4IV0A

Crystal structure of n-methyl transferase from plasmodium vivax complexed with s-adenosyl methionine and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
263
structure length
263
Chain Sequence
ISEPVDIKYLENNQYSDEGIKAYEFIFGEDYISSGGIIATTKILSDIQLDANSKVLDIGSGLGGGCKYINEKYGAHVHGVDICEKMVTIAKLRNQDKAKIEFEAKDILKKDFPESTFDMIYSRDSILHLSYADKKMLFEKCYKWLKPNGILLITDYCADKIENWDEEFKAYIKKRKYTLMPIQEYGDLIKSCKFQNVEAKDISDYWLELLQLELSKLEEKKEEFLKVYSIKEYNSLKDGWTRKIKDTKRDLQKWGYFKAQKMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphoethanolamine N-methyl transferase is a Malarial drug target
rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords Phosphoethanolamine N-methyltransferase, putative
total genus 110
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.103: Phosphoethanolamine N-methyltransferase.
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iv0A00
4PWYA 1I1NA 4FGZA 1I4WA 2JJQA 2P35A 3LDGA 4E33A 3CGGA 3HEMA 2AS0A 4GOOD 3UJDA 3GJYA 4EK9A 2R6ZA 4ER0A 2AOVA 3KQQA 3P9NA 4FZVA 2JG3A 1JTFA 1ZKDA 4MWZA 3EPPA 1ORHA 5EZSA 5CUQA 1NBIA 3DOUA 5K0BA 2WA2A 4OBXA 2AOWA 5FHQA 3RIEA 3M70A 3BWBA 3LBYA 3TOSA 5K0NA 4YUWA 5EZQA 3HNRA 3KQOA 5GM2A 2UYCA 5BXYA 3FTFA 3C0KA 3NWEA 3KHKA 3LDUA 1FP1D 1VIDA 2R3SA 5DWQA 3ME5A 5CVUA 1JSZA 2E5WA 2G70A 3M6UA 4DM3A 4GOMD 2I9KA 2GPYA 3AXSA 2B3TA 4A6DA 4E2XA 3BWMA 1TW3A 5FWDA 2OO3A 4KVZA 4ER3A 1XDZA 3CJRA 2IGTA 3EGVA 4RVHA 2H00A 3EEOA 3EGIA 2ZZKA 5C1IA 3DMFA 3G88A 4EVIA 2BZGA 2HWKA 2BR5A 1UFKA 1HNNA 2AN4A 5FA5A 3C6KA 7MHTA 3M6XA 5DM2A 3KR1A 4OA8A 4E2YA 2ORED 2YR0A 4KWCA 3HCEA 4LECA 4WVLA 2ZIGA 1NV9A 3DXYA 3P9KA 4AZVA 5K0GA 1XCJA 3P9CA 5DXAA 3VC1A 2HNKA 2Y1XA 1D2CA 1VL5A 4R8RA 5DRYA 4BY9E 5K0CA 3SVZA 3E05A 3HCAA 4WXHA 2Y1WA 5FQNA 2ZVJA 4M37A 2PBFA 1R8XA 1WXWA 2OZVA 2LD4A 1AQJA 2QRVB 3FUUA 3MCZA 2VDWA 3OCJA 4KRGA 3C6MA 4Y30A 3FPJA 1RI4A 3VC2A 1AV6A 2OBFA 5K0JA 2PX4A 1YF3A 4QPNA 4AZSA 4PGHA 3GRRA 3LECA 3PS9A 5FA8A 3G2PA 3TR6A 2B2CA 3HCBA 4KIGA 5HIJA 2IH2A 3FUTA 2ZZNA 3KPUA 4DQ0A 3KPYA 3KR0A 1TW2A 1X1DA 3SMQA 4XUCA 2C7QA 2ZZMA 2IBSA 2YQZA 4R8SA 1JQEA 4RTPA 3BZBA 2H11A 4FSXA 2BR3A 1XCLA 3EVGA 3I9FA 3KQSA 2XYRA 2P3OA 5EMLA 5BP7A 1SQFA 2PWYA 3MCTA 1JG3A 2IFTA 2OYRA 3M33A 2K4MA 3SSOA 3GRZA 2XVAA 2ZIFA 3T7SA 5KQSA 1R18A 4F84A 3IHTA 3NTVA 3C3PA 3DH0A 2DULA 3K6RA 3KKZA 5KS2A 3GGDA 3JWHA 1SG9A 2QY6A 3BGDA 1KP9A 1NW6A 3BWYA 5FTWA 5LR6A 1ZHFA 2AN5A 4GF5A 5IH3A 5E1OA 4ER6A 2G1PA 4QDKA 4U7TB 5KYGA 1KPGA 3ID6C 2PJDA 1Q0TA 3SXJA 3KQMA 1NW5A 1EIZA 2BM9A 3GNLA 2Q41A 1BHJA 3PTAA 2IH4A 3HCDA 4P7JA 4QDJA 2OKCA 3SX0A 2VDUE 2UYQA 2C7OA 3PVCA 1JSXA 3JWIA 3K0BA 5E9WA 2QM3A 4RYLA 5E8JA 2ESRA 3VSEA 3LKDA 5EMMA 1NT2A 5GP1A 1I9GA 4DMGA 2UZ4A 5EG5A 1RJEA 1UIRA 3HP7A 3EGEA 5DRTA 1EQAA 5DX1A 4CXMA 1YZ3A 2O57A 2OPBA 2WK1A 4C08A 1XJ5A 4NECA 2KW5A 5DM0A 5EHIA 3SSMA 2H1RA 3FRHA 3EVAA 3OPNA 5H02A 4E70A 1NE2A 3HA7A 4QPPA 1G8SA 1RJDA 2FK8A 1SUSA 2I6GA 1B42A 3KR9A 5P8WA 4HH4A 3EEYA 3I58A 1YZHA 1ZQ9A 2A14A 3O7WA 4CWAA 3OU7A 4X41A 3FTCA 2FYTA 4F86A 5MHTA 4OQEA 3THRA 3G2QA 3HA3A 5ICCA 4XCXA 1RI2A 1P1CA 5F2KA 5DX0A 4V0QA 2CKDA 1BC5A 2QRVA 2NXNA 3HVIA 4OQDA 1N2XA 2ZLBA 4HG2A 3TKAA 1P1BA 2PKWA 4IV8A 2FRXA 1KXZA 3F4KA 3MERA 3GRUA 1FJXA 1X1CA 5E9QA 5DTRA 5GWXA 3AJDA 1EG2A 4DKJA 5FQOA 4C4AA 2ERCA 5GINE 5EIFA 2XBMA 5EC8A 3EMBA 4CKEA 5KQRA 3A25A 1KYZA 1AQIA 3G5TA 3OE5A 2OB2A 5DM4A 5EKXA 1T43A 5ICEA 4RTMA 4AUKA 3E7PA 2PX8A 2UYHA 2IBTA 2YUIA 3M6WA 2AVDA 2V7EA 3O31A 5F2OA 2YX1A 2HR1A 1JG2A 3JWGA 4X61A 3R6TA 4K6MA 4OA5A 4RTRA 4EKIA 4PYOA 1RJFA 3FYDA 3EMDA 5FCDA 3ELWA 4P58A 1JQ3A 3LPMA 4IKPA 5CVEA 3MGGA 1IM8A 5E8RA 4E31A 5DT2A 5JR3A 3T7RA 2G8NA 8MHTA 1KYWA 2GH1A 3V8VA 2P3QA 3TM4A 4PGGA 3B89A 2P3LA 1X19A 3HCCA 4PYKA 4RTJA 4RX1A 2OXTA 1ZGAA 2P7HA 2PX5A 4X1OA 1TPYA 5LQKA 1JQDA 3A7EA 4R6XA 5FULA 5EHGA 4P7GA 4V0RA 2XVMA 4C04A 3EVFA 5K05A 1Q0SA 1XVAA 5CVDA 5DSXA 2G72A 2BM8A 3ELUA 2O0LA 3UJ8A 5EPEA 3CBGA 2XYQA 2AN3A 3UJ9A 3ANXA 1G38A 3EVDA 1M6YA 4HSGA 1O9HA 3NMUF 2YXDA 3PT9A 3GIWA 3GRYA 1QANA 3LBFA 2EFJA 3ER9A 1G8AA 1FPQA 2YTZA 4YUVA 2NP7A 4DCMA 4DF3A 5ICFA 3UJ6A 1D2GA 1PJZA 3OFKA 1UWVA 1QAQA 2PWPA 3TPZA 1WG8A 3QOXA 4POOA 5HOQA 4MHTA 3KPWA 4HC4A 3ELDA 1R8YA 1VP3A 3I5UA 2ZBRA 1P39A 2JHAA 2ONYA 3FPGA 4X60A 3I53A 1R00A 3A7DA 3UJ7A 5E2AA 5K0FA 4PYNA 5EKUA 3LHDA 1SVUA 3P2EA 4HGZA 1WZNA 1M0EA 1L3CA 5CCXA 3UJCA 4RTOA 5DXJA 1QAMA 2XYVA 1VPTA 4KIFA 2CMGA 5GOZA 3A27A 4L7VA 3ORHA 5DTMA 1SUIA 4FSDA 5HFJA 2IPXA 3BGVA 2ZWAA 3LL7A 3L8DA 1QYRA 2QYOA 3GO4A 2NXJA 1VP9A 3FZGA 3IEIA 5CVJA 5CIYA 4R05A 1WXXA 3EVBA 3PFHA 4OX9Y 3TRKA 2ADMA 2AOUB 2IIPA 3CCFA 3LCCA 3MTEA 4UOEA 5K0EA 2P1DA 3VYWA 2ZULA 4PYLA 2AR0A 1WY7A 5C9ZA 5HIKA 3BXOA 3M6VA 5E1BA 1PRYA 1ZG3A 3BKXA 3GU3A 3KPVA 3P97A 2B78A 2O05A 4DZRA 1WS6A 1ZGJA 3NVMB 3MAGA 3P8ZA 2G71A 5EOVA 4H0NA 1G6Q1 1X1BA 2EX4A 2ZTHA 4BP1A 2VS1A 3OZSA 3NDIA 2HMYB 4GOLD 1O9GA 5DLYA 2JH8A 2OY0A 2GS9A 2IP2A 4ATNA 4YUZA 3PLAE 1L9KA 2AOTA 4F85A 1EJ0A 1NW8A 4RTLA 5K09A 1F38A 1KHHA 1BOOA 1G55A 1JR4A 3KQTA 4CKBA 3TFWA 5EGSA 5GIOE 1SQGA 5F2NA 4RTSA 5DX8A 1L3IA 5ERGB 4BLWA 3FUXA 3TMAA 2EJTA 5DPMA 2AVNA 3LGAA 1OR8A 3Q7EA 5T6BA 2FK7A 1VE3A 1XTPA 2C7PA 3E23A 3LKZA 5K8VA 1P91A 3AXTA 2JHPA 2CWWA 2PXAA 2CL5A 4MIKA 3EVCA 2AOUA 4FS8A 4P7FA 5EMJA 5G02A 3NWBA 4ISCA 3S68A 1G60A 4PINA 3DXZA 3QOWA 4LWOA 4RVGA 3T7TA 3DLCA 2PV0A 2IDKA 1N7JA 3PX2A 4KDRA 2AZTA 1INLA 3GDHA 4M38A 1N7IA 1QZZA 3FPEA 4MTLA 3TQSA 1IY9A 4FT2A 1YFLA 3MB5A 4Z2YA 3E8SA 5BW5A 2N47A 5HEKA 4YUYA 2NXCA 4G56A 4ER5A 2UYOA 5LQJA 1QAOA 2AOTB 4JXJA 4FT4A 4GOND 2B9EA 3DULA 3R3HA 3FPHA 3TM5A 4CKCA 5K01A 1X1AA 3X0DA 1F3LA 3CJQA 3D2LA 3NW9A 5FWAA 3UA3A 1NKVA 2YXEA 3DR5A 3NJRA 4M36A 4AZWA 5GIPE 1ORIA 4RTKA 5CM2Z 3G2OA 3TLJA 4RV9A 3LDFA 3UZUA 2WA1A 3EVEA 3AY0A 4PYIA 4EQZA 3MHTA 4R6WA 4C05A 2C7RA 3FRIA 3RW9A 3LSTA 3R24A 2NNWB 2B25A 3DMHA 3KPJA 4PCAA 4BP3A 4EKGA 1DCTA 2Z6QA 4LG1A 4MQ4A 3TKYA 2FHPA 3HVHA 4PYQA 2O06A 5HILA 1EAMA 2GB4A 3OE4A 1MJFA 1SKMA 2I62A 3BUSA 4ER7A 3HM2A 2GAFA 2ZWVA 2ZCJA 4FP9A 4DA4A 4OBWA 4HTFA 4O29A 3CJTA 5FUBA 2P8JA 4EMSA 5CCBA 10MHA 3B3GA 2NYUA 3JWJA 3KQWA 5E1MA 4QVGA 1L1EA 1XXLA 2V74B 5C0OE 5KVAA 3KR2A 3OU2A 1KR5A 4QTTB 3BKWA 3KU1A 2GLUA 5E9JA 3G89A 3MTIA 4YV2A 4RWZA 3KQVA 4QQNA 2PVCA 3G2MA 3G8BA 3A26A 3GWZA 3LCUA 3AWIA 4PCLA 1JG1A 3KQPA 2P40A 3GCZA 3P2KA 3GRVA 3RODA 1L3BA 1NBHA 5FADA 4YMHA 5DTQA 1NW7A 2PY6A 2ZBQA 1M6EX 3H2BA 4M7RA 4PONA 4E32A 5LQAA 5FHRA 1YB2A 3PFGA 1D2HA 2F8LA 3KQYA 2BH2A 3DTNA 3OZTA 5K03A 3LCVB 5U4XA 1RJGA 3FTDA 2PX2A 1FBNA 1HMYA 3A4TA 3QV2A 1YFJA 4X63A 3P2IA 3WSTA 4BLUA 4YMGA 4KDCA 2HTEA 3I64A 3SSNA 1V39A 2PGXA 3SGLA 3THSA 1JTEA 1JG4A 4AX8A 1KPHA 4C07A 4IV0A 5LQUA 3V97A 3OFJA 4RVFA 4Y2HA 3ELYA 1FP2A 1H1DA 3R0QA 2PSSA 3DMGA 4RSRA 5LQRA 2NXEA 3LX6A 2CMHA 2Z6AA 5JUWA 3UBTA 2PXCA 1IXKA 1RI1A 4KW7A 4RTNA 2ZIEA 2YVLA 3B3JA 3B5IA 3PB3A 1O54A 5GM1A 4RVDA 1MHTA 2NP6A 3G5LA 1VBFA 2FPOA 5IKMA 2P7IA 4XUEA 3G8AA 4PYJA 5D1HA 2PXXA 3HVKA 3DXXA 5T64A 3GXOA 5LQCA 2BR4A 4PIMA 5E2BA 4YV1A 4YUXA 3DP7A 4GC9A 2VP3A 4HTFB 3REOA 3SM3A 3P71T 4A6EA 3R9XB 5LQNA 3HTXA 4GQBA 9MHTA 1Z3CA 3HVJA 4P7KA 2PT9A 5LSAA 3ERCA 2FCAA 4LWPA 4QVKA 4DCGA 3FUWA 2ZSUA 5D1NA 3FYCA 2ONZA 4HRAA 1NV8A 2PT6A 1YUBA 1DL5A 2Z6UA 3B3FA 3BWCA 3CVOA 3G7UA 3U81A 1EJ6A 3IYLW 3OU6A 4CTKA 3OZRA 5EVJA 3NDJA 4GC5A 5M5BA 1AF7A 3ER8A 4GEKA 2IDJA 4RTQA 2IH5A 3BGIA 4PNEA 2QE6A 2GA9A 3HCFA 5DSTA 3DLIA 2OB1A 3C3YA 3FPFA 3IV6A 1NW3A 2DPMA 3Q87B 3M4XA 4IWNA 4PIPA 5EEHA 5HIMA 3T0IA 3BT7A 4XUDA 5T67A 1Y8CA 2JH9A 1RI5A 2ZBPA 1KPIA 2EG5A 5BW4A 4HGYA 2O07A 5B1SA 3UFBA 3MQ2A 4PYMA 3UWPA 2AOXA 2HV9A 1XDSA 5EIWA 5CD1A 4QTUB 1U2ZA 2EJUA 3CC8A 4C03A 5HZMA 4E2ZA 4U7PB 5EMKA 1KIAA 3FTEA 3NVKI 1XDUA 3O4FA 3HA5A 4E2WA 4YV0A 1VLMA 3SR4A 4GUAA 2JHCA 1BKYA 2YXLA 3DUWA 3UA4A 5EEGA 3EVZA 5CVVA 4QQKA 1R6AA 5HIIA 5EQJB 2I7CA 4C06A 2P41A 4CTJA 3FUVA 2VZ9A 1DUSA 4AZTA 2VDVE 5K0LA 2ZW9A 3UJAA 4FR0A 1VQ1A 5ICGA 3P9IA 3B7PA 5E1DA 4GBED 4ZTBA 4E30A 2PLWA 3CKKA 4BLVA 2ZFUA 3PX3A 5DM1A 1RI3A 1R74A 3UJBA 4B17A
chains in the Genus database with same CATH superfamily
1I1NA 1SIOA 2BGLA 2EGHA 1K86A 1VXRA 1PO7A 3MJVA 2JJQA 3VGPA 2NADA 3W79A 1DCMA 3JXEA 4RZSA 4ZPJA 1Q2UA 4XCVA 2UZ1B 4LNUB 3R40A 3B78A 3DLPX 3JZIA 4IX9A 4RD4A 1NXQA 3E1KA 5TXGA 4DA9A 4EJSC 4YCCA 2YDYA 1ORHA 3AEXA 4UMDA 1S5PA 2BLLA 2OGUA 5BW6B 4TRNA 1EHIA 3F6RA 3OEEA 1THTA 1UZNA 1O8CA 3AKEA 4LJKA 1BEEA 1Z73A 4YC7A 2QBYA 3BWBA 3S2IA 1SRQA 1V25A 1ZD1A 3IR5A 4JLWA 3MWYW 3L05A 1QQ6A 1D9ZA 3KLPX 1V2HE 5EP1A 4B74A 4FSHA 3W3AH 2W58A 1TADA 4F4JA 2VDOB 2WM8A 2Y1EA 3OHSX 4G01B 4G07A 3QFRA 4Z0PA 3SNHA 2QXUA 2A0UA 3LT5A 4PZPA 1K68A 2VK1A 2A92A 4PY2A 1NI3A 2IEBA 5BOSB 1LRJA 1HQCA 3PQFA 4N5HX 2H63A 2HGSA 2HMVA 4H08A 3K4HA 4XWGA 4YQFA 4B73A 4BO6A 1KE1A 4D8YA 1OI4A 3QV1A 3P26A 1QG2A 3F67A 5A4DA 2MSNA 4NXNB 2EIXA 4XGQA 5I7RA 1QIJA 2BR5A 4EARA 4HDNB 1Q95A 1BCSA 2BGJA 5CT8A 1IQUA 4TWZA 5FEUA 2XB9A 2UAGA 2WSBA 4HVLA 2OLEA 4PHGA 3VU9A 4C43A 2HA3A 5FOVA 4AZVA 1NAHA 2GNAA 1N6OA 2GASA 2WSMA 4KDEA 5DN9A 5H59A 5FNVF 3PE4A 4BY9E 5K0CA 3UTCA 1IH8A 3TLMA 2Y1WA 5B4VA 2ZVJA 2UZ3A 5J1TB 4JQSA 2DG2A 4LC1A 4AJ9A 3JRWA 2PBFA 1A8IA 3MMZA 2OZVA 4MW1A 2HF2A 1T1IA 4NULA 3V6MA 1Q1BA 2CNKA 2CK3A 1DIAA 1LQ2A 4NNPA 3W90A 2V03A 2XPCA 3QEOA 2PX4A 2YXPX 2H1SA 3Q5EA 5K0JA 1AUOA 2IKQA 2J3KA 3CNOA 2HWWA 3ETLA 4IDCA 5UKDA 3WWDA 2WNIA 2I55A 2PL1A 5C4GB 4COOA 1DXOA 4RXMA 4FHFA 1ENYA 3OJWA 2RI1A 4BUZA 3BK1A 3KPYA 1PT7A 1RABA 4H7DA 2QGZA 3LNTA 2X8BA 3R5SA 2I5PO 5TPZD 3KT8A 3SZOA 3EAGA 2RHBA 2D7JA 5A05A 5IJ0B 4B3SB 1RZVA 2NU9B 1Z26A 1DAFA 3QUAA 1OIXA 2HQ1A 5JW6A 3IO3A 4WDRA 1K7SN 2FR1A 3DAYA 4IDDA 1GUFA 1JLSA 1I6LA 1YVEI 5C5IA 1GTMA 3R77A 1IMOA 4U2BA 3RS5A 3HZRA 1O94C 3EQ8A 3SSAA 1ZH6A 4RD3A 2EU8A 2QI9C 3CSUA 4GSKA 4IMIB 4KWHA 1ZXXA 1NXWA 4MS1B 4RIFA 2R68A 3QELA 4WHMA 4H7FA 1HFKA 2OV8A 4DSNA 1ZW6A 2IU6A 4RK4A 2HF9A 1QO7A 3JW8A 3OM8A 3Q98A 3HCNA 4NONA 3DZIA 1LSJA 1QGYA 3RU9A 3DTVA 5BSFA 3HBMA 1OVMA 5KYGA 5LWQA 3PFCA 4HPXB 1TYAE 4R1UA 4GO1A 5AM5A 2PX0A 3QFFA 3H1AA 5CFPA 4H7HA 2VDLB 4EJSA 3A9RA 4NCAA 1UPUA 1W46A 2B0JA 2NZYA 2V6IA 3PENA 4WNCA 4B81A 1A9YA 1RM5A 3V1UA 1VHLA 1S7CA 1QVAA 2CFTA 4CNQA 1OU4A 5DYYA 1VBKA 2OP1A 5C80A 3IAFA 3INNA 4PC6A 5FI3A 3VOBA 1C2YA 1NR1A 2EC5A 2IY8A 4X1IA 4FGWA 1HORA 5IZCA 2OPBA 2X41A 3DYBA 3O1JC 1YBFA 3AEQA 3GI1A 2KI5A 2QG6A 3ENKA 1JYFA 1IHDA 4AQDA 2A9VA 2I4NA 1KO8A 4WJLA 3EG9B 5DI3A 2HQOA 5EWLA 2I03A 1DHRA 4AMUA 3WHKA 4ZEVA 5A5FA 3RC9A 4PQRA 2FMTA 4HN9A 1KEUA 2GBPA 2ODBA 4PHHA 1P5RA 3I2KA 2JLQA 2FPSA 3BD8A 2X1HA 1JDVA 1IEXA 3GJ3A 3KKMA 3HA3A 1AX9A 1TUEA 3DKVA 3OM1A 1M1UA 1XE3A 3KJNA 1MJHA 5CLHA 2OK7A 2ZIUB 3VR5H 1FFXB 2MMCA 3K0HA 1B14A 1E4EA 2HEIA 4IJVA 5DGHA 3TWOA 1N2XA 4C4TA 3I9MA 2V5UA 1J9GA 2DWQA 3TKAA 4FR5A 3HYCA 4N47A 2O14A 4GPD1 5E9QA 4ZICA 4UC0A 4RGQA 3PBKA 3DPIA 2PRJA 1KO1A 5DV9A 5IJ9B 3OZVA 3NANA 1G5RA 4MUGA 4QREA 3QUCA 1Z2AA 1HE4A 1IK6A 3KUKA 1QVZA 1Z0IA 4W9NA 1YCHA 4CLOA 3I8OA 3K8QA 3DHVA 4EKNB 2XB2A 1U7ZA 5DM4A 5KX5B 5BQ5A 4DLXA 2FPRA 2O8DB 1EX1A 4U02A 1UZLA 4WGFA 5A62A 3TSWA 1DO8A 2JD0A 1R0BA 1JHUA 4FZ5A 4GKBA 1QGOA 5IFKA 1O8BA 3U4DA 2WU3A 4PSKA 4MA4A 2CDBA 3K20A 1E77A 1COZA 1TZBA 1V0JA 2AF4C 3KDAA 4N8DA 3UBMA 5CFNA 4UHKA 4QT0A 5ALDA 3UK0A 1RJFA 2ZIXB 3OT1B 3IEVA 5CVEA 4P36A 1SU6A 3AY7A 3GPCA 1ZHHA 3DTVB 2C4TA 2HXSA 2VYCA 1R0LA 3CCBA 2GCOA 4WFIA 2VTKA 4XJVA 3VDNB 4B79A 1XO1A 5JMWA 2P3QA 5KWSA 1KF0A 1BQ3A 3WZMA 3B89A 3E9YA 2FZKA 3C39A 3CB4A 2GDZA 1B8PA 4MW0A 4LYFA 2UVQA 4NBVA 2JAUA 4IQ4A 5BV1A 1AK1A 2L69A 3DDSA 3HPRA 2KYRA 4JT2A 4C04A 1E4VA 4DB2A 1IHOA 2BGIA 4JB2A 2Q0SA 3AVPA 4X7RA 2P2YA 2XYQA 4MEJA 3ZWBA 1GGKA 3LA6A 2I34A 2O52A 3NMUF 2IZ5A 2XUOA 3GUVA 3MRSA 1RZUA 1PQYA 2BFEA 3G0OA 3PT9A 1DJQA 1U7PA 2EFJA 3FYUA 4Y6PA 2ARKA 3ER9A 1VL6A 3COSA 2B6NA 1Z0KA 4MVCA 3SP1A 2J8ZA 1ZINA 1NXSA 1RWBA 3K70B 1D4AA 2G3YA 1H3FA 1WG8A 1XNJA 4IFEA 5AICA 3VRHA 2CCKA 4RELA 3IPXA 3NDBB 2Q2OA 3D59A 2XDYA 4RD1A 3ZN2A 4X60A 4MRPA 1KKLA 3DMTC 4LOHA 4C4PA 5H68A 1OUMA 5FPPA 1POXA 2ILTA 4R4JA 1JZSA 3Q3IA 1H8EA 1FTSA 3CTMA 3TG2A 2A9FA 4J7AA 5M7EA 5C81A 3SN6A 2H1OA 3MMXA 4BNHA 1RNLA 4EW1A 1TRHA 2QZZA 3NC4A 5DTMA 4B3RB 1UBCA 4GLOA 5C37A 3MUOA 1V8ZA 5JSKA 3GLIE 1AGNA 1TF2A 3EHDA 1U3TA 1HZZA 1TI7A 1E9SA 1FQOA 3GT7A 4URFA 3MILA 4URVR 2FJUA 2XQGA 2GRJA 2LWIA 1PL0A 1FTYA 1NMSA 5F73A 4S24A 1DDOA 5C52B 4C5BA 3BPSA 2XQKA 4Q05A 1MQ9A 3TYXA 5ESRA 3VMMA 3DDHA 1VKJA 4D4IA 3LGSA 1OV6A 1WMEA 1P80A 2AXEA 2II6A 1MGOA 1NBEA 2QE7A 2V4MA 1UKAA 1QFZA 3PD0A 4Y6GB 3OF5A 5ECGC 5K0EA 2CXNA 5BOSA 1IHPA 5IXYA 5C9ZA 2F4VB 2E37A 4KQGA 4RL4A 2YMQA 1YQDA 4I8DA 3LSYA 3FZEA 4BKQA 1WP4A 5BURA 1YRLA 1ZG3A 5DGDA 4B33A 3BHIA 2O59A 2G40A 3U3OA 2DR3A 3W7BA 2RKOA 2G71A 1YMVA 2ZYDA 5A7GA 1YHZA 2XE8A 2I3ZA 1JVNA 2XGMA 3L7LA 2QZSA 2JI6A 3ESDA 2VAPA 1C2TA 3Q8XB 5SYNA 3VSBA 4M0DA 1Q1NA 3H75A 5K8JB 3JAWB 2YOGA 2IP2A 4C7KA 3BAFA 3ZCTA 1TJPB 4NOMA 1PK9A 4L02A 3THWA 4C29A 2LZ0A 4C89A 1P9RA 4MQBA 4QYTA 3KQTA 1BOOA 2WSIA 4FHZA 1PZHA 1ZM3A 3INTA 1SKUA 3RRYA 1AHPA 4WKBA 3TFWA 3NP7A 5EGSA 5HBRA 3GJ4A 4FX2A 6AT1A 5CDFA 5G4KA 2ZPTX 1XRSB 3K8YA 4V38A 4C5CA 3IUEA 2R7MA 2FK7A 5SZKB 3VU8A 1FZTA 2ISCA 2RHGB 3CLRD 2O6HA 5AJZA 5G0WA 1IG0A 4CTOA 1RC8A 3IQDB 3EBPA 2IYWA 4KQCA 4Q1FA 5GV8A 4IDPA 1D2EA 4GXNA 2J4DA 1L7EA 3NETA 4Q7JB 4WMLA 2D1YA 2J0VA 3K5HA 3PPIA 3MCWA 4M7WA 4MRMB 4YRTA 4B3XA 4WT7A 2WD8A 3ZGNA 4V03A 1RRMA 2PV0A 1U1DA 1D0IA 2DFDA 4JFAA 4OATA 1D1PA 4UTXA 2BRUA 3L7CA 2JBAB 3F3YA 1PWXA 5IKOA 2PRYA 5CDHA 1ZGBA 4FT2A 2OBXA 4LQCA 1H2BA 4NYIQ 4QDZA 1IIRA 1F2UA 1SHLA 2TMYA 3ADPA 1Y6FA 4JI8B 1WL8A 2IIQA 3GLQA 3IAM1 4G97A 1NQTA 1QBKC 4GLFA 4IF4A 4L3WA 4R2MA 2QP3A 2YFYA 2JCVA 2POCA 3A4LA 1IWOA 4JJ6A 2OCPA 3UHFA 4I08A 1C9NA 4HX5A 4MWOA 4Y0NA 5FWAA 1QYIA 3ZHXA 4D02A 1A82A 1CE8A 1NATA 1J1UA 4IIEA 1L4KA 3BILA 4KQHA 1JE0A 1IN7A 1C8LA 1FDUA 2ODWA 4DDTA 4P4UA 4BFLA 1IZZA 5ITZA 1KERA 4I55A 3CO5A 4ZDJA 2CN1A 3RW9A 3ITKA 1C7JA 2XKJE 2B92A 4IDFA 4ILEA 1TEZA 2PLNA 5EWJA 1XZQA 2ZAMA 2HFJA 3IVCA 1ETHA 2HWUA 5HK9A 3OQBA 5KI6A 1UXKA 4TVKA 4X6UA 4IXWA 5J9FA 2ZCJA 4D4MA 1RAAA 1KHTA 1K7EB 3KJQA 4S1OA 1G5HA 1VE1A 2XLBA 1CXZA 5CAEB 4OCZA 2JHGA 1U9ZA 2GZ3A 3MC1A 1FP4A 1E5TA 4R1NA 2PLAA 5A0TA 4Q4JA 3B3GA 3DGEC 4W8OA 3BFJA 3BC1A 5SYAA 1FSSA 1QR2A 1U2GA 1YBVA 1Z5NA 4DARA 1W25A 1B6RA 3DVQX 5C8DA 1SG6A 3O26A 4DM4A 3KUDA 1Y5NA 2UXDB 1Q1ZA 1P9WA 1U7HA 2HCRA 1T9HA 3OZBA 1ZN2A 2QD5A 4UZEA 2EWWA 1YB6A 2WYIA 2F3PA 1V3QE 1NNLA 1M6EX 4EG5A 4AKGA 3NHWA 4MWBA 2WDZA 3F73A 4AY2A 2DSTA 2FH5B 2D5LA 2FOIA 3GLRA 1KQ3A 1CIJA 1VYUA 2PZFA 4QGAA 3A4TA 1GKUB 3KJEA 1VJTA 3U4MA 3RHSA 3A1SA 3UB3A 3NHRA 4J1TA 4OM7A 5HCNA 4FKZA 1NY5A 2W8BB 3GFVA 4ZT2A 3VPDA 5AI9A 3HK2A 3S2GA 4LCBA 1GNTA 3RFVA 1MJGM 1UKYA 2H2GA 1DIRA 5ECDA 3ACCA 1SHTX 3WI7A 4X6XA 1BEUB 4PVDA 5HMLA 3RGGA 5GTDA 2Q3EA 5LQRA 4KK4A 1H4SA 1RCTE 3OQNA 3WO0A 4C9BA 4CM8B 3B3JA 3TIGA 3FWHA 4LGMA 4YV7A 2NTEA 4KHZA 3NT4A 4MCAA 1JHQA 1Y3AA 2WUFA 4LRWA 5BRAA 1N7GA 1S3SA 3I1YA 1KZYC 3IHKA 1EAYA 3TK1A 3N8DA 3CH5A 3B2QA 4G1EB 5DEIA 1OTYA 3WMXA 3CG4A 5GJVC 2OLKA 4D82A 5LQNA 3W6ZA 4GQBA 2CD7A 1QHYA 3V8EA 4CE6A 1REQB 4JCCA 1BW9B 1R37A 2Z9CA 4OFZA 1KMNA 1AVTA 1XWIA 2O3SA 3FPAA 1GPLA 2BHSA 4NOJA 4PLVA 4E3WA 4AIIA 2FSUA 5GONF 2MHCA 3FB1A 2JS7A 1LLCA 5CITA 2O3JA 3X44A 5LYJB 3I6BA 2X15A 3WWOA 3I9NA 1I4OA 2IPNA 5J2UA 4ZHSA 4KUHA 3U48A 2QE6A 2IH5A 2QMUA 2ECOA 3L5OA 1RLTA 1TQ6A 1WEHA 4TTTS 1QRTA 1NM5A 3PGVA 1ZM9A 1PGOA 3O1HB 1KI3A 4ZQBA 1ISSA 4MZDA 1WCIB 4DCOA 3GAAA 4C3VA 3TUIC 4DMUB 5DIFA 3BMCA 3FPSA 3PGMA 4PYMA 3UWPA 1OE0A 3A2LA 4AJHA 4UU0A 1YCDA 5LP6A 2QX7A 3ILXA 1G2PA 4ENVA 2HLDA 2H9AA 1FFYA 4BGUA 1MOSA 2XUGA 3M0EA 1U2GC 4YV0A 3HB4X 5JH7B 2JFPA 3Q8LA 1UJBA 5EFOA 1SZCA 3M49A 2DH6A 1N2JA 4QM7A 1KI6B 2ZXFA 3RRJA 3AEQB 3OE1A 1GVHA 5K0LA 4BQPA 4PSUA 3PFIA 4ZTBA 2IYYA 1WZEA 2PLWA 5GVRA 4MWGA 5CX1B 4BLVA 3KQHA 1NUQA 1WD5A 1OFIA 1FFSA 4JELA 4DUZB 1OXXK 2JAPA 1X74A 3E22B 3I6MA 5BQ3A 4FE3A 2GN4A 2EVWX 2YIJA 4FBLA 1HI9A 4MUKA 1H0HA 3UJDA 2IU4A 1RYMA 2AKYA 4JJ8A 4R68A 3V55A 4DTIA 1J9ZA 4I36A 1E6EA 2FPGB 3ZXYA 5EZSA 4HZUA 2FVYA 4OV6B 5BN4B 3QA9A 4M87A 5BT9A 1UQRA 2C3OA 2VPIA 2ZYTX 2PD3A 4XQ9A 2XRYA 1N2BA 1X0XA 3H3FA 1YJXA 5DYWA 4CJXA 2BFOA 2LCIA 3DE7X 3TEMA 3CEAA 4EEXA 5K4GA 3ZUGA 4UCQA 1KZ9A 1P5JA 4E5VA 4HDKA 4H4EA 4LRUA 1K27A 2W0MA 4K40A 2Z56A 4MSUA 1YL7A 4BMXA 4M76B 5FBWB 4WNAB 3NHJA 1IM5A 4K88A 5BMVB 1U0FA 4GGPA 2GPJA 5FLEX 4J0IA 4A6DA 2WINI 3PT5A 4BAGA 1QE3A 2OO3A 3K0AB 1PFVA 1JAIA 4JDPA 1XDZA 4MMZB 4ZDIA 1H2WA 1E79A 1I1HA 3SYMA 2IW3A 5CDSA 2RGGA 3BS4A 4QULA 1O96B 1AHIA 1C0LA 1UADA 1UEXC 3C6KA 3L1UA 5CIQA 5A7HA 3UGKA 3HJTA 1ZRHA 2WD9A 4C6HA 5C18A 1IBLB 3STUA 3AP3A 3O74A 3IPRA 3LPLA 3TTYA 1NDQA 3JQBA 3ZE8A 1NFQA 1Z0AA 2NVUA 1JU9A 4AF7A 4JUAA 2D06A 2Y99A 2ZRFA 3EYAA 3RAFC 1U7UA 3DQQA 1G4HA 5ALJA 3UGJA 1NUSA 5A6SB 4QBIA 2WWHA 2ZT5A 5AVWA 2YJZA 2PJRA 2ZYIA 4KI0A 1OSNA 1G6OA 1HFEL 2AMYA 3BB1A 3I9V1 2VDWA 3O8DA 4ZV4A 5K9ZA 4HDAA 5IP5A 2ZAYA 1KZHA 3D1VA 3ONVA 2N9UA 5MFPA 5BO5A 1OJ7A 3W5SA 1RHMA 4C7OB 4F71A 1R66A 4I55F 4Z9AA 1K63A 5HIJA 2PUVA 4MPRA 1SK8A 2YYSA 4FNAA 4N65A 2X0DA 3WGQA 4S1VA 3AVQA 2ZZMA 1TEHA 3VAZA 4LQDA 4ZVPA 2AWNA 5L40A 2IBSA 3QEBZ 1GUDA 1YGPA 1GILA 4EI2A 5ARCA 5EMLA 3MCTA 2AL7A 2QTWB 3SCZA 3DT9A 1UOEA 4BKPA 2VUSA 2HWXA 3TB6A 2BMWA 2JCYA 3UMFA 4JAVC 1XEFA 2D0OB 2DU8A 2XVAA 3BFVA 1J99A 2QUKA 3KL2A 4S1WA 3V33A 4JYAB 3MBKA 2XDQA 1QB7A 4B83A 4ZVNA 5CD9A 2BTOA 1T0PA 4W9MC 5FTWA 3K9WA 4BQFA 1NW6A 1B7GO 4OXNA 4WKCA 5CCDA 4IOKA 5IH3A 3U7FB 3ZX4A 5E1OA 1CRQA 1AE1A 1UT8A 3M3DA 2K7FA 5IBQA 1RQ2A 3I6IA 4JR2A 4INOA 2JZCA 4NFYA 2XCTB 5AK6A 3GNLA 1XMVA 3DUFA 4OREX 2CZGA 4Y1GA 5EZYA 4YRBA 4P0PB 4LZOA 1XPOA 2GBGA 4J1TC 4NATA 4HS4A 1N1DA 3PKZA 2P2GA 2AKEA 3JWIA 4CR8A 3O90A 2YASA 2YYYA 1IXRC 1Q84A 4BQSA 4A5SA 2JW5A 2CT8A 4BPBA 5EMMA 4QUHA 4LRXA 1WDTA 1I2MA 1UKVY 2HSDA 3IPCA 1EQAA 5DRTA 2C78A 3I2JA 1DXQA 2XI4A 2WK1A 1GQSA 1QS0B 2YHAA 4NECA 2AKAB 4ZI7F 2H1RA 3RSCA 3V7WA 4R7TA 2V8OA 4J0QA 2QT9A 4DABA 5JWOA 5LLSA 1G21B 4XWKA 2G4LA 1G8SA 2I91A 3L4SO 3HNPA 5IAAA 4QXAA 1Q11A 3DBHA 3O84A 4DEYA 2I8CA 4GM4A 3GMSA 5FTLA 4QEKA 1IM2A 1YHNA 2CLMB 1P3JA 2NW6A 2P0AA 3QTBA 5IARA 1KTIA 4EYOA 1JQLB 3TNFA 4EJMA 2FFRA 1S89A 2XV1A 4UFOA 5JAHA 1NHGA 3GVIA 3NHSA 4PLZA 2CKDA 3WOVA 3VZDA 2JLUA 1N36B 2JFXA 4G8DA 2IUEA 2WWIA 4IYJA 1T2FA 1QIKA 1YS4A 2DUUA 1M7GA 1NP6A 2ZGVA 3JAKB 3PA8A 2FRXA 4DCPA 2EZUA 1TL7C 4D9JA 4MZXA 1WMAA 5FUYA 3TMKA 3I76A 3MGCA 5LZ2A 4I3GA 3KTOA 1GWNA 2VWHA 5DF1A 1GQOA 3MNFA 4MQFB 3BREA 4GWLA 3L8CA 1M6VA 4BWYA 1OJLA 2PGOA 1R27A 3MCVA 4LXIA 3ZDRA 4XA8A 3F6CA 4MLDA 3IT3A 1DEOA 1PZXA 1HRKA 4L6CA 4AN1A 1BXGA 3TW4A 5LMNB 2GHIA 2EZTA 4L75A 4N48A 5IAEA 1QHIA 2MR6A 3I2HA 3UMGA 2IYNA 3VKFA 3QXSA 3MBIA 4YCBA 2HR1A 5BQPA 1LI5A 5HX7A 1N57A 2GJKA 1DTWB 3QLJA 3Q0EA 3RANA 4GLBA 3EE6A 2IPLA 2ZJBA 4JUDX 3IT1A 5BWCA 4A8TA 2B4YA 2FZGA 2OYCA 1ZMOA 3K4PA 2P6OA 4I7EA 4B5LA 2JB9A 1QHHA 3K16A 1O87A 1FDSA 2C94A 4MJ7A 5GJCA 1IHUA 3HCCA 3WBBA 1R6XA 1DAHA 4PM4A 4DMHA 4YPVA 4DUYB 4CDMA 5WRFA 1RJ9B 4EB8A 1BD3A 4JUIA 2UZIR 4HNHA 5FDFA 3X43A 1EKXA 2QZ4A 3DL7A 4JB8A 1LCIA 5JAUA 1Q0SA 1SWWA 1LDNA 2V9CA 1BE0A 1N9ZA 2R00A 1BAPA 1KI2A 2OMEA 3O2NA 5BMOA 3AKZA 4UDNA 4K03A 2J6HA 3UG6A 4A8JC 4JV5B 1GU1A 2DOKA 3VOAA 3BJRA 3EFOB 3I9JA 2EYQA 2B1QA 2OFPA 1E2GA 1Y8RA 5REQA 3OWHA 1J1ZA 3PNLA 4KTVE 2IV3A 3OFKA 4MGKR 3DHWC 2DFNA 3ENQA 1V11B 2XNKA 3LD9A 3OMWA 1XL0A 3G17A 2J9XB 4UTRA 1XJ0A 1KC1A 5F98A 1R8YA 4G6ZA 2CD9A 2XWPA 2ZBRA 4RHFA 1AC5A 1XZIA 5BUQA 1UXHA 3VYRB 1DU4A 1ONOA 4PANA 1FDIA 3PWSA 2G9NA 4C7JA 3K71B 2IVZA 4WLFA 1L5LA 1VZ2A 4YXFA 5K0FA 3VR4D 1LNQA 4B3BA 4II7A 1XRMA 1P4RA 1WZNA 5HM8A 1L3CA 1AV7A 2QTAA 1ND5A 5LDDC 4NYJR 1X7HA 3STHA 2CMGA 1HE8B 4NYIR 3G0IA 3EDYA 3FOEC 3AI7A 3P0EA 5G4KB 4C30A 5HFJA 2IPXA 1N4AA 5TMPA 3VNAA 5T5QA 2ZYSA 5A5GA 2LP4Y 4OFXA 4HSEA 5CVJA 1YL5A 1Z18A 2LTAA 2RH9B 1X7GA 1R6DA 4MP3A 4N5LA 2XH8A 1GL3A 4OGWA 4HQFA 4MEAA 1WXXA 4QFDA 2NO7A 1EUZA 3W8EA 2NT3A 1NNI1 4Q1CA 4ZIRA 4B6FA 2YFHA 3LWZA 1VCHA 3HRHA 3TB4A 3WGLA 5L95A 5TB5A 3RJ5A 1NVGA 4GPIB 3ZHSA 4G5QA 4FB5A 3N2GB 3QX8A 3FMVA 4ZYLA 1OLUA 3EEFA 4EUNA 1Y80A 1C4OA 1F6DA 5B58T 2JLAA 2VQDA 1SH7A 3AONB 4XWWA 1F4LA 3IJPA 1T3TA 3QXGA 3Q3GE 4K2HA 4PLWA 1ESEA 2YCLA 4IRUB 1EGHA 3VR4A 4HYQA 4E1AA 5AKHA 7AT1A 4RXTA 5AHRA 4BNJA 4ZEMA 1L9KA 1A9TA 1QC5B 3DD1A 4LYDA 4OHZA 4BO0A 2WF8A 4AMYA 1GN9A 3QVLA 1K9VF 1XHLA 5TGTA 1FNSA 3DNMA 1W4ZA 1S2IA 2ENWA 1E96A 3D8NA 3GDOA 2RCNA 3E84A 5EESA 1FCJA 1KAMA 2OILA 3LGAA 1X2BA 4J6FA 5NLLA 2DHCA 4I1VA 3ZV7A 3E23A 3ENZA 4EX6A 1L7PA 4RKYA 3MRVA 4NDZA 2FX3A 3K09C 1L5HA 1WDKA 3IUQA 4P7FA 3FVVA 5EMJA 2DYKA 2X5OA 2H1CA 1TKRA 4NARA 1QIMA 1TVCA 4RZ3A 1CYDA 2FUEA 2PUGA 3P7MA 2HX1A 3UPUA 2XQJA 3LCMA 4HB2A 4I19A 2IUSA 2CHUA 3GDHA 3U19A 2EQBA 2J7PD 2QJFA 3LPAA 2DFKB 1XLUA 2CUNA 4GX2A 5AKEA 4C0SA 2NUTA 4CMIA 2PSHA 1JWAB 3AUJB 3I1JA 2ZITA 4MARA 4NZPA 3RVKA 1JR3A 2B8EA 2AJ8A 3HSYA 1MG5A 1QHNA 2WWVD 3I73A 3RO7A 2H31A 6REQA 2DPGA 2I7VA 2WIFA 4MLZA 3T7AA 3TZBA 2CXQA 2GN0A 2VLIA 3VR2D 1XQ1A 3CJQA 1ZL0A 1RBMA 3M4YA 3GK3A 4LCJA 1T24A 5HNKA 1T1GA 4O2AA 5ALYA 2OO7A 2HJ9A 2E4XA 4ARBA 4GX1A 2VPQA 1N6IA 2RGRA 2AFHA 3HP4A 3AY0A 4NZ9A 1YJ8A 1SG0A 2CJYA 3MHTA 2XB4A 5MGNA 3PUHA 1ZK4A 2FETA 4DMRA 3LSTA 1JKIA 1UT6A 1NNSA 1U0JA 3DMHA 5LB4A 4DHEA 4ABTA 1DCTA 4UHEA 2IUFA 1VJ1A 3L7BA 3KTDA 1UPCA 1R9NA 4JY7A 1MJFA 1E0KA 1VCOA 4YO8A 1BFDA 4CUJA 3IEUA 1EK5A 1VGVA 2RHTA 2ZWIA 5FPYA 1GSIA 3FSRA 3G6KA 4PG5A 4JYBA 4QFMA 1CIPA 2F3UA 3F6SA 1VLQA 3DE4X 4HX2A 4U1RA 4E21A 4E5KA 10MHA 2G88A 3AW8A 2NTNA 1C3LA 2Y1KA 2FZWA 5E1MA 5PGMA 5EHXA 3K9CA 1JH8A 5C0OE 5BV2P 3UOWA 2R48A 3L07A 1KKMA 4G86A 1OZFA 1VB3A 4DE5A 1U98A 1RDFA 1UQTA 3LUCA 3U56A 2ODPA 1G1AA 1ZBDA 1A3CA 2G0NA 2W9XA 3A26A 3AWIA 1XU9A 3DB2A 4X93A 1SVLA 1V8FA 4J16A 3TRIA 4JLPA 3L6CA 1N0HA 4MVXA 3NOOA 1HV8A 2GM4A 1ADCA 4P35A 5COBA 2HH9A 2FF7A 5JQGA 5G1NA 2ECKA 4CFYA 4GVLA 1FFXA 4C0HA 1CQWA 1P2VA 1QF6A 3KOXA 1HMYA 3CWZA 4Q6WA 5LU8A 4J9VA 4RLFA 3WHIA 2GJAA 1IG3A 1L7AA 1MFPA 2CDAA 2YXNA 1SVOA 2ZSAA 1MX1A 4R54A 4XUGB 1DKRA 3WY9A 5I7VA 5JJLA 1TO1E 2Z98A 3TCNA 4D97A 4PIVA 3TJMA 1DO0A 2JLYA 1KZ6A 4MR8A 4LYYA 3BWXA 5T4FA 4M2LA 1UZMA 2JRLA 3JZFA 3FFBA 1S0UA 5LJLA 4Z9FA 3N2NA 3DMGA 4D96A 2YZNA 4Y6SA 2ZEJA 1DAIA 1E0DA 3STWA 1PSZA 1IXKA 3UXEA 5HUQA 2F8SA 4C1NA 3IP3A 1R12A 1WXFA 1EXNA 1KRHA 1SXIA 2P2NA 4Q9DA 3HB1A 1J90A 3K9FC 4IO0A 1KI4A 1Y98A 1I2ZA 1A71A 1IN6A 1DAGA 1RAFA 2PVPA 3U7GA 4B82A 2P6RA 1Z83A 2RJOA 1M2JA 1O5TA 2VK2A 4O4JB 2RD2A 2A9QA 2QL5A 4X24A 4M7OA 1V9CA 3CNHA 4WERA 4KG7A 4G4IA 3QKUA 1JMYA 3REOA 2FXIA 2KWIA 3WYAA 5JECA 4J1SA 5TIIA 1ORVA 5CEEA 3LI2A 1TECE 3PXCX 1T25A 4K6OA 3TOCA 3KC2A 3CRQA 4WNAA 5FB3A 4Z3DA 4ZYUA 1IZYA 1OA0A 4C87A 1KK0A 2JEYA 5A5EA 1QP7A 3BCRA 3FBTA 4W6QA 2R96A 3SX2A 1DC7A 2Q4BA 4ZVUA 2DSNA 3TAHA 3S5UA 5H4GA 1ZAYA 2IHNA 3MWFA 2GTPA 1F51E 1H2XA 2YVQA 4HEA1 3PDIA 2PL9A 4MQLA 5INTA 1N2CB 2OAGA 3I1IA 4H31A 4XVQA 1YBAA 3HWSA 4OQYA 4R98A 1T91A 5CR9A 1N2EA 5KTNA 2NU9A 2WHEA 1J33A 5EEHA 4AFNA 3QYAA 4UQLA 1KZ1A 3OKPA 3H1BA 4GYKA 4ARZB 2GSDA 2JH9A 2VG8A 2QT1A 2ZBPA 4QX6A 3PITA 4Z4QA 3MSCA 2Z2IA 4JP1A 2J67A 5CLFA 1MV5A 4YBRA 4D8UA 2AOXA 3TQIA 4YJ2A 4QTUB 1JQ5A 3B7GA 1OC4A 2A30A 2VSFA 4KQKA 4CV3A 1MMFB 1YS1X 4RSMA 4RA6A 1B1CA 3LX8A 5EMNA 1XK6A 4WKNA 3F98A 3JATA 5ESWA 3QG1A 1PDOA 2QTVA 2ZK7A 1E5LA 1J24A 3GBVA 5TPZA 2Y0EA 3CZPA 5EEGA 4KQWA 4C3OB 2CDCA 1T2AA 1DAMA 3OEHA 4X8LA 2PUHA 4BKOA 2VDVE 1HSOA 4I5EA 1EG7A 3WKAA 5ICGA 1Q7EA 3B7PA 4YAKA 3DDWA 5JCJA 4Z4GA 3PDUA 1NVKA 2Q5HA 1ISIA 3DM9B 4FGKA 1HFJA 4G0MA 2REQB 4B6QA 3AY6A 5DGCA 1FMJA 1TMYA 2IYAA 3R1IA 1HE2A 4O33A 5D87A 3NEJA 1YV9A 3DNPA 3GJYA 2BVNA 3P2MA 5BSKA 5IK2D 3UWKA 3PEVA 1TCUA 2AOVA 3H8VA 3VI4B 1QCYA 1VIVA 5J4LA 3IMCA 1HT1E 1S8FA 2YHUA 5EZYF 1XVTA 5AJUA 4V0MA 3VVLA 4HLNA 2PIAA 3DKRA 4MOWA 5I7OA 3QZUA 3U5ZB 3M70A 2XIJA 5JATA 4OHMA 1QNFA 1KTVA 2O1SA 4WN9A 1XAJA 4IGIA 2QGNA 1FZQA 2H16A 1M72A 2PT7A 3PSAA 4KYIB 4L4YA 4PCVA 4QSHA 1Z8FA 3AK4A 4YJ3F 1G6KA 4GM0A 4YA6A 3PTZA 3V34A 1S1MA 1Y7PA 4YAGA 2A59A 5LIPA 2E4UA 4DAEA 2GPYA 1H94A 1UINA 3JTEA 5CLJA 3ZDEA 3BWMA 1XRRA 3T7JA 4KVZA 1JIIA 2CNNA 3DO5A 3KB6A 3IUPA 1Z0DA 4TS4A 1E9DA 4OGKA 2ZSJA 2HV8A 3ZG6A 2H00A 2Y66A 3DFIA 4URUR 1ZN8A 3SKXA 4D0RA 1E1QA 2FWJA 3PNVA 4EY4A 5KWJA 1G8HA 1XQXA 2RKWA 3EC2A 3ESAA 3FLEA 3D5QA 1RBZA 3DDUA 4DR5B 7MHTA 4OQNA 1R3UA 4FGSA 3KJHA 2NX2A 2C99A 3HCEA 3WQHA 4B34A 1SY7A 1R8SA 5KCMA 2J9FB 4KFTA 5JDIC 1JAYA 1XCJA 3ACBA 3TH5A 2F8TA 3AHFA 3KOYA 1KMMA 4YJGB 3AUUA 5BSEA 2FZVA 2CNWD 4BWFB 1GU7A 2F1IA 2G76A 5DLDA 5FQNA 3RNOA 4D9HA 1OIVA 3IHLA 1A0OA 4XARA 4FCCA 4C4XA 1L4FA 2LPMA 1TXGA 2EQ5A 2LD4A 1E18A 3BB4A 2MOKA 3BRCA 4LDPA 2QRVB 3KXPA 4ITRC 2C2ZA 1RWOA 4QXOA 5DMHA 4AECA 2HPVA 5JU6A 1HT2E 3R0ZA 3S2FA 4EHFA 5C4MA 1YF3A 1LLFA 3PQEA 1N2CE 4Z7JA 2XCRB 1CQJB 5DO9A 1Z5WA 2QLTA 5C7LO 2H92A 1FSFA 1YS2X 3GNTA 2P9TA 3KR0A 3HDJA 1ZPDA 4ZO4A 2IODA 1UAAA 1QG0A 1C0PA 1WSDA 3QK7A 4LPSA 4EI9A 3I62A 5IT9A 3H04A 3E7FA 2ZJ0A 4JBYA 4YRAA 1OVGA 5EGNA 2YYAA 4PC7A 5CG1A 2CUZA 2VJPA 3JRNA 2R2GA 4HJRA 3ZLTA 1KP2A 2KHZA 3GLSA 1ZISA 4RIHA 1KAOA 4UHHA 5JNTA 4YJFB 2PYDA 2GPSA 2HRRA 4BFVA 5HRCA 3L4BC 2BMFA 2VDKB 4Y1RB 4H7KA 3UV7A 3SEAA 3GA5A 1CULC 1E5DA 2F00A 4XFJA 3RJZA 1ONBA 3YASA 2GZ1A 4CW7A 4ER6A 3ZVKA 3ID6C 3N7UA 1Z63A 3U39A 1D6SA 4CMKA 2FCRA 3PTAA 3PUZA 4XM2A 4G5RA 3WSWA 2BKLA 5DYTA 4BL5A 5A4MS 4QDJA 1CX9B 1VHWA 3E4DA 2UYQA 2J5RA 3AEKB 1ZNQO 3H7IA 1E3TA 1ANKA 1JSXA 5E9WA 4MV1A 3NAGA 2QM3A 2IT1A 4WOBA 5E3JA 3CVVA 4PCUA 4Q3CA 4Q16A 4Q3LA 4EWLA 3LKDA 1GLGA 3K1ZA 4WXEA 1I9GA 2YJTD 2CV1A 2BDEA 4CXMA 1AK2A 2Y05A 4LPKA 4WASA 5A2QA 1FXWF 2A1UA 2CC2A 5BNTA 5CTJA 2AFIE 1JMKC 1GSHA 5FYQA 2ZB4A 1N9GA 2XIQA 2ZXUA 1QLWA 4HLUA 1DAOA 2AR7A 4X00A 3VISA 4UZSA 1FTNA 3BTSA 3GLFE 2P75A 3A28A 3IAM6 3SC2A 4H7EA 3ONNA 3PHBE 4OQEA 2G09A 3THRA 4FD2A 1B6GA 3BORA 3BRWA 4NOLA 2P1ZA 3OBIA 1RYZA 4DNOA 5DX0A 2YV4A 1SVSA 3BMQA 1PI3A 4MRMA 4PS0A 2YWCA 1X1CA 2N0SA 2ZS8A 3IP6A 1CJBA 3LMKA 3O7MA 1L5KA 3KSAC 3WTBA 4B3FX 5GWXA 4JI4B 1KI9A 2AD1A 1DC4A 1JILA 3DMNA 4ZT4A 1HQKA 2VUIB 4ARAA 4IZOA 2O2DA 3DE6X 3IPAA 4HFRA 5AW9A 4RY9A 3RPEA 1F0YA 5LP6F 2AK3A 1KK1A 1ZUD1 4IXDA 3V4VB 3D7SA 4UZFA 4TROA 2PX8A 1XRPA 3PWKA 2XOXA 4GMHA 3VC7A 4E5MA 3VZRA 1MQSA 2GZHA 3DOCA 2CJWB 3O9VA 4YB8A 4X61A 2Z08A 1VKRA 2P4QA 3X1DA 5HQJA 3F71A 3KKNA 1OKKA 1WY5A 1PNQA 2FP4B 1E92A 3QNWA 3GZJA 4ZT5A 4QUKA 2Z5GA 1K66A 1T1SA 5AXCA 4C6RA 3WBFA 4BX8A 4EYSA 1QZTA 2DTDA 4M9RA 4BNXA 3LUPA 3AM5A 3FX2A 1SD1A 3O2JA 4I4CA 4O1HA 1CRWG 3WZ2A 4A1FA 2AZXA 2F3RA 4A23A 2DFPA 3ETHA 3P32A 2WTAA 3NCHA 5EFZA 1ZGAA 3VTZA 2YMPA 5A4FS 3WQBA 3GROA 5F77A 3A7EA 1T1RA 2BGTA 1CIVA 1OB5A 3TS1A 3FZQA 3G82C 2XLCA 5AVSA 1CV2A 1ZCZA 2EW1A 2XY4A 1DUIA 1T5OA 1C80A 1W2WB 2AD5A 1XU4A 3DTYA 2I80A 5I9TA 1L5NA 4UVIA 3UJ9A 4CM3A 4ESHA 2H5JA 3KU4A 3QU5A 4ZYZA 1N2GA 1GL7A 5AM1A 2QROA 4KNVA 3AZOA 1QDUA 1NBWB 1VSVA 2WYWA 1WRBA 2REQA 2W2VA 2ZB3A 4HLDA 4MPPA 4DCMA 2D1FA 3VNUA 4U7GA 4JP8A 4X95A 5KYUA 3OX2A 3VVCA 5I3ZA 1J8DA 4QGGA 1TVEA 3SQWA 3F6PA 2SECE 3VR3D 2SKDA 3K1AA 3DYVA 5HOQA 3OZIA 1FJGB 1UC9A 3R74A 2HN9A 2BONA 3DL0A 2JJ1D 4IH1A 2EL7A 2M98A 1R00A 4BMSA 3QHAA 1AHHA 1JEJA 4NCXA 3HRKA 4JT9A 3CS3A 4L5AA 5AI6A 4Q9JA 4V2UA 3OWOA 4G5HA 5DLEA 2HBYA 4HGZA 3N74A 3QKSB 4CN8A 2HQBA 5DXJA 1TT7A 1G1MA 3H8SA 3QX3A 5KAPA 1KMQA 4QGHA 4YJ2B 3C7TA 2OV4A 3OURA 2AFVA 3DR3A 1VKNA 1YKFA 3SC6A 1EVYA 1GL6A 1VKHA 4Q3OA 3DZCA 1CUDA 3HCWA 4XASA 3Q0TA 5DM60 1A5ZA 5EIHA 5A3JA 2QMHA 1D7OA 5A9RA 3B5JA 4R05A 1H4VB 1OFUA 1UT5A 2C2HA 2P6MA 5CGQB 1YZLA 4JLUA 4EDFA 3M4NA 1EX6A 1U9JA 1IN1A 2IIPA 3PXUA 5DHAA 1SEVA 4QDTA 1MW8X 3K1JA 1ZRSA 1XPRA 1Y5RA 1ZC3A 2G7MC 1YCFA 3OQ1A 3D5TA 1EXWA 4WZAB 2VR1A 4DZRA 3P4XA 4ZEWA 3IP7A 2Q7OE 3QTLA 3T7DA 5JNRA 1KYTA 5K51A 5FPKA 1P19A 2BFBA 5LXTF 1N8TA 2INGX 1TTQB 1BX3A 3L77A 2DHDA 2B8WA 4U7JA 4YAFA 3ZC3A 4EBBA 1R4MB 4ALJA 2R4UA 2YJ6A 3S7ZA 3RB8A 3WB1A 3CUKA 5DLYA 3NB0A 3PXEA 3B1YA 4NEQA 4E4RA 1Z45A 1ZUNA 3D4NA 1MX3A 1P1IA 2PLRA 4F0JA 1EJ0A 2VF8A 4JHLA 3GJ7A 4RTLA 1CETA 1N6RA 1JR4A 1U0OC 2YYZA 4LGCA 5I5GA 4F6RB 5LP6B 1SIBE 2I3DA 3PHGA 4FGLA 4D4KA 4FYXA 5EPOA 1JR6A 1I2DA 1CZRA 4BFWA 5TMBA 1W76A 1WDMA 4GMDA 2QSYA 4KJZA 4EFDA 2D2IA 1JEYB 2V9ZA 4RE5A 3FJ1A 3Q7EA 5D3QA 3SIRA 4EG8A 1FLVA 2QXTA 1IEWA 4H15A 1XDWA 3RWBA 2C7PA 2G0AA 1Z4NA 3WGJA 4RLQA 4HUJA 5IJ9A 2EHJA 2DX7A 1Z6PA 1E9RA 1YASA 1KZ7B 1ETUA 3NWBA 3RH0A 5A9TA 1Q7TA 1E4EB 3NJ8A 2VHJA 1RRPA 1C41A 4XTRA 4YMTA 1Z25A 2FRDA 4S04A 4X44A 1BRMA 3OCVA 3H5VA 1H42A 4I55B 3NHAA 1ZH2A 1EJBA 1GNPA 5DP1A 3QLTA 1WV1A 4CIBA 3RADC 4JZKA 1M0WA 4P32A 2ZTUA 2G63A 1TC1A 4L8WB 3L6EA 4JJZA 1SBNE 2E4WA 2GJ8A 2FR0A 2J3HA 3X1XA 4DJDC 1EK1A 5FYDA 2IEIA 1IYZA 2PO7A 3QOFA 4AULA 5HP4A 1KYQA 1HDRA 1ZD3A 2FMKA 1M2KA 2NNLD 1SOVA 1V1MB 4HFJA 2FG6C 4TV8B 4F1WA 1QIIA 2JJ8A 3PQ3A 4B71A 2NZ8A 3BCSA 1ZNWA 4MLPA 3WO1A 4JBXA 3AJAA 2OO5A 3JTMA 1NLZA 3FDJA 4X20B 2WHRA 4RJTA 2DJ5A 1NASA 1QHSA 3LDFA 2CJXA 4PBSA 1GKLA 2GFHA 2YZGA 1ZN7A 3CPHA 3HU2A 3IE0A 2ZATA 2Y6VA 4LI0A 3ZCPA 4CGYA 2WM2A 2ZE5A 3IKTA 1JXOA 3R3JA 3H5OA 4RF4A 4XX0B 4NV3A 3N8NA 4U4AA 3GJZA 5HILA 2PYIA 4ZOQI 4H9GA 4IAOA 3PDHA 3R3WA 3IAUA 3ROZA 3EOAI 2WDPA 3KTAB 5IXSA 5IVDA 2C97A 1WTCA 2AEMA 2NV2B 3IPYA 4Z53A 2GVDC 3CJTA 1Z6ZA 4GUDA 5D2CA 1YA6A 3SWWA 1NI5A 4J1QA 3SICE 1F60A 1F8FA 1EVEA 1QO0A 2X86A 2Q8PA 4TWJA 6CHYA 4CNBA 3FM9A 3NXSA 1PNOA 4E46A 1HYBA 2NVBA 1P4SA 1G2QA 4S1NA 1RFGE 2YBEA 4UDXX 3U9LA 5JSQA 2PVCA 2OZKA 1SVIA 4V0ME 1Z2NX 4NENA 3KEQA 3KLBA 1XA4A 4EZBA 1UQUA 2NN3C 3Q9LA 4J8PA 5AIBA 1IZ0A 3REQB 1I4DD 3FKJA 3IBTA 3B6EA 4N54A 3RODA 1YR6A 4OB8A 3A9CA 3PQCA 3CUUA 4R5MA 3AF1A 4ERXA 1FQJA 3F7OA 3HJGA 4CGZA 5TEWA 1T6YA 3V1TC 1G3IA 2EWMA 2AYZA 1EVKA 3B51X 3CY6A 5U4XA 3TRFA 4BNLA 2Q5FA 4JB0A 5DASA 3TE6A 3HADA 4LHYA 2BFNA 1G2IA 2HSWA 2V6JA 2Q5IA 2GNOA 2X0KA 1OD6A 3D3KA 1Q1EA 3WLOA 4B2LA 4IIYA 5C4IA 1YULA 3NUQA 1BE6A 3SSNA 4DV5B 1Y9JA 4NP6A 4PLHA 5JI2E 5ETJA 1BS2A 3TLEA 1EX9A 4FVTA 2PSSA 4RSRA 1LDMA 1FDRA 1UFOA 2RSLA 1UXGA 1K8ZB 2VSNA 2LE0A 3JQFC 3Q3EA 4HXFB 3W2GA 4N41A 5J1SB 1YRHA 2IOFK 4EHNA 4L0DA 5GM1A 4MYDA 1NOJA 1PJLA 2DQYA 3G5LA 3G8CA 4U7FA 3D3NA 3I05A 1LW6E 1TCCA 2IA5A 4F3NA 4G9EA 3OQIB 1CEQA 4B40A 3OTOB 4BMPB 5G3ZA 1U8UA 3RSZA 2MTBA 5I9LA 2HB6A 1ST2A 1JPUA 1UDWA 4J0DA 9MHTA 1P72A 2Q5JA 5LSAA 1T10A 3EIXA 3REQA 2FFJA 4BKUA 4RH1A 3FYCA 3DHEA 1V9SA 2IHJA 2WWTA 3HG7A 1B0UA 4OUDA 3K1AB 4AJKA 3B3FA 3D7MA 1QIFA 3G7UA 2PPVA 1AMNA 1XPJA 2VJYA 3IYLW 4QU9A 1RYYA 4NG4A 1JB1A 2AA3A 2VHUA 5ICMA 3HU5A 2PLFA 4LVUA 2O4UX 3GPBA 4EATA 2QBYB 3U26A 1Z6QA 4O4IF 2NZJA 1F5SA 5EWLB 2X23A 4GDMA 2EFGA 2GJ9A 2CLCX 2PUCA 2DP4E 1USVA 3QMPA 1IB6A 4G0QA 2ZDQA 4JJKA 3IP8A 2D0IA 1N5RA 2ZUVA 4DQUA 1O6ZA 1NR5A 4D45A 3KLOA 4C0QC 1KPIA 1XT6A 1L4BA 1V4NA 2AUTA 2OQRA 4ZRNA 5B1SA 3UFBA 1LK7A 1P8JA 1SRRA 2DHEA 2C82A 3RYIB 1G5PA 3EUAA 5M29A 4JXXA 3HI4A 3K8OE 4Q1EA 5LZ8A 3TEJA 1N3IA 1PJRA 2ZRLA 4Z3OA 2NUAB 1WKVA 1WSAA 1KIAA 4ND7A 2YJ3A 4XKJA 3FB4A 3PHJA 3CKMA 5ILGA 3K6SB 4GKKB 3O4FA 5ES4B 2OWEA 3TX2A 2W98A 3R6GA 4PFKA 1DFIA 3SEQA 4FOTA 3I42A 1GXSB 3HYSA 4AZTA 3AL3A 3QFTA 1PTJC 2A1UB 3PG5A 1E6LA 1UKBA 3FDFA 3NONA 4PTZA 4ZA2A 3KQKA 1PZGA 3W34A 4DMMA 4D0SA 1HE3A 1VIYA 5B2FA 1R74A 4D74A 1ZR2A 4OH7A 3SBOA 3BMNA 2F1JA 2J31A 2XUQA 1FA9A 1PR5A 2VA9A 4IMJB 3HEAA 4KN5A 5E38A 1COWD 3ZDFA 1ZEJA 1J25A 2Z1DA 3KSUA 4DB4A 3GFQA 1QH9A 3PDWA 3GT3A 1KH2A 4FCVA 2C2YA 1FXUA 1U8XX 2PZGA 5J5CA 3TZLA 2JG3A 4OB7A 1JEDA 2N75A 5B1YA 3B1JA 5EJAA 2DR0A 3D6VA 4GBJA 4E4YA 4A8HA 4CMEC 2GD2A 3LBYA 4TWRA 4QBFA 5JSFA 4JJIA 1FFCA 2C2MA 3M5CA 1T0IA 3NIWA 1ZKMA 1IN5A 4HUTA 1JEEA 4OYLA 3F4LA 1RHKA 1I7NA 2R3SA 3GQVA 8ABPA 2CXUA 2PZ8A 2Z09A 3ESZA 1U9YA 2ZRDA 1O6CA 4OY3A 3M6AA 4OYHA 5DTEA 2AT1A 3FNHA 4Z8YA 1WCIA 2I9KA 1PYOA 3A8TA 2C84A 4LE0A 4DC9A 1XAGA 1NRXA 1Z5VA 1NXVA 1M6VB 1KY3A 4LZAA 5BWBA 1P7PA 2VSYA 3FCUB 3USZA 3GDWA 4LHZA 4KXFB 5FFNA 5K2OA 3BD7A 3AVUA 3IE1A 2FW6A 5SYMA 2XMQA 5FUXA 3I09A 3RWOA 1I7PA 1K5HA 2VPXA 1SKAA 4UUMA 4KWCA 1XTQA 2XBLA 1WMSA 1KY4A 1MXHA 4UUBA 1CEXA 1OLXB 3MWDB 4ZVKA 5AKZA 3PXBA 4MDFA 4JA2A 5TQ0B 4UMEA 3PXAA 1U94A 5EI5A 4A26A 3RARA 2NQ8A 3L06A 4MYRA 1ILEA 2FP4A 5LD2B 1CUBA 3WMRA 5C46F 4OQ4A 1GHTA 4AN0A 3FWZA 2VXBA 3TNDA 4UJ3A 1F4PA 1K5GA 3EZ7A 1DBWA 1M73E 2FN9A 5FNVA 2IHZA 1I0ZA 4QDUA 1C7RA 3HXPA 2ENUA 3ECAA 3TNYA 1JHXA 4OHOA 3ZWPA 3KZVA 3WNBA 2GPAA 3AESA 3NUGA 4XR9A 3GLVA 3GLKA 3NX4A 2G0TA 2QW0X 1V45E 1FJHA 2WUGA 1X1DA 4XEUA 1ONSA 2VOJA 3M9WA 1JL3A 1H8HA 3OJEA 4LBVA 3L0DA 4JKOA 5IASA 1SUBA 2ACVA 1QHEA 3LC7O 3FSGA 4A10A 1T2DA 5NULA 3QGMA 4O4IA 4CV0A 4AS1A 1KRXA 3SYKA 3G0BA 4FFSA 2IFTA 1QX3A 1ZI6A 1SVNA 1XALA 3I6QA 4ABYA 3SSOA 3QW2A 4DMKA 2O2JA 4FBMA 3ZLVA 3ETGA 2FMIA 2YWEA 4UM8B 2DULA 1Z74A 4X3CA 4B47A 1EWQA 2ZXEA 2BELA 1U3FA 3KELA 5AQEA 4O02B 3FOCA 1ZIPA 2DBZA 4KXMA 4A1OA 4W1QA 3CVXA 1U0EA 4CU5A 3N7TA 3UJ3X 1QP8A 2BFDA 3HCRA 2D7DA 4CEJA 1FBTA 5JISA 1H8ED 1NW5A 2H85A 3LFHA 3ZCVA 1O97D 3NHUA 3ZGZA 3HCDA 4G26A 1Q20A 3WDSA 1JR3E 1FMTA 1DRKA 3BTVA 2JFUA 3FSEA 3L8YA 4G81A 4P2GA 4HQNA 4P8RA 3GYGA 2J9FA 4R1LA 4EHBA 1DJMA 4RYLA 5KQPA 3QX9A 2NZUG 2HCBA 1F8UA 2I2CA 4JQZA 3B6MA 1JWBB 3PWZA 4QARA 4M9SA 4W6ZA 3VSEA 4UUAA 2HD4A 1PL7A 3OC6A 5CW2A 3MWJA 3RAJA 3IOEA 5JZBA 1G20B 4Z4EA 1D09A 4OLJA 3WKDA 2EXXA 5BVGA 4HH1A 5JDCC 3WISA 5KNBA 4PZEA 2X3UA 3QX7A 4LJ4A 3R9IA 1ODFA 4R1QA 4YT2A 1NRJB 2NUBA 3GVXA 2RKBA 3IQGX 4JH0A 4MV0A 3WMWA 5T3YA 3M3PA 1MP0A 2FWBA 1ELOA 3OJCA 4CWAA 4DLAA 1Y9ZA 3OU7A 2B4TO 5KINB 3HM9A 1GIAA 1NNUA 3HFSA 2VC2B 2JD1A 1P6UA 4G8CA 2AG8A 1P81A 2VHQA 2ZUBA 2BI4A 1GZVA 1MKYA 2Z6VA 3NBFA 2E2WA 3OM9A 3IBSA 1C9EA 4V0QA 2ODQA 5AJYA 3UVEA 4LJ8A 3K70D 1IHYA 2HZ7A 3GP3A 3VXKA 4MROA 1CKEA 3AIMA 3K6KA 2VN8A 2BI7A 1Y3HA 3HLTA 3K2IA 2BMDA 2HWYA 5EHZA 4LJ6A 4IXTA 2Z8YM 3DBIA 4G1VA 2C1ZA 2W2KA 3GN2A 3KLMX 4IUCS 3EH1A 4PSDA 2EGGA 1NVEA 3C3XA 1URPA 4YGYA 4JKYA 4HAOA 1T4MA 3ZNNA 4NFLA 5LOVA 5CT6A 5EKXA 1OHHD 3ZWDA 4D4LA 1G5FA 1HRDA 2ROQA 5ICEA 1EFRD 3C87A 4RTMA 1EFAA 2D7CA 2JBAA 3TW0A 1M5UA 1R7RA 3HU3A 3K9GA 1OASA 2YX1A 3D6AA 2B0CA 4FGJA 4LY3A 2JL1A 1EK6A 1PGQA 4S1TA 1GNLA 4PYOA 4ND2A 3HBFA 2GEJA 3V8RA 5JFTA 1OX4A 1TJ5A 3CRW1 4P54A 4M89A 2IF0A 3IS3A 5B12A 3QWHA 4TVBA 2Z2XA 8MHTA 1LBEA 2ZSDA 4NI5A 4IZHA 2IYVA 3KB8A 1MNQA 4N9QA 4S2UA 1MTOA 1X19A 4O08A 5E9AA 4ZI7B 3FHTA 2HSJA 3UGQA 3PK0A 4MGYR 1C3OA 4X1OA 4S0ZA 2C8JA 3K3PA 2VPTA 5EHGA 3ADBA 2GHQA 5I8ZA 2WBLC 4KGDA 3RJMA 4MUFA 4ARZA 5L7TA 1U11A 1F5NA 5DSXA 3JR3A 3LY8A 1G38A 3HU1A 1IPFA 3SFZA 1JQKA 2AN3A 4H6WA 1L9XA 2APJA 3X2FA 4BQIA 3AI1A 3DFZA 3A32A 5FD8A 4F5EA 2HJGA 4QSMA 1T36B 2C5FA 1Y6RA 4RZ2A 2IS1A 1FPQA 4YUVA 1GKIA 2A67A 3TLCA 3LF1A 1V41E 3NEYA 4NZYA 3WR5A 1CJUC 3DQPA 4URZR 2QR3A 3ZI0A 3I5UA 4LTDA 5IEBA 3FPKA 1RC0A 2XRZA 3QY0A 5HQ3B 3A7DA 2H4HA 2B7BA 3L79A 4H77A 1QXSA 5K3OA 2JGDA 5COAA 3F6YA 4B0OA 2BFAA 1QRSA 3RSSA 1P2TA 2HHLA 1WBBA 2O8VA 5JYDA 5KYXA 1RRFA 1VJDA 4N40A 5E4FA 1B41A 3MOIA 4JDUA 5TPWA 1HKHA 3A9TA 3NRJA 2CMKA 2J45A 4L76A 2CL6X 4LHSA 4PV7A 1JNYA 4E2FA 2WR8A 2NU8A 3T15A 1MVOA 2WTBA 3CUSA 4Z7NB 1RKQA 2DH5A 1DAPA 3RG2A 1VLHA 4JEMA 3LKVA 4X91A 1GDDA 3RFUA 1QWSA 3WL7A 1BJRE 2AR9A 2O3RA 1C8KA 2NXJA 3LOPA 1U5CA 3TSCA 5IXJA 4M0EA 3S4YA 2ADFA 3GC6A 2C03A 1LTKA 2X8JB 2R1TB 3AF5A 2GARA 2PG3A 3N2KA 1XOIA 2G5GX 2C8KA 4Q47A 4R2LA 1XHFA 1BJTA 4MRAA 1FVFA 1P31A 4JVNA 1XJWA 3U3XA 5HIKA 2PH3A 4J0KA 5F64A 1XZBA 5D5HA 1SKYE 4YLGA 2JAQA 4JGIA 4AG6A 5GY7A 2YRWA 2DBRA 4PLGA 3GLIB 3HN6A 5FUWA 2AN9A 3CIOA 4KO8A 4LEIA 5CURA 3FPBA 3NDIA 1IBCA 1VIAA 1XVLA 2HRDA 2H3EA 5BPFA 4LF7B 3COWA 5JAMA 4N3GA 1YOVB 3DDNA 3EG9A 1E1CB 2IP4A 1O3YA 4UJ5A 4YUZA 5B37A 6REQB 4KJXA 3PLAE 4DYDA 2GQ0A 5DNCA 3JQ6A 3MJHA 4O1MA 2PDAA 3LQFA 2AHRA 3QW4B 4RPIA 4UVDA 5KVSA 3USES 1R4MA 2Q5OA 1Q83A 4YQYA 4XJSA 4E5NA 1Y1PA 5ELXA 1YDHA 2QRHA 3WRXA 2OGTA 3FJOA 4RVOA 4YMIA 4B6PA 4OOEA 5FX2A 1OWOA 3AXTA 5K7SA 3EISA 3HN2A 4GR9A 1EDZA 2HNAA 3UY4A 3LHFA 2NPOA 3OTHA 4RCZA 3P4UA 5JYCA 3NM6B 3V7FA 2BN4A 3DDZX 2H7XA 2R8OA 3ETJA 1USUA 4XD2A 4RVGA 4LF9B 1RQGA 3V8MA 5KQMA 5MDHA 4K9PA 3PX2A 4L28A 3STYA 5T6MA 4BNYA 2H1IA 3BJEA 4IZ6A 4F04A 5D3KA 4QXQA 1ZMXA 5BVHB 1THMA 2E48A 3FVRA 3R3ZA 4N5DA 4DR1B 2JGLA 4G65A 4A16A 4E7OA 3WGHA 3NDRA 3LX5A 2SCUA 3UN1A 2UYOA 4P86A 3IV7A 4KN9S 3QLUC 4D9EA 1ABBA 2QRLA 2C77A 2R6AA 4GI1A 5IJ0A 3N5KA 2PKQP 1RWXA 1O95C 2DRIA 2Q28A 5LQDA 1NVMB 2OAQ1 2W4IA 1PTKA 3C24A 4H1WA 5I9MA 3I23A 2XVXA 3BFPA 4X1KA 3FGOA 4Y2UA 2DTXA 2ZPAA 3C6BA 1WKBA 4L8LA 4LJYA 2VP2A 3GLIA 2BKAA 4D2IA 2DT5A 2OVFA 1Z6TA 1AS0A 1E1DA 2BUAA 4AF8A 1I80A 1JDPA 3AV3A 5FL7A 4A2PA 2D4AA 4DDUA 2H3HA 4EFMA 3JQRA 3KPJA 4RVUA 3AF0A 2WOJA 5JXGA 5KYUB 4E6EA 3NBAA 4BQNA 4XPIB 2PGIA 4RIEA 2OG2A 3OSUA 3PR3A 4CL0A 4F2PA 3PNSA 4YNBA 1M8PA 1ZH8A 4DLZA 5F23A 1TF7A 2IXGA 3EA4A 4O29A 1THGA 3K0EA 3ZY3A 2A9OA 1BMDA 3CGWA 5KKNB 3HYLA 4RDHA 5KB3A 1Q1AA 3WVNA 5AKGA 3ZKAA 1FRQA 2HZBA 5F1OA 2M9MA 5I45A 4NKRA 5LA6A 1KI8A 1OT5A 2G8LA 3FAKA 1H0KA 5FAXA 1GEEA 3GCZA 2NTJA 4TMKA 3AKDA 2Z1MA 1JJ7A 2EJBA 2WU1A 2J6IA 4IDEA 4OJMX 1L8QA 2QU7A 2F67A 1V3TA 3WMEA 1EVLA 3UFXB 3KXIA 3CG0A 4OAQA 3KOZA 3UMMA 3B1FA 2J5QA 1KNQA 2XXAA 2IYOA 1E7QA 5J5VA 2N46A 4FU0A 5C8YB 1E2QA 1OLUB 1KDZA 1GD1O 4ZO6A 5F3DA 3JD0A 3RE1A 2W7TA 5EQTA 5CRIA 2CWDA 2Q8QA 3QBDA 2DQSA 4PWZA 3TQOA 1JLMA 1FNDA 1OX4B 3P9XA 3L6UA 3ZXUB 3JQAD 1SBQA 4RVFA 1ENPA 1V3VA 4RGBA 3UATA 4WKPA 2Y6UA 4IIVA 1SULA 3BXZA 3MS7A 3ZIUA 5FL3A 3HJHA 3RSLA 2C7GA 2ZRKA 3AHEA 4I3FA 1LZLA 2JFFA 1DXYA 4GKJB 4DW8A 2PXCA 3DZ8A 1T8WA 1UJMA 4IH9A 3W6NA 4RTNA 1Y1KE 2WQZA 2ZTVA 3RF7A 3B5IA 3LQYA 4RUKA 3FKSA 2A5LA 3O92A 2FZCA 4KUGA 2EF1A 4B46A 2FSSA 3CF2A 2A1TR 4CCYB 1BXZA 1M2GA 3CONA 3M6FA 3MLEA 1QIGA 1WD7A 1JDTA 3FCCA 5FBQB 4UVHA 4N12A 3TR0A 1NTRA 3OT5A 4ZAFA 2PAFA 8LDHA 1XL1A 2ETVA 2OHGA 1YIDA 1OH7A 2ZSFA 1I33A 4LXHA 4D81A 5J2TF 4TXMA 1GZHB 3HVJA 1NX9A 1YZKA 3KOOA 3Q7PA 2FCAA 4QVKA 3LBHA 5DGIA 1XNHA 1N8KA 1PV1A 1YIOA 1NHWA 4DJEC 2VUTA 2X76A 4B9EA 5B3JC 2XQFA 1LX6A 4MRRA 3EX7C 3GAMA 2H1VA 1J07A 3AF3A 4AMBA 2W5UA 4PU0A 5EHQA 2QUZA 1SZJG 5BQFA 3F5SA 2OSVA 5M04A 3BGIA 2YWXA 4D9MA 3LOQA 1VL0A 4DCNA 4PNEA 2YY7A 3QYJA 4ZC1A 3PV0A 4EQ6B 4NMWA 4MRNA 4URHA 1I5EA 2FX2A 1YRWA 3ZI7A 3W9SA 1UWKA 3SQNA 4AJEA 1J8MF 1TC2A 1TAGA 5AVQA 2CUTA 2WY2D 4XLZA 1RI5A 1OWMA 4JEHA 5EJIA 3EMVA 3MIIA 3JQCA 5SZHB 3GUUA 221PA 4ASUD 1I94B 3QITA 3PCRB 3UTDA 2R47A 3CC8A 4A9AA 1ORTA 5BSMA 2FF5A 5H0IA 3L1KA 3O93A 2UYYA 4EHJA 1WLSA 1ZW1A 2EJCA 5A1JA 3C3DA 1K98A 4QPZA 3OPQA 2XWSA 1X42A 1OKKD 3BH6A 4Z49A 3C43A 3OLVA 1QFXA 3IH5A 4NLLA 3UA4A 3MMPA 5CIWA 2BKEA 3FYSA 1CUYA 3FNBA 4BECA 5HGXA 3PNYA 4I1PA 4JYZA 3HJFA 3GGPA 1YZNA 5E1DA 3R7WA 2ZRBA 5DK6A 1XZJA 3ODPA 2CYAA 4Q9AA 3P0JA 4DLTA 5ALTA 5JAIA 4Y9SA 4KAFA 3FZYA 3P0HA 5HG0A 1QDLB 3ZU2A 1PTJA 1K3FA 1I4WA 1GGNA 1TQDA 4ZOEA 3ZZTA 4AJNA 1I2AA 3KYJB 3CGGA 3H99A 4MV5A 4QUGA 4L5BA 1U7XA 1WV0A 4RHUA 4FDUA 3WB0A 1VRWA 2X3FA 1GQFA 3EN0A 2DM6A 4NJEB 1TK3A 3EPPA 2IK8A 4YAOA 5I9NA 5I9IA 1IY8A 1NBIA 5KNCA 3ZHRA 4K0KB 2WA2A 2H48A 1JI0A 3IDQA 1S3IA 5BRJA 1HNWB 3I2GA 3TOSA 3LUGA 4CG3A 1Q7BA 4OHVA 4KXQA 1TU3A 3U0VA 3HBAA 4KYUA 3VPXA 1QH0A 3GH1A 5IZ4A 1OFUX 1EUDB 5JZSA 2HIHA 5B2ZA 1MN6A 4IHKA 2YNMD 5FOXA 4DDHA 2P6NA 2R1UA 3A6LA 2D5AA 4AMGA 2VEDA 4ZT6A 1R0RE 1RKUA 2KLHA 4JLVA 1KJWA 4HAWA 3IULA 3LY9A 1I7DA 1PCXA 2WT8A 5FIUA 4LISA 5CNKA 1BKSB 2WJZB 4JI1B 3W6UA 2BUCA 4JJFA 4YIKA 1G5TA 3D3WB 2LIVA 4JP3A 3WNZA 3ZE2B 5BYAA 1DIHA 4FLEA 2CVZA 1L7NA 3EGXB 1GM5A 3ZY5A 3WX0A 1UIMA 4UU8A 3VC1A 1J1IA 2FN4A 4MUXA 3U62A 2Y1XA 3L7MA 5FWNA 5DRYA 3R5HA 4IIDA 5FBHA 3JYQA 2WFLA 2Z30A 1MEOA 1PEAA 2HL6A 2Q3BA 1C4WA 2GAOA 4IL5A 4MP8A 5F7ZA 1KU6A 1IVSA 2IHYA 1LD3A 1XAIA 2WTEA 1I24A 2NO1A 3N3BC 1ODSA 1G8YA 4OPMA 5CT9A 4BV2A 3GEDA 3V4LA 3EQ9A 4TRJA 4IO1A 4LYEA 1JKXA 3BB3A 3PS9A 4O1IA 2YN0A 4MVJD 5FA8A 3QMVA 5JSYA 4JODA 4UHFA 4BNKA 4BVFA 3OQOA 1SU8A 1EP3B 3HQ4O 3CLVA 3HY6A 4DQ0A 5BWNA 1HG0A 2YC2C 4X1KB 1Z5UA 1T5TA 1U0TA 4Y1EA 1K3TA 3ULKA 2NM0A 4MVJI 1G8JA 2GPWA 4HN2A 4DYHA 5EJ4A 3E58A 3DV9A 3PGKA 1T5IA 2GO1A 2P77A 3GPDG 3E2PA 1RYBA 4HDMB 1FFEA 5KPDA 4D3YA 5DNYB 2RCYA 3EVTA 2B7CA 2CHFA 4YP7A 4BBPA 5BVHA 2C9CA 3CLKA 1AUQA 3FCYA 4B31A 3BGDA 2VHVA 3HJRA 4BVGA 2X0NA 3LUAA 1UMCB 3UH0A 4OX9B 2ZAIA 4IJ5A 4Q03A 3S27A 1X7DA 4YUAA 5IN5A 3OZCA 4AJ2A 4RKWA 4TS1A 4M54A 3RVBA 1QYDA 2MR5A 3ZY2A 1XXHB 5AOBA 4BB6A 1I32A 4YRPA 4PTLA 1LI4A 3WADA 5AK3A 3GGSA 5G4LA 2I33A 3H3JA 2C2XA 2NVUB 4ZMSA 4LN1A 1XYVA 1Q7GA 3AGPA 3EIWA 1KA9H 1U0GA 4CLHA 4HPJB 1RXVA 2OZLA 4UFPA 1K5PA 2R5WA 3NEPX 3NJ4A 4EGAA 5EQDA 4J90A 1C1DA 4WOCA 3RQSA 3T3IA 1TT5A 1UDAA 1COWA 2HBZA 3T5GA 2A0FA 5FA6A 1PHPA 4MVWA 3UWDA 2HDHA 1NVDA 1VG8A 2O57A 3IVXA 3JU3A 3KYIB 3ZWKA 4EMBA 3SSMA 3ZHQA 4D0NA 3L0SA 2AGVA 4OQXA 2OBNA 5JWHA 3ZDCA 4WCFB 4BVBA 1M1ZA 1K8RA 2E6KA 3GL9A 1E0SA 1RYEA 3UAVA 4CLRA 4HH4A 1N5DA 3CRRA 5J2TA 4FZ3A 3HJUA 3V7YA 6ABPA 1ATZA 3DOHA 4H6VA 4N4AA 2BCGY 4OYRA 4R7ZA 2WKPA 4ZI7A 4CQMB 1SC9A 3KE8A 1DCFA 3P9QA 1QHHB 1UOOA 1P1CA 2MSEB 1R0XA 2HA4A 3CIFA 3NFRA 3COVA 3LHSA 4MRVA 3TIVA 3BSYA 3GLGB 2VTEA 4BVEA 2JPDA 2CNDA 3HVIA 2QF7A 5EJ9A 4U2FA 1XA0A 3FCOA 3C6XA 3WYFA 1X7YB 4OL9A 3N2KB 5EP3A 3PC3A 1CUJA 1TU4A 2FN7A 4I2NA 4ECEA 2WT9A 2X0EA