1YZTA

Gppnhp-bound rab21 gtpase at 2.05 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
155
Chain Sequence
b'AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-21
molecule tags Protein transport
source organism Homo sapiens
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
total genus 53
structure length 155
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yztA00
1CRPA 2F9LA 2HCJB 4Q00A 4HLUC 1PUIA 1ZUNB 2X8AA 3Q9LA 1TL7C 1VCOA 2HDNB 3DMDA 4BRUA 3F0TA 3BS4A 1OV4A 2D62A 1MKYA 2FJUA 4DB2A 1Z0KA 1YZTA 4FN5A 1TEXA 4LC0A 5A0FA 2EYUA 1F5NA 2CK3A 2JIZD 1CLUA 3KKQA 4G1UC 2WWYA 5KYKA 3T35A 4YMVA 3LNCA 4HDOB 4XD7D 2IW3A 2VP2A 3SS8A 2GA8A 1G19A 2DB3A 4JL6A 1XF9A 2DYKA 3T34A 4F93B 2AK2A 2QSZA 2O0HA 3I32A 4BFZA 3KJGA 2YKGA 3QXSA 2WKRA 2X19A 2JLXA 4QHSA 2BBSA 2RH5A 3A6PC 1U0HC 4NU0A 3C14C 4Z1MD 4N0EA 4L16A 3LBHA 1QHXA 3IHLA 5FPHA 1G64A 3R9IA 3WMEA 2O8CB 4LBYA 2VO1A 4LZZA 2HF9A 1ZCAA 4PZYA 4F4IA 1X3SA 4PPQA 4NMMA 4C0SA 4BFXA 1H65A 4LK2A 4BFTA 1BOFA 3AKDA 5E7IA 3UANA 3CONA 4G5QA 3KUCA 4PXAA 4LGMA 1W0JD 3GJ7A 3TUZC 2IYSA 2XB4A 4XSGA 4BE7B 4V0MA 3KQUA 1OHHD 1NMZA 5FOTA 4XVQA 2A30A 1E2PA 1OW3B 5EZ6B 3CX6A 4M9SA 4B2LA 1MR3F 1XTQA 2RGXA 5J47A 3REFA 2D74A 5H68A 3RSLA 3LBNA 2IL1A 5L3RA 4UNPA 5CJPA 1BS1A 1Z2CA 1OIVA 1KNQA 1ZNXA 1T91A 1XTIA 2B21A 2F1IA 2BBWA 2VH5R 4NONA 3TKLA 4UNNA 4JYBA 4QKQA 2ZRCA 2LCFA 2PEYA 3W6PA 1Y63A 1AZSC 3QG1A 1R0ZA 2G9NA 5KDLA 3U7GA 4QBHA 2QMHA 1HE8B 2Z4SA 2J41A 1CS4C 3SFVA 2WSMA 4F4JA 4QGGA 2P3SA 3RVBA 5JSZB 5GVSA 3A1UA 5JECA 2WICA 1BIFA 2A5DA 3LV8A 1IHUA 1CXZA 2REOA 4JKYA 1W4RA 1Z06A 1VG9B 2CE7A 2Z6VA 1Q3TA 3GLGA 5FBRB 1RKBA 4PC3A 2CDNA 4QHYA 5G3ZA 1NF3A 1DEKA 4A6PA 3FFAA 3TW4A 2RGCA 1QBKC 2GETA 4NH0A 4QGAA 1NVVR 1TQ6A 5J4KA 1P2TA 4RZ2A 2FFHA 2G83A 5EP3A 2NO7A 3AV0B 4BLTA 4E07A 1OB2A 2AKYA 1EX6A 3BFKA 3AVXA 4Q9LA 2J9RA 2IUSA 3FMOB 5G40A 4MGZR 2JDID 1NVUQ 3EZ7A 1JXOA 5DSZA 5CLLA 1FP7A 4W9MC 1VYUA 5LDDC 1DPFA 3U3JA 1TPZA 2YOHA 2CL7X 3OE7D 2OFOA 3OHMA 2VPPA 3DM9B 2BOVA 1UFQA 3MJHA 1A82A 2J5XA 4I81A 3K0FA 4PC7A 4PTLA 4TL6A 2IWRA 4DLXA 2AHOA 2O52A 3AVUA 1CTQA 1G7SA 3SHWA 1IAQA 2CNWD 4Q18A 1P6XA 5L3SA 5GJVC 5E7JA 1A2KC 1G7CA 5FTMA 2AX4A 3GLHB 3FTQA 2BCJQ 4PPFA 4JJZA 3WNCA 2NZ8A 1W7AA 1GNRA 2PBRA 4NYJR 1BMFD 3D3QA 3LX8A 4OYHA 1HTWA 2C99A 3VKWA 3BD9A 3DM5A 1QHYA 3H4MA 5DHAA 2BM0A 4TMWA 4C4PA 3F3YA 3B9PA 2CMKA 2YYZA 4A0GA 1WCV1 2IUTA 1LFDB 2BKEA 3WNDA 4AKHA 1NN3A 4CT4B 1E9RA 4P0TA 1JB1A 2GCPA 1U2RA 4LHVA 1NN0A 4A6XA 5AR1A 4TQ9A 4TT3A 3V00A 1F3OA 2Q9BA 3BOSA 4RJLA 5KOYA 1OH8A 1E32A 4BFUA 1RRCA 3FHCB 3GQBA 4QGFA 4EPYA 3X1XA 1E98A 4XD7A 3HU3A 3IPXA 5DI3A 1N6NA 2N42A 5CB6A 4V0ME 2P67A 1OXUA 2ZYVX 1IBRA 1E3MA 1XX6A 3RS7A 2NO9A 1OFHA 1I2MA 1ZM7A 3U3KA 2JIZA 1RRFA 4NPHA 5KSOA 3V4FA 1ELOA 3CWQA 2GXQA 5K8TA 3PV0A 5TY0A 4NCKA 4BRWA 3M0EA 2OAP1 1ZNZA 3QEOA 1K5GA 2KE5A 4C9BA 2VF8A 1XDBA 3A1TA 2RB4A 3Q8XB 4P4SA 4RY2A 1OLOA 3LVRE 2E87A 4LJ9A 3CZPA 1G8PA 1I4TD 4D4LA 5LPNA 4CEIA 4US1R 1BYIA 1PUJA 4BQSA 2VYFA 3TSZA 5LD2C 1KMHA 2ZROA 4RZ3A 2QM7A 2Z5FA 4QC2A 4PC1A 3LLUA 3C41J 1NMYA 4ERNA 1JR6A 4XWAA 2YINC 1KKLA 5FBLB 3B13B 3DVLA 4TTQA 5LB4A 4BLQA 521PA 2YHSA 3DEFA 1NY5A 2J7KA 4IOLA 4KAXA 5FOSA 2REBA 1N3BA 3BBPA 3P1JA 1U8AA 3BAFA 4DLUA 3U5ZB 1OB5A 1XXHE 3P32A 3VNVA 2GF9A 2CEAA 4G5GA 1SQ5A 4MYCA 3O8CA 1KO1A 4GBMA 4IOKA 1S3SA 5K8IA 2XZOA 3RRYA 4NTZA 3AF2A 3A1VA 3ADDA 2FPLA 1O3YA 3CRQA 3NTUA 3Q85A 3A4MA 1GM5A 1OXTA 5TDHA 4D4MA 1IJFA 2OHFA 3KB2A 2J45A 4FMCF 1BO6A 4IW3B 4ACAA 1Z6XA 2EFDB 1HA3A 2BMJA 4GDFA 2BMFA 4DSOA 4KYUA 1EWQA 1S3GA 4IHQA 4B75A 2F1JA 5EE1A 3GJ3A 2OT3B 1DAHA 4GMDA 4IRUB 4C0BA 1QVAA 3OIWA 2GVDC 4DRZA 2J0SA 3PVSA 3BIFA 1NIPA 1NMXA 3A1WA 2OM2A 2GAOA 3RANA 3GFTA 1NL3A 3TGPA 2XJ4A 4ILEA 2UVQA 5KPDA 4RD4A 1OXXK 2ODBA 4K46A 5DLQC 4LPKA 4G3XA 4A2WA 2NPIA 5KHOC 5H1YA 2ZJYA 2IXFA 1ZM3A 3BORA 5EE0A 4TL9A 2O0JA 3PUVA 3CBQA 3UMSA 4RCYA 1MO5A 2GZDA 4A15A 1CULC 1HE1C 2DFTA 3IPYA 3LY5A 4RD2A 5J4HA 4CZ2A 1T3LA 2Z83A 3DKPA 2ZRFA 5CITA 5TMPA 4BPBA 3IUYA 2WJGA 4IEEA 4I1UA 4MGYR 4TMXA 1YU9A 3K70D 2ATXA 2NMVA 1E4YA 821PA 3LO5A 1A4RA 1IXRC 3CH5A 1UJ2A 4M9ZA 4B71A 4RCZA 5EE5B 3EX7C 2WZQA 2CCGA 2QP4A 1DG1G 2ZRAA 3TQCA 4CEIB 4AWXA 5FPSA 4BLPA 2OBMA 4DZZA 3I3SR 1IOZA 3T5GA 2JEOA 3I73A 4HAYA 4P4SB 2ZYUX 4GFDA 4LJAA 1Z08A 4F4CA 2C96A 4PQFA 1XPUA 2BWJA 4NYIR 2O8BA 1XCPA 2W58A 3BB3A 4EFNA 3THWA 5FUWA 3DMNA 3UKDA 1B23P 2ZRLA 4EQ6A 1JECA 1J8YF 5LB2A 1SVKA 2HLDA 2ZSAA 2IHYA 5JFGA 1KI9A 1N6PA 1DAGA 2DFNA 2ZSDA 2WM9B 2EU8A 1N0WA 4Q7LA 5D3MA 2V7QA 3A8TA 3KUDA 1P62B 1Q1BA 1Z83A 3AF4A 1F2TB 3K70B 1S9HA 3OIUA 5M04A 1MOZA 3ICQB 1BKDR 2IYUA 1V43A 3GP8A 5KNDA 4Q47A 1H8ED 4A2PA 2QP9X 2GXAA 3FE2A 1AQUA 2ZI6A 1GP2A 3AH8A 1KI4A 3UATA 3CPJB 1J70A 2B92A 3VTKA 5FR1A 4C30A 3RRZA 4IFEA 3NBYC 3DPUA 1SULA 5HTKA 4EJSC 3IIKA 2EFEB 1U8YA 1RE0A 2ODNA 3ZZTA 4KYIB 4D6PA 3SQWA 1H8HA 4WA7A 3IO3A 4AK9A 5C1BA 4GZLA 1DELA 3QKTA 3TBKA 3B1WA 3SEAA 2P6RA 3GJ0A 1I2DA 4Q9KA 3TUJC 3RRMA 4HAWA 3TH5A 1FP6A 2JJ1A 4JT2A 5KSYA 5JMTA 3EIEA 1Z47A 2RGNC 2VRWA 3R9WA 2QZ4A 4LCBA 3QE0A 4AURA 4LV6A 2MSEB 2GRJA 3JVUA 4OL0A 1VECA 4W5JA 1OFTA 2JCSA 2WPDD 3QKSA 4PX9A 4TWZA 3RS2A 2OLJA 1ZCBA 2GJSA 3DDCA 3NXSA 5CDFA 3BH0A 4D82A 1Z6GA 4Q4LA 3TQFA 2NQ2C 5KSZA 1N6HA 3ETLA 1RVDA 3R8CA 4PZZA 2ZI5A 4UXIA 1G9XA 3IHWA 4X8MA 3W5IA 4QM7A 5KTYA 1VCMA 2VP5A 2RGNA 3NG1A 2LWIA 1SZPA 4L8GA 2NO1A 4URVR 1Q21A 3FDIA 3GLGB 4WAUA 1YVDA 4EPWA 3SI7A 1UADA 3U3RA 2C04A 2QPOA 1XMSA 1IY0A 3KXKA 4XWOA 5CYPA 1KHTA 1P73A 3AP1A 1KSJA 4OKSA 3V9PA 2GK6A 2ZANA 3OEHD 1VG0B 3EC2A 1G7RA 1E1QA 4HDCA 5DE3A 5FL3A 3MWYW 1E0AA 1XTRA 4GSYA 3QF4B 2F55A 1P72A 4WIAA 1UF9A 3K0SA 3GLIE 1NIJA 4JYCA 2ZRJA 5DI9A 3LA6A 1J8MF 1KJYA 2QI9C 4NYIQ 1ESMA 2AKAB 2FG5A 2PLFA 4L5BA 5E95A 2V3CC 1U90A 1E2JA 4KHZA 4LJ4A 3B78A 3VR2A 1T4GA 1XCMA 4AYTA 1SHZA 1GZSA 3HR8A 1TF2A 3B2EA 3JVVA 2I1QA 5DYIA 5KU1A 2V4ZA 4PQYA 3SR0A 1TEVA 2EYQA 3KQLA 2MSDB 3QVUA 4V02A 3I72A 4L4UA 2H8KA 1Z29A 4DWJA 3DKVA 1R8QA 3ICEA 2QSYA 4GOJA 3WNBA 4Q01A 2ZVQX 3THWB 2Y8EA 5J40A 1TUIA 2XNSA 1P7CA 3C5HA 3PUYA 5JS7A 4N1AA 4U00A 2Q9CA 5B57C 1FQJA 2AFHE 1ZAKA 1N5IA 4A1FA 1HQCA 4DCSA 2P6UA 1E2HA 3ZS8A 4US2R 4I99A 1WE2A 4JBXA 1XP8A 2ZS9A 1H8EA 1SXJB 2ORIA 2A2ZA 2ZR7A 1QG2A 2BIFA 1LB1B 1OF1A 4QNMA 1T9HA 2QGNA 4KBFA 4HUQA 2IYTA 2ZRKA 2BC9A 1RW4A 1QF9A 1AIPA 2LKDA 3ADKA 2CL0X 3O8BA 1KSHA 4YMWA 2QE7D 4NCNA 5DI3B 1G20E 1OE0A 3AF3A 5DISB 2F6RA 4DIDA 4TQAA 2QMEA 3I61A 1AK2A 3B82A 1GUAA 1JAHA 3QBVA 5AJYA 1S2MA 1AJEA 5FOWA 4XTRA 2IS6A 2H16A 4R9UC 2A5FA 1ZC4A 3KL4A 4BFVA 5KSPA 2IWHA 4A0HA 5FL7D 1II8B 1XU4A 3AVQA 2B8WA 2E1RA 3HPRA 3WY9A 1KI2A 4EPRA 1NLZA 5F98A 2EW1A 2QN6A 3VHLB 4KJZA 4YMUA 1ZP6A 1UM8A 1TQ2A 4XH9B 4B3XA 4HLUA 3RC8A 1OKKD 1GL6A 2A5YB 1IN5A 1YZGA 2PEZA 4TYNA 1W49A 1FQKA 5KNCA 4P3YA 1T6NA 2XXAA 1XEWY 4LYJA 3VX4A 1GSIA 2AFIE 2A78A 3LLMA 2WJVA 2IEZA 3KJHA 1JJVA 1R8SA 3MWLA 5F9FA 2FWRA 4RSGA 5EQTA 4HB3A 2GJAA 2ORVA 1HT2E 1ZD9A 2QBYA 3SYNA 4D4KA 2QGZA 1YE8A 2XTMA 3NVAA 4B3BA 2F9MA 2WJJA 1N2CE 3SOPA 5KDDA 3AP3A 1F48A 3EW9A 4PHFA 2O8FB 3Q7QA 2OESA 2AR7A 2ODEA 3PEVA 3CM0A 2XZLA 3OAAD 2VP0A 5FUXA 4Q7JB 1J99A 4LJYA 1Z0AA 2OSBA 1RIFA 5IK2D 1NN1A 1SKQA 4A92A 2F3RA 1E4VA 5CLQA 1OIWA 1SXJC 2YWEA 5JJKA 2ZRHA 3B1YA 1RZ3A 4A8JB 1SGWA 4YDHB 5E3HA 4HEJA 4D0LB 4B48A 4IDNA 2C2HA 4PAMA 2VHUA 3U4QA 1SVMA 4CF7A 1GFIA 3DOFA 3UG6A 1W36B 1N0VC 4DIEA 1VHTA 4UJ5A 2YOGA 1KSGA 4NCJA 1KO8A 4BEBA 1G5RA 4DLYA 4E09A 2GEDA 3UK6A 2ERXA 2ZIAA 4ZKEA 1Z07A 3QKUA 2XNDD 4MQBA 3U60B 2ZRMA 5KPJA 4Q1EA 3U7FB 3AVVA 4C3ZA 1N6RA 5F2EA 1WBDA 1UBGA 4JVLA 1VIYA 4M1KA 3G5UA 4ZKDA 5CIQA 1J7KA 3CZQA 2W6JD 3RDPA 5EUQB 3VMFA 2WHXA 2QA5A 3V4RA 4W5HA 2GCOB 3CH4B 2XOKD 4D0NA 2B8TA 4KLNA 4Z8YA 1FNMA 1OSNA 1R0XA 1G4AE 1Q22A 1KI6A 1XJCA 3OE7A 4C0AC 1E9CA 1Z6TA 2FGKA 3FWYA 3K9HA 3QVVA 3G0HA 4PAQA 1TF7A 5FOUA 1G3QA 4NBSA 4B3CA 3EZ6A 5JS8A 2NZJA 1YHNA 2JJ2D 2PJZA 3P4XA 5FFMA 2R6GA 3WXMA 4OK3A 1KI7A 1OH6A 1JAIA 3EWSA 5D3MB 1U94A 1NN5A 1S4QA 2F1RA 3EASA 3ZZ0A 1Z22A 1LS1A 1X86B 2VBCA 2FF7A 3K0CC 4IOMA 2Z4RA 4WW0A 5EXPA 3FKSA 3UG7A 1GITA 2C03A 2OZEA 4E5UA 3H2YA 1TU4A 2VL7A 1EFRD 2GKSA 2PCLA 4IVRA 4ZV4A 2XGJA 1ONBA 1IONA 2XJ9A 2ZJ2A 3K8YA 5DO9A 5TB5A 2R2AA 4AKIA 2P5SA 4URXR 3QSYA 3VKGA 1CRQA 1TMKA 2RAPA 4KU4A 1G5PA 4Z51A 5ANRB 1Q44A 1U8ZA 1PLKA 2G3YA 4HLCA 1B0UA 1SVOA 1U99A 2QTHA 3W6OA 1R0WA 3N2IA 4F38A 1NI3A 3T06B 4CYMA 2AD1A 1KMQA 2PL3A 3M4YA 4OI1A 2DFKB 1A1VA 5BYJA 1KI8A 2V1UA 4WXRA 3LX5A 4QJ5A 4WOPA 4CRWB 2VEDA 2OXCA 3PJRA 2BDTA 1XCGB 5FOVA 1XD2A 2H17A 3RWMB 1RJ9B 3OESA 2J0QA 4PC6A 3SN6A 1GKYA 4M0LA 1BYUA 1X8LA 1E9FA 2H1LA 4JBYA 2XITA 3I4LA 4ZI2A 1UBEA 3CNOA 1XZQA 1CR4A 1YZNA 2QT1A 2VHJA 1VG8A 3QNUA 4IDQA 3FFBA 1W36C 4YQFA 1D2NA 2FEMA 4KVAA 2NIPA 1IY1A 3OEED 1Z8FA 4RZUA 4QJ3A 1L7VC 1ZUHA 2AWNA 2IF0A 3ZLJA 1XZPA 3B85A 5B2ZA 3B5JA 2QROA 2WWHA 1JALA 1LVGA 4NKRA 3TK1A 1E2NA 4CEJA 3GLHE 4A4DA 3LDAA 3SHFA 5JJIA 1IN4A 2XSZA 2V7QD 5CK5A 4PO1A 3WBJA 2GK7A 3LRPA 3CRRA 4AYXA 4XJXA 1KIMA 4HLDA 5CJ2A 5AUPB 2QAJA 1XEXB 2V8OA 5FPKA 3FMPB 1HEIA 1CP2A 3B60A 4L9WA 1ZU5A 2W2TA 5FBQB 3TVDA 1EX7A 4GRAA 2ANBA 2OV2A 1XEFA 1W4CA 2CVFA 2O5VA 4OI4A 2KSQA 2IYYA 2ZAOA 2NO6A 2ZJOA 1W0KA 3VR6A 1Z2AA 4BFWA 3CNNA 4Z8XA 1XTSA 3Q5DA 3W3AA 2G1JA 5CDFE 4GPTA 1E1RA 1W44A 4LPSA 1E2DA 1G1MA 3IILA 3SJCA 2WIAA 1T5IA 2ZSEA 1TX4B 1KK2A 2HYIC 3BH6A 3ZVMA 3PUZA 2D4HA 4NDZA 4B2PA 5JWOA 4LOAA 5K8LA 1T8TA 3P20A 1DAKA 1JQLB 2FZ4A 4O2RA 4NL4H 1VMAA 1M74A 3IBYA 2RMKA 3GCGA 1WBBA 4KVGA 1AKEA 2FGJA 1JPJA 3AB3A 1SHKA 1U9IA 2ZJZA 1MT0A 2D3WA 1HURA 3L0OA 1CBUA 3TUIC 3I62A 1KMHB 4QGHA 2Q9AA 1W5SA 4CDGA 4Q7MB 5CK4A 4Q5IA 5IHPA 1Z0DA 2QENA 3MAAC 4TL8A 1M34E 4MKGA 4NYMR 4RD0A 4URUR 3PXGA 4BZQA 3D7MA 3AKCA 1DE0A 3NKVA 5AJWA 3ZH9B 4LBWA 5IK2A 1DAFA 4DBLC 2FSGA 4D80A 4G0NA 2JLSA 2QMUA 3SJBA 4FI3C 1D9ZA 2ZJ8A 3GLIA 2ZSFA 5GJWC 2CBZA 1YZUA 1F2UB 5SZHB 3CW2A 3QPWA 2NOAA 4TYQA 3J81k 1SVIA 5CM9C 2YC4C 3NC0C 2FEOA 4M1YA 5BWMA 3OIVA 1G17A 3B9QA 4XTCS 4G5OA 3ZJYA 3RAPR 1MV5A 2QU8A 4UKDA 3GLFB 5IRCD 1UDWA 1R0YA 3CO5A 3TSWA 3ASZA 1N6OA 2ZUBA 2HV8A 4AD8A 4DDVA 4A9AA 1Z6YA 4P32A 3CR7A 3B1VA 3C4JA 2HT6A 2IYXA 4LX0A 3EZ2A 5GJBA 4C2TA 2VIIA 1KK3A 4HYYA 5C4GB 1CEEA 1MO3A 3E70C 3PIRA 1N5LA 4GP6A 1ANKA 2JJ1D 1KAOA 1SVLA 1Q1QA 3CRW1 3OFNA 2ZS8A 3CF0A 5LD2B 2GWHA 3GLHA 3AVPA 1Q57A 4UJ3A 4V03A 4AG5A 1M7GA 3CF2A 1Z3IX 4RFSA 4PSVA 5JEDA 1W1WA 2J1LA 4MUAA 4B74A 2G0TA 2DY1A 4M8NE 5FI0B 1CF4A 1BMFA 4JKIA 4EIWA 4JLBA 1DO0A 4MKFA 2IA5A 1NKTA 4LV5B 4TT3D 4EKDA 2ZM5A 3G82C 1W46A 1Z0IA 1Z28A 3N70A 1P9NA 3RC3A 1RJ9A 4DKXA 3CRMA 2NO0A 4DCUA 4Q19A 1TTTA 2FFQA 3RSOA 1GRNA 3BRWD 3TSOA 2GILA 2ZI7A 4QHTA 1I4LD 3TE6A 2VHTA 3AEZA 3X1YA 1XJ0A 5TXGA 2K5UA 1RC8A 2XAUA 2RHDA 2PX3A 3LW8A 1YZLA 1AQYA 1HY3A 3QQ5A 4D26A 2BEKA 3QENA 3WRYC 1PLJA 3ZQ6A 5JI2E 2R65A 2C9OA 4B35A 5B64A 3MG9A 4QNRA 3NIBA 4OQFA 1NG9A 1NRJB 2FSIA 1G8GA 2IBMA 2QMOA 3DO6A 2AWOA 3W90A 1GAJA 2AN9A 1COWA 5A4JA 3Q72A 3GJ8A 3AUXA 2WSSA 3O8RA 3NC1C 2XTZA 2ZUCA 2R6AA 5AJXA 2G6BA 3VKHA 2H7VA 1ZNYA 4QBIA 1ODFA 1JNYA 1VCIA 4DCVA 2JJ8A 2QTFA 5FBWB 5BQ5A 4O25A 1J2JA 1W5TA 1S1MA 2FOLA 4LI0A 1I4DD 1V5WA 3PFIA 1IXSB 3GLFA 2FNAA 3WHKA 3HYTA 2WWFA 2D06A 3OEEA 1FW6A 2ZUDA 5HPYB 1JR3E 1WA5A 3WYGA 4EJSA 4KITB 3I5XA 4NCHA 1ZW6A 3WMFA 3W9YA 4X8HA 1HH4A 2EFGA 3CPEA 4ESVA 4NE2A 2QAGB 4GOXA 1YR7A 3KXIA 3VR3A 2CK3D 3LXXA 3OIYA 3PEWA 4PO8A 4TSFD 3RABA 2JLQA 4JSYA 2ZTSA 3KTAA 1NVVQ 3T1TA 2V54A 2OCAA 2XX3A 3L82B 4ITRC 3RS0A 1HT1E 1G8YA 4MUBA 1T3HA 4C7OB 1IXZA 1W0KD 2BKUA 2GXUA 4JLMA 1EGAA 2X2FA 1KY2A 5BN3A 1E2GA 1NY6A 1ZM9A 1QHGA 4IDPA 5FH9A 1P75A 1SKYB 1XFAA 3BK7A 1CJTC 2WKPA 5EE9A 2FSHA 2D7CA 3C15C 3L8ZA 1JBKA 2D7DA 2GEUA 2QE7A 3OZXA 3B1XA 1SKYE 4DJTA 2XEXA 3MSXA 1XD8A 3KQKA 4IOJA 3WBKA 3NBXX 2HUPA 1CKEA 1GRQA 2PH1A 1MH1A 2ZE5A 4TZ0A 2A3RA 2DWOA 2YJTD 4HB0A 3FPAA 2G77B 1EFTA 4F91B 2BBTA 4XWKA 4AY2A 1F60A 1EWRA 1FL9A 1YRAA 1CJUC 4A82A 4DT1B 2VP4A 1IJEA 3EA5A 2ZE7A 4CEHB 4JLPA 2OFXA 3U7HB 4ZDWA 3ECCA 5EE3A 1KI3A 4B43A 2XTNA 2F1HA 4H1UA 2HJVA 4JLDA 3CUEF 3I8XA 4HAVA 4JT4A 2Q3HA 2WOJA 2FA9A 4B6EA 5JJLA 5E4FA 4ZIRB 1M7BA 4HAXA 4QL3A 1YQTA 4US0R 2QEQA 1XD9A 4TLDA 4FWIB 2JASA 1Z0JA 2J7PA 3BXZA 3LVQE 4C0LA 1L8QA 1EESA 4IVQA 5KNBA 1XEXA 1ZVQA 2ZREA 1ZD8A 3K0AA 4HB2A 1DTSA 4TLEA 4V0KA 4RFSB 2YZ2A 2KBFA 5J4LA 2DCUA 4CVNA 2V55B 1TUEA 3GMTA 1TNDA 1IN8A 4KLZA 1EK0A 3W34A 4BUJA 3K1JA 5ELXA 1N6KA 2IYWA 1ZBDA 4YMTA 2Q0HA 3A4NA 3IGFA 4L15A 2ZRDA 1GIAA 2N1BA 3CRVA 5AUQA 1GVNB 3PR1A 1PVOA 4HZUA 4TTPA 1PV4A 2FPMA 2E9SA 2ONKA 4XVRA 2GNOA 2KBEA 2MMGA 3NH9A 1JR3A 1W48A 1JQJC 1RYFA 2JLWA 1KOFA 2WOOA 1WB9A 4DB4A 3ND8A 3VAAA 1MO4A 2R9VA 4DT1A 1UBCA 1G8FA 1UEIA 4MYHA 1W2GA 5HZHA 3ZYCA 1LNZA 1MABB 1NLFA 4ARZA 2KI5A 5H70A 4UXJA 4PANA 2FX3A 1R5OA 2WWIA 1OJLA 2R62A 4LJ8A 2ZVPX 3AQ4A 2X2EA 1WF3A 2ZU0C 2RGGA 2ODWA 3SQXA 1G16A 2D2FA 2ZE6A 3OAAA 2GZHA 1XTJA 3F8TA 2D2EA 3BWDD 5E7MA 1G8HA 5EXXA 1OFIA 4FWTA 2VP6A 2GTPA 1QRAA 1Q12A 3CLVA 4R71A 3LWNA 4D4JA 1HV8A 1XWIA 3PENA 3TRFA 3U3OA 4BGDA 4C7OA 3PUWA 3TW8B 3D31A 4TSFA 2XOKA 2RGDA 4Q4AB 4OHWA 2WBLC 2WAXA 3KTAB 2GF0A 2DBYA 2PX0A 2JLYA 1A5TA 3NDPA 3VR1A 2IYLD 1LTQA 1R4AA 1XTKA 4KFRA 1M8PA 2QAGA 4BFSA 1W0JA 5JWRA 2PCJA 4ASUD 2V9PA 5JHGB 2XNDA 1ZYUA 3QBTA 3KZ1E 3P27A 2P0EA 5EP2A 5HCNA 3AGPA 3HYRA 3IIJA 3MUFA 1NBMA 4OQLA 2JATA 4QFMA 1NSTA 2HCBA 3UWOA 3SDZA 3THXB 1P4SA 3PUXA 3AF1A 2QRNA 4OQMA 4Q4JB 4G01B 1S1CA 1VYTA 4OQNA 1UKYA 1K5DA 1ZRHA 4M21A 3TJZA 3X2SA 4P31A 4KFUA 1FMLA 4AI6A 3U61B 3CX7A 3H86A 3WMGA 4Q21A 1JR3D 4ZO4A 2OEPA 4ZCIA 2G1KA 1KO5A 2RHMA 1E0KA 2GDJA 5IT5A 3I8SA 4IDOA 2CJWB 2OG2A 1RFLA 2Q3FA 2RGAA 3WHLA 3GJ5A 4Q1CA 1W47A 2L0XA 4JLOA 1WQ1R 2JLUA 3U4QB 5HZKA 3B1ZA 2ZYTX 3UMRA 3S1AA 4Q9IA 4E22A 3MD0A 4RVCA 1OFUX 3W6NA 4M1OA 4Q4HA 4FMBB 1II0A 2QTVB 3EIHA 2QQ0A 1G3RA 1OHHA 3TR5A 1E69A 1N0UA 4FD2A 1E9AA 3X1DA 2FDCA 1AS3A 1KDTA 3RHFA 1HQYE 1PJRA 3P26A 4B3DA 1A2BA 4D25A 2TMKA 3VQTA 1T8UA 1L2TA 3ZGXA 2ANCA 1JJ7A 1BH2A 1QVRA 1ZUIA 1QZXA 1ZU4A 2Z0MA 3BH7A 3AGQA 4POAA 1E9BA 1Q1EA 2OLKA 2QBYB 1XXHB 4A0FA 1II9A 3PG5A 2ZRPA 2Z43A 2JLZA 3ADBA 1IM2A 3GLGE 3WP1B 4JMPA 3R7WB 1MRSA 2CHGA 1LS6A 2J0UB 4IJMA 2OBNA 1LF5A 4CGZA 3A4LA 4R7ZA 4I1OA 2IK8A 4B34A 4EPVA 3THYA 2XXAB 1UPTA 2C8VA 1KO4A 5IDVA 4A2QA 3ADCA 4JBWA 2CHVA 4MKIA 2PZEA 2W00A 3ZZUA 3IEUA 1CR1A 2ZI9A 1WDTA 2ERYA 4WZBE 2J0VA 2BVNA 4HAZA 1IN6A 1Q20A 1NSFA 1R5BA 1E9EA 1G3MA 4MRRA 4UNQA 5B30A 4OHYA 3R9XA 1E94E 3EPJA 2W6IA 4OI0A 2W2XA 2KJQA 3NDBB 3EPLA 3U7EB 1Q1ZA 4C0QC 5DH9A 4O3MA 3TAUA 2H92A 2DR3A 5FBVB 2R8RA 5DYGA 4OJQA 4UNRA 1DBSA 3MMPA 1KI6B 4LHXA 3KX2A 4PPNA 2V6IA 2F7SA 3QUSA 4AKGA 2BHRA 1P2UA 4Q1AA 2FZLA 5HKKA 1D2MA 2MMCA 3EWAA 1EFHA 1KO7A 4Q1BA 1U9IC 1KKMA 4DLRA 1S9DA 1OXVA 3QKRA 4FCTA 4JVMA 3SBEA 2A9KA 2WSSD 3ZQJA 5JRJA 3BJIC 4HUQB 2B7BA 4PAOA 2ZITA 1DARA 2RKOA 5FUVA 4Y0VA 3GLIB 4B32A 3Q7PA 3VHXA 2ZETA 2C78A 2H18A 4GMXA 4GZMA 3K9LA 1SXJA 4FINA 2WV9A 2GAAA 4DCNA 5JLJA 1VYVA 4P4UA 2C98A 1GWNA 4LV8B 1OYYA 4X8LA 2J0UA 1D5CA 3TVTA 4EPTA 2W2VA 3KFXA 2GEVA 3N2EA 4CT5A 3LFUA 4Q9JA 1QHIA 3AKYA 2G0NA 5CYOA 4UQOA 4MITA 2ECKA 5L8VA 1KZ7B 2N46A 2VHQA 4DVGA 1FMJA 1GRRA 1G6OA 3Q5EA 3IO5A 5JBQA 2IXEA 4MYUA 5AJVB 3KJEA 4JVNA 3CPHA 3FOZA 4DDWA 3NHBA 2OCBA 2O8FA 4U02A 1P9RA 3CR8A 3F5FA 4OHZA 4XSHA 5JCPA 4I4LA 2FV8A 4NYMQ 4Y0AA 2AD5A 3GPLA 1UBFA 4RFVA 1UDXA 3OF5A 3QXHA 1ZM2A 5JI3E 3CKLA 1S96A 2XB2A 2ZS7A 3AVWA 4AG6A 4M22A 2ZAMA 4XIGS 3WP0A 1E0JA 2AXNA 5FTLA 5EXSA 3E1SA 2CNWA 3NEJA 4JL8A 3HR7A 1O87A 5DIFA 4EDHA 1YZKA 3NH6A 3VU9A 1J90A 1YZQA 3KDSE 3L43A 3KKMA 3VU9B 1P60A 5BW8A 4MRVA 4LJ6A 1W4BA 3L0SA 1XMJA 3PCRB 5J5CA 4RD6A 4XVUA 4CEJB 3THXA 2DHRA 2B7CA 4D2IA 3ZVLA 2QORA 1UEJA 4YLGA 1KDOA 4PZLA 3BB1A 3REGA 1D8TA 2ZR9A 1S8FA 1ZINA 4OBEA 4OQXA 4TYPA 4BFYA 5D3QA 4BASA 2BJWA 4QBFA 1QHNA 1HUQA 3EA0A 4Q1FA 5GADl 4Q66C 4JIMA 2YV5A 2CXXA 1E0SA 3BE4A 2QY9A 4B44A 1E6CA 3W8NA 2J46A 5AUNB 3OFND 1DOAA 2YWFA 3DZ8A 4NHOA 2CVHA 3HU2A 3P4YA 4Q4AA 4B3FX 721PA 3IQWA 1N5KA 1ZNWA 1JPNA 3MRSA 1E2EA 1WMSA 4FCWA 3NWJA 3K9NA 2FH5B 3FKSD 2FPKA 4PHTA 4Q48A 1E79A 2HXSA 3N5CA 3NHAA 2FFAA 4KCGA 1X8JA 4B2IA 1ZIOA 3M6AA 3NBZC 1LY1A 4FIDA 3HP1A 1G21E 5KDOA 1KJZA 4EUNA 1GG2A 3OEHA 2GHIA 2FFBA 2VQSA 1E2IA 1MRNA 1XEWX 3AP2A 1QDEA 2ASEA 3B7GA 4GNKA 3W5JA 4JL5A 1IN7A 2AK3A 3SNHA 4YMSA 2SHKA 1U81A 1VPLA 2HEIA 3EARA 4QXAA 3DL0A 2CE2X 2PT5A 2OUKA 2VF7A 4RZXA 3H84A 2J87A 1P2SA 2OO7A 1OIXA 5SZJA 1E2MA 3QKRB 4IFBA 1U0JA 2GESA 3QPVA 2HF8A 3IDQA 3THOA 4DXAA 1QHHB 3R8FA 4RKEA 5CIWA 4DCTA 4HZUB 5GJCA 4DLTA 4OK5A 1AS0A 5HE8A 3HPQA 2NTYC 3B8HA 4Z1MA 1Z6AA 1NVWQ 4I1VA 4TMVA 4IKEA 1RPZA 1NJFA 3IEVA 4YC7A 1DS6A 3U2QA 4LJ5A 4GP7A 2GCOA 2X1VA 3GD7A 4V0OA 5C4MA 4KI0A 1VKJA 2FMXA 1TF5A 4LWZA 4DDTA 3HU1A 5SZIA 4LBZA 2GJKA 1C9KA 1RRPA 4NYJQ 1KAGA 1NJGA 4DUGA 2G88A 2VP9A 1XRJA 4AC9A 3KKNA 1X1SA 3GJXC 3RS4A 4MYTA 1AKYA 3THYB 2PZGA 2HT1A 4UXHA 5TVKA 2UKDA 2CCKA 4B73A 1G41A 4BLRA 3LW7A 1FX0A 1AA9A 4QM6A 1EXMA 3A36A 2GJ8A 2I4IA 3AVYA 4OHXA 2BM1A 2QNRA 2DWQA 3K09A 2FN4A 2NG1A 3MWKA 4BLOA 1JI0A 1EG7A 5L3QA 3MJRA 1X1RA 4WVFA 4LDJA 4B33A 4Z54A 3LXRA 3I5YA 4DC9A 4Q9HA 3ND9A 4KSCA 1NG1A 2H5EA 4HI0E 3SE0A 4IXNA 4TQUS 5DHFA 2BBOA 3GEEA 3QXJA 2UZIR 2IUUA 2KB0A 2VHCA 1AM4D 2RCNA 3VX3A 4YXWD 4CW7A 1AGPA 5A5GA 4TZ6A 1K8RA 1VHLA 3AF0A 4FW9A 1GTVA 4M9XA 3L2OB 3E5HA 2OBLA 1E96A 1XMIA 3IKJA 3QKSB 2CCJA 4PQRA 2VSOA 1FOEB 5L3QB 3D8BA 3WRXC 4XOIA 4R98A 4C2UA 4DLZA 4PFSA 1LV7A 3RS5A 3RS3A 1OXSC 2ZRGA 3UMFA 4C0JA 4K81B 1M1YE 3CWZA 2JDIA 4TTRA 1FX0B 3QI2A 2ZYWX 1C4OA 1TQDA 4PSKA 4KXFB 4DLSA 1GNQA 3QY0A 3C16C 5FTNA 3FVQA 2CLCX 2VSFA 1G291 2FU5C 3QJYA 1UKVY 4S35A 5HE9A 4JLVA 2I3BA 3K70C 4U7DA 3D6TB 4JSTA 1KK0A 5EP4A 1KTVA 2FE4A 3BFVA 3IIMA 3BB4A 4W5WA 4LYAA 3ZS9A 1E9DA 4LYFA 1TQ4A 4R2IA 2IC5A 1X8KA 1XB2A 4MGKR 1II8A 2ZR0A 2HJGA 2OXRA 4S2EA 2HYDA 4M2LA 3FMFA 1SXJD 4EJSB 3KFVA 2C9CA 3TR0A 1E1RD 5TARA 1K6MA 3EPHA 3ZIAD 1F2TA 1G3IA 2IF2A 1XNJA 1PZNA 2BCGY 2IYZA 3WYFA 5HR5A 3FHTA 2DPXA 3B6EA 3RWOA 2WJIA 1QHHA 1LW7A 2WWXA 1WP9A 3TMKA 2O8CA 2GBLA 5L3VA 4FMDB 4HZIA 2P2LA 2YWHA 3SZRA 2OCYC 2QPAA 2WWWA 4PPGA 4TMTA 1GILA 4LHYA 2ONJA 3IQXA 2GXSA 1X6VA 1R6BX 4JZKA 4P33A 4EFLA 3H0KA 5DNYB 3AVTA 4FMDF 4A8JC 5F3WB 2CHQA 6Q21A 5JRZA 2IEYA 3FGNA 2WIBA 4ESHA 1CJVC 5G41A 3SYLA 2WMOB 4TLAA 3LH5A 4N0DA 4JLAA 4LJ7A 3R7WA 4KODA 2GBLC 4NCIA 3W8RA 2WTUA 1CR0A 4MRSA 3ASYA 1XXHA 3HWSA 4YDSA 1G6HA 4EFMA 2CLDX 3JZAA 1KZGB 3DHWC 2ZRIA 3VR5A 1KDRA 4DLVA 2ZRNA 1FUUA 5G3YA 3MLEA 3QIAA 4QJ4A 4LY6A 5EJEA 2PJRA 4NZYA 1L4YA 4JVSB 4M1TA 2OE2A 2WPDA 3KXLA 5DN6D 5K8UA 1YR6A 4OI2A 4AYWA 3I1FA 4DLWA 2OILA 3BC1A 5DGXA 1D2EA 5BXQC 3FHOA 3TLXA 1TAGA 2QRZA 4GL2A 5JHHB 4I1SA 2NGRA 3S1AB 3ONWA 4WBSA 2GVZC 3VR4A 2EWVA 4G5SA 2O0KA 3R20A 4C0KA 1G3UA 3HDTA 4O0MA 1COWD 1CIPA 1YRBA 2CJWA 2W0SA 5FI1B 4HAUA 5KO2A 1D9XA 2W0MA 4KSBA 4HATA 1G7TA 3EAQA 4FMCB 3U6BA 1NNEA 4TL7A 1GKIA 2BMDA 1KI1A 2QP3A 3UIEA 2C9YA 2RGEA 3QF4A 2H57A 1T0JB 3RLFA 4DSUA 5FL7A 2JGNA 4JLJA 1FPMA 3FMIA 3EXAA 3TNFA 3UWKA 1SXJE 2Q21A 3QF7A 1CJKC 1KJWA 1U98A 4Q03A 2YC2C 4RKFA 4Q4JA 2IT1A 3X1ZA 3O8DA 2GZAA 3A58B 2R44A 4DEYA 4TLCA 1RRGA 5AWFC 5AK0A 5JEEA 3K0FB 4ZIRA 2JAQA 2YVUA 3BERA 4QG7A 1E79D 5SZKB 2P5TB 2XZPA 2F43B 4PC2A 2YWGA 4DUGD 1C1YA 1YR9A 1FNNA 2REXB 4E03A 4YXWA 4Q7KA 1ZC3A 2W6JA 2O8EB 4LC1A 1HYQA 3CF6R 4CEHA 1F2UA 4IEIA 3T1QA 1W2HA 4IXMA 1DVRA 1GDDA 3K9GA 5P21A 4BEJA 5J4YA 3BFXA 3CB4A 3M1IA 4P4TA 5UKDA 2UZ3A 2BJVA 3DZDA 2P65A 1F6BA 2J3EA 4GT1A 4LHZA 3NEYA 1XMVA 3T5DA 2HXYA 3WYAA 5JWHA 3U44A 1FTNA 4B3GA 5H8WA 1U0LA 3FB4A 2JA1A 2V6JA 5JCZA 3T61A 5J4VA 5AJZA 1Q0UA 1XJQA 4J0QA 2BEJA 3EZ9A 1XPRA 5FOXA 4DHEA 2IYQA 4DSTA 1FTSA 1PLLA 2ZSBA 2WVJA 3KKOA 3H1TA 3KKPA 1S0UA 4GI7A 3JZMA 3VFDA 3EPKA 5FPTA 4OJKA 3ZVNA 1ETUA 2IHBA 4H1VA 1W36D 4MRNA 2QAGC 4IDHA 3AVOA 2R6DA 1KNXA 1VCNA 3LQRA 1MABA 1T5LA 2ZQ5A 4PHGA 5FTKA 4ARZB 5C18A 4ACBA 1P2VA 2OFWA 2R6CA 3GFOA 3IBGA 4PHHA 3A1SA 4U5XA 2PMDA 2A7QA 4QBGB 4IVPA 1OPXA 1TU3A 3CNLA 3GEHA 4TYWA 2J7PD 4TMKA 1EFCA 3I92A 1FUKA 3LQQA 4DEXA 3ZD7A 4MRPA 2ATVA 5GVRA 1OYWA 2Q6TA 1P61B 1ZD1A 2KWIA 3QOFA 4LUCA 5HCIA 3C5CA 1W4AA 1MO6A 1R10A 2WAYA 2PMKA 1Y3AA 1R5NA 3MCAA 4BECA 4URWR 4JLKA 1NP6A 3K0CA 1E2LA 1ZM4A 1GL7A 2WMNB 4JLNA 4TLBA 2ZPTX 3X1WA 2ZI3A 1M2OB 1E2QA 2R6FA 1GKUB 4N3NA 4Q02A 4ZCMA 2ZI4A 4G5RA 4EQ6B 3AM1A 1E9SA 2GCNA 2JJ2A 1CJMA 4M4SA 3CIOA 2A5GA 1AGRA 1M7HA 2O8BB 4LSGA 1YR8A 4B6FA 4A0RA 2XSZD 4YONB 3TAHA 1NBME 1RYHA 1FZQA 5FUYA 4D81A 1IY2A 4ZDIA 4BZPA 2PLRA 4HB4A 3EZFA 2QT0A 3K0AB 5HKKD 1Q3HA 5BN4A 5L3SB 2QG6A 1Z0FA 2ZRBA 3K53A 5BN5A 2DFLA 2IS1A 4II7A 2X77A 4FXPA 1GNPA 1VIAA 3U6KA 1YJ5A 1EFRA 1A7JA 3SFZA 2C95A 2VA8A 2IYRA 2ZXUA 4PR0A 2QPTA 4D0GA 4PO9A 2ORWA 3RNLA 4O2LA 5DN6A 1AS2A 4WZAE 3SU8A 1ZMXA 2CL6X 4HUTA 1VG1A 3GFPA 4F7WA 2C77A 5CM8B 5AUOB 2LKCA 3L0PA 1WRBA 2RGBA 4TMZA 3GEIA 5EUMA 4ZCLA 2QQEA 4R2HA 4M9QA 3HJNA 2VSXA 3SJZA 1ZIPA 2GJ9A 5TV2A 4Q4HB 4PSAA 4Q1DA 3SBDA 2EVWX 5EP1A 3BGWA 1KY3A 3C8UA 4BLSA 4ZDKA 1VDZA 4C0HA 2IS4A 1CU1A 3GLFE 1P3JA 1E2KA 4BWYA 1H8HD 1NLYA 2QL6A 2WWGA 3LBIA 5JSZA 1UKZA 2YOFA 4QRHA 5G53C 4M1MA 3KJIA 1JEDA 1R7RA 4ZI3A 2A5JA 4M1SA 2NPFA 3QXXA 1AZTA 221PA 1ESNA 4OHVA 3LD9A 1D6JA 3GJ4A 4V0LA 2JLRA 4WZ6A 1EFUA 3MWJA 1VTKA 3W3ZB 2CLSA 3SYKA 1AN0A 1DAEA 2ZU6A 1OKKA 3A37A 1N6IA 3NBFA 3SC3A 2ZJAA 1DG3A 1KDPA 1NVXQ 2ZJBA 4H9GA 1M6NA 4MDFA 3UPUA 1GL9B 3EG5A 3FKQA 4RD3A 5C2JB 4A36A 3QXCA 4LHWA 3UXMA 1R2QA 4EAQA 1N6LA 4UNSA 3RYTC 1G5TA 1NBMD 1Z63A 4MA4A 5B58C 4L9SA 1E99A 2WJHA 1SVSA 1DO2A 4MH0R 5FR2A 3FYHA 4ASUA 2IX3A 2QUZA 3QG5A 4X8OA 4AKEA 1DAIA 4LBVA 5JZVA 4TN1A 3KQHA 2EFCB 2ZJ5A 2F3TA 8OHMA 4B76A 4KV9A 2W83A 2BMEA 2BV3A 2EWWA 3MGCA 1T3SA 1JXMA 4CIDA 3T12A 4KFTA 4ABYA 1KSFX 1TADA 1QG4A 2OAQ1 4ZPXA 3U3MA 3T1OA 2I1VB 4GOKA 3ZVRA 5KUTA 4W7SA 1UAAA 2IXGA 621PA 3O47A 3MFYA 2JLVA 4F92B 3ZD6A 4RD1A 1QHSA 5F9HA 1NKSA 3TIFA 4A8JA 3VNUA 3U44B 3AKEA 5EXTA 3ZIAA 1KYIA 4MDEA 1E2FA 1ZJ6A 3DOEA 3RRNA 3EIQA 121PA 4LRWA 2OCPA 3Q3JB 5CB8A 3K09C 1XPOA 4DSNA 4TYYA 2VLIA 4URZR 4B47A 4NP6A 4M53A 4DDUA 3AUYA 3SJAA 4KFSA 3T1VA 3ZDQA 4FCVA 2O8EA 1CR2A 1GOTA 1KK1A 4M1WA 2WJYA 3L8YA 1US8A 4ZDJA 3EC1A 4MKHA 5LBIA 5C46F 4HSEA 4K8OA 3C7KA 2F43A 2FSFA 1KGDA 2AL7A 2HLDD 3PITA 1P5ZB 2P6NA 4LYHA 2AXPA 2B6HA 2C5LA 1OH5A 1YKSA 1DAMA 3L0IB 1UKEA 3GJ6A 5BYKA 3PEYA 5FPYA 2VTKA 1IQPA 2O8DA 1N25A 2MSCB 2EQBA 2W6ID 4JJKA 4WXPA 2PT7A 1OT3A 2WKQA 3KB1A 5IF9A 3LAWA 4KBGA 4OK6A 421PA 4ON9A 4V0NA 1XBTA 4BZXA 1JEEA 4QOSA 4AIIA 1WXQA 4EPXA 1P9WA 3QPUA 2IS2A 2O8DB 4JS0A 1FFHA 1L4UA 4URYR 4HLQB 3K0EA 2EFHB 2IYVA 4HDQB 2J59A 5EZ5A 1G4UR 5FTJA 1E1QD 2V1XA 4MGIR 3T15A 3PEUA 2ZEJA 1LF0A 3KQNA 1T0HB 2ZE8A 1Z5ZA 2DWPA 3QEJA 1N5JA 2QM8A 2YNMA 4KO8A 3PQCA 2PZFA 1XD2B 1DADA 3CX8A 1OH7A 1US8B 2Q3MA 1SVWA 3E2IA 1G18A
chains in the Genus database with same CATH superfamily
4ER3A 4IIJA 1RNLA 4WDRA 4OHBA 2YVKA 4RYDA 4AW9A 2HCJB 3CLUC 4KIUA 3F46A 1PUIA 1T24A 2X8AA 4LA4A 4LNUB 2WYVA 4B1FA 4WL0A 4FDAA 3QV1A 3F0TA 4DXDA 5CLFA 4L4ZA 2IOFA 3OTHA 1ZLYA 1MKYA 1N8NA 1NTOA 5FADA 5HG0A 4BMDA 2W8BB 5JYCA 4DB2A 4JJAA 1TEXA 1ZX1A 1L5RA 2RFLA 1DQRA 4PRLA 1QZUA 2UVDA 3UWDA 3ELWA 4UM7A 3RBZA 4WNYA 3IVMA 1NJ8A 4DY4A 5KYKA 2QMQA 2HLHA 4MS1A 4HDOB 1ND6A 3KEGA 2FHPA 4HYTA 1RXSA 4K9LA 2DB3A 1FFGA 1XF9A 2V03A 2O0MA 2O0HA 3F90A 3LYHA 4IIHA 1AUOA 3WYDA 3KJGA 3O92A 5J63A 3RFFA 4DR3B 4YI3A 3A6JA 5BPFA 4QHSA 2JLXA 5EMKA 1Y8ZA 4AJHA 1YTUA 4ZU3A 1QO9A 3A6PC 1U0HC 3HB4X 2XT6A 4HVAA 4LCJA 5D85A 4YMIA 3H87A 4B6PA 4Z1MD 4OXQA 5HDQA 3R3UA 3LBHA 4BNFA 4YJKA 2DT8A 3WMEA 1G64A 3OU7A 4I7EA 2CYBA 1QHFA 2R8BA 3DVRX 3R9IA 4ZYYA 5JRDS 3Q1KA 2PUGA 5KJ1A 1NP7A 4W5OA 3GZJA 5IKPA 3JQDA 1N34B 3ETNA 3KTOA 2WKWA 1CW2B 3ULKA 1CZKA 5HJ5A 1BMQA 2O3JA 4L4RA 3I04M 1H2AS 1I6WA 3UANA 1WMEA 4G5QA 5AKYA 2IYSA 2XB4A 1W85A 2XUJA 4W6ZA 1DIGA 1Q0QA 4KB5A 1RXVA 4HBZA 5FOTA 2IU6A 3BTUA 4HWOA 4XW2A 1OW3B 4IGFA 5EZ6B 2ZTHA 3G8CA 1J6UA 2XADA 4M9SA 2H9YA 5IAJA 1JMVA 1ZRMA 2VYNA 2D74A 3OQVA 4P98A 5J1TB 2HC9A 4NZ9A 5IM4A 5L3RA 3KZNA 1JHAA 4Q82A 4WDQA 3ZWMA 4GW3A 1E7RA 1KNQA 1ZNXA 1T91A 1I1OA 2F1IA 4HQ6A 1PR1A 2AI1A 2VH5R 1X3LA 4K03A 4JYBA 1SOVA 2OENG 3W2IA 3HBAA 3IVAA 3D6AA 1J9GA 1JL3A 4HAIA 3QG1A 1R0ZA 2G9NA 1GCAA 1NYQA 5EZSA 3RIXA 4RTNA 1J00A 3K1AB 3QE9Y 2QMHA 4F4JA 2RBEA 2J41A 3EUWA 3SFVA 2H0QA 4B3MB 3P9SA 2NTJA 4TKVB 3FOCA 4ZJYA 2JFNA 3A1UA 1J2YA 3G49A 1JHVA 3N8HA 4CM8B 1CXZA 2NLOA 5AVYA 3R0QA 3OMXA 4LTDA 1BJTA 2I4NA 1T34A 2CE7A 2Z6VA 4KWEA 2PD3A 1U3UA 1KYWA 2Z1MA 3LXMA 4BP3A 3PXXA 3N07A 4H1TA 2E4AA 4OH7A 4EYOA 1GNSA 2QWXA 4X91A 3LZ6A 1SBCA 2RGCA 3JATA 2GETA 3R0VA 4CL2A 4NH0A 5JATA 1UEXC 2H1VA 1NVVR 3P97A 1C3XA 1N8SA 4KYTA 3HCDA 2H2DA 2FK8A 1VKRA 2FFHA 5H3HA 4QTYA 5JZOA 2Q1WA 4IEFB 2AKYA 1EX6A 3Q40A 4C6RA 5I4IA 2J9RA 4YJ3A 2IUSA 1BH6A 4MGZR 1R3UA 1JXOA 1U9CA 4M0EA 3SQDA 2CLHB 1HE2A 3EISA 3PTZA 4W9MC 4D3SA 5LDDC 2QRMA 1DPFA 1PWZA 1TUBB 1TPZA 3U3JA 3J80A 3PR3A 1VDMA 2OFOA 5DGTA 1LBSA 3TSAA 2BOVA 1UFQA 3ITDA 1Z25A 3LVFO 4PC7A 2IWRA 3AVUA 2APJA 2O52A 3O5AA 2DX7A 3SHWA 1Y1QA 3M81A 2FMFA 3ROXA 3C0KA 1P1HA 4NAHA 4Q18A 3OSZA 4QPPA 3EQ2A 3L8EA 4ZOEA 3DHNA 1BKSB 1A2KC 5E7JA 4LXYA 1CYDA 3L8CA 3QE3A 2E5WA 2BCJQ 3O4GA 3WNCA 4A3SA 4NYJR 5IJAA 4L5JA 3WTBA 4Z4QA 3HHEA 1T9GS 2FVXA 1HTWA 1AUVA 1I2CA 4ZOLF 3DM5A 3NYIA 5DHAA 1LDYA 2AJTA 3AM4A 2CMKA 2IDMA 4V2IA 3CUTA 1BWSA 1UXHA 2L69A 2BKEA 3BA6A 4A0GA 1E9RA 3R5FA 4FJ0A 4Q05A 1YMVA 3E9MA 1T36B 1K3TA 2JBHA 2X9GA 1U04A 2QJRA 2BFBA 1NN0A 4LHVA 4BN4A 1U0OC 3TZKA 3VPFA 1PZEA 1K5HA 1OH8A 1Z35A 1SHTX 2VDNB 3FBTA 2Q4DA 1UBJS 4EPYA 2V4MA 4JJGA 1IBCA 1M1NA 2J3LA 2JBAA 1USKA 2C5BA 2N42A 3HU3A 1PEYA 1ORTA 4HOYA 3UOWA 5CB6A 2ZSJA 4U7FA 1WPQA 4Z86A 1MNQA 2X42A 4L9RA 1OFHA 3EZLA 1ZM7A 4AL4A 2X9NA 2CXPA 4MR9A 1QFMA 4NARA 5HNKA 4WSOA 5BV1A 4HWKA 3O31A 5EJAA 4YJHB 3CWQA 3HRIA 3L41A 3HY3A 1XZCA 3IUQA 2E4VA 2YXNA 3M0EA 4MO9A 4YIHA 1BTOA 3H4TA 1DC5A 2HHLA 1GD1O 4I5DA 5P8WA 1AJEA 1O94D 4JOBA 2R84A 8MHTA 1XDBA 2XGGA 3A1TA 4MWEA 4P4SA 4JQCA 4QOIA 1FDIA 3AG6A 3CZPA 4FR5A 3WOVA 1JJIA 3IHTA 1M66A 5DBFA 3B6KA 1WPGA 3SXUA 4D4LA 1YTLA 1O96A 5H59A 1CRWG 1PUJA 4M0DA 4IIXA 3TSZA 1LQTA 4E15A 5LQCA 1KMHA 1T9BA 4DIFA 4RZ3A 1L9KA 2P2NA 4GMKA 1E3IA 5J5VA 5DFAA 3L7BA 3NI2A 2GBIA 4E1AA 5IASA 1NMYA 1Y5NA 4RA9B 3ZN2A 4ERNA 4XWAA 2QM0A 1XL0A 2EBUA 4RU1A 5CX1A 4JH0A 1KKLA 2ZCVA 4HWGA 3RAJA 2WD8A 4HPWA 4LY0A 521PA 2CV0A 3HBNA 2ATIA 1NY5A 2HMYB 1SUEA 5I9MA 1OUMA 3BBPA 1ZGJA 5HS6A 4IJ6A 2F3SA 2GHTA 5JMPA 4DW8A 5K3DA 5CFMA 3P32A 1SQGA 2BR4A 1B7GO 2H0RA 1CJBA 1HZZA 5K6RA 1UMCA 5ICGA 5JTUA 2DFPA 2FCRA 1KO1A 2XZOA 4Q1VA 1NYRA 2Y66A 3CWCA 5L40A 2H2FA 4GM4A 1YBMA 3WADA 4JP1A 5FF9A 1LX6A 1PX2A 3L8HA 3CRQA 4X1KA 2Z56A 1V3TA 4K28A 4IGEA 1GM5A 2AZXA 1G6Q1 1EQ2A 2O4CA 3BYZA 3CHYA 1A9OA 3FMGA 2OHFA 5TDHA 2J45A 1BO6A 3WZ2A 4JUBA 2YJGA 2EFDB 1C5KA 2CF6A 4KWTA 1BE0A 2C5HA 3WWEA 1E6KA 4GDFA 1W35A 2JFFA 4DSOA 4AM8A 3F5MA 4KH0A 2IGBA 5CLHA 3KKLA 3QHQA 1DQPA 1MEJA 3C2QA 2HMWA 2Q07A 5REQA 5LYJF 2VJBA 4DPMA 1F38A 5IZCC 2BR3A 2WB4A 4EG7A 2J0SA 4J0GA 2K7ZA 3AY6A 4TXNA 1YDMA 3N8KA 3TZCA 3CRNA 3CSDA 1FDRA 1YWGO 2J48A 4U2EA 3K6SA 1NL3A 3TGPA 3CJQA 2UVQA 3M83A 2ODBA 2WVAA 3EDQA 3IAS1 1FF9A 1CUHA 4FGZA 2AOWA 2QHXA 2XOXA 2QLNA 2VPXA 4HN2A 2IDJA 1YJCA 3L7CA 3CS3A 1KJNA 1YQUA 2IRWA 1NBWB 3D3WA 3CZ9A 3LNTA 4H0NA 3D4LA 2GZDA 3COPA 4A15A 4OQYA 3LQYA 2FMTA 1EAMA 2DFTA 3S81A 3IPYA 3BKXA 3LY5A 4IV0A 4E32A 1QXSA 1T3LA 3DKPA 2ZRFA 2PV0A 3WGHA 1DBIA 3IUYA 2WJGA 3AFMA 3TECE 4WLEA 1LBQA 1UDRA 2NNWB 2ZT8A 1TYAE 3EZYA 4BO2A 2ATXA 4IZ6A 2I8AA 2JFZA 2RHCA 3RG2A 3CH5A 2FEXA 4M9ZA 4B71A 1UJMA 4N5IX 1IZ0A 3K5IA 4ZJZA 1SUIA 2XB9A 4EG1A 1TIPA 1UMKA 3PGLA 2QVXX 3GPCA 3DE2X 1GQOA 2GD6A 3D1VA 3N3AC 4HX5A 2ISQA 4QTXA 4DYDA 4BY9E 1IOZA 3E6AA 1LSOA 2JEOA 3I73A 4RVUA 1DP4A 2ESRA 4P4SB 1GPUA 2YHIB 1QIDA 1NM5A 2VRNA 2D13A 4F4CA 2GZSA 2Z5VA 1KIAA 2C96A 1GFZA 4WI1A 3P9IA 1XPUA 1YACA 2NSDA 2BCEA 2O8BA 5DM4A 5DTEA 4ZO6A 2CD9A 5DNUA 2GPSA 5FUWA 1BCSA 4P82A 2RBKA 2XUHA 1ZJ4A 1KJJA 2Q3CA 1B23P 1I4OA 1J8YF 3CYFA 4R41A 3RV3A 3CLTC 3IA7A 4PLGA 3O1IC 1KFKB 2C2BA 1DPGA 2IDZA 4IHJB 4MRAA 4R1LA 5JFGA 1GG5A 1C7RA 1DAGA 4Q7LA 1UOPA 2WM9B 1N0WA 5D3MA 3V3KA 2V7QA 3N2KB 4AN4A 2XMSA 1TC2A 3A8TA 1Q1BA 2JKVA 1F2TB 3K70B 3KAJA 3A6KA 3P26A 3GZNA 1CQJB 1ZW1A 4RVHA 1EK5A 1D2RA 2QE6A 2EJUA 2EEZA 4X45A 3D7RA 1UUFA 3ILXA 4KO3S 1AK9A 5AM0A 5KNDA 4LZWA 4E1BA 2GXAA 3PZBA 1S01A 3HGMA 4KQFA 3OP1A 1KI4A 2I22A 3CPJB 1J70A 4L74A 2B92A 4I2VA 5FR1A 4C30A 4EB6A 5I7SA 1XYGA 5L7TA 4IFEA 3V4RA 3PUHA 5EZQA 5HTKA 1DWQA 1SA0A 3CZ5A 4IZHA 3INTA 2WVGA 3T7KA 5TIIA 4BXOA 3IUJA 3SQWA 2C9DA 4FYMA 3S6JA 2JIOA 1SOUA 3QKTA 1L7QA 4GPAA 3SEAA 1K0FA 2HSDA 1I2DA 4TS4A 4DLLA 3RRMA 1QUEA 2X4GA 3IB6A 4JT2A 4DJAA 3EIEA 1Z47A 5K5EA 3R9WA 1K97A 1IWBB 2B99A 2BUAA 1BX0A 2QZ4A 2QRVB 1S4MA 1KJ9A 4LCBA 4WFQA 3RBXA 2MSEB 1V9SA 3FZNA 1JHMA 2B9VA 4JI0B 3GLSA 4OL0A 3D7SA 2FPGB 3GB9A 4MLZA 2HMTA 4NBUA 4UM8B 4FGKA 2W48A 4IUBS 2YCBA 4TWZA 1H9BA 3UWPA 1J8QA 3DLTA 3DDCA 1SEVA 3EVAA 2ZYGA 3BH0A 1T29A 4D82A 1XLUA 1N1DA 1MW9X 4XB6B 1YQWA 4JI4B 4ZAXA 1Q17A 1KTIA 2R8PA 2HFJA 1QV7A 1S2NA 2ZUVA 3ED5A 4PZZA 1G9XA 3IHWA 4X8MA 4D96A 5J2TB 4E51A 2VP5A 2JVKA 3GJSA 2UZ1A 4IH9A 1EDBA 5K0ZA 3HVUA 1FS4A 1I14A 2R60A 1SBNE 2W2QA 1U2DC 2XNJA 3PB3A 1UBHS 4L8GA 3VU8A 3TO5A 1H2BA 3TLGB 5IJ9A 1YHZA 5BQXA 3RIGA 4EPWA 2IITA 3SI7A 5HWSA 3A06A 1BWRA 3EODA 1XLVA 4WZZA 4AO7A 4CEIB 1XMSA 1HORA 4D9MA 3TTSA 1IULA 4OBXA 1KSJA 3V9PA 2GK6A 1NT2A 5JAUA 5JXHA 2ZOSA 3O38A 4GVPA 1PT5A 1BAPA 2XLBA 4BQQA 3D8SA 1L0BA 3K8ZA 4BX8A 3CNHA 1G6KA 1D2HA 1RZUA 2DAPA 2X4LA 3GDHA 3KB8A 1XTRA 4IIEA 3CT4A 5CVEA 1E0AA 4WIAA 3PSAA 5AI6A 1V9CA 4C76A 1U5BB 1Z37A 5HW0A 3LOQA 1E63A 2P9GA 2HH9A 3LA6A 1RQXA 1UAGA 1KJYA 2EFYA 4R8KA 1ESMA 3I2IA 2M6RA 1N2CA 1VL2A 2PLFA 4L5BA 1QKJA 1W85B 2AEEA 3E5MA 1J5XA 2C9BA 3LFTA 4JYMA 4CL8A 3WGGA 5D7NA 3DMPA 3KDPA 4RKYA 1T4GA 1C8LA 4YBZA 5ISMA 4RLFA 1JR4A 3PE4A 2HA0A 2HXGA 3E53A 3CMCO 4JT8A 4EVSA 4NEGA 4W8GA 2DUNA 2K4MA 3SR0A 1JLHA 3I72A 2H8KA 4IHJA 1PR6A 3ICEA 3KVNA 1XR3A 3CIFA 3B3AA 5IH3A 3WNBA 2ZVQX 5JS1A 1U31A 3VVBA 2VYQA 3C4QA 5GZ1A 2BELA 2GKOA 1DC3A 2XYHA 4RQBA 2Y8EA 3CGGA 5AK6A 1BXGB 1K68A 2XNSA 2ZJ3A 3HWWA 5DK6A 3NHPA 4R1MA 3TMAA 1IEQA 5JQWA 3TDKA 3KZXA 5EA2A 3ZXYA 5JS7A 2F8LA 4NS4A 2VT6A 4A03A 1BXKA 4UVGA 1H3FA 1HBJA 2Q9CA 3IE2A 4S24A 5LUAA 1G66A 1RHMA 1H3NA 4B0PA 3TOCA 4AUKA 1L8LA 4PS1A 1AX9A 5GZ3A 1XAJA 2X41A 1HQCA 1FP1D 3MWGA 3RS8A 4BQRA 4CM9A 3OPYA 3ZS8A 4ZJUA 3P7MA 1WE2A 5KTRA 2PBFA 1L5VA 1SXJB 1XVLA 1QAOA 2ORIA 3BUSA 4JP8A 3JSXA 1NQ5A 2HRBA 4AMYA 3TAXA 2V8BA 1QG2A 2BIFA 2R1UA 4PLCA 4FDVA 2V9CA 4OY3A 1T9HA 3BGIA 4YJ3F 3MMSA 4NMHA 2PAFA 2IYTA 4RZHA 3LDFA 1AIPA 3ADKA 5DBOA 3SX4A 4CMJA 1SKUA 3O8BA 1WQ4A 4HFNA 1B74A 1G20E 2HPAA 2CF5A 1VI5A 2DH5A 4MUJA 2F6RA 4DIDA 2JI9A 1AK2A 5AW6A 4NPCA 1GUAA 1JAHA 5BQPA 4BNZA 5IDXA 5AJYA 1G0NA 3MT8A 1Z4OA 2XWBF 5ICSA 2A5FA 5EWLB 1TQHA 2BFBB 2I2WA 2X5XA 1OCEA 1J24A 3DFZA 4CGYA 4QYXA 1Q1AA 2F64A 2HUNA 3EVFA 3L7IA 3UAXA 3P96A 4WJLA 3DTVA 2O3SA 4D74A 2QOEA 3SKVA 2OPHA 4N6NA 3IXLA 1G59A 2HU8A 5KKAA 3D1LA 4C07A 3P0FA 2JW5A 5TR9A 4EPRA 3HKEB 1PYOA 2GD1O 3K4HA 5KAPA 3D4IA 4YMUA 3ZW8A 4H3KB 4O08A 1TQ2A 4QREA 5AW8A 1ABFA 1Z38A 4WGFA 4Y2JA 4B09A 2PUWA 1OKKD 2A5YB 4EKNB 3JWPA 4KI7A 5ALRA 1Z7EA 1FQKA 1P44A 4J2HA 4Z7OB 1AE1A 3R5JA 2O48X 5M34A 1TVMA 4EJMA 2HNKA 4TV9A 1GSIA 2AFIE 4B82A 2O1SA 2WKSA 1ZSYA 3LLMA 2WJVA 5HA5A 5B6IA 2W6OA 3RYHB 3IVCA 1KMIY 1R8SA 4U2CA 1TLFA 3D8TA 4HB3A 2GJAA 1RLTA 3FGOA 3K0BA 3VO2A 2QBYA 2X23A 1IOLA 3SYNA 4D4KA 4IUDS 1CUDA 4NMXB 4NNOA 3HUEA 3T3EA 3A3PA 3ZNOA 3ZKWA 5DNWA 1AUPA 3H2SA 2WJJA 3VZCA 4BVFA 2M2IA 4GWLA 4PHFA 2O8FB 3G68A 3K9QO 1P1CA 2HHCA 4TWJA 4HQNA 2XZLA 1W6RA 4BVKA 2W90A 2VP0A 1DX4A 1NZDA 1JLLA 2G8LA 1ECLA 4MQUA 1Z0AA 4J0FA 1Y4AE 1F9EA 1E8NA 2OSBA 3L4BA 3N39C 3PHCA 4IWXA 4LDRA 2UYHA 2F3RA 2YWEA 3C8ZA 5JJKA 1SK9A 2ZYSA 2VTDA 2ZRHA 3NYQA 1RQ7A 4J4BA 1I13A 4YH1A 4MP8A 2O2CA 3OPMA 3TQSA 4YDHB 1BE1A 2HHAA 4D0LB 4EB8A 3I5UA 1A2OA 3AU9A 1MB3A 2C2HA 1FC0A 1TKCA 3JQBA 4UAJA 1IB6A 2LGJA 2VHUA 4Y2TA 1A5ZA 1J33A 1TJ4A 3DOFA 2JGJA 5C7OO 3BWMA 4YCCA 1N1MA 3ESBA 3OT1B 4R2MA 2IJGX 4PPYA 2DJIA 4NCJA 4UJ5A 3HNOA 4BIMA 2PGOA 1G5RA 3PJGA 4JEMA 1CB7A 3NBAA 4DR2B 2IZ1A 4E09A 1NI5A 3UK6A 4H6WA 3CW8X 4AS3A 2VHXA 5INTA 1CY1A 2Y0EA 3QKUA 3S0JA 2G36A 4DQKA 4Q1EA 1UPAA 3EW7A 4TROA 4C3ZA 4YDRA 4R4JA 5F2EA 5KPJA 1WBDA 4M0KA 4JVLA 2XCRB 2YYAA 3CU5A 1BHSA 1LLDA 3AOGA 1FYVA 1P7PA 5DT2A 4BQEA 5CLJA 4HC4A 3E8SA 4LSWA 2ILVA 1AV7A 3W5CA 3IDOA 4MIOA 3VMFA 4BAGA 1NV8A 2WHXA 4L4SA 4YREA 4IDGA 5AKGA 4EI2A 5C1OA 4F5DA 1HKHA 3DDZX 4IRXA 4RHEA 4LZPA 3R0JA 2CMFA 1ZI8A 4ZRNA 5JD3A 3CZAA 4BNTA 4WBNA 4P0QB 1A69A 3HLTA 2YR0A 1XJCA 5B3JC 1E9CA 1JXAA 1Z6TA 4ZN6A 3QVVA 3G0HA 3AY7A 4YDQA 2HOQA 1SUDA 1G3QA 1ICEA 2AFRA 1UT6A 2GEBA 3EZ6A 3AHCA 2R8ZA 1HNNA 4NBSA 3LGAA 3L1HA 1WSDA 5FFMA 5EZYB 3WXMA 1R9NA 5TGTA 3V4OA 1OH6A 1JAIA 3RG8A 3TCKA 1MDFA 1TM3E 1U94A 2ZLBA 1LW6E 2ZWAA 2DHCA 2F1RA 3FI0A 3HYNA 1Z22A 4KQKA 1PWEA 5DXAA 5F9MA 3U17A 2VBCA 5A4DA 2FF7A 3ANTA 4IOMA 1GZ3A 1Q83A 3FBGA 3V48A 5EXPA 4IHAA 4CMIA 2BI7A 2UDPA 3S3TA 3FKSA 2V3WA 5K4AA 1GITA 2FTKE 4UMFA 3O21A 5CCDA 3UG7A 4CLDA 4QEDA 4ZZ2A 5K8JB 2D2IA 4YCLA 3E4DA 4KC0A 1FLVA 2VL7A 3SDBA 3RJZA 4CM4A 1EFRD 2GKSA 5HF5A 2C4MA 4IVRA 2DZDA 1G38A 2XJ9A 1IONA 4JJ7A 2ZJ2A 3ZLVA 1XAGA 4ZPJA 4ZAVA 1KMNA 2R2AA 3IMKA 5A3SA 4RZSA 4AKIA 3WLTA 1CRQA 1S7CA 1XYYA 1DC4A 5JDCA 3AOEA 3G3EA 4RFLA 1Q44A 5ANRB 3MTAA 3OCWA 4R9NA 2BEVB 5HM6A 5K3OA 1PLKA 2G3YA 4GI3A 4FDUA 1R0WA 2DWUA 4F38A 1M1YB 3A9TA 1YBFA 5FT9A 1J39A 2WHYA 4E4YA 2AD1A 4XRRA 1RR6A 2PL3A 2ZT6A 5DWDA 4YQEA 2P9BA 2RAUA 3CEAA 3OCZA 4CRWB 1P0MA 2VEDA 2H29A 3U49A 3QEBZ 2BDTA 1XCGB 1N32B 4PBRA 3OESA 1MLDA 3IAUA 3JATB 4PC6A 3OY7A 1FXWA 1BYUA 1TM2A 1X8LA 1E9FA 2HGZA 1THZA 2VQ3A 4P54A 1LTKA 3NZEA 2GHRA 2XOEA 4ZI2A 2A4KA 2OOSA 3RJMA 4B17A 4DV7B 3NVKI 2VHJA 1V1MA 1AMNA 1VG8A 5BN5B 3OETA 3N0TA 3FFBA 2R4UA 1LXCA 1SG6A 3QX8A 4KVAA 1U3TA 5K6TA 1Z8FA 3OKAA 3DB2A 4I4TB 4TKVA 1T9KA 3STWA 3ZLJA 1NR1A 3H5AA 4PZEA 2OO5C 3AUSA 1C2YA 4QO8A 4A4DA 3LDAA 4AAYA 1Z26A 3EDCA 1VZ3A 3GQVA 4KH1A 4FP9A 3RRXA 4Z3DA 5JY6A 2ZIZA 4GRIA 4NEHB 2V7QD 3D7LA 1EWKA 2GD2A 4WXHA 4CG1A 3N1UA 5ERGB 3LO8A 4C05A 2DTEA 3PQ3A 1CUZA 5AUPB 1N9GA 1NJ5A 2QAJA 2CNKA 4HDMB 5FPKA 2PSDA 1ZU5A 5FBQB 3TVDA 4J9VA 1QYCA 1RD4A 4LE2A 5DHUA 1V6SA 1TPYA 2ZATA 3OIFA 4PEVA 3V7YA 3LC7O 4FHZA 3MC1A 1YJAA 2ZGVA 3L0BA 2RONA 1PJ2A 2KSQA 1CE8A 4EUHA 4A10A 2YS6A 2ZJOA 1W0KA 1DINA 4X3PA 2BSAA 4XARA 5T41A 1J1IA 4BFWA 4IWYA 4BZWA 3CX3A 1Y9EA 2COUA 4MQEB 4GPTA 3KHUA 4LOLA 1G21A 4C7KA 1E1RA 2NUAA 4U2FA 1E2DA 3DXZA 4MJ3A 3IV9A 3SJCA 3NO4A 4C1BA 2D8MA 3EXEB 5BW6B 2GZ3A 1TZ2A 1IVNA 4OLJA 2HYIC 4M1ZA 3T1HB 3KLOA 2A1UA 4RO0A 1WSAA 1WDMA 3BVPA 2Q5OA 1M8KA 4KE7A 3AI2A 3I05A 2CEKA 3H1EA 3RT1A 3ZWWA 3KHKA 4RA9A 3OIDA 1BG6A 2HJHA 2DQYA 3GCGA 5ENVA 1A9RA 4ZEVA 1WBBA 2ZJZA 1ABEA 3KAPA 1MT0A 4LRQA 3R44A 2D3WA 3H5OA 3HTXA 3CO0S 4XFDA 2DEUA 1KMHB 1U6JA 2Z2ZA 1ONOA 3KOMA 3JQ8B 5IBCA 1X70A 2VFAA 3FFXA 3TQHA 1ZGGA 3JQ8A 4R84A 4HDNB 4A0QA 1U0BB 1XRNA 1WKVA 1Z0DA 2Z8ZA 4ZT5A 4EF6A 2XUDA 2YZMA 5C53B 5LLTA 2DWCA 4KXYA 3T7CA 1M34E 3PFWO 4KXWA 4NYMR 4RD0A 4URUR 3U7JA 1SQSA 1RYEA 2EARA 5B4TA 1IQ0A 2HPHA 1WY5A 4I14A 4M9RA 2QW1A 2PY6A 2Z9BA 3AI7A 4WLFA 1DAFA 3MBKA 3ZH9B 4EHDA 4I55B 5HYVA 3JD3A 3RBAA 1U5CA 4ND5A 1YK0A 2EF1A 1DIHA 2O07A 3DDUA 1F7UA 2ZJ8A 5AW5A 3WMWA 4B5KA 1NFQA 4OB6A 2ZG6A 3GLIA 1R12A 4YP0A 3N6RA 2Y4NA 3JYHA 1YZUA 1MOSA 4WEOA 2Q5IA 3CW2A 4DUYB 1KP9A 3TD6A 1AHIA 5CNJA 5TF4A 3NC0C 2FEOA 3MQFA 2BPOA 2Z1NA 4JP5A 4X20A 5KNBH 3ZJYA 1OX6A 1PL0A 5AW0A 1Y82A 5ALUA 4HXYA 3VJLA 4W8OA 1LBIA 5F1KA 2FPRA 5EYPA 3TSWA 4DTCA 3KBOA 1GGHA 1FFDA 2G71A 4FYVA 4D9JA 1E8DA 2FYTA 3CR7A 2ATEA 2H1FA 3RGGA 5GJBA 2ZAYA 4XB2A 5SY6A 1U7UA 1CEEA 1MO3A 4H1WA 3O8LA 1N5LA 3AI1A 3RVLA 1YMUA 3HS3A 1XO1A 1SHJA 2JJ1D 5BUSA 2HWXA 3KOYA 3WL5A 1Q1QA 1ACMA 5JQGB 3TW6A 3ESYA 2ZS8A 4Q93A 1Z5WA 1QH1A 5E6UA 3UN1A 1I4WA 1H9CA 1QMGA 1T0PA 3AVPA 1Q57A 4D5EA 4AG5A 1FVHA 1WLSA 3CF2A 2MR5A 4KOEC 4B84A 5D5HA 4NCAA 2H2GA 4M8NE 4A0SA 4IMRA 4UVEA 4IVNA 1DO0A 3DUFA 1RRKA 1MCZA 2IA5A 2OHXA 3GWGA 4MKFA 5FPQA 3WK5A 1FTGA 3OEWA 4TT3D 1TGVA 3I42A 2J85A 1ADCA 1P9NA 3RC3A 4IDBA 4DKXA 3CRMA 3LGSA 4PWYA 2NU7A 4DCUA 2PA3A 3H42B 3UHAA 1HYEA 4J1NA 1I4EB 1H4SA 1CVRA 1Y8CA 2O7SA 1HG1A 2H4WA 1OYOA 3NV7A 1N33B 4JITA 5TXGA 3WIUA 2XAUA 2QY6A 2RHDA 2PX3A 4EL5A 3L49A 4M8LA 2Z57A 4S1PA 4Z99A 4F8JA 4ZCTA 5MGBA 4N41A 2C58A 4DXHA 1HY3A 2F67A 3V4LA 4BJ5A 3K96A 1GNTA 2BEKA 2PIDA 3QENA 4O1HA 3WRYC 3ZQ6A 4QWMA 2V74B 4B3RB 4U2KA 3JQ7A 4DA8A 1IXYA 1EB9A 1KS9A 2JJQA 4OQFA 5F2KA 2WTXA 4AJEA 4DQVA 4WKGA 4YJFA 4MI9A 2FSIA 1G8GA 5CTJA 2J3KA 5KX5B 2AWOA 3G2PA 2AN9A 2AZ4A 3C8HA 1R4MA 2Q27A 2WD9A 3S2ZA 5JPCA 4LJSA 3WIOA 4CQLB 4L78A 1PZXA 4NZMA 1KZ9A 3H2IA 3ETHA 3M6MD 4GF5A 2B3TA 2OHJA 4YV2A 5AVQA 4KQ6A 4QBIA 1G8JA 1VJDA 1YDEA 2YS7A 2HTEA 3KELA 5G4KB 4WNCA 5DHSA 5I9BA 5IBQA 4DCVA 3DZCA 2DPLA 3DHEA 3HFRA 4KX5A 5HF8A 4ZGWA 2W6NA 1S1MA 3C6MA 3AESB 1D09A 2PMFA 3TFOA 1I4DD 2A0KA 1V5WA 3PFIA 3KKZA 3CPSA 3KOUA 4BVLA 4DG5A 3PFCA 3HYTA 5KYWA 2WWFA 2PMBA 2D06A 2BSQA 1J0XO 3OEEA 2ZUDA 3TNLA 3FGZA 3UGTA 3WYGA 4EJSA 3I5XA 2R86A 2V0GA 4BNYA 1XXLA 4MUHA 3GLUA 5MGNA 1MX5A 2EEPA 3IQFA 4X8HA 4IQ0A 1PR5A 3GRKA 2UYGA 4I36A 5EFZA 4K40A 5JO0A 2CK3D 3LXXA 3OIYA 3HJRA 4PO8A 5J2UF 1DU4A 2WNSA 2SCUB 1GQSA 4LE0A 4OIFA 2QRPA 4AWBA 1WW2A 1YS2X 2FUG1 3KTAA 3V7NA 3RS0A 5AI9A 4AY3A 4ITRC 3ZU3A 3S8MA 3QW2A 4U7GA 1WP4A 3F73A 1J0AA 2RE8A 2BKUA 2VI5A 4TTSA 4MWDA 4J16A 5H4HA 1PFUA 3KPYA 4HEA6 1PHPA 1NY6A 4IDPA 2AW5A 3H19A 4NK4A 2WJ3A 3HACA 3FXAA 3AJEA 1XFAA 1CJTC 3WLKX 4YACA 4OHUA 2FSHA 2D7CA 4K9OA 1JBKA 1LLUA 4ALKA 5ED4A 5DMXA 4M0CA 1EUQA 2PKXA 1B16A 1UBTS 3MSXA 2GEFA 4YA6A 4MYDA 3SQNA 3KQKA 5AVSA 1U8FO 3B8EA 3DMTC 3V6MA 2HUPA 1BRMA 1CKEA 1GRQA 1U7HA 1MH1A 2BHNA 1NP3A 1S2GA 1X39A 2PH1A 2DWOA 4D99A 4HB0A 1AO0A 5EJMA 5HCUA 4DMLA 2ZBPA 2A1UB 3EDYA 1CZRA 4XWKA 3M82A 1EWRA 1PS0A 1FU7A 1K6IA 4JGGA 2WT8A 1E18A 1P2GA 1IJEA 1W34A 1Z8HA 1M34B 2AQ8A 3EA5A 4G4SO 1Y4ZA 3F6YA 4QU5A 2VNSA 4Q9AA 2P7HA 4Z9AA 1PKXA 1KI3A 5EE3A 3ZWVA 1VBNA 2F1HA 3DTVD 4H1UA 4ER6A 3KYDA 3OE4A 4PS0A 1BD4A 4JLDA 3CUEF 4JAVC 1Y6ZA 1O95C 2FA9A 1E6LA 2I4RA 5ICFA 3MS7A 3QM1A 4GSKA 1EXDA 4F1WA 2YV3A 3IDAA 4TLDA 5M5BA 4RTKA 1D5WA 1QPBA 4NFSA 5EWJB 4ZC1A 4AICA 1SU8A 1YL6A 3BXZA 3LVQE 3RYFB 2Q4OA 1L8QA 1LQ2A 3C87A 4IP0A 4HDMA 5TPZD 4C0LA 1HT3A 5KNBA 1IBKB 2NSYA 4KAAA 4TLEA 5DHQA 2BEWB 4BS9A 1W5FA 1GZ7A 1NUHA 2R47A 4RFSB 1YZYA 2YZ2A 2KBFA 4B3SB 5AMXA 4FUQA 4FBGA 3ICVA 3KTDA 3RVNA 5K0TA 1J8FA 4ZOAA 4ENSA 3BRSA 1IN8A 4J3JA 3C4VA 3TOVA 2X8JA 1RHRA 3IQEA 3C5VA 3PRKE 3W34A 3NM5A 4BX0A 1HG0A 2IYWA 4HEA1 4BUJA 1UQUA 3ZHZA 2QF7A 1ZBDA 4YMTA 3FWKA 1R5JA 1O89A 4UCFA 3AHEA 2O8NA 3IHKA 2Q0HA 4FR0A 5FRDA 3K94A 3LHIA 3PDCA 4I0WB 4JU8A 4L15A 1GIAA 4FDLA 4O4LB 1U7WA 1HSZA 2BGRA 2P9HA 4L0DA 1P5FA 2X1LA 3BMOA 1GVNB 5EWJA 4BMNA 4O59O 1EUDA 4B4UA 3UGJA 3OF3A 3TL6A 4HZUA 5JR3A 4IY1A 3Q2OA 5CFRA 2FPMA 3SVTA 1LI7A 2YDYA 3KYDB 4KR3A 4QTUB 1DWUA 3UAGA 4X94A 4E0BA 2O4UX 3R6TA 3S2UA 3FPCA 4RZIA 2V7VA 1WTCA 4XOUA 4I9UA 2QX9A 3PIIA 5CVDA 5EQFA 4CFYA 3DAHA 3VA7A 1KOFA 3FWHA 2WOOA 2IUFA 1U4OA 4CDNA 2H2IA 3ND8A 3ELYA 2R9VA 5D51S 4N3BA 4D46A 1SNYA 1UBCA 1G8FA 4CR8A 1E58A 3H0EA 3IULA 3PNMA 3U9TA 3ZYCA 5BQ3A 1U7DA 3KYJB 1A8PA 1EP9A 2O6HA 4ZVTA 2E18A 2IHKA 2JHAA 3PL5A 1E1YA 3BMXA 3K9WA 2R62A 3ELUA 2RGGA 3DKKA 2PKRA 4L6CA 2QL9A 2EKPA 5F5NA 4BO4A 4EMUA 2VRCA 3UV6A 1ADFA 3OAAA 1JZTA 2D2FA 1QRTA 3BWDD 3EJWA 4DA9A 5JFTA 2CXQA 4H7IA 3RU7A 3UUEA 3O1HB 3L5KA 1Y5LA 3RROA 2AI2A 4RA6A 2GQ0A 5JAZA 1Z56C 1PFKA 2JFYA 3OA2A 1VE9A 2NACA 3MOIA 4HNUA 1J49A 3PENA 3O3OB 4GUAA 1YRHA 3C7AA 1EVEA 3D31A 4YT5A 1SY7A 4HQRA 1T5OA 2RGDA 5BSFA 3HL4A 1QV9A 2JZOA 4GGOA 4OHWA 4PLFA 3I2KA 1JWLA 1YR2A 1A5TA 1ISSA 1Z8DA 3I09A 3NDPA 3VR1A 4KRYA 1G2QA 4F45A 1LTQA 5FQOA 4D9EA 1BFDA 1URPA 1VYHA 3UV3A 4RIFA 3WAKA 5ICMA 4QPJC 5FD8A 2AMJA 4MMZB 5FOQA 3PHGA 1RAGA 3B3GA 3ETEA 2JJYA 1KAQA 2HRQA 3MB8A 4DUZB 1NJ1A 1ZYUA 3IBSA 3R4VA 1FJGB 3KZ1E 5C32A 5IT0A 2P0EA 4MQ6A 5DRTA 5EP2A 3AGPA 3V1UA 3TR6A 1X7YB 3UXYA 1L7PA 1NBMA 4HQLA 4MQ4A 4A6DA 5F7XA 1NSTA 1ZMTA 1MH9A 5AK4A 3AHJA 2KYRA 4RF3A 1PQ4A 3SDZA 1P4SA 3PUXA 3KLBA 3EGIA 2UYCA 2H06A 3KD3A 5JANA 4CQNA 4YRQA 2O23A 5LYYA 3JQGB 4G5HA 1C1HA 3TJZA 5LVAA 2PANA 4PYNA 1Q7EA 5JD6A 1FMLA 1SOWA 4AI6A 4A73A 1OBFO 2FW0A 2GO1A 4XQCA 5ARDA 3WGOA 2B1QA 1JR2A 2Q45A 1QU3A 1VHJA 4ZCIA 3B5EA 3QOYA 4E2YA 3DOCA 1VKOA 4KUHA 4LYGA 5ITWA 2QVLA 2VWQA 5IJXA 5BXYA 2PFKA 4KK4A 4XWWA 1OBOA 2RGAA 3GJ5A 3A31A 4RV4A 3WHLA 4NK5A 1J0DA 3VZSA 1AF7A 4I9GA 4MVJG 3DNMA 2CLMB