1YZTA

Gppnhp-bound rab21 gtpase at 2.05 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
155
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
total genus 53
structure length 155
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yztA00
1NLYA 4WBSA 2QPAA 4JZKA 2J3EA 2C96A 5KDOA 1XTSA 2YNMA 4ZCIA 4HUQB 4JLKA 5FOTA 3ADDA 3GJ0A 3QXXA 3WP1B 3AVWA 1ZM4A 3ICQB 1XMSA 2HUPA 1CP2A 1KI4A 1CR1A 2FEMA 2OXRA 2VP9A 5BQ5A 5IK2D 5EXSA 2IF0A 3CM0A 4HZUA 1CJKC 4O2LA 4RKFA 3LXRA 4O25A 2IHBA 1K8RA 4D80A 4LYFA 4TTRA 3DZ8A 1E99A 1XTKA 2GVDC 2PL3A 5FI1B 3NDBB 4GFDA 4TLCA 1CJUC 2WIAA 4Q4LA 2BKEA 3ZVRA 3UK6A 1CF4A 4TN1A 1OXVA 1E1RD 4FMCB 5E3HA 4DB4A 4TZ6A 4MYUA 1GVNB 4AYTA 4BECA 3SDZA 1MO4A 2FFBA 4IOKA 3K70C 1GAJA 4XSGA 1BOFA 2CK3A 4GOJA 2A7QA 4C4PA 2EWWA 4ZDWA 4B76A 1UDWA 2O8FA 2W6JD 3G82C 2LCFA 5BN4A 4A4DA 4PHGA 1D5CA 3E5HA 3LNCA 4JLBA 1KDTA 4TYPA 3RSLA 4R98A 1FUKA 2O52A 3BB4A 1CKEA 3FKQA 1YZNA 1GUAA 2QU8A 1HQCA 2XOKA 2QMHA 3LWNA 4JBWA 2YYZA 3K09C 1EWRA 5DE3A 5TVKA 2MSDB 2VHJA 1NBMA 3TVDA 4E03A 3B6EA 3UIEA 1EG7A 1EFHA 1Q44A 4NDZA 1E3MA 1NN1A 4C30A 4ZKEA 1CR4A 1HT2E 1U81A 5L3SB 3TQFA 5FOVA 2RMKA 4TSFA 4X8MA 2CHGA 2YVUA 2ZS7A 4OQFA 4ZDIA 1WXQA 1S8FA 1A1VA 1MABB 2BHRA 3M0EA 1JAHA 2J1LA 1PJRA 5FTLA 2O8BA 4JVNA 1MT0A 3AEZA 4B2PA 4BASA 4URXR 2FGKA 3OESA 4C0JA 3UG6A 3KXIA 1COWA 2BKUA 1E2GA 4RD2A 3H1TA 1LB1B 3C41J 1ZUIA 4PC3A 1XTRA 1TF7A 2GXUA 3U3OA 2VSFA 2AHOA 1XNJA 4HB3A 4WW0A 2A3RA 1Q22A 4KFTA 3CX6A 3ZYCA 2YWEA 2XB4A 1QHIA 1ZP6A 4KFUA 2D2EA 2IXGA 1NIPA 3G0HA 2VF8A 3ZS9A 4U02A 4P31A 1YZQA 3B1WA 3FVQA 4UNPA 1I4TD 2J0SA 4R2IA 3AVXA 5C4MA 4CT4B 3R7WB 1ZW6A 1P2TA 3U2QA 2GWHA 3VR5A 1KO4A 2L0XA 4I4LA 3LBNA 1KKMA 5J40A 2MMCA 1AK2A 2JJ8A 4LJYA 1BIFA 3AF2A 3LBIA 4OHXA 5CB6A 4MYCA 1AA9A 1R5BA 2V6IA 3RWOA 2RGNC 1AN0A 3EWSA 3OEHA 3KQHA 2WWXA 1M7HA 2GXQA 1E1QD 2QL6A 5AJWA 3BWDD 2AR7A 1JEEA 4JYBA 3DM5A 5AJVB 2O8CA 3PFIA 3H4MA 4L5BA 4JBXA 1D2NA 3FWYA 4Q4JA 3H86A 1Z0AA 4YLGA 4UXHA 1DTSA 3CWZA 5EUMA 2GZDA 2QT1A 1D6JA 2GILA 4C7OA 1OSNA 1Z83A 4P0TA 4PQRA 4C3ZA 4C2UA 4W9MC 4IEIA 2JCSA 3QKRA 4DCSA 1VHTA 4URUR 5GJVC 1JR3A 1ZM3A 3VMFA 5D3MA 1YR7A 1N5IA 2G77B 4PZYA 2ORVA 2EQBA 4X8OA 1ZNXA 1TEXA 4F38A 4ZDJA 4TQAA 4UJ3A 1GP2A 1QZXA 3B9QA 4C0KA 1FMJA 1ZM2A 2CE2X 2FPMA 1P73A 2J0VA 1JQLB 1KGDA 1S3GA 4Z1MA 3OF5A 5FTNA 4NL4H 4MKFA 3BS4A 3LV8A 2QP9X 2X2FA 3BGWA 3FMOB 5FBWB 4B3FX 4DXAA 2G9NA 4CRWB 4DCVA 3REFA 4BE7B 1VCMA 3ADKA 2XXAB 3MJHA 1SVMA 4KBFA 4FCVA 2CHQA 5J47A 3QF4B 1OXUA 1Q3TA 5AK0A 3SHWA 1KSHA 3DOEA 3SJAA 2QNRA 2ZTSA 3K0CC 4JLMA 1DAIA 1ZINA 2UZIR 2REOA 4I99A 1W1WA 2MSEB 4CIDA 2B7CA 1MOZA 4D0GA 3NH6A 3O8RA 4XIGS 4EPXA 2HEIA 2WJIA 2DWOA 4W5HA 5IDVA 3T1OA 3R8FA 4HLUC 1XPUA 1KJZA 1VYVA 2QQEA 3IQXA 1W4AA 4HEJA 4TTQA 3TR5A 3MWLA 3Q5EA 2XZLA 4PZLA 4A8JC 1KDPA 2RAPA 2VP0A 4HDCA 5JRJA 4FMBB 1KK0A 1S0UA 4M1MA 2EFEB 4HSEA 1U0HC 2XITA 2VA8A 2Z4RA 2H16A 2ZU6A 1NMXA 4N1AA 4XVUA 1XCMA 4OHWA 3FTQA 4YMWA 5HR5A 4XTCS 1ZRHA 2OV2A 2ZRPA 3GLFB 5FL7A 3KJGA 3UMSA 3T1QA 1D9XA 4D82A 2YHSA 1CBUA 3CKLA 4TQUS 1G7RA 3SI7A 5CM8B 1T9HA 2FPKA 3WMFA 3I5YA 3NHAA 1WE2A 1AGPA 3Q7QA 1ZMXA 3AKDA 4G5QA 3ETLA 1JALA 2NIPA 1KI3A 4P4SB 5TY0A 4UXIA 4DIEA 2ZPTX 4Q48A 3LAWA 5JJKA 4CEIA 4WA7A 3M6AA 3VKHA 4V0MA 4PPQA 4WOPA 1P9NA 5JRZA 5K8UA 1SXJC 4CEJB 1PLJA 3L0PA 1W46A 3CRMA 4A0GA 2J5XA 4DBLC 4JLVA 1H8HA 2OCAA 4N0DA 4F92B 1OXSC 4FWIB 3LXXA 4F4CA 4JT2A 3CH4B 2AK3A 3W9YA 5AUQA 1AQYA 1US8B 2QORA 2QQ0A 4DDWA 2QBYA 4WXPA 1TMKA 3RS3A 1PVOA 4LUCA 1Z63A 3MD0A 4L9WA 4RVCA 2D7DA 2XXAA 2ZR7A 4LYAA 3BC1A 4Q4AB 1CR2A 1VCNA 1Z6XA 1DG1G 2ZVPX 3EIQA 3KB2A 4TL9A 1MRSA 3IUYA 3GLHA 4N3NA 4RJLA 2P2LA 1I2MA 3QVUA 4GMXA 4BUJA 2ANBA 3MMPA 4ASUD 3D6TB 4TYYA 2DR3A 3K9GA 4WXRA 1Z07A 5K8TA 1Q1ZA 1QHXA 2QUZA 1O87A 1G3MA 3EW9A 4EFNA 4F93B 5P21A 4LPSA 4NH0A 3RNLA 1TEVA 4CDGA 2NTYC 2P5SA 2CLCX 4RSGA 4MKHA 1Z2CA 3F3YA 4P4TA 4C0SA 3ZLJA 4TT3D 4Y0AA 4OK3A 3QXSA 4PHTA 4M9SA 3WYGA 1HURA 1RJ9B 2VIIA 4LBVA 3ZZTA 5EXTA 4OYHA 1N6IA 4FMDF 5M04A 3GLIA 3QI2A 3A1VA 1JI0A 1QRAA 4MRNA 5BWMA 2WWYA 2XGJA 2Q6TA 4Q7JB 4KITB 4TZ0A 1HA3A 1J2JA 1VCIA 1UKZA 4B33A 4IRUB 4DHEA 2ZR0A 4CT5A 1LF0A 4RD1A 2IX3A 1XU4A 3LH5A 1X1RA 1YE8A 4FINA 1UADA 1N5LA 5CITA 5HTKA 3D31A 3HJNA 3BD9A 4NP6A 3AVQA 1UKVY 3KKQA 4MGZR 4PR0A 3TE6A 2GJKA 5CYPA 2WHXA 3KQKA 1OFUX 2D2FA 3P27A 3U60B 1N6PA 2IUUA 1Z6GA 4DIDA 2WJJA 5BYJA 3K9LA 5KYKA 2GF9A 3LO5A 4PSVA 3W6PA 2LWIA 4Q4HB 3GJ8A 3L8YA 1KSGA 2KE5A 3W8NA 3GJ3A 3B82A 4D25A 3VNVA 1OH7A 2ZRHA 1ZU5A 4A6XA 4KLNA 1OF1A 3HYRA 1KZ7B 1N6OA 2JA1A 3EC1A 3TBKA 4E07A 1TUEA 3R9WA 4B2IA 1N6NA 3CWQA 3R20A 5E7JA 4MYTA 3KFXA 1ZJ6A 4UNRA 1XEWX 3Q85A 1JB1A 3A4LA 4E22A 1W0KD 2V54A 2DWQA 2V4ZA 2FNAA 5KDDA 1CXZA 3FDIA 1XXHB 4QG7A 3TSWA 2PMKA 2YWGA 2RGNA 1U8ZA 5AJYA 1NLZA 3AKYA 2NO7A 3EXAA 2J0UA 2ZE7A 1FX0A 4LV8B 2XNSA 3DM9B 2B21A 2A5DA 3SNHA 4BLTA 2IW3A 1KK3A 4HZIA 421PA 4EJSC 3O8CA 3D7MA 4NCJA 5FR1A 3MCAA 3CBQA 3ZS8A 3A4MA 2AL7A 3BH6A 5CIWA 2J0QA 4LC0A 1SXJD 1XTQA 3Q9LA 2VLIA 1P75A 2ZEJA 1U99A 2PX0A 4TLDA 4AC9A 1EGAA 3QXJA 3ND8A 3WY9A 2Z5FA 1G18A 1NMYA 5CDFA 3IHWA 5FL3A 2YOFA 5J5CA 3R9XA 1AS2A 2J7KA 1HE8B 4B47A 1E4YA 5FBVB 3LA6A 1Z28A 1Z47A 1II8B 2ZSFA 3LX8A 3MWJA 1SVLA 2WKQA 3REGA 2BM0A 2C98A 3AF3A 1U90A 4Q47A 4LJ4A 1TPZA 5FPKA 4O2RA 1XFAA 4D0LB 4M1TA 1DE0A 1M7BA 3FB4A 3V00A 2ZRFA 5GJBA 1TL7C 1CTQA 2MSCB 4GBMA 1G7TA 3FPAA 4NMMA 4HAVA 3M1IA 821PA 1G8YA 1YZLA 2QRNA 1R10A 4CEIB 3LW7A 1N6LA 4G3XA 2AD1A 4QC2A 3GJ4A 4LJ9A 5KNBA 2QE7D 5L3QA 3SQWA 3W6OA 5DI3B 1UF9A 2GEDA 2XOKD 2OG2A 3W3ZB 3UG7A 2R8RA 5FBLB 4MUBA 4DLYA 2PH1A 1FQKA 2W6JA 2REXB 1NRJB 1ZUNB 3AM1A 1ZIPA 2D06A 4OHYA 5EXPA 1YRAA 4C0LA 3FMIA 2QAJA 5J4YA 5KSYA 2VHQA 2ZS9A 1W2HA 2HF8A 3N5CA 4M1YA 3BORA 2Q9BA 2D62A 2BJWA 1U98A 3LY5A 2FMXA 1AZTA 4A8JB 1P5ZB 1SZPA 2AXNA 1G8FA 4BGDA 4G5GA 4NU0A 4AIIA 1ZIOA 4S2EA 4WZBE 1TQ4A 3AUYA 1L4YA 4XVQA 4B2LA 1P2UA 4BWYA 2QAGC 2OESA 3BJIC 4JVLA 1T5LA 4KFSA 3W34A 5HZKA 1GFIA 2JLRA 1DAMA 4CF7A 1F2TA 3MGCA 5KNDA 4NCIA 2JLWA 2A30A 3HR8A 3IIMA 4QKQA 4ESHA 5CJPA 2WSMA 2V55B 1E9BA 1IBRA 2OCYC 5IT5A 4Q7MB 2IYXA 3EZFA 1G3IA 1DS6A 1VHLA 2I4IA 3GJ5A 4NPHA 1LY1A 5HKKA 3DVLA 2BCJQ 3A37A 1R8QA 4OQLA 1X3SA 4Q1FA 4Q9HA 2AD5A 1DO2A 3DHWC 3OE7D 5H8WA 2P67A 5L3SA 1XP8A 2JLUA 3CO5A 2CNWD 1NIJA 1Q0UA 2ZANA 4LYJA 3UWOA 2XB2A 5EUQB 3A6PC 4RZXA 4L4UA 3TMKA 4XJXA 1Y3AA 4BLOA 2FEOA 5F2EA 2GK7A 2ZUBA 3L82B 3NVAA 2ZITA 4LZZA 4HAXA 4IDOA 3AH8A 4BFVA 2ZJ5A 1XXHA 2HJVA 2GRJA 2D4HA 3HPQA 2FH5B 2OCBA 3AVUA 4FXPA 3MUFA 4Q1AA 2KBEA 1E1RA 2EFDB 4QFMA 5KU1A 3THWA 1HT1E 1DPFA 2C78A 2GKSA 4GNKA 3U44B 3B5JA 4HI0E 3LBHA 3U4QB 3T1TA 1P72A 1NN5A 1T8UA 2ZI4A 1M1YE 2YZ2A 4PANA 4IVRA 2NO0A 1DAEA 4WIAA 5B58C 4AKGA 2BDTA 2RHDA 3GMTA 2CLDX 3PCRB 2ZJ8A 3CPEA 3C4JA 4FMDB 5DLQC 2YV5A 4A82A 4KYUA 3W5IA 1BYUA 3T15A 3X1ZA 1W2GA 4JIMA 4QBIA 5FL7D 3V4RA 4KXFB 2FSIA 3SN6A 2B8WA 3OZXA 3Q72A 1E2EA 1ZCBA 2HT6A 4X8HA 1W0JA 4DLWA 2IS4A 4KVGA 1VG0B 4M0LA 1VCOA 3DL0A 4W7SA 2O8EB 3MFYA 2XX3A 4DVGA 1ZU4A 5LD2C 3MRSA 5HE8A 1TAGA 3JVVA 2N42A 2GBLA 5GJWC 5CB8A 1II9A 1P9RA 4IFEA 2JLXA 5LD2B 3KJHA 1EK0A 2HYDA 1Q1EA 3KTAA 2VHCA 3DMDA 3M4YA 4ZO4A 2QSYA 1CIPA 1X86B 4NCHA 3E70C 2OFWA 3GLHB 3OFNA 3CF6R 1EFRD 2ZQ5A 1II8A 2YJTD 5J4HA 2VHTA 1UKYA 3IKJA 4JLJA 1KY3A 5LDDC 3FOZA 3GEIA 5LB4A 3LD9A 2G3YA 2G83A 2WJHA 1CJMA 1UEIA 3EAQA 5JWOA 5EZ6B 2BVNA 3LW8A 5AUNB 4MKGA 3K0AB 3WNDA 1KO1A 2P0EA 1LVGA 2BEKA 3DO6A 4LY6A 3TAHA 4EKDA 2QT0A 2QGNA 3RLFA 4HLQB 2VF7A 3DPUA 1GWNA 1U9IC 2G0NA 5EE9A 3ZGXA 2F9LA 3NKVA 3ZQJA 2EU8A 1GOTA 5K8IA 3VU9B 1NF3A 1NNEA 2EVWX 4YONB 3EG5A 3K70B 3GQBA 5DHFA 3PUWA 4PAMA 4PXAA 2CJWB 4LHVA 2WBLC 2FDCA 3W5JA 3B60A 3P1JA 1M74A 4K8OA 5AUOB 2IS6A 1KNXA 2ZUCA 4G0NA 3AF4A 4DSOA 2ZI9A 1WDTA 1QHYA 5JJIA 4L15A 2GVZC 1XF9A 4JMPA 2ZIAA 4LYHA 1GDDA 1U2RA 2VP6A 4LHWA 4TMVA 2BV3A 3GLGB 2ZJ2A 2PBRA 1N6RA 2CL0X 3CH5A 4G01B 3RS5A 2IF2A 4J0QA 4ZV4A 3VU9A 3WBKA 1MO6A 4DCUA 4DZZA 1Z6YA 2QTFA 4Q4JB 5BN3A 4ASUA 1RE0A 4GOXA 4P4UA 1KI6B 4JLPA 5FUXA 1M7GA 3TK1A 2W58A 1HH4A 3EC2A 2CJWA 4NHOA 3WNCA 2FFHA 2O8DB 3J81k 2FFAA 4IJMA 3QIAA 4M1KA 1VKJA 3EIHA 2NGRA 3I73A 1QHGA 1HUQA 2DHRA 4RFSA 3I92A 4JLDA 1OFHA 4XD7D 4LSGA 1M2OB 1XTJA 2GESA 4LV5B 1KI8A 4GT1A 3AP3A 4OJQA 1J8YF 4MH0R 4URWR 3KUDA 4X8LA 4NZYA 4QL3A 3SE0A 2B6HA 4URZR 1OE0A 2GF0A 4B6FA 1WA5A 2IHYA 1X8LA 3MWKA 4HLCA 5EP4A 3T34A 4DKXA 1I4DD 3EA0A 1UBEA 1CRQA 2QM8A 2K5UA 1G9XA 3EARA 1X8KA 2GCOA 3NBXX 5DSZA 5KNCA 4AWXA 1GNPA 3RS2A 3U7HB 1K6MA 3VX4A 4C7OB 1GZSA 5DGXA 5D3QA 3K0SA 2WWWA 4RD3A 1QG4A 3CZPA 3OIUA 1SXJE 1NN3A 2Z83A 1TU3A 2ZYVX 2OUKA 3ASZA 1A7JA 2CK3D 1G41A 3GFTA 1UBCA 3QG1A 4URVR 4LHXA 4QJ4A 2FG5A 1W49A 5JMTA 3AUXA 4RCYA 2FV8A 2R2AA 4D0NA 4MQBA 1E2JA 2W83A 4BFZA 5TXGA 4LJ7A 2JDID 5JECA 1LS6A 1FP7A 3QY0A 2ZRDA 5E95A 5CK5A 3IO5A 4DSUA 1T4GA 3ZZUA 2FGJA 3QOFA 2IT1A 4JS0A 4LBWA 4M9XA 1GL6A 1D2EA 1KKLA 2RB4A 3JZAA 4A0FA 4QM7A 2ZREA 1O3YA 1N0WA 4KI0A 3SEAA 4ERNA 4GP6A 1SHKA 1CULC 2O0JA 3KKPA 1TQ6A 4XWKA 4M21A 1Q1QA 1U0JA 5L3VA 2O8DA 2OCPA 4IVPA 3U44A 2ERYA 1XZQA 1IONA 2ZAMA 5KSZA 3A8TA 1R2QA 4WZAE 1E2MA 2V6JA 3Q7PA 2ZRIA 4PAOA 2ZETA 4Q19A 2OM2A 1W44A 3NWJA 5C18A 2ONJA 3PEYA 1G291 2VQSA 1DELA 2OILA 3PENA 2ZROA 2LKDA 3SFZA 3BH7A 4UKDA 4B71A 4KSBA 3AP2A 2Z4SA 1H65A 4B3BA 4RD4A 5IF9A 4W5WA 2WV9A 3KDSE 4YC7A 1G8HA 3P4XA 2IS2A 4B3CA 1Z0IA 5JSZB 5L3QB 1TADA 1YR9A 4V03A 2EFCB 2QTHA 2ZAOA 3NBZC 3OAAD 4AK9A 1W7AA 4QRHA 3SJCA 5EP1A 3RRMA 1YHNA 3QKUA 4I1OA 4D4LA 521PA 4Q03A 2VSOA 3LDAA 4EJSA 1E2PA 3B78A 1RC8A 5CM9C 4TQ9A 3P26A 1R6BX 1XMVA 2CMKA 3W8RA 2X2EA 1KSJA 2XTZA 1E2QA 3FMPB 4POAA 4IXMA 1J8MF 1FNMA 2ATVA 4TYNA 2I1QA 3BFVA 3UKDA 4BFXA 2XEXA 3UANA 3AB3A 2TMKA 4M9QA 2F3RA 2EWVA 4P33A 4QGHA 3K9NA 1DARA 2RGGA 2DYKA 5H1YA 1KHTA 2UVQA 2XZOA 2CL6X 3RC8A 5EJEA 1DBSA 2DCUA 1F48A 3FHOA 1ZVQA 3ZQ6A 2FJUA 1OPXA 3BFXA 5FOWA 4R2HA 3SBDA 5FOSA 1E79A 2OLKA 2ZE6A 4DWJA 3BB3A 2IWHA 2ZU0C 1F5NA 3D8BA 3WP0A 1CR0A 1JXOA 3LLUA 4RD6A 3THYB 4PQFA 4K46A 4BQSA 5EE3A 2FF7A 2QMEA 1TQDA 4XOIA 3TUZC 2CHVA 1E0SA 1HE1C 5DNYB 3C7KA 4OK5A 1OV4A 4B44A 1NSFA 1FTSA 1GG2A 1P2SA 3DKVA 4JJZA 4LHZA 2GBLC 2ERXA 4B6EA 1UFQA 3RSOA 1W47A 4RZ2A 3IDQA 4ITRC 3QKSB 4II7A 4RZ3A 2WMOB 3Q5DA 1EESA 2OFOA 1FFHA 2NO1A 3WRXC 3GEEA 4LJAA 4E5UA 2J0UB 3BRWD 3AQ4A 4KHZA 5KUTA 1IM2A 2PEYA 2PLFA 1HYQA 3W3AA 4FN5A 1NY6A 4WVFA 1KZGB 3WNBA 1IHUA 2HXSA 2QZ4A 2YWFA 3B7GA 4QXAA 4QM6A 3A36A 3K53A 1ZCAA 3KQUA 1SVKA 1NBME 2XZPA 4KAXA 3WBJA 1UM8A 4F4IA 2KSQA 3CF0A 3CX8A 3TLXA 3NC0C 4CVNA 3KQNA 3IILA 4ARZB 3H0KA 3KXLA 2OSBA 3WHLA 1YZGA 1T3LA 1Z0FA 5FOXA 3D3QA 1NY5A 2VSXA 4HAYA 4A2PA 3U4QA 2DFLA 1G4AE 1OXTA 4JLAA 4PHFA 1HY3A 1KAGA 3GJ7A 3CR8A 2QE7A 2F43B 1R0WA 3CIOA 3ZVLA 4HAUA 4DUGA 1T91A 4LJ6A 2RGEA 4OI2A 3VR2A 2N46A 2OT3B 2GJ8A 2PT5A 2E9SA 3NIBA 1VYTA 2C8VA 4H1VA 3ZD6A 2E87A 2ZI7A 3QF4A 4TMWA 5F9FA 3T61A 1E79D 2CXXA 1GKUB 1MO3A 5FPYA 5K8LA 1NL3A 5JS7A 2WIBA 4U00A 1BH2A 2BMFA 5F9HA 3TGPA 2A5YB 3RRYA 3RS0A 3ZIAA 2GTPA 4B48A 3EX7C 4I1VA 2HLDA 2Q21A 4RFSB 3TUJC 4GZLA 5KPJA 1NI3A 4G5SA 3TRFA 2OFXA 1G5RA 2JATA 1CS4C 1G21E 2J7PD 4TWZA 5G3ZA 4DLVA 2OHFA 1YKSA 4LX0A 1VYUA 3QXCA 1MH1A 1E0JA 4Q9JA 3LVQE 1Y63A 3RC3A 3FKSD 3AV0B 2AXPA 3IEUA 3UWKA 2ZRCA 1T3SA 3VKWA 2H92A 3HP1A 4PPNA 3CNNA 3SJZA 2Q9CA 3TSZA 1EX7A 2P3SA 2PT7A 2ZJYA 3PIRA 2GAOA 4B3XA 4IOJA 2IYQA 1GRRA 3ONWA 4G5RA 4U5XA 3RAPR 3RWMB 1FL9A 1ONBA 2A5GA 1TU4A 2QMOA 1PUIA 5JI2E 1IN5A 1RIFA 1YR8A 4Q66C 3K0FA 2GZHA 4XH9B 4RZUA 3K9HA 3EPKA 1OIXA 2DFNA 2IWRA 1N25A 1N2CE 2RGBA 4TSFD 2NMVA 4V0LA 3RHFA 5KPDA 1FP6A 2BC9A 1MRNA 4A8JA 2BCGY 1KO8A 2F1JA 2HV8A 3OIWA 1RYHA 2C77A 4V0ME 3QG5A 4DLXA 1T0HB 3BE4A 3NXSA 2DFTA 4ZCLA 2Z0MA 2RGXA 1GL7A 4C0HA 3GLGE 4ESVA 2QP3A 1OIVA 4HYYA 1E2IA 2IUTA 4TL8A 4ZI3A 3TR0A 1Z06A 1JXMA 1GRQA 3A1TA 3K0CA 4C0AC 1T0JB 2WSSD 1S2MA 2FZ4A 1FZQA 1D8TA 1EXMA 3HR7A 3AVPA 4HDQB 3T06B 1ZNYA 4EJSB 5FOUA 2YOHA 4QNMA 4KBGA 1WBDA 3EZ7A 2A5FA 4A0HA 2A5JA 5A5GA 1NLFA 3PUVA 5CJ2A 2JLSA 1IN4A 4Q1DA 5FPSA 3RANA 3SZRA 8OHMA 1RRCA 2VRWA 1KI2A 5HCNA 2ZSEA 4GP7A 3TH5A 5FUWA 1XEXB 5HKKD 3GLFE 2B8TA 4GZMA 3QQ5A 1Z6TA 2VHUA 2VBCA 2WWHA 4BFTA 5JJLA 4R9UC 4D2IA 4BLPA 3GJ6A 1ZD9A 3C5HA 2IK8A 1G20E 5G53C 1KNQA 1NG1A 2REBA 5J4LA 4CGZA 3L8ZA 4YDHB 5L8VA 1LFDB 1MABA 2WAYA 3THYA 1G4UR 1JR6A 2IXFA 3IEVA 3T5DA 3VAAA 5IK2A 5BYKA 4JJKA 1W48A 4A6PA 4JKIA 1JQJC 4Z8YA 2QBYB 3QXHA 4FD2A 3U7GA 1Z0DA 2W2VA 5KO2A 1DADA 4BLSA 5C4GB 1ANKA 1GSIA 1SHZA 1ZBDA 1KYIA 2I1VB 3FYHA 5H68A 4C2TA 1ZM7A 4LJ5A 2R6CA 1L7VC 2KBFA 4BZXA 1HV8A 2QG6A 3ICEA 2ZSBA 4PFSA 1G5PA 1R5NA 2PZEA 4O0MA 4P4SA 4XTRA 5CLLA 3SYLA 3NBFA 1EFTA 2QROA 2UZ3A 1ZD1A 4EQ6A 3CRW1 1U0LA 1ZNWA 3EASA 3HPRA 1E2DA 2X1VA 1F2UA 3QKRB 1E32A 3I5XA 2Q3HA 2HF9A 2KI5A 4I1UA 4IW3B 1KDRA 2ZRKA 2KWIA 4F4JA 3PEVA 2BJVA 3SHFA 2OEPA 1KTVA 2RCNA 3IIJA 4BEJA 1XMJA 2G6BA 4ZI2A 1NVUQ 3KKMA 2RHMA 4LRWA 4NKRA 4AKEA 4DT1B 3W6NA 3K09A 1UDXA 1NMZA 1AJEA 4DDVA 1NVVQ 4OL0A 4C9BA 2ZE8A 2O8EA 3RS7A 3FFAA 4JVMA 4QOSA 3NTUA 4JL5A 2IL1A 2OZEA 4JBYA 4QNRA 4OI1A 4DT1A 1AM4D 1G6HA 5G40A 4BLQA 4V0NA 2ZRLA 3I8SA 4LC1A 5GVRA 5GVSA 3C5CA 4HDOB 1KSFX 1LV7A 1IY1A 1C4OA 4OBEA 1J70A 3GD7A 5AWFC 1ESMA 3EPLA 1ESNA 1VECA 5DIFA 1YRBA 3ZJYA 1QG2A 1XTIA 2O8CB 1HQYE 1JR3E 1BMFD 3IBYA 4KYIB 4MKIA 1RRFA 4JLNA 1NVVR 3NG1A 1DG3A 1ZNZA 1ZC3A 2IYVA 4Z51A 4F91B 4Q21A 1FUUA 4PC1A 1XMIA 3A1WA 2J87A 1E9SA 1OW3B 2JASA 2PMDA 3I8XA 4N0EA 4XWAA 2HCJB 3ZZ0A 4BZPA 4DEXA 2HLDD 1U8AA 2EFGA 2ZJZA 1KAOA 5FTKA 3RS4A 1W36D 3QVVA 3P20A 1C1YA 4FCWA 2QN6A 1GILA 2B7BA 4M8NE 2OE2A 3SC3A 1P9WA 3RRNA 2AX4A 1DAFA 4Q7LA 1RRGA 3IGFA 2QMUA 3N2IA 2R44A 1RJ9A 5B2ZA 3S1AB 2GXSA 4V0KA 3QNUA 4L16A 1G8GA 1JR3D 4YMSA 4DC9A 1AKYA 3IIKA 4US2R 1VG1A 2RH5A 1NBMD 2H1LA 4AG5A 1TF5A 2SHKA 1OHHA 4UNSA 3B1VA 2F9MA 4B73A 2CBZA 2CDNA 1J7KA 3THXB 1SVIA 1G17A 2X8AA 4JYCA 4H1UA 2CL7X 3CW2A 3F5FA 3C8UA 3GFOA 3CF2A 3DEFA 1IXRC 2CVHA 4XVRA 1DOAA 2F3TA 4BFWA 3GP8A 3L0SA 3GEHA 4OKSA 1LNZA 1KI9A 1VPLA 1QHSA 2A78A 1S3SA 5JZVA 2W0MA 1AIPA 4NYMQ 4PO9A 5KOYA 4EUNA 1PV4A 4GDFA 2H5EA 1JPJA 5FUVA 2FPLA 3AVVA 1F2TB 3CUEF 4OQXA 1FMLA 2C9YA 2WJYA 2CNWA 3O8DA 3BXZA 4KV9A 1IY0A 5TARA 3SFVA 2C99A 3BK7A 1GRNA 1ELOA 3K1JA 5IHPA 1E0AA 1N0UA 5DO9A 3ADBA 1N0VC 4QBGB 4DEYA 4A0RA 4OQMA 2FSGA 2QENA 3TVTA 1VG8A 2WICA 1TX4B 4L8GA 3DDCA 1AS3A 2PJRA 2IYZA 1SQ5A 4KU4A 4PHHA 3SJBA 2P5TB 1E1QA 2D7CA 2KJQA 2PX3A 2WJVA 2G0TA 2ZS8A 1WP9A 4M2LA 4CYMA 5A0FA 2ZYWX 2OBLA 3MSXA 4D81A 3ZVNA 1WB9A 4Q5IA 1NVXQ 1G6OA 3NEJA 4IXNA 1KO7A 4P32A 3QPWA 1LTQA 2O0KA 1W0JD 3BERA 3VR6A 4KVAA 4AKIA 4EPRA 1E9EA 2QPOA 2ZRAA 3VR1A 1P3JA 1HEIA 3P4YA 5FBRB 4EFLA 1IJEA 2P6RA 4R7ZA 2FU5C 2GHIA 4PQYA 4BRWA 1OFTA 4NCNA 2CEAA 2WJGA 4TL7A 4B43A 1KOFA 5BW8A 1N5KA 1XPOA 3B1ZA 1XZPA 1OB2A 3KX2A 1A2BA 1MO5A 2A2ZA 3N70A 1GIAA 2WMNB 1E98A 1QVAA 1WF3A 2RKOA 4EDHA 5JBQA 1XJCA 3PUXA 4DLSA 3RABA 2IEZA 3QEJA 3HYTA 2C2HA 3H84A 4LPKA 2ZI3A 1QBKC 4LJ8A 1G3QA 4OI0A 3R7WA 2D74A 2J41A 3PITA 4TL6A 2F7SA 1E69A 3WYFA 1UPTA 2O8FB 4MITA 4EPTA 2GCNA 2QRZA 1G7CA 1E2FA 1G1MA 3CNOA 4OHVA 2F43A 4ACBA 3THWB 2WAXA 3AVTA 3TW4A 1XCGB 2ODEA 2WVJA 3QPVA 2V8OA 4B34A 1B23P 3F8TA 4AG6A 4PSKA 4U7DA 5FBQB 5ANRB 3PR1A 4LBYA 1SGWA 4CZ2A 2XJ9A 2IYYA 3IPYA 1OXXK 2PEZA 1NVWQ 3DOFA 5FTMA 3T12A 3OAAA 4AYXA 3QUSA 1E2NA 2JLQA 2X19A 3FGNA 1E2LA 4RD0A 1IY2A 2IEYA 2IBMA 3TQCA 3UXMA 2ZSDA 4FIDA 5FUYA 4PO1A 4V0OA 3PEWA 4CEJA 3I32A 2DB3A 4PO8A 1DAGA 1P4SA 1OYWA 2ZI5A 4YXWD 4HUQA 1NKTA 3TKLA 3ADCA 5F98A 2Q9AA 1FW6A 4E09A 2V1UA 1IXZA 3RDPA 4MRRA 1NSTA 2W2TA 2GJ9A 4JL8A 1P62B 1ZD8A 3JZMA 3A4NA 3WXMA 1IQPA 3IQWA 3BH0A 1FPMA 1A4RA 5TB5A 3VFDA 4UXJA 2WOJA 1XCPA 5C1BA 3CRVA 1VG9B 4ON9A 2JJ1A 3QKTA 2DWPA 4GPTA 5EE0A 3EPHA 3AP1A 5C2JB 3SQXA 4M1WA 3AKEA 3AVOA 4M1OA 2G1KA 2H57A 3WYAA 3PJRA 1II0A 1MV5A 2XJ4A 2ANCA 1KO5A 2Z6VA 1W0KA 4ZCMA 4W5JA 3B2EA 4G1UC 3ZDQA 1TUIA 2B92A 5JLJA 1Z5ZA 2PLRA 2ASEA 4KLZA 1RKBA 4LV6A 4TYQA 3THXA 1H8ED 1WQ1R 3DKPA 3LQRA 3QSYA 1G5TA 2WWGA 3KUCA 4XD7A 5JEDA 1RRPA 1TNDA 1JJVA 2AWOA 4A2QA 2CLSA 2IS1A 2QTVB 2VO1A 3OEEA 2J45A 4M9ZA 4Q4AA 4XSHA 4DJTA 3GPLA 4BZQA 3AVYA 2QY9A 3HU2A 1E9RA 3KTAB 1C9KA 2GDJA 3PEUA 4HB4A 2GXAA 1Q57A 2CCGA 5CLQA 4HAWA 1D9ZA 1JBKA 4Q7KA 3GLHE 1GM5A 2ZJOA 3FFBA 3NEYA 4UNNA 4HUTA 1EFRA 3TAUA 3QJYA 1W5SA 3OHMA 3T35A 5FH9A 1A2KC 2JAQA 3FHCB 1N5JA 1YZUA 4DSTA 4D4KA 1SXJA 4PSAA 4DCTA 4EIWA 2YKGA 3PXGA 4DDTA 1P7CA 2GA8A 4XWOA 4FW9A 2XNDD 2QGZA 2MMGA 3K0EA 1I2DA 1OFIA 3AGQA 4Z8XA 5DH9A 2JIZA 4IEEA 1KMHA 1AKEA 4US0R 4LOAA 4YMUA 3HU1A 1CJTC 2R9VA 5EE5B 3IPXA 1ZAKA 3KXKA 3OIYA 1A5TA 3IO3A 5B64A 2OBNA 1G64A 4YDSA 5F3WB 3LLMA 4KSCA 1L2TA 3UMFA 2FWRA 3N2EA 1Z3IX 2BBSA 1Q21A 1R0ZA 4LGMA 3EWAA 4M53A 1F3OA 1FOEB 4LCBA 5FI0B 3T5GA 4IHQA 1TTTA 2VTKA 5ELXA 4LWZA 3UATA 3L2OB 3FE2A 4GSYA 3FMFA 2IYTA 1M8PA 2XNDA 4JKYA 3OIVA 3X2SA 3PV0A 1DVRA 4DRZA 1KI6A 2C9OA 1WMSA 3O47A 4HZUB 5KSOA 3KZ1E 3CLVA 1FX0B 3OFND 2DFKB 1W36C 2ODBA 4LBZA 2VL7A 4PZZA 5GJCA 3GLFA 2HCBA 4IDPA 5KDLA 4HATA 2ECKA 3RYTC 2WTUA 1S1CA 1S9DA 4GRAA 3B1XA 2GNOA 3I4LA 5DI3A 4QGGA 5G41A 3BIFA 4MRSA 3SYNA 1JJ7A 3SU8A 1QVRA 1GL9B 1K5GA 1Z0JA 2WWFA 2FE4A 2XTMA 2FFQA 4MDEA 2DY1A 2ZSAA 2AK2A 2ORWA 2ZXUA 4KODA 2KB0A 1JNYA 3KJEA 2PZFA 4QHYA 2BMEA 721PA 2BOVA 2XTNA 4GI7A 2BEJA 1KJWA 2X77A 3O8BA 3ZD7A 1E4VA 3VHLB 1P60A 2J59A 4D26A 2I3BA 1F2UB 3RVBA 1CU1A 1AS0A 2QAGB 2ZRBA 4LI0A 1BYIA 1S96A 5CK4A 1ZM9A 1DO0A 2BBOA 3QENA 3ASYA 2ZJAA 5SZJA 3L0IB 1WRBA 3LVRE 1Q12A 2J7PA 2VEDA 3B85A 3GJXC 3QF7A 4PAQA 2NZJA 4AURA 3HDTA 4KJZA 2CCJA 3VTKA 3K0AA 1OYYA 4NTZA 3A1SA 2V3CC 5JS8A 3PQCA 4TMXA 1WBBA 3U61B 1E9FA 3LRPA 5DISB 1RPZA 5H70A 4DSNA 1SVSA 2IYUA 4ZIRA 1SKYE 2FSFA 2OO7A 3TW8B 4RKEA 4DLRA 3C15C 3GLIB 2DBYA 1P61B 2BWJA 3E1SA 4EPVA 1HTWA 1AGRA 4NYIR 3VHXA 2F55A 1KIMA 2JLZA 2JEOA 2WKPA 2R6FA 3I1FA 4JT4A 3FHTA 4Q9KA 5JEEA 2AKYA 2ZUDA 1FQJA 1DEKA 2HDNB 2R6DA 3KKOA 4NYJQ 5EQTA 1XBTA 1IAQA 3VKGA 1IN6A 1Z29A 1YZKA 4BLRA 2FA9A 1YQTA 1P6XA 1XD9A 4G5OA 1U9IA 2V7QA 4A9AA 5KTYA 1F60A 1ZC4A 1GITA 2NPFA 2YOGA 4FI3C 4OK6A 1XEXA 2NO9A 4A1FA 1YU9A 3W90A 3WHKA 5J4VA 1G8PA 1OKKD 2ZJBA 3MLEA 4B3DA 5JWHA 1N6HA 2QA5A 5JI3E 4IOMA 2AWNA 2BBWA 2QM7A 4I1SA 1D2MA 1VIAA 2C5LA 4DUGD 5HPYB 2ZVQX 3EPJA 5SZKB 1KK2A 4FWTA 4A92A 2ZR9A 2C04A 4EAQA 4JVSB 2F1HA 1K5DA 2ZYUX 5JWRA 2ZYTX 5GADl 2C95A 3U3MA 4A36A 2PCLA 1JEDA 3MG9A 1CEEA 121PA 2JGNA 3BFKA 3C14C 4AY2A 4ABYA 4BEBA 4IFBA 4IVQA 3BB1A 4MGKR 1JECA 5EZ5A 1UEJA 5FPTA 3CB4A 3EZ9A 4MGIR 4TLAA 3EZ2A 1E9DA 3I72A 4QBHA 1NJFA 1T3HA 1IJFA 1B0UA 1E6CA 1XPRA 1G16A 1NJGA 5DN6D 3NBYC 5B57C 3B9PA 1PLKA 3B1YA 5EP3A 4TMTA 1VDZA 2V1XA 4LDJA 1T5IA 2FOLA 3BOSA 4TTPA 5DYIA 1R8SA 1X6VA 3PVSA 5EXXA 3GLGA 3GLIE 1RW4A 2WPDA 3F0TA 4D6PA 5HZHA 2F6RA 1R5OA 4LHYA 5D3MB 2F1RA 3GFPA 3NHBA 2JIZD 2VP4A 1R7RA 3CRRA 3PUZA 1VMAA 2XAUA 3U5ZB 2R6GA 2NO6A 4MUAA 2AFIE 1TF2A 4PC7A 2W6ID 4ZPXA 5IRCD 3MWYW 2GCOB 2IYLD 1UAAA 2IC5A 3SOPA 4JSYA 4Q4HA 2H17A 5JHGB 1S1MA 1BMFA 1Z6AA 2W0SA 2GEVA 1XEWY 5HE9A 1MR3F 4JL6A 5DN6A 2ZE5A 3X1WA 4P3YA 4Q02A 2O8BB 2P65A 1LF5A 1KDOA 2H7VA 4PC6A 1OKKA 2C9CA 2ZRNA 2FZLA 4B35A 1XB2A 3MJRA 5TDHA 1U94A 2GJAA 3JVUA 3VR3A 4ZIRB 1NKSA 3WMEA 2UKDA 3U3KA 4CEHB 1DAHA 2R62A 1E9AA 2J9RA 1US8A 1QHNA 2OLJA 1Z8FA 3PUYA 4Q9LA 5E7IA 2HT1A 1L4UA 3QBTA 4C0BA 2IYRA 3QKSA 2GEUA 1KMQA 2YINC 1OHHD 3QBVA 4IKEA 1LS1A 4Y0VA 1PLLA 2WOOA 5LPNA 2ODNA 1XX6A 1T6NA 2NOAA 1OH6A 3LFUA 4URYR 5SZHB 1KI1A 4C0QC 5E4FA 1KK1A 3CX7A 2BIFA 1SKQA 2FSHA 4NYMR 1CJVC 1G19A 3VR4A 5FR2A 4O3MA 3WRYC 4Q9IA 4ACAA 2VH5R 2XSZA 2W6IA 4UQOA 4KFRA 3SBEA 3TUIC 1PUJA 1Z0KA 2NPIA 1OB5A 5AUPB 1IXSB 1XD2A 3TSOA 4DB2A 1SULA 1UBGA 3AKCA 4Q18A 1W36B 1Q3HA 1OT3A 2V7QD 3AF1A 4OI4A 2JDIA 3A1UA 1Q20A 1QF9A 2ODWA 5DI9A 3OE7A 2O0HA 4B74A 5JCZA 1EWQA 2FX3A 4TMZA 2AN9A 3VQTA 2ATXA 2G88A 1NN0A 5TMPA 4PPFA 4BFSA 2QI9C 2YWHA 4A15A 4FCTA 5EP2A 4BFYA 3SR0A 1RZ3A 5J4KA 2PZGA 2ZRJA 3CONA 2EFHB 2AFHE 1S9HA 3CZQA 4CEHA 1V5WA 1M34E 1JPNA 5L3RA 1GKIA 4M4SA 6Q21A 1YJ5A 2W2XA 2RGAA 2EYUA 1YZTA 2N1BA 2R65A 4S35A 5UKDA 3HWSA 5C46F 1KY2A 4DLZA 2QPTA 1BS1A 4NONA 3V9PA 5DYGA 2OBMA 3R9IA 4AKHA 1R0YA 2BMJA 2C03A 4ARZA 1ZUHA 3ECCA 4NCKA 3UPUA 1LW7A 1CRPA 4TMKA 5CIQA 1J90A 5JCPA 2H18A 2BBTA 4EFMA 2BMDA 4GMDA 3BAFA 4HLUA 2RGDA 4QHSA 2QSZA 3IHLA 4ILEA 2GZAA 4Q1BA 5KSPA 3I61A 2R6AA 4Q00A 2VP2A 5LB2A 3WMGA 4NBSA 1BO6A 5TV2A 1EX6A 4LK2A 1X1SA 3KJIA 1G7SA 3R8CA 1J99A 1WCV1 5KHOC 1OH8A 3K70D 4KCGA 1EFUA 2JLYA 1P2VA 3X1YA 2JJ2A 3CNLA 2ZRMA 1TQ2A 4FMCF 3NH9A 4KO8A 4MRPA 3KL4A 4QBFA 5A4JA 2IA5A 1QHHA 4D4JA 4YQFA 3QEOA 4NYIQ 4PX9A 2VYFA 4Q1EA 4US1R 4AD8A 5SZIA 3TJZA 2PCJA 4TLBA 2HXYA 2ZRGA 4M1SA 4NYJR 3VNUA 1U8YA 3PG5A 3U6KA 1RFLA 1IN7A 4IOLA 1FNNA 4HB2A 1Q1BA 2CE7A 4L9SA 1OJLA 3I3SR 1KI7A 2JLVA 2F1IA 2QAGA 1XRJA 1YR6A 4QJ5A 5EE1A 1E2KA 1Z22A 1UKEA 2IYWA 4TT3A 5AR1A 1AZSC 1UBFA 1YVDA 2P6NA 2ZM5A 1Z08A 3FKSA 3QPUA 2NZ8A 2O5VA 3UMRA 1XDBA 4Q1CA 1QDEA 4Q01A 2Q0HA 1FTNA 3TIFA 3NC1C 4ZKDA 221PA 3KFVA 1T8TA 2G1JA 3ZIAD 2D3WA 1W4CA 2OXCA 1EFCA 4MA4A 5CDFE 3EA5A 4IDHA 2V9PA 3TNFA 1CLUA 2GCPA 3QE0A 1X8JA 4HB0A 3THOA 1G3UA 2J46A 3EIEA 3IBGA 5LBIA 2RGCA 1A82A 1E0KA 2GK6A 3U6BA 5JFGA 2WM9B 1XJQA 1F6BA 1W4BA 2JJ2D 2QEQA 2P6UA 3Q3JB 1SXJB 2OAQ1 1PZNA 1SVWA 3EZ6A 3T1VA 2EYQA 4MRVA 5FFMA 1XD8A 4DLTA 4ZDKA 1OIWA 3G5UA 3B13B 1E2HA 1W4RA 1H8HD 4K81B 3L43A 4RFVA 3U3RA 1NP6A 3LQQA 2IXEA 4B3GA 1AQUA 2WSSA 4MYHA 2AKAB 2GJSA 3A58B 3K8YA 4QGFA 4RCZA 2WZQA 3CR7A 5G3YA 5B30A 2Z43A 4BFUA 1I4LD 2HJGA 3OEED 4MGYR 5CYOA 4DCNA 1S4QA 1E96A 4A2WA 2CVFA 3X1DA 1JAIA 4IDNA 2HYIC 3KB1A 1H8EA 4HLDA 4PPGA 4DLUA 2FN4A 1G3RA 4IDQA 4QGAA 4B32A 3V4FA 2ZI6A 1SKYB 1N3BA 2VPPA 3CPJB 5HCIA 3U3JA 4GOKA 2W00A 4HAZA 3ND9A 1W5TA 1DAKA 1RYFA 2OAP1 3ZH9B 4EPWA 2LKCA 2DPXA 4V02A 1SVOA 1XWIA 3DZDA 1OH5A 2Q3FA 5FPHA 2IUSA 2ORIA 4QJ3A 2EW1A 3E2IA 1ZYUA 2PJZA 1RVDA 4EPYA 1UJ2A 621PA 4OJKA 4D4MA 2GETA 2YC4C 2YC2C 4Z54A 1QHHB 3KQLA 4DDUA 4B75A 3AF0A 4PTLA 2WPDD 3RRZA 1KJYA 1GNRA 4BPBA 1ODFA 4UJ5A 1KMHB 3CRQA 1ETUA 3SS8A 2XSZD 3OEHD 4I81A 2VP5A 5E7MA 4TYWA 3L0OA 3GCGA 3KKNA 4EQ6B 4F7WA 1M6NA 4R71A 2IYSA 2NG1A 3I62A 1XEFA 3HU3A 3MAAC 4NE2A 1V43A 4YMVA 2WKRA 1GKYA 5AJXA 4YMTA 1E9CA 4H9GA 5JSZA 2NQ2C 5BN5A 4WZ6A 3DMNA 1COWD 2A9KA 3B8HA 1R4AA 3NDPA 4AI6A 1E94E 4WAUA 4JLOA 5FTJA 1BKDR 3VX3A 3SYKA 1VTKA 1GTVA 4QHTA 1XJ0A 1NG9A 1Z2AA 2GAAA 2Q3MA 3LX5A 3AGPA 3S1AA 2BM1A 4YXWA 1MKYA 3K0FB 3P32A 3C16C 2H8KA 3H2YA 4RY2A 3X1XA 1XD2B 1L8QA 3ZVMA 5AJZA 4MDFA 3Q8XB 4BRUA 2Y8EA 2WWIA 3BBPA 1VIYA 2CCKA 4OHZA 1IOZA 5DHAA 4GL2A 3U7EB 4TLEA 4OQNA 4Z1MD 2E1RA 3U7FB 3CPHA 2JJ1D 1XXHE 4JSTA 4PC2A 5BXQC 2QP4A 1R0XA 4M22A 4CW7A 1IN8A 1N6KA 1OLOA 4UNQA 4AYWA 5JHHB 2ONKA 1GNQA
chains in the Genus database with same CATH superfamily
3MERA 1IK4A 1WF6A 1UXJA 2C96A 2MCFA 1CUZA 5KDOA 4GVXA 5AVKA 2B7LA 1V5FA 4BO6A 3ADDA 3GJ0A 2FWIA 3AVWA 1RQPA 1ZM4A 1U2SA 4Y67A 4C4YA 2QJTA 2BUCA 3E9NA 2DBQA 1XVLA 5CB0A 2OXRA 5DWQA 4JXJA 4DIUA 2YYAA 3HXPA 4I1PA 4YR9A 2BFMA 3DXXA 1KVUA 4LVCA 1MQ8B 1GPBA 4OMUA 4BQIA 4AJKA 2Z3ZA 3IAAA 3LXRA 2IHBA 3WDKA 3L6CA 4XB6B 1YUNA 5G1PA 2V97A 3SZMA 4RVOA 3BG5A 4EJ2A 1QO0A 3A6GA 5EJ2A 4B82A 4KR6A 4WNAB 2C9BA 1UZMA 4H7PA 1RYNA 3FAZA 3ORRA 5A1TA 5B4VA 4PG7A 1CJUC 2EX0A 2WIAA 1WPRA 3A4VA 3G5TA 3OSUA 3RU7A 4HGYA 3HB9A 1N5MA 1E1RD 1RHKA 3UK6A 5B2FA 5JZMA 2Q4EA 5K4HA 2I1LA 2PFGA 3N07A 4OHBA 1YBFA 4TZ6A 3I9V6 4WACA 4MVJG 1RWMA 4AYTA 1Y8RB 3TLBA 2WTEA 3ET5A 3ZH2A 4ENRA 2LIPA 3BF7A 2RGYA 2G0AA 3IP5A 1WEHA 4MUGA 4XSGA 1BOFA 2A7QA 2UUCB 3C1UA 4DR2B 4ZDWA 3A7EA 1UDWA 4DMCA 2VSYA 4C6RA 1AQJA 3K5IA 2W6JD 3G82C 4YJ2B 5AK3A 5C7LO 4A4DA 3KCQA 3E5HA 1VJ5A 4JLBA 3SYRA 4OYLA 5E2BA 3A0RB 2O52A 3BB4A 1CKEA 5LWQA 4EG0A 3A10A 3KO8A 2AVDA 4JNKA 1ULBA 4PIMA 3IBSA 1U7TA 4P54A 1EWRA 3OPNA 4XQEA 3ZJ5A 1M1ZA 1Q1NA 2MSDB 3MT9A 4YWHA 3U37A 3TVDA 1LJUA 3ZE8A 5LP6C 3UIEA 3TL6A 2H2HA 2ZJ0A 4RLSA 1Q44A 3VH2A 3HH8A 1KRXA 1EQAA 2WU8A 3RFXA 1WHSA 3BULA 4ZKEA 1TW3A 4KIWA 4M0FA 1PZXA 4DAOA 2P6PA 2YVUA 4OTZA 3HVHA 1S8FA 3C3CA 1F8UA 1D04A 4XIYA 4YIHA 4KR2A 4D4IA 1GZ3A 1M6VB 2JFVA 5BVHB 4ZEVA 2O8BA 3QY9A 1YJ8A 1BA2A 4URXR 3AEZA 3KM0A 2R751 5ECWA 2FGKA 2NNWB 1ZVMA 4LFAB 5CHEA 1H9CA 2IDJA 2IDMA 1E2GA 3M2PA 4UTNA 4MOWA 1KFBB 3G9XA 4YCNA 1LB1B 5DBIA 4HUJA 3V1KA 2GXUA 3DOJA 3MT7A 2AHOA 2QTVA 3MT8A 4WW0A 4CM8B 2X8JA 4QATA 4K9LA 4PYJA 2HK8A 1I5RA 4HEQA 4TTSA 4HNGA 3OM8A 2D2EA 3U31A 3ZW8A 3ELYA 3OOYA 1ITZA 1O6CA 4KPUB 2J0SA 3AVXA 1KZHA 5I3CA 4OHUA 3R7WB 3PXCX 4XJTA 1KO4A 2I4LA 1A9YA 1C41A 1OFGA 4WOBA 3DUFB 3MLBA 4Y2VA 2CSXA 4CDRA 1HDEA 1X7ZB 2J4FA 3LCJA 3OPQA 3P9ZA 3IV9A 3WB1A 3OT4A 4LJYA 1BIFA 1T36A 3N6VA 1NAIA 1CQZA 1R9MA 1S2LA 3C70A 5CB6A 3QVGA 3EMKA 3O9ZA 2VS1A 3OEHA 3AEXA 2WWXA 3LC2O 2RIPA 5FB3A 4AN1A 4C6HA 2QL6A 4L4ZA 3AI2A 1JQ3A 4IRXA 2UXCB 1EWKA 4FK8A 2ZZKA 4YJGA 3RIHA 4JYBA 2IHZA 1G38A 4YPFA 2ZM6B 3H4MA 4U7WA 2UYOA 2ILTA 3ITNA 1H4VB 1HTBA 2IUEA 3WLKX 2LUOA 2H1CA 9LDTA 4O63O 1EVKA 1C4KA 2HRBA 4PNZA 2HHLA 4RHEA 1Z0AA 1KGSA 5JQGF 5A0TA 2J48A 3CWZA 2Q5JA 3SNKA 2GZDA 4EY4A 2O4UX 2VQ3A 1LGYA 1BWRA 4C7OA 1H66A 4JUAA 4E21A 3C3XA 3ZDCA 1DBRA 3BSYA 4RX1A 2FR0A 4D97A 1DQNA 3BICA 3GRFA 1ZM3A 2FZ5A 5GJVC 3VMFA 1NE7A 2Z8YA 5D3MA 1N5IA 1KZ6A 1WB4A 2ORVA 2EQBA 4ZDJA 3V4LA 1MB2A 1PD1A 3D3KA 2BDUA 1L5YA 4KEAA 3BD8A 4MQ5A 4C0KA 1FMJA 3L1UA 3WB9A 3CG4A 4JB8A 5FHQA 2NSHA 2Y0CA 5BN1A 2RG7A 1S3GA 5A02A 4JT8A 1P4RA 5FTNA 3QEBZ 1RQXA 3JTEA 4MKFA 4D56A 3BS4A 3GMIA 2X7JA 1ES9A 4YDQA 5AW4A 4DR5B 2X2FA 3BGWA 5FBWB 4B3FX 1EH5A 2GD2A 4KSYA 4WZBA 4DXAA 2B98A 4DGQA 1TECE 4MWGA 2VTVA 4MP8A 1VCMA 1ZH2A 1QR2A 2HQSA 4DM4A 4ARCA 3MJHA 3VPXA 4FCVA 3G17A 3B9BA 3LLVA 3QF4B 5DBFA 3SHWA 1E3WA 5J47A 3BXPA 1D4ZA 3HXTA 3PNYA 3SJAA 4BMDA 3R6TA 3HVRA 1KVRA 1ATIA 1Z7EA 2J9YB 3K0CC 4JLMA 3IOCA 4XPZA 5LNK6 3V1YA 1PDVA 1RPAA 3RYHA 3DF9A 1Y98A 1W34A 1MOZA 3K72B 1AF4A 1KZ9A 2WUEA 3NH6A 5IAEA 2UZ1A 3W5CA 3IKTA 4PEVA 1W29A 4NU6A 1BQ3A 4HNVA 3ENWA 3DEAA 4C76A 5I4KA 1KJZA 1YCGA 3TXXA 1VDMA 4IZ6A 5KVQA 9ABPA 5K6AA 2XZLA 2PAAA 4A8JC 4HDCA 1U8FO 1UC8A 4FMBB 1KK0A 2ID4A 3I2FA 4ZVNA 4BVJA 1KU6A 2EFEB 1TZJA 5AESA 1WKCA 4HSEA 1NR5A 2M1XA 2Z1DA 1IBMB 1HDIA 2XITA 3OA2A 2IPXA 4NFHA 2ZU6A 1NMXA 2FMTA 3N86A 4NZMA 4OHWA 3V8VA 3FTQA 5HR5A 2XMBA 1TJ5A 1W76A 3BGVA 4MWEA 5KQLA 9MHTA 1QPGA 3KU1A 2OV2A 2ZRPA 4ZQEA 5MGNA 3GLFB 1QX3A 3KJGA 3T1QA 2BLNA 1QOPB 5DN9A 3P5SA 5CM8B 1T9HA 3JR3A 1MNAA 5T5QA 2VN8A 3FY4A 3NHAA 5GWXA 4EI2A 5AVYA 1Y37A 5JNLA 1AKWA 3O0TA 3CFYA 4R9NA 3AKDA 1IK6A 3ZWYA 3ETLA 2JHGA 3H2GA 1KI3A 5C37A 1U8XX 4EB6B 5EVJA 1MJFA 3VKHA 2A1TS 3FWZA 4PPQA 1L4MA 1SXJC 4CEJB 1WMEA 2I2WA 3CRMA 3L0PA 3TLEA 3OEYA 4ESEA 5JZBA 1M2VB 3ZPXA 4ITVA 1H8HA 3BFPA 4MVWA 3EXIB 3LCRA 3LXXA 1NYRA 4JT2A 1KPHA 1ESDA 1OV6A 3SLGA 4BXOB 4YV2A 1US8B 2QQ0A 2QORA 2W2MA 3AUFA 3VHQA 2G9UA 4WXPA 1TMKA 4FDMA 4GPEA 3PQ5A 2Z5VA 4UFPA 1ZJZA 2AOVA 3Q9SA 4PLTA 1Z63A 3G5LA 4I5EA 5EEHA 5TEWA 4L9WA 1OD6A 2D7DA 5FLYA 2ZR7A 4LYAA 3C39A 3LYUA 3SCZA 2ZVPX 4TS1A 2P2LA 1YTLA 1NVGA 4XPIB 2PD4A 1ESEA 1QYIA 1IPHA 5CMLA 4R9VA 1R9GA 1UINA 4DPKA 2VTDA 3ZDDA 1P7VA 1U0SY 1U0TA 1ZHOA 2QW8A 1R0KA 3Q4GA 4R8VA 5AI9A 4O3FA 2DXIA 4CM9A 2DTEA 3CUSA 1ESZA 1G3MA 3SQOA 3MS2A 5P21A 4F93B 1BGWA 1EG2A 2PIDA 3OQIA 10MHA 1E6MA 3DTTA 3JQAA 3IXMA 3R3YA 1TEVA 2NU9B 4WN3A 3RNLA 1F0YA 7GPBA 2VJPA 4Y2HA 1LJ8A 3I2KA 4K03A 3S5JA 4MHSA 3V42A 1XZLA 3ZLJA 5LQJA 5KWVA 2AFVA 2CZGA 1SCDA 3FVRA 1JU3A 3UHAA 3BK2A 2B99A 2VPQA 2VEOA 4M9RA 4OL9A 4LBVA 4QDUA 2E55A 4Z9XA 3ZWKA 3ZZTA 4QWWA 5KYWA 1I1QB 1ZOPA 4FMDF 5M04A 5JPDA 4KPEC 1JI0A 1PEKE 3KLBA 4N82A 2FFJA 2HCTA 2OR3A 2VBIA 3TIVA 5JVDA 4MRNA 2DERA 3HL4A 2J33A 3KTDA 3OZCA 2Q1TA 3ER9A 4OHOA 4EB3A 3BFJA 1HA3A 4J0EA 5T4HA 1BZYA 1QFYA 2FRVA 2P27A 4KIGA 3LYAA 4HGZA 2OHGA 4RD1A 1E5QA 1RIIA 1X1RA 2V7GA 1GNSA 1UADA 2RHCA 4FYJA 4YYZA 3IAHA 4WNCA 5P8WA 1QOZA 3BD9A 4FR2A 1VHJA 1QDUA 1Z38A 1XZDA 2IY7A 2OM6A 2J3IA 4XCQA 4JWTA 3WLAA 3I9FA 3BSSA 3OIDA 2X5KO 2Q6KA 3VKVA 5EJ6A 3VR2D 3UFXA 1H2BA 2WHXA 1UT5A 2EARA 5AP9A 2HMWA 3UWMA 3MWDB 3KQKA 1FS6A 1O94D 3P27A 2WIKA 1N6PA 2IUUA 2NV0A 1Z6GA 1XK7A 2I6QA 4L22A 3HY4A 2PIAA 5KKAA 4DIDA 3AKZA 4URHA 2P90A 3LO5A 2H4ZA 4F3KA 1JSZA 1KSGA 2IUFA 3T3HA 3B82A 3VNVA 1OH7A 2VLBA 3EXHC 3ZK8A 1K7XB 1VBKA 1ND6A 1MOSA 1UT8A 2I71A 3EC1A 5IVPA 1N6NA 3CWQA 3I05A 1Y4DE 2QTRA 3R20A 4YK7A 4YMIA 5EGNA 1SC6A 2LRHA 1JBQA 4HWKA 1AO0A 5EKTA 1W0KD 4WLVA 2DWQA 5ICMA 1AUPA 2H9YA 2V4ZA 2FNAA 1ZGJA 1XXHB 3MQ2A 2OQ2A 1WZUA 3QSGA 3LUDA 1QZZA 1U8ZA 1ISHA 2X8LA 1Y3DE 2NO7A 2RH4A 4C01A 3TG8A 1G5HA 4IJKA 3EVAA 5HCUA 3STVA 4RKYA 4XDGA 2XRMA 3VPHA 1PEDA 2B21A 2A5DA 2VJMB 4O2AA 3ZR4B 4N3CA 3O8CA 3HN7A 1VLHA 1CWUA 4P1ZA 3DFFA 4WTOA 5JMOA 4ENUA 2LNDA 1YGYA 2PZMA 4O4HB 4HNRA 2MSLA 3P9CA 3GCDA 3A4MA 5I7EA 3L6BA 3VM6A 4LC0A 2ATCA 4GYJA 2ZT5A 2PX0A 4CF6A 2VPYA 1EGAA 5LIRA 3RBXA 2OV8A 2WG2A 2ZFUA 1NMYA 1V41E 4JA0A 3H11A 5KX5B 5KIAA 2P2DA 1UK8A 2YOFA 4P7GA 2OXTA 1HE8B 4EKYA 3BWEA 2FEAA 3V55A 4D99A 1Z7WA 1E20A 3FJYA 1P5RA 2GPWA 3O8OA 3DBHB 3Q10A 1ULTA 3ZV6A 3D02A 3E1KA 2PKWA 3UAXA 3GNQA 1Z7YA 3SHQA 4A16A 3H2HA 1JH8A 1YF3A 4P5DA 4BGIA 1G6KA 4HQFA 2G5CA 1FYVA 2C98A 5FPKA 7MHTA 3G7SA 1TFUA 1XFAA 4D0LB 4M1TA 1LRJA 2Z56A 4G1MB 4X6LA 3JYHA 1GUZA 2GPTA 3V00A 3DPSA 1O03A 5BP7A 4B3RB 4JOCA 1PL8A 3U3DA 4YAIA 1TL7C 4ZMBA 2GR9A 4GBMA 1KJJA 3FPAA 3OURA 1DTEA 3FDFA 4QDJA 4MIOA 2UXDB 4GVPA 1ZVKA 1K6EA 2PKRA 4G3XA 2DE0X 4QC2A 3TEJA 4N9WA 5KMGB 5KTSA 2FSSA 3BQMB 5IXSA 1JXQA 4LJ9A 4PAGA 3OE5A 5L3QA 3W6OA 3N8GA 3HCNA 1T0UA 5AVUA 2HB6A 3MVEA 2H0QA 2XOKD 2XKKA 1GPH1 1IATA 2WJZB 3I5MA 3W3ZB 3QW4B 4DLYA 1VP3A 3RRBA 4CIXA 4PPYA 4FOSA 3QVJA 7YASA 1FQKA 2I8LA 4PYOA 3DHEA 3K31A 1R6VA 1O97D 1AQIA 1ZUNB 5AXBA 5B2EA 3GARA 5AKJA 2NXNA 4KV7A 1O6BA 4TKUA 5EXPA 4OP3A 3F7OA 1E59A 4YT4A 4OHYA 1KJ9A 4LF7B 1Z34A 2PUWA 5DM0A 2PGNA 1UXKA 4C0LA 4XQ9A 4QOFA 5JZSA 1TC1A 4H1TA 1XLTC 2C4WA 2ZS9A 2HF8A 2ZBRA 3BJZA 2BFOA 3EQ9A 2ZXEA 3N5CA 4H3SA 4JWKA 1NP3A 1BCSB 4M1YA 5ALKA 3STTA 3IRUA 2BJWA 1U98A 3KUKA 3LY5A 2GD1O 4QJBA 3G0BA 1T2FA 5G02A 4V3CA 1V7PC 2V7UA 1AKQA 3U40A 1BXGB 1G8FA 1LBIA 4I5DA 2V3WA 4TMFA 3L1VA 1JQBA 2HR1A 1AXRA 2WINI 1W5BA 1JQDA 1TQ4A 3R0VA 4JSRA 4L02A 4S2EA 4ZU6X 3TLZA 4XVQA 3CUKA 2C7VA 3D6NB 5KQPA 2ID9A 2QAGC 5C3MA 4WOCA 1P45A 4G5HA 4KFSA 1FYEA 3W34A 1XELA 3ZV3A 3TECE 1HC7A 2A30A 2IQ5A 2WHYA 2EP5A 3FCCA 3IA2A 1B00A 5CVDA 3T3MB 1M0SA 3FMVA 3HM2A 1NVFA 3PR2B 2IEBA 3ZHUA 3R6GA 4Q7MB 4UCQA 4WINA 2XHZA 1DRVA 3EZFA 2GHQA 3LRTA 2PKQP 4K9NA 1JKXA 1LY1A 2NT3A 2P9TA 3DVLA 2BCJQ 3A37A 2YUIA 3UJBA 4BV3A 3PC8A 4FOPA 3OZ7A 3IT2A 5IN5A 1REQA 5AVZA 4DILA 3DHWC 1DO2A 4K1XA 4NY1A 5B1DA 1AHPA 2H9IA 4H1WA 4Q37A 2F3UA 1XP8A 3PTAA 4N7RA 2A94A 3CO5A 3UWOA 2XB2A 2R6JA 3G0OA 3ZCVA 3GVCA 2RCYA 4ALLA 1MTOA 1SD2A 3O2NA 2VHVA 4M98A 4L6AA 1NUTA 2R47A 3NFYA 3RYIB 3DDZX 3LDUA 4YP6A 3W5VA 4FBLA 3JD2A 2P4EA 4BLOA 1VKZA 4Y2SA 2A5LA 4ZEOA 4B3JA 2ZUBA 4D5EA 3HM9A 4OM7A 2QX9A 3NVAA 5I9LA 1Y4ZA 3K3PA 3PNLA 5L7TA 5FLKA 8ADHA 1NC1A 4YMGA 1JVSA 4X7RA 4Z4CA 3KR9A 2SECE 1U80A 2NWQA 3OWHA 3Q11A 4FXPA 3R4VA 4J07A 4Q1AA 4RF2A 3T0FA 4MV8A 1Z0UA 4Q82A 4PFJA 1HT1E 2C78A 2D1RA 2O06A 1YZFA 3GRVA 4GNKA 4JC8A 4MW0A 4MV5A 2ZG6A 4ZPJA 3UWSA 4ZYWA 5KOJB 3NLLA 4Z4IA 1XVTA 3T1TA 3NHWA 2HY7A 1T1EA 1NN5A 4C88A 1M73E 4EH1A 4MQFB 2YZ2A 4GLJA 2YW9A 3L4BC 4H6WA 4MDHA 4IVRA 2AZ4A 1J7JA 1F8FA 1DAEA 1QNLA 1RPTA 1RTTA 2NO0A 4UEKA 2RBGA 3QVKA 1EQUA 5BQXA 1PTKA 2BDTA 3BSWA 4U5QA 4UOQA 2WSYB 3T4XA 3GMTA 3IA7A 4G4IA 4CMHA 1J20A 4YAKA 1PR0A 1RLJA 1U31A 2O2HA 2AC2A 3CPEA 2YV5A 4MPPA 3T15A 5IDXA 1W2GA 3KVOA 4JIMA 1OLSA 5FL7D 3SDBA 3V4RA 3JXEA 3TQTA 2FSIA 5AHXA 4Q4DA 2RBEA 3Q72A 2HT6A 2FLVA 3HN2A 2INGX 4A7PA 3C6MA 5LP6A 4CNBA 1Z8NA 2YV2A 2ZCUA 1K2WA 1C2YA 4M0LA 5A62A 1QGYA 5K0EA 2O8EB 1MOPA 3MFYA 4MVJF 3MRSA 5HE8A 2W42A 5AW8A 2FKNA 3TL3A 4N0PA 5GJWC 1YS9A 5CB8A 2VDMB 4IFEA 1EK0A 3GDOA 2FXVA 1OU0A 3M4YA 1BE6A 2KS6A 3WGQA 3EMDA 3C4QA 3HP4A 3I09A 3A4YA 1O95D 4J3FA 3H5OA 4ZAZA 1RBZA 1GEGA 1YBAA 3A3OA 4NCHA 2VDLB 1QHEA 3DTVB 3E70C 3GLHB 5EPEA 3CF6R 5E0OA 2PLNA 5HP4A 1II8A 3ILHA 4XSVA 4RY9A 4OQZA 3S8MA 1IUKA 2HXGA 3H2ZA 3IKJA 5SY6A 2R66A 3ZU2A 2XNJA 5LDDC 2J9FB 1NXWA 2I62A 1WIWA 2HIHA 4WLEA 4AY4A 3LD9A 2G3YA 2G83A 3ZHCA 4G0WA 3BEDA 4CLOA 1YS2X 4I4NA 3EIWA 3AI1A 2VZ0A 3UBTA 1BMTA 5JWOA 3Q8MA 3LW8A 4XLLA 4MKGA 1U4OA 3SWWA 1XU7A 2O2YA 3PFFA 3UAOA 3A2NA 3OMLA 4YRLA 3BMOA 3JYPA 4AMGA 4P0PB 1CVRA 2G0NA 4UUMA 2RHWA 4LF5B 1VB5A 5EE9A 1YB5A 1XALA 2GZSA 2F9LA 3FUVA 2J9ZB 4QOJA 3RAFC 2QHXA 1UAYA 4R9RA 4XCXA 1JH9A 1TVCA 1CQPA 2D2IA 2ZJ4A 1HZJA 3DL4A 2C07A 4P3NA 3WKCA 3VU9B 2B8JA 5K3BA 2EVWX 1LBQA 3O8LA 4YONB 2XIJA 1C1DA 1F7UA 1C4WA 3HUTA 4UDNA 3GQBA 2FQWA 5DHFA 2IH2A 3ISVA 4K6HA 3RHSA 3R1IA 2BONA 3UOWA 4BDTA 5JQGB 2OHJA 3PUWA 4PAMA 4RDHA 4IXDA 3IPCA 4JODA 3ZY4A 5NLLA 2FDCA 4NICA 2RARA 1KETA 1U28A 3P1JA 3UMJA 1DX9A 4K8OA 3M6LA 1KNXA 3Q6IA 4QSMA 1FSGA 4G0NA 2D8MA 3W79A 4MIEA 3WK6A 5KHLB 1WDTA 4DRXA 4JMPA 1CNFA 1I1HA 4RVHA 4O4IF 5E2IA 4LYHA 2XCOA 5E9JA 5ER9A 2BELA 4LHWA 1CRWG 4CKYA 3GLGB 2ZJ2A 3CH5A 2X9LA 3P52A 3T95A 3E5RA 3TLMA 4C7JA 4KR7A 1H0SA 5IBPA 3S2EA 2P7IA 3WBKA 4DCUA 1JHZA 1QGUB 5CNJA 1A4IA 3VPFA 3IVAA 3FHJA 1XQYA 3IP9A 1N2CB 4GOXA 4P4UA 1ZXXA 1LBTA 1HH4A 2ORYA 2ZIGA 4NEHB 1XZEA 3CWCA 4KACA 1UKAA 3QVLA 2RK6A 2FFHA 3WNCA 4FE7A 5IDQA 2FFAA 2CUKA 1CUVA 3I73A 4N5MA 2MINA 4QPNA 5AICA 1NSYA 4RVNA 3I92A 1OFHA 1L5SA 4CWAA 1WR8A 1H2AS 1XZ8A 3VNBA 3FFXA 2XRZA 4F5YA 3PDUA 1WB5A 1KI8A 4RY8A 1ZHHA 3AP3A 3WTBA 1J8YF 3HFGA 4MH0R 4R6XA 2HA4A 2WMDA 4GO1A 2OHOA 2YWDA 2RBKA 4PCAA 3LL4A 1U8CB 1GLNA 1JR2A 3SE0A 5DNDA 2VTEA 3U16A 1ZZGA 4MQFA 1NQXA 4Q3KA 4DKXA 1V1MA 5EP4A 2X7HA 3AR6A 3GGDA 4HFJA 5KTOA 3EA0A 2QM8A 1DIGA 1ISPA 1D6MA 2DGDA 1LK0A 1S3FA 1G9XA 3RIMA 1X8KA 3MJDA 2EAUA 2PLWA 1N34B 5DSZA 1P29A 2NSYA 1JN0A 1EUCA 1K6MA 5J63A 1GZSA 1C1XA 5GGXA 4OKIA 2D59A 1AK1A 3EZLA 1BKSB 3IR6A 3VU1A 2OUKA 3H8WA 5EIFA 1R4MA 5CAEB 2IHVA 2GN1A 3GFTA 3FSGA 3WQHA 5I5EA 4O2BB 6REQA 3QPBA 4XEHA 2PUEA 4NCAA 4LHXA 3TIGA 1CUHA 4M83A 5H0IA 1GV0A 3F78A 4UZEA 1W49A 3L1KA 4AX4A 1EM8A 1XVAA 1T0BA 2LV8A 1I2ZA 1MAUA 4QUKA 1OBCA 2FV8A 4LQ4A 2R2AA 3MUOA 5C5CA 1Q50A 4D0NA 1RC1A 5A04A 4MJ3A 5DEOA 3WWZA 3U4GA 4L3VA 3OC6A 5JECA 3UENA 2IU4A 1V11A 4NBTA 4Q12A 4CMEC 1AD2A 1PWZA 1P0QA 3PHCA 3VO2A 3ZZUA 5JZ9A 2FGJA 4LBWA 2RB4A 4PNPA 3JZAA 4DA7A 4HK4A 2W8BB 3GUCA 1WPGA 4ME6A 1VL6A 5IAJA 5TPWA 2P3OA 3SEAA 1ZOIA 4BLVA 4BVLA 3LY9A 4YCMA 2GM4A 4GP6A 1SHKA 1E89A 5JJBA 4E31A 1CULC 1W5FA 1A9RA 4EF5A 4F6RA 2YFHA 1Q1QA 2PUHA 1KAQA 3SLKA 4A1OA 4ALMA 4NG4A 2BHSA 2F00A 4IJ6A 3HGMA 1F8XA 1IONA 1NXXA 2H7CA 3GEBA 4WZAE 1CDZA 3JTMA 3L7CA 2YHAA 4JXZA 2V6JA 2ZRIA 4P92A 4Q19A 4R81A 5C18A 3DUWA 2IHJA 4TWAA 4J16A 2W4IA 2BFWA 2ONJA 3PEYA 2VQSA 4MICA 3SHOA 2CHFA 1YJAA 3RC1A 3PENA 4BV2A 3C7AA 3Q7RA 2OBFA 3FUCA 4OFBA 3H9JA 4OA8A 4JITA 2JGDB 5BSGA 2Z4SA 4CM4A 1UC9A 1BCSA 1A9XB 1E6UA 3N3AC 3I6MA 1K92A 1N4AA 3R3WA 1QGOA 3PQ6A 4YC7A 5GP1A 1JNXX 4IGEA 1U3FA 2ADFA 1M2WA 1Q0QA 1YOBA 1K75A 1TADA 2DKFA 1ZN8A 2HOQA 4MGEA 3MTIA 5F1KA 2NUAB 3GF4A 3OAAD 5KS2A 3EGXA 4ZAVA 2CNKA 1A77A 3BRCA 4I1OA 2NAPA 521PA 2WDZA 1VJGA 3QELA 1RMYA 3M5CA 4FHDA 3FUTA 2H2WA 2QNIA 2WHRA 4V1CA 1KERA 5CM9C 1DZIA 3QLJA 5BWBA 3PZBA 5ALJA 1NUUA 2LGJA 3HLTA 1MX9A 4GX0A 4E1BA 4UOZA 3W8RA 4ZQBA 1KSJA 4OHFA 2H29A 2F17A 2RB5A 4POAA 4EMTA 3LF2A 1FNMA 4FKBA 3E9DA 3H5TA 2I1QA 2F4VB 2LP4Y 3DEKA 2CWDA 5MHTA 4I2NA 1F17A 3JQ6A 4O1MA 3RQSA 3D3WA 4M9QA 2K7FA 3EVDA 5ES4B 4QUBA 3RVDA 4YASA 1DARA 4WN9B 5A3RA 1OTYA 3DAOA 2QZ9A 4N12A 1OX4A 3EPRA 4CM4B 4DMMA 2Q3EA 4LXGA 2Y1GA 2DCUA 2C4MA 1F48A 1MXHA 4PQGA 3ZQ6A 3N0XA 4QECA 4KGXA 5FOWA 3NVKI 1D09A 5FOSA 4XLTA 1PYDA 2H5JA 2BN4A 4HEA1 2OLKA 3BB3A 4LE2A 1APBA 3ANSA 2HJHA 2P9BA 2ZU0C 1XT6A 1KE2A 2WB4A 2Y27A 4RD6A 2I29A 2X5XA 2UYQA 3D8TA 1VPDA 1KQNA 4E4YA 2F3QA 2FP3A 1BCRA 3D8HA 4GICA 1EAMA 1K27A 4URFA 4PLFA 1P1BA 4YCBA 4AY6A 4XOIA 2BFAA 2AJLI 3AU9A 4ZT2A 5FF9A 3TD2A 4O08A 3VI4B 3TUZC 4P36A 3SEQA 4V1CB 1WMAA 2OHIA 3LPNA 3M5PA 4EKEA 1OV4A 1Y7TA 2REQB 2HU7A 4WY2A 2HFKA 5B12A 5JNSA 4JXXA 4MUIA 5B6JA 3OTQA 4LHZA 4MXDA 5DW3A 3U17A 1JQAA 4RZ2A 2AN3A 3IJPA 3IDQA 2XTAA 1HQDA 3UK2A 1L7XA 3ELUA 1AO3A 2EKDA 3WTCA 1EESA 1FFHA 3PPIA 1H2HA 4E3WA 4Z7JA 1L7AA 3FPGA 3R2JA 3FYUB 3CRZA 3BRWD 3ZGVA 2GAIA 1UMBB 3CZ4A 1L4LA 3NCTA 1YB7A 1QONA 3NTVA 4RENA 2CV1A 5EHZA 1EBFA 5K6AC 4NZZA 1IHUA 1Q77A 4BNMA 2AQ8A 2YWFA 2AYYA 2Y4NA 1D4FA 1U7HA 4IZHA 1KZYC 5ADUS 1SELA 4KAXA 2XZPA 1EVZA 3LTNC 2W2LA 2Z5LA 1IEQA 1AKTA 3LXUX 3H0KA 3KOWA 3UJ9A 3V4ZA 1JFTA 2HA2A 4LXTA 1T3LA 3H8SA 3ILVA 4JI4B 4F6RB 4E30A 3HUEA 3GJ7A 3RJZA 2QE7A 1EA7A 3O8NA 2HMTA 5FCDA 5F3RA 2JHPA 3KJXA 3ONDA 3S28A 4AG3A 4DUGA 4OI2A 2PQMA 5GV7A 3KT0A 4LMPA 5ALHA 1C30A 2QUHA 3C43A 4L9RA 4TN5A 1DX6A 3ZHTA 4JV5B 4D3SA 1KOGA 3QF4A 4TMWA 5F9FA 3P96A 1ZCJA 3PE4A 5DRYA 2FJPA 2ZPAA 2BGWA 1SXHA 1V37A 3ZY6A 3EXG1 3TPCA 2WIBA 3KTOA 1BH2A 4U00A 2BMFA 3W7VA 4PINA 4JUIA 1PJLA 3HUFA 1GPLA 4O02B 3TUJC 1JFFB 1QC5A 1LTHR 1LEHA 3GVIA 4FGUA 4E5SA 4EGFA 2OFXA 1CS4C 4UFNA 2OHFA 1YKSA 3QGMA 1KP9A 6AT1A 1JTEA 1E0JA 1G5IA 1H9BA 1S89A 2BGLA 4FFOA 5E6RB 4NC9A 1S7CA 1NYTA 4OQYA 3O75A 1V8PA 1T3SA 3GA5A 1IZ7A 5EWLA 3ZCXA 2ZWIA 3HGQA 2FB9A 3HMQA 4KZKA 3HP1A 1QLWA 5HILA 1YJXA 1MW9X 2OENG 2CFTA 2Q9CA 4NBNA 3SJZA 4M3NA 4CCAA 2PT7A 5CCXA 5TQ0A 1CP3A 5K8VA 1AX9A 2QVGA 3RAPR 2AS0A 3RWMB 1JHRA 2RHLA 4MLZA 1I7QB 1ONBA 4ZREA 2A5GA 4PZPA 1TU4A 4AZWA 1FFXA 3DT8A 1YR8A 3KYIB 1WVIA 5LYJA 1ORHA 5EL0A 5JI2E 1UOEA 3FGOA 3UKOA 4AS2A 4GH5A 2IWRA 3FSGD 1HOXA 3A1CA 3O7MA 4C7VA 4YRQA 5LKRA 5KPDA 4X45A 4JI1B 2OCGA 5LQKA 4A8JA 1KO8A 2AMYA 2HV8A 4QODA 3AG5A 1NBHA 4V0ME 4FDLA 3FBTA 4OREX 3RSHA 2GSDA 4HG2A 4BNGA 4DLXA 4ZO7A 5EZYF 4ZCLA 3CLUD 4WLUA 1GL7A 2R5WA 4ESVA 4HXYA 3ZBPA 1NKVA 1OI2A 1L3IA 1KMMA 1E2IA 3DCIA 3NANA 4HAIA 3QWIA 1PNTA 2A6PA 1TIBA 1HE5A 1MZVA 4HFNA 4EYQA 1HZZA 2ADMA 1LPBB 3LA8A 4CTJA 4N40A 4C0AC 4NF2A 9GPBA 1VC2A 2WSSD 4BVBA 2HCFA 5AW6A 1EXMA 5JW6A 2I8CA 3MINA 2YOHA 2WTMA 2YBDA 2O8VA 3OM0A 4OXQA 2A5FA 4TWJA 1WV0A 3EEBA 4H7FA 5NULA 1BE0A 4FHZA 3U7QA 5CJ2A 3EGXB 2XUZA 1RRCA 5FPSA 3DFUA 1X7XB 4CTOA 2ZSEA 1T13A 3O1LA 1F20A 2HA6A 5JANA 4FNMA 3KOZA 1X14A 3MJTA 5HKKD 1IM8A 5DTMA 2ZJ3A 3I42A 2WWHA 2H2IA 5GZ6A 1PBNA 1WUJS 1WB6A 4GC5A 3IEKA 3PZRA 3DWEX 4MKXA 4UEQA 1K9SA 5FPQA 1ZD9A 2AFIB 4BLPA 2H00A 2WZCA 2Z2KA 4J0JA 2P4QA 4P84A 3TMAA 3ZDBA 3T5MA 4X20B 4GECA 3SIPA 5J4LA 4CGZA 2YDXA 3OPYB 4YUVA 3L8ZA 5L8VA 1X80B 3PD0A 5BQPA 3SC6A 4BKRA 4ZICA 1M6VA 4D8VA 1JR6A 1G4UR 5C80A 2IXFA 2VBFA 2PV7A 5ALTA 1XMPA 4CTNA 3RPEA 1SG0A 2DAPA 3DYVA 1S2GA 5IDYA 1K08A 4CTKA 2QN8A 1QMGA 1TKRA 3LC0A 4QPPA 1FDUA 4QU8A 4RLHA 1L5HA 4JKIA 2A1TR 1FU7A 4WK2B 3KC2A 4LXYA 4QOHA 2QVXX 1RQRA 4FD2A 5CVCA 4D9CA 1Q83A 3ETGA 2PNJA 4LDQA 3RVKA 5KO2A 3ZU4A 3ZY2A 4GYYA 4UTXA 4BLSA 2PUTA 1ADFA 1ZBDA 1TTQB 3QI7A 1CE8A 1KYIA 1V35A 2I1VB 3L0ZA 3QOYA 4QU0A 4ZC8A 4C2TA 1ZM7A 4IGFA 3FI0A 1L7VC 2NYRA 4FNOA 4R0VA 3RVPA 2FUEA 2CLLB 1A4XA 2QG6A 5AXCA 3FOFC 4TTJA 2ZSBA 4R40A 2PZEA 1R5NA 4BN0A 4BNKA 1E3DA 1TD1A 2WUVA 4DG8A 5DNCA 1EFTA 2QROA 1ZD1A 1B16A 4XFJA 1ACMA 3VNRA 1U0LA 3HPRA 4EKGA 4TSRA 1F2UA 4RYLA 4EITA 2V9ZA 1E32A 4I1UA 2HF9A 1DJQA 4PGMA 3SC2A 4RY0A 4IW3B 1KDRA 2ZRKA 5K3AA 4F4JA 1IHDA 3EISA 3E23A 4KNYA 2DUNA 3E7DA 1N2SA 2G6BA 5DCUA 1E5VA 2VRCD 4LQLA 2RHMA 1RTKA 3VDNB 4DT1B 3DD5A 2XKBA 2H1VA 1VLLA 2OD7A 5GMOA 1JL3A 4DS3A 3W6NA 1DWUA 4IV8A 1DZ3A 1NMZA 1E7MA 1VPTA 1NVVQ 2F59A 1P44A 1SWVA 2O8EA 2M98A 1P74A 1MNQA 4JBYA 3IAS6 4JMLA 3LUFA 4OI1A 4DT1A 1AM4D 4E14A 1Z3CA 4PTYA 3ROGA 3T5PA 4V0NA 2ZRLA 5GVRA 3EULA 4R5HA 1I36A 2PNFA 1A2OA 2YS7A 3BZWA 3C5CA 1KZ4A 3GRYA 4WH0A 5CTJA 4GQAA 5I3ZA 2XF8A 4RZIA 3WRVA 1OLSB 3L6EA 4HYQA 3MTGA 2XKJE 1Z12A 5AWFC 4FHEA 1X3LA 4JQYA 4QULA 1O5OA 1ZGGA 3EPLA 1VECA 3IUSA 4ODIA 3V4OA 3B3FA 4U2FA 5DIFA 1WAMA 3V5NA 3UCFA 2FQ1A 4DQVA 1PR9A 1HQYE 1JR3E 1M76A 3IBYA 4K26A 1RRFA 5FNVF 3AB7A 3C8ZA 4I50F 3NG1A 1DG3A 3KJQA 4LSWA 1Q6YA 1ZC3A 5D7BA 4B7ZA 4DXDA 2O9JA 4F91B 1IBKB 4R16A 5KYUB 1QFZA 1XMIA 1CSEE 1JLMA 2H31A 1RQ2A 2J87A 4X5OA 3I8XA 3MRVA 2Q4BA 1MV8A 3QIVA 1YQQA 2ZIEA 4K8RB 2ODPA 3HJHA 5ALNA 2XUQA 1EFAA 4DEXA 4NXMB 3CLUC 4MAFA 1U8AA 2DULA 3ETHA 1DKRA 1JEQB 4A0QA 1KAOA 4RCVA 1Z2OX 2YIVX 3RV4A 1R15A 1X7ZA 1V8BA 5KJFA 1UJMA 1RWQA 1RRMA 3MNFA 1QH1A 4L4XA 3PJFA 1AUXA 4F12A 2PN1A 2QVZX 4MVJH 3U3XA 4IJVA 4HNAB 1Q6ZA 4D9EA 1C3LA 1P9WA 3RRNA 1FTGA 3GDWA 3OM1A 1DAFA 2C0CA 5JDIC 4WBXC 2PX5A 2XMRA 4RBNA 2R44A 1C2TA 3S1AB 1FDSA 5H81A 3GH1A 2GXSA 1QH9A 3ZI7A 4L16A 4LWPA 3OIGA 1ZRSA 2W6QA 2Q5FA 5F3DA 1TZKA 1N1EA 2BI4A 2VXBA 2L2QA 1AKYA 4C4OA 4US2R 1Z4MA 2M2IA 1QQTA 1GPNA 5DRTA 5J1TB