4IV0A

Crystal structure of n-methyl transferase from plasmodium vivax complexed with s-adenosyl methionine and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
263
structure length
263
Chain Sequence
ISEPVDIKYLENNQYSDEGIKAYEFIFGEDYISSGGIIATTKILSDIQLDANSKVLDIGSGLGGGCKYINEKYGAHVHGVDICEKMVTIAKLRNQDKAKIEFEAKDILKKDFPESTFDMIYSRDSILHLSYADKKMLFEKCYKWLKPNGILLITDYCADKIENWDEEFKAYIKKRKYTLMPIQEYGDLIKSCKFQNVEAKDISDYWLELLQLELSKLEEKKEEFLKVYSIKEYNSLKDGWTRKIKDTKRDLQKWGYFKAQKMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoethanolamine N-methyltransferase, putative
publication title Phosphoethanolamine N-methyl transferase is a Malarial drug target
rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 110
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.103: Phosphoethanolamine N-methyltransferase.
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iv0A00
3B5IA 3LKZA 1INLA 2GA9A 1FPQA 4RVHA 3GJYA 3KQOA 3RODA 1XXLA 1NE2A 1SQFA 1VIDA 1VLMA 4HC4A 4QPPA 4CXMA 1P39A 3OU6A 5CVJA 5FTWA 5H02A 4E2ZA 2GPYA 2R6ZA 1L9KA 5DX1A 2P7IA 2G70A 2YX1A 5HIIA 4E2YA 4MHTA 3TLJA 5DLYA 3PVCA 2GH1A 4Y2HA 2YVLA 4C05A 1D2GA 2JH9A 3DXXA 4MQ4A 4QTUB 3HNRA 4U7PB 4X41A 5DRYA 3LDGA 5E2BA 3SX0A 4F84A 3GGDA 4GOLD 5HFJA 3E7PA 1G8SA 3TR6A 2PSSA 2CKDA 5LR6A 4PIMA 2JJQA 2IIPA 2ZWVA 3T7RA 3V97A 3AWIA 3E23A 1YUBA 3P71T 4FGZA 2OY0A 3DMFA 4YMGA 5CCBA 3PFHA 2HWKA 1KYWA 3B3GA 5D1NA 3OFKA 2FK8A 1XVAA 3EVCA 1IM8A 3UJCA 3OU2A 4XUCA 3UJBA 10MHA 3CJTA 3OCJA 5EQJB 4P7KA 3JWIA 5DPMA 5E1MA 2PWPA 5JR3A 1T43A 4RVGA 4RTNA 3DUWA 5E1OA 3HP7A 3ERCA 5MHTA 5E1BA 2GB4A 1TW3A 1PRYA 5C1IA 1KXZA 3AXSA 3OU7A 3G8AA 3OZRA 5FADA 3G5TA 3O4FA 3EEYA 5FUBA 3T7SA 4AZVA 2UYHA 2UYCA 3DP7A 4QVGA 1VP9A 2CMHA 4X60A 1L3BA 2WA1A 2OKCA 1WG8A 3C6MA 3PX2A 5EZSA 4H0NA 5E1DA 5DSTA 1NW7A 2NP6A 3B7PA 3KPYA 4PYMA 3PFGA 5P8WA 2E5WA 3MCZA 1NBIA 1X1BA 3EVFA 4FT4A 2PY6A 2R3SA 2ESRA 3G88A 3G89A 4X1OA 5FWDA 4BLUA 4PYJA 2HR1A 3LCUA 4RTLA 3BWBA 2ONZA 3MB5A 4IWNA 2UYQA 4HTFA 5FCDA 3M33A 4C08A 2EX4A 1JQEA 2WK1A 4YV2A 1EJ6A 3GIWA 3FUVA 3HCEA 1XJ5A 4FZVA 1DUSA 3BKWA 5C9ZA 3AXTA 5EKXA 2XVMA 2PX5A 3O31A 2XYQA 5T67A 2FYTA 3C0KA 5T6BA 3GRVA 1AQJA 5GM1A 2VDUE 1ZHFA 2DPMA 5HIMA 3TFWA 3LBYA 3UJ6A 1QZZA 3WSTA 1M0EA 3CJRA 4LWOA 1RI4A 3A25A 1JG3A 3EVGA 1O9HA 4GBED 1B42A 4RV9A 2OB2A 4LWPA 2VZ9A 1XCLA 4KDCA 1RJEA 5LSAA 5E9JA 4V0RA 3E8SA 3HVIA 5HIJA 3LPMA 4DM3A 2NXJA 4RYLA 3P9CA 3HM2A 3REOA 2B3TA 4HSGA 3OZSA 4NECA 3ORHA 4YUWA 8MHTA 5CUQA 2NXCA 1KPHA 1SUIA 3B3FA 3NWEA 1SUSA 2YUIA 4XUEA 5B1SA 3UJAA 1DL5A 3FZGA 5KVAA 4HGYA 3TRKA 4BY9E 5EEHA 1RI1A 1RJDA 1WXXA 2JH8A 1FP2A 5EMJA 4BP1A 3NVKI 1EQAA 3DH0A 1TPYA 3GRUA 4PINA 2O0LA 2AOUB 1UIRA 2O57A 1KPGA 2P3QA 2ZIGA 3LECA 5CM2Z 5GOZA 1NW5A 3UA4A 2P41A 4IV8A 3V8VA 3LCCA 3LDFA 2FK7A 3KR1A 4EKGA 1Q0TA 3HTXA 1P91A 1VP3A 1Q0SA 5C0OE 2YXLA 2C7PA 3BGIA 4XUDA 2C7OA 3G7UA 5HILA 1XDUA 5E8RA 3EMDA 2AN4A 1KYZA 1D2CA 2BR3A 3KQSA 3M6WA 5EHIA 3KPJA 5GP1A 1HMYA 1NBHA 3P2KA 5DXAA 4AZWA 1ZG3A 4RTSA 2H11A 5EG5A 4CKCA 3GRRA 2A14A 3HCDA 3LKDA 3LL7A 3MTIA 1VE3A 3TQSA 2BH2A 4WXHA 4CTJA 1RJFA 4PYNA 3VSEA 5CVDA 2C7QA 5FULA 2AOXA 2XVAA 4R05A 1G8AA 2Z6AA 4PYKA 1DCTA 1WS6A 1BKYA 3C6KA 1YZHA 4OQDA 3KPVA 3ELYA 2AS0A 2G71A 3UJ7A 4JXJA 1EG2A 4R6WA 2ERCA 5K09A 1ORIA 1N7JA 3FUUA 3NDJA 4X61A 5E8JA 3ELWA 5ICGA 4CKEA 3MGGA 3LX6A 1R18A 3TOSA 2P35A 4YV0A 3C3PA 3DTNA 4DZRA 3OZTA 4PYOA 3SSNA 4GC9A 4RTQA 1RI2A 3NWBA 5HOQA 1G38A 2IP2A 4E2XA 2Z6QA 4GOOD 1WXWA 2IPXA 3BT7A 2PXCA 1KP9A 3CC8A 3KPWA 5CVUA 4E32A 2YXDA 3THSA 2FCAA 3M70A 1JSXA 5DRTA 2P3LA 2YXEA 2HNKA 1AQIA 3ANXA 3R24A 5KQSA 2Q41A 4C4AA 5LQAA 2AOWA 2WA2A 3MTEA 1JR4A 2QM3A 3GXOA 4GOND 2ZIEA 4HH4A 1KHHA 5DM4A 1AV6A 2VS1A 4C03A 1TW2A 1X1DA 3SGLA 3P2IA 2EFJA 2IH4A 4DA4A 3GCZA 4E30A 5K0JA 4YUZA 3DMGA 4K6MA 1FBNA 1G55A 5EGSA 3B3JA 4MIKA 2OYRA 3NJRA 4YMHA 2GLUA 1RI3A 2KW5A 3EVZA 3DMHA 2XYRA 5EIFA 4M37A 3NVMB 2ZZMA 1BC5A 3JWHA 1EAMA 1SVUA 5KQRA 5GINE 4BP3A 2DULA 4P7FA 1O54A 2H00A 3TKYA 2QE6A 5LQRA 4LECA 2GS9A 3EGVA 2AOTB 2NXEA 2NXNA 2O07A 4M36A 4QQKA 1ORHA 3LCVB 2QRVB 5EZQA 5HEKA 4C04A 3RIEA 4HG2A 1VBFA 3MQ2A 3JWGA 3T7TA 1HNNA 5DSXA 2YTZA 3MERA 1SQGA 2N47A 5LQKA 2P7HA 2PV0A 3KQQA 4XCXA 2PX8A 4DCMA 3FTCA 3UZUA 1F3LA 1H1DA 1N2XA 2IGTA 1Z3CA 2OB1A 3JWJA 3K6RA 2Y1XA 3R3HA 1EJ0A 3BWYA 3A7EA 5EC8A 4PONA 5F2OA 5FHQA 3UBTA 4ER7A 4P7JA 5GM2A 2FHPA 3F4KA 1NW6A 1SG9A 2P3OA 2VDWA 3CBGA 3KQMA 2V7EA 3UJ9A 1JG1A 1M6YA 2ZSUA 4QQNA 5K8VA 5EEGA 3T0IA 1IY9A 4ZTBA 3ID6C 3KQPA 1JQDA 4P58A 3PLAE 5IKMA 5GWXA 3ER9A 4RVFA 4BLVA 2P1DA 3P9IA 3UFBA 5K0BA 4PYLA 5CVVA 4A6DA 5DM0A 4QPNA 5FQNA 5GIPE 5BW4A 2ZW9A 3R6TA 2OZVA 2IDKA 3KR2A 5F2KA 2I6GA 1KIAA 5CVEA 4RTOA 4OQEA 2ZCJA 1D2HA 5EOVA 3DXZA 4C06A 5ICCA 4PWYA 2ZLBA 2G72A 3B89A 5K0EA 2BR4A 2IFTA 3TM5A 4DQ0A 3CKKA 5FA8A 1WZNA 4M38A 3FUWA 5EVJA 2IBSA 1I9GA 3EVAA 5D1HA 4YUVA 2PVCA 4MWZA 5EKUA 1Y8CA 5FHRA 2JHAA 2QY6A 3MHTA 3FPJA 3G2PA 2BZGA 4Z2YA 1WY7A 5BXYA 3EVDA 2PX4A 3CVOA 4EQZA 3A4TA 5DXJA 1ZGJA 3M6XA 4E33A 3M6UA 5K0LA 5LQCA 2YR0A 1NV8A 3KKZA 3UJ8A 3X0DA 5DX0A 1P1CA 2CMGA 3DXYA 5ERGB 1M6EX 5DTQA 3U81A 4ATNA 5BP7A 2NYUA 3FPEA 2XYVA 3H2BA 4FSXA 3TKAA 3HCAA 1R00A 2ADMA 3L8DA 4PIPA 3KQTA 4CWAA 5JUWA 4KW7A 4KWCA 2ZULA 1QAOA 3K0BA 4PCAA 4FS8A 3A7DA 2CWWA 2H1RA 4OA8A 3SXJA 2OXTA 3EGIA 3VC1A 1L3IA 5K0NA 3EMBA 4CTKA 1P1BA 3EVEA 3HA7A 3HCBA 5DTRA 4DCGA 5LQJA 2AOVA 5KYGA 9MHTA 2JHPA 5K0FA 2Y1WA 4KVZA 3BGVA 2PXAA 4PGGA 5FQOA 3GRZA 5U4XA 4UOEA 2C7RA 1F38A 1BHJA 2CL5A 2VP3A 2ZFUA 2AVNA 3I9FA 4EK9A 1NV9A 4EKIA 3Q7EA 4P7GA 4RTPA 2AR0A 5DM2A 5E2AA 3IYLW 1JTFA 2ZZNA 2VDVE 1QANA 2V74B 1FJXA 3ER8A 3SM3A 3KHKA 5HIKA 2OO3A 3HCFA 2B78A 1O9GA 3GDHA 3VC2A 2PWYA 5GIOE 3HA3A 4B17A 3FTFA 2BM9A 3LDUA 4ER0A 5FA5A 1RI5A 3G8BA 3I58A 5DWQA 1OR8A 5EHGA 3G2MA 4EMSA 3BGDA 3E05A 3P97A 2PKWA 4PGHA 3KR9A 3LHDA 1QAMA 4DKJA 3G2OA 3MCTA 4HGZA 5CD1A 3ELDA 3OPNA 3IEIA 1YFJA 5K03A 1YF3A 1SKMA 3A27A 5LQNA 2I62A 2AVDA 3GO4A 5LQUA 2EG5A 2NNWB 5E9QA 5CCXA 3ELUA 3UA3A 1IXKA 3PS9A 3VYWA 2EJUA 4RSRA 5EMKA 2PT9A 3NTVA 2ZWAA 3C3YA 3FTDA 4FP9A 3SSMA 4AZTA 4MTLA 3QOXA 3EVBA 2K4MA 4GUAA 4FR0A 4Y30A 2AOUA 4POOA 1NT2A 2HV9A 3QV2A 1ZKDA 4QDKA 5EIWA 1I4WA 3D2LA 2O05A 3FPFA 3PB3A 2P8JA 2UYOA 1R8XA 3KR0A 4LG1A 5DX8A 3DR5A 1MHTA 2B25A 1JSZA 2ORED 3SSOA 3R0QA 1XCJA 4RTJA 3DLCA 4OBWA 3FRHA 3FTEA 4GQBA 3NMUF 3FRIA 4FT2A 2AZTA 2QYOA 3I64A 4ER6A 4AX8A 3BUSA 4R6XA 5IH3A 3S68A 1VQ1A 3LSTA 2OPBA 5E9WA 2XBMA 5KS2A 3CCFA 5K0GA 3PX3A 1YB2A 4GC5A 4F85A 4F86A 7MHTA 1VPTA 1ZGAA 3KQYA 3HEMA 4G56A 1X19A 3G5LA 5EMMA 2JHCA 3KQVA 5DTMA 3GU3A 3CGGA 2G8NA 3HVKA 1R8YA 4DMGA 1XTPA 1N7IA 3HCCA 4KIGA 3LBFA 3FYCA 3LGAA 2ONYA 5EMLA 1KR5A 3BXOA 3SVZA 4ISCA 2IDJA 2OBFA 4O29A 1AF7A 2PBFA 4QTTB 1PJZA 2ZVJA 3NDIA 5DM1A 3FUXA 5ICEA 2YQZA 3AY0A 3FUTA 4FSDA 3BZBA 4KIFA 4OBXA 1R74A 4OA5A 4WVLA 2GAFA 3P9KA 3THRA 4E2WA 4ER3A 4KDRA 5K0CA 3OFJA 4EVIA 3R9XB 4GOMD 2PLWA 3P8ZA 2PX2A 3OE4A 4V0QA 3FYDA 3EPPA 4RTMA 2FPOA 3AJDA 3RW9A 1XDZA 1JG4A 3TPZA 2IH5A 3FPGA 2EJTA 3KPUA 5FWAA 4HRAA 3UWPA 5CIYA 2IH2A 3G2QA 3IHTA 4YUXA 5F2NA 2FRXA 2I9KA 5G02A 4ER5A 4OX9Y 2IBTA 1KPIA 5M5BA 1X1AA 1G6Q1 3OE5A 3I53A 2AN3A 4A6EA 1BOOA 3UJDA 2JG3A 4KRGA 4BLWA 4X63A 4RVDA 1XDSA 4RTKA 5T64A 3GWZA 3ME5A 3BWCA 3DLIA 3EGEA 1EIZA 3GRYA 3Q87B 4IKPA 1QYRA 2BR5A 4GF5A 2AN5A 2UZ4A 3NW9A 4QVKA 4R8RA 2HTEA 1JG2A 5ICFA 3TMAA 4U7TB 3PTAA 3GNLA 1VL5A 3I5UA 1MJFA 3P2EA 2ZTHA 4IV0A 3EEOA 2G1PA 2AOTA 3KQWA 3FPHA 4L7VA 4CKBA 1NKVA 4QDJA 2P40A 1L3CA 2QRVA 3KU1A 2ZBPA 3SR4A 2HMYB 3DOUA 3BWMA 5EPEA 1NW3A 1FP1D 1G60A 3HVJA 2B2CA 1NW8A 4PYQA 4AUKA 4E70A 2ZZKA 4PYIA 4M7RA 3A26A 2NP7A 4YV1A 3HVHA 2PXXA 3TM4A 3IV6A 1I1NA 3M4XA 3SMQA 4YUYA 4RWZA 3CJQA 2BM8A 3MAGA 3PT9A 4DF3A 1JQ3A 3HA5A 4R8SA 4AZSA 5K05A 1JTEA 4RTRA 1UWVA 1V39A 1X1CA 5BW5A 5K01A 2ZBRA 4HTFB 2O06A 3O7WA 1QAQA 1RJGA 2PGXA 4GEKA 5DT2A 1L1EA 3BKXA 2I7CA 2PJDA 2ZBQA 4PCLA 2B9EA 1R6AA 4RX1A 1YZ3A 2Z6UA 5HZMA 1YFLA 1ZQ9A 1UFKA 4C07A 3M6VA 2F8LA 1U2ZA 2ZIFA 3P9NA 4E31A 3DULA 4PNEA 2PT6A 3QOWA 2LD4A
chains in the Genus database with same CATH superfamily
1ANKA 4OHOA 5ALGA 5G1PA 2C7BA 2EFHB 2Q3HA 1K6XA 3B1KA 2DR2A 3PQ8A 2IEDA 4I08A 4TL7A 2PUDA 1VIDA 4M9SA 5H02A 3CYFA 1PT9A 4YJHB 2XA2A 2P7IA 4IXWA 1WUIS 4M1EA 1HOXA 4IUBS 4RLHA 4PAGA 1XZEA 4MGYR 3OCZA 3RVOA 4WDRA 1WY5A 2JGLA 4NJEA 1AB5A 3R23A 3TZQA 2RJNA 1Y7PA 3AV0B 3B1YA 3Q7TA 4OJMX 1H2FA 4LRTB 1TAGA 5AM1A 4PQGA 3DUFB 1L7PA 3QW2A 2H1IA 2PAAA 3VKHA 5TGZA 2FK8A 2PRZA 1H93A 4X7PA 4H6PA 3AF1A 2JLUA 1SVWA 5CX1B 2Q28A 3BZUA 2ONJA 3U40A 1K2VN 2I6UA 1Q0ZA 3SOZA 3DUWA 1ILWA 1OAKA 3OA2A 2EDAA 3RKUA 4F06A 3VYSB 5I7WA 1ZQ1A 3OU7A 1N8NA 4RK4A 1Y3HA 4DQUA 3EFHA 3IQXA 2IYEA 4R81A 3BICA 4J3JA 2UYHA 1DEHA 2WT4A 5TEWA 5KREA 4NBVA 1UBFA 3AEXA 4IDNA 1HPLA 1E3WA 1NFRA 2Z2KA 3BXZA 3HR7A 3ENKA 5AUQA 4BLOA 1I6LA 2JDIA 1ZGBA 4GM1A 3PX2A 5AKLA 3D8SA 1I10A 5KNBA 2HPZA 3AF3A 3ICWA 3ETNA 4PYMA 5FL7D 3O9MA 4MVJA 3WISA 1NN0A 3ABRB 4LHWA 4X1OA 13PKA 1Y4DE 4XYBA 1E58A 1H05A 4XWTA 1SB9A 3IERA 3A6FA 3SKXA 4PEVA 4DUPA 1DJLA 1BROA 3LCUA 2AIRA 4BQEA 2RGEA 4ES6A 3A1TA 4EG6A 3CLHA 4NATA 4NYMQ 1TE2A 4UNQA 4JBIA 4OSPA 1Q0UA 3KTAB 1P60A 2G76A 1JHVA 1XAIA 4LXTA 1JALA 5REQB 5D3MB 2V6MA 4YRGA 3FVRA 4GYKA 1EUQA 2CNWA 3JYNA 4JC0A 4ETIA 2I78A 2DCMA 1NY6A 3HSSA 3P9SA 5AQ1A 2KM1A 1CR2A 1NVTA 3DZIA 1CUWA 3VI4B 4RZHA 4CCWA 5AW2A 1C1DB 1X92A 2VJCA 3O4HA 2VIIA 5ULLA 3OAAD 2ZE8A 4FX5A 4B85A 2R47A 3K0AB 3DTTA 4B6OA 3T35A 3CF2A 2CJPA 2YXPX 2VT2A 2GEVA 2Q5OA 2VF7A 4MDYA 4Q66C 4FZ5A 1UBGA 1EFVA 3EFOB 2XB4A 4BMVA 3Q9NA 3BSYA 3RS7A 1DRWA 3HHPA 3PUJA 2P2YA 4AP9A 3JQGB 1PX0A 2WJ3A 4OL9A 1EGQA 1H2WA 2H4WA 2IC5A 5JJLA 2NYVA 4XUEA 1BE0A 2VH1A 3H3FA 1RWPA 2EERA 4E5SA 3QKRA 1OPXA 5C7IO 3PSAA 5EZYF 1XAJA 3M82A 2AMJA 1PU2A 2GSDA 1WB5A 2HNAA 2JD0A 3V4PB 1MVOA 2IOFA 4EL0A 5JASA 3ZNOA 2OGUA 1UIRA 5AVVA 4FBGA 4JUCA 2P8SA 2WIDA 2VYQA 1YD7A 3LVBA 4NS1A 4V2IA 2A0WA 3HCOA 4JJ4A 4LFAB 3ZWVA 2I4TA 3LUPA 5ALVA 5IH7A 4BWFB 1YIDA 4CQLB 1T1RA 1K7YA 3B1VA 4R0NA 1JGTA 4US2R 3HKEA 1PFWA 3L0IB 3V3TA 2JGKA 1K7EB 2ZUWA 3BFVA 3L18A 4L78A 5G0TA 4FOTA 2GKGA 4HP8A 4G5HA 2E4ZA 3D8UA 3ZHBA 5FOXA 4RTSA 2QT0A 4XQ0A 4EARA 2NTEA 4HTAA 4HUQA 4LY9A 2Q2VA 3FFWA 3VVCA 2LW7A 3O0TA 3V8NA 1U8ZA 3W77A 3OIFA 4IVPA 1U2TA 4HO1X 4KYTA 5J2UF 2UVQA 2PRKA 5HQJA 4XLTA 1GNSA 4P2BA 3H04A 3Q8MA 4MHSA 3ZG6A 3RSGA 2VWHA 3EZXA 3OTGA 4JB0A 4FHGA 4BKPA 4Y0NA 1GPKA 1UBKS 2ZE7A 4Q6WA 1VC2A 5FOQA 2ZP1A 1Z33A 1A9PA 4D3YA 1W94A 4MWCA 2R8YA 2ZIZA 5IZCA 1DEKA 5A7FA 2AW3A 3LHSA 4M9CA 2RBKA 3Q9LA 1SOAA 5CDTA 4K88A 4ME6A 1ZD9A 1B76A 2BFBA 2QZJA 4QZVA 1L6RA 3RDPA 1X1TA 3ZGVA 2IY7A 3IO3A 3BD9A 3AVOA 4CT4B 3H5WA 3G5AA 2MMGA 3E7FA 4GX0A 1T6ZA 3C97A 1GUBA 4WXYB 1VDMA 5EHZA 3NNSA 2CV2A 1KOGA 3ZS9A 2PNJA 1IIRA 1V2GA 1XAHA 3EQ6A 4TUYA 1VCOA 4HZUB 4LMAA 5EJAA 3P4YA 1XZGA 5JS8A 2E49A 4L8YA 1K75A 4NNJA 4V0SA 4BKRA 3CZQA 4ODIA 1C1XB 1MO2A 5AKKA 1TQHA 821PA 4KQXA 4DM4A 4ZCLA 3TXXA 2FE1A 3CUSA 1DAMA 3OJXA 4KC0A 2GD2A 1DIOB 2YJGA 4MTCA 5C3MA 2BMEA 4MLDA 4B5KA 4MLZA 4HL6A 1QVAA 3ZZ1A 3WOVA 1TADA 2H00A 2I6FA 3ETGA 3EH2A 1EFAA 1QIJA 1C8BA 1SCJA 1RD4A 2IPOA 3TI7A 4BO5A 1XGKA 3QM1A 4BQIA 4U39A 4YP1A 4L51A 1XKTA 5JAOA 3LOPA 3EDYA 3K8YA 1DKRA 1L5MA 1XD9A 2PUTA 3BIXA 5LQKA 4MVJE 1KK1A 4CEJB 3QSGA 4DCMA 1VXOA 3OT5A 3UO8B 4H27A 4QHYA 3AGPA 2QXTA 4Y6RA 3JVUA 5FHQA 1N33B 3IOBA 5AJXA 4EW2A 5KTKA 3IVRA 3GVPA 1IU9A 3BL8A 4CIBA 4AQDA 2ECOA 2V7EA 3KXLA 3UJ9A 5C1BA 4QQNA 4C0QC 3RTGA 3A4IA 3O1HB 2BL4A 3GJZA 1U8YA 2H0QA 3V1LA 3BG5A 3VGPA 2W8BB 1PNQA 3OZGA 3ZCRA 1WXQA 1HO3A 4RVFA 1ZNXA 2NO0A 1Z0ZA 5IFKA 1XX6A 3ZBTA 1N1MA 1EVQA 1UMCB 2WUDA 3UPDA 2JA1A 1IJKA 1FTSA 1SC4A 1YQDA 2N3ZA 2SKCA 4RTOA 2VTBB 1UPBA 4J1NA 2C2WA 2MJLA 4DCGA 2X1LA 3AJ9A 4EI7A 3VOSA 2G72A 4C0LA 1VRCA 2JLSA 2Q8PA 2QDKA 4CR8A 5CRIA 1ZC3A 3PLRA 4D8TA 1OI3A 3U4MA 3TW8A 5A4JA 1A2KC 2KJQA 4WOBA 4KXVA 4WBSA 3EVAA 4L5AA 2BP7A 4MWZA 4ZTZB 1G2PA 4S35A 1XQ6A 5CCEA 2R751 2JJ2D 2QY6A 4Q3LA 5CAEA 4LBWA 1VMDA 2BW0A 4TQUS 2PUEA 2EP5A 1NFQA 4R3WA 1XZBA 2VHCA 4IGFA 4H6WA 4JASB 1W75A 4NABA 5K0LA 5HX7A 1FMTA 5AXDA 5D01A 4AVYA 5C5EA 4B75A 1AMUA 3M5PA 2CVFA 3DXYA 2ZRCA 1L5HB 3PJEA 4JLOA 2QRMA 3ZX5A 2XWPA 3IMFA 1KQOA 4UOQA 4NMHA 4RCVA 3U0BA 3FPEA 4QYTA 3SXUA 1VPVA 2VQ3A 4U63A 4V39A 4CWAA 1C4OA 3E2MA 1CU1A 1OFGA 4I8DA 2PIDA 1U7OA 4GI1A 2RGBA 3ZHUA 1DP4A 5F7OA 3SEQA 4OM7A 2DFTA 1D5WA 3BOSA 1I36A 4HPWA 1KY2A 1ZH0A 4YHHB 2YQ5A 1JECA 1T9KA 5DTRA 4N5NA 2P9EA 3DLHA 3TYXA 2DT5A 4FIZA 4JP3A 2HCBA 2JFUA 3EOZA 1KDVA 4KFTA 1I7QB 1N2CE 2QSYA 3AHJA 3CSSA 1NBAA 4AXXA 1OOEA 1T15A 2NYAA 3S4YA 4AICA 5KYTA 2XQVA 4YCNA 5LL6P 1FNNA 3VC2A 1CQZA 1W2GA 3R2JA 4WNCA 3CR3C 4BEVA 1DRKA 4LSZA 5HNKA 5EWLA 4IXDA 4RHUA 1QIIA 2B21A 5CB4F 1PEKE 3H2JA 3D81A 3IP1A 1IM2A 4TWAA 5KO2A 3FNHA 2J08A 2OUIA 3EZ7A 3T9AA 4IIUA 4Q4JA 5LN1A 4BAUA 4G5SA 4KB5A 1JEQA 2BJWA 4PNZA 4DIOA 4YAUA 2CV1A 2Q9CA 1BGVA 1N6NA 4GRDA 4GZ6A 2NNLD 2FPMA 4PF1A 4RIIA 4BQPA 3DMNA 4Q02A 1E2IA 4LY0A 5SZKB 3RV4A 1YF3A 1DQPA 3HLKA 4RE6A 2QT1A 5EJ8A 1W6UA 3CINA 2RK3A 2VR1A 4M8KA 4Q34A 2GPAA 3GO4A 3D6VA 4EYKA 5C37A 2IZ1A 4M1QA 3B36A 2REXB 1UOPA 4RESA 2EJCA 4MI9A 2FETA 4DA7A 2C2OA 3HEBA 3R0VA 5SYMA 4JDPA 3UA3A 4BVLA 5JXWA 2WTUA 2VHXA 4F9GA 2DSNA 4D46A 1RJWA 2ZXEA 4O2LA 2OHGA 3FTDA 2OHIA 1BH6A 5BWMA 1P62B 3UN1A 4BC1A 2X9QA 3HKDA 2BGJA 3ENQA 1FFHA 2VRWA 4FR2A 4H7DA 4P22A 4DLNA 2QTHA 3EXG2 4KMOA 5KWIA 1C80A 2A9RA 3PB3A 4YBRA 4CLRB 3I5XA 2ODBA 2EEZA 1L7XA 1A88A 2NADA 4IDDA 4MWOA 3SQMA 4FGJA 1ZXBA 3DMDA 2H7VA 2YS6A 1Y8AA 3DBLA 1DUIA 3ITNA 1U3GA 2CB9A 4X3OA 3RTAA 3QE9Y 1P2FA 1XU4A 1IXRC 3NATA 1TCAA 2F43A 1S1CA 4O2AF 3R8CA 2ZI4A 1HM5A 2QQ5A 4M8LA 1UKZA 1BN6A 4YLGA 3HFJA 1RRFA 1IWBB 1GUYA 2WJVA 5K8UA 7MHTA 1H8HA 1B00A 1X19A 1HE5A 2ISQA 2IHBA 3DKIA 3WL4A 1JILA 4KFRA 4UBIA 2YZKA 1IUOA 3AJRA 3MJRA 1E6LA 2DKFA 4GQIA 4IH4A 5D87A 3WSWA 1PGJA 2VLIA 3FYCA 5G0VA 3S8EA 2ONYA 3P32A 3R3JA 4JXKA 1CCWA 3EN0A 3ONWA 1GQSA 3U49A 1OTYA 4HAXA 4ZC1A 4AKHA 1GU7A 2P1ZA 4XARA 3QRWA 1TEZA 4CFYA 1YB4A 3S99A 4KIFA 4EW6A 3FYUB 2B4TO 1SRRA 3IHWA 1SBHA 4FJ2A 4QKQA 3UXYA 2R6GA 2DHQA 2UUPA 3TR5A 4EVIA 3PWKA 1JI3A 3P26A 1A3CA 3KTDA 3VOTA 1O6ZA 2AW5A 1Z2EA 1AE1A 5FO0A 2PX6A 1V5GA 4MYCA 1XDZA 5JH7F 2HH9A 1JDNA 3OG9A 5E2IA 1OLUB 4NCXA 3HBNA 3KZMA 5C35A 3FWYA 1M6VA 3RS9A 5G02A 4ER5A 4ZKDA 4FONA 3KT8A 2DHRA 4NHEA 3ET4A 4I1PA 1G6Q1 1KEZA 3OE5A 1P18A 4H7HA 4TYQA 4A6EA 2ZM6B 4KRGA 3DF7A 2QM0A 4HPXB 5B7PA 1XDSA 5CDHA 1QFSA 3ZCQA 4FUQA 2FN9A 3PIRA 2R11A 3KUXA 4OJKA 2HRCA 2WZDA 2VHVA 3LLMA 3WGOA 1N75A 2BN4A 2CV0A 3KJIA 1UCFA 3W4IA 1YU6A 3CMCO 3P2EA 1ISPA 1WXIA 4E1VA 1XAGA 3FKQA 3KQWA 1N2SA 5JCPA 3UENA 4C0HA 3ZE9A 4GL2A 1KZ6A 1SUFA 1Y42X 1W5SA 5F23A 4NNOA 2Y93A 4OMUA 4TQAA 9ABPA 3NHFA 3OT1B 3T1QA 3EG5A 2YZ2A 2QLLA 1YMQA 4FCWA 1J2YA 1Z6PA 1FJGB 2GPNA 3MWLA 2B0CA 1J07A 2PXXA 3F71A 3M0EA 1P1HA 4BWVA 2J3EA 3PHIA 2PYDA 4Q4LA 3RUPA 2VT6A 1KBZA 3IDFA 4MW7A 1YRQA 3INYA 4IX9A 2JJYA 4HDRB 5HK8A 3M9LA 5AW9A 5AD1A 2FKNA 2XYHA 3V6LA 5CFLA 4GFDA 2FF5A 1YSCA 2HBRA 5JANA 5JS2A 2B9EA 3ZJUA 4TZKA 3DAFA 1YNOA 3QOFA 2QBYA 3JQQA 3QPDA 1KI9A 2QPAA 4X85A 3CKMA 5IT4A 1TTPB 4IJUA 4KAJA 3L7NA 4OYRA 2C0QA 5TXGA 1I2MA 2PFKA 1HDOA 1FJHA 1M8KA 2AG1A 1QCZA 1P29A 2H2AA 1INLA 2O1SA 2QRKA 3F3SA 4OJTA 4EO7A 1O8CA 5MGBA 5TF0A 1A76A 3D6HA 3BDIA 5LXTA 4FGKA 4PSCA 5GONF 2QX4A 3H9BA 3UANA 3VHQA 3QOYA 2DVMA 4C6SA 5BWNA 4XR4A 2HN9A 1HLPA 2YX1A 4YJGB 2OM6A 3LT0A 3PVCA 5DLYA 4C4RA 1OB2A 3NHSA 5KSPA 4M1KA 1NOJA 2A1TR 3T3EA 3DPUA 4ND6A 1G3UA 4UARA 4R9NA 2BPOA 4GM0A 2PVPA 5GAJA 3GQBB 4US0R 2RC6A 4YCLA 2H1VA 4G5RA 1AX9A 3KZKA 4DIDA 3AWIA 3P71T 3RQSA 2VWPA 1PJ3A 2OY0A 2ZUUA 4A8TA 1T2NA 3KFVA 5B53A 1SXJA 5FOTA 1ONOA 5BN1A 2AJCA 3NGLA 1D6JA 2D3TA 3NHZA 1R1DA 2H4XA 4NYJR 5CMLA 4RPLA 1R16A 1U04A 2JGAA 2MSDB 4IRMA 3KEOA 2OSBA 1W8DA 1UZNA 2Q50A 2QSJA 2ZANA 2AK3A 1TW3A 3KUCA 1IL0A 2C3UA 4K6HA 1AA6A 1G66A 1RCFA 4JP8A 1VHQA 2B4AA 5A6VA 4X91A 2JLZA 3GFQA 4CMEA 4ZVUA 1RQ2A 3GUVA 1YFKA 1QZUA 2E7ZA 3ADOA 4X60A 5DWVA 2OKCA 1BQ4A 1JXOA 1YK1A 2X19A 2K87A 1PYGA 2EDCA 4EKNB 5AVOA 3KPYA 2DWQA 5D86A 1DJPA 3QFTA 3PCXA 2RHRA 2C59A 3OKCA 5KU1A 5BV1A 2P68A 5CPFA 1M2OA 2HBYA 3BD6A 3ONDA 2QQEA 4BASA 2CLHB 3E9DA 3UAGA 2WK1A 3RLFA 4CEHB 2NPFA 1GV1A 1R9NA 2QL6A 2RI1A 3DYVA 4LYDA 1X1RA 3KYJB 3PUIA 4FHDA 2H2IA 2HQSA 3KKPA 3NASA 4EPWA 3QYFA 1KMCA 3W5DA 2ZSAA 2XYQA 1EK1A 1XQWA 4F4FA 4JI7B 3R5TA 1UBRS 1NOKA 2DPXA 3ETHA 3VHXA 3JQBA 1RHRA 2JGRA 2GTHA 3P1JA 2ZK7A 2VEOA 3H83A 4MI1A 3A25A 4TKZA 1XCBA 3L7KA 4Y6GB 3KK0A 2HF7A 4DCJA 5AVUA 4Z54A 1WXEA 1I4EB 3K16A 1XCLA 3KAKA 1VSUA 3OC6A 4CNBA 2UV8A 4YMWA 1N8TA 1IN7A 5IANA 4KQ2A 2WE7A 1B3BA 3A32A 1PZNA 3HB0A 3V7UA 2OK7A 2E6KA 1XWFA 3D8TA 1NDUA 1MAWA 5K6AC 4BVHA 4FW9A 2ADFA 5AOCA 3H2GA 5AHKA 5CLIA 2QRHA 2JLRA 3ORHA 3TOVA 3VVLA 2J87A 3HFGA 4DUGD 2W83A 4EG8A 1H1LA 1D1QA 1KY4A 5B1SA 5A0FA 2VSQA 1VGRA 5DOZA 2HEIA 4XFDA 4EELA 5GTDA 4UZEA 1J00A 2KHZA 3E4CA 4HGYA 1JLRA 4JYPA 4B3XA 1R5JA 2N9UA 3BL5A 1RJDA 1WXXA 2BJVA 3JWEA 3OLXA 1L4GA 2HU8A 4EO4A 2Q1WA 2PD3A 1RTTA 3GUUA 3PD7A 3CZRA 1EQUA 4XB1A 1GAQA 2HEGA 5JAZA 3O8CA 4Y1RA 1S9HA 4I1UA 2GXQA 1HRDA 1QBGA 4JI3B 1YHYA 3SZMA 1E9EA 1Q0TA 4MQUA 4MQMA 4Q9LA 5H3CA 4I1IA 4P32A 2YXLA 2IUFA 3UAOA 2A92A 4H18A 1VSBA 2Y99A 2V9PA 4IBOA 4PFQA 4GICA 4OGKA 3F6BX 5IBPA 2OEPA 4GIBA 1PG0A 1WHSB 3Q10A 3KKLA 4IHJF 4UM5A 3DO6A 5TJHA 1CY8A 3QEAZ 2K7ZA 4HX9A 4D9EA 5LP1A 1SQ5A 3UJ3X 3GMTA 1RKVA 5HG0A 1PD0A 2FB9A 3CHYA 2OHXA 4MP3A 3GEIA 1Z16A 3EZ2A 3N87A 3T4EA 4CGZA 1QCYA 4EAQA 3EE6A 3F2IA 1EP3B 4G8CA 3H1GA 2VTKA 4EDFA 2AOXA 1UANA 1RWQA 2FR1A 4KMMA 5GJWC 1V6SA 2BFOA 2FPIA 3RKRA 1K97A 4AF8A 3K35A 4JXJA 2CFRA 1QQ7A 4D9KA 2JKVA 4EJ0A 1HFKA 5M7EA 1W48A 4B9AA 2V7BA 2X4LA 3K1ZA 1YVPA 3KJGA 5F1PA 1J2RA 2ERYA 4C2UA 1FFWA 1H3FA 1KL7A 1NVWQ 2MYPA 2RE8A 1FRFS 1OFVA 2WB4A 1NVVQ 2G3YA 2Z83A 3OZCA 2XV1A 4U00A 4C87A 1TC2A 4PXAA 2QY9A 4BU1A 1U9IA 1P61B 3FPSA 1UT6A 1DBQA 2IPXA 3BWVA 4BZQA 3NDBB 2PL9A 4WNIA 1RKBA 2RKBA 3IPAA 5HQTA 2MINA 5BWOA 1WDKA 2IKQA 1WPXA 5EP3A 3TSAA 4B3SB 1YRBA 2YXEA 3RVJA 5DP1A 3B3AA 3WK6A 2UUBB 4J76A 3UUFA 3QLUC 4AROA 2R0QC 4IQ0A 2VTVA 4QBKA 2C9YA 3NIFB 2H57A 4W5WA 2GHQA 1ZD4A 3REQB 2ECFA 1SXJE 4JENA 3H17A 1SELA 2EFJA 1ZJYA 2GWHA 5K8LA 4LXGA 4JGIA 4ZANA 3A1WA 3M5CA 1Z7BA 4DA4A 1SD2A 1ECJA 4E30A 5FOSA 5CFOA 2A67A 1G98A 5JCZA 1YZTA 3OM9A 1CNMA 3NV9A 4ZVQA 5EIFA 3DW3X 4ZOCA 3COJA 4RNDB 3VNQA 4Q3BA 1GZ4A 1KK3A 2Z57A 1AS3A 1U0TA 2HFKA 4FFWA 4MVCA 4UD6A 3VDRA 3ZEIA 4D0SA 4CKYA 4ZO8A 5TX7A 1WCIA 4M0CA 4PX5A 4RZ3A 4AJNA 1EJ2A 1OT5A 1J1UA 1TQ4A 1ZDMA 4RVUA 1BKSB 3EYWA 4LHVA 3O1JC 3QVOA 2A9PA 4A8JA 2R9VA 3K30A 4BECA 5JRDS 3ZJVA 1PKXA 4D25A 3PC6A 4DSUA 1QQAA 2GVZC 5DM70 2W2TA 4BYMA 2G0TA 2IOQA 4YC7A 4C01A 2B7CA 4GGMX 2D5IA 1P0MA 3ONEA 3OCYA 1WBDA 3AIOA 3V32A 4E6EA 3QPCA 4O8CA 1EWTA 2FP4A 3LM8A 1BW9B 1DCFA 2ZT6A 3FTPA 1EZ4A 4B3DA 1VJGA 5IT9A 4P7JA 3LXUX 1KAQA 2QKYA 1X80B 4PPFA 5CA0B 1C7JA 5JS1A 3O8LA 2V3VA 2CBGA 3AF5A 5L51A 1M6YA 4XEHA 1IY9A 3WZ2A 4YRZA 1BCSB 1UQRA 1CD5A 3W7AA 1OU4A 2YOFA 5CK5A 4YV7A 2D5AA 3EZ9A 4H1VA 1DE0A 1KP2A 5AUOB 3P9IA 1SBIA 1K0UA 2HQBA 3NTOA 4NQRA 4NZPA 1UDXA 4I4IA 1KETA 3WLSA 4CG1A 3H97A 3NHMA 2P9TA 3LO5A 5DI3A 3HB7A 3R6TA 1VIVA 3BM5A 2ZPUA 1MQAA 1E5DA 4D1YA 5FORA 1U99A 2QAGC 1JDTA 3N07A 1JIIA 1V1RA 1DAFA 3HP1A 3COZA 3HCNA 2G9RA 1R88A 1TUBA 1UXJA 3CTMA 4X45A 3FDZB 1Z7WA 4MVJI 2QOEA 1IN1A 1SHTX 1NW4A 2EGUA 3CKKA 4OGGA 1Y3IA 4EI8A 3SIXA 1F6DA 1A4UA 1AMNA 1FS4A 3HDYA 5LZ9A 3I5MA 1XPOA 3MHTA 1MJNA 3FM9A 4OHBA 2NZJA 1VMIA 2COEA 1WY7A 3UQZA 1G2QA 2PGLA 2ZJ7A 1NNLA 2PX4A 3CVOA 3PSHA 4Q7MB 5EGNA 1OV6A 3VR1A 5LP6B 4BYGA 5ECYA 2G40A 4IIVA 3LTNC 2HDOA 1BHO1 4IJQA 3WA7A 5L7WA 4NI5A 5E6SA 2JVJA 5DX0A 2C8VA 2GAOA 2QMEA 1TF5A 2A5YB 3M1IA 4J16A 5FNVF 5L6LB 1XTZA 3IAAA 5IN4A 5JT1A 5DTQA 4B3TB 1LDNA 3K09C 5HF9A 2I2FA 4YDSA 2XVXA 2COKA 2YMPA 4UTNA 4PIPA 5ER9A 2DHDA 3LDAA 1KI1A 2XCUA 4WZAB 2I2CA 2VCEA 2B98A 4H6XA 4KH1A 3IAUA 2C3MA 1JIJA 1YQGA 1US8B 4LIPD 1F2UB 4I99A 2ZSBA 4BV2A 4YQZA 4I6EA 4MINA 2ZYHA 3IV7A 4U0JA 2G77B 3RBAA 3NM5A 1C0PA 3IBTA 4ND2A 4GWLA 4IJWA 3PYLA 4Q39A 5EXEA 2LWIA 2XWSA 4DTCA 4L0MA 1B8PA 2PJZA 5JCJD 3PXBA 2GUGA 1OWPA 3TIFA 2PQ6A 2RHHA 2PPVA 1HH4A 2CJWB 3ZQ6A 1WLYA 2OAGA 4ZV9A 3AFHA 5HF6A 4RPIA 3RSFA 3PJRA 4R4JA 2PD6A 2HT6A 3IHLA 2WF9A 4PRKA 1T0BA 2CYCA 4OGWA 3QWIA 3VJLA 4C6TB 5I7UA 1EP9A 2FLVA 3EEBA 1T3LA 3FY4A 3BRSA 2Z8YM 1BCRB 4Q6BA 1TVKA 5HMLA 4EMSA 4U7HA 1MV8A 3P97A 1YR8A 2A9QA 2O2GA 3JAKB 1KEEB 1MA3A 3FB1A 2F9FA 4MMZB 1NQUA 4U3JB 4E4YA 3MJ4A 1YJ8A 2JA2A 4S1VA 1SZCA 3GH3A 1Z6TA 4WLVA 4BJ5A 1B23P 3E8MA 2C98A 3BVPA 5AWFC 1SFRA 4ZZ2A 3H7IA 1GNQA 4IWXA 3RVSA 5HUJA 1R5BA 3S70A 3OQPA 3VBEA 4E1BA 3C74A 5FUMA 1J22A 1HFWA 4I8XA 4Q12A 5E6RB 4I1YA 5GMOA 4ERNA 1JDBC 2WAOA 1SUAA 1K6JA 2GN9A 4RHXA 5CBPA 4J0KA 1BYUA 2RGNA 1JMKC 2VHTA 5SYAA 4KLCA 4UQOA 5H59A 5CB4B 4DBVO 1QYDA 2NXWA 1Y1PA 1NJ5A 3EA5A 3T5BA 1G21E 4HJXA 4YCDA 4MR8B 1T0UA 2CL6X 1PJ2A 2FEAA 3AI2A 3JVIA 3FFXA 1T5LA 4RIHA 5ALWA 4KPGA 1OJLA 4L2IA 3Q85A 3PITA 4TMTA 3SSOA 2FW6A 2R60A 2A8YA 1U65A 4S0ZA 1GXSA 1P72A 1SU8A 2OV3A 2WD8A 3PEUA 4YI3A 2DUMA 5CEJA 3BQMB 2ZB2A 2EQBA 1QH1B 3K3PA 4JR0A 2JGDA 1GZ6A 3AKDA 3NHAA 2ANCA 1ICIA 4H1UA 3SS9X 3FCOA 3TVDA 4GC5A 4NFHA 4PSKA 2VLBA 3DB2A 3ONFA 3HEMA 4AXBA 3BK7A 4CL8A 2XVYA 4DNPA 3FHLA 3ZCTA 4ZV4A 1GPUA 4OQQA 2PCLA 4BFXA 3GARA 1JU3A 2VI5A 3U5TA 1Z5UA 2D2XA 4D42A 2J9XB 5DBIA 4H3HB 1QG2A 4E3ZA 3K8ZA 4ISCA 1C4XA 2FP3A 1CRWG 1AF7A 5CFQA 4QTTB 4BFTA 3VSCA 4TQ9A 1BMTA 2Q6IA 3SR3A 3PV0A 5AK4A 1KI8A 3QWAA 4HXEB 3I1IA 3S2ZA 4MVXA 1UZLA 4IUYA 1PQ4A 2HHCA 3QELB 3ZGNA 4BCCA 2O19A 1JSLA 3P9KA 3EMVA 2PJRA 4ZVKA 5JLAA 1XROA 1LF0A 5FTKA 3HCPA 3V42A 3EXEB 3W6PA 3CU5A 3M81A 4IILA 1W1WA 3VZPA 4LOKA 2PWBA 3UMJA 4D02A 4OQ4A 3FLBA 4YJ3F 4X71A 4U7FA 3CONA 2WQ6A 2PQ0A 4I6JA 5FWXA 5BUSA 3IAXA 3OQBA 2WHPB 3QH4A 3ORFA 2WICA 1CQIB 4HRAA 4XYGA 1XNQB 1A8SA 3LVFO 4P4SA 4MI3A 4RYDA 1PJQA 5THXA 7MDHA 3IUEA 4PHCA 3A4NA 1CXZA 1PHPA 3QFRA 1QKIA 2NSHA 5FFFA 2IBTA 2R96A 4IMRA 4AL4A 3N2IA 2H2GA 4UJ3A 4QM7A 2J9FB 3ETDA 4ZXFA 4RTKA 4KPUB 3GLIA 1H4TA 4XWOA 5FPYA 3EGEA 5A5GA 3FLMA 5A9TA 3GFPA 3BHNA 4OUKX 3AZPA 1JRLA 2DFKB 1Z12A 3VDXA 2YVKA 3I5UA 1BWQA 3LY5A 4GE0A 2ZUFA 1FPMA 4OIMA 3DONA 5JH7B 4LVUA 1GSOA 2E89A 3KU1A 4WN9B 3ZWOA 3Q11A 4M76B 3L7MA 2RDMA 1S3SA 4XQCA 1CG6A 1NQOA 1SRQA 2WYWA 3RVKA 1E4OA 4TV9F 4B31A 4LYJA 5H16A 2YZGA 4BATA 3O7MA 3NWPA 1M9NA 3BHMA 4RWZA 1RAGA 4JIMA 1QM5A 4GLLA 4FS3A 4R8SA 1X7YA 1DC8A 2AYZA 3L0OA 3O9VA 1V39A 4G25A 1JZSA 3CNOA 4X6LA 2I55A 3QHPA 4KBGA 1L7BA 5ALXA 1NLYA 2CNBA 1UC5B 2QTRA 1R37A 3ZE1B 1VJTA 3WBFA 1OC4A 2EP8A 4A91A 3PF9A 1NUSA 1VLLA 2C2YA 2CVPA 5TGTA 2I1LA 2LKDA 1FXSA 1P3JA 3PUVA 4F7WA 1H3EA 4L1KA 1CUJA 5F78A 3F0TA 3LOQA 4D9GA 1KJZA 2LD4A 2BBSA 3WLHA 1I33A 4GRIA 4BO0A 2QTFA 4A1OA 4I5GA 1XXLA 1PUIA 4J4TA 1PWHA 1Z0FA 1DQSA 1GITA 3HJNA 3JVEA 3JQ7B 4BIIA 5A9SB 4X65B 4P3KA 4C14A 5LD2C 4FNOA 3U37A 4HQLA 4QWWA 3LK7A 4IZOA 5HIIA 1EUCA 2Y68A 1FJ2A 4G9BA 4PBSA 4LF6B 4C05A 3QFCA 1J5PA 2CVQA 1D2GA 4MHOA 3VDNB 3O1LA 1D6MA 1N0IA 4FFLA 3U17A 3X1XA 3L49A 1F2TA 3TR6A 4QPZA 1REQA 2OP1A 3T7RA 3ZWYA 1YUBA 1BMFD 5J40A 4NXMB 5HDBB 1M0SA 3OFKA 2F4VB 4ZK2A 4GP9A 1LKZA 1HL3A 1XVAA 1IM8A 4QGHA 4B83A 4PLWA 2QPLA 1K3FA 1S8AA 4ZXPA 4BB9A 1PGOA 5KX5F 5GADl 3QPVA 2VYCA 4ZYWA 4J3FA 1M1YE 2JGNA 1SHZA 1UKAA 5ALUA 1J56A 3UHAA 1XP5A 3O8QB 2X2EA 1L1FA 4B47A 4NYIQ 4R2IA 3CWCA 1TKRA 1CB7A 3B2EA 3G2HA 3BWXA 1K7FB 3K2EA 4IUCS 4KMRA 3HBFA 2AXEA 1BXGA 3MZ0A 3VTFA 3AVQA 2ZRKA 1HDIA 2OKGA 4L08A 1KXJA 1ZBDA 1TZKA 1CRZA 3N0TA 4CU5A 1WHTA 1OQAA 4BLRA 1T2DA 4PZEA 1ODTC 3K6SA 1A9QA 1LQTA 2ZVDA 3IALA 3THXA 3NFYA 1SO8A 4P5PA 3PKZA 3TEMA 2A59A 2SNIE 2Z2XA 3PPWA 4JJ6A 5EP4A 3JSAA 1CZKA 3P4XA 5LZ2A 1BVRA 5DNDA 4JV5B 2H1HA 5IXYA 5KQPA 2UYQA 2V6GA 3SZ3A 4EP1A 1YQ9A 4YV2A 1RYFA 1JV2B 1W85B 4N7MA 3WADA 3G9TA 4M8NE 3THYB 1WX1A 3NAQA 2XQJA 1DIHA 4ZYTA 4W7HA 2ZSJA 3GRVA 3LVRE 5GM1A 2VDUE 3P52A 1BKDR 3ZU5A 4CM5A 3LBYA 1TOAA 2ZTUA 1E7SA 1PW5A 2Z1MA 4EY3A 4FMBB 1JFRA 1L7EA 2AQKA 1QF6A 4M0DA 3RYIA 5F76A 4BVJA 5AVJA 4DHEA 2OB2A 1BX0A 3RVQA 2BSXA 1F06A 2WJWA 3AGQA 4N65A 3GPLA 3IMGA 4ZEWA 1UJ2A 2VCHA 3CPHA 2HD4A 3FBWA 3QGMA 5CPBA 5AW4A 4GX5A 3ZX4A 2MSNA 2YIVX 3FROA 3PGLA 1U8EA 5L4NA 3P0FA 1QTIA 3EGXA 1GPH1 4RY0A 5M3BA 3ANYB 1Q0HA 2P2GA 4OFWA 5ITZA 3O21A 3U7FB 1F9EA 2IUUA 2VPWA 4QGGA 2AH5A 2CLOB 1IVNA 4UHDA 3W9BA 3FSJX 1NBMD 4PSAA 3VZSA 4GKVA 1T1JA 4EYOA 5FUQA 3ZDZB 2F3TA 3LECA 1SCAA 1PZMA 1L5QA 2EEPA 2O57A 4IIHA 4O4HA 4Y7DA 2QJRA 4FFBA 5DHTA 1JG7A 1U7UA 4IV8A 4PV7A 2OCGA 4JHXA 3IO5A 3SQDA 1VP3A 3DFUA 2CVOA 3L0ZA 5AVQA 2C7OA 3G7UA 3UPTA 1XDUA 4QO8A 3HZZA 2R4TA 4TQGA 2AN4A 4UEQA 2EZ9A 1D2CA 2MYTA 2Q6LA 1NLUA 4N9WA 3T1TA 4W5JA 2HO5A 5ALIA 5GP1A 3LUHA 2JLCA 4XWYA 3ZD7A 1E2MA 2NX2A 2YRWA 2YYAA 4A0GA 3V1UA 3GRRA 3LL7A 5ED4A 2V7WA 3S1AB 3DTVD 1E1MA 1F14A 1EBBA 2JB9A 3FJOA 4JB2A 4W5HA 2FFBA 4TXNA 1MCZA 1DPGA 1GJRA 3C24A 3ZGLA 4H3VA 1YUMA 2B9VA 3CR7A 1MQ8B 4FMCB 1KRHA 5K09A 2Q5IA 1TF2A 2ZKLA 3QVJA 4N3CA 1AKNA 4I1RA 5B2FA 3R6LA 1QGYA 4OIFA 1KQ3A 4R5HA 3DTNA 5CNJA 3BH0A 4GC9A 3PQFA 3DAPA 2W2LA 3FE2A 1SA0A 1HEUA 2GZDA 2PXCA 3CC8A 1NG1A 2CMDA 5HOEA 3PQEA 3F8WA 4MUKA 4HV4A 5C34B 2W22A 5D7BA 4O02B 4Q9AA 1RPZA 3ANXA 2OC9A 4BAGA 1JIUA 1OBVA 2BONA 1KKLA 3CG4A 4GOND 5FOWA 3TR0A 1FUYB 5HZGA 3BF7A 3U16A 2AWNA 1LI7A 1FRVA 1B8VA 2SCUB 2VQDA 1O5OA 1Q3TA 3QTTA 2YWDA 4J75A 4R84A 1EXNA 5ER6A 3TVTA 4BWGA 4KG7A 3WKBA 3CLKA 1JE1A 1L8XA 3KWJA 4OY3A 4UCWA 4ZU6X 5C7LO 1HT1E 3GLSA 3E2PA 4MUFA 4DOMA 4MRRA 2Z8YA 4QDTA 3JWHA 2XWBF 1SVUA 2OBMA 4IUDS 5KOHA 2OFPA 2QROA 2HA4A 4G65A 4N03A 4DT1A 3AR8A 1XLWA 5BYJA 3NJ4A 5KTMA 3IEVA 1SZPA 1YRLA 2YVQA 4OI0A 3PR3A 3U44A 1K5HA 3F74A 3T7TA 4MR9A 5AVSA 2GM9A 2QEQA 4MS1A 2OQVA 2ARKA 4XCXA 4JS0A 4AW9A 5G3YA 2VYVD 3FTCA 2CFIA 1K1EA 1JFFA 1QFJA 4GBJA 4K0RA 4P86A 4DIKA 3RC1A 2B7LA 2V4UA 1EK6A 3MBIA 3PQ2A 4KBYA 4MVWA 3EWSA 3TLGB 1WJGA 3QKTA 2ZYAA 5FUYA 3C3DA 5AW1A 2DQZA 5F21A 3MNFA 3FAKA 3QU7A 5IK2A 1SG9A 1ECPA 3I6ZA 4L4YA 4LSGA 4DVGA 3PHGA 2QMHA 4M8SA 3T5AA 3GRCA 3ZXXA 1I4LD 3ZNQA 3GZJA 2IUYA 3ZPXA 3OY7A 1X8XA 4CQJA 1H23A 1R8SA 2W6MA 4EPYA 4H4DA 5DN6D 2B0JA 3Q0EA 4DUYB 4F9FA 1WW2A 4FOLA 2H9YA 3QSYA 3CH6A 2YIDA 1DFHA 4C30A 2X2PA 4EY5A 5A03A 3MWJA 4MCIA 1Z3IX 2X7JA 4NS4A 5F7ZA 4DXDA 5K3EA 3U4QA 2R5WA 3GN2A 3T7EA 1U6JA 2GJSA 4YPOA 2H29A 1JPUA 1P31A 5I9NA 1KWGA 4PWYA 1COWD 1UBNA 2FX3A 1T3GA 1MRSA 3RS0A 1JHMA 1XJQA 4N39A 1EM6A 3R7FA 2NUTA 1A77A 2X0JA 4R51A 1GNRA 3UW3A 5KOYA 2D1RA 5FAXA 3VPGA 3TG2A 1Y8CA 3FPJA 2ACKA 2W2PA 4HKTA 2Z5LA 1S8NA 3G7SA 4PG8A 1JQBA 3WXMA 3FNEA 2DKOA 2VZLA 3L8YA 1D09A 4G0UA 4EMTA 3WLOA 4IZ6A 1M34E 2XNKA 1NRIA 3ZHQA 4KYUA 2B5WA 4H2DA 3FWPA 5DB4A 3FRJA 3L5OA 3DQPA 2QZPA 3RG2A 2C4HA 4DDVA 1QE3A 4YJKA 2CXQA 4EX7A 3Q4GA 3U81A 1TZ2A 1BX1A 2F1IA 3MT7A 1OMOA 5AIAA 3SG0A 2VK1A 1CR4A 2TYSB 3L8DA 1II8A 4NIMA 3KQTA 1BYIA 5BW8A 1NNI1 1E2LA 1D6NA 1UMBA 1X87A 3KYDB 3K0BA 2JJ1A 4ALMA 4XASA 2EC5A 4YWJA 4EKEA 2AFHB 1QCCA 1VPEA 5LUBA 3ZU6A 5IKXA 4Y1FA 1DKQA 2OESA 3DC2A 1R0XA 1UM8A 5H1YA 3SDBA 1C30A 1F6WA 3EVEA 4HXGA 4NOKA 4CU2A 3R77A 4UDXX 1MR3F 1CUAA 4ZOEA 5FLXA 2QUKA 3MPOA 1O2DA 1IHXA 1MW9X 3O2QB 2NVBA 3L40A 4IVRA 3ZR4B 1B6RA 4EK9A 1GUFA 4DLSA 1NV9A 4NV1A 5JWHA 3BERA 5TE9A 1G20A 2ZVQX 2WJGA 2H59A 3BRWD 4RA9B 4Z3KA 1PLKA 5EIEA 1QHEA 3C3MA 3KVRA 2AD1A 1KFBB 4EGFA 1N92A 4DSAA 4MB2A 2PMWB 4ENTA 1E96A 2IQ5A 2ZRHA 4ER0A 1I2BA 4TMKA 1RYBA 3QVGB 2OBXA 3O6VA 2GCOB 2YHUA 4FHFA 3FOZA 1Q0LA 2QX9A 3I3SR 1X8KA 5ERXA 2R5NA 2O7SA 4BE7B 4PGHA 3F6EX 3U3KA 1SUCA 2F1HA 4MRPA 3G2OA 4HGZA 4U2BA 3H1EA 4F4IA 4IMIB 2PLFA 1ZRSA 4UKDA 1GKLA 3TK1A 1A4RA 3RNOA 4MRAA 2VUHB 3ULKA 5BNWA 2NTJA 5HM6A 5IUNC 4RHEA 3R20A 4YHBA 4YMUA 1E2QA 5BYBA 2AV6A 4JI0B 1OYWA 1Y80A 2DT8A 4GKKB 5E9QA 1WRBA 1EE1A 1E9AA 2IWRA 4RORA 1ADYA 1VZ2A 1FYEA 3PVSA 4GPTA 4WEQA 1L7VC 2WYUA 4KZKA 2XIQA 2B6NA 3CPJB 2BRUC 4W1RA 5GGXA 3U7IA 2I4OA 2OV8A 3WRVA 4AZTA 3ZV7A 3PFIA 3U2QA 4KQ6A 1LB1B 3EVBA 5LIPA 2VEDA 2H5JA 2Q4BA 2J6BA 1PI3A 1P6QA 3GLFA 2C2KA 1GFWA 4GX2A 2WVHA 2FXIA 2YL2A 4RD3A 1MVLA 1UC9A 3JV7A 1FU7A 1JI0A 2Z6VA 4QBIA 3G23A 3BQ9A 3NR2A 1G9XA 1E3SA 3A11A 1PR2A 1OTHA 4W4TA 4QOFA 3A6EA 4N01A 3V33A 1CUZA 2AZTA 2WMNB 1IBRA 2IYSA 2Z2IA 1KRWA 1WZUA 3A37A 3OUUA 1SG0A 2G25A 4Q3DA 5HMMA 1K89A 4YREA 4F2GA 2VSXA 3ASUA 5IP5A 3NFRA 2NSLA 5K0GA 3PX3A 4F86A 5EQDA 4B8WA 1IWPB 1VPTA 5F5LA 1KBQA 1W93A 4TT8A 3TIIA 4ZDWA 3VU3A 4JBHA 3GBPA 4PYRA 5IWCA 1LS6A 1D0VA 3TH5A 3RTCA 1QHYA 4D9IA 4B4OA 2QTTA 3DCIA 1NY5A 4M60A 4DLYA 4LNUA 2VDPB 2DUNA 3JQ8A 4L27A 2BHTA 2AKEA 1NXXA 1QO0A 1ZZGA 1MIHA 5HIAA 2AR9A 4K3VA 3I9V1 4RKQA 4OHFA 2YY5A 3LKBA 2D0PB 3H8SA 3NDIA 1WSWA 2PK3A 3GPCA 3H86A 1YONA 2JH3A 2P62A 3C5WP 3K0HA 4GPD1 4UDYX 3AY0A 5DGTA 4D82A 2EJWA 4DMLA 1S3GA 3EIXA 3RWBA 3IJRA 1L5RA 2BELA 1WP4A 3K5IA 4MV8A 3AJ8A 1BGWA 3O8OA 1T35A 4RV5A 3VH4A 1W4RA 4QUEA 1MB0A 3FB4A 3R7WA 2PLWA 2V1XA 2GHRA 3DL2A 2H4YA 4U2FA 1KOLA 3O94A 5C8YA 3O73A 3CUWA 1PL8A 1WZEA 5AKXA 3PIDA 4MDEA 4A7PA 1BVHA 4JB3A 5EJ5A 3T3NA 2OYSA 2A5DA 5JQGF 1XRMA 4CETA 2QT9A 1QVZA 1CY6A 4PO1A 3IEXA 3BTUA 4LXIA 3E9CA 3PA6A 2IEBA 4G0PA 4C29A 2WTMA 3ZU2A 2X86A 3MPUA 1N6RA 1U5CA 2Q0XA 4KJZA 4BLWA 1U4SA 2IGBA 3C6YA 2A94A 2G07A 2CJXA 4QELA 1EI9A 3SKYA 3BMCB 1CUFA 3AM3A 2L17A 1GQOA 3EHEA 1QYRA 4JC5A 5BR8B 1IEWA 2XODA 3B1JA 2X5NA 3K2QA 1NYLA 2HJ9A 1D07A 5J59A 3PTAA 2P4EA 4MCAA 3FFTA 1KAOA 3TXAA 2C8JA 5BYKA 4XI9A 3AESA 3E7DA 2UU9B 3A06A 3NRCA 1LGYA 4F72A 4CIXA 5T4HA 1I13A 3TDNA 5GONA 1NJGA 3GEDA 2BSAA 5DXFA 2W5UA 1Z2DA 4BO7A 4O63O 2ANBA 1B4DA 2QUJA 4K9QA 2KSQA 4RETA 4B7CA 1HNXB 1RPJA 4L0CA 3ZTWA 4HH0A 4ZZ1A 5ITSA 2PNFA 4MRMA 2WWYA 5TMEA 2PG3A 1MXFA 2X8AA 3PT9A 3HA5A 3DOFA 2JRLA 1Q0PA 4H4EA 2JFOA 3AUTA 3VC7A 5BW5A 3DM9B 3CVWA 4HTFB 3KWMA 5FTJA 3O7WA 5L6MB 3LZDA 3R5JA 4I2NA 3EGDB 3KS9A 2F8MA 4I50A 1E3QA 1IUNA 1CKEA 2GQ0A 3R3WA 3GJ3A 4IEEA 5GQSA 5B1IA 5FTMA 1ZQ9A 3P9YA 3WHKA 5F64A 3W6ZA 5AW6A 3CS3A 1EKXA 2NU8B 2WWVD 3OQVA 5H4GA 3OPYI 4PNEA 2Q0HA 5FKJA 2PT6A 3IAFA 1E79A 4PLYA 2FZCA 5HFAA 2VG8A 2P9HA 3GA7A 4GPEA 3L4BC 4YMSA 2QR2A 1JEJA 1X7HA 1QRRA 1M83A 1HDXA 1YJXA 1WPGA 4MDHA 4BKOA 2FI1A 1IY8A 1E6UA 1DS6A 1UDRA 1X7XB 2LCIA 1QHSA 3C85A 3EXHC 1W30A 2CLEB 1N78A 1YOVB 3CUTA 2F62A 2G70A 4BKMA 3ACDA 1X9HA 2H0AA 4MQ4A 1DQRA 2NUPB 2XMZA 5K8JB 1Q74A 3SLGA 1G8SA 1A04A 2J67A 4GKJB 1GZ7A 2AEMA 4D9NA 5JYEA 1QIEA 3I04M 4PIMA 1VRVA 5BQPA 2VF8A 1OYYA 1NMQA 2G5PA 1A5SB 2I33A 2IEZA 2J4FA 2WM3A 1HQDA 1U0RA 1WCV1 2DPGA 3D3WB 3RARA 2PZKA 1ACLA 1NC3A 4KQIA 1RHUA 2ORYA 1GLVA 4YAOA 3VDMA 4AI6A 1SCBA 1RZRA 2Q6KA 5LB4A 4MPTA 3IKVA 1HE4A 1QE5A 3JWIA 3ICVA 3M3HA 3MJEA 3O90A 1Q15A 4MP6A 4R7TA 2PWPA 5TMPA 3CF6R 1WBBA 4B46A 2PKQO 3I30X 2DY1A 4MR7B 2JAWA 5SV2A 4D3SA 2O8EA 1MC8A 3HHEA 1PNRA 4MIOA 3D6AA 3N0RA 4AMZA 2YY6A 1VGQA 4J90A 5KYUB 1U63A 1S0UA 3ZLVA 3PQ4A 1YNSA 1JJ7A 1IHOA 2JIRA 1L3BA 3OE7A 4MQFA 4AJEA 3G2LA 5F3DA 1B1AA 3U39A 1MIOB 3Q6IA 4OU5A 5BQOA 2UVPA 3ZHSA 1R6BX 2ZTLA 5TLSA 3TTSA 3A9TA 1NBIA 1X1BA 3UMFA 1T6NA 2RI0A 5FWDA 1AGNA 4BLUA 3LY9A 2DHCA 4ZPXA 1GEEA 1E1CB 5KNDA 3BWBA 4GMKA 3U4DA 4TROA 2XUOA 3A6KA 2GT1A 4EDHA 3R6GA 2DUJA 4GZMA 2MSWA 1QU2A 2CFTA 4K8OA 2VHYA 4BBAA 5FTLA 5KINB 2O0MA 1BVYF 1JEDA 2I6QA 3W1EA 3TO5A 4JLKA 2O2YA 1NP6A 2RHGB 3JD4A 2XCIA 4PHTA 4EGSA 1K98A 5LOVF 1J06A 1P0FA 3UJ6A 5DLEA 1KYXA 2LE0A 3T34A 2O3QA 4MOWA 4GBED 3HEAA 3CLSC 4DB2A 2Q5CA 4Q19A 4QTXA 4F04A 2PBLA 4MKIA 4ZAWA 1GYQA 3RREA 2A9OA 4B33A 1X70A 2ID8A 4K9RA 1Z18A 2A35A 3W90A 1HDCA 1DAHA 1KVUA 4XIYA 2X22A 4PHFA 1Z37A 3UFXB 4F3NA 3P9CA 1KO7A 2AZDA 1C2YA 3ZWMA 1TMYA 4P5EA 3MOSA 3T3OA 2V4ZA 4C22A 1T6BY 1GYRA 1YDFA 3DBRA 3MWKA 2P9YA 4ID3A 1FTNA 1C14A 2FF7A 4HD8A 1DL5A 2OAQ1 4OXIA 1KARA 2JDID 1RI1A 3DZGA 4JDUA 4YK7A 3IMEA 1R5OA 3SIWA 2X1MA 1DJNA 4AFNA 4E12A 5KNBD 1IBKB 1I3NA 1RRCA 4UBNA 1XLTC 3NYWA 4MVJD 1KYVA 1Z07A 2D1FA 2J5RA 4RPJA 3EZYA 1TVCA 1EE2A 3OWXA 1GKKA 2VXYA 3R8FA 2R62A 1G291 3PXEA 4QYXA 4FC6A 5DOVA 4A3SA 4AN0A 2V03A 3OHMA 1U28A 3DMPA 4CDNA 2ZI9A 4TL9A 4RD0A 2BR3A 3ZYZA 4CCYA 1RYEA 2IUEA 4DG5A 2ORVA 4RA6A 1B41A 2CNWD 1I0IA 4GKBA 5LLTA 4RGBA 4ZCSA 1FW6A 4Q47A 1WIWA 3LQQA 5LUAA 5LYJF 5KYWB 3L1VA 1N3IA 1FS5A 3NKLA 2Q7OE 2DBRA 3KSBC 3GLUA 3ETEA 2GOYA 3VZQA 3KUUA 1B0ZA 2DP4E 1H0SA 3TAHA 5HKBA 4TTVA 1NPTO 2WAMA 1NR1A 2Y1DA 1TXGA 4EITA 3RH0A 3WYEA 4UNSA 2AS0A 3K9CA 2PH3A 2Q8NA 2FWBA 4FGSA 3AF6A 2BISA 1ZOPA 2EW1A 1J49A 1H9AA 2G9ZA 3C4QA 4TS3A 4X61A 3NC1C 1DEXA 2P4QA 2QRJA 5ALZA 4B84A 4F4JA 5A6SA 3T5PA 5D3KA 3AEKA 4K28A 4F46A 3Q8XB 1H0HA 4L6AA 3W79A 5J1SB 5EVCA 3NWBA 3MRSA 3RYCB 1N77A 3I72A 4LC9A 3I6MA 1U8AA 2A5FA 2RH9B 4GOOD 1PIWA 3HO8A 4KGZA 4ZQGA 3RS2A 1H42A 4UFNA 5CVUA 3THSA 3QMVA 1VCIA 4I4TA 2TS1A 1ULSA 1N5OX 1R5NA 4GLBA 2AOWA 2VP2A 3PCTA 4ZVVA 4B35A 4DR4B 3AMVA 4RW0A 3QIAA 5FUVA 4C7MA 4CIWA 3PKJA 3EWAA 5DM4A 4EYSA 3OO0A 2ODNA 3SGLA 5C8ZA 3RF7A 3KETA 2JNWA 5BOSB 2QAGA 3J81A 3M89A 4JVMA 1PYDA 1G8HA 2GBLC 2PH7A 3B52X 4MW0A 3GC6A 2CLCX 3I4FA 4QUDA 3VBCA 1QYXA 4V24A 2XZDA 3UYKA 1BC5A 1HQCA 5T4BA 1Q7BA 3F5MA 4EHJA 2AX3A 5AVRA 4EYGA 1YR7A 3ICPA 4PWZA 1DAKA 3UAWA 4FWIB 3T7JA 4KLNA 4B74A 1M2VA 1HFEL 4LECA 4EG1A 2PLRA 1KZ4A 2GRAA 2OCBA 3DMYA 3DEHA 4C04A 1M67A 2CDNA 1E6CA 1MRNA 3DZ8A 3GELA 3OEYA 1B0UA 1HNNA 1JVSA 2CUZA 1N8SA 2G36A 3JSXA 4F4DA 3OLQA 3QITA 3TRFA 1GKUB 1UQUA 1ZK1A 3KQQA 4DEXA 3A1NA 3DMTC 4HWGA 1H5QA 4BV8A 2DERA 1ZNQO 1UKBA 2PO7A 2V4MA 4PBRA 3ZWWA 1XJWA 4BMOB 2AFIA 3K09A 5CH8A 2GEBA 4PONA 5F2OA 2O2ZA 1DBPA 1P1RA 5IPFA 1E2UA 2R48A 1SGWA 3RT7A 1NW6A 2Z0MA 2D2VA 4RZ2A 2VDWA 1N5IA 2DOKA 5BN4B 1LS1A 2I9PA 3OTHA 4K6KA 3T38A 4OFBA 3QVWA 2QLMA 2ABWA 3TNFA 3ZD6A 2VQSA 4QG7A 4MW2A 3NQ41 5IKMA 3MTAA 2ZCUA 4M83A 2EKDA 5AJWA 2YYYA 3OZ7A 2JEZA 1E0JA 2QW1A 4DLPA 3BCRA 3KBOA 5DMHA 3WV4A 1FE8A 2NWQA 4TXJA 1Q3HA 4MKXA 3RTDA 1QO9A 2P91A 3A14A 3QE4A 4YJHA 1NJ8A 3MBKA 4MNTA 4YB8A 5FR2A 5G0WA 5JMPA 3P0RA 4ITRC 3WK9A 4DXHA 4RZXA 1E3LA 2IIBA 4DPKA 1MAUA 1ZM7A 3PEEA 4D79A 1NNSA 1GTVA 4KO3S 3IKMB 1MAAA 2B5OA 2BR4A 4D9BA 2WB2A 4DFDA 3IELA 2V5VA 1QLHA 2VSNA 4PZUA 4ZT7A 2QUHA 1USKA 2LIPA 3UCXA 4Y1EA 4YUVA 5H9WA 4MUYA 3N8DA 5IUKC 3V1TC 3DUFA 4U02A 3L43A 5CJPA 3T7DA 2AXPA 3BSWA 3MA0A 3PIIA 1WDTA 4Z2YA 2O5CA 1U6IA 4CN9A 2XT9A 2GF9A 2IU3A 3AIMA 2ENUA 2ODTX 2OOKA 4UULA 3U4CA 3ZVNA 3AVXA 1F51E 4CW7A 1DJMA 2M9MA 1CFJA 1AS0A 2YR0A 3EIQA 2J0EA 5KB3A 2QU7A 2LGJA 3DE5X 3ZZNA 3R75A 3HJFA 2ZS7A 4FCTA 4FDAA 2Z9BA 3AYXB 3OUTA 4Q21A 5ERGB 5LNK6 1IHUA 1K5PA 1HWYA 1R4NA 2X9NA 2WG1A 1NYRA 5MN6A 1J90A 5DYGA 2GI4A 1F2VA 1QAOA 5A06A 3QUSA 4PQEA 4U8GA 5DGDA 2OXTA 3M4YA 4D26A 1QPZA 1P5JA 4R1MA 4ZO6A 5IJAA 3T1OA 2E18A 1I1OA 3OCXA 4UMFA 4OLFA 3ROZA 2XJ4A 2D0DA 1D2MA 3GRZA 4DPMA 2V0GA 3U19A 3ND9A 3R8XA 4F21A 1YJQA 4LX0A 5AJZA 4F0JA 1X14A 1ECCA 1NASA 3K4QA 4L16A 3W5BA 4HH3C 3VKUA 1F4VA 1PQWA 1YXMA 2SHKA 4I81A 3KTAA 3C39A 3E61A 5A4DA 4YUAA 2HX1A 2HWYA 1TEVA 5D3MA 2B78A 1QU3A 2WM9B 4PW0A 1P9LA 3QXCA 5TDHA 2BLLA 3BRQA 4KKXB 2LDXA 5B3JC 2PU7A 4ZAFA 4HRXA 4J03A 2JL1A 4IVQA 4JU9A 3DG9A 3RAFC 1NA5A 2RGRA 1ZIOA 5JAQA 1T4CB 4HN9A 3ZD9A 4HYTA 4RL4A 1C81A 2QIPA 1V71A 1KVQA 5ES4B 5I4BA 5L3QB 3N6RA 3D4NA 3G2JA 5FL7A 3A4YA 2HPHA 4DR3B 3V2GA 4Q15A 5BMVA 1MH1A 2VJBA 3HKBB 3HKCB 5IJ0B 3NBXX 3WGZA 2HK6A 3TZKA 1C9JA 1G3RA 3VPHA 4G8BA 1IMJA 4DNFA 1D4FA 2TMGA 4CUKA 1NJ6A 2IXAA 3RJTA 1RE0A 4PLHA 1Z13A 2PE5A 2F8TA 1VRWA 2EJUA 1DIRA 2QSZA 3JATB 1IOWA 2WM2A 1UF9A 3KCNA 3LQ4A 3O9ZA 3OO1A 3Q2IA 3DBVO 3UK7A 3V3KA 4CM9A 2R7LA 5G53C 4MTLA 3B12A 2R8PA 3QF4A 4OMDA 5ITVA 1XD2A 3HACA 3HCWA 3KOYA 3FH0A 1ZL2A 1WQ3A 2RK6A 3OX3A 4FU0A 1ZPDA 4CKBB 5JZBA 2UYOA 1TB4A 3KR0A 4XSVA 2B25A 4KUEA 4RTJA 1NN3A 3FSEA 2RAVA 3VO1A 3WYBA 4O0LA 4B5LA 4EVRA 3VHRA 2YHSA 3RPEA 1OSNA 4K26A 3W5HA 1PG5A 2WD7B 3G85A 4UHEA 4JT4A 5K3CA 4BL5A 4JI8B 3N6VA 1VKZA 1Y98A 2JC3A 3C43A 4FKBA 1RJ9B 1SC6A 1WEHA 2XBMA 4CLDA 2HW8A 5DN9A 3K32A 4TVKA 4XD2A 3UK1A 3JAWB 4XB2A 2CL7X 1W4CA 3ZVMA 1DAEA 1THGA 3MMZA 1IZYA 4G56A 3G1WA 1ZEMA 3IBFA 5C31A 3TCXB 3HCCA 4KIGA 3H4IA 3RFVA 3ZGXA 1L4EA 3W8RA 3ZGOA 3DLPX 1CE8B 2WTBA 3MTJA 3NEAA 2HRQA 4LDRA 3WIUA 4QWMA 2H7YA 1ZM3A 3CX6A 3PL5A 3R5FA 4ZVMA 3BYZA 1FL9A 3FUTA 2KPOA 2FX5A 4M89A 3WLEA 2D5BA 4HQFA 2EKZA 4OA5A 4WVLA 4E2WA 3T3PB 2XDQB 3VPDA 3GA5A 2QW0X 5CXSA 3TZLA 4Z4EA 5K3BA 2RHLA 4DQKA 2WVJA 2P2LA 3R9XB 4UMDA 3K2BA 4RJTA 3H1AA 2JFHA 3EPPA 3U61B 4LZLA 2QVZX 2ZIXB 1U90A 5AKYA 721PA 3TPZA 2BIFA 3BDAA 5LBUA 4Z51A 1NQWA 3D3EA 2ZR0A 3DOOA 5FFNA 3PRHA 5JSHA 1MB4A 1MC1A 4WERA 3IHTA 2I2WA 1K5DA 3WRYA 1P7VA 1ZCFA 3A3KA 2HYDA 3T7IA 5AXBA 1WEKA 1KPIA 1C1XA 1JFTA 4OHVA 2W58A 4HR7A 1H0KA 2FMTA 4K9SA 1VXRA 4II2A 4GZ5A 2VJAA 2ZT7A 3WLLA 5A4FS 4LKRA 3ZHVA 3G0OA 2EZ8A 1VJRA 2H48A 3DLIA 3TNLA 2J33A 1H8HD 3WLTA 2UZ4A 1WCXA 1EVEA 1XCMA 3A9RA 3K9NA 3C3EA 4GF5A 4QVKA 2REQB 4WGFA 1UFRA 5IWAB 1QWOA 3WGIA 4KGVA 3RLIA 4U2EA 4GMHA 4I5IA 2EHJA 9ATCA 3GGCA 4I9FA 4BGDA 3EXIB 4HB0A 5DIZA 1KSFX 2VJDA 2ODEA 3G2KA 1UR5A 2OTCA 4AWBA 1T91A 5KJFA 4P4GA 2B2CA 1MVNA 2XCRB 1GL6A 1AJEA 4CEJA 3ND8A 4P3YA 1I51A 2SKDA 3UM9A 4OHYA 3HVHA 4N0DA 3FAZA 4J0QA 5DJ5A 3TQIA 5BQXA 1HSZA 3B9PA 2JFQA 1EPUA 1GDHA 1QDLB 2AMLA 1KYYA 2Q1UA 1U81A 4EY4A 3PNMA 4HT3B 5ELMA 4LJAA 5D85A 4ARIA 4YASA 2DFPA 4JSRA 5DT2A 3SY8A 1Z15A 1YQEA 3AFOA 5JTTA 4H7EA 1WNTA 5JO9A 5HKKA 1YFLA 2QVBA 4CMKA 3IR7A 4ZI7F 1XRJA 2B8WA 4TS9A 4XA8A 1T0JB 2BEWB 3DULA 4PSDA 5EZ6B 3RFFA 4B3HA 4EABA 2A30A 2XAAA 2ON6A 3RYFA 5FLKA 4QFCA 1WVGA 1TJ3A 4LJ8A 4AWAA 3ZHCA 1HTWA 1DJQA 2C0PA 2H52A 3NOQA 1KA9H 4CXMA 3L7JA 1VCNA 1LA2A 1T5BA 2RSLA 3OPXA 4PPNA 5FTWA 1ENPA 1FFXA 1GY8A 3UT6A 2JRCA 4M9RA 2WJHA 2Y1GA 1T8PA 2GBFA 1A2OA 1O0SA 2WJIA 3DHYA 3GJ7A 3LDGA 4AKGA 4MB6A 1ODCA 4E08A 4M88A 4CTMA 4F11A 3PQ7A 5HBGA 3PHBE 5K0SA 2RIRA 2ZROA 4OYYA 4P92A 4WXPA 2C3PA 5MN5A 1IXZA 3CISA 1WM1A 2BKAA 4E0BA 3N2LA 2HPAA 1KI7A 1AM4D 3NWJA 4NNPA 2JLQA 1R4MA 3C7DB 1CQPA 3AY6A 4N48A 2KQUA 2UDPA 3ODGA 1T36B 1N2JA 1U7HA 1LXCA 1Z2AA 2G9VA 3EVCA 3HJAA 5IFLA 1L5HA 1GPMA 1TQDA 2XB6A 1B7GO 3CJTA 3I1JA 3PI7A 3FWHA 4C43A 3MLEA 1J9ZA 4PLZA 5EQFA 4DNQA 3AVTA 1CRPA 2EWMA 2OCXA 4GW3A 1G8JA 2X5XA 3H5LA 1I1HA 1RYZA 2XDYA 3DBIA 1EFTA 1RBZA 2I3DA 4U6NA 4UXIA 3RU3A 4DSOA 3O4FA 5FUBA 4GVPA 5HHTA 3SEAA 3H3JA 1UUFA 3M9XA 5KTRA 3DNMA 1KH3A 2R7MA 4IMPA 5HJ2A 4J2TA 2GK6A 5BVGA 4MK4A 4POAA 2FEXA 3JARA 2AEJA 3CLTC 1A98A 2HBZA 5TMBA 2R7AA 4D5GA 4MIEA 1FU8A 4QOJA 2FQYA 3QTLA 5C1PA 2I4NA 3EPHA 2GDZA 1QTRA 3DF9A 3LHKA 4G6ZA 3W5UA 1KI3A 1KFEB 4W5QA 4K5QA 4F6LA 2C0CA 5FCDA 1GADO 4ZOQI 3M33A 2GBGA 3IQIX 3AEUA 3E9MA 3RRYA 3BJMA 2GZ3A 2N46A 2EXXA 3K9QO 4DLTA 3OKAA 4L8WB 1IZ9A 1PK9A 1RQXA 4MEAA 4RELA 2NTNA 4B3GA 2ZRQA 3L6CA 1NQVA 2X0IA 3DAOA 4ZAXA 3C0KA 1ZU4A 1CT9A 2XPCA 2D7JA 3DJYA 4OP2A 3ZKAA 4EW3A 1XMPA 2VHUA 2Y2VA 2Y67A 3QNWA 4N7JA 3IKTA 3O4RA 4OK3A 1ZW6A 5FB3A 4DJDC 3ZXSA 1CP2A 1SXJD 1V7QA 3DDZX 5E9AA 3R40A 2ZJ0A 1KJQA 1S2MA 1S7GA 2V7XA 3O03A 4OMCA 4XDGA 4KN6A 1RJEA 3DO8A 5AI5A 1O89A 5EKTA 3PRKE 1ZUIA 3TPCA 4BV9A 4F2WA 3W2TA 3TLCA 3RSQA 5JAPA 4DR6B 1O96B 1RWNA 2F1RA 1P3Y1 1UFVA 4R2KA 4UTPA 2LUOA 1XIVA 2RHMA 1R0SA 2CXOA 3M1LA 4BQRA 2RC5A 3HU3A 4MUXA 4R8VA 1OX5A 3E84A 3BD8A 5A0TA 4D0RA 3IMCA 4RHYA 2WJZB 3BXXA 1ZCAA 5DLDA 3D31A 3FZGA 5AW3A 5C7OO 5I7FA 5KVAA 1J4AA 1O58A 5LOVB 5ARDA 2GK7A 3CEPB 5KEIA 2ATIA 4LWQA 1Y3CE 3ABZA 3KU4A 1RMQA 5HRUA 5IAOA 3DWIA 1LPMA 4BKQA 2XUJA 4DV0B 4RAOA 2YFKA 1UXGA 3NH6A 5BQFA 1Z0KA 1W4AA 4RCYA 4L28A 1SWWA 2AOUB 2QS9A 2E9SA 3QHAA 1R4ZA 2NV0A 4HADA 3HC7A 1NW5A 4Z9YA 5GOZA 3X2FA 1UM9B 4E5MA 4EPRA 2YRXA 3HTXA 2QMZA 5BSUA 1KMMA 1QIGA 1WV1A 1PCXA 2GKSA 2FQ1A 1OZFA 5J2TB 5EA2A 1MZPA 1MJGM 3CCCA 3CXUA 1YR1A 2FX2A 3UQYS 3LXXA 5K3OA 3MJVA 3LQ1A 4HDQB 4TTJA 1F3OA 5DCLA 2V3CC 5CYPA 2QXUA 3KPJA 1IBLB 3DT6A 5E0OA 5JPIA 3RUAA 1CIJA 1QV9A 5DW3A 3VPFA 4KXFB 5AI9A 1N25A 5DXAA 3GR6A 4ENSA 2Z5VA 4WBNF 3DGFC 4IIDA 4K9KA 5TVKA 2Y0CA 1U0OC 1KO8A 4DQXA 1HL7A 4BAZA 4TV8F 1RVV1 4BNTA 1QK4A 4JWTA 5CVDA 2HBQA 2W00A 3QFHA 3QBEA 4LC1A 1L5FA 5JFTA 3KO8A 3WBJA 2HB6A 4PIVA 4BO3A 4LQCA 5K4AA 3BE6A 3ELYA 3H5RA 3V7NA 3F3YA 2INGX 4EJ6A 4FD2A 4R6WA 2BZ1A 2ZWMA 4HN2A 3RVLA 1NC1A 3FI9A 4QOGA 3T0GA 1WMSA 2J1LA 3EC2A 2I4MA 5JZMA 4X1YB 2IX9A 5IDYA 1XRQA 5IC4A 3UK0A 3AUFA 4FYIA 3AJAA 1W5FA 3JZMA 3RBXA 4AJOA 4ZRNA 1KP9A 4BFVA 5LYJB 1KJ9A 1L5NA 3AEQB 4R3NA 2XOXA 1FNDA 4MWGA 3WL8A 3SQLA 1DARA 1A71A 3FCXA 3TW6A 4QQFA 2FWMX 3W9UA 3OIWA 3A6GA 2W7TA 2ONKA 3JAMA 5H9VA 2KE5A 2QM3A 2PGIA 2VTDA 3JQAA 5CM9C 1VA5A 1SWVA 3HE3A 4K81B 1TM4E 3D7MA 3C15C 4D74A 4XEUA 1OU0A 5B36A 3D9QX 2IYPA 1R0WA 3AILA 2OVBA 3QPUA 3TIGA 2ZT8A 9MHTA 4K6MA 2O52A 3GZNB 3GLTA 1OIVA 2Q4OA 3M6AA 3Q1KA 4MIKA 2GLUA 3RWOA 4Z4CA 1MJHA 1U4NA 2DQKA 2ILVA 2QVGA 3GGGA 4HZGA 5CW2A 3K2IA 3SYMA 4QXMA 4A4DA 5AUNB 4O4JA 5KQRA 1E3DA 1FLAA 1II0A 3RIGA 3NDRA 3UT5A 4F97A 1E7RA 4NESA 1C5KA 1O6CA 2QN7A 4LXUA 4B7UA 1J9EA 1ESEA 1U2EA 2W2KB 3MGKA 3ZLJA 4GOXA 1AU9A 3NBKA 5C7YA 3EQ2A 3BGWA 1VOTA 3BK2A 3DOIA 2UUOA 3NGXA 3R44A 4BRZA 1YS7A 2J3QA 2W90A 1J9GA 2JZCA 3GJ4A 3MQ2A 5AR1A 2F55A 3MERA 2OZLB 4LISA 5TQ0A 3ZNNA 5K2MA 3WWYA 1JT2A 2PX8A 4Z4IA 1M8JA 3UZUA 4NDZA 3EPLA 1JDVA 1H1DA 1XNGA 4YRBA 1NW9B 3KVVA 2LXNA 3QQ5A 1AKTA 1ISRA 1Y8RB 3GNSA 3ZE6A 1GZ3A 2WF7A 1BXKA 4DDHA 5KCMA