4IV0A

Crystal structure of n-methyl transferase from plasmodium vivax complexed with s-adenosyl methionine and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
263
structure length
263
Chain Sequence
ISEPVDIKYLENNQYSDEGIKAYEFIFGEDYISSGGIIATTKILSDIQLDANSKVLDIGSGLGGGCKYINEKYGAHVHGVDICEKMVTIAKLRNQDKAKIEFEAKDILKKDFPESTFDMIYSRDSILHLSYADKKMLFEKCYKWLKPNGILLITDYCADKIENWDEEFKAYIKKRKYTLMPIQEYGDLIKSCKFQNVEAKDISDYWLELLQLELSKLEEKKEEFLKVYSIKEYNSLKDGWTRKIKDTKRDLQKWGYFKAQKMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphoethanolamine N-methyl transferase is a Malarial drug target
rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords Phosphoethanolamine N-methyltransferase, putative
total genus 110
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.103: Phosphoethanolamine N-methyltransferase.
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iv0A00
1OR8A 4PYKA 5K0EA 4YV0A 2YR0A 3MHTA 5GM2A 4A6DA 1R6AA 3LSTA 1SUIA 1RJGA 2YXEA 3NVMB 4DMGA 2ZCJA 2OB2A 5DX1A 4XUDA 5EHGA 3KQYA 3JWIA 5K8VA 4DA4A 4MTLA 2OXTA 1YB2A 1KP9A 2OY0A 5FWAA 1EG2A 2VDWA 3KPJA 5E9WA 5EPEA 3G89A 1M6YA 1X19A 3DLCA 4QQNA 3UA3A 5EHIA 4AX8A 3P97A 1RI4A 1N7IA 1UFKA 4PINA 2AVDA 1ZGAA 2PXCA 2A14A 4X1OA 5CUQA 4PYJA 5K0FA 1YUBA 5DXAA 2XYRA 4G56A 5BW4A 4GC9A 1VQ1A 5HIMA 3B3GA 5E1DA 4ER5A 3EVBA 2QE6A 3KQMA 2EFJA 3OZRA 1AQIA 3FPJA 5CVEA 3G2OA 3MQ2A 4GOOD 4RVFA 3SGLA 1YFLA 1BOOA 2O05A 2PLWA 2YVLA 3I53A 1N7JA 5FA8A 3EVDA 3A25A 3EMDA 2PWPA 2Q41A 5ICGA 3V8VA 2ZSUA 1X1DA 2ZLBA 2NXJA 2UYCA 1I9GA 5D1HA 1JSZA 5HIKA 2P35A 5KQRA 3ER8A 4Z2YA 1WZNA 1G55A 3SSNA 5EIWA 3G2PA 4F84A 4PYOA 1X1BA 4ATNA 1JG4A 5K0BA 4C4AA 3DULA 1BC5A 1I1NA 5CVUA 2JHAA 2YTZA 5GWXA 1JSXA 4YUYA 5GIOE 2ORED 3I58A 2QM3A 3NJRA 4EKIA 5E2AA 5EMJA 5DXJA 2PX4A 2I7CA 4QDJA 4C05A 3I64A 1G60A 1H1DA 3BKWA 2FYTA 1XXLA 3VYWA 3TKYA 3PX2A 1RJDA 4QPPA 5C1IA 1FJXA 3TM5A 2VP3A 4M37A 3MTEA 2EG5A 2IIPA 5EEHA 3LCUA 5ERGB 5EKXA 2GB4A 1FPQA 1VLMA 3G8AA 3MB5A 3DTNA 5DM2A 1SQGA 2JHPA 3HCAA 4IWNA 1ORIA 4HTFB 1HNNA 4F86A 2CKDA 3MERA 2GAFA 2VDVE 2UZ4A 3I5UA 1VP9A 2ONYA 3LGAA 2HWKA 1AV6A 1IY9A 1ZGJA 2Z6UA 3P2KA 1NBHA 3FTEA 2QYOA 2IFTA 4XUCA 3T7SA 3FUUA 3LDGA 2XVMA 5EEGA 1EJ0A 3C3YA 3DXXA 3G7UA 3LHDA 4FZVA 3R24A 2G72A 1TPYA 4R6WA 4H0NA 3KQSA 3FTFA 1DUSA 2ZZMA 3LBYA 4RTNA 3X0DA 3PT9A 4E30A 4FT4A 4KDRA 5LSAA 4CKBA 3DMHA 4GUAA 3HA3A 1NW8A 4M7RA 4E31A 3SMQA 3Q7EA 1AF7A 2VS1A 5EKUA 3TM4A 3G5TA 3HCCA 3U81A 1YFJA 4QDKA 1X1AA 5CD1A 1D2HA 3OU2A 3CCFA 4FSXA 1TW2A 2BR4A 4IV8A 4F85A 5CCBA 1NE2A 5HEKA 4BLWA 4RTMA 3JWHA 2E5WA 2ERCA 2NYUA 4CTJA 1TW3A 3HEMA 4PIPA 5CVVA 2N47A 3DOUA 4BP3A 4C03A 5LQUA 1KXZA 3I9FA 4PIMA 4CKEA 2P1DA 3EGVA 5ICFA 3T7RA 2G8NA 2QRVA 2UYOA 1MHTA 3FTDA 2F8LA 3LDUA 3PTAA 3LBFA 4YV2A 3EVAA 4YUZA 4RTRA 5E9QA 2IGTA 3B7PA 3FTCA 3PLAE 2G1PA 5HIJA 2JH9A 5E1OA 4C06A 3OPNA 2YXLA 3BXOA 3L8DA 3M6UA 2PV0A 5EMLA 5T64A 3WSTA 4E2XA 4RTSA 1N2XA 4RTOA 1O9HA 2QRVB 1P1BA 1P1CA 2B2CA 5IKMA 5HFJA 1NW7A 2AN3A 2B78A 3GU3A 3O7WA 4GQBA 4P58A 4P7GA 2B9EA 5E8RA 8MHTA 3BGVA 2BR3A 2C7RA 1SQFA 2ESRA 1JG1A 3FUTA 1IXKA 2XYQA 5CM2Z 5IH3A 3ELYA 4OBXA 5U4XA 3K0BA 3NW9A 2P7HA 3SVZA 4K6MA 3M4XA 3OCJA 3P71T 2ZBPA 3CKKA 2IPXA 3ELWA 1RJFA 2HTEA 2IH2A 1SG9A 3GNLA 4ER6A 3HVIA 4YUVA 5K09A 5D1NA 3HVKA 4O29A 5E1MA 4U7TB 4BP1A 4HTFA 5BXYA 2AN5A 3PFGA 3O4FA 5EVJA 4MQ4A 2EX4A 1SVUA 2H1RA 3DH0A 4PCAA 4C08A 3TOSA 5JUWA 2PBFA 3NDJA 2ZBQA 3TRKA 5CIYA 1Z3CA 1JG3A 3GO4A 3LECA 4HH4A 2OB1A 4CTKA 3A7EA 2PT9A 3BT7A 5FULA 3T0IA 4DM3A 5KQSA 2C7OA 3ELUA 2IBTA 5GINE 3REOA 5GP1A 4OX9Y 2HV9A 1VL5A 3GXOA 3KPWA 5LQCA 3CJQA 3PVCA 3MAGA 5DWQA 1YF3A 4GEKA 3E05A 2C7QA 3TR6A 5FQNA 4M36A 3P9IA 3UJ7A 3UJAA 5MHTA 3FZGA 4DKJA 4ZTBA 1P39A 5EMKA 1ZKDA 2I62A 3NDIA 3CJRA 4FT2A 4Y30A 2PT6A 1G8SA 3HCEA 4QTTB 1PJZA 1NT2A 2CMHA 1G38A 5DTMA 3A4TA 2P40A 3FUWA 3ANXA 3AXSA 4RX1A 2H00A 3DMGA 10MHA 2ZTHA 1ZHFA 5LQRA 2BH2A 2PJDA 1R00A 5FWDA 5T6BA 1KYWA 5EGSA 1V39A 4E32A 2AN4A 2BR5A 5K0JA 5E8JA 4DZRA 3OE4A 1DCTA 2IDKA 5HOQA 4BLUA 2Z6AA 2AVNA 5CVJA 5T67A 4OBWA 5DX0A 3T7TA 1UWVA 3THRA 2WK1A 1B42A 3ERCA 5M5BA 3TFWA 2GH1A 5DSXA 2CL5A 4GOMD 4E2ZA 5LQAA 1VIDA 4R8SA 2UYHA 3VC2A 3Q87B 2P41A 3P9CA 1XDZA 3B3FA 1FBNA 1QAQA 5B1SA 1XDSA 1DL5A 5EQJB 5ICEA 2NNWB 4EQZA 3EGIA 4RSRA 4EVIA 2AOTB 1KPGA 4KWCA 3ME5A 1G8AA 2HR1A 1JQEA 2OYRA 1NW6A 2OPBA 4DQ0A 1VPTA 2HNKA 2YXDA 4AZVA 5HZMA 3PB3A 4X61A 5BP7A 3G5LA 1QAOA 2DULA 3EVGA 3GCZA 3HM2A 5DTRA 3LCCA 3GWZA 4L7VA 4LECA 5FCDA 2V7EA 4DF3A 3BWYA 3HP7A 3M33A 3CBGA 5DLYA 4EK9A 5DSTA 1FP1D 2ZWAA 1ORHA 3SXJA 3M6XA 3R6TA 5P8WA 3C3PA 3FPGA 2AOUA 3MGGA 3E7PA 4RV9A 4XCXA 5F2NA 4BLVA 3FUVA 1WXXA 3E23A 3GDHA 1P91A 2NP7A 2R6ZA 3DXZA 3E8SA 3JWGA 4HSGA 2WA1A 3UJDA 2ZFUA 5KS2A 5CCXA 4X60A 2AR0A 3G88A 1Q0SA 1O9GA 3R0QA 3FUXA 2OBFA 3KQPA 5EZQA 1VE3A 3NTVA 3AWIA 1D2GA 1NKVA 1VP3A 1ZG3A 4PYNA 4ER3A 5DPMA 3TMAA 2UYQA 3PX3A 2K4MA 3OU7A 2PWYA 3AJDA 2CMGA 2O06A 4RYLA 1KHHA 3KQVA 4FS8A 3SR4A 2YQZA 2AOXA 2AOVA 4FR0A 1L1EA 4KW7A 3KPUA 3G2MA 4QPNA 4X41A 3B89A 2G71A 3C0KA 1T43A 3EVEA 3LKDA 4HC4A 2PX2A 4YUXA 4RTQA 5JR3A 2C7PA 2KW5A 3CGGA 3PS9A 1WXWA 2G70A 3BWMA 3UWPA 3JWJA 4GOND 4BY9E 4HGZA 1EQAA 4HRAA 4KIFA 3NWBA 3CJTA 1JG2A 1NV8A 3EVCA 3TPZA 4AZTA 3MCZA 2NXCA 2PVCA 3BWBA 2AOTA 3ID6C 2CWWA 1JQDA 2HMYB 4MIKA 2V74B 3GRZA 3SM3A 1BKYA 4WXHA 1VBFA 3GRUA 4OA5A 3SSOA 5BW5A 3UJBA 2Y1XA 3UBTA 1X1CA 2GLUA 3UFBA 3F4KA 2FCAA 4C07A 4CKCA 2ZW9A 3UA4A 4E2YA 3THSA 2NXNA 4RVGA 3G2QA 4YMHA 2ZZNA 4CXMA 5G02A 3P2IA 2BM9A 4RTKA 4KVZA 4RVHA 5H02A 5DM0A 2GS9A 2ZBRA 3OE5A 3DR5A 2BZGA 2ZIEA 2P7IA 3IEIA 4XUEA 3UJ6A 3SX0A 1MJFA 3OZSA 4IV0A 2IBSA 1D2CA 1RI1A 3BKXA 3KPVA 3KQQA 5EIFA 5FHQA 4ER0A 3UJ8A 5KVAA 2IP2A 3FPHA 1IM8A 2PX5A 1YZHA 1L3CA 4WVLA 4UOEA 3RW9A 3NVKI 4P7JA 3DLIA 4V0RA 4POOA 1QAMA 3HA5A 4NECA 3ORHA 4PGGA 9MHTA 3RODA 1AQJA 3HA7A 3MCTA 3S68A 3HCBA 3UZUA 1M0EA 3D2LA 4A6EA 4C04A 5C0OE 3HNRA 3EVZA 5LQKA 3O31A 4E70A 4P7FA 5FUBA 2WA2A 4DCGA 2NXEA 3LDFA 1JR4A 1NBIA 1R8YA 1WY7A 1M6EX 2BM8A 2JJQA 1RI2A 2GPYA 3KU1A 3FPEA 4YV1A 3IYLW 3AY0A 2O0LA 5EMMA 5F2OA 4PONA 2NP6A 1G6Q1 4RWZA 1L3IA 2Y1WA 3DMFA 2ZVJA 3QV2A 1NW5A 4V0QA 2O57A 1UIRA 5GOZA 4MHTA 3ER9A 4PYLA 2OKCA 2B25A 3OZTA 2FHPA 3QOXA 4QQKA 5DM4A 5E9JA 5K03A 2ZIGA 2P8JA 5FQOA 4GC5A 7MHTA 4PGHA 4FSDA 3EGEA 3OU6A 4U7PB 3LKZA 5DRYA 2AOUB 2O07A 3K6RA 3VC1A 4R05A 2ADMA 4PYIA 3P9NA 4R6XA 3UJCA 5LQJA 1QZZA 5FA5A 1JTFA 3B5IA 4RTPA 4JXJA 4M38A 1Y8CA 1QYRA 3MTIA 2AS0A 3EMBA 3HCFA 1L9KA 2XVAA 3M70A 1BHJA 2OZVA 5CVDA 1EAMA 5FADA 3A7DA 1JQ3A 3EPPA 2ZULA 4OQDA 5EG5A 1RJEA 5EOVA 1RI5A 4E2WA 1PRYA 2IH4A 2FK8A 2I6GA 4AZSA 5KYGA 3HVHA 4PCLA 5DRTA 3TQSA 3DXYA 3LX6A 5E1BA 5DT2A 2PGXA 5K0LA 2PSSA 2ZWVA 2VZ9A 3OFKA 1Q0TA 2I9KA 5FTWA 1F38A 2ZIFA 3TKAA 4LWPA 2XBMA 2PKWA 1KR5A 2QY6A 5GM1A 2IDJA 3FYDA 3G8BA 1INLA 3FRHA 2PY6A 1SKMA 2P3QA 4OQEA 1R18A 2B3TA 5K0CA 2FK7A 3PFHA 1XCLA 2FPOA 4KRGA 4GBED 1EJ6A 1F3LA 4KDCA 4CWAA 3BGIA 2JH8A 3IHTA 3M6WA 3GIWA 1RI3A 2R3SA 3KR9A 3ELDA 2YUIA 4DCMA 4IKPA 5K01A 3BGDA 3BUSA 3KKZA 4QTUB 1XJ5A 3C6KA 2YX1A 4AZWA 5EZSA 3BZBA 1ZQ9A 4R8RA 3FYCA 3GRVA 3R9XB 3HVJA 5ICCA 2H11A 3IV6A 3LCVB 3KR0A 1QANA 3KQTA 3KR2A 3UJ9A 3H2BA 3R3HA 4QVGA 2P3LA 3CVOA 5F2KA 3GRRA 4GOLD 3B3JA 3A27A 3FRIA 3QOWA 4PNEA 4EMSA 3EEOA 5E2BA 3GRYA 2VDUE 3V97A 4ER7A 2GA9A 2PX8A 4PYMA 4Y2HA 3DUWA 5DX8A 1KIAA 2DPMA 1EIZA 4X63A 1U2ZA 2XYVA 4EKGA 5K05A 2ONZA 4E33A 4PWYA 3GJYA 4KIGA 2JHCA 3FPFA 4P7KA 2PXAA 3KPYA 3P8ZA 3A26A 2EJUA 1XVAA 1O54A 4LG1A 4PYQA 3RIEA 4FP9A 5C9ZA 3KQOA 1NW3A 4OA8A 4AUKA 2Z6QA 4YUWA 1YZ3A 3HCDA 4FGZA 4RVDA 3P2EA 3KHKA 5GIPE 5FHRA 2EJTA 2PXXA 3LL7A 1SUSA 3VSEA 2LD4A 3NWEA 5DTQA 1XDUA 2JG3A 4ISCA 4GF5A 3KR1A 1KPIA 3EVFA 2FRXA 1WS6A 4MWZA 4YMGA 4B17A 3SSMA 3TLJA 2P3OA 1FP2A 1NV9A 2IH5A 1XCJA 4RTLA 4LWOA 3CC8A 5HILA 5DM1A 4HG2A 5LQNA 1XTPA 3AXTA 1HMYA 2AOWA 4HGYA 3M6VA 1JTEA 1I4WA 5EC8A 3LPMA 1R8XA 1L3BA 3C6MA 3BWCA 2AZTA 3GGDA 5K0NA 3P9KA 2ZZKA 4RTJA 1KPHA 1R74A 3KQWA 3DP7A 5HIIA 3NMUF 3HTXA 1KYZA 5LR6A 1WG8A 3OFJA 2OO3A 3EEYA 5K0GA 4QVKA
chains in the Genus database with same CATH superfamily
2A9JA 1DBWA 2H1IA 1SUFA 1YL7A 3ZLBA 4YWHA 1XRLA 1PEKE 4N39A 2WSSA 3U1TA 2JLCA 4BB5A 4XWGA 3LUKA 3F1LA 2ECKA 1CQJA 3JAKA 4IG4A 3W3ZB 4BGDA 5LP6A 1SU4A 2C9DA 1T0HB 5KSZA 3LC2O 4L4UA 1E18A 1K6IA 1JB1A 2CDBA 2DGDA 4GVPA 3W5AA 2SCUA 2BF7A 1EG2A 4Z1OA 1OHHA 4LI0A 5K3CA 1X6VA 4PFQA 1NQVA 1FRFS 3OZBA 4I1YA 1O5TA 1RI4A 2O1SA 4YQZA 5K6RA 1TT7A 2LCIA 2YWEA 4PYJA 1DTSA 1N7HA 1Z08A 4JR1A 4WJZA 3UJNA 5B1DA 3A1SA 3UQYS 4ARSA 2GZSA 3V55A 1B93A 1DJLA 1EP2B 3AVPA 4KR0A 5I7WA 4IJMA 3EK2A 1ONPA 5F7XA 3COVA 5K8UA 2WYOA 2VJYA 2H2GA 1GLNA 1X7GA 1H2EA 3EIEA 4A03A 5GZ6A 2IV7A 1L2TA 2YVLA 3I53A 4IGKA 1N7JA 5LBTA 4AP5A 4IICA 1TK3A 2RSLA 3GLQA 2VK8A 3EAFA 5DEOA 3MCAA 2QY9A 3QFTA 3BHNA 4GBGA 4OBBA 3RG8A 3VSBA 4NEHB 1IUOA 1GQQA 1A88A 1I0LA 5FXMA 3GUHA 1SOVA 1Z63A 4EY5A 2DFPA 1GG8A 4XWTA 3SZGA 2VZ0A 3HQ4O 4ZVMA 1KFEB 1DXQA 1PNVA 4H7KA 1GA1A 2X13A 4BQOA 1F4LA 2QMHA 5L7WA 3V1NA 4HPXB 3YASA 5K8CA 5KJ6A 4QBFA 2SKEA 2ST1A 1PLJA 1M2JA 3PR1A 3TPCA 1W4ZA 4ALLA 2FV8A 3QI7A 4IXWA 1T0IA 2PRKA 1K92A 1T24A 3AB8A 4DUZB 1JJFA 4KC0A 4F45A 3JS5A 5ALHA 4C05A 1VPWA 5LKAA 3ZWDA 2D0PB 3DQZA 5EXTA 4COOA 4DDKA 3QFCA 4KBGA 1TUGA 5AIAA 3NALA 2Q2VA 4WGFA 2WWYA 4QBKA 1QZXA 1T5TA 1KS9A 4O2RA 4A0GA 4B84A 1F1BA 3GGGA 4GZ3A 3WWEA 3T6KA 1LRJA 3R40A 1JKIA 2FWMX 1HE5A 2GK7A 1B00A 2QTVB 3BERA 3RVSA 4REQA 1LGYA 4J0DA 4NV1A 2CKDA 1FMLA 3H1FA 1GPYA 2PKQP 2PGAA 5JHHB 4OLBA 1JTVA 1WXEA 3EDOA 2ONYA 3LGAA 3R76A 4HUTA 3FRJA 2WYHA 4P08A 2F62A 5EKDA 3P2KA 1R0LA 1GADO 3G0IA 3OKFA 4HRVA 5KYVA 5LBUA 2YFYA 4RSMA 4UE2A 2R87A 4V02A 3ZE9A 1QSGA 1VMAA 4FYMA 4MJ3A 5KU7A 3PE6A 4CL2A 1NVFA 2C59A 2HSGA 3ASZA 4YXFA 4EF5A 2WT9A 2H1VA 4ZV4A 3FTFA 4BNXA 4LMAA 2BP7B 1TO1E 2WWXA 1RXEA 3EF0A 2QLMA 4Q4JB 5GONA 1XJ0A 1SKAA 3KJXA 3QG5A 4JA0A 2YVUA 1URPA 3DMHA 1GILA 4RZHA 3KYBA 3Q7EA 1SWWA 3IEUA 5EKUA 3ACBA 1AB6A 4XX1A 1D2HA 3WIEA 3AGPA 3CH4B 4DJJA 4BO2A 2PAFA 1ZW6A 5EE3A 4FGWA 3ZCPA 4BNHA 3RS3A 2P30A 3AUJB 2YY7A 2C5EA 5CNKA 5CVCA 1IEQA 3QY9A 1NXWA 2ZSAA 1QCCA 3LA8A 4RL4A 4S3MA 4YJHA 4N48A 3KEOA 3WA6A 4CQMB 3EGXB 4CIWA 1OX5A 4W1PA 4GI5A 1NXQA 2G80A 4G24A 3OMXA 1JAXA 3NAZA 2QRVA 2UYOA 1OFIA 3HXPA 3JCZA 1NI5A 3UK0A 5IULC 3PTAA 2N9UA 2W4MA 5AICA 2OWDA 5E3JA 3ZJ4A 5ILQA 4XVHA 3PNLA 5CITA 5D5HA 1P5HA 3K8QA 5JYCA 3PLAE 5A0VA 1OF1A 4BB6A 4YRTA 1Y0BA 4CMEC 5EMLA 3FX2A 4N03A 3EIUA 4J6EA 4QEKA 4DMMA 1K8RA 3VPAA 4HGQA 5I4CA 2IU0A 5BUZA 1JEAA 1RQNA 2G9NA 4ESEA 4Z4EA 4KH1A 1NW7A 1BSVA 2XMSA 4L28A 1POWA 3DV9A 2A94A 4TT3D 4NJMB 3C7KA 1U9CA 4BEJA 1BWQA 3OIDA 4DA6A 4IJ6A 3HBLA 5IXJA 3M9XA 4OBXA 3QEOA 1Y8AA 3BF7A 4XD2A 3F6CA 1N5JA 3L93A 3GI1A 3U0VA 4EUFA 1H2RS 2FSVC 2HTEA 1DWOA 3LWDA 1W0JA 3HN2A 2X40A 4FNGA 1MHPA 3G9TA 3OQHA 3KT0A 4UHEA 5B55A 3PFGA 3KQLA 2GOYA 1XJWA 3GJXC 4J4BA 4PCAA 2JVIA 2QTCA 1E7SA 2J6HA 3O73A 2KLBA 2F67A 2I2FA 1E7QA 3BSSA 4HWKA 3QJYA 2AL7A 4JZKA 2OHIA 5IM4A 3VO8A 1VG9B 3EF3A 4GPIB 4I2NA 1XWIA 3OIUA 5F5NA 2BUAA 4I4NA 3KJQA 3RC7A 1W34A 3ND5A 1T2VA 1N8SA 2IHVA 2XUDA 3BX1A 3ESDA 3TO5A 2OCDA 3JYNA 2DAPA 5P21A 3DBVO 5I9BA 1QPZA 3UUFA 3KWFA 1SXGA 4JBNA 4KQ6A 1LK0A 1VL0A 4K7JA 1ZIYA 4IGIA 4IJVA 3B6EA 1DEOA 4ZI5A 4AKTA 2R48A 3ZD7A 1EEXB 4KDEA 2AFHE 3G9UA 2I0FA 5BSHA 3T1QA 3C6YA 3N0TA 2ZANA 1ENPA 3QF7A 4BMDA 3GH3A 1RS0A 2EHJA 1KFJB 4MJXA 1PX2A 3MTJA 3CLRD 4G84A 5LDDC 2JI4A 2EFEB 2AT1A 3JQAB 5KAMA 3WK7A 4DNQA 3FHTA 1CUJA 1RAFA 1XZLA 1YOBA 2VJAA 3R5KA 5AI4A 3V46A 4E12A 3EXG1 2IYPA 1G8HA 3D8HA 4BX0A 2YHIB 4JBWA 1T1IA 1GGMA 3GD5A 4WKCA 3WZMA 2JJ1D 4GBMA 3GRCA 4QYIB 1W5AA 5EQJB 4EW3A 4YLYA 3OLCX 2BW0A 3Q1KA 1UJ4A 2R00A 5ECDA 5LNK1 3GG9A 1VE1A 1VFNA 2PH3A 2OYRA 3VR4D 4FIDA 3GA5A 4JJKA 2PD3A 1ESMA 2MR5A 1OFUA 1Q1GA 4TWRA 2DM6A 4CU2A 1V16A 3GWZA 2RH4A 1UDCA 2PEYA 2QTMA 4LA4A 4B09A 3UHOA 4S1OA 2KLHA 2AOUA 3KDAA 1G59A 2W2XA 3MGGA 3I9MA 1YL6A 2JJ8A 2V3WA 2WIGA 3HB7A 4Q4AA 3K70D 1LNSA 1TQDA 2GYVA 4MQ5A 3ZOZA 4NBVA 3E23A 4L16A 3M5DA 2R5WA 5LA6A 4ZKEA 5DYTA 5CDYA 3IEXA 4HSGA 5DBGA 2FWBA 2UVPB 5TSDA 3WJ7A 4Q4HB 4L78A 4C76A 2VHJA 4MHSA 1MEOA 5C7IO 3R0QA 2BDUA 3F3KA 4QDUA 2CXPA 5EZQA 5SY4A 3D0KA 3N8KA 5C34B 3V7NA 4C2UA 3FBWA 2EYQA 8ABPA 3HU1A 2QTLA 2NPFA 2I7XA 4E14A 1XJQA 4YJFB 3QXGA 2LGJA 1V4BA 1ZD3A 3GLGB 3KPUA 1N1GA 1G2OA 3C3CA 4IV5A 3OM0A 2I22A 4CF7A 4LOKA 4RTQA 5L4SA 3L7AA 3TIXB 3RAEC 1XQ1A 2OENG 2X58A 4GM1A 1KZ6A 1Q50A 3CGGA 2J9FB 2O8EA 1CT9A 1JI3A 3NTLA 3RHZA 4EGAA 3UKOA 5JZMA 3JVVA 3ZGYA 5AVJA 3HXMA 3VSDA 2GXUA 4EMTA 5IFKA 4WUVA 5CRIA 2IXEA 1G20A 3EXAA 4KHPB 4GDFA 2WYWA 3AKYA 2CDRA 4G1UC 3VR4H 1CEXA 3BMOB 3DR3A 1Z18A 2J4CA 5AI5A 3GROA 4EHDA 4LYYA 4G5XA 3RI3A 3LL4A 3S2FA 3PSHA 1AKMA 4Y67A 4YVFA 4JSYA 1A98A 2ZW9A 4V39A 2CLLB 1Y7TA 3EFEA 2WKSA 1IHOA 2Q1UA 2OORA 3EIWA 4G4IA 3JWEA 5KQPA 1AS2A 4RTKA 1MT0A 4X1IB 1W36D 3PJDA 3WYAA 2I78A 4L9RA 3EZGA 4C4XA 4DA7A 2ZIEA 2J9XB 1SHLA 3KHTA 4YIHA 4BTEA 1Y98A 4E0BA 2P90A 2B4YA 5HJEA 1UOEA 1R1DA 2HHCA 1A5SB 2XQVA 3PGMA 4ICIA 5EYPB 4CR8A 3NANA 2ID9A 1OZ0A 3KQQA 2GK3A 4FFLA 1SIOA 3GZNA 4RF3A 5TF0A 5KVAA 5HM6A 3GLHE 1NTOA 2OGTA 4O3FA 3H1TA 2H08A 3A3PA 3CRVA 4PGGA 4LSZA 4ZHQB 1GTSA 4AKGA 2PU7A 2HM7A 2Z5LA 1ESZA 3IB6A 3V4ZA 4CN9A 5KYXB 5C0OE 5ED4A 2ZT5A 1DBIA 2WAMA 4N8DA 4PAOA 1ID8A 3VTZA 2A9OA 2B94A 1JVNA 3MUNA 2JJQA 4MEAA 4YTEA 2GPYA 1X7HA 4G5YA 4RGYA 1NYTA 2NO4A 2K5UA 1PUXA 2LZ0A 2Y0BA 2EQAA 4TKVA 2V7UA 1BXGB 3Q4GA 3MWDA 1MH9A 1UXIA 2ZYUX 3E1SA 2NIPA 1ETUA 3LHIA 4Y2QA 2DHRA 5THQA 1PR2A 1T5OA 1G6Q1 5CBKA 3R4CA 4BFLA 1L3IA 2YRXA 3OLVA 3QBEA 1T4BA 3T7KA 1AMUA 1UINA 1PLKA 1N2OA 3RWMB 3NHWA 1UIRA 3I28A 1IJBA 3S8YA 1EVEA 5DI9A 2BHRA 2L19A 1P29A 2C00A 2CYCA 2FHPA 3NDBB 4K9MA 1CRLA 1MQ9A 4NMWA 4RD2A 3QFHA 4Z3DA 3UKJA 3GT4A 3QNMA 4UM5A 5K4HA 1P19A 4ZQEA 5C3MA 4PQRA 4YJ3B 4UMDA 3X1XA 5HXAA 5KWVA 1V16B 1QYCA 3WL3A 2QW1A 1GPUA 1ZCJA 3O94A 2H63A 4ZYLA 1WVIA 1OY1A 4ZREA 2DJ5A 1VKZA 3TNDA 4CPDA 3CW9A 1JQ3A 1HDXA 1ZUNB 5DDIP 5KNDH 2WB2A 3UAVA 2QTNA 3Q2KA 5D2CA 3SC3A 1UBOS 2YWXA 5DSZA 1KEPA 2C5AA 2J32A 3SIXA 4AZSA 1N57A 3IQIX 4C1BA 4DCJA 1G6KA 2XKJE 5U4QA 4AJOA 1ZD8A 1F2VA 1AKNA 2BI8A 1QQTA 2E2WA 1GO2A 2PMKA 5EJ4A 4D0GA 1ODLA 4AJKA 2PKWA 3AM1A 1VHJA 2XYHA 3K8ZA 1T5HX 2P3QA 3WIUA 3IAHA 2B3TA 2HREA 2HR1A 1RBYA 2OLJA 4QREA 2JDIA 4URVR 4ZTUB 1Y1LA 2C5SA 2Q9CA 1KJIA 1HQKA 2X8JA 1PIWA 2VK2A 5B6JA 1UPAA 1FFYA 3N1UA 3IXMA 2AJDA 1E3JA 1MC8A 2GBCA 4CEJA 3HVJA 1Q0PA 3KJFA 2AMJA 3G8CA 3N8NA 4LNUA 1XMSA 3KQTA 2G7MC 4RHTA 3HJFA 1UPTA 3K96A 1T36A 3OFND 4DRXA 4MULA 3WLOA 3LXXA 4WNYA 5KHOC 4OPMA 3N39C 3T7JA 3RC1A 2P2LA 2HNBA 3LM8A 1UBNA 4G0QA 4I50A 4D9GA 5MN6A 1LBSA 1E2GA 3WYNA 1KBOA 4NV3A 4UTXA 3TNLA 2A9QA 5ILOA 3IBGA 2QAGB 1LDEA 2GEKA 1E3DA 2ZI4A 3BTUA 3SIPA 1H2ZA 1EGHA 2CJYA 4DA0A 4PWYA 1NMYA 3C4VA 4WERA 2XHZA 3RU9A 4FOPA 4PZCA 3ZXXA 3OTQA 4AD8A 2INGX 3ITNA 4FBGA 4FGZA 1JQ5A 3EVNA 4BE4A 4EZBA 3IAM1 3K1JA 2BUBA 2PXXA 3OT5A 3PNOA 4GMFA 3TGWA 3UWKA 3M9WA 1CS0B 1D6JA 5ULLA 4ND2A 3MM4A 2FSIA 4ZOLA 5AXBA 1LW6E 2ZRIA 4FSHA 4ISCA 4G0MA 3ND8A 1KPIA 4M0CA 4PR3A 2BBWA 5FOTA 2JH3A 2VBGA 1JT2A 2F4VB 1ICEA 3W9BA 3EZLA 3MOSA 3J81k 2OQIA 2XCSB 1RYMA 4MS3B 2LTAA 1EBFA 2ZU6A 1GLGA 2IUSA 3SYKA 1CIJA 3LPCA 3ZU6A 5JO0A 1HOTA 1R9GA 2REXB 3E58A 3V8MA 1USVA 3C6MA 1OWMA 3UB2A 1OJ7A 2R11A 3HA2A 1Q92A 1VIVA 1M2VA 3HB9A 3KUXA 2FSPA 4RHEA 4XX0B 3DS8A 4OAPA 3E48A 1RWNA 3AQIA 3N8DA 1L1RA 2ZI7A 3CT4A 1XTBA 3EEYA 1QQ6A 4OOFA 4UAVA 5AXAA 4EY6A 1SCQA 2RAPA 4DFDA 4F4HA 2YR0A 3ENZA 3HCOA 1HFKA 1ONNA 4K9RA 4NV0A 2YWJA 4OGLA 1TYBE 4M55A 3OX2A 1SUIA 2NGRA 1N2SA 2PE5A 2M6SA 3UHPA 5DE3A 2Y05A 1TF5A 2PGDA 3NB0A 1GXSB 4JI6B 3UAXA 1Q77A 2BFBB 4FDUA 4IEFB 2MSKA 5KIAA 5TR9A 2FDXA 4L3VA 5LNK6 1IN7A 4HAYA 2YJ5A 1RYHA 1N1EA 2FZKA 1LJ8A 3Q9NA 4FXPA 1S3GA 4IMJB 2JLBA 2WF9A 3ABIA 4WK4B 2Q28A 4KAXA 1LD3A 4Z0TA 5HQJA 1W2HA 1N7IA 4Z1MA 1RZUA 4J03A 5FWXB 3IT3A 3NKFA 2V3CC 4BFXA 3RT1A 3WKAA 3I6YA 3K2EA 2YV5A 1NLUA 3AK4A 2QX6A 4WZBE 1A8HA 3ZIAD 5BRJA 1MD9A 3LY7A 4MQMA 3GEHA 5JVDA 1WLSA 1DI0A 1JJAA 1QFZA 1XQYA 3FYUC 2YHBA 3FPJA 4HRXA 2JCYA 3C5WP 4PZEA 4Y9TA 3PDUA 1PV2A 4CVNA 4YBRA 1FP7A 2OQRA 4WD3A 5B4UA 1YFLA 1OROA 1HOXA 1Z39A 4TSRA 3VNAA 3P4YA 2PWPA 2POCA 3EZYA 3SY8A 2HSWA 2ZLBA 3H8SA 5HUQA 4HMOA 3JQ9C 1NYQA 2UYCA 2AHOA 5D1HA 4YP7A 4XDYA 2L0XA 3UUGA 3QKSA 1OB5A 4NXMB 2O8FB 3N3BC 1N2GA 2IU6A 1G55A 3LOUA 3PC6A 5AO9A 3QWFA 2JIBA 4QECA 3CX8A 3F9IA 4RLHA 3TLMA 4EG3A 3MPUA 2QSUA 1PK7A 3K9NA 1R8JA 3TSYA 1KJ9A 1FFSA 3EC1A 3FMOB 4F4FA 5CDUA 4TXMA 3MC1A 5BYJA 4LOJA 4KWIA 3B1ZA 1KARA 2FPIA 3FDZB 2E1PA 3ZWKA 4N7MA 2PX4A 3RC8A 5F4ZA 1DT3A 4H6WA 4Q34A 4R1TA 3C8MA 2P77A 3T3OA 2NUPB 2O7VA 2QU7A 4IJKA 3ZI7A 2X0NA 3B1VA 1F0PA 1MIHA 2DBQA 2ZRQA 1KZ7B 4QPPA 1VYTA 4W1QA 3KK0A 2DKFA 4LK2A 2IIPA 4L4ZA 2W2QA 5JDCC 3VXKA 2Y0PA 3LCUA 3SYMA 5CA1B 5DP2A 2LCQA 5DM2A 1JQLB 5SYMA 2GBIA 3WL8A 4X3PA 4AS3A 2V6FA 3ILYA 4BUCA 1DKOA 1A2QA 2BGWA 1AURA 3QXXA 1UOQA 3B9RA 4RIGA 4JLVA 1RWOA 1FJGB 3G8DA 1FU8A 3L84A 1TU0A 1A95A 2A9FA 2NSLA 2CHGA 1GFSA 3FSGD 3PKZA 2BFCA 4BNVA 2BEUB 1WOMA 1LFAA 4CHTA 1RT9A 1GRQA 4XUCA 1C5KA 2AX3A 5EEGA 1MQSA 2F1KA 3A06A 1YCFA 4Q00A 5DH9A 3QMVA 4WUTA 2RB4A 1HZZC 1Z0IA 2CFCA 3FHLA 1WSWA 1N5RA 2XMBA 1HEUA 4TTPA 521PA 4TMTA 1YVPA 4RZUA 3V4OA 4ZAXA 4H1UA 5H68A 3Q5GA 1G9SA 1NSFA 1ST2A 3PHBE 3V6LA 1R64A 3NBYC 4MGIR 4B85A 2PLFA 2HLDA 5HFNA 2P69A 1YFJA 4K0RA 3R41A 1FDTA 3E3MA 4GOXA 1MX1A 5CGQB 5AK5A 3SHQA 3R4VA 3OCXA 3HR8A 1ZMRA 3OEED 5AOCA 5G3ZA 4LBVA 4DNXA 4DV4B 5TF4A 1W29A 4Z8XA 2NT3A 5BQXA 2R6AA 3CRZA 3WNCA 1MW8X 5JCOA 4J07A 2X5NA 1PR9A 4E1BA 1RAGA 4PG8A 2WJ6A 1N33B 4WACA 1Y5MA 3D81A 4XQEA 2JI8A 4ZOLB 3A0UA 4ZEMA 2IYQA 3A6KA 4BFSA 3AVYA 3DDOA 3B7PA 3F6EX 2I55A 1US8A 3FTCA 4FQ5A 4DLTA 3R20A 1DIRA 3NZEA 4G1EB 1DELA 5CM8B 3ORFA 4MYDA 5BPHA 2V96A 2GLXA 1OQAA 1R50A 1FRQA 1VYUA 2EGUA 4TKUA 5F3DA 2R0QC 3D2CA 1V0JA 1M3SA 3ET4A 2FOLA 3D5QA 1PR0A 3PG5A 3QRWA 1AHPA 1TJYA 4OUDB 1BTOA 1P9NA 1TI7A 2VCEA 1XF1A 4JEUA 3VR2D 4Z7JA 8MHTA 3IAEA 2BR3A 3W5IA 3CNNA 3FOAA 1P4HA 3I5MA 3IERA 2VWQA 4YCSA 4MS1A 5I7UA 2D5LA 1E3LA 1LPPA 5CM2Z 4AFNA 3I4LA 1EFVB 2E87A 2OOSA 2ZT7A 3WG9A 2QZPA 5E7MA 4W7HA 4F3YA 1AU9A 4YH1A 3EPKA 4BP9A 2I99A 2VIIA 5GINE 2Q3DA 2IYEA 2R8RA 4ER6A 1AUPA 1W0KD 3DPUA 4MV0A 4FWTA 3WTBA 1Z8NA 1SVNA 3B1XA 2A88A 2DHCA 2X8JB 3KALA 4DV1B 1EBUA 5U1PA 3FNFA 3TRKA 4DDVA 1KJNA 4KXVA 5KYUA 3AUAA 2YVAA 4GP6A 4X8LA 3UAWA 1RQ2A 4MUMA 3CLUD 2W6NA 2BHNA 2QD5A 1VHTA 2I3AA 1NLYA 1KDZA 2VQ3A 1SC4A 2IX3A 4H31A 4BGIA 4FYIA 5DWQA 3LG2A 2QVXX 4Z7QB 1AOXA 3QA3E 1P2BA 2ZRAA 1ODFA 4QUIA 3TBKA 4F6LA 3PEWA 3ZJTA 1ZM3A 4L8FA 2OO7A 2H5EA 2HXSA 2DPHA 2Q7XA 1RRVA 3RF7A 1U9IC 3R3VA 3TOCA 2AYZA 2PT6A 3SN6A 5B7NA 3BPSA 4RZQA 3T5PA 1TFUA 3RUPA 1X7WA 3DD5A 5IVIA 2P40A 3DBLA 1ZI9A 3N0WA 3PFIA 4LKRA 1A8UA 4QGAA 1OW3B 2PXHA 1J5PA 4RX1A 2TMYA 3PFBA 3RTGA 4PSDA 3G1TA 3LAWA 4JI1B 1DPFA 2ENUA 4MNTA 4KUEA 2JFFA 2Z1NA 1V71A 3HPRA 3Q3JB 2HK6A 2XWJI 3WMWA 2F90A 4DNPA 5IN4A 4X90A 3ODPA 1VA5A 2H18A 3M2TA 4ZGBA 1XP8A 1QH8A 2GUWA 4LJRA 1LK5A 4FBLA 2F7SA 3Q87B 3ICEA 5FJIA 1QTRA 4A92A 4OFBA 1GTG1 4QOJA 3RRBA 1BHSA 2ZPUA 3RT7A 3QGMA 3FLAA 3GD7A 4HOYA 1YQWA 4KMSA 4YONB 3RVBA 1FFXA 2QSJA 2Z56A 3H6HA 1EA7A 2AOTB 3HKEA 5CIQA 4U7WA 1G8AA 1SN7A 3W2EA 1XTKA 1GAJA 4ZWNA 1NUAA 1UWKA 2XRFA 1CJMA 4UM8B 3C2QA 4EUKA 3V7FA 5HZMA 4QU8A 1FQJA 3NDPA 4ZEOA 1JLMA 3EULA 3LPDA 3QFRA 5IKPA 1T3LA 5AJVB 4C2TA 1KKMA 1TF7A 1ADCA 1ZRSA 2YDXA 4QLOA 5KNDA 3AINA 3FYUA 3SXJA 2RG1A 3D3JA 3HU5A 4HXFB 2AYYA 4YV7A 2ATXA 4JMPA 1DU4A 2C5FA 1PL0A 2D06A 3DFIA 4P4GA 5F2NA 2F6RA 4J3FA 2XCLA 3WV5A 4PHFA 3GJTA 3SEAA 1NJ8A 4A2QA 4F4JA 1KSHA 1Z0FA 4XGKA 1GFWA 1GRCA 4ID9A 4EO9A 4OHZA 2AR0A 3CXUA 4BNJA 1DC3A 3E7WA 3AFMA 2AN9A 4NTZA 1SCKA 1COWA 2V7QD 1UAGA 1YO6A 4RQTA 4B3GA 3B51X 3D8TA 4AU1A 4LW8A 4MP8A 4F9FA 1U8CB 5C18A 2BPOA 4HWGA 4U3JB 1JHPA 1PZNA 3PCRB 4D9MA 2H4WA 5H70A 1U7TA 2C2WA 4A4DA 2B36A 4US2R 2PFGA 4H4CA 1SC1A 3TVYA 3VR3A 5JR3A 1LPMA 1GNVA 4TXLA 2IXAA 3T9BA 1DCFA 2I76A 2HRDA 3PXCX 4GPBA 4WFJA 2HLNA 1FDSA 1X87A 1FFHA 1Y33E 3JWJA 4EKDA 4IJ5A 4PVDA 1QDLB 1CHNA 2Y1DA 3CJTA 4LV6A 4OBEA 4V03A 9ABPA 1MP0A 1XTVA 2D0OB 1FLNA 1N0VC 3MCZA 3OECA 2QJRA 3PFKA 4PLVA 3WLLA 2V9PA 4YJ3F 1M1XB 1NURA 1RXYA 3WZ2A 1JHAA 1SURA 3I09A 2RHHA 1VBFA 4AF6A 1UKAA 2Y1XA 4CLEA 4DMUB 4NE2A 4G9GA 2BH9A 4CDGA 4X7BA 3L40A 1DQSA 5K7SA 4MRMB 1EDEA 2RHLA 2VRNA 3G2QA 3R0VA 1NDQA 1ZC4A 2A86A 1YQXA 3O2QB 4DQUA 3QVWA 5LWHA 4RVHA 2XDQA 2HJRA 3JYPA 4HKTA 4KQFA 4L08A 2Q7DA 1XFDA 4ZVTA 3LQKA 5ALRA 4BZXA 4FOSA 2MIIA 3SX0A 2AGVA 4PAMA 3M82A 5KYWA 3P4UA 5EXXA 1Q1QA 2CE2X 5EIFA 4G41A 4D43A 5JNLA 1IM8A 4GNKA 4CNBA 4UOEA 4E51A 3UMBA 4V0RA 2WHEA 3RSLA 5JJKA 2BZ0A 5AM4A 3DAFA 4UVIA 2PQ0A 3E3OA 3RODA 4DV3B 4G8JA 1Z2CA 1TKCA 3NOXA 3OZDA 4R9VA 5I9MA 2YFQA 4Q01A 3VAYA 1ISMA 4Q9AA 4ZI2A 1PR1A 1ISSA 1ACJA 3W4KA 3HJUA 1FSFA 3DPIA 3GJQA 5FUWA 4N5NA 2F59A 5KX5B 3VDQA 3SMVA 4IH4A 5EMMA 4JASB 2W2MA 3RS0A 2WI8A 2H7VA 5LP1A 3MT8A 4YP0A 5A04A 2XW6A 4YAFA 5ITSA 1QGAA 2YCLA 1YJQA 4B47A 4PZDA 4L22A 4Q82A 5L95A 5GMOA 3LRPA 4WLUA 1RJ9B 1EE2A 4JLKA 5HCUA 4JR2A 5T57A 5IG2A 1TEVA 4KLNA 4DMRA 2O57A 3ZR4B 4HB3A 3I2KA 1O0SA 5L4LA 5KO2A 4LJYA 2CV0A 1Z6AA 3IE1A 2ZJZA 4M1QA 1ODCA 4QQKA 1D0SA 1WHSB 4EGSA 4IIEA 2PUDA 1M7BA 1TAGA 2ILTA 2C9ZA 2JI6A 1F2UA 4LQLA 1Y8QA 2WAOA 3WNZA 1L4BA 1NBMA 2FXIA 1DOHA 3HJTA 1VLQA 2HTFA 5EUQB 1O97D 2ES4A 4INJA 1MC1A 4BNNA 5KOJB 4RGBA 4C7JA 4JXJA 2RBKA 3FCUB 1JMYA 5BV1A 2I8LA 3B6ZA 1L4KA 4P4SA 3EMBA 4KO8A 4N65A 2AK3A 1FVXA 2GZRA 2QVYX 3NCTA 5F1YA 3I2HA 4QNRA 4NPAA 4V3BA 1P7WA 3KV1A 2NW6A 4W5OA 4XR9A 2IOYA 4J7CA 3V48A 4Q4HA 1EXWA 2PS1A 4R2IA 1ILWA 3HS3A 3EH2A 4KXYA 4F5WA 3FCCA 3H11A 3DVQX 4PPNA 3I5YA 3FGZA 1R5JA 1ZKMA 5AVQA 2O8BB 1ZJ6A 2QAJA 3W2HA 4G01B 2IJGX 4F6RB 4YRMA 1DJQA 1LC0A 2GFHA 2QY6A 2RMKA 4ZK2A 1MV8A 3SBEA 1M8JA 1UJ5A 5KNBA 4HZUA 4A36A 1U2PA 2QTZA 1T5DX 1Y3AA 4M8LA 4NHEA 2JLQA 3GYGA 1TD1A 2GX6A 2ENWA 2VP2A 3HFGA 3ND7A 3EUAA 3TSWA 4QYXA 4JJZA 1EJ6A 4WXEA 3AM5A 4RHYA 4QUBA 3KWMA 2JH8A 5BYAA 1OH7A 2R3SA 3VR2A 2JGKA 4MEJA 4LJ5A 3VHXA 4CUKA 4TMVA 2YUIA 4JCCA 1K1EA 1NPYA 1UBLS 1XJ5A 1EVKA 1O96B 1J06A 4AUNA 3K9WA 1YI0A 2GTPA 1FC0A 3E22B 3NT5A 4URXR 3ONWA 2FSFA 3TG2A 5MFPA 5CXXA 1RZVA 2P3LA 1BVYF 1TM1E 2V4ZA 2B0CA 3AR6A 3P52A 3QMMA 4GOLD 3QOWA 3RRJA 5ES4B 3DBRB 3C1UA 3P5BA 2VDUE 4ER7A 3SHTA 3NGXA 4II2A 1DSSG 1EIZA 2PGNA 2ZRDA 4R5MA 3WLKX 5AJYA 3KXDA 2ZR0A 4P34A 3AMVA 2IS1A 3HVUA 2HFJA 1NMQA 2Z5VA 3A26A 2WWFA 5FPQA 2D2EA 4B7AA 2IC5A 1EX1A 4OA8A 3LNCA 3P5SA 4IOLA 5TJHA 3R7WB 5BV0A 1F9EA 4QUHA 3VSCA 3N6XA 1KEEA 1WPXA 1DC8A 3MELA 5BR8B 5FIUA 5FHRA 4MAAA 2FETA 3PEYA 1RU3A 3X2EA 3F3YA 2HA0A 4R7GA 1G8MA 2Y1EA 1WO8A 2FZEA 2HLPA 1NKTA 1SBHA 1I4EB 3JQBC 4JB0A 4WSOA 3IULA 2E9SA 1UK9A 3E82A 3TBHA 4CLRA 4N0MA 1OXBB 1DO8A 2DR3A 4Z0HO 4RJTA 4Z8YA 3O3OB 4OQXA 4HX5A 3OF2A 3I9V1 4QUGA 4X1KA 2QUZA 1QXSA 1TQ2A 1MOPA 1HEIA 2QQFA 3PPVA 3W34A 1JTEA 1I4WA 2WNSA 2J3IA 5EL0A 3MMXA 1XAIA 2HDHA 3JR7A 3HJNA 1WULS 2A1UA 2ZZKA 3KTFA 3UWDA 1UXGA 1DWUA 2VO1A 3KQWA 3IV9A 4FM9A 3SYLA 3EZFA 4NMXB 1HK7A 3A6DA 3OFJA 1K3TA 1O8CA 2Z08A 4OXQA 4X92A 1A5TA 2BFFB 2Q29A 2Y8EA 4MO9A 4MYSA 2DBYA 4I1VA 4RIFA 3RRMA 8ADHA 4XRRA 5ICMA 5K0EA 4AY2A 3OJWA 4RKYA 4F2GA 4D7AA 3ZY3A 1R6AA 3EQ9A 3G6KA 3O3NB 4TLLB 4QJ4A 5EIHA 4DLPA 4MV1A 1T2CA 5DM70 4C5AA 3B5JA 3TLYA 2Q6IA 2EZUA 2HK7A 5H8WA 1BS9A 4WESA 3CF2A 3L7CA 4NXNB 2TECE 1RLOA 1J5XA 2PPVA 3RS2A 1R16A 4PHGA 1K3UB 4R84A 4PGAA 1UOPA 4MQ6A 4IUBS 1ADFA 1I2CA 1OV6A 2GZDA 2X5KO 2D1TA 1DC6A 1ZK4A 1ZGAA 2G3YA 2GM5A 1EWVA 4P84A 4PNPA 1CUHA 2A14A 1E99A 3NGMA 1NVDA 1X42A 3V1LA 1TAQA 2H1CA 2G0AA 2Y67A 4OL9A 3FNHA 1RLMA 2ZTMA 1Z13A 4FEAA 4LZWA 3UK2A 4A9AA 4HDKA 2MYNA 2YVQA 1X94A 5AM2A 4CFZA 1QMPA 5I3ZA 3QUSA 4IMPA 1JEDA 4ZDIA 4JK3A 4DARA 4HQOA 2VYVD 4B3DA 3RUEA 3SGLA 3AIMA 1K5HA 1JXOA 4RVFA 4Z9YA 2N1BA 4E08A 5KWEA 3VUFA 3SC6A 5FA8A 1PWEA 3K0FB 5D7NA 3BHIA 1Y80A 3JR3A 3L8HA 3WISA 3OVMA 3QE4A 3ZHBA 3O91A 5C4IA 2O7RA 4K9QA 1T9GR 2BGTA 5CFMA 2YUTA 2R84A 4NVRA 5HKLA 2P35A 2QXTA 1CNEA 1IHUA 1E79A 3UO8B 3NPMA 2OBNA 3T0GA 5DB4A 2F1JA 2X23A 4IIJA 1RZRA 3UK1A 4FC7A 3GJRA 4IWYA 5DI3A 3VISA 3DVLA 4D4MA 3QSYA 2GO7A 3K70B 1Q84A 1SVIA 3SOZA 2QM3A 3SE0A 3MTBA 4CHGA 3U7RA 3E5NA 4MB2A 4O2BB 2CSXA 4O2BF 4RY2A 2HU7A 3D54D 2B7LA 1D07A 2PKYX 4HQ0A 4ZALA 2GF2A 1FDVA 3HZZA 4RCYA 2AZXA 2XD4A 2VP3A 4RVUA 3T95A 4X71A 3PNYA 3GHYA 1VLMA 3D6JA 2GM9A 3E5MA 3I04M 4OFXA 4P22A 5FUQA 5H3LA 3IUJA 3RLFA 5BVGB 1BVRA 3LXUX 4BGUA 4DWOA 2GCGA 3ZQKA 3JX9A 3CYFA 4IJQA 5L3QA 3LY5A 5F4BA 3VU3A 1NBMD 2FW0A 8ATCA 4MVXA 2FEAA 1J39A 4I6JA 4WBNF 3EZ7A 1ZGJA 3CKMA 3RC9A 1X7XA 4WBNB 1YCHA 1R66A 2DQZA 1BDMA 4I8XA 1E9DA 1NBHA 4NULA 5EGNA 3WMFA 2BEKA 3A6GA 1BQEA 2V59A 3U3OA 2O5VA 2JFGA 2Z2YA 1W2WB 4GD3Q 4TZ6A 5DN6D 5G40A 3WAJA 1BX0A 1NQAO 4TSFA 5LU9A 3MJSA 5GJVC 5ICSA 1I6WA 4EGCB 4BWGA 3RU3A 3OPQA 5H82A 1XN4A 2CJWA 1NRWA 3EZ9A 2QL6A 4D4GA 4OAOA 4NATA 4QODA 4A27A 3ZZ0A 5DTIA 1N2EA 5FOVA 4HFRA 1VE5A 4CF6A 1IEVA 1XTUA 5EJ2A 3N7AA 1Y89A 1YDEA 5JPIA 3SWWA 3V1TC 1C30B 3FKSA 3RH0A 4PYRA 1HSOA 1GTL1 5EINA 1SIBE 1Z4NA 4EKEA 5DYNA 3STYA 3QX8A 1QHGA 4FQ7A 2ZAOA 3CZ4A 1KYVA 4BNFA 1RWMA 2C4KA 2JA1A 4NOJA 5EJ7A 4UDYX 1XZNA 2B4AA 4BIIA 5C1OA 2O2CA 3I9FA 4XUGB 1K0UA 3EGVA 1U8YA 4U3JA 4RS4A 1XZGA 3VU9B 4KQMA 4MLZA 1N5OX 4GPZA 5ADHA 1MHTA 3FPBA 1TCBA 4D44A 4ZHQF 1IQ0A 1JHQA 1T6ZA 2JGNA 2P9ZA 1GNQA 3OZGA 1CY1A 2IBMA 4NH4A 1P60A 3QBDA 4Q12A 4D8XA 4DG8A 2JH9A 5E1OA 1WUKS 2TSYB 2Z2IA 1SUAA 1DOZA 3CTPA 3H5VA 4IXMA 1S5PA 5NULA 5AHOA 3WSTA 2IHZA 4DIOA 4R5HA 4BKUA 2OHOA 2HK9A 3O95A 1JH9A 1RP7A 1LRKA 4CGZA 3ILHA 3IXLA 3QIVA 1Q7RA 1P1IA 2IYOA 1L0BA 1TVKA 2FG6C 3DLAA 2X42A 4OHMA 5CT6A 3EODA 2CXTA 3PQ3A 5DISB 3BN3A 3QXHA 3RFCA 3SU8A 4J0KA 3RTAA 1PGPA 2R47A 2B5OA 3CISA 3E7FA 2JFNA 4OKIA 2A9PA 1W52X 3Q7TA 4Q9HA 5CHYA 5H4GA 2P7HA 4G0ZA 3SKYA 2R7NA 2OBYA 3L46A 3ELWA 4RENA 1A82A 3IAS6 1QE5A 1X74A 2HMSA 2Q6TA 1V45E 1ZO8A 3EZ2A 3GNLA 3LYUA 1KZ4A 4O8CA 4YP9A 3WJ2A 4CQMD 3I61A 5BXYA 2WNIA 4LY0A 3ZWMA 5EVJA 3H18A 2EX4A 3D59A 3FVVA 3VPFA 4B71A 3C39A 2DPYA 4C4ZA 3B78A 4A2CA 3AR9A 2JGLA 1YSCA 3D6MA 3FNGA 3M81A 1RLJA 5JUWA 4N3GA 1BD3A 1DKNA 4TXHA 2PT9A 2DZDA 2OZPA 3K5HA 3ELUA 3H7IA 4HDMB 4Z4IA 3CZCA 1CYDA 3BRWD 3CJQA 4G9EA 5B58T 2H54A 1PDVA 3PR3A 5IANA 5CH8A 2F8TA 3FLEA 4M0PA 1EXDA 3M6AA 1DQRA 2OLKA 4QUEA 3DZKA 1PEDA 2C5HA 2VWPA 3IQDB 2G28A 2QDKA 4PC2A 2J5RA 4X6YA 3RCBA 1BG6A 3GNQA 4GRIA 4PO8A 1T2AA 5HNKA 4D42A 3FUWA 1B43A 1TVEA 4XCQA 4NQZA 5A9SB 5G3YA 2IX9A 5LQRA 1U2RA 4C87A 2Q3JA 3JV7A 3NYRA 4OFWA 2AN4A 4YB8A 2VQSA 5F7OA 1Z4MA 2IDKA 4IDGA 3U13A 1NASA 5A7FA 4DR7B 3LIPA 4J9VA 1WPGA 4UBLA 3HKBB 4ZVRA 1P3Y1 2XWQA 5IK2A 5TNXA 4M87A 1XDBA 3DHEA 4RQUA 4W6ZA 2OV2A 5H9WA 4XFKA 3MINA 3FCSB 2OKGA 1XDZA 4CMAA 3T3IA 1A9XB 1OCEA 1EGMB 4XE5A 1X9HA 4PN7A 5IZCC 2YZNA 1LLQA 1G63A 2XTJA 4V0MA 2EV9A 4NI5A 5JJCA 1Q1BA 1V95A 1NRJB 4WA7A 3ZS9A 3ODGA 3ADDA 2FZ4A 4DT1B 1H3NA 5HRUA 2R2AA 4KLRA 3MUEA 1T1RA 1QE3A 2R5FA 2FHSA 3DL7A 4H15A 1BHQ1 4DUGD 4XIGS 4P2GA 4ZKDA 5L40A 3KSZO 3O6VA 2NOAA 5T4HA 1JVBA 3EVGA 3QE0A 3L9XA 4H3VA 4F84A 1BXKA 2FOXA 3A6FA 1SUPA 3D31A 4JDUA 2I4LA 2Z58A 3M33A 4DR5B 3CZQA 5DLYA 1FE8A 1L8AA 3NHUA 1RYZA 3KSAC 1KI8A 2M1XA 1JN0A 2ZJ5A 2H06A 3O3MB 2QZSA 3N6RA 4XD7D 4RE5A 3BG5A 3CZ9A 3NAQA 3HDYA 3MRXA 221PA 1GSAA 1FUKA 4BLVA 4HUQB 121PA 1U3TA 2P4UA 5CA0B 2VP9A 1XVVA 1Y9JA 3T5DA 5FTKA 1SQSA 1DEHA 3CNOA 2W2OA 1LBIA 1WHTA 2FN7A 3RYCA 1QGED 1QIIA 4E94A 4DQKA 2FFRA 4EB6B 5GZ1A 3RVJA 1GV0A 3AWIA 3E5RA 4WZZA 2DLDA 4XWKA 1D5WA 1YQQA 1ZG3A 2BE7A 1AV7A 4JY7A 1ZH8A 2XXBA 2K4MA 2NV0A 2J9RA 1XAHA 3KQVA 1D8AA 1Z6ZA 1ZUWA 2EP7A 4OQPA 5ALTA 2WU8A 3A4MA 4QPNA 4J76A 5LIRA 4TWZA 1BXZA 1C1DB 5AJXA 3TCXB 2F9FA 2YWRA 2VC2B 5DNWA 5G1OA 2C96A 3F73A 3AYZB 2AYXA 5A4MS 1ZD9A 2RAVA 4FCCA 4LN1A 4PC3A 1ZH6A 1EQAA 1NVUQ 5IDVA 5AQ1A 5IJ0B 2OHXA 3ENKA 3TPZA 4AZTA 2G9VA 3URMA 4D9KA 3CQ9A 1EYZA 2C20A 3DPSA 3DVAA 1BOFA 2IF2A 3DWGA 5K4AA 3BORA 3WGZA 3Q88A 2WSMA 4LJ7A 4RY0A 4BFZA 3U4MA 3UH0A 4NNPA 3UBTA 3BJMA 1G17A 3IESA 5FX2A 4Q24A 4XJTA 1JIQA 4D81A 1T2FA 5KDDA 1AO3A 4OHKA 2KYRA 2C57A 1L7XA 1QRAA 5CK4A 1VIAA 2RC5A 3OBIA 3KKLA 1DJNA 1XTZA 4TMWA 5FFMA 4OXKA 1K7FB 1U28C 3ZCUA 2JAPA 5HE8A 2P2DA 3G59A 5FPTA 2J5BA 4AL4A 4BV2A 3LKVA 1R0BA 5BQ3A 5CXQA 1D2CA 1SZDA 4TTRA 3HUFA 4U4AA 2WT4A 4TTJA 2WU1A 4DBLC 1V9LA 5YASA 4MK4A 4DE5A 3S8EA 2VUUA 1YUNA 1BMFD 4UPEA 3H3JA 3DOIA 3TIGA 4INPA 5B37A 4EKNB 3PHGA 5L51A 5FWXA 2CLMB 1UKCA 3HCBA 3ONVA 3T1TA 4BS9A 1TAUA 1CUGA 1DDGA 3OZCA 2AJLI 1BKSB 3MJDA 5H80A 5AXCA 4LXYA 4N5MA 2NXEA 3GUZA 5JNVA 2VA8A 1TM3E 5G4KA 1PJQA 3CLTD 2ANCA 3HJRA 4TXJA 3TLAA 5C7YA 3SK0A 1OV4A 3H42B 2EZ9A 3QJ5A 1C1XB 2W42A 3FTQA 4E4TA 2ISQA 2ZYAA 2AV6A 4DUYB 3GEEA 3C3AA 3NHYA 4UFOA 1SD2A 3UCEA 4GLFA 1FFGA 4FHCA 2XY4A 2XMPA 3JD1A 1IU9A 1OSNA 3L07A 3LUJA 4XPIB 2PUAA 1ZRMA 4NCNA 4FZ5A 5HE9A 2NU7A 1IZ8A 4K9NA 4NYMQ 4PZLA 3W04A 4DMFA 1FQOA 2DPLA 2PFKA 1NONA 1XDWA 4EHBA 4HK4A 3LP8A 4QRHA 4PGHA 3D3QA 4U7PB 1T1EA 3LKZA 3DFKA 2QYSA 2R6GA 1KF0A 2AOUB 2COEA 4C2AA 4PLWA 4QBGB 1YH3A 2ZTSA 4EUHA 1E0SA 2AJCA 4XPZA 4JLBA 4RADA 2YW2A 4CFSA 1BEEA 1WDMA 1J8MF 1E1CA 2G0TA 2GAAA 1GDDA 3MT9A 4L51A 4QQNA 2Y9MB 4QELA 2Q0HA 3LZDA 1OMOA 2OV1A 3HBMA 3JY6A 2R6FA 3A7DA 3U7IA 4FFDA 3MMNA 2ZETA 1C50A 3HLKA 3LFUA 2GASA 3KXLA 2EBFX 1NXTA 4H7PA 4LRQA 3ZNOA 1V43A 4YXWA 2IH4A 3ZD6A 4LPSA 2P5SA 3TZHA 1CEQA 2FPKA 4NZMA 5FLEX 3FPLA 4C5BA 3EQ6A 2DFDA 2G82A 2P4QA 3OLWA 1SVOA 4M7OA 2ZWVA 5DEIA 1RFGE 3ZGZA 4RHFA 2O2IA 3GFFA 4C4RA 2VRBA 3OE7D 4DC0A 1W0JD 3NHSA 4H0FA 4MYHA 5LLSA 3H9UA 5EUMA 1QZUA 4AQDA 1SKMA 4PEVA 2R44A 2VSNA 4HDOB 2HQBA 2HT6A 1JTFA 2FPOA 4KRGA 2PX0A 4EW2A 1Y81A 4FQ8A 4J7UA 4CWAA 2Q2WA 3FZQA 5MDHA 1V11A 4OHUA 3ZY2A 3I2YX 1ZOLA 4IIXA 3U5TA 3KR9A 3CVYA 4JU8A 1X39A 2YBDA 4UHFA 4XPIA 1THTA 4HJXA 5MF6A 3QOYA 1BFKA 2IV2X 1II8A 4ZDJA 1TQ4A 3LCVB 3HYLA 3BTVA 3H2KA 1L5RA 5I7HA 4Q1BA 4FE4A 4X0EA 4C0WA 1N1DA 2O2DA 1RRCA 1PS8A 3AEQB 3FRIA 2Q45A 2X0IA 1ZM9A 2IHTA 2ZPTX 3ZKAA 5HF6A 3HXQA 3VKGA 1NUTA 1VB5A 2VPZA 3GRAA 3OLYA 2FGKA 2IEGA 4RXMA 3U4CA 4QM6A 1XTIA 3PQ5A 4TV9A 3ZIAA 2HA3A 2IYYA 2Q8NA 5K05A 4I1SA 3BXPA 2Z3WA 2BSAA 3GJYA 3VH1A 2JHCA 4TM8A 1IBKB 3RIEA 1VHDA 5KOHA 4PYQA 5E4YA 3GUYA 1TLLA 1PWHA 1JRLA 1T8RA 3N8IA 4Q18A 4YS6A 3B13B 1GARA 2ATVA 2WWVD 1JKJB 1TTPB 5I5EA 1JDPA 4HGOA 5JYEA 3PUZA 4CLOB 4FFPA 1VHLA 3TIIA 6CHYA 1BVHA 3C5CA 4W9RA 1VDZA 3VM6A 4MVJE 2O7SA 1K06A 1CDEA 1R8SA 1S2LA 2E3JA 4IEEA 2WD9A 5AVKA 3UQZA 4DBVO 2HSZA 4B17A 2P3OA 4IFBA 1R0KA 3LJKA 3RRNA 5I7RA 1D6SA 2HV8A 2VTDA 1NV9A 2WWRA 2ZYRA 3OICA 5A6SB 4BU0A 4D4JA 3DBHB 1W96A 1GA6A 3HDGA 4LWOA 3RB8A 2PZMA 4YAUA 2AD5A 1QVZA 3JAWA 2NVWA 2R1TB 3BRSA 3WHLA 1EUCB 1JV2B 4LS3A 1UK7A 2X3YA 5CEFA 2QG4A 4KJXA 3Q7RA 1E2JA 2HUNA 3VOAA 2OHHA 1U7DA 4A8JA 5LR6A 1QIGA 4UXIA 4LXXA 1Y4SA 1NVKA 1U6KA 2V7GA 3QKIA 3V4RA 3Q9LA 4IDPA 2OCAA 4AYWA 4YV0A 5AVRA 4YJDA 5TGZA 3ZH9B 3MHTA 1EK5A 4Q3OA 5FPKA 1RXSA 1TO2E 4TKVB 2J3EA 2G77B 2J41A 3PC7A 4G4GA 1L5KA 4PXAA 1B1CA 2ORYA 4KFSA 2YBEA 4XUDA 5EHGA 4DWJA 4D80A 3AIIA 3GNTA 5CCEA 1BE8A 2PUWA 2Z6VA 4I8IA 4JSTA 3WRXC 5EJ6A 2W6ZA 3UUEA 1I36A 5KYXA 4AX8A 5MN5A 2QTHA 2C4UA 3D3WB 3HCWA 4HWOA 4RK5A 4M6WA 4GIBA 3SSAA 1FS5A 3P0EA 3TZQA 3O2SB 5I45A 2A92A 5TARA 3HSKA 3OHSX 4Y7CA 4JI5B 1ZISA 1RTKA 4DSOA 2R1UA 3I0ZA 2UUBB 2FX2A 3NOVA 4XGIA 2PGOA 2Y77A 3RLIA 1OA1A 4D96A 2P6RA 4OJQA 1XQXA 1CRWG 1H8HD 3JD3A 4K3VA 4O1MA 3VPCA 1T10A 4F5DA 4FFBA 4MVJF 3ZYZA 4YCJA 4XIFA 1TZ2A 5HKKA 4PSKA 3PNPA 4RDHA 3NNDA 1KMHA 4K2AA 3X44A 4IVQA 5ALKA 1OBVA 3D8NA 3N8HA 3ZTYA 3V8VA 2D5AA 3K35A 4QDTA 3U44B 2H2DA 4ZVSA 4C88A 5FTJA 3RS4A 1Z9BA 1ZIOA 1CRQA 3IUYA 4JL5A 3RFTA 3DHYA 1PYOA 1ZMBA 2OO5A 3BMOA 2ZRGA 4OG2A 3P9SA 4ZZIA 1OXTA 3SDSA 1J0XO 1G20B 2IS4A 3NIFB 1CE8A 4J0QA 4U2KA 4RMGA 5F64A 3GJ0A 4L5CA 1R3UA 5FOXA 5CDGA 3FM9A 1TA9A 3ZHOA 4KKVA 2Q5FA 3DULA 1A9XA 1JG7A 1X92A 3HI4A 1ZXLA 3PQCA 5BSRA 1VC2A 3U44A 4LHVA 2QPLA 2KB0A 5TXGA 1JE1A 1DIBA 1K7EB 4FONA 1I0IA 5KSPA 2P0EA 4WBXC 3I64A 1P1RA 1QMGA 1XXLA 3MUFA 4WLEA 3DBIA 1HSZA 4KFTA 3GLIB 3U31A 3PX2A 4YJFA 2EX0A 3TM5A 3QA9A 4WK2B 3HBJA 3IDSA 2PQ2A 1II8B 3COPA 3MRTA 4L27A 4YRCA 4BNWA 1JR3E 5EKXA 5A9SA 1TUBB 4ZHQA 1TVCA 2FFAA 5BWBA 3AJ9A 4YT4A 1Z88A 2QENA 2XUJA 3EDRA 3LCJA 4QASA 2ZTVA 1FNBA 4IRXA 4ZAWA 5HKAA 4PZ0A 1L5LA 3MERA 3A3KA 4MCJA 1SEPA 4YRSA 1C1YA 1EK2A 3Q8LA 2WTAA 5LA6B 2ZGVA 3MIIA 3W1WA 3KP1A 1IY9A 1NNLA 1PZMA 2A9VA 4HZIA 5FWYB 3LRXA 1PD1A 1CQWA 4TZ0A 4CEIA 4W1RA 2DJIA 2AFIE 3PUIA 4R31A 4CL0A 4FZVA 1KXJA 2R60A 4B6JA 2M32A 5HYVA 5GV8A 3WQBA 2OXFA 3NHJA 4I4TB 3C48A 5TQVA 3RROA 1X3SA 4RHXA 2XB4A 1PFGA 4UJ5A 4DCPA 2C8LA 4KDRA 1SXJA 2AIRA 4O4IA 2W2NA 1NW8A 4E31A 3TE7A 2KI5A 4NG5A 2WKPA 3O4JA 1IY1A 2YWFA 4GLBA 4LBYA 1W93A 4MWDA 4DXAA 2SKCA 3TLKA 4F9EA 3KVVA 3TTYA 3ZK7A 1I3NA 2YHUA 3FUCA 2MSLA 1K8YB 4HNAA 2J0SA 3A04A 4JLUA 1NE2A 2FFHA 3LPAA 2PG3A 1V4VA 3MW8A 3S5UA 3W79A 2PKXA 5LLTA 3FSEA 4DQXA 2EP8A 3H5OA 3UMRA 1PAUA 2G36A 1ZLYA 3RBZA 1XNJA 1T0PA 3CS3A 4H4EA 2AFVA 2RFLA 4L7QA 2GZMA 1PT7A 3CR3C 3ZW7A 5HS4A 5JSKA 3BRCA 1HDRA 3M3PA 5IT0A 3HVRA 1UPXA 2XTZA 4QJ5A 3AZPA 5IUKC 4YUZA 4G5FA 4N0EA 3WB9A 3PC3A 5FI1B 3RVDA 3WMXA 4C0AC 4YCBA 4FVTA 2PA0A 1K75A 3EF1A 1H65A 4C06A 3QEBZ 3B6KA 2E5LB 2WM9B 2C5LA 2PV0A 3NH9A 2O8DA 4BZZA 4RPCA 1GEEA 2ZXUA 2L17A 3PEVA 1E60A 4UCFA 5LZ5A 2GVDC 5HSGA 1E3MA 1L7PA 3SJAA 3RSHA 3RYTC 1BA3A 1LJLA 2CLKB 2IV3A 4JJIA 3ILSA 2OCIA 1TXGA 3C7CB 5A4JA 1JG1A 1Q0ZA 1IXKA 1DZ3A 3L8ZA 4JAVC 4HMPA 3ROTA 1Q20A 1R0ZA 2W9XA 5KI6A 1A4XA 2FJPA 3GT7A 4LDQA 4DIMA 2RKBA 3DEZA 5TS2A 4AG5A 1U31A 1GU0A 1NXXA 2CXUA 2R8BA 2WDZA 3CY6A 1KYIA 3PLRA 4L95C 3ORYA 2IH2A 4X20B 2W6QA 1KE2A 1T5SA 4RJLA 2N75A 4IOJA 3C87A 4JB2A 1MG5A 1JZTA 2EW1A 1SVUA 3QJGA 2H1RA 1IBCA 5DIZA 1G3MA 1WW2A 3DYVA 3E35A 3NDJA 3RHTA 4R1QA 4FILA 4RVOA 4ZO6A 4EGFA 1NI4A 2QR3A 5BR4A 1TRHA 4I1RA 2H1FA 2QLBA 3O4HA 4DCOA 5LOVA 1XG5A 2JFUA 2GN8A 4UU0A 1WDTA 4J75A 4B3CA 1AVTA 1ENZA 5B7GA 1OTYA 4U8GA 2WJHA 1Z82A 3WA7A 4U8HA 4F1KA 1NNSA 2ZS9A 1GGNA 3DYIA 1ZKDA 1GG2A 4PLHA 4BNKA 3ZVKA 4OHWA 3MEQA 1P7PA 2YICA 2P5YA 3O38A 2WQZA 4HX9A 4I14A 4MUIA 3BXXA 4WAUA 4EYQA 2PNJA 3IP5A 2XHEA 4CIYA 1XDGA 1KZ1A 4OQLA 2R62A 1IXSB 4U5QA 1E1CB 3CLSC 4HNHA 1QV6A 1CW2B 1Z47A 2VQDA 3Q0IA 4HAVA 1QOQB 1C1DA 1EFVA 2C2YA 1X1TA 4GU5A 4CFYA 2QRMA 5BQPA 1SPBS 1CK4A 3OJOA 1CZHA 3KELA 4LMRA 1VIDA 2RK3A 1I5EA 1SUWA 1JLKA 3W7BA 4D0RA 2P41A 5L3SB 2X9LA 1I3OA 3R9IA 2VF8A 4UVEA 3FAZA 2O8VA 1VXRA 3QPBA 1XQWA 3JRNA 3LT2A 4YACA 4ZYTA 5DN9A 3EGIA 4L8YA 1HLPA 3SDBA 4BNGA 3OQVA 4XWOA 1DAKA 1UC8A 3WYGA 4C3OB 5E7JA 1NXVA 2D3TA 1AB5A 5FCDA 2XBLA 3CE9A 3LCCA 3R5XA 2X0FA 1G0NA 4QL3A 5BOSB 1S2IA 4CEHB 2B6HA 4LE1A 1P0QA 1PNQA 4S05A 4A6XA 2ROQA 2A5DA 4DLVA 1H4SA 3ZLJA 2IY9A 1CZUA 1ZA1A 2EFDB 2HWYA 4Q93A 1WTCA 3H2HA 3HADA 3UTCA 5G1PA 4DR3B 5EQTA 5TVGA 4E5UA 1EVLA 1K8XB 2IPNA 2P2NA 4R81A 6REQA 1W19A 1Y3FE 5EJGA 4OMFG 3LA6A 2ZWPA 4B4UA 2FFQA 2B4RO 2B4KA 4RFSA 4MRRA 3UM9A 2Q1YA 1F4VA 5LYYA 3WGJA 5AW0A 1D2GA 1NKVA 1DX4A 3KTDA 4FZRA 2OAGA 1J07A 3I6MA 5B7QA 2X19A 4FS8A 5TGDA 1UT5A 3RRXA 1Z4QA 2NU6B 1AZLA 4H9GA 2Q4EA 4ZAGA 2I6XA 2ZJ7A 3GW8A 4UCXA 4I7EA 2DR0A 5B2EA 3QZUA 2A5LA 1SCNE 2LCFA 3L0DA 5AW3A 3T52A 1MOZA 1M76A 3PJRA 1E92A 2V98A 1EGQA 2XITA 3U17A 2P2SA 1V7ZA 1B41A 1BDHA 5CFNA 3OSZA 1YNSA 3GRUA 2PPLA 1GM5A 1C8VB 1O5IA 1UC4B 5JROA 3ABQB 3LK7A 3OAAD 3ESCA 2QAGA 3R0ZA 4LRSB 3SKXA 5C4GB 3VZQA 4U2BA 1PP4A 3OKCA 3U61B 3HP1A 3LT5A 1W35A 2CW5A 3BXHA 5FAXA 2JGMA 3MXOA 3OE5A 3OHPA 1KERA 3FGNA 1AQYA 1QR6A 4BO6A 4JENA 3G6WA 1P7VA 1U9ZA 1I80A 1OXKB 1VE7A 1X14A 5CB8A 4OSEA 1QO0D 1YONA 4ZEVA 2QTVA 4DMLA 3MGBA 3B82A 3R1IA 4U6QA 1AQUA 1FQWA 1SKBA 4AIIA 1PNOA 2H4XA 4LNAA 5C7OO 4TUYA 4IZIA 3QKSB 3HCNA 3TRIA 2O8FA 1WSBA 4UBJA 1FTYA 1V8BA 2QXUA 5DGDA 1JPUA 4G0NA 5TGTA 2HF7A 4P0PB 2PZ8A 2Q5JA 2IYWA 1VXOA 4LBZA 1O77A 5T4BA 4E3WA 2PFSA 3LVQE 1V26A 1M6EX 2GBPA 2L2QA 4HXYA 5BT8A 2NU6A 1GZ6A 1L7EA 3QWHA 2J6BA 1GZSA 5T8KC 3VV3A 3ZV6A 3LTEA 3TVTA 3IUEA 3ZHSA 3LWNA 3VNQA 1T6XA 2KX7A 4P4TA 5KSYA 3QIAA 3UYLA 5C80A 2ZSIA 1FYWA 1XCGB 3OCUA 3GB9A 3QQ5A 4KIUA 4L5BA 4NQRA 4TS1A 1H4QA 2IW3A 3VHXB 1XWFA 5KVCA 3CUKA 5JECA 4MHTA 2QGZA 5DP1A 4NU5A 3QU5A 1S4QA 2OKCA 5FPSA 4UFNA 4ZN6A 3P2YA 1LBEA 3NXKA 4W5TA 3SQXA 1PZHA 4CE6A 1C4OA 1MGPA 3GX1A 5CW2A 1TEZA 3CW2A 3G0HA 3LO5A 2ZUEA 4BAZA 2ZS7A 1PGNA 3EGEA 3VAAA 4K8OA 4LJLA 2BFBA 2QN2A 1UPCA 3K9CA 4R0VA 4YFYA 3WSVA 4O4HF 4YJ2A 4A1OA 4WGGA 3QU9A 2GILA 2OUIA 3UJCA 4AZ3B 4IY1A 3AERB 3ANLA 1UZMA 2UKDA 3MZ0A 2FUG1 4MUNA 1W44A 1E4VA 2YASA 3HKDA 4QGBA 5DPMA 4UBKA 3VDXA 4FB5A 4LRTB 2HHJA 1T5IA 1L5NA 3OM9A 1J00A 2P6OA 4KYUA 5EWJA 3GLFE 4C5CA 2IS6A 1XVLA 2WNHA 5AI8A 4E2WA 2QE7A 3W9SA 4N0PA 4B4OA 3WK9A 2XF8A 5JSZA 4RU1A 5JD5A 2RGUA 3K09C 1QV9A 1HDZA 1L6RA 1GQOA 2ET6A 1LS1A 2EHDA 2BMVA 2XSZD 3HYRA 3LOPA 3MMPA 3GFOA 4IX9A 2PSSA 4NBUA 1N5DA 3DE1X 1W85A 2W48A 3M6MD 2VVTA 2D6FA 3HNOA 1USWA 2MSEB 3WRYA 5D6NA 1JXQA 3ASUA 3B1KA 5TS3A 1DLJA 4NS4A 3TTXA 5IDQA 2VNSA 5JHGB 3F8SA 5CJJA 1LX7A 4WMLA 4G2TA 1KSJA 1IG3A 1NBOA 3V8NA 1LPAB 3AEKB 2MT9A 4KPUB 5DYIA 5L3QB 1Z5PA 4HAWA 1IQUA 3M6WA 4A0FA 4B5KA 2HYDA 3FFTA 2Q4RA 3OKPA 3QXJA 4EGQA 3ZWOA 3WRXA 4N18A 2XKKA 3KOZA 3WLJA 3L06A 1G291 1NX9A 2YL2A 4KWEA 3IDAA 3T3HA 4F04A 5KCZA 4IZ6A 2JRCA 4DZTA 1YCGA 1RLIA 1MB3A 1GKUB 2VHXA 4EL0A 1GFIA 3SYRA 4RK4A 4EUSA 3ZXUB 3CVOA 4NMMA 1SBNE 5FUVA 3B3JA 2IL1A 4MCAA 3NNNA 1AMNA 2WYIA 4ZEWA 1IEWA 3ZGOA 1XEWX 4EFDA 4I5EA 1NNEA 2DRIA 1HZJA 3I6IA 4Y2HA 2OCXA 5EIOA 2NACA 1DP4A 4CG3A 4CMKA 2DEUA 1IY0A 1BDBA 4N0QA 3P4XA 1W6UA 4PFJA 5H4HA 2ONZA 3U62A 4DRXB 4E33A 1E1NA 2X7HA 4A3SA 1WCIA 2KJQA 1MAVA 3A9WA 4C30A 4ZYVA 4J49A 5JSZB 3QKRA 4DA8A 2VH5R 1VYVA 1B0ZA 1RQGA 5HQ3A 2DUWA 4NAHA 1CUYA 5FR1A 4C7BA 3NWEA 4GR5A 4F4IA 4KR3A 2QJOA 5DTQA 1YZUA 3ZE8A 1XDUA 3GFTA 3MG9A 4ETWA 1NIPA 4EZIA 2DUMA 2Y6VA 4GF5A 2JCSA 3WYCA 3ISVA 1NP6A 3VU9A 2QTAA 1R9NA 3L7YA 4PQFA 5IAKA 2ASVA 2RI6A 1LW7A 4GKVA 4K9SA 2BF4A 5EIBC 3N87A 4IVRA 2FF7A 1R37A 3EUWA 3FMIA 2FKNA 4QRIA 4LOAA 5IARA 5IJAA 4GR4A 3ZDYB 4JS0A 2FCRA 1XTSA 5TPZD 1ZK0A 5EY5B 1W46A 2YC2C 1B2RA 3CM0A 2OO3A 8AT1A 3U6BA 1FMFA 3CGWA 1KPHA 3P7MA 3PGJA 4KXLA 3KYJB 3VRHA 1G19A 1EP3B 3CIOA 5ECGC 2C7VA 3VR5H 3QTTA 3GN1A 4UEJA 3ST7A 1WMDA 2IPMA 3QYAA 3ZQ4A 1SUCA 3H0KA 1J42A 2A0KA 1LI4A 2FEXA 4DMGA 1J1IA 1M2HA 3LYLA 1JEEA 5DGHA 3T5GA 1EK1A 4PC6A 4RFVA 1B7GO 5LM3A 3O1HB 4CL8A 2G08A 2R00C 2Z3ZA 2NVBA 3HWWA 4HQNA 4ZYWA 2FWNA 1CY2A 2JIPA 1M6YA 1E79D 3GCWA 4M22A 5DU2A 2PUBA 3W8EA 4FHGA 2JLWA 4FPXA 5AW4A 4B6SA 1U0HC 3P2OA 3P97A 1O0CA 2C88A 1PBTA 2F3UA 1P1KA 2AH5A 4TUYB 3P1JA 2BTOA 1E9AA 3IBYA 3PA8A 3TI7A 4OLAA 2GD6A 3I9V6 3H05A 4KLZA 1A9YA 2XTNA 2XOEA 1L7AA 1P17A 1E3WA 3T5MA 1EFLA 5C2JB 1XNRB 3EVBA 3I01M 3TB6A 2BLLA 5A71A 4XVQA 3CPEA 1N32B 1GPWB 3E8XA 1KVSA 1YZKA 3Q7IA 2VBFA 2D5IA 5AW9A 4EYKA 1DGQA 3RM3A 4B73A 1Z5GA 3EXHC 2B69A 5BOVA 3ZDXB 2B5WA 1RCUA 2GEJA 4HQ6A 4BMYA 2R96A 4D45A 1GG9A 4DLSA 4YRZA 2C83A 3WWZA 1FDIA 2Z9CA 5TT0A 1N78A 1II9A 7AT1A 1RBMA 1UZLA 4B5LA 2ZJ2A 5IXYA 1TLTA 1JI0A 4GGOA 2YY5A 2QVCA 2QVGA 4MUYA 4A8JB 1K9VF 3O8DA 3ICWA 3UYKA 1JLSA 3G13A 1KQOA 1GSHA 3F90A 1JPVA 3JQFC 5FUXA 1YVUA 4B7XA 2QTFA 2NTEA 2BAGA 3IIIA 3L18A 1ZOPA 1HLDA 2IE0A 3IVCA 4UNSA 4WVFA 1RIIA 3I2FA 5TQ0B 3ZCXA 4B3IA 1XQVA 5HHTA 2VT2A 2FMUA 2XQIA 3FXAA 4L8LA 3K8YA 2MINA 4BFYA 1TM5E 2I29A 4UVHA 1EE9A 1K3FA 1C7JA 1OASA 5BYBA 4NHOA 1WM1A 3W6OA 2V5VA 1BO6A 1Z73A 2QHXA 1B0UA 1E7MA 1U0LA 3A4NA 3PENA 1PZFA 2GPTA 5EEHA 5JO9A 3PDIA 2PRJA 4KBYA 5TMEA 3H5NA 3DC2A 3DBLB 3EG9B 5JBIA 4EA7A 2VYNA 5JARA 3GZJA 1XMXA 5EFOA 3SFVA 4DLBA 3EFBA 3UXYA 5LZ8A 4EPVA 4JI0B 1UZUA 2ZRCA 1UK8A 4UHJA 3JQ9A 4MQFB 1Z7YA 6REQB 5FOWA 2X6TA 2I6SA 3E3AA 1Z07A 2C1EA 3K16A 4Y1FA 4EVQA 1D1PA 2WAXA 4UNQA 1ULSA 3H5LA 1AD2A 1JDSA 2A5YB 3KV3O 3R7SA 3FTEA 2GAJA 4D4LA 5MFZA 4LUCA 1PFVA 1HDCA 2Y1GA 3AEUB 1PX0A 4QFDA 3F47A 4DIBA 1Z6YA 1ZJZA 4OTZA 4BE9A 1A9SA 1LDYA 3AU8A 4G36A 4RVCA 4I4TF 3VU1A 1ZAKA 1VG8A 1QONA 1U7ZA 3H0CA 1XJCA 1N92A 2H57A 2C4TA 3KVNA 3OF5A 4DAEA 2H3EA 3E0QA 3ZV4A 2UZIR 2YMLA 8OHMA 4P3KA 3QI2A 4NICA 3RHSA 4CMGA 2AQKA 2J46A 2AEJA 2G1UA 2HPVA 2V5UA 1YV9A 3O2JA 3ZX5A 4O4JB 4XI9A 3V7YA 3E9ZA 3Q41A 2E5WA 3AYXB 2WIKA 2Y71A 4AX4A 4Q4AB 5TV2A 1RLTA 3DWIA 5FF9A 4S12A 2QIOA 1YIOA 1RLUA 1NM5C 1Y8QB 2GNAA 2F43B 1X9IA 1BGXT 1SBZA 4N6OA 4NOKA 4AJJA 4FW8A 2ADOA 5I47A 1RACA 2OK7A 4YV2A 3BMQA 4UOQA 1IWBB 4WTOA 4ZXPA 3STTA 4GNRA 5BN5B 2HSEA 2WP0A 1U3FA 2YXLA 1QH0A 3OPNA 2EWWA 4JB8A 5G0TA 5SZIA 1E0KA 3SS8A 3AI3A 4BX9A 4YCMA 4QZVA 4HB4A 3IR7A 3E9CA 1FYFA 3QUBA 4QVIA 1ESDA 4RIHA 5ESWA 2PGIA 2PRYA 3KO8A 4TROA 3EQZA 3RUDA 1YJCA 3GU3A 5KTYA 3W5BA 1FF9A 3HJCA 3BBLA 2P1ZA 4L9AA 2CDNA 1J20A 2GBFA 3MYYA 1OIXA 2ESRA 2Q9UA 4K5QA 4ZCSA 4MS4B 1NWCA 3KJNA 1GL7A 1U1CA 2BKUA 4W82A 2BCEA 3BD9A 3RSFA 4U2DA 1LV8A 3RANA 1XPOA 4BCBA 1R4NA 3S40A 1RHQA 2CWDA 1EK0A 3FR7A 3KYCA 4P53A 3PQ2A 4EY7A 4CLOA 4FDVA 3FKQA 1DDOA 1JDJA 1A8SA 1EDBA 3ETCA 5G0VA 1M6VB 2RGYA 3N05A 4FD2A 2FPXA 1UXHA 3RSGA 4RVSA 4C0HA 4ECEA 3V4PB 1C7IA 2UUAB 5ITWA 4R40A 5HMLA 4YMLA 3RTDA 2HSDA 5ER9A 3PIRA 3TTUA 2P4HX 4BVKA 1JYFA 4CTKA 2CFRA 5K8IA 4UQPA 2IBTA 1U3DA 1CUSA 5AUNB 4QAQA 1VL5A 3KPWA 2I65A 1DQNA