3HYTA

Structural basis of gdp release and gating in g protein coupled fe2+ transport
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
245
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVRKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of GDP release and gating in G protein coupled Fe(2+) transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
total genus 81
structure length 245
sequence length 260
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hytA01
1WF3A 3P27A 4Z1MA 1OFTA 3B9PA 1E69A 1L7VC 1YHNA 4M1WA 1Z29A 3GJ7A 2Q3HA 2ZVPX 5DLQC 3K8YA 4US0R 621PA 1QG4A 1GAJA 1DAKA 1NVVR 2WPDA 3CLVA 4TL9A 2PZFA 2QMUA 4G0NA 1ZM3A 2XZLA 4N3NA 1W1WA 4Q4JA 3OEHD 3ZS8A 2NO6A 4JLVA 4HUTA 3OFNA 2R62A 2OT3B 1P9WA 1VYVA 4KODA 3UMRA 3I8SA 1TADA 2FFQA 2PMKA 5JS7A 5ELXA 1XRJA 2IYZA 1GZSA 1KKLA 2ECKA 5HCNA 5GJVC 2W2VA 2DHRA 2OXRA 4ZKEA 4YQFA 1W4CA 2XTMA 5FOWA 3X2SA 4YXWD 1KK2A 1NY6A 4TWZA 4LPKA 4X8MA 1N0VC 1A7JA 2WICA 4UKDA 3VFDA 1XP8A 5FR2A 1Y63A 3TBKA 3KB2A 3PFIA 1BMFD 1JAIA 3QXJA 3IILA 4Q01A 5CIQA 4K81B 4CYMA 5CJ2A 3REFA 1KI4A 4A8JC 1P75A 1RJ9A 2DPXA 2IS2A 3EPLA 4O2RA 4DCVA 3AF4A 4PPQA 5FTKA 4R71A 1OE0A 3W34A 2QRZA 4LV8B 4PC6A 1IQPA 4R2IA 4DUGD 1W0JD 4ERNA 3GLIE 2OCPA 2C9CA 4Q7MB 1Q22A 2RGDA 3BK7A 3PEUA 3B6EA 3GLIA 5A0FA 4EPRA 4DIEA 2GXAA 1E2GA 2HYIC 1G9XA 2GHIA 4KCGA 1K5GA 2QQEA 4TMVA 4EAQA 3CRQA 5BYKA 1QHGA 4DLWA 2QENA 1D2NA 1QBKC 1WXQA 2P67A 2R6AA 1SVIA 3S1AA 2BM1A 1W7AA 2FEMA 1VG9B 3DVLA 4P4SA 4BFWA 4QBFA 4FXPA 1PLJA 1FQKA 5KUTA 4RD4A 3SU8A 4PAMA 1GNQA 2B21A 4Q7LA 2G1KA 1KSGA 3T61A 5KNDA 4FMCF 4DLZA 1J90A 4D0NA 2O52A 2C95A 3NBZC 1GL6A 2DFNA 1T5IA 2ZRIA 3IUYA 2FG5A 4PC7A 3AKDA 3R7WB 4D4LA 3NBFA 1G64A 4RKEA 3AUXA 4URVR 3MFYA 4M8NE 3AF0A 4EUNA 3MD0A 2MSEB 2CBZA 1KDTA 2J46A 4CEJB 1JQLB 3HYTA 1UEJA 4Z8YA 2IYWA 4JYBA 3VNUA 4LJ4A 1AQYA 4GBMA 4QBIA 2JAQA 3G5UA 3OEED 4IFEA 2X77A 4D80A 2E87A 2I3BA 2BMJA 1G5TA 2QPTA 3DZDA 4JKIA 1G3QA 2DWOA 1CR0A 5JHHB 3N2EA 4PZLA 3OIYA 1COWD 2EQBA 1NMXA 4LJ5A 1W4RA 1KY2A 4I1UA 2XNSA 4AYWA 4C2TA 1SZPA 1N6IA 3P4YA 4DCUA 3B8HA 3CNLA 3GLFA 3BFVA 4PZZA 3PJRA 4MKHA 2GJKA 4LHVA 2IUSA 1FP7A 3CR8A 4LJAA 3UANA 4ZKDA 5FBVB 2VA8A 2GEVA 3EPKA 3H86A 1KI2A 1OH5A 1CJTC 1N6LA 1Q12A 2EU8A 1XPOA 2ZSEA 3KJGA 1XCPA 2V8OA 2QM7A 1FQJA 4M2LA 4RZ2A 5GVRA 1OH8A 4B74A 4BZPA 2FOLA 4NYMQ 5IK2D 2WWGA 3NHBA 1E2FA 1ZC4A 2ZANA 3H1TA 5JBQA 3RRYA 4XIGS 1F2UA 2FDCA 2JA1A 5HPYB 1P2TA 4XTRA 1R5OA 2XX3A 3WBKA 5LPNA 5GJCA 1DO0A 3EIQA 2FX3A 2YHSA 3OIVA 2BEKA 4EJSC 1NSFA 1VTKA 3AM1A 3QJYA 1F6BA 1R0ZA 2BV3A 4MYCA 4BQSA 1DBSA 4LHYA 4YMTA 5FPKA 4AG5A 2GAOA 3B82A 1K8RA 2HCJB 4XSGA 3A36A 4Y0VA 2X1VA 2QU8A 4KXFB 4BECA 4DBLC 3PENA 1E2JA 1UJ2A 4KFTA 2AD5A 3HYRA 4P4SB 2JGNA 4KBGA 3E2IA 1B23P 2X2FA 3DL0A 2UVQA 5FL7A 4KITB 1M8PA 1ZNWA 2O0JA 1XJQA 2ZSAA 2JLWA 3ZIAD 3EZ9A 5J40A 2ZU0C 1MABB 3I92A 3QOFA 4LCBA 4QJ3A 1E1QA 3GLIB 1ZNXA 1OB2A 1NG1A 3FFAA 4LK2A 4C7OB 3W8RA 2Z6VA 3KJIA 4RFVA 1W5TA 3EARA 2F7SA 2JLVA 3RC8A 2V1XA 2IF2A 1PLKA 5LB4A 2O0HA 1G8PA 4V0LA 5HZKA 2NMVA 3R8CA 3SJAA 1E9EA 1NJFA 1TQDA 4GL2A 3LAWA 4MRNA 4TL7A 2O8CB 2YKGA 3BH7A 2WM9B 2BDTA 5EE1A 4DLTA 3QF4A 2N46A 2AKYA 3KUCA 4QC2A 2BBSA 4QL3A 4AD8A 1E2IA 3K09A 2PLFA 1I4DD 2BKEA 1W44A 1QRAA 3KJEA 2J0VA 4DLRA 3ZS9A 3BJIC 2EWVA 4IFBA 1E2QA 4EPXA 1XD8A 2CVHA 3PEWA 5AUPB 3AVOA 4JYCA 3AVVA 2ZYVX 3DMDA 2ZJAA 2GZAA 1BYUA 2IXEA 2OUKA 2DR3A 4MKIA 2OFXA 1SXJD 2NO9A 3DOFA 4DDTA 4X8HA 1ZNYA 2F9LA 1CBUA 1P7CA 1ZVQA 4TMXA 3O8BA 5CDFA 4DDVA 2OO7A 1DAFA 4W5WA 5TDHA 1SXJA 3T12A 2ZUCA 2WOOA 1LVGA 1Q1BA 3NXSA 2CHQA 4ZCLA 3OAAD 3B60A 4JJZA 5DO9A 3A4LA 3FPAA 4YDHB 3RANA 2WJHA 4LRWA 2AL7A 4CF7A 3UWKA 1KJZA 1ZIOA 2R9VA 4B44A 4XVUA 2GAAA 4LPSA 4JVSB 3B1XA 4DLSA 2VH5R 5EXXA 3PCRB 2H18A 3K9GA 4BLSA 4F92B 1RRCA 3TUJC 4HATA 1CIPA 2C8VA 3LXRA 4L4UA 3AQ4A 4B76A 3D3QA 4FMCB 3T06B 4ZCIA 4FW9A 2GXQA 3ADKA 3H0KA 2HYDA 2BMFA 2YWEA 5JSZA 4MGIR 2XTZA 3LVRE 4ACBA 2C77A 2ZAOA 2GEDA 2FPMA 2A78A 3OZXA 1DAMA 3PUZA 3AB3A 5EZ5A 2JLSA 3EA0A 4I1OA 4KAXA 4QJ4A 1US8B 3RLFA 1E9SA 5EP2A 3RYTC 1G17A 1CU1A 1SHKA 1XD2B 2GCPA 4TLDA 4CT4B 821PA 2IWHA 3Q3JB 1T0JB 3ZDQA 4AI6A 2ZEJA 1HY3A 1VG1A 3AVXA 2ZRHA 5CK5A 1KK1A 4AY2A 4Z54A 4BFYA 1FUKA 4A82A 4B2LA 1D5CA 4IDNA 3BORA 3UMFA 4O3MA 1TMKA 5JWRA 3GMTA 4Q9HA 1YVDA 1JAHA 3DZ8A 4B3CA 1OB5A 1Z0AA 2DYKA 5A5GA 3OIUA 2ASEA 4JMPA 3GFPA 4GFDA 1VYTA 3GEIA 2F9MA 4TTPA 2ZRBA 1N6HA 2QAGC 2IF0A 4GMDA 2ZRFA 1KHTA 2RB4A 2YV5A 2O8BA 3LD9A 5FTNA 2JASA 2HUPA 4UNNA 3SFZA 3I62A 2ZTSA 1MRNA 2BVNA 1XTIA 2VL7A 1DVRA 1EFUA 2WIAA 4B34A 3PG5A 3LLUA 1JBKA 2GA8A 2D2FA 5EE5B 3GD7A 1RYFA 2Z5FA 5DN6A 5FI1B 1RRGA 5BXQC 3IGFA 5GJBA 2VTKA 4URYR 4GI7A 1FMLA 4KV9A 4Q9KA 2Q9BA 1XDBA 3ZVMA 2QBYA 1IAQA 3KJHA 1H8EA 2OBNA 2B7CA 1OXTA 4XJXA 4HAVA 2H7VA 2CJWB 2PX3A 1KSFX 1XB2A 2O8BB 2OHFA 3CO5A 1GL7A 2V4ZA 1AQUA 3ND9A 4Q1AA 4M9ZA 2QL6A 4B3BA 2JJ2A 2J7KA 1GKIA 4I81A 2V3CC 1ZCAA 1P6XA 2OLKA 4IW3B 5G40A 3T1TA 4QGAA 3NBXX 4BZXA 1G5RA 4RZXA 2WWHA 4HLUC 3U6KA 2ZRJA 3CF6R 2VHTA 1YZTA 3A1WA 2IYTA 1E98A 4QNRA 2DB3A 3AEZA 4D26A 5HE9A 2J0SA 3EASA 4ON9A 521PA 1KO5A 1M7BA 4JLKA 4NYIQ 1AZTA 1XTSA 1RPZA 1F2TA 1TUIA 2JIZD 1QZXA 3D7MA 5K8LA 1UKYA 1HH4A 4DLVA 4DSUA 1T3LA 1ZUIA 1XD2A 2G0NA 3C16C 1OH6A 2O8DB 3A58B 4GRAA 5J4VA 1XMJA 4B47A 4EFNA 1RZ3A 2W6JA 4FIDA 4D4KA 1KOFA 2QQ0A 2A5JA 2EFHB 3VMFA 1Z0IA 4Q66C 2ZJ8A 3P20A 5JEDA 3KKMA 4RCZA 5DI3A 1II8B 1P2VA 2PEZA 1LFDB 4GOKA 3Q5DA 3CBQA 2QUZA 2REOA 3LLMA 4UJ3A 4NE2A 4LSGA 4F4JA 2ZI3A 4JBWA 5H68A 4FMDF 3RS4A 2IUUA 1KO1A 2ZYUX 4URZR 1X1RA 4TYPA 4RD3A 2LKCA 4DCSA 3THXB 4CZ2A 2C03A 1T9HA 3ZJYA 1G8GA 5B64A 1Z8FA 3X1DA 3F5FA 3T5GA 1GRQA 1V43A 2J1LA 2SHKA 2ZIAA 3GPLA 5AWFC 5DHFA 5L3SB 3I72A 1KGDA 2ZS8A 2A30A 4Q4HA 3J81k 2YWFA 1GWNA 3QKSB 3QVUA 1XTRA 4BRUA 5C18A 3MRSA 4URXR 1U8AA 2ZI9A 1H65A 2V9PA 2XB4A 5IHPA 1MO3A 4AKGA 4IOLA 1KI1A 4Q1DA 2XITA 3LBNA 3UPUA 3ICQB 1F5NA 1U81A 1Z2AA 8OHMA 4EKDA 1ZM2A 1VG8A 1VYUA 2D2EA 3I1FA 3AV0B 3IEUA 1D8TA 4LHXA 2V1UA 3QF4B 3U5ZB 1G19A 2CNWA 1GKYA 2AR7A 2RKOA 1GL9B 5HE8A 2PJRA 2O8CA 3KTAB 4HI0E 1XWIA 2ZJ2A 1Q0UA 1Z47A 2FFHA 1MOZA 1E9AA 3AP3A 4M1MA 4G01B 4TMWA 3ONWA 1Q21A 5JLJA 1G7CA 1X8LA 4FCWA 4A0RA 2YNMA 4UXJA 4C7OA 1RVDA 1G18A 1VDZA 1VHLA 2WKRA 1NRJB 5AUNB 2PCJA 3HU1A 1KO8A 2B8WA 2OE2A 1GDDA 3RDPA 1GNPA 1UM8A 3W8NA 4GT1A 2IL1A 3V00A 4GP7A 4YMVA 3CNOA 3TUZC 5KHOC 1D2EA 5JEEA 5JS8A 4G1UC 1ZUHA 4P4UA 2AD1A 4LYFA 2ZRCA 1EFRD 2QMHA 2VIIA 1E79A 3W5IA 4A2PA 4V0MA 5GJWC 1OIVA 3ETLA 5BQ5A 1D9XA 1UADA 2FGJA 2H17A 3P32A 3QPWA 1E79D 1G3RA 5KYKA 1DS6A 3IO5A 2F3RA 2NGRA 2Z4SA 1FL9A 2WSMA 2JLRA 5KO2A 3HU3A 1G4AE 1JPNA 1XCMA 1L4YA 3PR1A 5KOYA 5FPTA 4J0QA 4IOKA 3RS0A 3LNCA 3JVVA 2BEJA 4H1UA 4PQRA 3THYA 2W6IA 3ZH9B 4YC7A 1LF0A 1HE1C 2TMKA 2IYQA 2ZR9A 2IK8A 4ZIRA 1KI6A 1YR8A 1LTQA 1TPZA 3AP1A 2D3WA 3CONA 3I61A 1M2OB 1FP6A 4KU4A 2IEYA 5CM9C 4B3FX 2VP2A 2JJ8A 2H57A 5JJIA 4ZIRB 1DG3A 1R6BX 3K0AB 5H1YA 5F3WB 1RFLA 3B2EA 3VKWA 4DRZA 1KI9A 1AS2A 2QROA 3DKPA 4PQFA 1HA3A 4IXNA 4OK6A 1F3OA 2REBA 2V6JA 4PANA 1XFAA 3EWAA 3SBDA 2F1HA 4IRUB 2GILA 5L3RA 2ZR0A 2W6JD 3A4NA 3U61B 4FWIB 4LV6A 3KKPA 2V7QA 2BC9A 3L43A 3GEEA 3QG1A 2ERXA 2PLRA 3KXKA 3GJ6A 3RNLA 1RKBA 4FI3C 3EIHA 3U2QA 1NVWQ 3BE4A 5DH9A 4EPWA 3IDQA 3JZAA 4QG7A 1AM4D 3MG9A 4NYIR 2QAGB 3CUEF 3SS8A 4AURA 3UKDA 4L16A 2CCGA 2FN4A 4DEYA 2ZI6A 5SZHB 1BIFA 4DEXA 3O8DA 3MJHA 4QGHA 4BLRA 4MYTA 1TEVA 4WIAA 1CJVC 4QM7A 3JVUA 4LZZA 1KNQA 2WKPA 1S3GA 1YU9A 2RMKA 2I1VB 3IHLA 4R7ZA 2G77B 1EWQA 1OFUX 2ZS9A 2G83A 1F60A 4M53A 3CRVA 5C46F 3OHMA 3CWZA 1E99A 2KWIA 4DB4A 1T3SA 1R0YA 1QG2A 1FNMA 2KSQA 3ECCA 2VF7A 5DNYB 1G8HA 3FMIA 1W48A 3R7WA 3DMNA 1E32A 3EXAA 4KHZA 1ZD8A 1JEDA 4D0LB 2Y8EA 4KJZA 1KO7A 5HKKD 4IEEA 2J59A 2WSSA 1Q57A 2ZE5A 2ZSDA 2PH1A 2QSZA 2ATVA 3GLHA 4ASUA 3ADBA 3KQUA 2IUTA 2GRJA 2FH5B 3O47A 2FGKA 1KKMA 2FNAA 4I1SA 2OEPA 2YWGA 1WDTA 5DHAA 3EA5A 3TJZA 1GTVA 2WJGA 4BFUA 5IK2A 3QEJA 4MUBA 2FSIA 3K9NA 3I3SR 4MGKR 4M22A 1G3UA 5L3SA 3RS2A 3QVVA 3VU9A 5TV2A 3QSYA 3AVYA 2DFLA 2GJSA 2WJIA 3VR6A 4M1SA 4ZDWA 4M9SA 2ZRKA 1W0KD 5E7IA 4XD7A 3C8UA 3EW9A 2NTYC 1FX0A 3MJRA 2QMOA 1SKQA 5KNBA 2R6GA 4KVGA 5CIWA 1NI3A 1ZUNB 5KNCA 1Q20A 2J0QA 1XEXB 4RSGA 2NO0A 4A0FA 4LJ9A 2X2EA 4RCYA 1T91A 1M7HA 2HLDA 4OQNA 1ESMA 3TVDA 3KB1A 5B2ZA 1SVMA 2XSZD 3CRW1 4I4LA 2WTUA 5DI3B 4E09A 1L2TA 3I5YA 3NC1C 4N1AA 4NYJR 4E5UA 4BPBA 1IXZA 2WV9A 1X8JA 1XMIA 1BYIA 2P0EA 5D3MA 1VG0B 3O8RA 1DAHA 4IXMA 1DPFA 1EK0A 1M7GA 4KYIB 4Q5IA 5BYJA 3RS3A 1UBEA 4FWTA 2A3RA 2VHJA 3G0HA 2GZDA 3UWOA 1YZGA 1FUUA 2IBMA 1JPJA 4GPTA 1NKSA 5JRZA 3MMPA 3A1VA 3DPUA 1T8TA 4DDWA 1N6RA 3NKVA 2VF8A 3AF3A 4PPFA 5HR5A 4CRWB 3NBYC 3GJXC 1E9DA 1YRBA 3K70B 4MYUA 1BMFA 1ZC3A 2WSSD 2NG1A 1KMHB 1SGWA 3DDCA 2ZITA 4EFLA 5JSZB 2GJ9A 1TEXA 3TKLA 1ZIPA 3QE0A 1IN5A 4EFMA 4MRPA 3B1YA 2J5XA 3LO5A 1H8HA 3D31A 3Q9LA 1AN0A 1J8YF 1KI7A 3I4LA 1II0A 4KFSA 2MSDB 1JJVA 4W9MC 2IXFA 3NC0C 5A4JA 1DE0A 3HU2A 3GLGE 3TSOA 4DCTA 3R9XA 3RC3A 4PR0A 1OHHA 2ORIA 1L4UA 5C1BA 1AIPA 1S8FA 3OIWA 4A9AA 4B33A 3TSZA 3BAFA 2WPDD 3A1TA 2IS4A 1DADA 2GXUA 4ZI2A 2WVJA 5JJLA 2OAQ1 2ZQ5A 2BBWA 4PPNA 1N5LA 3GJ8A 4KBFA 3P1JA 4WBSA 3VNVA 3KDSE 3MWLA 4KI0A 3NDPA 3P4XA 3SYKA 2ZJ5A 2JLZA 3WNDA 1CP2A 1JR3A 1OXXK 4DCNA 2IS6A 2BJWA 1HE8B 3RS7A 1CS4C 1QHSA 4AWXA 4GOJA 5FR1A 2AKAB 3IEVA 1P3JA 3RVBA 1CR4A 4D81A 1X1SA 3JZMA 2WMOB 1HYQA 3F0TA 4EPTA 1GITA 4HZUA 4C0AC 1C1YA 4NYMR 1VCNA 3EZFA 3X1ZA 2OBLA 2CXXA 4NDZA 2MMCA 5DSZA 4AG6A 1EWRA 4NU0A 1TQ2A 2RGBA 4OHWA 2GK6A 1KZ7B 1VHTA 3B1VA 5FTLA 2ZYTX 4IVQA 5JHGB 1Z5ZA 3SQWA 4PZYA 2IW3A 3RWOA 4Q4AA 5JRJA 1SVLA 1OXUA 4DDUA 1S3SA 2A5FA 1J70A 1TAGA 3BB1A 3IPYA 5EXPA 2YOFA 1XXHA 1Z83A 3D8BA 2WWXA 1LF5A 2CDNA 2VHQA 1NBME 4DJTA 2IYSA 4QHSA 3T35A 5BN5A 2V54A 4KFUA 3KXLA 5KSOA 3QXSA 5EP4A 2EVWX 3IKJA 5JI2E 1EFTA 3KFVA 2HXSA 4AYXA 1GM5A 2Q0HA 3PUWA 3AVUA 2GCOA 4F4IA 2QM8A 3TW4A 1LS1A 2QTFA 2R65A 5IF9A 4PFSA 4X8OA 3R9IA 2GCNA 1N25A 3HR8A 4L9WA 1Q3HA 2OXCA 1F48A 4LBVA 4PO8A 1P2UA 3U3MA 4BFSA 3V4RA 2VYFA 1LW7A 2GZHA 4LHWA 3SYLA 2AK3A 2QPOA 3K70C 1R5BA 3WNCA 1G41A 3ZLJA 2WWWA 1CR1A 2XXAA 4B35A 2ATXA 1DELA 4HAZA 1KAGA 4HB3A 2QORA 1YRAA 1E0AA 4F38A 2FF7A 1G3MA 2EFGA 2KBFA 2ODBA 3QKRA 3QNUA 4BFTA 3QPUA 2G1JA 1TQ6A 1KMHA 2XJ9A 4BEBA 4PPGA 1XX6A 1PZNA 3LBHA 3TK1A 3U7HB 3KL4A 1U0HC 1F2UB 4JJKA 3OAAA 2WJJA 1OT3A 2CE2X 2E9SA 3NWJA 1P9RA 4QXAA 3PEVA 2PT5A 3WMGA 4PSAA 1CLUA 4B71A 4Q7KA 4ILEA 5SZJA 3K70D 1A1VA 2JLXA 4LJ8A 2HT1A 1E4YA 3Q7PA 4YONB 1S4QA 5JMTA 2AX4A 3IBYA 4NHOA 1FTNA 1YJ5A 3FHOA 4OJQA 5DI9A 1E4VA 5CB6A 2C78A 2FV8A 1S1MA 1W5SA 3THWA 4DSOA 4C4PA 3TH5A 5BN3A 2J7PA 3B7GA 1SULA 3IIMA 1IN4A 3C15C 4O0MA 2XNDA 2PMDA 3G82C 1EG7A 2VRWA 4HLUA 4RD1A 2WWIA 1XEXA 1NP6A 1NN3A 3AKCA 4CW7A 1LB1B 4B3XA 4NONA 2F3TA 3QI2A 3MUFA 3CPJB 1HT1E 4ZI3A 4II7A 1FX0B 3CRMA 4GP6A 2LCFA 1G7SA 4NPHA 4A2QA 4MH0R 4XTCS 2FZ4A 1RC8A 4PHTA 4M1OA 4EQ6B 1QVAA 4C9BA 4HUQB 1AS0A 1I2MA 1KO4A 3C14C 4LYAA 5CYPA 3RWMB 2ZETA 3HJNA 3EX7C 1BH2A 4MGYR 5CM8B 2ZPTX 2VO1A 2F55A 4KLNA 1TF5A 3F3YA 3I5XA 4QOSA 2CLDX 1GFIA 4M1TA 1MO5A 4DT1A 3PVSA 1IJFA 4KYUA 5DIFA 4G5GA 2Q3FA 4RKFA 2BCGY 3DO6A 5E3HA 2BM0A 2IC5A 3BD9A 4CEHB 1E94E 4JS0A 1FOEB 1WBBA 1ZD9A 4GNKA 2QZ4A 3AP2A 4HB0A 2ZUBA 4LY6A 4UQOA 3CF2A 4WXRA 4WZ6A 5EXSA 4ESVA 5H8WA 4URUR 3T15A 4JLOA 3L0OA 1ZM7A 4TT3A 5UKDA 4C0SA 4EJSB 5JI3E 1O3YA 3F8TA 4ZDIA 1ZBDA 3HR7A 3RSOA 2QTHA 2WWYA 3S1AB 2ORWA 4TN1A 3TLXA 3PUYA 1U9IA 1Z3IX 3B9QA 1GVNB 2WZQA 3WY9A 1NVXQ 1ZU4A 3FMOB 4AKEA 1TF7A 2ZRNA 1XEWY 4OYHA 4ESHA 2WAYA 2BIFA 4HSEA 3B85A 4EQ6A 1U94A 3WHLA 4N0DA 2F6RA 3E70C 4TMZA 2RH5A 1OYWA 1B0UA 2OCAA 2QAGA 2ZR7A 4JT4A 4TLBA 5FPYA 2QG6A 1JJ7A 3N2IA 3TNFA 4JLJA 1CKEA 1G3IA 4W5HA 3DM9B 2GXSA 4Q21A 4Q19A 3DHWC 5L3QB 4OI4A 4TQUS 3KTAA 4WOPA 3K0CC 3TSWA 4A0GA 5KTYA 3PEYA 1E9CA 2C9OA 1UPTA 2B92A 4GSYA 4QM6A 1DO2A 3RS5A 1UKEA 1KJYA 2DBYA 1YZLA 1R8SA 2XZPA 4PC1A 1U2RA 3FGNA 5KDLA 3T1VA 1XJ0A 3W6OA 4WZBE 5CYOA 1ODFA 3A1SA 1E9BA 1G6OA 3K0AA 1WMSA 5FUXA 3UATA 2OLJA 3B1ZA 3T1OA 1IBRA 1WA5A 4YMUA 2PJZA 5JZVA 4JLDA 4JSYA 3Q7QA 3LQRA 4TL8A 2QE7A 4I99A 2O8FA 5FPHA 1Z22A 5ANRB 5C4GB 2DWPA 1EFRA 1GRRA 1QDEA 1T6NA 2ZS7A 4P4TA 3CM0A 1PJRA 421PA 3U7EB 4JVLA 2GWHA 2V6IA 1W47A 2BMDA 1YZQA 4LJ7A 2ZJYA 3CR7A 3AVPA 1G5PA 5E4FA 3TRFA 3WHKA 1Q1QA 4GMXA 1SKYE 2AXNA 2D7CA 3L0SA 2CHGA 2P65A 3DM5A 5B58C 5DN6D 1CEEA 1E9RA 1OF1A 3A1UA 2GETA 4Q00A 3REGA 1D6JA 1IY0A 1OH7A 1P61B 3FKQA 3AKYA 3WXMA 2D06A 1I4TD 1KIMA 2FWRA 3ZZ0A 2QT1A 1KMQA 3IPXA 3TAHA 1NN1A 3LH5A 3GCGA 2FEOA 2ZRGA 3C7KA 3U7FB 2GCOB 1VCMA 3FWYA 4JSTA 5EE0A 5EP1A 1S9DA 2AXPA 4Z51A 4D25A 3QKUA 1UDWA 1JALA 4IJMA 5AK0A 2EYUA 4A6XA 1NVVQ 3NTUA 2G0TA 1EESA 4QRHA 2O8DA 1NLZA 4XWKA 3BB3A 5KPJA 3U60B 3IHWA 1E9FA 2OCYC 1E1QD 3KUDA 4YLGA 4Q1FA 4V03A 3SR0A 4DSTA 1RJ9B 2FE4A 2Q6TA 4HDOB 3EWSA 5J4YA 1Z6YA 2VQSA 4BUJA 2VP5A 4PSKA 1T0HB 4TQAA 2RGGA 3RSLA 4LI0A 2HXYA 4TZ0A 1E2HA 4TMTA 2AK2A 4V0KA 4AK9A 2A2ZA 2XSZA 1MH1A 2IEZA 2QEQA 1DOAA 1W2HA 3CH5A 3WMEA 1ZYUA 1X8KA 4LJ6A 2YOGA 2JATA 5B57C 3VHLB 4QGFA 4C2UA 5FUYA 1R7RA 2ZROA 4G5QA 4NCHA 4TSFD 1OHHD 1Z08A 4GOXA 2UKDA 4LYJA 2ZM5A 4V02A 1QHIA 3VQTA 1E0SA 3QKSA 4WXPA 2P3SA 5D3QA 3QENA 1YZUA 4QGGA 4NL4H 3X1XA 2BBOA 1G21E 4P33A 2QI9C 5FBQB 5J4KA 5C4MA 2HT6A 1UEIA 2WHXA 1R2QA 3H84A 4JLNA 1OXSC 5DYGA 4CIDA 4EPYA 3TGPA 4QBHA 2QT0A 4B2IA 4AKHA 2VHCA 4IDHA 3W9YA 3ND8A 1DEKA 3K0FB 2CE7A 2ZRDA 4D4MA 2JLYA 4C0KA 4B73A 3U4QB 3QXHA 3THXA 3SNHA 3HWSA 3KX2A 1CR2A 1N6NA 1IY1A 2CCKA 3AVWA 2C98A 4YMSA 3T34A 4RVCA 2UZ3A 2YJTD 2RGEA 3C41J 1A82A 3R20A 4MRVA 2FFAA 2GDJA 4JBXA 4TTQA 2PT7A 2WOJA 2QN6A 4B48A 1II8A 5LB2A 2PX0A 4BLTA 1J8MF 1LV7A 1S9HA 2QTVB 2ZAMA 3K0FA 3CX7A 4JVMA 4PO9A 4V0OA 2IX3A 3VHXA 4MDFA 2J0UA 1JI0A 1OPXA 1VIYA 1UKZA 4MRSA 4WA7A 4RFSB 2AWOA 3ADDA 4MKGA 3ADCA 3TE6A 3IIJA 3K1JA 5C2JB 1M74A 5D3MB 1CJMA 2DWQA 1TU4A 5CK4A 1EX7A 5KSZA 1R0XA 1E2MA 1IN8A 1W46A 2FA9A 1R8QA 1NIPA 5BN4A 3BB4A 3I32A 3QG5A 4NCIA 4WAUA 3KFXA 1PVOA 3GJ0A 1KTVA 3HPRA 3KZ1E 1N5KA 2G6BA 2FMXA 4M21A 2YOHA 4JZKA 1E0JA 1S0UA 4ARZA 4A1FA 2B8TA 3CPHA 3TUIC 3CX8A 4Q9LA 5J4HA 4HDCA 3SJZA 1U0LA 2D74A 1TUEA 4M4SA 1MO6A 3BH6A 1GG2A 2CHVA 4P32A 2XJ4A 2OM2A 2R44A 2XOKD 4BFXA 2JCSA 3VU9B 1KJWA 2VEDA 4GZLA 1VMAA 4HLDA 1WBDA 4UNRA 4WZAE 2P6UA 1A2BA 5HKKA 4V0NA 1XNJA 2A7QA 1DTSA 2GKSA 1Z07A 4LC1A 5DE3A 1SXJB 1XF9A 4DZZA 2ZXUA 5HCIA 2CVFA 3SE0A 4N0EA 1AA9A 1NY5A 4RD6A 4UXHA 3WRYC 3K0EA 3L2OB 5IDVA 5FOVA 2REXB 2R6FA 3VTKA 1E0KA 4TLCA 1CJUC 1FPMA 1T8UA 1ZM4A 4IKEA 4W7SA 2IYXA 4DLXA 3FYHA 2QMEA 3H4MA 1AGPA 2BMEA 5J5CA 4C0BA 1OIXA 2OFOA 1NN0A 1V5WA 2XNDD 4C0QC 3UIEA 3AUYA 4XD7D 4TYWA 4K46A 2D4HA 2ZJBA 1BS1A 1R0WA 2ZI4A 4F93B 3VR1A 1OV4A 3GFOA 3RAPR 3LXXA 3K9HA 4D82A 2VP6A 4HAXA 3EC1A 4JLPA 1MKYA 3QEOA 4P0TA 4DC9A 5FH9A 4PC3A 2ZRPA 3QPVA 4US1R 2ANCA 2JJ1D 3CH4B 3M1IA 4Q02A 4BZQA 2D7DA 2MSCB 2O8FB 4OKSA 1MABA 2O0KA 2RGCA 4R98A 1UFQA 3LX8A 1G4UR 2DFKB 4MA4A 2F1IA 2V7QD 4M9QA 3HDTA 3MWYW 4DLYA 5F9HA 4HZIA 1J7KA 2NIPA 3ASZA 4G5RA 4US2R 3IQXA 1XEWX 3SN6A 1OW3B 1QF9A 4DVGA 4H9GA 5EXTA 2RGNA 1WCV1 4U5XA 4HAYA 1T5LA 4P3YA 5HTKA 5FTJA 3CB4A 2GJAA 2ZE8A 4A8JB 2EYQA 1KK0A 2KI5A 3LX5A 3CZQA 1AKEA 1VKJA 3NDBB 2CL6X 1NMYA 2JLUA 1N5JA 1IXRC 1KK3A 2YVUA 2HJVA 1VIAA 2QP3A 3LW8A 3BWDD 2GBLC 4JL8A 5IRCD 5FBRB 4NYJQ 3QUSA 1DAEA 4LGMA 1ZCBA 4NMMA 2YC4C 4GZMA 3W5JA 3ZVNA 1TX4B 3BXZA 4D0GA 1K6MA 1XXHE 1Z06A 1ETUA 1P62B 1Z6GA 3BIFA 4DUGA 5AJWA 1YZKA 1P72A 3CNNA 5BWMA 2FSGA 2BKUA 3U3JA 4Z1MD 3W6NA 2CL7X 1E1RD 2YYZA 3TQFA 4JT2A 1ZINA 1R5NA 2W2XA 2WBLC 4IDQA 4PSVA 4DSNA 3NEYA 2WJVA 4TTRA 1HEIA 1Q1ZA 3U6BA 2IYUA 2AWNA 1J99A 5H70A 4R2HA 4K8OA 2L0XA 3FMFA 1N6PA 4KVAA 4RD2A 5TB5A 2W00A 1XMSA 2KE5A 2FJUA 3AGQA 4UJ5A 1TL7C 4OJKA 2OESA 2OZEA 2CEAA 3RRNA 5G3ZA 3QXXA 1XJCA 3NH9A 1BO6A 3UG6A 3FMPB 4PHHA 4OI2A 5TVKA 4EDHA 5E7MA 1GSIA 3T5DA 1EFCA 1JR3D 3KKOA 5KSPA 4DHEA 1OKKA 1JNYA 3AF2A 1P9NA 2GJ8A 3AF1A 4JL6A 4A36A 1EFHA 4O25A 1P5ZB 1X6VA 2P2LA 3LY5A 2QE7D 4H1VA 4HUQA 1KNXA 3SEAA 4M9XA 1YR6A 3ZQ6A 5LD2C 3ZZTA 1AS3A 3U7GA 2PZEA 5KSYA 4CEJA 2CLCX 1N6OA 3OE7A 2ZYWX 4PO1A 1NLFA 1XZPA 1RE0A 3WYAA 4URWR 1HQYE 4HLQB 3OE7D 3GLGB 4M0LA 3PV0A 1JQJC 1CRPA 3RABA 3AH8A 2HJGA 3L8YA 3GJ4A 4YDSA 2ZU6A 3N70A 4B6FA 3DEFA 5CLQA 3V4FA 4A0HA 1XU4A 5EE9A 2NQ2C 4CEHA 4BLQA 4KFRA 2GVDC 3BC1A 3LWNA 1E2KA 4DT1B 1OXVA 1H8HD 2F1RA 2ZREA 4ZDJA 3O8CA 1XBTA 2C2HA 3W6PA 3OESA 4CDGA 3VKGA 1ZP6A 4AC9A 1OSNA 3VR4A 2JDIA 5EUQB 2I1QA 1XD9A 2ZE6A 2P6RA 3EG5A 1W0KA 1KY3A 1KI3A 1G16A 5G41A 5FOUA 1NVUQ 2JEOA 2ONKA 4OI0A 1W49A 3IQWA 1BKDR 3LW7A 4IOJA 4G5OA 1OJLA 5FOTA 4HDQB 1E1RA 3ZYCA 4BLPA 1JB1A 4QBGB 2JJ1A 3KQNA 2H8KA 5F9FA 3X1YA 2FSFA 2H16A 4GDFA 5FOXA 2J45A 1NMZA 1Z6AA 4C0JA 3L82B 2QGZA 2VLIA 3GLFB 3U3OA 3UK6A 3THOA 1Z63A 2GNOA 1HUQA 5SZIA 4JLMA 2C99A 3TR0A 2J9RA 2W58A 2A5YB 4OHXA 1IN7A 3ASYA 4HB4A 4IHQA 5FL3A 3TR5A 2W0MA 2NPFA 3A8TA 3UXMA 3ZZUA 2OFWA 4DKXA 3ZQJA 1IM2A 4JVNA 5JWOA 3MWKA 1PUIA 4LDJA 3EZ6A 2ZRLA 4QFMA 2JJ2D 3M0EA 1IN6A 4D2IA 1I4LD 2VP0A 4B75A 3LVQE 3A37A 1COWA 2Q9CA 1KDOA 3IBGA 1EGAA 1YKSA 1ZD1A 4RZUA 3SI7A 1UAAA 1EXMA 3W3ZB 4KO8A 2RHDA 4LYHA 3V9PA 3WMFA 1MR3F 3VKHA 2VPPA 1GOTA 1UKVY 3LBIA 3B78A 4RD0A 3NEJA 2KBEA 2HDNB 4FCVA 1XPUA 4NP6A 4PTLA 1E2NA 4U00A 1QHYA 1SQ5A 3UG7A 3ZGXA 2IHYA 2IYYA 4ABYA 4BGDA 2ZI7A 1W0JA 2XXAB 1IOZA 1ZMXA 3C5HA 3L8ZA 4YMWA 3CIOA 3E1SA 2R8RA 4D6PA 4TSFA 1VECA 2WAXA 3CF0A 4ZPXA 3BBPA 4BASA 2WWFA 2AN9A 1MV5A 4NBSA 1FNNA 4PQYA 3ZVRA 2HF8A 1MT0A 1KDRA 4OI1A 2O5VA 5P21A 1JR6A 2G9NA 5DGXA 1SVOA 3OEHA 1ZM9A 4RZ3A 4UXIA 4Q47A 1CTQA 4NH0A 1UBGA 2JDID 3TIFA 5FFMA 2RGAA 2C96A 5BW8A 1AJEA 4QKQA 5M04A 2W83A 3Q5EA 3EPHA 4C3ZA 1JEEA 3K0CA 4KLZA 3CWQA 5JJKA 2PBRA 1O87A 3NHAA 1YQTA 3CZPA 2NO1A 3SHWA 4XWOA 4Q4AB 4TT3D 3WYFA 4Q1EA 1SVSA 5DYIA 2OILA 1E2EA 2GESA 1ZNZA 2C5LA 4MRRA 3PUXA 2RGNC 1OIWA 4B3DA 2PZGA 3BOSA 3LRPA 4B2PA 3ZD6A 3FHTA 2IYRA 2VSFA 121PA 3QY0A 4CEIA 4MUAA 2ZUDA 2DY1A 4HZUB 1YE8A 1NSTA 1ZJ6A 3EAQA 2ORVA 1XTKA 3ZIAA 4JL5A 4POAA 1ZAKA 3QQ5A 3DKVA 1S96A 4XVQA 1XZQA 2XEXA 1G8YA 1G20E 5EE3A 3P26A 5AR1A 1RYHA 1U9IC 2OSBA 1E2LA 3Q72A 3W90A 4L8GA 4G3XA 3NVAA 4DLUA 721PA 2YINC 2OCBA 3SDZA 3SOPA 3VR5A 4NTZA 4WW0A 1OFIA 4Q1CA 1HT2E 5AJVB 1AZSC 3BGWA 3K53A 4Q4LA 1UF9A 4OK3A 4PAQA 4BWYA 1GIAA 2GEUA 2WJYA 5JCPA 2A5GA 1GRNA 1IONA 1N2CE 3MSXA 2XGJA 4LJYA 5EJEA 5GADl 4JKYA 3SJCA 4XWAA 4F7WA 4LOAA 4Q18A 2EFEB 1CXZA 1ZRHA 3PITA 2EFCB 1X86B 3RRMA 1LS6A 2EWWA 1S2MA 3EZ2A 4DIDA 1W36B 4CEIB 2IA5A 1Z28A 3SC3A 1HTWA 1SVKA 5JCZA 4PHGA 1HV8A 1U0JA 1X3SA 5AJYA 1QVRA 3A6PC 2AFHE 4BFZA 4LX0A 3U44A 4XVRA 4QNMA 4E22A 5F98A 1LNZA 4L9SA 4PX9A 5L8VA 2QAJA 1JXOA 1CJKC 2J41A 4D4JA 3U4QA 2GF0A 2IYLD 4NKRA 1CRQA 3Q85A 1N6KA 2QP4A 1GNRA 5TXGA 4Y0AA 1FW6A 5CJPA 2N1BA 1P4SA 4MKFA 4OL0A 5E7JA 4OHVA 1WQ1R 3I73A 1CULC 1W2GA 3DOEA 4IVRA 4Q1BA 4HYYA 3LQQA 2VP9A 4OQMA 4LWZA 2CK3A 3ZD7A 1ELOA 2HV8A 4TMKA 3SQXA 4OBEA 1AKYA 2YZ2A 3TMKA 1DAGA 4R9UC 1RW4A 1H8ED 2KB0A 5EP3A 3GQBA 2ZSBA 1U8YA 1UBCA 3WNBA 3PQCA 4L5BA 3AVTA 5K8IA 1TQ4A 1NF3A 2AFIE 3BH0A 4ZO4A 5JECA 1KSHA 3OF5A 3CW2A 1OYYA 4UNQA 2FPKA 1M34E 3KKNA 5F2EA 4HLCA 5FBWB 1PLLA 2P5TB 5AUOB 4P31A 2NO7A 3ICEA 1E2DA 1FTSA 2ZVQX 1XCGB 3MAAC 3C4JA 4B3GA 4AIIA 3FHCB 3QBTA 3BERA 4LHZA 2CL0X 1T3HA 2EFDB 3B1WA 3CPEA 2K5UA 3CX6A 2KJQA 3UMSA 1XTJA 5K8UA 2A9KA 5SZKB 3BS4A 4YXWA 2VP4A 3AVQA 2ODEA 3MLEA 5DISB 2NPIA 4AYTA 3R9WA 5FTMA 5L3VA 1NBMA 2A5DA 4Q9JA 4A15A 3GLHB 1UDXA 5LDDC 1G291 4I1VA 221PA 2FU5C 2GVZC 3WP1B 1KAOA 2F43B 2Q21A 3GEHA 1NBMD 1P73A 4LBWA 4XSHA 2GK7A 2O8EA 4QJ5A 3W3AA 2XTNA 2XOKA 2RAPA 5KDDA 1WB9A 2CLSA 5G3YA 3RHFA 4LBYA 5FUWA 5K8TA 2RGXA 4G5SA 1FMJA 2HCBA 3MWJA 1YR9A 4S35A 2X19A 1CF4A 5JWHA 2QY9A 4IEIA 3QKTA 2XZOA 2GBLA 4U7DA 1VCIA 1E96A 3WRXC 2F1JA 2R2AA 1PV4A 4FMBB 3FTQA 1JR3E 3MCAA 2ERYA 2WKQA 3LV8A 3OEEA 2VHUA 1I2DA 2EW1A 5E95A 4TYYA 1KI6B 2J87A 1N0WA 1VPLA 3WP0A 1AGRA 2JIZA 3SJBA 3LFUA 2ODWA 5FBLB 3KQKA 3BFXA 3CRRA 5LBIA 1KYIA 1Z0FA 2QGNA 4TYQA 4MQBA 3QF7A 1D9ZA 4TL6A 1HURA 2W2TA 2NOAA 2ZJZA 4A8JA 3C5CA 3GLGA 3AGPA 2QPAA 2FPLA 3EIEA 4E03A 3AKEA 4AKIA 1GKUB 4A92A 5L3QA 1UBFA 2Q3MA 2G3YA 4FD2A 3TVTA 1N0UA 2R6CA 4Q7JB 3FB4A 1VCOA 5FPSA 1Z6TA 1QHHA 5FOSA 3ZVLA 2G88A 1E3MA 4LUCA 5FUVA 2CCJA 2B6HA 3FKSA 4NCNA 2BCJQ 4TZ6A 2YWHA 1IY2A 4QHYA 1Z2CA 1U90A 3FKSD 3SFVA 2P6NA 1NG9A 3TW8B 4O2LA 5AJXA 4LV5B 1DAIA 1GP2A 3L0IB 1L8QA 2LWIA 3FVQA 3VR2A 4ACAA 2IT1A 2UZIR 3PIRA 3MGCA 3THYB 1TNDA 4EJSA 2HEIA 1IXSB 2RHMA 2ZJOA 4Q03A 4FMDB 2Z83A 3D6TB 2ZRMA 5FI0B 1FZQA 1C9KA 3QIAA 4LBZA 4NZYA 3L0PA 3KQLA 4OK5A 5AUQA 2F43A 1N3BA 3CKLA 1A2KC 1E2PA 1Z0DA 4Q48A 4BEJA 1R4AA 1MO4A 3VR3A 2HF9A 1PUJA 4DXAA 3B13B 3TQCA 4FCTA 2XB2A 4CGZA 2IWRA 2B7BA 4KSBA 2IYVA 3K9LA 2CMKA 1TU3A 2FSHA 3SBEA 3VX3A 2ZSFA 1QHNA 2J3EA 4FN5A 5KPDA 1T4GA 1U8ZA 2OBMA 4TLAA 1WE2A 4Z8XA 1Z0KA 2P5SA 4Q4HB 3NIBA 4JLBA 2J7PD 4PAOA 2IHBA 4X8LA 3IIKA 4ITRC 5CB8A 4QHTA 5HZHA 4C0LA 2MMGA 1QHHB 3A4MA 1SVWA 2CNWD 2GF9A 4IVPA 4PC2A 3OFND 1SXJC 4S2EA 5EZ6B 4DWJA 2H1LA 2V55B 4TYNA 1WP9A 3KKQA 5J4LA 4MITA 1IJEA 4OQLA 4ARZB 5CLLA 2BBTA 5KDOA 4JLAA 2BOVA 4BFVA 1II9A 4OQFA 3TAUA 2VSOA 5IT5A 1AK2A 3SZRA 3NG1A 2H92A 4RY2A 4C0HA 1W36C 3GJ5A 2H5EA 2QSYA 3GLHE 1SXJE 3K09C 4U02A 4FINA 4IDOA 4A2WA 3THWB 1OLOA 1JECA 5CDFE 5FL7D 1Z0JA 4IOMA 2Z43A 1KZGB 1KI8A 3LDAA 3PUVA 2ONJA 3FE2A 2I4IA 2C9YA 2R6DA 3M4YA 3FDIA 3K0SA 1RIFA 1IHUA 1G6HA 1Q44A 1XMVA 2GTPA 3U3KA 4HAWA 4EPVA 1KDPA 1GUAA 1RRPA 2ZRAA 5EUMA 4CVNA 2ANBA 4ZV4A 2J0UB 4Q4JB 3EPJA 2NZJA 1GILA 1OFHA 4ZCMA 2XAUA 4CT5A 2Z4RA 3HP1A 4IDPA 3Q8XB 2E1RA 5KU1A 2VSXA 1DARA 4BE7B 3GP8A 2LKDA 4JIMA 1JXMA 1W4BA 2QA5A 1KSJA 2AHOA 2O8EB 3FFBA 3QKRB 2QP9X 3T1QA 4BRWA 1XTQA 3U44B 3HPQA 1TTTA 4JBYA 5TY0A 3WBJA 5TMPA 1TF2A 3KXIA 5GVSA 3EC2A 1DG1G 2ZE7A 5CITA 1M6NA 3PXGA 2Z0MA 3SHFA 2RCNA 1YR7A 4A4DA 2VBCA 3GJ3A 3B5JA 4ZDKA 1U99A 2C04A 2Q9AA 3IO3A 4NCJA 4PXAA 4M1YA 1A4RA 2WMNB 1D2MA 4M1KA 4UNSA 2PEYA 1NNEA 1G7TA 1MRSA 1ESNA 1YZNA 2ZI5A 2D62A 2PCLA 3EZ7A 1ONBA 1XPRA 6Q21A 1NIJA 4E07A 2YC2C 4TQ9A 2X8AA 1E6CA 3NH6A 4A6PA 1F2TB 1G7RA 4F4CA 3WYGA 2NZ8A 1C4OA 1ZW6A 4XOIA 4EIWA 2QNRA 2DCUA 1G1MA 1P2SA 2QRNA 1Y3AA 1XXHB 1Z6XA 1FFHA 5LD2B 3I8XA 4RJLA 4TLEA 4HEJA 1OKKD 4KSCA 3VAAA 2IXGA 4OHZA 2HLDD 2BWJA 4PHFA 1S1CA 2FZLA 1BOFA 3H2YA 2W0SA 2PL3A 5TARA 4MDEA 5AJZA 1J2JA 1W36D 1LY1A 1M1YE 1RRFA 1NN5A 1SKYB 1EX6A 4NCKA 4OHYA 5B30A 1NJGA 3SYNA 3FOZA 3KQHA 1A5TA 4XH9B 4DB2A 2CJWA 4B43A 3RRZA 2FFBA 4C30A 1K5DA 4F91B 2WIBA 5JFGA 2DFTA 3QXCA 3R8FA 2QBYB 3LA6A 2IS1A 3X1WA 4BLOA 3BRWD 1WRBA 1HQCA 2OAP1 2OG2A 4HB2A 2ODNA 3M6AA 4HAUA 3E5HA 4MGZR 1Q1EA 4RFSA 4WVFA 1R10A 1P60A 2JLQA 4V0ME 5EQTA 1U98A 3QBVA 4Q9IA 1NKTA 1G8FA 4OQXA 2BJVA 1US8A 3N5CA 3VX4A 1Q3TA 4LC0A 1SHZA 2BHRA 1ANKA 1NLYA 3GLFE 4L15A 1N5IA 4MYHA 1NL3A 3GFTA 2OV2A 2N42A 4W5JA 1QHXA 4ASUD 2W6ID 4UNPA 1ZU5A 4B32A 5J47A 1XEFA 2CK3D 5G53C 3U3RA 4B6EA 1W4AA 3BFKA
chains in the Genus database with same CATH superfamily
4TZKA 4Z1MA 3ZHSA 1L7VC 1YHNA 4ZGGA 2A9PA 4IS2A 5C1OA 1EYZA 5DSXA 1Z29A 4LG1A 3QOWA 5DLQC 3PFNA 3F8WA 5BYBA 4XOUA 1QG4A 1GAJA 1EE9A 3ZGYA 2WW8A 4GZ5A 3M8KA 2QMUA 4I55B 2JFNA 2LUOA 3OM0A 2EW2A 4KX5A 4TWAA 1GU0A 1KE1A 2XZLA 1R64A 3OEHD 2YHUA 4GPD1 4M98A 4MR7A 3HJGA 4G0OA 1C7IA 3TB4A 3UMRA 5C7YA 1LJ8A 2Q4BA 3W5DA 1KORA 2EJBA 3I8SA 4YACA 1A4IA 2FFQA 4GZ3A 3ZG6A 2FAXA 4AO6A 2EKBA 4IDGA 2IODA 5LP6A 4I5GA 4DMUB 3WTCA 5HCNA 4NMXB 2W2VA 4YQFA 4Q34A 1BROA 1FFCA 3KFLA 4X5OA 3B9BA 2OM6A 4MS1A 1DC6A 3QWBA 4LPKA 4RVFA 4TWZA 5CU7A 3RYHB 4INPA 2ES4A 3AFGA 4XZ3A 1TW3A 3DBHA 1WXWA 2WICA 2XTJA 4JT8A 3KVNA 5TPZA 4CKBB 2P4HX 3N2GA 1PK9A 4RXUA 4IIVA 5FR2A 5IJWA 1Y63A 1P6UA 1KJNA 3KB2A 2XYHA 1SN7A 3E1KA 3PDIB 3PPXA 3QXJA 3IILA 4Q01A 4LFCB 4CKXA 5K8JB 4QTTB 3P2MA 4FYXA 4QU9A 5CJ2A 3REFA 4A8JC 3LVBA 1GSAA 4O2RA 3UAGA 3MJ4A 3KKZA 2UYGA 4R71A 1UQTA 4YDQA 2QD2A 4XXHA 2PWYA 2H4FA 3W34A 1WG8A 1FZTA 2J9FB 3KZMA 4DUGD 2ZWMA 3BXGA 1P9OA 2O2GA 2OCPA 3MNFA 3I30X 1Q22A 3KVVA 4BMZA 4J07A 5K0EA 5A0FA 1JEOA 1TYDE 2C0PA 3W77A 5CA1A 3GVPA 2GHIA 1UQUA 4KCGA 5ILQA 1V4VA 4O29A 5B7PA 4W1SA 2GSWA 1QHGA 2LPMA 4HBZA 1QBKC 1DHTA 1Y3CE 3O0DA 1VA5A 1XAGA 2XMPA 1P19A 1K8YB 4ZQEA 1W7AA 3DVLA 4FXPA 1PLJA 3H11B 3CBGA 3I4CA 4GKAA 4RD4A 2H2WA 1KAHA 3P9XA 4R81A 4U2FA 3SU8A 1SCBA 2G1KA 2EJCA 5DYYA 1RJWA 3A11A 1TKBA 4D02A 5J3JA 1IH8A 1SBHA 4MV9A 4WNCA 3I5UA 2V45A 3TTVA 1WPRA 4FMCF 4M7WA 4WFIA 4Q82A 2R6JA 2VNJA 5TS3A 3NBZC 3LI2A 2WJWA 1JU4A 2FB9A 4B3TB 3AY7A 3IUYA 2PNJA 1VHQA 3PYXA 1ZGHA 1GEGA 3O3MB 3IR7A 4NZMA 4G8JA 3V55A 3AUXA 3H5OA 1K7SN 5E9WA 2VCHA 5A4MS 3VR0A 1S3FA 4K86A 2J3LA 3TXAA 4H15A 4ZVLA 4GI3A 3UPDA 3K6RA 4S1WA 2ZTMA 5IKMA 1B1CA 4CDNA 2FWBA 2MSEB 4EW3A 1I32A 1KDTA 2CBZA 3BHNA 5A4KA 5A6VA 2QJFA 2G72A 4W8HA 1VKRA 1OMOA 2IYWA 3LUHA 5K6AC 4BXOB 3HJBA 1VP9A 4GXRA 5BMVB 1QIDA 3PE4A 4I8IA 2ZYSA 3AU9A 4D80A 1TJ5A 2E87A 1JLSA 1BD4A 1FNCA 1G5TA 2QPTA 3DZDA 1VB3A 4DQVA 4DQUA 4U6QA 3VC3A 4I2VA 5JHHB 2HD4A 1JT2A 1U1FA 2XOXA 1PL7A 4XE5A 5ALFA 5KVSA 5LQDA 1ZCJA 2H2DA 3BHJA 3OIYA 4FZRA 1COWD 1I5EA 1NAHA 1NQVA 4HHEA 3TMYA 1N5DA 4LJ5A 1T24A 1QYCA 1Y1RA 2R96A 4I1UA 4AYWA 2W2OA 4C2TA 3BWEA 5B2FA 2ZBFA 3C3KA 1F4PA 4ICIA 4G97A 1N5MA 3TIXB 3GUZA 1JW9B 2XR1A 3B8HA 3SF8A 1VXOA 2AQIA 3CNLA 3GPBA 3RK1A 4L51A 5BN3B 2QPLA 4PZZA 5D5PA 2BFWA 5E6UA 2G17A 2PKQO 3MEQA 3PCTA 4LHVA 1FP7A 5G0TA 5BR4A 1ISPA 1SWVA 4BHTA 3H6GA 3DZHA 2QX8A 4AAYA 5KTNA 4U3JB 3I9MA 4GWGA 1C4WA 1WB5A 3LXMA 3UYLA 1OH5A 3H86A 1IMOA 1KI2A 4EG5A 2OORA 3S7ZA 1N6LA 2AZ4A 2PWBA 2C84A 4OH1A 3WXBA 5KX5A 1K08A 4P86A 3KJGA 2V8OA 1VRVA 2QRHA 1FQJA 1QNFA 4M2LA 3GUCA 2PJUA 3AYZB 4DXDA 4GWLA 5GVRA 1EWVA 4IQGA 1TQ8A 2N47A 1FFGA 1TO2E 1ZH2A 4KK3A 3IBTA 1I3NA 4PLYA 5DEIA 5BUCA 2WWGA 3NHBA 4IV5A 4NFLA 3H1TA 3JQRA 4ZT6A 2J32A 4TS1A 5AM4A 5JCOC 2R8ZA 3ZE1B 5HPYB 1GPAA 3ENQA 2O2JA 4FFWA 4UTOA 3KSZO 1A9QA 3HCAA 3QPBA 4XTRA 5JC1A 3TO5A 1N9GA 1TA4A 1V9LA 2FUKA 2V7XA 2XX3A 4GOLD 1QBGA 5GJCA 3KZCA 1DO0A 4AY3A 2C4MA 1UJBA 1MPTA 4R8RA 3HFGA 2YHSA 3V7UA 4MPJA 3S28A 2BEKA 4KWEA 1VTKA 4LZNA 3U31A 5F76A 2BV3A 3ZHXA 4MYCA 4EP1A 1J24A 1NXPA 2OCGA 4IG4A 4KN8A 4P22A 2B4QA 1NW3A 2ZJ4A 2GAOA 4FR5A 4MQEB 3OOWA 4K9SA 4Y0VA 3D5EA 4QXOA 2ZJ0A 3O38A 3PENA 5ICCA 1C8VB 4HDKA 3RSQA 1WL8A 2ZSUA 3ESDA 1SMKA 1RM0A 1V3TA 2UVQA 1H2RS 1ZHOA 1M8PA 2QRQA 1GGNA 1ISGA 1VMEA 1RABA 1YUMA 1ECPA 1ZNWA 1V26A 2ZSAA 3CFYA 3QRWA 4HQOA 3ROEA 3PB3A 3ZIAD 4BJ1A 4ZZ3A 3QLVC 3FD8A 2JVKA 4NBTA 4YO8A 1XRSB 4H7EA 4RPCA 2JS7A 3KAQA 4M86A 2NYAA 2X8BA 2ZBEA 1SXGA 1YQGA 4WBXC 5C80A 5IKXA 3F5DA 2AOTB 2HQOA 4HEA1 3FFAA 3M4XA 4Y2XA 5CD1A 3CSSA 4BY9E 2JH8A 1KY4A 3D6UA 4J7AA 4Z0HO 3RGWS 3RVSA 1TU0A 1W5TA 3EARA 1SH7A 5CFPA 2F7SA 5ADVA 2B1RA 1SCDA 1PLKA 4RAOA 4RMNA 3GZNB 1N5RA 5CXSA 3NAZA 5HZKA 1HMPA 1CJBA 3HLKA 5DBGA 3SJAA 1YNSA 1E9EA 1NJFA 1HDZA 3N2KA 4MULA 1QOPB 3G2QA 1AUVA 3CG4A 3O7WA 4REQA 3KT8A 4ZO8A 5ALOA 4FYYA 4AS3A 4DCJA 3HA5A 2WM9B 2BDTA 2X8WA 4AMUA 5KJ6A 5DLEA 2VOJA 1FU8A 1U8UA 3D2LA 2AKYA 2Q4OA 2CXPA 4HWGA 3K09A 3A1FA 1NV8A 2Y1OA 3RYHA 4EYSA 2BKEA 1Q0QA 1L5HB 3I58A 2PANA 5DASA 4KC0A 2Z5VA 4IFBA 4UEOA 1E2QA 3GT3A 4Y30A 3OM1A 2Y2UA 4X7MA 4ZO7A 4UUMA 5LMZA 1MJFA 1BYUA 1FVFA 3GAFA 2AG1A 1W87A 2QVXX 2NO9A 2ZOSA 5JBIA 1P1CA 2PX5A 1CBUA 2IU0A 1P7CA 2HN9A 3D3KA 4W6QA 1NR1A 4KQXA 4DDVA 1IIBA 3N86A 4W5WA 1GQSA 2ZYIA 1SXJA 3T12A 2WOOA 2IKSA 3D8SA 3MXTA 1JQEA 4YI5A 3G59A 3VDRA 3ZQUA 5KVAA 1JFVA 5D6OA 5FI5A 3OAAD 1OBHA 2WIFA 2Q2OA 3FPAA 2ZLBA 4YDHB 4EA6A 4YJGB 1YVEI 4NG5A 5LNK6 3NHKA 3UBTA 4DV0B 3CLRC 2VHZA 3AV3A 1ZIOA 2R9VA 3N28A 5IAKA 1O96B 5JS2A 3UWKA 4UHHA 4RL4A 4LPSA 4BE9A 2ZIXA 5EXXA 4OREX 1QP7A 2GUWA 3PNBA 4LRSB 1B00A 1YV9A 4BLSA 2BZSA 4RDHA 3K4QA 3AQ4A 2NZVG 4B76A 3D3QA 3T06B 3JV7A 1JL3A 4QPDA 4MR9B 2VWQA 1CR6A 2HIGA 2BMFA 1EFPB 5EPUA 4LN1A 4EQZA 2XTZA 3T7IA 4KO3S 4GYKA 1L7PA 2D6FA 1A8HA 4YX9A 4LQLA 2GEDA 2BLNA 4XEUA 4F3KA 4Z4CA 2A78A 2P75A 3OZXA 4NABA 5IARA 3WKCA 5BSEA 4B87A 4I50A 4I1OA 3EA0A 4QJ4A 4QU5A 3Q8MA 2W6MA 2DMRA 2Y1KA 5EP2A 3L93A 1H2XA 2R8PA 2GCPA 4TLDA 2JBHA 4W7HA 1C8LA 4ZEXA 5HZGA 3IS3A 1T0JB 3Q3JB 3HDYA 4DJ5X 5I8WA 3CUKA 1DV1A 1HY3A 2BFDB 1E18A 2ZRHA 3AVXA 1PEKE 1ZMTA 4Z54A 3KXDA 2B7LA 1Z0SA 2N1MA 3AJAA 3TLGA 4B2LA 3VSCA 5HS6A 2AJ8A 3UMFA 4KQMA 3GMDA 2Q29A 2VJAA 1KTIA 3GMTA 8ATCA 1P77A 1GARA 1TVKA 3C6MA 2O23A 4G5YA 1ZFNA 4YRTA 1F20A 1ZBQA 4IGFA 1GFZA 1UAYA 3PZBA 2DYKA 4OGKA 5ECDA 2X0EA 4B3CA 1TOAA 4YLYA 4ZYXA 2P0YA 3CRNA 3GFPA 3GEIA 4EO7A 2F9MA 4GW3A 3EVCA 2H48A 2PX8A 5LXTF 3TZLA 2GPJA 3ZHYA 5KJCA 1EX1A 2QAGC 5G0WA 4G9EA 1TECE 2DQZA 4GMDA 3PHCA 1KHTA 3SYRA 1ADCA 2X0DA 3LD9A 2O8BA 1ZH6A 3KSMA 2YYYA 3HCRA 4X3PA 1MRNA 3VNRA 1MQ9A 3OZAA 5J59A 3VU8A 2HBQA 4BB5A 3MB8A 1PWEA 1V8PA 1JBKA 1X42A 1KH1A 2D2FA 2GA8A 3IA7A 5H5JA 4UAUA 1KS9A 1WUHS 4YJFA 2XA2A 3DE0X 4YRDA 1BHSA 4Y2RA 5BNWA 3E4CA 3OO0A 3PGVA 1LBEA 2NAFA 1D3AA 2Q9BA 2UUOA 4MJLA 4Q9KA 5AVJA 1V25A 3K16A 4G09A 4FKMA 2O4CA 3P4UA 1PR2A 4ZHQB 3WKDA 4N3BA 1I8TA 2B7CA 4XJXA 4DEVA 2B2NA 2H7VA 4ZTBA 5E8JA 3RUIA 3MPOA 2IIQA 4BKRA 4DN6A 1APBA 1N3LA 3N87A 3CO5A 3NBMA 3R5XA 4G4SP 5LOVF 1A27A 3PC8C 1BU8A 1NPDA 3ND9A 4PLFA 4C07A 2C8LA 1G66A 3PL5A 4M9ZA 1PV2A 2EDCA 4E0BA 2JJ2A 5AVUA 1ONOA 2CD9A 3FYCA 4OV6B 3SD7A 3CT4A 3GLVA 1KYYA 1CUZA 3IOCA 3T1TA 2OCLA 2JFQA 1CT9A 2YXNA 3D6HA 4HLUC 5IDXA 4QE3A 2BH9A 3A1WA 3ZGVA 4OHRA 4RE6A 3ZJ4A 4RA6B 3Q8KA 1E5LA 5AJUA 1I6MA 5CA0F 1U7XA 4Z2YA 4MEAA 3JVIA 3P71T 1FSPA 2I34A 3EEFA 4ZO6A 5BVGA 2NT3A 1RPZA 1F2TA 1A76A 1D0SA 4LZPA 2I9PA 1CF9A 1UKYA 2TRSB 1WU8A 2WR8A 3ITDA 1T3LA 2CXTA 4X85A 1MB2A 1XD2A 1BW9B 2G0NA 4FQ7A 4MAMA 1J1IA 5G4LA 4B7ZA 4EFNA 5J4VA 4FK8A 5A5EA 1QKIA 2FDXA 1Q7GA 1RZ3A 4MX8A 3M6IA 5TQ0A 5HHTA 1KOFA 1MENA 4HFRA 1L3BA 5JDIC 4ZT3A 3L1KA 2II6A 3PD1A 4R3WA 3TLCA 4J9UE 2J5KA 3P19A 4KN6A 4YP5A 5JEDA 3DNMA 4F4FA 1H2FA 2XRYA 3H0EA 3FPKA 4KGVA 5FLEX 2JHFA 1NOIA 5D51S 1JAZA 4Y1FA 2QUZA 2JLBA 4NE2A 1X92A 3H5AA 3UUFA 4KXLA 2ZI3A 1QFJA 1M72A 2UYYA 3CF4G 3CEHA 1I5OA 1U1CA 4WACA 1XLUA 2XNHA 5LJIA 2ZYUX 3V48A 1ZUNA 1GTMA 1X1RA 1M10A 3A1DA 4Z9YA 3H05A 3DO5A 3BMOA 2GH1A 4DCSA 2QIOA 5EQDA 1WIWA 4G0PA 2QRVB 4CZ2A 4QLBA 4K40A 3DF7A 1Z8FA 4DV4B 3F5FA 2HRDA 1GRQA 2I8LA 1SHLA 2J1LA 1YQQA 4JB0A 4R2LA 3T5GA 4DGQA 2R6R1 1X77A 1QS0B 4IDCA 5L3SB 3KSDO 1J1ZA 1RI3A 3FPFA 1UIMA 1UINA 5DHTA 1V5GA 4AZTA 2ZCVA 3HKEA 1I4EB 4YRBA 2DXIA 3HP4A 3J81k 2VPWA 1V6AA 4I1IA 3L0YA 2YWFA 3ED5A 4B7XA 3AOEA 4HQLA 4BMSA 4C20A 5C18A 4BO9A 4AO8A 1UBHS 2XB4A 2DKOA 1MO3A 3AIOA 1XR3A 2VAVA 1H5QA 3L0ZA 4MVXA 1FU4A 5FIUA 2NLOA 4RHFA 4Z4HA 4Q1DA 4UE6A 2O50A 3KDPA 3X0DA 5CX1B 3O7MA 1TK2A 1I0LA 1UWVA 1NUAA 2CSUA 4IX9A 4EKDA 1C14A 1QNLA 3V4ZA 3K1AA 5GM1A 2D2EA 3QVGA 2Q1XA 5AVVA 1OGIA 3NGLA 4O0LA 4LGYA 3AV0B 3IAFA 2V6BA 3IEUA 4PZDA 1SIOA 3ZV7A 5IAEA 2CNWA 2OV1A 5F12A 7ADHA 2PJRA 5DHQA 3KTAB 5AKLA 4UU1A 3KEQA 3N0XA 4Q7QA 3IPRA 1S3IA 2FFHA 4CM7A 2E85A 3AP3A 4MLPA 2CYCA 2CFIA 4G01B 4G4SO 4JBHA 4TMWA 1F0NA 2BPOA 2BFFB 1T2CA 2OHGA 3QV1A 1Q7TA 4D4GA 4FCWA 4YIHA 2BH2A 5C8ZA 3WYCA 2DUUA 3AWIA 2YNMA 3ESQA 5C0OE 4MV7A 4E2FA 1SM4A 1AK1A 5KWJA 2QUHA 5AUNB 3BGOS 3KPWA 4QDJA 1JLLB 2QN1A 3RCBA 1DKQA 4E14A 2H5IA 1YAHA 1CUDA 3HNPA 3RDPA 1GNPA 3JAMA 4GT1A 2IL1A 3COPA 3F7TA 1VMDA 2OAEA 1GD1O 1TAHA 4J49A 4EVRA 3AHIA 4FKZA 4YMVA 1XNHA 3VKFA 5KHOC 1F7VA 1D2EA 3COYA 5JEEA 5JS8A 3HKDA 2AFHA 2AD1A 1BVYF 2PD6A 3N07A 1EWYA 4CMAA 2VIIA 2YQ5A 3CYFA 3ONFA 4MW7A 1WZUA 1T2NA 5FO0A 2WB4A 3UO8B 2RD2A 3BL6A 2FGJA 3PJFA 2NPOA 1IPHA 3F5QA 3SZLA 3D5TA 3T7JA 1FDVA 9ATCA 2I4TA 2V0CA 2IUFA 2F3RA 2NGRA 5TJHA 1LPSA 1UP7A 3V34A 3SCZA 1N3IA 2BF4A 5D1NA 3W2IA 3HRHA 4CLDA 1F6DA 2PS0A 4IOKA 3RS0A 3ED1A 2I6TA 2NVWA 3SZMA 4PQRA 1ZVJA 2W6IA 3U81A 4YC7A 1LF0A 3ZZ1A 5DDIP 4E5NA 2WPNA 2JANA 4E5PA 4M37A 3SXPA 5JSUA 2FQXA 1GFWA 2FUG1 3P97A 1QWOA 3L04A 4PEVA 1ICIA 1YR8A 4OHUA 3PC8A 2ZYAA 3AP1A 2AJTA 2X40A 2EV9A 3CONA 5G0UA 3WGTA 2GPAA 4DV6B 1FP6A 4RF4A 2UYQA 1V11B 2IEYA 3SHQA 5KYUA 4RSRA 5KWSA 4YI3A 1M2WA 4ENUA 5JJIA 1G0NA 1LQUA 4ZIRB 1DG3A 2ADMA 4JQCA 5IJ0B 3VKWA 2CLKB 2PQ0A 4DRZA 3HP7A 3HJCA 3LCJA 4RM3A 4KG7A 2QROA 1X7ZA 2DJIA 2B98A 1QRUA 5SYNA 2QRVA 4IXNA 4WZZA 4PANA 4LY9A 1XFAA 3EXG1 2F1HA 4IF6A 4FFNA 5DXJA 4D92A 1M1NA 1P45A 2Y67A 3BWMA 3MRTA 3VVLA 3C6QA 5NLLA 3BSWA 1XO1A 2IOYA 1I7LA 1QIJA 2RARA 1MC1A 4FWIB 2JJYA 5HGJA 2BC9A 4YUYA 3VDMA 2WT8A 3ANTA 3HB9A 1UOEA 5AICA 2J31A 1ISMA 2DTEA 4KTTE 3GJ6A 4NJEB 4PNPA 5KQPA 2HAEA 3K0KA 1MAUA 3ENVA 5U9CA 1RKBA 2HJWA 5A06A 1V1RA 4JC4A 1COZA 3U2QA 5U1PA 2PA0A 4QPPA 3IDQA 1JG3A 3MIZA 1JLKA 1HYEA 5HP4A 5HKOA 4O59O 1RKUA 3CUEF 5A4IS 4AURA 1PNQA 2ATIA 2W98A 4L16A 2CCGA 3ER9A 2CKDA 3I12A 5SZHB 3RS9A 1JFRA 1SKUA 3PDWA 2IKQA 4WXHA 1M6YA 4C3OB 4EHNA 1CJVC 1V8OA 3JVUA 4LZZA 4FOTA 3ZYZA 1S3GA 4F4DA 1LQ2A 3KLMX 4EMTA 1YU9A 1EWQA 1TE2A 2G77B 1QCDA 2ZS9A 2G83A 4DMCA 5J2TB 5TSDA 1F8YA 3CRVA 3LRTA 1U0RA 2ZPUA 4LOLA 1C30A 1Z2PX 1FFAA 3SQMA 4R05A 4G0WA 3IAS6 2KWIA 2F3SA 1T3SA 2W6OA 1QG2A 1B4DA 2L17A 3AW8A 2KSQA 4QG3A 2VF7A 1XZIA 4X62B 2FJPA 3TIGA 1TW2A 3K5HA 1JTEA 4Y9DA 5F7OA 4RGQA 4GF5A 3W2EA 3RK4A 4TRJA 4BEVA 1E3EA 1DWUA 1L9XA 1PZGA 2WSSA 1Q57A 2PH1A 1AV7A 4YJDA 1E1DA 4HXYA 3GGOA 3QU7A 3IEMA 3R09A 4IXDA 3W05A 3M5DA 4F45A 2FP3A 2EATA 1NT4A 4EHIA 3O47A 5FNVF 4W4TA 1B43A 1X39A 1KKMA 2FNAA 1HOTA 1TK9A 3N76A 5TLSA 4L8LA 3TIIA 1WDTA 3DTVB 1NX9A 2BHTA 2ZT8A 3GNLA 3IEKA 3L0DA 3G1WA 1GTVA 2CXOA 3LT1A 4FCCA 3R7LA 1JHDA 5IK2A 4DRXB 2HWUA 4HYQA 1T6BY 4JT9A 4PO3X 5DWQA 4ZT2A 1N0IA 1ESEA 3I3SR 5B1HA 4MGKR 3F1KA 4PX3A 3Q6MA 2ARKA 2IPXA 4O5OA 4D3FA 2Z95A 3VU9A 1VJ0A 4RHEA 4Z4FA 1IN1A 5KTSA 4GMGA 2VYQA 2GJSA 4PRKA 3VR6A 4I66A 4OA8A 3HXPA 4M9SA 4ZDWA 5E7IA 4XD7A 5CVEA 2DTXA 3C8UA 3EW9A 4M6WB 3Q0TA 1WOYA 4F46A 4Z1OA 1BJRE 1SKQA 2XE8A 4MQLA 2R6GA 4KE9A 4KVGA 1EP1B 2QVYX 4PPYA 5I5EA 1QXSA 5KNCA 3CUVA 1U0EA 3PPYA 1VHDA 3DDZX 4G36A 5G0VA 3NHZA 5K03A 3LIPA 1DP4A 4LJ9A 2X2EA 2ZBRA 1T91A 3PF9A 5F2NA 4OQNA 5B1SA 1ESMA 2XQKA 3TVDA 3G2OA 3OOEA 4MAAA 2ZM6B 1SVMA 2XSZD 3O1IC 4X7RA 3ZBTA 4YCCA 2CXHA 3AIKA 1L2TA 4N1AA 4BPBA 1NUUA 1XMIA 3ORHA 3DZFA 2AZMA 4FLMA 3EGOA 3OX1A 4MV0A 4QARA 5ALKA 5B1DA 1XWWA 1FFYA 1MTZA 1RP7A 3RFVA 3RS3A 3WJ1A 4L5CA 5DX0A 1YZGA 2P0AA 1FUUA 2IZ5A 2OHXA 4Q3KA 1QU2A 5FKJA 1MOPA 4GPTA 4BNTA 1NKSA 2ZAIA 4PX2A 3TR6A 2NYRA 4I5DA 4XJVA 4UPEA 4DDWA 4WEQA 1N6RA 2B8EA 4MIKA 5EPOA 1HDYA 2EL9A 2QTVA 1M2NA 4O1IA 5AK6A 3VH2A 2H4YA 4EHDA 4MYUA 1BMFA 3EUAA 1AKRA 5CR9A 3WL5A 1ZH8A 5KOHA 3L8CA 2NG1A 5ERYA 1O8BA 4BO7A 4RU1A 2HO4A 2K7ZA 2ZITA 4ZJUA 3OFKA 2ZP1A 4MUXA 1FC0A 2IE0A 3U62A 4I6GA 3JAKA 3JY6A 3OT5A 1GY8A 4WNYA 1AF4A 3B1YA 4UCWA 2WM3A 3EHEA 3D31A 3KQQA 2PFGA 1J8YF 1II0A 3WO1A 3B6IA 5DCLA 1JJVA 4GPBA 2IXFA 3NC0C 5A4JA 1DTEA 2W43A 3GY0A 4DCTA 4DM3A 3R9XA 3RC3A 3L5KA 1OHHA 2Z1MA 3P2OA 4TXNA 3T3HA 5C1BA 2LDXA 1BMQA 1EWKA 2ZR8A 1XKLA 5C51B 4B33A 2AI1A 4V24A 5GQSA 3JQAA 5LJLA 1RTTA 4NH4A 2ZCJA 1U3CA 2GXUA 4ZI2A 2WVJA 3CNHA 5HMLA 4ZGWA 2OAQ1 3I2YX 5JJLA 1EM8B 4RPHA 5EJGA 3HDQA 2QX9A 4ED9A 4KBFA 3VNVA 5GONA 3MWLA 3NEPX 1GPYA 1GGJA 5KNCD 3A6HA 3E7XA 5KU7A 1PDWA 2PVCA 4R69A 1T8PA 1UDBA 4LI3X 1QQTA 2PWZA 1CP2A 1JR3A 3M81A 4HDMA 4HWPA 3RS7A 4P0PB 3O3CA 3CINA 4KDRA 4GOJA 4ZREA 4AWXA 1L5HA 1P3JA 2O1SA 4B3IA 4MVJH 1GA1A 1X1SA 2YW9A 5C1DA 2JF0A 4RDCA 1HYQA 3FLAA 4ZOLF 5DGIA 1GITA 4HZUA 2WZBA 1Y8CA 3R3SA 4M55A 3S5JA 4EI2A 1X1EA 3X1ZA 2D1TA 1XNGA 1JIJA 4V1CA 3AYXB 3ZDDA 1QU3A 4HSGA 3GMSA 1TQ2A 2RGBA 4CKCB 4K6OA 2ZYTX 3PC6A 4LQCA 4PZYA 3RWOA 4Q4AA 4F3YA 3K9FC 2DJ5A 1EP2B 1OXUA 1IUNA 1ZONA 2A5FA 2G9ZA 1J70A 4DYDA 2QVBA 1Z83A 2BTQA 3D8BA 2ONYA 2WWXA 3E9ZA 4IH4A 4XW2A 1XL1A 2VHQA 4IJUA 5DGDA 2QLLA 3QHPA 4IM7A 1L7BA 1DZIA 2RJOA 3W4KA 3DE6X 5CFOA 1TM2A 1LDMA 1H4TA 2V54A 3GFBA 4NEGA 2WE7A 2PD3A 3QXSA 2EVWX 4M49A 1NVDA 3E4DA 1BD3A 1EFTA 2A9VA 2HXSA 2QS9A 2Q0HA 3HN2A 3PUWA 3PCXA 4YPOA 5AIBA 1QG0A 3MJCA 4P34A 3TW4A 4ALLA 1LS1A 1L4LA 2R65A 3HRIA 5L45A 1L5FA 1RCUA 2DUWA 3SSNA 4EZEA 5CB4F 3IOMA 4YWJA 3C97A 5FDFA 2ZAYA 1KWKA 1H5UA 1P2UA 2H07A 3PFHA 3V8PA 4PAWA 2VYFA 1HNXB 5BURA 1SRQA 3C5VA 2QPOA 3EGCA 5FX2A 2P68A 2O5RA 3C5WP 3KZOA 3WNCA 1D8AA 4CMGA 4DIBA 4ARAA 1CR1A 5AM5A 2WTAA 4JHXA 3KR2A 1U63A 3B7WA 1U3FA 2QORA 1YRAA 2XF8A 5FD8A 4DXHA 1I2BA 1GU1A 1IHYA 3BL8A 3QNUA 4YGXB 2KMLA 4ID3A 1JS1X 1XQ1A 3CX4A 3U7HB 1UBRS 1TRKA 2GGSA 1XX6A 3LBHA 3EZXA 4PPGA 5ALTA 2UVPB 3MIIA 4BEBA 4EGJA 1U0HC 3ETDA 3OY2A 3I04A 4WKOA 1QIFA 1Z5OA 3TSYA 2ZT6A 3OAAA 5FPPA 1P9RA 2F62A 1I0ZA 3HE3A 3N9IA 3LC0A 4LA4A 4PSAA 3CC8A 3QTLA 4RZSA 4FGLA 3TNLA 4Q7KA 3D5QA 1Z5NA 4JWTA 1NJSA 2O06A 1WVMA 2CFSA 5AP9A 3AEXA 4NFSA 1ZN9A 3MOIA 4UZEA 1S4QA 4Y18A 1JHUA 3IBYA 2AG5A 2HJRA 4HGQA 4C4ZA 4IIYA 4TM7A 1Q50A 1X7WB 2Q8PA 3HNRA 1AGYA 3DPIA 4NBLA 5DI9A 2COKA 2RK6A 5EA2A 4ZYUA 1S1MA 5CB6A 1TC1A 3PC7A 1MFPA 3TI9A 1IATA 4ZK6A 3THWA 1RYZA 4DPKA 5NULA 3I3OA 4MQFA 1MO2A 4BP8A 4H60A 2A35A 3WB2A 1NONA 5BN3A 1L4HA 2J7PA 3B7GA 3IIMA 1PWHA 1JV2B 3PK0A 2XNDA 2PMDA 2AG0A 3TRHA 1O0BA 1N2JA 3L01A 1I36A 1QDLB 4HLUA 3WRWA 2C5BA 1LB1B 3HKBB 4YAWA 4G89A 2N3ZA 1H94A 3ZHOA 4GXQA 2F3TA 3KG2A 4Q37A 3RPEA 3N0TA 3QI2A 2C2MA 3Q7SA 4FE3A 2QG9A 4ZI3A 4II7A 1Y34E 1VKHA 3CRMA 3K96A 3D6JA 3R0XA 4BIIA 1C80A 2XUZA 2PUTA 3DGEC 5CAEA 1Z0UA 2BSAA 4UREA 2IW1A 4JI7B 3OTIA 3OCYA 3V7FA 3SSOA 3IIEA 3JQ8B 2ZZMA 1KO4A 4LYAA 3NZEA 3WRYA 1K1EA 4EX7A 4FBLA 4FDMA 1CHDA 3PHBE 2HPVA 1NRIA 2PX4A 3D3NA 5CM8B 5CEJA 2WYWA 4RK6A 1EJBA 3MMNA 2F55A 1K8QA 1T8YA 2RK3A 3JQAD 3F3YA 2NU7A 3AUTA 3PXAA 3G9TA 3WRXA 1K4MA 2CLDX 3F7MA 3IUMA 3JQBC 4C03A 4DT1A 1MO5A 1KEEA 3A4TA 3PVSA 4UTPA 3NO4A 1IJFA 4QUBA 2I8AA 2AZXA 5DIFA 2J9ZB 1W1UA 3TOVA 1BN6A 3OZFA 4CEHB 4JS0A 3QEAZ 2E37A 5E2AA 1FOEB 4GNKA 2QZ4A 1KRWA 3AOGA 1B15A 4LY6A 3ZE0B 2Q5EA 1W85B 3S2GA 5C7IO 1VKOA 3ZH2A 5H8WA 4M0DA 4URUR 2NZXA 3VOSA 1L4GA 5JJBA 2EFYA 2XQVA 1WV1A 5FV4A 5UKDA 1VPEA 2C4NA 2C9BA 4EJSB 2GLXA 2IPNA 1O3YA 4GAEA 1A9TA 2QRUA 1ZBDA 2V7PA 1RLTA 3BQMB 4RPLA 2PMCA 2WWTA 4I5EA 1C3JA 4FJ1A 4GOOD 2ORWA 2XIJA 3C1OA 3S1AB 5KYXA 2WWYA 1FXWA 3QA3E 3B9QA 4I8DA 5CGQB 1NVXQ 2GHTA 2LZ0A 3HCOA 2GN6A 3I39X 3HI4A 4AKEA 4Q3OA 2EQ5A 1TF7A 4OLBA 4JENA 3PUJA 3RKUA 2BIFA 3K8ZA 4BBZA 3E5MA 3B85A 3QWIA 3K72B 3UCEA 4EQ6A 1PGPA 2ROQA 3GFGA 2PTGA 1GN8A 1MZPA 4JT4A 1IMJA 2WHPA 4R3UC 4TLBA 1DMRA 4RVSA 3DMTA 3WG9A 3RTDA 3ORSA 1JEYA 2F4VB 1JXQA 1CKEA 1A9PA 4W5HA 5LA6A 2PQMA 1DL5A 4XM2A 2GXSA 3NBAA 1BQ3A 4NDNE 4Q19A 3ZWPA 4Z4QA 1ZQ9A 1ONPA 4DQDA 3OECA 3H1EA 3E9QA 5T6BA 2O20A 3FVRA 2NTEA 4GUAA 3N2GB 5KTYA 1F14A 2OCDA 2C9OA 2XD9A 2IPOA 2XB9A 3L7MA 5AKHA 4HNUA 3GPIA 2X5OA 4CLRB 2P9TA 3RBZA 1UKEA 2DBYA 1V3VA 5HSGA 3HEMA 1YZLA 1DU4A 2VK8A 3FBWA 4PC1A 4KREA 5E1OA 4WZBE 5CYOA 4J29A 1VKZA 1ODFA 2WHEA 3JPYA 2AHRA 5JVDB 5JJCA 1QPZA 1DFHA 1E9BA 3UATA 1WMSA 2G40A 2OLJA 3BZWA 1FEZA 4B4WA 4OX9B 2Y0PA 2PJZA 2FXVA 4YA6A 3S2UA 4YYEA 4IHJB 4KIUA 2AJCA 2Y0EA 4L7QA 4LXXA 1Z13A 3T3IA 2APJA 1G8MA 2Q46A 5KYUB 5LVAA 5FPHA 1Z22A 5ICFA 4DCOA 3WLSA 1Q17A 1V9CA 4BVGA 1QDEA 3A05A 1JQAA 1U3DA 3ETJA 3TNYA 4FBGA 2BFBA 1R4MB 3NUZA 1YZQA 1Y82A 4A5OA 5E4FA 2O2ZA 3TRFA 3ZPXA 1P81A 2Q1SA 3EAFA 2PYDA 3L0SA 2JW5A 5DNVA 4R16A 4Q00A 4WESA 3UV3A 4UMDA 1IY0A 1Z4QA 4CKEB 3MT7A 5H4HA 1OR8A 1W9HA 3QLEA 4HO1X 2FSVA 1KIMA 1N75A 3LC7O 3EA4A 2XGOA 5IM4F 3H2HA 2JGKA 3VNBA 3ZZ0A 1OYOA 3D0OA 1MQSA 4H4EA 3LH5A 1UWKA 4MW1A 3UWPA 4ALKA 3AR7A 3U7FB 1JXAA 4HUJA 1VCMA 3DXYA 2VBGA 4WX2B 3SEZA 3TZQA 1H9BA 4GI2A 1L7NA 4AMBA 4BX8A 4Z51A 5EE0A 5EP1A 3AR9A 4I2NA 1FJGB 3WDLA 1DIGA 1TZBA 2PYIA 2VXCA 1JALA 3R7SA 5AK0A 5EOVA 2AS0A 5FT9A 4LAFA 1NVVQ 3FUVA 4A6XA 3VH3A 3O03A 4NHEA 4MI3A 4Q15A 2V0NA 2O8DA 1JA0A 1NLZA 3CG0A 4OMCA 2G4VA 1L6RA 4U8GA 4XEHA 4NESA 1M2FA 3IHWA 3OQIA 5EZQA 4Q3EA 3BULA 2BFEA 3FKJA 1E89A 2Q6VA 4J3FA 4DSTA 4MRMB 4CLOB 3TZEA 2XVXA 5AQEA 2XUAA 2CJXA 2CWWA 4JJ8A 3COWA 2FEPA 4RA9A 3TAXA 3KHTA 1I2ZA 3IVRA 4ME6A 5AVKA 4M8IA 4MS4A 1VL5A 2WVHA 2ZGVA 3W2HA 4ZZ2A 3FNQA 1AVTA 2HWWA 3BDIA 2ZIEA 1CS0A 2HJ9A 3QVXA 1MH1A 4BOYA 1DOAA 3VU3A 2A7XA 2ID7A 1SBIA 1ZYUA 2OB2A 4P98A 3L40A 1OV6A 1QAMA 3ZC3A 4OTZA 3USCS 5B57C 1MNAA 2DU8A 3OPVA 3VHLB 2PGXA 4ZVSA 5REQB 3TLAA 2R7MA 1BC5A 1MEEA 2ZROA 4G0MA 3HXQA 4O4JF 4QBKA 5IJ9A 1OU0A 4OFWA 4TSFD 3H2JA 3P7MA 4CIXA 4RF2A 1OHHD 2NO5A 1P7YA 1Z08A 4GOXA 5KQLA 1UBMS 2H1HA 4Z9FA 2UKDA 3EBLA 4F3RA 3DB1A 4FYMA 4JCCA 4R0NA 2G9VA 2WG1A 4V02A 3W6ZA 3ISTA 3ZDZB 2O14A 1O57A 5F64A 4JWKA 5IVIA 4RELA 1H2HA 1C41A 2Y1DA 3AXTA 4MAFA 3VQTA 2ACEA 4WXPA 4F8EA 2P3SA 3X1XA 5KYNA 1YZUA 1V1MA 3N7AA 5J4KA 2D5AA 1TEZA 2HT6A 1R2QA 2EP5A 3MM4A 1OXSC 1YHZA 3QIVA 16PKA 4X7BA 4K9LA 2YYAA 4EPYA 1THTA 2Y27A 1T9KA 4QBHA 3DMTC 1VBKA 1QMGA 3ND8A 4IKPA 3K0FB 1ARZA 3LT5A 2JLYA 4C0KA 4DC1A 3QXHA 4I4NA 4NNJA 4K9DA 1RQPA 4HQNA 2FPIB 3HWSA 4G25A 1SKAA 2GMWA 4HDRB 2OZPA 3QWAA 2EXXA 1Z8HA 1Q91A 5DBEX 1EVZA 1R3UA 2O7RA 4YMLA 3QVSA 1ECGA 3RC1A 1N1MA 2C1EA 1VI6A 2F90A 3R20A 2P2CA 3GJTA