4IV0A

Crystal structure of n-methyl transferase from plasmodium vivax complexed with s-adenosyl methionine and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
263
structure length
263
Chain Sequence
ISEPVDIKYLENNQYSDEGIKAYEFIFGEDYISSGGIIATTKILSDIQLDANSKVLDIGSGLGGGCKYINEKYGAHVHGVDICEKMVTIAKLRNQDKAKIEFEAKDILKKDFPESTFDMIYSRDSILHLSYADKKMLFEKCYKWLKPNGILLITDYCADKIENWDEEFKAYIKKRKYTLMPIQEYGDLIKSCKFQNVEAKDISDYWLELLQLELSKLEEKKEEFLKVYSIKEYNSLKDGWTRKIKDTKRDLQKWGYFKAQKMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoethanolamine N-methyltransferase, putative
publication title Phosphoethanolamine N-methyl transferase is a Malarial drug target
rcsb
source organism Plasmodium vivax
total genus 110
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.103: Phosphoethanolamine N-methyltransferase.
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iv0A00
2A14A 2PXCA 2JHAA 3TLJA 1N7IA 5M5BA 5DSXA 2BZGA 5CVUA 2C7QA 3OFKA 3RW9A 4YUXA 4RVGA 3RIEA 4M7RA 2FK8A 2B2CA 4AZVA 4PYKA 5ICGA 4DKJA 4E2ZA 4JXJA 4PCAA 3I64A 1KXZA 2IPXA 5DM1A 3HCFA 4RTRA 1NW6A 1KHHA 3MERA 2IP2A 5CM2Z 4XCXA 1L3CA 2ONYA 1YFJA 3G88A 3IHTA 5FQNA 3UBTA 3FTFA 2H11A 2PX4A 5K05A 1EJ0A 3VC1A 3HA3A 4RTSA 3GRYA 4FZVA 4CXMA 1RI4A 1IM8A 1Q0SA 3DUWA 3B3JA 3FTCA 3GCZA 3GU3A 3GRUA 4HRAA 3ERCA 1XDUA 4HTFB 5DTQA 5EMMA 5GIPE 1ZGJA 5DLYA 4UOEA 1NW7A 1RI3A 1FP2A 1SG9A 3DR5A 5EIWA 2B3TA 3AY0A 3LCVB 2GA9A 5E1MA 4CKEA 3BGVA 1KR5A 1RJDA 2YX1A 2G8NA 5KQSA 4RTOA 2R3SA 3CBGA 1JG3A 4E70A 3EEOA 3LKDA 1ZQ9A 3KQPA 3UJ7A 1KPIA 1UFKA 1M0EA 2ZZMA 1AV6A 2ZIGA 4MIKA 1XDSA 1H1DA 3PT9A 3V8VA 4C08A 5K0GA 3A7DA 3AXSA 1L3IA 3BKXA 3HVJA 3MAGA 5MHTA 1F38A 3EGVA 2ZZKA 3O31A 3P2IA 3P71T 4X60A 5BP7A 2R6ZA 3B3FA 1FBNA 3SSOA 2PVCA 4HGZA 2O57A 4RTPA 1M6YA 3UZUA 5FULA 4P7FA 2GLUA 3THRA 4AZSA 4GOND 4HC4A 2XYQA 3NWEA 4BP1A 2VDUE 1KPHA 1L9KA 3G2OA 3GJYA 4GUAA 1IY9A 5IH3A 4PNEA 2G70A 3FUTA 2QYOA 4AZTA 2B9EA 4E32A 3B89A 3FPJA 3MCZA 5EMJA 1VL5A 2BR3A 4PYOA 2GB4A 2P7HA 1WZNA 4GEKA 4RVHA 1R74A 3HP7A 3DH0A 3KR2A 1QANA 5F2OA 1KYZA 5JR3A 3DULA 3VSEA 5K8VA 5HIMA 2P3QA 4GOMD 4OQEA 4PCLA 3UJAA 3LBFA 3M33A 5LQUA 2EJTA 3EPPA 3M6VA 3E7PA 2PJDA 4BP3A 3TFWA 2PV0A 4OBWA 4R6XA 1VE3A 3KQYA 4FT2A 4R8SA 2IH4A 2P41A 3OZTA 4IV0A 4RTNA 2G71A 4X41A 2CKDA 3HA7A 1RI1A 3KU1A 5EKXA 2ZLBA 5BXYA 4OA8A 3G2QA 3SR4A 4YMHA 5E1BA 4RTJA 2IH2A 1XVAA 1R8YA 4HTFA 1WXXA 2WA2A 4P7JA 1G60A 5EZSA 4BLVA 5GM1A 2YXLA 4P7KA 4XUEA 3DXYA 5DXJA 4NECA 3M6WA 4P58A 4ZTBA 5EMKA 4IWNA 5GM2A 1JR4A 4C05A 4YV0A 5HZMA 5KYGA 2VDWA 3GRVA 5CVJA 4LWPA 1V39A 2PKWA 4CKBA 2ZBQA 2NXCA 5LQJA 3UA4A 5CUQA 1DL5A 2AOXA 1NV8A 2AS0A 5GP1A 1DCTA 1WG8A 5C1IA 2GAFA 5HIKA 3FUXA 1VIDA 4RVDA 4CTKA 5K0BA 3FRHA 2GH1A 4PYLA 3EVBA 2XVMA 3BT7A 5P8WA 4X61A 4ATNA 1R6AA 3FUVA 2PGXA 5EEHA 2OXTA 2OYRA 4EK9A 4GQBA 1FP1D 2EFJA 1VP9A 4KRGA 5DSTA 3EVEA 4V0RA 2G72A 5IKMA 2BR4A 5F2NA 3LPMA 5E8JA 1HMYA 1I4WA 2AOUB 3IYLW 2FCAA 3KPJA 5T67A 4FT4A 3VC2A 4E2YA 3MTIA 4F86A 2JG3A 3QOWA 2VS1A 2P3LA 1SKMA 4RTQA 1QYRA 4MQ4A 2CMHA 4O29A 5FCDA 4L7VA 1YZHA 2NP6A 1BC5A 3TMAA 2XYVA 3L8DA 5DWQA 2ADMA 2V74B 3KPUA 3M4XA 2LD4A 5LR6A 4QQNA 3GO4A 3LCUA 2AN4A 3EVDA 3I5UA 2AOTB 1ZKDA 3C0KA 5CCXA 3NWBA 2BM9A 2AVNA 2FK7A 2ZWVA 5FQOA 2C7RA 3ELDA 5D1HA 3UJDA 2YR0A 4PWYA 4E30A 1QAMA 9MHTA 5EGSA 1AF7A 5U4XA 3ELUA 2PWYA 2CWWA 3KQSA 2OPBA 1T43A 2HTEA 3V97A 5HIJA 5LQRA 1XDZA 3LSTA 4A6EA 2OZVA 4ER7A 3CKKA 3OE4A 1X1AA 5GINE 3LBYA 3KQTA 2DPMA 3GXOA 3NVMB 5K0FA 2P3OA 3DLIA 3KPYA 3LL7A 1D2HA 4FSDA 3UJBA 5C0OE 3H2BA 4FS8A 3EVZA 5ICEA 2PLWA 2AN5A 2HWKA 4DCMA 3GRRA 2QRVB 4RVFA 2I9KA 2PX8A 5B1SA 1R00A 2FYTA 1XJ5A 2OBFA 2HMYB 3CGGA 3P9IA 4GC9A 5EOVA 3U81A 3I58A 1O9GA 5FADA 3EVFA 2NXJA 4H0NA 1VQ1A 1B42A 1Y8CA 5HFJA 3UJ8A 4F85A 2GS9A 3SGLA 2G1PA 3M70A 2BH2A 3C3YA 5DPMA 4YMGA 3TM4A 5LSAA 8MHTA 4PONA 3UWPA 1RJFA 5CVDA 1XTPA 5FWDA 2PXAA 2Z6AA 3NW9A 3LDUA 3O7WA 4Y30A 2ZW9A 4RX1A 5DM4A 4E33A 3KR1A 5D1NA 2AVDA 5DX1A 2P1DA 2P7IA 3NTVA 1FPQA 5DTMA 5T6BA 3UJCA 4A6DA 5LQCA 4BLWA 3PVCA 5EKUA 1TW2A 5F2KA 4CWAA 3I53A 3P9KA 2AOWA 2JH8A 3M6UA 3T7SA 4KDRA 4YUVA 3OCJA 2YUIA 2BR5A 2PWPA 1MJFA 2QE6A 3AWIA 4RTLA 2PXXA 3LCCA 3LHDA 2EG5A 2I7CA 3SSNA 2IGTA 3DMHA 2AOTA 4KDCA 3EMDA 3PTAA 1VP3A 4V0QA 4QQKA 3T0IA 4OX9Y 1WS6A 5E1OA 3E23A 3GRZA 4KIGA 2ZVJA 3BGIA 3BWCA 3Q87B 1YB2A 1N7JA 1DUSA 3RODA 5KS2A 4FP9A 4ER6A 4PGHA 1YFLA 3DLCA 3P8ZA 1YZ3A 1PJZA 3FRIA 4IV8A 1BKYA 2KW5A 2OB1A 5FA8A 4E2XA 4EVIA 4PYQA 2JH9A 3ANXA 2IDKA 3HNRA 1EAMA 1RI2A 2YXEA 4M38A 3K0BA 4HGYA 5C9ZA 1SQGA 2ZWAA 4KW7A 3SVZA 1Q0TA 4WVLA 1ZG3A 4M36A 1D2CA 3T7RA 1M6EX 3FUUA 3OZSA 3NJRA 4B17A 1EQAA 1VBFA 3EMBA 5K0NA 1L1EA 2ERCA 1N2XA 2HV9A 3CCFA 3PX2A 4PIPA 3HTXA 2P35A 2NNWB 3DXXA 3CJQA 1QAOA 5EZQA 4ER0A 2VP3A 4QVKA 2YVLA 5FTWA 2JHCA 4HH4A 1P1BA 1L3BA 3HCAA 5ERGB 4YV2A 2YTZA 4OA5A 5K09A 3KQMA 3KQWA 1BHJA 4GBED 3R3HA 5K03A 1G8AA 3EGIA 4U7PB 3B3GA 3UFBA 1Z3CA 3UJ6A 2QY6A 4MHTA 3P2EA 3HVIA 5E2BA 4M37A 3G5TA 3FYCA 3HA5A 4ER5A 3HVHA 5HEKA 1NE2A 5E9JA 2ONZA 2VZ9A 5DX8A 1NBHA 3KKZA 2GPYA 2FPOA 3GIWA 2OKCA 3HCCA 5E9WA 3CJRA 1JQEA 3D2LA 3EEYA 3WSTA 5CD1A 5GOZA 3C6KA 3S68A 4KVZA 3HCBA 3KPVA 5CCBA 4ER3A 3Q7EA 1QAQA 3P9CA 3EVCA 4PGGA 1SUIA 4K6MA 2FRXA 4RWZA 4LWOA 3I9FA 1ORHA 3F4KA 2Y1WA 4HG2A 5KQRA 5DXAA 2ZZNA 3MQ2A 2NP7A 2I62A 4PINA 5BW4A 3LECA 1RI5A 3B7PA 2ORED 3MCTA 5GWXA 1SVUA 3OU2A 1XCLA 4E2WA 2PY6A 4EKIA 3R24A 4DF3A 3FPFA 3R0QA 3MHTA 5G02A 3E05A 3P2KA 5CVEA 1NW8A 3A25A 3SSMA 5K0JA 3NMUF 3PFHA 3OU7A 5FWAA 4IKPA 5E8RA 1NW5A 3KQQA 3BZBA 2UYHA 3FZGA 5LQKA 4LECA 4P7GA 3GNLA 3G2PA 1TW3A 3O4FA 3EGEA 4AUKA 5DM2A 2FHPA 1JSZA 2P8JA 3G89A 5LQNA 4Z2YA 1EIZA 5EG5A 2UYOA 4OQDA 2B25A 3HM2A 3BGDA 2XVAA 4DA4A 2IH5A 5K0EA 3NDJA 2IFTA 1G55A 4CKCA 4R05A 3TPZA 3THSA 2PX2A 3CVOA 5H02A 3UJ9A 4X1OA 2O05A 3JWIA 1VLMA 3A7EA 5HOQA 2Z6QA 4OBXA 4BY9E 2ZULA 3R6TA 1P1CA 3KQOA 5K0CA 1AQIA 3GDHA 4QVGA 1KPGA 3PX3A 2O07A 1OR8A 3TKYA 2YQZA 3A27A 3FYDA 2YXDA 4CTJA 5T64A 4FSXA 1ZHFA 4U7TB 1NV9A 3HCDA 2N47A 4XUDA 2VDVE 4YV1A 1IXKA 1R18A 1TPYA 3A4TA 1JSXA 2ZBPA 4KIFA 5EPEA 3MTEA 3AJDA 2C7OA 3REOA 2IBSA 3ID6C 5DT2A 5K0LA 1JQDA 2QM3A 1NT2A 4QTTB 2O0LA 4EQZA 3NDIA 2IBTA 4AZWA 2AOUA 2AZTA 3BKWA 4MWZA 3NVKI 2O06A 1RJGA 3EVGA 2NYUA 1WY7A 4GOOD 3VYWA 2PSSA 4DMGA 2ZBRA 4QDJA 3FPGA 4AX8A 1NKVA 1YUBA 2IIPA 5HILA 3G8AA 3R9XB 1ORIA 2OO3A 4POOA 4R6WA 3BUSA 3LX6A 3FTEA 2EX4A 1KYWA 2OB2A 3HVKA 3PS9A 4RV9A 2DULA 2ESRA 3LKZA 4PYMA 2AR0A 1G38A 4F84A 3GGDA 3SX0A 4C4AA 5EC8A 1G8SA 4RSRA 5DRYA 3DMGA 5E1DA 3UA3A 2BM8A 3IV6A 4XUCA 5ICCA 4C06A 4C07A 3HEMA 3C6MA 1NBIA 4YUWA 3G8BA 3X0DA 2Y1XA 2AOVA 4QDKA 1MHTA 3G7UA 4E31A 3GWZA 3A26A 2K4MA 3SM3A 1AQJA 3ORHA 4FR0A 3JWHA 4QPNA 2H1RA 1ZGAA 1VPTA 3CC8A 5FA5A 1FJXA 1WXWA 2JHPA 3KHKA 4PIMA 5EHIA 1U2ZA 3ME5A 5EIFA 1O54A 3HCEA 5LQAA 3C3PA 5DX0A 2WA1A 3SMQA 2QRVA 1I9GA 1PRYA 3DXZA 4DQ0A 1YF3A 3TOSA 2Q41A 4X63A 4PYIA 2IDJA 5EHGA 1P39A 3SXJA 5JUWA 1EJ6A 10MHA 4EKGA 1RJEA 5K01A 5E2AA 3DP7A 2EJUA 2UYQA 4PYJA 4YUYA 3MGGA 7MHTA 1BOOA 1XCJA 1I1NA 3ELYA 4RYLA 5ICFA 1JG4A 5CVVA 5EVJA 3TM5A 4MTLA 4EMSA 2P40A 2CMGA 4FGZA 5EMLA 3TKAA 5EEGA 2Z6UA 5DRTA 2PT9A 3OU6A 4LG1A 1EG2A 3T7TA 2NXEA 2PX5A 2ZIEA 4Y2HA 1KIAA 1JG1A 2OY0A 3JWGA 3LDGA 3ELWA 3G5LA 1NW3A 3FPEA 3JWJA 2PT6A 3DTNA 4QTUB 4C04A 1O9HA 2AN3A 1JQ3A 2ZIFA 3BWYA 1P91A 4G56A 1JG2A 2B78A 3KR0A 2XYRA 3M6XA 1KP9A 4GC5A 2UYCA 2E5WA 1X19A 2ZTHA 1JTEA 2ZSUA 3CJTA 4DM3A 1F3LA 3OFJA 3BWMA 1QZZA 3FUWA 3FTDA 3KR9A 5FUBA 3LGAA 2UZ4A 5FHQA 5GIOE 5HIIA 4RTKA 3P97A 4PYNA 4RTMA 5DTRA 3DMFA 3OE5A 3TRKA 4BLUA 1R8XA 1HNNA 5DM0A 4GF5A 3OZRA 2H00A 2F8LA 4C03A 2ZCJA 2V7EA 1X1CA 3AXTA 2JJQA 2CL5A 4DZRA 4WXHA 2HR1A 2PBFA 3FPHA 3K6RA 5CIYA 4YUZA 3OPNA 3DOUA 4GOLD 2WK1A 2XBMA 3MB5A 3BWBA 3P9NA 1D2GA 1UIRA 1JTFA 2HNKA 5KVAA 1X1BA 3PFGA 3G2MA 5EQJB 4KWCA 1INLA 3TR6A 3B5IA 3QOXA 4ISCA 1X1DA 1SUSA 2ZFUA 4QPPA 5FHRA 3QV2A 1G6Q1 3PB3A 3EVAA 3KPWA 2C7PA 3ER9A 2NXNA 3TQSA 3BXOA 3IEIA 3KQVA 4HSGA 3ER8A 4DCGA 2I6GA 4R8RA 3PLAE 1XXLA 1SQFA 3LDFA 5BW5A 5E9QA 1UWVA 3E8SA
chains in the Genus database with same CATH superfamily
2H4JA 4FHCA 4Z53A 1RWMA 4WNIA 2BZGA 1ZRNA 1KDTA 3D1LA 4UJ5A 4YJFB 4YJ2B 2B0CA 3JQRA 2BBTA 4PYKA 3ROXA 1O5TA 2C07A 4O1HA 1N0VC 3I64A 4FBMA 2P9GA 1LX6A 1GZHB 1GRRA 1COZA 2HRRA 2QDKA 4WNAA 5ALXA 1C0EA 3G88A 1JDVA 1G5IA 3F9IA 1L4BA 4MV0A 1N2ZA 2MWMA 3S4YA 4AS1A 5ESWA 1PHRA 4LSWA 3Q3EA 4KVAA 3DPUA 4DJAA 1GUDA 2HK7A 4FZVA 3PVSA 4NJOA 1AHHA 4NK5A 3B3JA 1CW2B 2GF2A 4QJ4A 3FROA 5L3RA 4W9MC 2G6TA 4OK6A 1E9EA 4X8LA 4YJHA 1LK7A 1NW7A 5CW1A 5T3UA 3WTBA 3DR5A 4EECA 1O6GA 4FYYA 4M1SA 1AKQA 1RM4A 2V8OA 3MF4A 4C4TA 4P5PA 3BHJA 5AKKA 4F5WA 4EDHA 4UAUA 1Z8FA 1NVXQ 2XT0A 4OCZA 1RQNA 2GXSA 4X20A 1K6EA 1AB5A 1ZXBA 3EY9A 4AG3A 4DV0B 3KUKA 4XVCA 2IQ5A 1K68A 3A9VA 3ZD9A 3L18A 3P2IA 3RS9A 1TCVA 3GJ0A 3QYJA 1NUAA 4EKEA 1IQRA 4NVRA 5TR9A 1G16A 1P72A 4IVPA 4ZJZA 3LKBA 4R5MA 1ZVJA 3ICWA 4TLAA 2VA9A 1AUPA 5JQWA 3E3MA 3NTLA 4EW1A 1IBCA 2EBWA 3EXHC 3J81A 1GFWA 3B53X 3RWMB 1UKAA 2B9EA 1H85A 1WSAA 4RF5A 3PUJA 3RUPA 5B64A 3QUBA 2GB4A 4CQMA 1XMSA 1OKKD 2XD4A 1V1RB 1TDJA 1WVIA 3K2IA 3EWSA 5E6RB 1Y1PA 1I3OA 3F67A 2B1RA 1GTVA 1QJCA 1RXCA 1G291 4ZU1X 3BSSA 3AZOA 1DKRA 1KARA 3SHQA 2HMTA 2P0YA 3IMGA 4LBZA 3UXYA 3QVKA 4E14A 4BVKA 4ZVNA 3GNQA 2A67A 2DPGA 4RQUA 3JAMA 2R5WA 3R8CA 2ZUEA 5EKXA 2Y76A 3RTGA 4HZGA 3R0VA 1W0KA 2GD1O 3BRSA 1N9GB 4FKBA 2IOYA 3I83A 1DE0A 2WA2A 3WFJA 2HJRA 2GOYA 4F5DA 2P6MA 1V5FA 1GO2A 4MDEA 5AVXA 2Z4TA 1A9SA 2NVWA 3AHJA 1R6DA 2XDWA 1HNZB 4AYWA 5ABPA 5A5GA 4DJEC 3S2IA 4JQCA 4UD2A 1MEOA 3ZCRA 3M4NA 1YR1A 5AH0A 5FTLA 3E1SA 1SBTA 3QELA 4PRKA 3WZMA 8LDHA 2VTBA 4JBLA 3TSWA 3OLWA 1IH8A 4RVDA 3AJAA 2SICE 2GFQA 5K0BA 2RHRA 3UB2A 4OIMA 2AE2A 4YR9A 3KZCA 4NKRA 1GLNA 1ORWA 1Y8QA 2I55A 2DWUA 1G5TA 2WU4A 1W30A 4JEMA 3ZYZA 4EK9A 4DXHA 4BVLA 1FP1D 1THGA 4M9CA 2WJYA 5FBLB 3SDSA 2UU9B 1JU4A 4AF7A 2OGUA 3FN4A 4C1NA 2EX0A 3LRXA 2I8LA 4KPFC 4YRNA 1EFAA 4YMUA 3RAFC 3I3SR 4TXLA 1OGJA 4Y6SA 4KRYA 1SXJD 1EJBA 4ZC1A 5CXUA 1ZRSA 2A1TS 2CUTA 2WPDA 3H8VA 3L7MA 4RK0A 1N6LA 5HP4A 1GRVA 1RHRA 4B3DA 4Q4JA 4WT7A 4R3WA 3WLMA 3NHBA 3ADDA 3IPLA 3BA6A 2AOTB 4F6LA 2XTMA 1NBMD 2FK7A 3TGWA 4JITA 4LOLA 2MSWA 4FQ8A 1XZ8A 5ALDA 3USZA 2H4FA 1FL9A 9MHTA 3KT0A 1AF7A 5U4XA 1W36D 5EAIA 4Q7QA 7REQA 1RC8A 2H29A 2NG1A 3IESA 3CVUA 3IKLA 1X39A 4YMTA 3V97A 2YZMA 4C78A 3LSTA 4TTPA 3SC6A 1W96A 1W4ZA 2RONA 2IZ5A 5GAJA 3IUYA 4HDQB 3DV0A 2WKPA 3ZWKA 5BN1A 2C2BA 1NF2A 3WP0A 2JFUA 4CT5A 5F7JA 3VV2A 3K1ZA 1CUDA 3C43A 4WY2A 3U7JA 1KKLA 3R75A 5JYEA 3P0FA 4M8IA 1M5RA 3GRRA 3AVWA 3OG9A 2DPYA 2HZBA 3B85A 3W77A 3E4CA 1F2UB 1PEYA 1P9RA 2GBGA 2IEYA 5BVGA 3K05A 3SZRA 4INPA 4LXTA 3UJ8A 2O2JA 3B9QA 2B8JA 4LAFA 2GO1A 2AN9A 2DG2A 2GKOA 3C3YA 4GM1A 4D79A 5HJ7A 2UZ0A 4ND8A 3TM4A 5B2EA 4BMVA 4NABA 1MO4A 1NN1A 1Y81A 3D7RA 2QZSA 1BCRB 1IHUA 3UGTA 4JT2A 4WZAE 3OFNA 5DM4A 1DZ3A 1QYVA 3H1PA 4ARAA 1X8JA 4HH3C 4Y6QA 3KOUA 3UOGA 3HJUA 1FCJA 1N2JA 3RWBA 2YZNA 3LVFO 9GPBA 3GJ7A 3COJA 1QRSA 4V0MA 3M6UA 1XCGB 1N6IA 2F3TA 2ODNA 4QGGA 4C0SA 5HM8A 1XK6A 4PAWA 2CD7A 3MQFA 4DR4B 821PA 1AE1A 2J9ZB 2QE6A 4FMDB 3USES 3K09C 2FLVA 1RHMA 3IA7A 1FVOA 1KJNA 4ALKA 1G2QA 5KJEA 2IDZA 3OHSX 5HNKA 1KJQA 1MDFA 1U8EA 3ZPXA 2XQJA 3BWCA 4TQGA 3VDNB 5CEEA 2ATIA 1T9HA 2X4DA 1FFHA 3EQ7A 1XNQB 4XM1A 2BFBA 4UBMA 2FV8A 4P2GA 2Y1GA 1O94C 2O59A 3QKRA 2OAEA 1EK0A 2CXTA 5BSMA 3ZOZA 4MDYA 2IDKA 2P91A 4DSUA 2VUHB 4BTEA 1EAMA 1FW6A 3RSSA 4IILA 2NSLA 4C4YA 4QOGA 4A8PA 3DUFB 4ENQA 5MGBA 5F78A 1J20A 3V00A 1EFKA 1M6EX 1JDPA 3OZSA 3R20A 3NT2A 5ALMA 1O3YA 2OYCA 1L1EA 3KHTA 3GJZA 2XUQA 5REQA 4BGUA 3PX7A 1RPAA 3MTGA 2WHXA 5F35A 1TAHA 3LUJA 4R81A 3VHXB 4DUZB 3DXXA 3RYFB 4FYIA 4AW9A 5ALOA 5IS2A 1E5XA 1H42A 2XXJA 4XFJA 3DQQA 3OIFA 4KV7A 1JKJB 3RGGA 3ZH9B 4C6TB 4CEIA 5H81A 3EOAI 3MB8A 1UAGA 2PBRA 2VYND 4EYGA 1KEEA 2IOFA 2PL1A 3TCXB 5K03A 2QR3A 3RJTA 4EYEA 3PTZA 2IS4A 2MIIA 3H16A 1IMJA 1ECCA 1NVVQ 1Z3CA 4J1SA 5AKJA 3GH1A 1V45E 3UFBA 5GZ1A 2O5RA 4K9PA 3DOCA 5HE8A 4J4TA 2O3SA 3IDSA 4ECEA 1CUEA 5JSUA 1OB5A 1JB1A 1B0AA 2DFPA 1ZGBA 1K7SN 3NBYC 1SUEA 2OBNA 2PLRA 3C5WP 3E3AA 1ULAA 2V4MA 4KGZA 3KG2A 1P3Y1 2HY7A 3PE6A 1ZH6A 5J5CA 4Z4IA 1RLIA 3NEYA 3Q1LA 4L57A 3I12A 4TWRA 4XX1A 1W73A 3GR6A 2FPGB 5K8IA 4JMPA 4EHLA 1R15A 3VJLA 4N48A 5KSWB 1GGNA 3AGPA 5THQA 3M5WA 3L8GA 1YVUA 3B6IA 1ZWKA 1DT3A 2BGTA 1GFZA 1XPRA 1ORHA 3F4KA 3KOXA 3LXXA 4FW8A 5F33A 4UBLA 1SUCA 3KS9A 2VDQB 3C8UA 3H2KA 1NVFA 4HB2A 4UM9D 3LECA 2WWGA 2ZYDA 3O9MA 5DJ5A 5T4FA 5G1OA 1KVSA 3ETNA 3CW9A 1SELA 3R24A 4MNTA 4EY7A 5A5FA 1Y6GA 2FB9A 4NONA 1Q77A 2WVHA 1UZMA 3WGOA 1F4PA 4FHFA 5BT9A 1HFJA 2B34A 2JAOA 4B0OA 2H5LA 1PVDA 1SM4A 3NHKA 2ZSIA 4IKPA 3KQQA 3R40A 4OQFA 2UYHA 1DFIA 2QVLA 4LECA 5H83A 4KE9A 2BFNA 1Q22A 1JNXX 1J33A 2NUPA 4X71A 5E0KB 4Q16A 2CLCX 4BZZA 1HTTA 3VR3A 1UJNA 3GV0A 4NYIQ 1FLVA 3F5DA 2CYBA 2HHCA 1LX7A 3EEBA 2WJ4A 2BHTA 1DBIA 1MGOA 3LC1O 4AI6A 2PX2A 2GJAA 2HFKA 1T0JB 2WMDA 3R44A 4XQ9A 4IS3A 3PNBA 3S6JA 3VHRA 3R6TA 2F1HA 3WJAA 4S1TA 3NGMA 1HLPA 4NS4A 1BHQ1 5B6IA 4U7JA 4EG7A 3CRW1 5J4HA 1QYDA 4EJ6A 3AEYA 3LMKA 2YHIB 4KH1A 2FQ1A 3B38A 4O4IB 4MI3A 1NV9A 2YOHA 2HRQA 2VC2B 2ZI7A 1DX6A 4TT3D 4MYUA 4C4OA 1F0YA 1KMIY 3A9RA 2CNOA 1J97A 4MUIA 4MYSA 1O96B 1N36B 1P7CA 2C7OA 5HXAA 3J7TA 3VQTA 3FOFC 1C9DB 1XIVA 3ANNA 4LXIA 3UUFA 5KQMA 3DCIA 5AIBA 1R8SA 1Q0ZA 1LBQA 3DDHA 1LS1A 1DG1G 1TCCA 1PIWA 5AK3A 1SXJB 3VYWA 4EF5A 3VPXA 1CR2A 2VDLB 4HLCA 1NJSA 4DMGA 4RFSA 3JALB 3LK7A 2P69A 1NKTA 4BMPB 1ORIA 3TTVA 5B58C 3NFRA 2AG0A 4RESA 2O50A 4BMZA 4TTAA 4DCPA 1ZW6A 4WNYA 3PS9A 4MPDA 4TRNA 5EN4A 3DVRX 5GV7A 2EV9A 3WLSA 3VU3A 1XA3A 2YHSA 2WG1A 2BFMA 4II2A 2V6BA 1M8JA 1D1QA 4BPBA 2HF9A 1CJBA 2GCIA 3VGPA 1AKTA 1P6UA 3FWPA 1DQZA 1G1AA 1YZTA 3LT0A 3RLFA 3DO5A 1L5FA 1C0PA 1U0EA 4FYVA 5H4HA 2GKGA 2CN1A 4R01A 4F3YA 2AOVA 5BNZA 3HKBB 1FRZA 4TTJA 16PKA 1O57A 3A26A 4LJ5A 1J09A 4IVQA 2O3UA 3CC8A 2Q5JA 3CONA 3VTFA 3VH1A 2WAOA 4L0CA 5AHOA 1QHNA 4EENA 1G5RA 4TMYA 4EG0A 5J2UF 2CF6A 1B3BA 3TXYA 3WC4A 1OBCA 5F7OA 2QRVA 3DL2A 3RNOA 1IBMB 5HQTA 1UMBB 3G0GA 4PQYA 1PKXA 1U5CA 1N0WA 1YB4A 2M9MA 5D7NA 3P2MA 2Q8PA 2X14A 4FEGA 2N1MA 3E5NA 1DMRA 1TCUA 3A3OA 3FYHA 4ZO7A 4GMGA 4U9HS 4YGYA 2UVDA 4MS4B 1BQ3A 1GAQA 4P0QB 4M6WA 1EFRD 1PEAA 1MU0A 2BHSA 4QGAA 5GGYA 4AUEA 4EO7A 1LLQA 1A9RA 2QUIA 2ZRKA 2DR3A 3GVCA 2AW5A 3WJ7A 2CMGA 1RKUA 1RPJA 2DQSA 3H2SA 3QMMA 3QBJA 2Z6UA 1KP3A 3D7KA 3IEKA 3DMYA 3R5FA 1XRRA 4M4SA 3V9AA 4EHNA 2Z2ZA 4WBNA 3DKKA 3W78A 4CMJA 2FFJA 4N40A 4NU0A 1A7AA 2Q9AA 1GGJA 4TS9A 2VWGA 3EIHA 4WFIA 3DTNA 5LXTF 3W9SA 5KYYB 1GTJ1 2AXQA 2IXTA 3EC1A 3OPVA 1YR8A 4P3NA 5FPPA 5D7BA 4CI0B 5D01A 3O2QB 2BEVA 3PNQA 1ZISA 2YYAA 2DFLA 4N49A 4HDMB 1KP9A 2CXNA 5C3UA 4MUNA 1QK3A 2ZTHA 4CV1A 2J32A 3KZOA 3PYXA 3ZCUA 3EXFA 1DAFA 2FPPB 1U98A 2ZIUB 1BE6A 1OX4B 1QS0A 4IVNA 3ZWYA 4FMCB 4PF1A 5IKPA 3OQBA 3DZCA 3SQDA 1H0RA 4KRXA 4XPIB 3LY7A 2V6IA 2QTBA 5DM0A 3CN9A 2QN6A 1MJ5A 4NG4A 3OZRA 1LPSA 1SULA 3CXUA 3M4ZA 3RYCB 3JQCA 4DV3B 3C97A 1OYWA 2EFEB 3AXTA 1H23A 4GX5A 4BVFA 1T4MA 3JQBA 2B2XA 3L6UA 4GZ3A 3W8RA 2GN2A 4D4KA 1NXPA 4GOLD 4Q01A 1HL3A 5ALTA 3FDXA 4M0KA 1XDBA 5JNUA 3TSAA 3G1TA 3V8PA 2C4TA 3WKAA 1E5DA 1OSNA 4TKLA 1R0KA 4FTWA 2YNMA 1UM8A 3B5IA 3I2HA 1FQKA 4CJXA 1X70A 1JG7A 3E3OA 4HNSA 4MAMA 3FI0A 4MRMB 3EZYA 3EE6A 4QPPA 3FNHA 4NOLA 4ESOA 3BE6A 4IV5A 1QQBA 4B4KA 5BMVB 4N41A 4MV8A 4BB6A 2X8JB 5CHYA 4DWWA 3EBOA 5BRJA 4YFYA 1BE1A 1ZJZA 2HA0A 2KLBA 3F6YA 3IAHA 2RHGB 1NYRA 4G9BA 4WZAA 5CXQA 1G2PA 1V5WA 4DWVA 3CUSA 5DSXA 3QBTA 2BMWA 2AW3A 3RW9A 4EYKA 1PR4A 1CULC 2M6SA 2HA6A 3BHNA 5KPDA 9ATCA 1FFGA 4YCBA 3OEED 1HNWB 2QSJA 4G8CA 1ZYUA 2IXFA 2A9VA 4ZDIA 2IPXA 2PWBA 1HQDA 3DMTA 3R7BA 2WKQA 2Y27A 3FIUA 3E9EA 3IRVA 4K9LA 1UBSB 3BERA 4M0PA 1ZNQO 1OXSC 2NUAB 4XCXA 3QUCA 4DT1B 1B2LA 1UJBA 2VDJA 3BE4A 3O2JA 1QGAA 3B6JA 5CB4B 2H11A 4B6EA 3E7FA 3Q12A 4OI1A 2PA0A 1A98A 4TGLA 5LB4A 3QUQA 4JVOA 4UM9B 4LS3A 1ZESA 4NP6A 4L50A 1O94D 1NMXA 2B5OA 3U40A 2I2CA 5LYJB 4AY2A 3HCOA 2NLOA 4LGCA 4RABA 3V8MA 1FP2A 1PBNA 3KHUA 2PR2A 2OC4A 4WCFB 3S55A 2OAP1 2Q45A 3F5SA 3F2VA 3G13A 3SKYA 2XVZA 3KQPA 3SF0A 5HPYB 4Q3LA 1PE0A 5HVNA 3VUEA 2DB3A 1OT3A 1QIHA 3VR4A 4DEXA 1HYGA 3EULA 3ZGLA 2B1JA 2ZWOA 1VJ1A 1QP8A 2B4TO 3QY0A 1T34A 1IM5A 1NXSA 3AEQB 3GT3A 2OEPA 2PGIA 3FLMA 2ZRAA 1K1EA 4REQA 1A9QA 4RTPA 3LTNC 4MQBA 4UNIA 4BZWA 1W0CA 2FEPA 2ZYIA 4JIMA 3MBOA 4OH7A 3TN7A 2C1ZA 1AQYA 1OGIA 4I55F 4E5YA 1J8VA 1KOFA 2W98A 3DDWA 3QFRA 4JR2A 4D3ZA 5E0OA 1GSHA 1SCAA 1T5LA 1KK2A 6AT1A 2WU1A 3L6CA 2VHZA 5JU6A 3EQ9A 3DG9A 1KA9H 3KVRA 3T06B 1V2HE 2X7XA 3HVUA 4E32A 2CFSA 5CX4A 1GCUA 4IGFA 5F9MA 5FUVA 1NN3A 4DIEA 5JS7A 1RYEA 3N8HA 2CJXA 1XPOA 1OY1A 1HEYA 1CVLA 1YJCA 1TM5E 3ZHTA 3FVTA 1I4EB 3DBRA 1NFQA 2AJTA 3DULA 4ZI7F 4G1MB 4OATA 4RC9A 4GOMD 4AJJA 4YRBA 1OXTA 3CUUA 5LQUA 4XGNA 3M6VA 1T9GR 4PW0A 1W6UA 2WJ3A 4BO4A 4BO1A 2HK8A 4FT2A 3UV7A 3WA7A 4R8SA 3Q8LA 2H57A 5JPIA 3VKHA 1X9IA 1VBNA 4X1YB 4XGQA 1G1MA 1V8ZA 4ZO4A 5T5QA 3U4DA 3WHIA 5ECGC 4LY9A 1HFEL 4XYEA 4OHCA 3QNMA 3UAGA 4CKCB 3O8NA 1T8TA 2VHWA 1SBCA 1DJLA 3WHPA 2D13A 1BNCA 4ZTBA 3IBCA 4JZKA 3GJXC 4KG7A 4Q9KA 3T7EA 2JEOA 4LWPA 1K8QA 4YIKA 1WKCA 1R1DA 4D99A 1UKEA 4JL6A 5AXBA 1KZ9A 2XUPA 3BIXA 3VSDA 1NV8A 4QBTA 4ZCQA 3GT0A 5JAOA 3IAXA 2O8BA 4CQMD 1W8DA 2XUGA 2JIOA 2ZRMA 4RDIA 3TIGA 3WDMA 3TYXA 4C0XA 4ZYWA 3OSZA 3FRHA 1ZX1A 2FEWB 1IOLA 1H05A 1Z83A 2JFOA 4TYPA 1TM7E 4CZ2A 2BEKA 2Y0PA 4PO1A 1DB3A 1WZUA 5B53A 2JBHA 1J1IA 1ZUD1 1PT6A 1M0SA 3WZLA 2PX0A 1JFFB 1YQWA 3ONWA 4JVNA 3UG7A 1SXPA 2AOUB 5FWNA 2GR9A 4HGNA 1P60A 2AYXA 3AGQA 3NVAA 4KI0A 4YRJA 3NX4A 1ODSA 1ZRMA 4D8UA 4V1CA 2G7MC 3JRWA 1G21B 2IRWA 3H1TA 5F9FA 1W0KD 2OHXA 3KVOA 4A8TA 2G5CA 2HRZA 4BVEA 8ATCA 4MMZB 5HK8A 3OQOA 1Q3HA 1SY7A 1ZEMA 1SKBA 4WD3A 4JI5B 2QAGA 4TV8B 1EUQA 4ITVA 1OV6A 3G79A 5HE9A 2J9YB 1E7MA 2ZWVA 4Q9AA 4E4TA 1SHTX 1JW9B 1E6EA 1QAMA 1K7EB 3M4YA 2JIDA 4DG8A 3KQSA 1T1IA 1NXVA 3GJ4A 1DHTA 3HFGA 3Q7IA 3FG9A 5CM8B 3MEQA 2X2FA 4DRXB 5LD2B 4AKIA 3G6KA 4XB1A 1X42A 2QYHA 1TE2A 4B4OA 3LBYA 5IDXA 2JGJA 1P2VA 1DC4A 1KQFA 4CV3A 3OQ6A 1O2DA 3ZGYA 4Q1VA 2W2MA 2DUUA 3A31A 4XDYA 1W5BA 2AN5A 3NONA 1XEFA 3PNOA 1JHOA 5ES3A 5FOXA 5CCDA 5AM5A 1KOLA 2RGXA 3IBFA 4IXWA 1QV9A 2I9KA 2FW1A 3UGJA 3EDCA 1LVUA 1YB5A 2ODPA 2IEAA 1O9GA 1SH7A 2Q0SA 1Q0PA 2RGYA 1Z0DA 3CLVA 3TVYA 1VQ1A 1P7YA 4ZDWA 2W5UA 2Z1DA 5JCZA 3L0CA 2BTQB 1EXVA 2RHLA 4X24A 1TK2A 5FOTA 4YMGA 5D00A 2VF8A 1GQQA 4U2DA 4URYR 4IDPA 5C80A 4BQEA 3HYCA 3VNSA 2PXAA 1T9AA 4M0FA 3WNDA 1REQA 3W7VA 4NRDA 5C53B 3WLTA 2P75A 2ZE8A 5DX1A 2AI2A 2REQA 3FDFA 5EKUA 4D8YA 3UXEA 4PWZA 2AOWA 2JH8A 1SVNA 4XLLA 3OIYA 4KDRA 1L2TA 2WG2A 5ADHA 1FZTA 4KOAA 1MV5A 2G08A 1DI0A 1KO7A 2CNWA 3T95A 1DLJA 4RU1A 4D4JA 1IM2A 2TMKA 2CHFA 2A5YB 5HF8A 4QM6A 2HMSA 1CEYA 2CFTA 5A1JA 2QMYA 2ODQA 4LDNA 4TKMA 3W8NA 3ZUPA 4D5GA 3H1AA 3CZRA 4PBRA 4JT4A 4NOKA 2Y05A 4ZCSA 4KIGA 1RHJA 4F56A 2YNMC 5EJ8A 3GDWA 4EA6A 3QW2A 5KS2A 2KX7A 3OUUA 4AJ9A 3MWEB 3P20A 1UK8A 4FBGA 5FL3A 1QKJA 4B4WA 4J16C 2PSDA 3PC6A 1XU4A 3ZY2A 3S27A 4URHA 4ONEA 2EFDB 3ZE2B 1FUIA 1QXSA 2C5SA 3LQ2A 1UBCA 3OFND 1ZG3A 5IX8A 1P9WA 1TEHA 2A30A 1BAPA 3DBVO 3NJRA 5A6SB 3ROPA 4B3HA 3DEKA 3RIMA 3N2GA 4QYXA 5G0SA 2VF5X 3GFFA 1VMDA 1QCCA 2V7PA 3A4LA 1K8XB 2NZXA 3OPMA 4IHJF 1CPYA 2O7RA 2WKWA 3WI7A 4ZMRA 2CL6X 4IIDA 4XB2A 1Q1ZA 4FKMA 3D8SA 1AKEA 1Z0UA 2X76A 3F7TA 4HH4A 4NH0A 4HNRA 4OYRA 5FTWA 3V2IA 4ALIA 2NO5A 3S81A 1DRJA 4ZANA 2AYZA 1QYIA 4M1QA 1GAXA 3KBBA 4HNAA 4LBYA 4GQIA 1U7OA 2O2EA 3OTWA 4R4JA 1DFGA 3GGJA 3KYCB 2I1WA 3F6BX 2PCJA 3IIKA 4LK2A 4F8YA 5C1DA 1HC7A 5AJXA 1FRFS 5HEKA 1FW8A 3T41A 3RJ5A 3F78A 2HMAA 2BD0A 5IXSA 4EX6A 1KEWA 4WNAB 1T4CA 1YXMA 3S68A 1EX9A 3KPVA 2PEZA 1KI7A 4MQLA 4HF7A 3RK1A 3BZWA 3WLOA 4EGQA 1GVNB 2JGKA 1NTOA 4FOPA 1PHPA 3LWBA 2WIAA 3IDFA 3SHFA 1JDUA 3CSUA 1E9AA 1V3TA 4KMSA 3WJ2A 3WMWA 1SU7A 4DQVA 4YJHB 4Q05A 1EK1A 1H1LB 3CUKA 4GICA 3AYXB 3K1YA 1YR2A 3C8MA 4Y1FA 5ENZA 1NMYA 5CTJA 1R6TA 1GD1O 1ZJJA 2P2ZA 3PFHA 1YBAA 4X20B 2L69A 3DT9A 3I2FA 3LHFA 4N6NA 1JAHA 3SQNA 3W06A 3V33A 4CMBA 2FR8A 2R8EA 1VIAA 4MJ3A 4D45A 2X0RA 5C51B 3O90A 1T2UA 2GA8A 4Q3NA 2J9XB 1PVOA 2FR1A 4XRGA 5AVRA 4A10A 3MTQA 2GVDC 3KSDO 3WE7A 2CF5A 3MLEA 4EAAA 2ZYWX 4DSTA 4EFKA 1X7DA 4ZGBA 4KO8A 2C77A 3FSRA 1GKYA 2ZPTX 3CE9A 3MWJA 4NZPA 1D2MA 2ZULA 3IP6A 5KJ6A 3LQQA 4F9FA 1YJXA 3ROTA 1AQIA 4LEIA 1QQTA 1ZITA 2GN1A 3UYKA 1KPGA 4MWDA 1XBTA 4C7XA 3FYDA 3P5SA 3O26A 4FUQA 3K92A 3IAS6 2GCOA 4NNJA 5H68A 4DSNA 3GGGA 4TLLB 4UHFA 4UFPA 1GT91 1XF9A 4WGFA 2DUNA 3V4ZA 3FGZA 5FO0A 2J09A 3D6NB 4KQ9A 2EW8A 5DH9A 3D4PA 1GR1A 4M8LA 3HXPA 2WWIA 2Q5HA 4TTTS 2FMTA 2H1LA 2GCEA 3MILA 4DEVA 3IB3A 2GCPA 4M0DA 3EG9A 5H3HA 5ADUS 4HYTA 1LF0A 2YWFA 4DAOA 3AR7A 3ZJYA 2NYUA 1M67A 1KK1A 1ODCA 1VG1A 2QD3A 1QIKA 4JXXA 3VR3D 2HHHB 3O75A 1ADYA 3FM9A 4NARA 2YZKA 4PVCA 1VB3A 1YH3A 4HMOA 4Q02A 5IDWA 1A76A 4ZAGA 3QXXA 1A4IA 3LX6A 3T5AA 5CIQA 3CS3A 1GPWB 4Z3KA 2GD6A 1R6BX 3IAFA 1UZNA 3BGSA 1T0HB 3IX7A 3KEFA 1BXGB 4MCIA 4QA9A 4URUR 5F7ZA 3UB3A 3WBBA 1SEPA 4GM4A 1OIXA 3H86A 4WEOA 3W7BA 1TKRA 2QJRA 4P86A 4YRGA 5GVRA 1FVHA 2P9QA 4JI3B 3LGSA 1WBJB 3QELB 3WYCA 2VTBB 4I4NA 5EZ6B 1SCQA 1JEJA 4WZBE 3F4LA 2Y1XA 2YMQA 4ZDKA 3BJZA 2B82A 1FK8A 1M83A 1ZMRA 2QRPA 1ZGAA 3II6X 2PR7A 2G17A 5EWLA 4B32A 2EGHA 3OZEA 2EKQA 5DGIA 2GEBA 2I2BA 4WBSA 2ONKA 4PX5A 1AZSC 2QQEA 4XH9B 2D2VA 3E22A 4RKYA 2OESA 2YHUA 1TJNA 1F7VA 1IAVA 3C3WA 5HFNA 4DLUA 2G80A 3OOYA 4DKXA 1ADBA 4OAQA 3VZRA 5A4DA 5AJWA 4H1WA 4RWEA 2NO0A 3E70C 1QTIA 2R86A 3JYOA 1GILA 3NV9A 5IBQA 2O2ZA 2NUBA 1JHPA 3H4MA 4GP9A 5J23A 2XQIA 3KKEA 1QGED 4JBXA 1SVOA 3FHLA 5CVVA 1U7UA 1T5BA 2QXUA 1XVLA 3A4VA 1XOIA 3M6FA 4FGZA 1ZMTA 5ER9A 3PHGA 5EMLA 4RCZA 5IC5A 4WN3A 1E4OA 3NHYA 2HRBA 4CHGA 7REQB 1SCIA 1XRMA 4LQ4A 3B52X 2JGDB 3FHOA 4WTOA 1JG1A 5AVVA 4XFDA 1V3QE 4LRUA 5H3LA 2JLUA 2YV2A 2V5VA 2KLHA 2XWBF 1UH5A 1ZA2A 4URWR 4AKSA 3DV0B 3U4CA 4U02A 4TKVA 1Q1EA 1FEZA 1L7EA 2GILA 3CR3C 3DV9A 1QDEA 4RPIA 1EBFA 1QPZA 1GOTA 2F1RA 4L8GA 2PWZA 2ZPUA 1F2TB 5GQSA 3RIXA 4C89A 3UWKA 3FTDA 1MC8A 2FMUA 5FUBA 1VLHA 3AUFA 3PXBA 3CVVA 2DF8A 1CS0B 1JXOA 3OE5A 3GAFA 3N87A 4ZEWA 5BYJA 5BVGB 5AHXA 1J9GA 4OP1A 4ZOLF 1GZSA 4DPKA 3WIBA 4E5VA 1PJLA 4BMOB 1IWBB 5K3OA 2AGVA 2MDTA 4N5MA 1W2GA 4ND8B 2Q07A 1F0NA 3BQNB 1H3NA 3GEPA 4KWIA 3UT5B 4MRAA 3V48A 4XDGA 4YUZA 3S1SA 1RW4A 1Z16A 1ZD4A 2IHTA 4K9QA 3ZI7A 5LZ5A 3I1IA 4OK5A 5EIHA 1LQTA 1KZ4A 2WIBA 4IMIB 3HACA 1D8AA 1OLXA 2H3HA 1CEQA 4K2AA 4Y2YA 5EQFA 1VSBA 3DBHA 1VCNA 4J4BA 1MAAA 1WA5A 1UM9A 1LI4A 3ICQB 2CDNA 1LEHA 5FHRA 5JXIA 4CV2A 5H8WA 2ZJ8A 2W2XA 1ODLA 1FP7A 2EKBA 3ZU3A 4L4RA 1AQ6A 1Z9BA 3JCZA 4H3KB 4XARA 4E46A 2J7PD 2FN8A 3GRCA 3I6IA 2V4UA 4TMVA 3PRHA 3G8CA 1D1PA 1NP3A 1GQRA 1HSZA 4H31A 4BNFA 2WUWE 3RYIB 2F59A 4AZVA 5ICGA 2XBLA 5LQSA 4K9RA 2FPRA 4JXJA 4EYOA 3HR8A 1GZUA 3ANLA 1KXZA 3MGKA 4G0OA 3QKRB 3WQRA 4BVJA 1AA6A 1U5AA 2VT7A 2YQ5A 4JB8A 3SQOA 4ZHQB 2C4NA 4P36A 2IHJA 2CLDX 2GKSA 1PF7E 3W79A 5JCOA 4F96A 1RAGA 3HLTA 1YFJA 3HNPA 3GA0A 3B60A 3DHEA 4RD1A 3WB9A 1AZWA 3VR6H 3WVNA 1EUZA 1UFOA 2WIJA 2YNMD 3LQKA 4C0HA 3TIXB 3GRYA 4LJ9A 3EISA 1EFPA 3MK31 3QEOA 4QEKA 5ALIA 5E6SB 3L7YA 1XD8A 2CCGA 1TZCA 1UWLA 2DBZA 1MZPA 5NLLA 1LTQA 4IIBA 4CBVA 4Q21A 5BSTA 4EHHA 1KFKB 2MSKA 1KEEB 3QE3A 3B82A 3QE2A 5DEIA 3LKDA 2VXOA 2G09A 1PZEA 2CNNA 3QPBA 3GHHA 5EGNA 3N58A 4XQGA 3JXEA 1XDSA 3G1WA 1A5AB 1JRLA 2D00A 3AOEC 1JU9A 3IUBA 3EA5A 3E7XA 1S2GA 5C31A 3B6EA 3LLSA 3R7AA 3T4UA 3V7NA 3GAAA 1CUSA 1WEKA 5TQ0B 3O31A 4BX8A 3LWZA 3M83A 2PVCA 2HA2A 3NWJA 1PG0A 3L04A 4OO3A 3H3FA 2C1EA 4UC0A 5LBTA 1W88B 1Z18A 2GLUA 4KE8A 3H9CA 4LGVA 3VU8A 4OHKA 2F3SA 4KQ6A 4Q7EA 2QGZA 2VDUE 3PKIA 1DEAA 5ALLA 2GF9A 3KOYA 1BG6A 3FUTA 5JW6A 5G0UA 2FR8C 1IEQA 2NZUG 2QYOA 3QXGA 2H92A 4WA8A 4RD4A 1RHQA 3WHLA 4ZQFA 1P0QA 1KDOA 2FP4A 2X23A 3QKUA 1ENZA 2VSNA 5HGJA 4OB6A 1YDWA 1N92A 2WW8A 2PKEA 5IN5A 1J0AA 1YNSA 4NBUA 2FUNB 4FIDA 2YFYA 4WJZA 5JRDS 4NMMA 1ULTA 4ZT2A 5BURA 3BHMA 3NRBA 3NIFB 3JAWA 4GYKA 1M2WA 5B6JA 2YBDA 4M1TA 2E5LB 4JC4A 1N6HA 3I42A 4MKHA 1CY7A 2VDNB 3HP1A 5K3CA 2BE7A 2WOOA 3VR4D 5T6MA 5ALNA 1M33A 3BILA 1L1FA 4AD8A 2FX3A 1YS2X 3OPQA 3RIHA 4BCDA 1FOEB 2APJA 2P5TB 2YWBA 3F3MA 3H9JA 3NHMA 3NAMA 4J07A 3Q6IA 4BRZA 1RI1A 4Y2GA 5AI0A 1SBHA 3ZI4A 2G77B 1PNQA 2JCBA 4HAIA 4QYMA 2RB4A 3KDSE 3BH6A 1L4KA 1EE1A 2VPQA 1R8YA 3V3KA 1WXXA 3VVMA 3W8EA 3V8QA 4QTZA 3VX3A 5A3QA 2GXQA 1VBKA 5BSGA 2IDMA 2YVKA 3ZDYB 2OD2A 2ZREA 1HOTA 4N7RA 3DJFA 9LDTA 5DLEA 2YJ3A 4C7BA 1T6YA 5ESDA 4DCNA 2HLNA 1HF3A 2ZBQA 5A4AA 2PPVA 4GKAA 2AOXA 1XQ6A 1TADA 4X91A 5CUQA 3NHZA 3AFIA 3REGA 1A0OA 3CLUD 4UEOA 3TKLA 1IN1A 1GSAA 2J5QA 1IATA 3LH5A 2AD1A 4JJZA 4QWWA 2Q2VA 1GZ7A 1QCYA 4LDPA 4ARVA 4BKRA 4BO9A 2EZ9A 4PY2A 4J0GA 5CRIA 2PMKA 3OZFA 3WL6A 3ZNOA 1ZAKA 3CYFA 3WLFA 3ENVA 5EWJB 1I94B 1JDJA 5BWOA 3CNBA 2FUG1 3UO8B 2AMYA 3WMRA 1C7IA 4ZXFA 4CIVA 3COPA 1M7HA 4F1KA 2BR4A 4CIDA 3FYUA 4GMHA 5B3KA 1XRPA 5KOYA 3BE5A 2YRXA 3M81A 2HMUA 4B7AA 3EVTA 4F86A 4O4LA 1TT7A 2AEFA 3EEQA 3UJPA 4B84A 1I0LA 4RFSB 4MQ4A 1VMIA 5LP6B 5FJIA 3UPTA 2O2SA 1PS0A 1TF2A 4J6FA 2VHXA 3TX2A 3M4XA 3T1TA 2O19A 1QG2A 1JU3A 4QQNA 4DABA 3O4VA 1YI0A 2JIZA 4X5OA 4RS4A 3HB7A 1IY0A 3ELDA 3S70A 4HAOA 5J47A 1RXVA 2VQ3A 3AOGA 3GUYA 2KQUA 3VSAA 3WADA 1JHMA 3BA1A 2Y0EA 1FXWA 2F9FA 5CA1A 3VZCA 4KJZA 2HTEA 1Q3KA 2ZG6A 3LY9A 4Q0MA 8OHMA 3DL0A 3KZMA 5TMEA 1KQOA 2NAFA 2PUJA 4EAQA 3OBIA 1TK3A 1MR3F 5KAPA 3UJNA 4X00A 4D6PA 3F47A 3OT1A 5J9FA 1ZCBA 1H2AS 3LU1A 4P53A 2G4LA 2BGNA 2JKVA 3LL7A 4AS2A 4LF9B 3PNPA 4X64B 5GTDA 2YN2A 5G4KB 4QSHA 1CR1A 3GRFA 4JWTA 5JROA 2Q8NA 1EP2B 3O1IC 4GYJA 5D5QA 2QRVB 1A9XB 1OYVA 4GEGA 2OK8A 4IWYA 4KQXA 2IKQA 2Z2KA 4S3MA 4MQUA 4EARA 4MVJH 2X0JA 4IIJF 1M2OA 2V6JA 3UG6A 1PNVA 1FC0A 3VPHA 5FADA 4JBHA 4EVRA 3GUVA 4WZBA 1SVKA 3RHTA 4FB4A 3DWIA 1UL1X 2H7CA 1K88A 3E0QA 1DDOA 4DLKA 3GC6A 3OIGA 3ZLTA 5BOVA 3U61B 5EPOA 2QL9A 3NTQA 5FP0A 3SBDA 3ZIAD 2LKCA 4DUGA 2BJVA 2D59A 1I7SB 1RMQA 3BB1A 4RM2A 4PZZA 3TUJC 5EIBD 5T41A 5AJVB 3PICA 4WBNB 3QLUC 4HQKA 1LLDA 4A6DA 1HT1E 1P1JA 1E2FA 2RKWA 4XI9A 1E1CA 1QSGA 3TSCA 4PG8A 2F3QA 1QZ3A 3CH4B 1LDGA 1NZFA 4BN5A 2BEVB 4U4AA 3RPEA 3HXQA 4AN0A 3OY7A 4LRQA 4YT4A 2C0QA 5GJCA 1WY5A 3ZZTA 4B7CA 4CLEA 1MCZA 2JJ8A 2RGAA 4KFUA 3KEMA 1G3RA 3BIWA 4PZLA 5KMGA 2Y9MB 4RE5A 2HWUA 4OPMA 1CRQA 4OUDA 1DO8A 1U0LA 2Q9UA 1HTBA 3DONA 4JI1B 3T5PA 4BVAA 1OU4A 5UKDA 2FE4A 4Y3UA 4AO6A 4XA8A 3GA7A 1KO5A 5CJJA 3A1VA 3OOWA 3DO6A 3K0CA 5AVJA 3AEKA 4ZZ0A 1E5LA 4CM4A 4R54A 4AQDA 4INAA 4DCTA 3ZV6A 1RIIA 1O4VA 1NF3A 4NH4A 4FCWA 3QKWA 4KXYA 5DTJA 1TKCA 5FORA 4BMDA 1T0IA 4YBZA 3A06A 3KKKA 2PXHA 3AUTA 3LUHA 4NIMA 4ZKEA 2ERCA 4YRMA 3QHAA 1JEDA 1EUDA 1SZPA 3PC8C 4KL8S 4OLHA 1SB9A 2LDBA 3I52A 4OQ4A 4DDMA 1CFJA 1K92A 1VA4A 2GCGA 2WF7A 3EUAA 4LDZA 1L5OA 2DQ4A 2PH5A 3NBZC 4LQDA 2W2KA 4OFWA 2CNWD 3RS7A 5KNCH 1KI2A 4P1ZA 1UKCA 1DOHA 1QG4A 4IOJA 1EP9A 3DXFA 3O84A 2CGEA 2VYCA 1P1BA 3HPRA 3B1VA 5JCOC 4WK0B 2ZRBA 3QUTA 2EP7A 4EJFA 4V0OA 2BTEA 3LGXA 3HHPA 3B20A 1JPVA 1JT2A 1U02A 2G4CA 3DHVA 1KDVA 3WGJA 4L0DA 5BO5A 4GR5A 1KU6A 1OCEA 1N34B 1ZVQA 5DCLA 5ECDA 2IHNA 4FEEA 1GZDA 1M2NA 4BMCA 2B30A 4BTVA 4DA8A 1HV8A 2NO9A 1FVXA 5D84A 1RXSA 1ZM3A 1K63A 4YJ2F 3AUKA 3ZDFA 1B73A 5IHPA 5IZCA 1HURA 1I3MA 1AKMA 5DZSA 1NBEA 1O1YA 2OV6A 3H1EA 1GAEO 4LJ8A 3EUEA 2J67A 4EJ0A 4HLQB 4F3RA 2FVYA 1R5OA 2DX7A 3LTEA 1RQ7A 3DKVA 1TUGA 2ZT7A 1R66A 1EEXB 2FRXA 1U99A 2BWJA 3UJ3X 4X95A 5AHRA 3GZNA 5JNLA 2F3PA 5EJIA 1WHTA 3EC7A 4NCBA 1T35A 4F92B 4C08A 2HSGA 3MCTA 1LBSA 3QF4B 4E2WA 1KP2A 5TIIA 1M66A 2H7XA 2IVFA 3FPBA 3QPAA 2B21A 3DZDA 4CI9A 4QEZA 1FYXA 1KAHA 1SUDA 4HNQA 4MWGA 3SD7A 1YHNA 2H1HA 2IS6A 5AW7A 2WB2A 1RYHA 2HPHA 5CD9A 3RJ9A 3COSA 1N8SA 4OHYA 3KKMA 1CF9A 2Y2UA 3WGKA 5KYNA 3TO5A 2EVWX 4TYWA 4K9DA 3MMZA 5EYPA 4Z2YA 1F9AA 2VLIA 4REQB 1IIBA 1S2LA 4E1VA 2QTVA 2IH5A 3VYRB 2W90A 3NDJA 4EI8A 1HKHA 2BHLA 3I9JA 4ID3A 4E11A 4R7ZA 2OWDA 1FTSA 4CU2A 4S1WA 2G4VA 5HRCA 1H9AA 4RIFA 1Z22A 2VHEA 4OJQA 1P1CA 4GLBA 4M3NA 4UMFA 1SR8A 3ETEA 3T12A 1O9BA 1D6SA 3PQ8A 1DIRA 2FPLA 6ADHA 1UBJS 1XA0A 2BFCB 3JSAA 3ILHA 1IZYA 4L2IA 4KR0A 3RUIA 5EFOA 4NBSA 2IVZA 3D5TA 5FAXA 4CT4B 4YV1A 5H80A 2EQBA 2EGGA 2R66A 3NT5A 3QLVA 1P2FA 1YFKA 2I65A 4P54A 4DVJA 2E1PA 1A96A 4U2EA 4GM0A 1WTCA 1VXRA 3SC3A 5DT2A 3UMBA 6REQB 3UKDA 1TCAA 1AH2A 3IALA 2H1CA 5KJFA 3KFLA 4WK6A 3VO8A 1QRRA 2R1VA 3R6LA 5AM0A 1PLLA 2IBMA 2C8JA 2WJWA 2WYWA 1YR7A 3BEOA 1TX4B 1F48A 1BKDR 1WY7A 4L5IA 5KYUB 5ES4B 5DYYA 2WWVD 4YEDA 3MRTA 2V0CA 2O7VA 1S2OA 3VR5A 4M7OA 4LKRA 4WCVA 1XVIA 4J6EA 2W2TA 2GERA 3EZ9A 2OVFA 3AVYA 4CMEA 3V8NA 5AOAA 1KSHA 1ZCAA 2I3DA 1Y8RA 5JAMA 1RQRA 2FU5C 5DK4A 2OGTA 1HE2A 1QOPB 2KE5A 2PIAA 1X86B 1Z5UA 1D6MA 3QJGA 1RLUA 1DC5A 4YAKA 4OSOA 4F1JA 1TYAE 3O9ZA 3U49A 4YJ3B 3O5AA 4MKFA 1KNQA 1MAVA 1SBZA 2O8BB 4BMSA 2PUDA 3C6MA 1QBGA 3PEEA 3C8ZA 3M49A 2VIIA 4DLZA 2R8PA 2ATCA 1T8UA 3L43A 1AIPA 2GARA 3ENKA 1FNBA 4FR0A 1EAYA 1YS4A 1NONA 2QPLA 1WMBA 3EEFA 4XGRA 5YASA 4BE7B 4DCOA 4UE2A 1A27A 3G59A 4QARA 1U2ZA 2R7MA 4B6QA 3GJ6A 2EYQA 1W2WB 4HHEA 3WFZA 3CNHA 1GKKA 4N9QA 4V1CB 2JBAB 3ILSA 1EVYA 3NBMA 3OSUA 4DIOA 1K3UB 2CW5A 2FSPA 3LFTA 4K88A 3LI2A 2Q41A 4JJEA 2NWQA 2OCPA 1A2KC 1B4DA 3AJ9A 3G8DA 1F06A 1PQPA 2XUIA 1EUCA 1XEWY 3QFFA 3CMCO 2IZZA 3GMSA 1JAXA 4CODB 3ZWOA 3FJYA 1WUIS 2AJ8A 3W9BA 4BP9A 2QAGB 1SXHA 1D2NA 1BOOA 1OVMA 1A5SB 3AH8A 2ZVQX 3LBHA 3TM5A 4WOBA 2OHHA 1TO1E 4CRWB 1IJKA 2OHJA 1HZJA 3IQGX 2P9BA 4U39A 3A1TA 4IDOA 4LG1A 4PZ9A 4UREA 3A6JA 4Y9RA 5FR1A 3SYKA 2GESA 4FW9A 1DKUA 4O33A 4E2FA 2C4HA 2IS2A 3A05A 1IZ7A 4FYJA 1HORA 3EH1A 4UD6A 1EWTA 1BDIA 3KB8A 2CNBA 1TZBA 4DSOA 1HDCA 2IZ1A 1NE7A 4HQ0A 1GJRA 4RELA 4R16A 4JC8A 3CQ9A 3IVXA 4KE7A 5CEFA 1DGQA 3R4VA 4RMHA 5AKLA 3ROFA 1VCIA 3CJTA 4OL0A 3OFJA 3PPVA 4RNDB 3DLPX 4LJAA 4OIFA 4WOCA 4U7FA 2F64A 4GFDA 1XZKA 4D92A 3IQXA 4XYLA 1J4AA 5FHQA 3H2GA 1CQJA 3U1BA 2G1UA 3DMFA 5DTEA 3DBLA 3SOPA 5B4UA 5KOJA 1WU7A 5HA5A 5KREA 4OOFA 1RKBA 1X7XB 4BNTA 2RI6A 1EIWA 2ZTSA 1YBMA 1XZGA 1KZGB 3DHWC 4BNUA 6ABPA 1DWUA 5DBGA 3L8FA 1XNJA 2E4WA 3RTAA 2IK8A 1JBEA 2VNIA 1UC5B 2VPYA 3A36A 4QT0A 4X6XA 2JKZA 3K5PA 3ITKA 3KUDA 2VG8A 4C2UA 4V02A 3CX6A 4HY3A 2QSZA 3A0UA 4IZ6A 5ITVA 1P61B 4GBMA 3C6ZA 1KAGA 5EE5B 1JTFA 3REFA 3HCWA 1AMUA 1U11A 3DEYX 3QY9A 4TROA 2X0NA 4TZ0A 1SRRA 2ZRGA 2A9OA 2FZEA 4RBNA 3KB2A 2JEZA 1V8PA 2Q0QA 3MRVA 1E6KA 2N1BA 4RHCA 4UCFA 3HYNA 3TW6A 2NX2A 4TVBA 2WLSA 3PB3A 2NN3C 3OH8A 5F5XA 3ZDAA 5JZSA 4RA9A 1SKMA 2HLPA 1J2UA 4DDWA 2QLFA 1BQEA 1ZIYA 4GX0A 1CYDA 3K2BA 4LE1A 4CL3A 1P5FA 4TQ9A 2ZBEA 1R8JA 1R9GA 5CH8A 1U04A 3KJNA 1YZKA 2OD7A 3B5EA 4AZ3A 1RWWA 1P2SA 1Z4IA 1E58A 4B81A 5L7TA 3F6SA 3GLHA 5FEMA 3PF8A 3K16A 1I0ZA 1TTQB 1G3IA 3N7AA 4EGFA 4YRZA 1E1DA 3E9YA 2W4IA 2M32A 3FFTA 3KZNA 4J94A 4QE3A 2HA4A 4RVNA 4UEQA 5DIZA 4B6SA 1YA6A 2PIDA 3W3AH 3QBDA 1FDSA 4ZQHA 4ZV9A 1WE2A 1KOJA 2DLNA 2R84A 4LJ6A 3WIVA 5IKOA 5IT9A 4A92A 3DF7A 2FG6C 3N2GB 1E63A 2K2QB 3ZVNA 3VC1A 2N46A 3HA3A 2P27A 1MABA 4U6QA 4CM6A 1SD2A 3OZAA 3ZZ1A 1RI4A 5KYXB 3TCNA 4IDQA 3K0SA 2GZSA 3ZHXA 3MC1A 3KIPA 1KU0A 4FKZA 3KT6A 4PGFA 1CR4A 2P62A 1QH9A 1YA4A 3EBPA 3MN1A 3TRIA 1ENYA 2AJCA 4CKEA 5L53A 3F73A 2UXDB 4U2CA 5IZCC 5KQSA 3VPSA 4FI3F 3CBGA 3OFVA 4E70A 4Z4FA 2BKAA 4KR7A 1I5EA 2OVBA 2C5FA 5J43A 4GL4A 4OQZA 2VRCA 1Z06A 2GEDA 2R00A 2ZIXB 3KJFA 5A05A 4C21A 2PUWA 4HGPA 1NG9A 1S8AA 4C6RA 2AHOA 1AKUA 1IPFA 1C8KA 2A1TR 1HLGA 3P0IA 4GE3A 5DI3B 2DUMA 1EB8A 1YIOA 4E21A 2R6ZA 2OK7A 4L0MA 4BNIA 1UMCA 3D7MA 2X0EA 4I4IA 5FI5A 4H35A 3PD7A 1QIMA 5JXHA 1W44A 4PNHA 3THRA 3P2JA 1PTJC 2CXRA 4KXMA 1FDRA 1Q1QA 4HRVA 3TD6A 3CXRA 5ENVA 2FW6A 1DXOA 1JE0A 2X2EA 1P7PA 2ECFA 2VDOB 3R77A 3LPNA 1IUKA 4LTNA 4TS4A 4KO4S 4GRDA 4EHBA 3VVCA 1OLSA 3FPJA 3H3XA 3U1VA 4C3ZA 2R1TA 2Z04A 4HB0A 3M6LA 3U7EB 3R3VA 4GEKA 3FOEC 2FQXA 3RWOA 1JFTA 1JA0A 2QM8A 4U8HA 2D5CA 4PSVA 4KQIA 4AP6A 5ERYA 1ABBA 2B9VA 1SU6A 3VPCA 2ZM6B 4JL5A 5FF9A 1C7RA 5HIMA 1FMCA 1DSSG 1GU7A 3SEZA 3BMCB 1ZU4A 2EJTA 5BV7A 3T5BA 4FDTA 1IAQA 2XCUA 3CT4A 4DLBA 1H65A 1YQ9A 1Z8DA 3O83A 1CS4C 2P41A 1P0PA 1W47A 3BULA 4FXOA 2ZXUA 3HA7A 2IL1A 1EFLA 1KTVA 4OA8A 2E4YA 3K96A 3LKVA 4D9MA 5ALEA 1S8NA 2O8EA 1N78A 2R6GA 4P35A 1J8DA 1GL7A 3DXYA 4D25A 1QR6A 4QUAA 4P58A 1RWQA 4GLOA 1H6DA 4YRKA 4H2DA 2OQRA 4ENWA 3P9ZA 5EJ5A 3PJGA 3WFIA 1OF1A 3PJFA 2UUAB 2QMZA 3GVHA 1DL5A 3MFQA 5FUXA 4BC1A 4JXKA 1DCTA 3FLEA 2CHGA 2A9JA 4PG6A 3MTJA 5C1IA 3JQ9C 4G23A 3ZG6A 3JD1A 3ZWWA 4D43A 1DO2A 5HIKA 1PZXA 3GDOA 3AEZA 3FBTA 1KVUA 3PFBA 1AK1A 1MD9A 1RABA 2HBQA 2M1XA 1JLKA 4PRZA 3BT7A 4NULA 2OV8A 4X61A 1R6AA 5GJWC 4XM2A 4CMEC 2GRUA 2OYRA 1WQ1R 1J70A 3QKTA 1ZUHA 4O4IF 1RBQA 2WRZA 4JJIA 4ND5A 4RGBA 3EG9B 3NIGB 1FNNA 4WEQA 3A3KA 3E8XA 1XDDA 4JOBA 5T67A 2IHKA 1C29B 2GPJA 4E2YA 5FB3A 3AV3A 3HR7A 3L7OA 1E1NA 2GEKA 4ZVUA 4BKMA 2FDXA 2IY7A 1CZRA 2PH1A 5FCDA 4L7VA 2VP0A 3R9WA 1BC5A 1T5HX 3ETGA 2P9JA 4NAUA 5DWQA 4RF4A 3TMAA 4P92A 3U44A 3P2YA 3L40A 1J0DA 1SBNE 2Q1UA 4RH0A 1QH8A 5HKLA 1OFUA 3RBAA 5A9RA 3RUFA 2AN4A 1E2MA 4TXJA 4KN5A 4R1TA 1VJTA 1X0XA 1TA4A 1BEUB 3HNOA 4WLNA 2NYVA 3WGHA 4U7DA 2QNIA 3FTQA 2KM1A 2QN9A 1JQBA 3HP4A 2PWYA 3ZCTA 1T43A 3QXSA 1Z75A 1T29A 2Q9CA 2VDPB 2QD2A 2ZSDA 3Q98A 4K8RB 4LXGA 2GN4A 4GR4A 1AUVA 2REXB 2RI1A 3NKFA 3TUIC 1MEJA 3FDIA 1JZTA 3FD8A 3GW8A 4LJSA 5EWLB 4E3WA 2ARKA 1O5IA 3H2BA 1PT7A 1W29A 3G2LA 4G25A 1E2NA 1P6QA 1XTSA 3N2NA 1X8LA 3R0ZA 3OCVA 2M6KA 2DETA 2ET6A 3LUBA 5DCUA 3E81A 2PMDA 3CGGA 3JYNA 4A8HA 1RRCA 1SHLA 2WM3A 4YH1A 5C8DA 1IG0A 2FUKA 1AGPA 2QUKA 4KX3A 3BMNB 4WMLA 1DC6A 4UTVA 4DV6B 4NV3A 3OPXA 2YINC 2XZOA 3S2SA 2JIZD 2W9XA 3L0YA 3H9GA 2ZI5A 3RB8A 5L3QA 2WIKA 5J2UA 3J7AC 4F06A 4MRNA 4H0FA 1H2ZA 3IELA 1QRDA 3PR1A 1FY2A 3WIUA 1KAQA 1LSUA 3LDUA 1OAAA 4E33A 4G5GA 2XE4A 3KR1A 5GONF 4J76A 2YIVX 4JJ7A 4K9NA 4PE5B 2PMCA 3H11B 5DNAA 4FDVA 3DVAB 2LZ0A 5AO9A 4AWXA 3I53A 4IHKA 2XDYA 2RIRA 1X1EA 2GZ3A 2Z3ZA 3D5EA 3T7SA 3U62A 4JEIA 4D9IA 2EATA 3AI3A 1E9RA 1YGPA 3NDRA 1BCSB 4LZWA 2HNAA 1OWLA 1OH7A 4BASA 4GNRA 2L42A 3DDNA 2F6RA 2HBYA 2CD9A 2PNFA 5CPFA 1GYPA 1R7RA 3Q10A 4UUOA 4YBRA 3EMDA 3SG0A 4D9FA 4EY8A 2NO4A 5TQJA 1X2BA 1M2VA 1IVYA 4F8EA 2W6IA 3JQ7A 1R0CA 2XCQA 1RWVA 1VLVA 3K4QA 4XSVA 4EI7A 1EI9A 1N7JA 4WXRA 1K3FA 5FPKA 2BI7A 3CLSD 3S2UA 2Z43A 1XHFA 2L19A 2X15A 2VPIA 3RT9A 3GP8A 1C3JA 5FUWA 3QM1A 4IV8A 4NENA 4DUGD 4H15A 4RGYA 4HAWA 2JLSA 4LVUA 4ZAZA 5AQ1A 1U2PA 4QYIA 4JFRA 4DDKA 2LE0A 1OZHA 1BFUA 2IU3A 4FPXA 4BKOA 4H77A 2QZZA 4JBGA 3IP3A 1NM5A 3T54A 3ONFA 1LKZA 1YZQA 3DBHB 4PIPA 2Q6TA 1ID8A 2HRDA 3OP4A 1UM9B 4D57A 2QB5A 3FPLA 2QN8A 4AF6A 2IYRA 5AT1A 5EZQA 3WKBA 6CHYA 2QG9A 3ZJ4A 1ZK3A 4CIAA 1QIEA 5DHUA 1U8FO 5KZMB 3KQMA 3PA6A 3WWPA 4QICA 1IY8A 1FVFA 3LLVA 4MXDA 2HJWA 3S5UA 3DFIA 4WBXC 5DSZA 2QVXX 1RM0A 4I50B 1AGRA 5BMVF 4LF8B 4X1KB 4G2NA 2XA1A 3QTLA 1V8BA 1CP3A 5KYWA 4MHTA 1KI6A 3P2EA 3WK9A 4ARBA 3CR7A 4ECAA 2O8FB 3W9UA 5I3ZA 3FVQA 1BX3A 2GN9A 4N3CA 1LI5A 5DIFA 2WJPA 4B3IA 3CJRA 3TGLA 2HCFA 3HFSA 5CYGA 3RVBA 1JXMA 3NAZA 3U3MA 4OY3A 1JXAA 1CNMA 1IIRA 3HCBA 1II8B 3LC7O 4RIGA 4E51A 4XJSA 4L4UA 4ER3A 1DKNA 1NYLA 1IPHA 1UR5A 3R7DA 3JS5A 4HFJA 4C7OA 4RWZA 4XTRA 1JWBB 4LXUA 5KQRA 5DXAA 1EXNA 3KX2A 3QITA 2JKYA 4DY4A 4QHSA 3IAEA 1H93A 2VEDA 1TYBE 4HVAA 1ITZA 3E82A 4KVFA 4L0QA 5CB4F 5JMTA 2IYQA 2GT1A 2HKIA 3SEQA 3AL2A 1L6RA 1RQ2A 3GLFE 1QIGA 3HV2A 3BGWA 5LBUA 3UB4A 2O23A 4D74A 5G0VA 1W75A 2VYFA 5LYJF 4ID9A 3W6PA 5M29A 2R6DA 4F4CA 1U81A 7ABPA 3O4FA 1EM8B 1M2JA 4BP8A 1RVV1 4YDSA 3Q5DA 3LDAA 2C3YA 4M1YA 4UARA 2XVAA 1OAKA 2ZUVA 3DWFA 2DCMA 2D8MA 3CO5A 2QTCA 5K0EA 3P0RA 4ON9A 1VBMA 3R5SA 5CM9C 4ZCPA 1ZONA 5CFRA 3N1UA 4XSHA 4X1OA 4G9GA 1VLMA 3A7EA 4PZEA 1CUVA 2FZCA 2VK4A 4ZVOA 3JAKA 1MENA 3OHPA 2ZBGA 1LLUA 4WKNA 4Q7KA 2FP4B 4FN5A 4HGRA 1EINA 1GSOA 4PFKA 1RXYA 5CH3A 1CG6A 5DNWA 1PUJA 2BUAA 4N5IX 1VKHA 4M46A 4OI0A 4QBFA 1UKBA 4I55A 2FMXA 3OZGA 1TPYA 4IJVA 3VDMA 3JAWB 1OJ7A 4UUQA 4D80A 5IKEA 4UAGA 5EUMA 3HI6A 4YXWA 3VO9A 3TFQA 2GM9A 3CF4G 3IQHX 4DV1B 1NT2A 3WYNA 2O0LA 2WJVA 1PD0A 5TQVA 3W9YA 4DB2A 3LZ6A 2H17A 1L8AA 1XT6A 4LZAA 3T1QA 2PSSA 3KQNA 1KZ6A 3QP9A 1YZGA 2Z2XA 1AUXA 3K0AB 4L4XA 2FPWA 4E22A 2WTEA 4ZI7A 2J3LA 4JZYA 1E6LA 2XA2A 1S1MA 2E4AA 1XL0A 2ZJ6A 5KYTA 1P0CA 5KKNB 1TC1A 4K1XA 5J4KA 1U1CA 5GMOA 3GDGA 2QRNA 1GNRA 1UBGA 1U2EA 4CCYB 3PNYA 1DV1A 1QX4A 4UDYX 4QYTA 1T0UA 2IX9A 3I5AA 1NC3A 4Y2XA 3ZGVA 1LD3A 4MARA 1M72A 1TVCA 4P4TA 1SJ9A 1UXGA 3ZU6A 3L05A 1IQPA 4AXXA 1F60A 3WHKA 3OTOB 3GWZA 4MVJI 4QJ5A 1GQFA 1ZJWA 1UZUA 1P2DA 1TECE 3GMIA 4OLJA 5DHQA 1J0BA 1EE2A 1E0JA 1MX3A 3FYUB 4JYCA 1E2PA 4I2VA 1AZTA 3EGXA 3FGPA 3QEBZ 2HYDA 4TOIA 1T6BY 4ZZ2A 2XSZA 3H19A 1I9GA 1UC4B 4ARCA 4QOHA 2C59A 3PUHA 2D4HA 1I5OA 2C4UA 2WFMA 1U8AA 3IMCA 2QWXA 1T0PA 3B6MA 4KIWA 2CKMA 2JGEA 5AW4A 3SXJA 1HO3A 1HE1C 4GO1A 4E7OA 2IYZA 4NJEA 4BZXA 2HU2A 2ZUWA 4EKGA 2VZ0A 1QHEA 3ICPA 1QP0A 3AF6A 2W6QA 2Z2JA 4BNDA 3GLSA 3HE3A 4U1RA 1YASA 4BB5A 2D2IA 2WT9A 4MCJA 1K8RA 1B26A 1P4JA 5KUTA 3OF5A 2B37A 3T5DA 2DHQA 1MOSA 4IH4A 5CA1B 2IZ6A 4TV8F 2X58A 3S29A 3V5NA 4BU1A 2NNLD 2O3TA 3BRQA 3MVEA 4RTQA 2IC5A 5CLJA 3G5LA 1TTHA 4C4RA 2F8TA 2G0AA 4JP1A 1JR6A 1T10A 2G67A 4G56A 2ZT6A 1YDMA 1JNYA 1XDGA 1SPXA 2C95A 3WV5A 2E18A 3R9XA 2XYRA 4FN4A 1W8IA 3GELA 4GPZA 1FS4A 4K0KB 5AVZA 4YQFA 4HUJA 1SQ5A 2ZITA 1J42A 4RV4A 3C6YA 4UQPA 1V25A 4D81A 5IJZA 1IRIA 2F90A 5HIIA 2QL7A 3V9PA 4QNMA 3DE7X 2VHVA 1JEAA 2OCXA 4REMA 1YJBA 1GNSA 4E03A 4DBZA 4MVWA 3VC7A 2NPIA 3R6DA 5FWXA 1BMTA 1Q1GA 2V98A 4GPTA 1KI1A 1Q1NA 2LTAA 1NL3A 2UUOA 4OSPA 3GT4A 3ZGXA 3QA9A 4CF4A 5KC8A 1ZMBA 2XBMA 1STOA 1CTQA 1ZOOA 3ESXA 3LLUA 3QYAA 4RE6A 4B7UA 3G85A 3K6JA 5DCWA 4EB8A 2B8EA 1GPBA 1KQGA 1E77A 4J4HA 1HT0A 5L7WA 2J6HA 1ELOA 2NM0A 5EQJB 2WF8A 2HJVA 4AJIA 5DLQC 2MR5A 5E95A 3F3YA 3I6BA 2HC9A 1AF4A 4S04A 2GZDA 1G6Q1 3NS7A 2C7PA 3MCVA 2QW1A 2NXNA 5G53C 2L18A 1XELA 1PJRA 1UODA 3UK7A 3PD1A 4X44A 1P9LA 2Q50A 4DCSA 1XXLA 1SQFA 2OP1A 2PNJA 4EPTA 3LVQE 3LQ4A 4G5XA 5GWXA 4HD8A 5KMGB 4QVIA 2HADA 3N8IA 2HWYA 2ZJ3A 1XZHA 4BJ1A 1ISIA 3AUSA 5CVUA 3MBKA 2ZT8A 3PHJA 4U7GA 4M7PA 4CTOA 4X45A 4AVYA 1HX7A 1KBQA 4HX9A 1GDDA 4UTNA 1N3IA 4PCAA 1M0WA 4ZC8A 3A9UA 3AEKB 1TNDA 4HL6A 4CF6A 4CM4B 3W8FA 1IYZA 3PUVA 5A4JA 1E0AA 3VU9B 3BH0A 1G3QA 1CDDA 3ORSA 3PG5A 4HN9A 3W8DA 1QO0A 2A5JA 4QDOA 3CRMA 3GLGE 3V1YA 2FGJA 1S2MA 1MFPA 4DBVO 1Q50A 3S3TA 4ZOBA 2PX4A 1CYEA 2WG0A 1R9MA 3FAKA 1N5LA 5AR1A 5K05A 1GT6A 2NU8A 3IPRA 4CXMA 3DUWA 2ATXA 1RE0A 3FTCA 1N25A 3O8RA 3IKJA 1XTQA 2HIAA 3SLGA 5A3JA 1AXRA 3URKA 3BTSA 2B3TA 1KMHB 4J3JA 4ZMBA 3MSXA 4CETA 3PR2B 4Q82A 1H6AA 2WFLA 1OC4A 2AG6A 3TTUA 3CZ5A 1QH0A 1MORA 3D0RA 4PRYA 4Q1BA 1QB7A 3UJ7A 2H3EA 1EXMA 1SQ6A 1WV0A 1UEXC 4DLXA 3FNQA 1Z2NX 2C2WA 2ZB2A 1H1DA 2FA9A 2FZ4A 2H07A 2XGMA 2V97A 3PT9A 2OOKA 3SICE 4DXAA 1L3IA 2C54A 4ETMA 1XZPA 1MO3A 1F38A 2I3AA 3A9TA 5BP7A 1DEXA 4D0SA 3P26A 4IW3B 3V1NA 4PR3A 3DWEX 3U4AA 4ZGGA 5DNCA 2V3WA 3JVUA 3RROA 2WSYB 4GOND 4M49A 1KSFX 3EHEA 4PLTA 4UBNA 2ZYRA 4BPRA 4IXDA 1PJ3A 2IYOA 3GJYA 4FX5A 2ZUCA 4MSUA 1HT2E 3RVKA 4Z2AA 3OX2A 5FTKA 1ZI9A 4KLAA 2BGKA 1CUUA 3UAYA 4MCHA 1NF9A 2X13A 2AZDA 5FNVB 2CDBA 1CUJA 1WHTB 1RBMA 1T26A 4UM8B 4PYOA 4WY5A 4O4JA 3E48A 4D4GA 1TQ2A 3T1NA 3U3DA 3SF8A 2A1UA 2V6FA 4NK4A 5K4AA 4ITUA 2GXAA 1A8HA 4OQEA 3DPIA 2VRCD 4NEGA 3KLNA 1NYQA 4R2HA 3ROZA 3K20A 4WKGA 2BFOA 3KWFA 1Y1LA 4V3CA 3AWDA 3ZJVA 5TQ2A 3JRXA 4RL6A 3T7JA 4IV0A 4FYPA 2PEYA 3BJMA 3AM1A 2IOQA 2EFYA 2XE7A 3AERA 2QTVB 1NDUA 1HQYE 3SR4A 4CHTA 2VHUA 5JJ5A 2AXPA 5EKTA 4NFLA 4EPYA 1JDZA 3O3MB 3GLFA 1UXKA 5I4KA 4YGXB 4YV0A 1ND6A 4HDSB 3GZTB 2VDWA 4OGKA 3H13A 4ZIRA 1V39A 3VRHA 3ZIDA 4ZRMA 4OLBA 5FIUA 4CKBA 1JF8A 1X1SA 2VH2A 1AMOA 4DIBA 1WG8A 3B2QA 4L2IB 4ANFA 1MNAA 2AG5A 4LCJA 1G20E 3WIDA 1U1DA 1SA0B 1VKZA 1XYYA 2I3BA 2O0JA 4IMPA 5DGHA 5ALQA 4P3XA 2B1QA 3A28A 2XMZA 4ODIA 4V3BA 1C7JA 5I9TA 3EZ6A 5P8WA 3TI7A 3C74A 2LKDA 2JVJA 1QHHB 2ZATA 3DD1A 1VPDA 2NT4A 3FAZA 2XKBA 3BMOA 4EGSA 2JHFA 3AL3A 4MV1A 3WYFA 4BV2A 1AKNA 1RCTE 1RP1A 4EVQA 3FCSB 3P9YA 4ZYXA 2RH5A 1HL7A 1I10A 1XLUA 2C31A 2H4WA 2P65A 3ACBA 4S12A 1G7SA 3WLPA 4F4UA 3EZ2A 1ORDA 2GZ1A 1WDLA 3L8DA 3FCXA 2VHCA 4KQFA 1FDVA 3R74A 3RARA 4YRRA 4UHHA 1VB5A 1L4YA 5B55A 4X90A 3BFPA 1EFVB 2GJKA 1O7JA 3DDCA 3QI7A 2RGWA 4GRAA 3UWSA 3K8QA 4QUBA 3VZBA 3ASVA 1JHZA 4BNLA 1P5JA 1Y7IA 3SS9X 1E79A 1Y3CE 3AVUA 4PWYA 2E1RA 3PQFA 3SX4A 3R23A 3WYGA 1ETUA 3REQA 4LZPA 4WN9B 2BKEA 3TZCA 3V1LA 1J22A 2RFLA 1SK8A 4HV4A 2BV3A 1P4SA 3TQTA 2QY9A 3UKJA 1IN6A 3H75A 5JAUA 1TFRA 3U31A 4UU8A 3U80A 4E1BA 5GINE 1JYEA 4R9NA 4O2LA 2J5KA 2OQIA 2QTAA 3I8XA 4MUJA 4YP7A 4A82A 4FS8A 1T9BA 1EE9A 1D5CA 3D4BA 5CT8A 3EFOB 3W5CA 4B6FA 4NC9A 2WWWA 2ECQA 3M6MD 2FJ0A 1FDWA 5DF1A 4C0QC 4W4TA 3KQLA 3A3PA 5BNWA 1PWXA 2FDRA 2HDOA 4YMLA 1FFWA 3AHCA 3MUFA 4XSGA 1S2IA 2ZU0C 4O0MA 2XCLA 4C29A 2BH2A 4HH1A 4F1WA 1X6VA 3PQDA 4NY1A 3IQDB 3WK8A 1QIIA 3L7CA 5CTAA 4UBOA 1USIA 4A0RA 1GFIA 4LRXA 1TAQA 2GRJA 5IXYA 1E2JA 3KYBA 4L5AA 4A2QA 1EQUA 1UKVY 3R5TA 5FWDA 4AAYA 4D4LA 2QVCA 3N2IA 5DEOA 1Z33A 2RGGA 4R1OA 4BWGA 5KTKA 2YY6A 2W71A 1I24A 4LI0A 1XWIA 1GPLA 1NMSA 2KSQA 3GDFA 2HPAA 4LQLA 3HYLA 4BV8A 1TZ2A 2GZ2A 1PNRA 1FFCA 1PYOA 3R3UA 1E9CA 3R4CA 3R3JA 4K6GA 3P9KA 1MIOA 3OC0A 1NVTA 3PLRA 2BR5A 4OREX 3KEGA 5K45A 2BY4A 2MINB 2PWPA 2J48A 2NU7A 3HDQA 1Y4UA 3HN2A 4IH9A