDLA 5JXIA 3KWFA 3FKQA 5JNTA 3U3JA 3DE7X 2UYOA 1OXVA 4PN7A 1VLJA 1F6BA 4L9AA 2PKXA 4J0JA 3TJRA 3V8RA 3WWZA 2VK2A 2F3QA 4HNVA 2VDUE 1O95D 2PGAA 3ICVA 2RGBA 1PJ8A 2Q45A 3PRYA 5FLXA 2UYYA 2NZYA 4JLJA 3TRJA 4I5EA 4KJXA 1KKMA 3WNBA 1ADBA 1Q2UA 2JLWA 1ULUA 3AHHA 3M5DA 3NM5A 1QIDA 1N3LA 1PR1A 2ID9A 4V3BA 5CB8A 3AVXA 3VTKA 1X7ZA 2W22A 4UAJA 4LEIA 1P4JA 3JWGA 3WWYA 3HCBA 3E23A 1VXOA 2X4DA 2CV0A 3TTXA 4E2YA 3WXMA 2X42A 1XTIA 2FZGA 3LFUA 3H1TA 4ZU1X 4Y2RA 2DEUA 5CLFA 3RJMA 4I5DA 2QAGC 1EUCB 4ZV7A 3VR4D 1SU7A 1DJQA 3BIWA 3A1FA 4N3NA 1JHPA 2GN1A 3EBLA 3ZCRA 4XD2A 4A8TA 3C3CA 4LOJA 2XDQB 4OTZA 1I0IA 1VKNA 2GEDA 1J33A 3T4UA 3REFA 4AP9A 4KPYA 5DLQC 4UNRA 5HJ5A 2UUCB 3RTDA 4HBZA 2L82A 2QYTA 2H5LA 2CB0A 2DWQA 5CT4A 1GRCA 3SKXA 4D4GA 2P2DA 5DEIA 5TPWB 2VBGA 3STYA 2YWFA 3OTQA 3WZMA 4GVPA 5KTKA 2OTCA 3HN7A 5EIAA 4O3FA 3WO1A 3PNLA 4MEBA 3MT0A 1U6JA 3EB9A 4MR8B 4QPJC 4KYTA 4O8ZA 1OH8A 2AOVA 4IJVA 2R1VB 4LF9B 4RFSB 4G37A 2ZRBA 2HLPA 1H8ED 1F51E 2CJYA 2I4OA 1ZKDA 1DMRA 5H68A 4HRAA 2VDMB 2BMDA 3R3WA 4S05A 1JSRA 1JW9B 1GSOA 1KJQA 5IYZF 5M5BA 1TA4A 1O8CA 2RAUA 1ND6A 2FG5A 2H2FA 4G5RA 2EZ8A 3F8TA 1B6GA 2H9YA 3OZUA 3QELB 1MZPA 1E2KA 1XZKA 1HFEL 5AI0A 4V1CA 3OC0A 4M9RA 2I2BA 5ILOA 4I5FA 3FPKA 1H85A 1NBAA 1DIGA 4GR9A 4TS1A 5ECWA 3TW8B 1J9EA 1DTWB 3KQUA 2PWZA 4CDGA 2BM9A 1YQGA 1AV7A 1QVVA 2XUDA 3CWZA 4MRRA 3QWHA 4HEJA 4Q93A 2YY6A 3LE8A 5CB4B 3LX6A 2Q2WA 3EIHA 2GTHA 3V8NA 3ZI7A 1UM9A 4G1BA 1QGYA 3PIRA 4FI3F 5KJ6A 1R0KA 2Y1DA 3M49A 4Z53A 1TIKA 4EGJA 2FZ4A 1W48A 4S1TA 1AQNA 1GA1A 3T3MB 4BFCA 3CZCA 3F6YA 4KRYA 1YDWA 2Y67A 1TRHA 3PE3A 3CRQA 3CT4A 4Y2HA 3DZFA 5AK6A 4MQEA 4MLDA 2XKJE 3GWGA 1T0PA 2GN2A 3GFTA 4RE5A 3WGKA 1L5KA 4QGHA 1E9SA 1HEIA 5EE5B 5B4TA 1CUSA 4MRMA 5DNWA 2GTIA 3BE5A 3DB1A 5DXFA 3ABSB 4BO9A 2COKA 1D2CA 4G5YA 2DKNA 3EA0A 3ET4A 4LW8A 3TQOA 3NVAA 4MRVA 4UMVA 2X9NA 4N8DA 4X1IB 5KSYA 1O58A 1LJUA 2FF5A 3PZRA 2ZR9A 1M0EA 1WBDA 2P75A 1S96A 4DR4B 1J9ZA 2CNBA 3I5XA 1AKYA 2G82A 3H9GA 1W0JA 5FHQA 4IW3B 3VTZA 2AI2A 3JZFA 5HIIA 4WJLA 3Q3IA 5JWRA 1ENZA 4LF7B 4D8WA 1M2VB 3BHNA 3HB9A 3TINA 1Q92A 2F1JA 4OVKA 4RLSA 4D9BA 3RK4A 5IBPA 1PV2A 1EGVB 2EZ9A 2BGLA 2DCMA 3CNBA 4W5TA 2AMFA 2BE9A 4J03A 3ZWMA 1MXHA 3KYCA 1U31A 5L51A 4B32A 3P0HA 1JHVA 1IN7A 3Q7IA 3R5JA 4I8DA 4ZAZA 5LU8A 2ZJZA 1HUQA 4HBGA 3M1YA 4E6EA 1W47A 5JQGF 4WLNA 1IOZA 1YT5A 5LQNA 4N03A 2CXTA 3OP1A 4RF4A 4IGKA 5KC9A 4IIUA 1NWCA 2HNKA 2QI9C 3DDCA 3GH1A 3N76A 4MNTA 4BU0A 1KA9H 2HSJA 2Q5IA 1XLTA 1M7BA 4QXPA 1Z83A 3UYLA 1UPAA 2C4VA 4YDQA 2IH5A 1E3MA 3MBKA 2I4LA 4Q0MA 4CHGA 1IN4A 1NPDA 2H1WA 3DO8A 5E7JA 3F7TA 4KW7A 4JSTA 4RLFA 5DM4A 4M60A 1G9SA 1XZQA 4JZKA 1F20A 4RD1A 1FP1D 2DG2A 4CKYA 2ZSDA 1E7MA 1WRBA 1UQTA 2XVAA 5BOSA 2HMVA 1A9RA 2PGIA 1H93A 4WT7A 3TJZA 1CJBA 2VJNA 4KGXA 5AM3A 2D74A 1SU6A 4C1BA 3ENNA 2D0OB 4YJFA 3WHPA 2W6IA 3WOHA 1J5EB 2E18A 2XSZD 1XKLA 5EUBA 5JG7A 4P7JA 4CU5A 1Y4DE 3LIIA 3HGMA 3OCYA 4ZMSA 3S5UA 5CRIA 3QVSA 1K2WA 3CRRA 4MAMA 4DCUA 4LWZA 1M6WA 4W5RA 4AKSA 4UU1A 5IXSA 1Y0BA 3JS5A 1I2AA 3EAQA 3RC3A 5EE0A 5U9CA 4ZAWA 4EHAA 3AR2A 1DO0A 3OTIA 1ONPA 3WKAA 5BN1A 2VBFA 3IDAA 4UBKA 5JZVA 5HKKD 5K20A 4OAOA 2CC2A 2XIJA 3CM0A 4L8VA 1IM5A 3W2TA 1Q11A 1TDJA