3HYTA

Structural basis of gdp release and gating in g protein coupled fe2+ transport
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
245
Chain Sequence
b'KKLTIGLIGNPNSGKTTLFNQLTGSRQRVRKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis of GDP release and gating in G protein coupled Fe(2+) transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 81
structure length 245
sequence length 260
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hytA01
5BYJA 1GILA 1JR3D 3NBFA 2RGCA 1JB1A 2QGZA 4JL8A 2ZE5A 1U8AA 3GLIB 3O8CA 3NXSA 4Q4HB 1RRPA 1W0KD 2ZREA 2VEDA 3BD9A 3RC8A 2H1LA 4MRPA 4EIWA 4QHSA 1BS1A 3MG9A 5JZVA 4GP6A 2AXPA 4A92A 1I2DA 5L3SB 3LA6A 5EXPA 3AEZA 1XEWY 1HQYE 2CE2X 2ERXA 3THYA 4WBSA 3LX8A 3K0FB 3CONA 3OFND 4Q18A 4Z8YA 1E9DA 4TQ9A 3UWOA 4U7DA 1P7CA 3X2SA 4D6PA 1J2JA 1DAEA 4WIAA 4FD2A 3C14C 1KAOA 1ZM4A 5SZJA 5GJBA 1X8JA 2WJVA 4Q21A 1RRGA 1H8HA 2A5YB 4LBZA 3SZRA 1N6RA 3OEHD 2JIZA 4KVGA 4YDSA 1D2EA 1G5PA 2BBWA 3SBEA 5EE3A 3RC3A 5E7IA 5AUNB 1E2LA 4NHOA 1RJ9B 1S4QA 2GA8A 2IYZA 3FHOA 4WW0A 1TQ6A 5JWRA 2XZOA 1P2TA 4MQBA 5FPHA 5HCNA 5FPKA 1N5KA 2PT5A 4ACAA 1KO4A 2O5VA 4KJZA 1N5LA 4N3NA 4KO8A 4P3YA 1E79D 3I5XA 5BWMA 3PIRA 1ZIPA 2BMDA 2GKSA 2GK7A 2B7BA 4G1UC 4YMVA 2G1JA 4B71A 4BRWA 4MGKR 2FZ4A 2EWVA 1F2UB 3AVXA 3CF2A 4MKFA 4BQSA 4ZKDA 1OB2A 1GKUB 3SNHA 1E4YA 4HB2A 3U44A 4CZ2A 1COWD 2IYXA 5J4YA 1YZGA 4QBFA 4N0DA 3AVWA 5BQ5A 3FMPB 3QXJA 1JALA 1E2FA 4TSFA 3Q85A 3BFXA 1LW7A 4IHQA 2YVUA 3QXXA 4D0GA 2QP9X 3QKRA 3D8BA 4JKIA 3B78A 2CNWD 2PH1A 3RRYA 4DEXA 4CEHA 3IO5A 2XXAA 2OBMA 3VR6A 2DFNA 4DHEA 3GLHA 3ADDA 2NIPA 1CJTC 2FSFA 3QBTA 1Z0IA 1E2JA 4OHZA 3QXSA 3NIBA 5AJZA 1T3HA 4MRVA 2ZEJA 2Q0HA 1IN7A 1R2QA 1LNZA 4DLYA 3X1XA 1ZM2A 1HY3A 5IK2D 4GNKA 1I4DD 4PHFA 3BRWD 4BFWA 3VHXA 2D7CA 2PZEA 2QMUA 1IXSB 4X8OA 1LY1A 5JWHA 4RSGA 5CK4A 2BDTA 1GITA 3ZVMA 4LK2A 3MWKA 2AX4A 2ZSDA 1LFDB 2GESA 1EWRA 2QQEA 1CR1A 3OEEA 2WJYA 4NYIQ 1F60A 4EPVA 2FGJA 2QT0A 1XXHE 3C15C 3TNFA 1HH4A 2XEXA 2HDNB 3CW2A 3VKHA 1AZSC 5DI3B 1R4AA 3I4LA 4FCVA 4M9XA 3AP2A 3HPRA 1HYQA 1ODFA 1VG8A 3OAAA 4AYXA 1ZMXA 4BFYA 3THWA 4BEJA 1SVOA 1LV7A 2DWQA 3F5FA 3AB3A 4ZCLA 5KTYA 4QGGA 3ETLA 3EA5A 3TH5A 3HYTA 4Q4LA 2C98A 4HAUA 3W6PA 3ICEA 1GRRA 1TMKA 3B1WA 1W36B 3LWNA 2ONKA 4OK6A 2OUKA 2GRJA 2ZSFA 3BH6A 2ZIAA 1P2VA 1Q3HA 3AF3A 4DDVA 2GK6A 1DS6A 2ZYTX 3B1XA 4TL6A 1U98A 5UKDA 2GXSA 5AJXA 4JL6A 1Z0AA 1XPRA 1P4SA 2VH5R 4H1VA 4IDOA 1DEKA 2Z6VA 1YRBA 3LXRA 4Q4JB 2O8BB 4IVQA 4M1KA 1U94A 1XF9A 1NG9A 5HPYB 2FZLA 1YR7A 2O8FB 1HE1C 1HT1E 5ANRB 4B6FA 3N2EA 5E4FA 1KY2A 4B3DA 1MKYA 5FUXA 2XOKD 3KX2A 4TZ0A 4TLCA 1YZUA 4DLXA 3IEVA 4HI0E 3Q3JB 1ZU4A 3K70C 2OESA 1JJ7A 4DUGD 1R5BA 3CRVA 2Q21A 4YMSA 4P4UA 1DO0A 2ZJ8A 3WMEA 3TAUA 3PUXA 1E3MA 3B9PA 3I92A 5CB6A 2A5GA 1UEIA 4KV9A 4TMTA 3CWQA 3VQTA 2IEYA 2ZS8A 1JR3A 3IBGA 3KB1A 2IXFA 1MABA 1W0KA 2G9NA 2F55A 4US1R 3JZAA 1KAGA 3PXGA 4DKXA 2G88A 1DOAA 1UF9A 221PA 2Z4RA 3I8SA 4OHYA 1EFUA 1NNEA 2X19A 3LD9A 5CK5A 2QRZA 1T0HB 5DO9A 4GL2A 2R62A 3U7FB 4XIGS 3J81k 3OFNA 2A5DA 3BB3A 4JMPA 1RKBA 1II0A 3I3SR 1FNMA 1PZNA 2PX3A 1HV8A 4JT2A 5KSOA 2KWIA 4B3XA 3OEHA 3I61A 1Z47A 3BAFA 3TUIC 1TUIA 1ZBDA 1T6NA 2QTVB 1N5IA 3SR0A 4UJ3A 4MKHA 2VHJA 1NKSA 2ZRBA 5BN5A 3MUFA 4JVLA 1P6XA 3CPEA 4OQNA 2F7SA 1KO8A 3E70C 2R6FA 5E7MA 1ZAKA 4OQFA 4Q7JB 2ZPTX 2J5XA 1XTIA 1WMSA 4K81B 3ZDQA 2VHQA 1XB2A 3N2IA 1E79A 2OO7A 2R6GA 4MRRA 4PHGA 4ZIRB 2HCBA 3LVRE 2XTMA 3KKMA 1P9WA 3PEVA 1GRQA 2IW3A 4KFTA 4HLDA 4PO1A 3UPUA 3CNNA 2VP2A 1SXJB 4CEJB 3GCGA 1KO1A 3FGNA 3T5GA 5DYIA 3BIFA 4A8JA 2ATVA 4E03A 2EVWX 4DLUA 3EARA 5F3WB 1COWA 3EIQA 3QPWA 5G40A 1E2KA 3AVQA 2J7KA 5EE0A 4DIEA 5H68A 2PZFA 4CRWB 3CX6A 5KPDA 4DCUA 1Q44A 2OLKA 2ZVPX 1U2RA 4C0BA 3AQ4A 5CYOA 3AF4A 1G7RA 4LYJA 1G8GA 2OFOA 2V6JA 4V0MA 2P2LA 4A1FA 4EFLA 3WNCA 4XH9B 4EPYA 2CNWA 3L0PA 4TMWA 1JEDA 4DLSA 4IRUB 1WXQA 3TAHA 3D3QA 3OIUA 4PC1A 5FI1B 2AWNA 5JS7A 3LLUA 4OQLA 4NH0A 4JKYA 1LF0A 1NN0A 1NVXQ 3GLIA 5ELXA 2I1VB 3KKPA 4Q4HA 2BWJA 2OEPA 5IK2A 1E0KA 4UQOA 1YJ5A 3BE4A 3SFZA 2D4HA 4B2PA 2BOVA 4EQ6B 2DBYA 2NPFA 3TK1A 3H84A 1G20E 3WYAA 4HZUB 3LQRA 3GJ4A 4BFVA 1G41A 1G6HA 3O8BA 4PZZA 3RS2A 4JYCA 4QGAA 4NPHA 4QL3A 4V0OA 3W8RA 4GFDA 3K0FA 1OB5A 2P5TB 3L0SA 3TGPA 1XEXA 5H70A 4R2IA 3DPUA 4C2TA 1Z29A 2Q9BA 2ZYVX 3UMRA 5EP4A 3ZVLA 1RE0A 2GJAA 2OCYC 1K5GA 1KMHB 6Q21A 2PJZA 1Q1QA 1G4AE 3QENA 3JZMA 3TJZA 2QM7A 2ZE7A 4LDJA 4A2QA 4KXFB 4KLNA 4X8HA 3GLIE 2HJVA 4D26A 2V3CC 1FTNA 3AF2A 3O8DA 1WA5A 5FOUA 2GXQA 1KDPA 1Y63A 2W00A 1GSIA 1QVRA 4A8JC 4PO8A 4W5HA 1XZPA 3LV8A 2OBLA 2ZRLA 2KB0A 3H4MA 2ZSBA 2RGNA 4G01B 3ZZ0A 1V5WA 1ZUNB 1D9XA 1VECA 4HAZA 3RS4A 2J0VA 4C30A 5EJEA 1Z08A 5DH9A 2QRNA 4KSCA 2IS2A 1G5TA 2P67A 4A9AA 3BJIC 2C04A 3AGQA 4RD6A 3RRZA 3OIVA 4WA7A 4TLDA 2VQSA 5CDFA 1O3YA 4TL8A 5EE1A 2GEUA 4PSVA 3REGA 2XOKA 1KDTA 3KJGA 1CLUA 1G8HA 1L4YA 1H8ED 1EK0A 5KNDA 1A1VA 3AUXA 3X1WA 3UXMA 3QVUA 2IUUA 3FMOB 3RVBA 2H92A 3CBQA 4DJTA 4DUGA 1NMZA 3IDQA 2ZRIA 2KBEA 4LPSA 1E2NA 3QKSB 3AVYA 2OFWA 2ZU0C 1IY0A 1NI3A 1OXVA 2CCGA 4D0NA 1SGWA 1FQKA 5FTMA 1DAHA 3WRXC 2WSMA 1A2KC 1N6IA 1OSNA 4W5WA 1BYIA 1Z83A 2C9YA 4DLRA 4P0TA 1TQ4A 1XJCA 4L9SA 4L5BA 4TTQA 4U5XA 2NO0A 5L8VA 2P6NA 1QHHB 4PQRA 5J4VA 1ZJ6A 3A4LA 3X1YA 3GLFA 2AFIE 3EZ9A 4ILEA 4IDHA 4QHTA 2Z5FA 4JLNA 4KI0A 3SQWA 5FUWA 3NHAA 3KXKA 4H9GA 1OFTA 1E2PA 1SVWA 4LPKA 3W6OA 2GBLA 4UNSA 3RS5A 2XX3A 2Z0MA 4POAA 1M6NA 3GEIA 1G8YA 4P4TA 1SKQA 2FGKA 2BIFA 4MKGA 5CM8B 2W83A 4JLKA 4XTCS 2WOJA 3QI2A 3ZD7A 3A6PC 2VHTA 2YINC 2J1LA 2HCJB 3BK7A 1NIPA 2WZQA 3V00A 3VU9B 4C0KA 4HUTA 3ZJYA 4NU0A 1F2TB 1F5NA 2DWOA 4XJXA 1PVOA 2RGNC 4LC1A 2GEVA 2RGDA 3U3JA 1DTSA 4B35A 3U3RA 1K6MA 2ZAMA 4RVCA 1KSHA 4A82A 1JAIA 2OG2A 2P6RA 4YMTA 2ODNA 4Q9KA 3G82C 1KNXA 3RNLA 5DNYB 1XTRA 4ARZA 3U61B 3AP1A 3QF4B 1AIPA 2KI5A 3LW7A 4TZ6A 3FHCB 3V4FA 2C99A 1Z0JA 2QAGA 3RSOA 2GNOA 4JT4A 1SVSA 2QPAA 3ECCA 4O2RA 1U9IA 3EPHA 3QUSA 1N2CE 3B85A 4TQAA 1FL9A 5EE9A 1SVLA 1M1YE 2O8BA 4HDOB 4GSYA 4BEBA 1VMAA 2EQBA 2IYWA 2J0UB 5EXTA 5FOVA 1Q21A 1XTSA 3VNUA 2KJQA 4QM7A 1N5JA 1TPZA 1WQ1R 2C5LA 3WYGA 1UDWA 2G0NA 2GWHA 3NH9A 4HB0A 4LV8B 3TW8B 4BWYA 5K8UA 1ZU5A 1CRQA 1G16A 1SZPA 2DFKB 5HCIA 2QAJA 5AJYA 4D2IA 1ZCAA 3QQ5A 3I32A 5FOXA 1XCGB 3BFKA 4RZ3A 3PEYA 1OIVA 2PLFA 2RKOA 2EFCB 2YNMA 4LV6A 1QHXA 1P5ZB 2IHYA 1GVNB 3CM0A 3N5CA 3TW4A 4EPRA 1OH7A 2GBLC 1CJMA 5GADl 5TDHA 4DCTA 2WOOA 1II8B 2AN9A 4A2WA 5DIFA 2ZR7A 3B7GA 3LBHA 1KDOA 3EC2A 2O8CB 2QY9A 2QSZA 3LDAA 1JXMA 3QOFA 2C9OA 1J70A 1WP9A 3A1UA 621PA 2IT1A 1IXZA 1T8UA 1YE8A 3CRQA 4M1OA 2YWHA 3NBYC 1E1QD 4WZ6A 5KDLA 4DRZA 4RFSA 4M1WA 2WJJA 2AD1A 3LAWA 4PQYA 2DYKA 3R7WB 2WPDD 4PC7A 5AUPB 4P33A 4YDHB 2VF7A 1DARA 2HUPA 1OIXA 2UZIR 3K9GA 2XNDD 2QAGC 3L82B 2OM2A 1P3JA 1U9IC 5FTJA 5K8IA 2GZDA 3MFYA 1FP7A 4JBYA 3FMFA 4CIDA 3KQUA 2MMCA 2RGGA 1GNQA 1S9HA 4KCGA 4ZIRA 2Q9AA 1IXRC 2OHFA 2OCBA 3FWYA 1RRFA 1KJYA 2B7CA 4F92B 2VP4A 4ZDJA 1G8FA 3FDIA 4JSYA 1EG7A 2BEJA 1E9SA 4M1TA 1KTVA 4CF7A 2O0HA 1KOFA 3KDSE 4BLTA 4M1SA 3SOPA 2CJWA 1US8A 2B21A 3VR4A 2E9SA 1BKDR 2DR3A 2A78A 3TMKA 1AS3A 4RY2A 4B76A 4TYWA 4RZ2A 1DG3A 4TMZA 5FTLA 1NL3A 3EXAA 3AH8A 3G5UA 4PPGA 4C0LA 1H8EA 5IRCD 1AN0A 1XWIA 2ZE6A 1W5TA 1DVRA 4EFNA 2IF0A 4P32A 1QHSA 3SI7A 1Z6GA 4GP7A 3ZLJA 3K9HA 3W90A 3GFPA 721PA 3B82A 3I5YA 3QJYA 5JWOA 3CRW1 3BWDD 3F8TA 3SJCA 1P9NA 1SXJE 4ASUA 1FW6A 3P4YA 1Q3TA 1W1WA 3F3YA 5J4HA 5BW8A 1NN1A 3GPLA 2NGRA 2D7DA 2QORA 4EQ6A 2RHDA 3IILA 5DE3A 3PVSA 5L3QB 4I4LA 2VP0A 4HZUA 3C5HA 3CPHA 1K5DA 1R8SA 2RGAA 4B43A 4W7SA 4RD4A 4LJ8A 5FTNA 1CU1A 5D3MA 2CLSA 4DVGA 4HB3A 1MOZA 3TVDA 2O8DB 3U5ZB 3BFVA 1YR9A 3QEOA 4LYFA 1FUUA 4TMKA 1A7JA 5EE5B 4KVAA 2CL0X 3T15A 2NO1A 2F1IA 3HU2A 1S2MA 3BH7A 1KMHA 4G3XA 2ZUDA 421PA 2NZ8A 2GJKA 1FQJA 3MSXA 3ND9A 4JLAA 4BRUA 1Z0KA 2J7PD 1R7RA 2IBMA 2ZE8A 4XSGA 1EWQA 1JECA 3R9IA 2ZRFA 4Q5IA 3O8RA 3AVVA 2D62A 4LJ6A 3NBZC 1ZM9A 1AS0A 3ADBA 3GLGB 1ZNXA 2IS6A 3IIJA 4QJ5A 5JHHB 4LBWA 1G7CA 4RFVA 1KI8A 4DT1A 3L8YA 2O8EB 1E2HA 3AVUA 4Q1FA 1E9CA 1G3MA 1W2HA 2Q3HA 1YZNA 4PX9A 1EX6A 1YZLA 2BM0A 2RB4A 1DAGA 4ITRC 4LRWA 1W48A 3KKOA 2ATXA 3B5JA 1IJFA 3SHWA 4EAQA 5JRZA 2JLSA 5LDDC 2O52A 1ZM3A 3QKTA 2HXYA 3Q9LA 1D6JA 4GOKA 2WVJA 2ZJ5A 3MAAC 5FR2A 1UEJA 5JI2E 5JSZB 2CXXA 1OKKD 1T5LA 1D5CA 3REFA 1Q57A 2W2TA 4JLBA 1PUJA 1E9FA 2FSGA 3WYFA 3QKSA 4JL5A 4NCKA 1YR6A 4HB4A 3GJ5A 2QN6A 4DIDA 3MWJA 5CLQA 1ZD8A 3NC0C 3ZH9B 4CEIB 2UVQA 3EIEA 1JJVA 5FH9A 4KYIB 4PAOA 4HLUA 1D9ZA 2OE2A 4HZIA 2GCNA 1MRNA 1R0WA 3I1FA 1NLYA 1XP8A 4IDNA 3QVVA 2Y8EA 3VR5A 1NVVR 2QZ4A 1FPMA 2H57A 3UWKA 3D6TB 1Z5ZA 4D4JA 2J0SA 5CJ2A 4XWKA 5F9HA 1ZYUA 3VHLB 2GZAA 4R7ZA 2P3SA 1N6HA 2WHXA 1FP6A 4E22A 2OSBA 5DSZA 2ZM5A 1E1QA 3Q7QA 4WVFA 1DAKA 1VCIA 1VCNA 4MUAA 1KSFX 2JLZA 1ZD1A 4DBLC 821PA 3VU9A 2V1UA 1XXHA 3K1JA 5GVSA 1F2TA 3U4QA 1M7BA 3X1ZA 3NG1A 2WPDA 4Q9JA 3B60A 2G6BA 4TYYA 1XTJA 2A7QA 2YHSA 5JBQA 1Q1BA 2XNDA 1N25A 4OJQA 1FZQA 4CVNA 4Z8XA 2H7VA 3C16C 3B1YA 1AJEA 4GOJA 4ON9A 1KK2A 1YZTA 3DDCA 3E5HA 3Q5EA 5TVKA 2QE7D 2QMHA 4UNNA 3UMSA 3IGFA 2E1RA 1UFQA 4Q7KA 2ZYUX 3QF4A 4S35A 2PZGA 4YQFA 5BYKA 1AS2A 5E3HA 2YJTD 3THOA 5HKKD 1U90A 2B8TA 2WV9A 5KOYA 3LW8A 2BMJA 2BVNA 4MYTA 4XVQA 4D80A 1KI2A 4LHWA 4OI4A 2Q9CA 1P2SA 2C77A 1OF1A 4IEIA 4QBGB 4JLJA 4QJ4A 3B8HA 1QZXA 2CCJA 2VLIA 4RCYA 1IN6A 4A6PA 3U6BA 1CR4A 1VTKA 3T1QA 2I3BA 4BE7B 2B8WA 2ZRKA 4JVMA 4BFUA 3OIYA 1IN8A 4AC9A 2ZRMA 4URVR 1KZGB 1XRJA 2WKRA 1RVDA 2IC5A 2ZI7A 1JQJC 4HLUC 5KO2A 1JBKA 3LNCA 1UKYA 1U99A 3B6EA 4FN5A 2ZAOA 1Q22A 3NC1C 4Q4AB 2YC4C 3CH4B 1N3BA 2JLXA 3LLMA 5M04A 4TYNA 3TRFA 1TQDA 4FWTA 4C4PA 2AXNA 2BJVA 3SEAA 3I62A 4BZXA 4IOKA 1OIWA 3RWMB 2QMEA 4OI0A 3NEYA 5G3YA 2ZJ2A 1OFUX 1ZCBA 4QGFA 4YXWA 2ANCA 4UNQA 2FSHA 5EQTA 2PJRA 2WJGA 4RZXA 1R0XA 4IJMA 5A5GA 3OHMA 2J3EA 2YV5A 3HYRA 4HUQB 4KBFA 2JGNA 1VKJA 3CB4A 4LZZA 1N0VC 1NN5A 2AKAB 3EZ2A 5JECA 1AK2A 1IY1A 1ZVQA 3K0AB 4QM6A 3NDPA 4PPQA 2ZANA 2PLRA 1FTSA 1E32A 2XITA 1LB1B 3R7WA 1P62B 2PCJA 1N6NA 4MDEA 3DVLA 1C1YA 3LRPA 3H86A 2J7PA 1EGAA 1NMYA 3KL4A 3RAPR 4Q66C 2MSEB 3RABA 4BZPA 3FVQA 1U0HC 4B2LA 5FOWA 1OXXK 2GJSA 4JLDA 1QHIA 5JMTA 4JBXA 4ZKEA 2N42A 3RSLA 4HSEA 1RYFA 4PR0A 4AKEA 2GEDA 2HJGA 1TQ2A 4Q1CA 3CR7A 5HZKA 4BGDA 4F4IA 3UANA 1KK0A 2WICA 3AKEA 4TT3D 2EFHB 1TL7C 3R20A 2MSCB 1NBMD 2BBOA 2ZRAA 2F9LA 4UNPA 1CJUC 1TUEA 1KO5A 4H1UA 5L3RA 5JJIA 2ZQ5A 1FOEB 4QG7A 2WIAA 2BC9A 3A8TA 4PAQA 3H1TA 4F4CA 1XZQA 3Q72A 3GEEA 2EFDB 3UG6A 4NYMR 2WKPA 4CW7A 1E2MA 2GDJA 5LBIA 3C7KA 3UG7A 1UBCA 2ODEA 5IF9A 1W36D 1XDBA 2CVFA 4LJ5A 4GOXA 3EWAA 3CX8A 2QROA 5JI3E 1X6VA 4LBVA 4KODA 4B74A 2N1BA 2ZYWX 4TL7A 2VYFA 5L3VA 1KO7A 3SYKA 1R0ZA 3TQFA 2QNRA 3GFOA 4NCNA 5KUTA 4MRNA 4IDQA 1Q1EA 3I73A 1KI6A 3CPJB 4IFEA 4NMMA 4BECA 1W44A 4DDTA 3KTAB 2XSZD 2ZJZA 3DMNA 1AZTA 3DHWC 2WSSD 2BJWA 3B13B 1UJ2A 2ASEA 3M4YA 2PBRA 4TMVA 4Q9HA 5EP3A 4NONA 1M34E 1HE8B 2REXB 3U6KA 4XVUA 1OW3B 4U02A 1XU4A 4LBYA 1GFIA 2YWEA 1XD2A 1AGRA 4NCIA 2R44A 3SDZA 4Z1MD 1ZM7A 3DM9B 1M8PA 2AK3A 5J5CA 5H8WA 2VSXA 5EZ6B 1F48A 3BGWA 1GM5A 4A15A 3OIWA 4HYYA 4ERNA 4HAWA 3NH6A 2CHGA 3WNBA 3QG1A 1T5IA 2VP9A 3M1IA 4B2IA 1NVVQ 3NTUA 2RGXA 2C8VA 2DY1A 3QG5A 1Z3IX 3BERA 4GZMA 5LB2A 2QBYB 5FBRB 3DO6A 4B33A 2FJUA 1MO6A 1RZ3A 2R6CA 5JJLA 1KJZA 1XMJA 2JJ8A 1HT2E 4AI6A 1KI7A 1OT3A 3GLGA 1UAAA 1TAGA 2QE7A 3D31A 5B2ZA 3R8FA 4D25A 5L3SA 3TVTA 1J8MF 3AF1A 5EUMA 3QKUA 1EFHA 2A9KA 1XCPA 2D2EA 4DLVA 5HKKA 3KQNA 3UMFA 4IEEA 1L2TA 1TNDA 2WJIA 3IQXA 2WWYA 4M1YA 4DEYA 3SYNA 5AWFC 1Z07A 2HV8A 3FYHA 3VNVA 3SQXA 1O87A 3CRMA 3A58B 4EPTA 1FX0B 1ZNYA 4PHTA 3CKLA 2BKEA 2AKYA 1YZKA 2GAOA 3BORA 1GP2A 1YVDA 2A30A 1FFHA 3U7GA 4D4KA 2GJ9A 1RJ9A 4QC2A 2DFTA 5B64A 4HAYA 4XTRA 3AKDA 3SU8A 4BLPA 4A36A 3GLGE 3K09A 3VAAA 3W8NA 4RCZA 3HPQA 2J45A 1UBGA 1GL6A 3QNUA 4FINA 4A0GA 3V4RA 4JVNA 2VF8A 4N0EA 2NPIA 5G41A 4CEIA 2REBA 4JLOA 4ESHA 4US0R 5JRJA 4PSKA 1SXJD 2ZRJA 3AP3A 1F2UA 4BFTA 4EFMA 1XFAA 3THXB 5LD2B 3VX3A 2OILA 1T3SA 2X1VA 2PT7A 3MJRA 4KFRA 2FPKA 4K8OA 3H0KA 5KYKA 1S3SA 1P61B 4WOPA 4HDQB 2ZRDA 4Q1AA 4HDCA 2KE5A 1T4GA 3IPXA 2HLDD 3RS3A 4MGZR 1YZQA 4P4SB 1CS4C 5C46F 1E2DA 2W2XA 1N0WA 3L0IB 1YRAA 1A4RA 2G0TA 2IYYA 4Q9IA 4LV5B 5F9FA 3THYB 3ASZA 2QTHA 3WP0A 3T61A 3TQCA 2NMVA 1NLZA 1TEXA 1X1RA 1E99A 1ZC3A 4AWXA 1E96A 1R6BX 4G5QA 5FPSA 2ZR9A 1OYWA 3EZ6A 1L7VC 1P73A 2X2EA 2AL7A 5FUYA 1W4RA 3U60B 5IT5A 5DYGA 3TIFA 2C2HA 4DDUA 4OBEA 1TF2A 4QHYA 2WTUA 1U8YA 2XTNA 2OV2A 2IYLD 5A0FA 5DI9A 2VP6A 1KI4A 1NN3A 4IKEA 1K8RA 1T91A 2OCAA 1CP2A 3VMFA 4BFXA 2ORIA 1DO2A 3E2IA 4MYUA 1OFIA 4WZAE 1GOTA 1E1RD 2ZTSA 4IOLA 1MRSA 4PZYA 3WP1B 1IHUA 1UKEA 1ZRHA 1UADA 2XJ4A 3K09C 3V9PA 3K0SA 5DI3A 1C4OA 1CULC 2V6IA 4NKRA 1NBMA 2HEIA 3GP8A 3EPKA 3FKSD 1GKIA 4A4DA 3U44B 4UJ5A 3LQQA 3Q5DA 1IAQA 2AHOA 2UKDA 1TTTA 3ZQJA 2G83A 2ZI3A 1JXOA 3HDTA 1GNRA 4Q1EA 2W58A 3VR2A 5E95A 1ESMA 1YKSA 4MITA 3ICQB 5FBLB 2IS1A 3QKRB 1GIAA 3W34A 2I4IA 2X8AA 4CEHB 1OXTA 2XXAB 1GNPA 2BCGY 1G7TA 2Z43A 4Q48A 3GLHB 3TR0A 4A0RA 2JLYA 2V8OA 4NTZA 3QPVA 2BV3A 1GAJA 1JQLB 4DB4A 2FA9A 3IIMA 4RJLA 2XGJA 2IF2A 3CR8A 1PUIA 1GL7A 4MYCA 4DLWA 4ZCIA 3S1AB 3ZD6A 2XSZA 3BB1A 4Q4JA 1E0SA 3A4NA 1NBME 2WSSA 1BO6A 1R5NA 5AR1A 4NYMQ 3K70B 2QA5A 3T35A 2O8FA 3AVOA 2IYUA 3FPAA 4V0NA 3U7EB 5C1BA 2ZJAA 4JS0A 4KFUA 5KDDA 3DZDA 3K0AA 4Z1MA 4G5GA 2ZS9A 4Q1DA 2OCPA 1E2IA 1Z0FA 1ZD9A 5CM9C 4D82A 4C0HA 4R2HA 1QHGA 4D81A 1KNQA 1DAIA 1N6LA 1OPXA 2ORVA 1S9DA 2BBTA 2WWWA 2XNSA 4F93B 3AVTA 4PPFA 2PX0A 2L0XA 2RGBA 1RRCA 3ZVRA 4OKSA 1P9RA 3BB4A 2FF7A 1Z2CA 2WBLC 3THWB 2SHKA 4X8MA 2A3RA 2ZUCA 1EESA 4UXJA 3VFDA 4DSOA 2OAP1 1VYUA 2W0SA 3SFVA 3PUZA 1R5OA 4QBHA 1LS1A 5JCZA 2HYIC 2WWFA 3UKDA 1CR0A 1ZNZA 4QOSA 4FMCB 5F2EA 5BN3A 2XB4A 3AM1A 2QPOA 2G77B 3ZIAD 5FR1A 4BLOA 2G3YA 1F3OA 4W9MC 1NJFA 1Z6AA 3LX5A 1IBRA 4MYHA 4C0SA 4LWZA 4C0QC 3T1VA 2VSFA 3GQBA 4RZUA 4MRSA 3DMDA 3M6AA 1W36C 4PFSA 2ZUBA 1CEEA 2X77A 1T0JB 4CDGA 1G9XA 5KPJA 3EZ7A 1EFCA 2TMKA 3WHKA 4DCNA 3ZS9A 1U0LA 2BMFA 4L16A 4TN1A 5CITA 3M0EA 1VYVA 1EFTA 2G1KA 3C41J 4M21A 4XVRA 1D2MA 1XJ0A 4G0NA 3P27A 4Q03A 1CR2A 1XMVA 3DL0A 1GG2A 2VTKA 4PSAA 1A5TA 4URUR 3KUCA 3OF5A 1FMJA 2ZVQX 4JLMA 1XJQA 4V02A 2AFHE 3SC3A 4AKHA 4F38A 2DB3A 5H1YA 4V0LA 4URXR 1SHZA 1RW4A 2D3WA 1ZUIA 4JJZA 5FBQB 1S0UA 1VIAA 1TU4A 2CEAA 2GETA 2OZEA 3EZFA 2JEOA 1SXJA 3QE0A 4QXAA 2D74A 5CJPA 4CEJA 3KJHA 2P5SA 2A5JA 5J40A 2QG6A 2X2FA 5JJKA 3EW9A 2EW1A 2ZRNA 3VKGA 5GJVC 4ZI2A 1W4BA 2IL1A 4IW3B 1QG4A 1WBBA 2PEZA 1P72A 2DHRA 4Q00A 1NKTA 2HLDA 4JYBA 1S1MA 5AUQA 4PO9A 121PA 1T8TA 2QM8A 4QBIA 2Q6TA 1DAFA 3ND8A 2XZLA 3K9NA 1OJLA 3OE7D 1D2NA 2A5FA 1XEFA 2J0QA 1I4LD 2AD5A 3MMPA 3UIEA 1E94E 1RC8A 1FNNA 2V55B 3CNLA 1OXSC 2FFBA 2MMGA 3ZQ6A 4HLQB 2FV8A 4I99A 3TKLA 4DXAA 3F0TA 2GHIA 1L4UA 4C7OB 2V7QD 8OHMA 4UXIA 5EUQB 1UM8A 3HP1A 2F43B 2GCOB 1S1CA 3A4MA 4RD3A 5EP1A 3MLEA 4A0HA 4GT1A 4CT4B 3I72A 4PC2A 1Z63A 4M8NE 2PMKA 5AUOB 1AGPA 4LX0A 1W46A 3I8XA 4KYUA 1ZUHA 5C4GB 4TQUS 3L0OA 1JNYA 1SULA 3MRSA 1E1RA 3IUYA 2NQ2C 3NDBB 2GF9A 4L4UA 1B0UA 4EKDA 2GAAA 2WWHA 4JZKA 2H17A 2IYRA 3FKSA 1JEEA 3L8ZA 4A8JB 2IS4A 1X3SA 4YMUA 1ZW6A 4LUCA 4F91B 1AM4D 2W2VA 4ABYA 1OH5A 4BFSA 3RWOA 1OHHD 1SXJC 2OLJA 1X8LA 4BLSA 1JAHA 1P60A 2FNAA 2FFQA 1QBKC 1IJEA 3B2EA 1M7GA 2ERYA 2Z83A 5KNBA 1ESNA 2REOA 3HWSA 4LHVA 3RRNA 4C0JA 2JLVA 1KMQA 1ANKA 4MA4A 2ZRCA 5DLQC 2CMKA 1XMIA 4AKIA 3EA0A 3HR7A 2FDCA 2PEYA 2IXGA 2PCLA 4G5SA 3C5CA 4RKFA 4AY2A 1GKYA 1G19A 1ZNWA 1E4VA 1N6OA 2ZROA 5FI0B 2QTFA 2C78A 2JLWA 5SZIA 2FX3A 3ZGXA 2JCSA 5JHGB 5JS8A 5KSPA 1G17A 3QXCA 4M53A 2Q3MA 3PR1A 1EFRD 1NVWQ 3DZ8A 4MUBA 4DZZA 2RHMA 4P4SA 2MSDB 1NRJB 1OFHA 4NCHA 1CJVC 3AUYA 5FBWB 1W0JD 3AF0A 2FN4A 1JI0A 5LB4A 3MWYW 2QMOA 2ANBA 3U2QA 1M2OB 1XBTA 2FPMA 3JVUA 5FBVB 3NHBA 4GI7A 4Q1BA 2B92A 4AK9A 2JJ2D 1DG1G 3W6NA 4TLEA 1XEXB 4OK5A 4LYHA 1KGDA 1SKYB 4HATA 4AKGA 4PTLA 4LC0A 1W49A 4LHYA 3EASA 3OZXA 1TF5A 4AYTA 3N70A 3C8UA 2DCUA 3L2OB 3P32A 5AK0A 4R9UC 4WXRA 4EDHA 2V4ZA 3KXIA 3SJBA 3K53A 5HR5A 1QHHA 5KU1A 4LI0A 3LXXA 3B1ZA 2WIBA 3EAQA 3PUVA 3RLFA 2VA8A 1WRBA 1Z2AA 1KIMA 3FKQA 3IQWA 4O2LA 4KBGA 3K0EA 1GDDA 4MKIA 5EP2A 3PEWA 1NLFA 2IA5A 2XTZA 3GJ0A 3P4XA 1H65A 3ZIAA 3TUZC 2QU8A 3PG5A 4EUNA 4TL9A 3KQKA 1HA3A 5KHOC 5KSZA 1RPZA 1KKMA 1IN4A 2ZRGA 3PUYA 1J7KA 2D2FA 2CLDX 2OXRA 2AWOA 2FU5C 1CKEA 4M2LA 3KFVA 3NWJA 2JLUA 1Z6XA 1X86B 2VO1A 3GJ7A 4OK3A 3T34A 1SVIA 3KUDA 3JVVA 3VX4A 3WBKA 4B3BA 1M7HA 2JAQA 2NG1A 5LD2C 3IKJA 1QRAA 2J41A 4JLPA 4FMDB 1GRNA 1XPUA 4LSGA 2ZS7A 1BMFD 3MWLA 5E7JA 1MO3A 4UXHA 3GFTA 3EX7C 1DPFA 2IUSA 1DAMA 1AKYA 3WBJA 4PPNA 2W6JD 1QF9A 2QEQA 2R6AA 1NY6A 4LJ9A 3SN6A 3Q8XB 4XD7D 4DCVA 3CWZA 1JPJA 5J4KA 4P31A 1E9BA 4N1AA 1S8FA 4B32A 1Z0DA 1OV4A 1R0YA 3LBNA 3S1AA 2J9RA 4A6XA 3CF6R 4LJ4A 5GVRA 1P75A 2P6UA 3FB4A 3IIKA 1IY2A 1SVKA 2J0UA 4U00A 4KSBA 1J8YF 1R8QA 3FTQA 1Q0UA 3GLFB 2HT1A 2EYQA 1KY3A 3WMGA 1EX7A 2LCFA 1WB9A 2ZR0A 3A1SA 3WNDA 2LKDA 4C2UA 1E6CA 1UKVY 3OE7A 3QF7A 3GMTA 3WXMA 2GXAA 4OHWA 4MGIR 2IK8A 4Q7LA 4DSUA 3GLHE 2HT6A 2XAUA 4XWAA 1FMLA 2EU8A 4AYWA 1CRPA 1A2BA 2CLCX 3GJXC 1AQUA 3KKNA 1G3IA 1PLJA 4S2EA 2QQ0A 5GJCA 2GVDC 1II8A 4KAXA 2V7QA 1V43A 2HF9A 2ZJOA 4B75A 3R9WA 5FL7D 1FUKA 1VCMA 2ZI6A 2O8CA 1VPLA 2H18A 4G5RA 4PC6A 5BN4A 3IBYA 2YOFA 3AKCA 4E09A 1KZ7B 2F6RA 1ETUA 4JJKA 2H5EA 2NTYC 3FHTA 2FFHA 4ARZB 4L9WA 1G3QA 3EIHA 4GRAA 1NSTA 3HJNA 4RKEA 5EXSA 2JATA 5CIWA 5FOTA 4DDWA 2VPPA 1UPTA 1LVGA 2RGEA 2CCKA 2FOLA 2QAGB 4JSTA 2P65A 2C95A 3IPYA 2RAPA 2FWRA 4D4LA 4RD0A 3A37A 4JVSB 4DSTA 2OAQ1 4Q01A 2CDNA 1M74A 5SZKB 3R9XA 2A2ZA 3LH5A 1OHHA 3CF0A 1GTVA 2WAXA 3U3OA 2F1HA 4XWOA 1G3RA 3LO5A 2QP4A 2WM9B 3T06B 1TF7A 4R98A 3A1WA 2QUZA 3FOZA 2JLQA 3BBPA 3EPLA 4OQXA 4AG6A 5P21A 4AG5A 4Z51A 3KKQA 4LJAA 5DHAA 2XB2A 1G4UR 4G5OA 4KU4A 4QFMA 1UBEA 5B58C 1IOZA 1GL9B 2OBNA 1L8QA 4OL0A 1EFRA 2YWFA 3Q7PA 4C3ZA 3AV0B 1QHNA 4BASA 3NKVA 4YMWA 4Q9LA 1CXZA 2KBFA 1W0JA 5LPNA 1I2MA 2JDID 1HTWA 3GD7A 1BOFA 1OKKA 3PV0A 3TE6A 3BS4A 2JJ2A 4FCWA 4L8GA 4LJYA 5DGXA 3QSYA 3UK6A 4B44A 3FE2A 4IXMA 3KJEA 3ASYA 4RFSB 3T12A 4Y0VA 1NVUQ 2QPTA 2HYDA 3VTKA 1GZSA 4M4SA 4EPWA 2QT1A 2F9MA 3SE0A 1E9RA 1KI1A 3SJZA 4C7OA 4TLBA 4CGZA 4R71A 3CO5A 3FFBA 4PAMA 1JR3E 5L3QA 2F43A 2GCOA 4EJSB 2IUTA 2FPLA 2R9VA 4K46A 4TTRA 3KQHA 2VBCA 3H2YA 2IYVA 3AKYA 5C4MA 3P26A 2O8DA 2WMOB 2V1XA 1I4TD 4NCJA 3CNOA 2ZSEA 4KHZA 5K8LA 5FFMA 3PENA 5DN6D 2HF8A 2FEOA 2WWIA 2BMEA 1XEWX 4QJ3A 2CHQA 2QP3A 2O0KA 1RFLA 1YQTA 2J46A 2O0JA 3BXZA 3A1VA 3DKPA 3DOFA 4J0QA 1KSGA 3WHLA 1Z28A 3LVQE 4OI1A 1VHLA 5TARA 1G7SA 5JEDA 5TB5A 2EYUA 3PCRB 2CJWB 1US8B 2EFEB 2DWPA 3HU3A 4US2R 3TUJC 3QPUA 1F6BA 1XX6A 4FMBB 4FW9A 1BIFA 4QNMA 5CB8A 1KK1A 1ZP6A 5FL3A 3KQLA 4PC3A 5HTKA 1Y3AA 1E98A 1BMFA 4FWIB 1A82A 2V54A 2PL3A 4Z54A 1EXMA 1Z6TA 4GPTA 4MDFA 3KB2A 2CE7A 5AJWA 5TXGA 1VG0B 2W6JA 1XTKA 3P1JA 3DM5A 3K0CA 4XD7A 2VHCA 2O8EA 2B6HA 2V9PA 2NO9A 5G3ZA 3K9LA 4DWJA 4XSHA 4OQMA 5HE8A 4GDFA 2JLRA 4C0AC 5AJVB 3ZZTA 2W0MA 2CL6X 4MGYR 2NO6A 4HAVA 1GUAA 2WAYA 2IHBA 5D3QA 1N6PA 3QEJA 3T1TA 4Q19A 3DKVA 4TYPA 2OT3B 2P0EA 4FMCF 2WWGA 1W4AA 5JSZA 1TADA 2FG5A 3TSOA 2ZJYA 4IXNA 1Z8FA 1TEVA 5D3MB 2W6ID 4DB2A 2ZITA 3EC1A 2F3RA 4V0ME 2FEMA 3DEFA 3BOSA 3WRYC 3PJRA 1HEIA 4PZLA 3TSZA 1DBSA 3QBVA 3CIOA 4KFSA 2RH5A 1OLOA 3UATA 1R10A 1VCOA 1G3UA 2Q3FA 3PQCA 4EPXA 4IFBA 2GF0A 1ELOA 1XD9A 3MD0A 4Q7MB 5GJWC 2ZI5A 1BH2A 2R2AA 5JLJA 1OH8A 2ZI9A 4M22A 1DADA 4ESVA 4JIMA 2GVZC 3QXHA 3TSWA 4URYR 5FL7A 1NF3A 4NBSA 4NYJR 1WBDA 3TBKA 5FPTA 2DFLA 2BM1A 2IYSA 1WF3A 5DHFA 3W5JA 2CK3D 3G0HA 3W3ZB 1PJRA 1XNJA 1JPNA 1AA9A 3GJ3A 3NEJA 4B3GA 4NE2A 5CIQA 5EXXA 1VIYA 1IQPA 2HXSA 3ZYCA 1X1SA 4OHVA 2LKCA 5EZ5A 3RYTC 4D4MA 2BHRA 3U3KA 1GWNA 2AR7A 2FSIA 3HR8A 3RS0A 2BBSA 2XJ9A 1SKYE 4LGMA 4DT1B 1UBFA 1YHNA 1CJKC 2QI9C 4I81A 4QKQA 2QGNA 1VG9B 2GILA 4TMXA 2Z4SA 5FTKA 1B23P 1ONBA 1AQYA 1MV5A 3RANA 1G64A 3K0CC 3CH5A 1MH1A 5C2JB 1G5RA 1YU9A 1ZC4A 4X8LA 4OYHA 4BZQA 5HZHA 4M9ZA 3RDPA 3ZS8A 3LFUA 5FUVA 3T5DA 4ZDWA 1ZIOA 1SQ5A 4O25A 1NSFA 1TU3A 3PUWA 1XCMA 3GJ6A 4PHHA 4LHXA 2XZPA 3E1SA 4B3FX 5JEEA 4I1SA 1II9A 4ZPXA 1RIFA 4BFZA 4NDZA 2FH5B 4Y0AA 2BEKA 2IYTA 1D8TA 1SVMA 2IX3A 1P2UA 4ASUD 2IEZA 2PMDA 4YC7A 4ZDKA 4NP6A 2F3TA 2C03A 1UDXA 1DELA 4TT3A 1LS6A 3GJ8A 1Q1ZA 4ZI3A 2H8KA 5BXQC 1OYYA 1T9HA 4B34A 4CYMA 521PA 1XPOA 1AKEA 3OESA 1U8ZA 4GBMA 2BKUA 5CDFE 4IVPA 5TMPA 5KSYA 4LY6A 3SJAA 2CL7X 1KI9A 4AIIA 3U3MA 3QY0A 4URZR 5FPYA 3BH0A 2JDIA 3R8CA 1Z06A 4AD8A 4O3MA 4ZO4A 1NY5A 3KZ1E 2R8RA 3L43A 4FIDA 5C18A 4LCBA 1VDZA 2ZSAA 1WDTA 1OXUA 1U81A 4LJ7A 4Q4AA 2D06A 1S96A 4IDPA 4WZBE 4DC9A 4ZDIA 1HURA 3VR3A 2ODWA 3CLVA 3KXLA 4ZCMA 4LHZA 3IHLA 2JJ1D 1T3LA 1XXHB 3GEHA 3ONWA 2JA1A 2EFGA 3CRRA 3U4QB 2ZI4A 4JBWA 4W5JA 4II7A 1PV4A 1E9AA 4NL4H 2ORWA 3LBIA 2ZU6A 3FFAA 2OXCA 4LYAA 5KDOA 4C9BA 4MH0R 3SBDA 5FOSA 3GLFE 1C9KA 2RMKA 4TTPA 4YONB 4HUQA 2F1RA 2ZXUA 2YWGA 2ZJBA 2YC2C 1KHTA 4GZLA 4DCSA 3K8YA 4BUJA 2ODBA 3W3AA 5JFGA 3D7MA 3KFXA 1NIJA 3P20A 2BCJQ 3WY9A 5DN6A 4QNRA 4KLZA 1KI3A 3HU1A 3PITA 3TLXA 2FE4A 3W5IA 1HUQA 2YOHA 4E5UA 2K5UA 1HQCA 4FI3C 1IM2A 3SYLA 1E2QA 3B9QA 1G291 1H8HD 2WMNB 2GCPA 1RYHA 2JIZD 4WXPA 3SHFA 2VHUA 1ZINA 1J90A 1LF5A 1DE0A 1Q12A 4JLVA 5CLLA 4M0LA 4OHXA 5CYPA 4DSNA 1N6KA 2EWWA 2AK2A 1MR3F 4F7WA 4M1MA 5B57C 1YR8A 1MO4A 2LWIA 1G21E 2H16A 3TR5A 4URWR 1KSJA 2FMXA 4TYQA 4B73A 1G1MA 4HLCA 1PLLA 4BPBA 1IONA 3A1TA 2YOGA 1N0UA 4V03A 4OI2A 2IYQA 3AVPA 3EG5A 4XOIA 1JR6A 3MJHA 1Q20A 4B48A 2QSYA 1VHTA 2ZRPA 2WWXA 1W5SA 1MT0A 4UNRA 3RRMA 2CBZA 1E0JA 1KK3A 1MO5A 3CZQA 5IHPA 3FMIA 3ADCA 2WKQA 4ZV4A 1G6OA 1E9EA 1W4CA 4TSFD 1CF4A 4D0LB 2FFAA 2W6IA 1NP6A 2ONJA 2GTPA 2YKGA 2YYZA 4HEJA 2VIIA 1E0AA 1WE2A 1CTQA 5F98A 1VG1A 4IVRA 4Q02A 4WAUA 1J99A 1S3GA 1U0JA 1E69A 1W47A 3C4JA 3NBXX 2R6DA 4O0MA 1W7AA 2R65A 3EPJA 5TV2A 4RD1A 5TY0A 2IXEA 5HE9A 4B6EA 1BYUA 4PXAA 4NYIR 4IOJA 3KTAA 5J47A 5J4LA 4EJSA 1E2GA 3ZVNA 3A36A 4UKDA 3K70D 4FMDF 1G8PA 4PANA 3X1DA 2J59A 1MABB 3W9YA 4M9QA 2CK3A 2VL7A 3U7HB 2UZ3A 3DOEA 4M9SA 5JCPA 1LTQA 1NMXA 2J87A 4I1UA 5A4JA 5SZHB 4A0FA 1QHYA 4AURA 5KNCA 1VYTA 1NJGA 2VP5A 2ZRHA 1XD8A 5K8TA 4HAXA 3PFIA 2OFXA 4FXPA 5G53C 3CZPA 3OEED 4DLZA 3B1VA 3O47A 2NO7A 4I1OA 1NG1A 1Z6YA 4GMXA 1QG2A 4B3CA 1KYIA 2DPXA 4F4JA 4Q47A 1OE0A 4PQFA 2I1QA 4B47A 2GZHA 4NYJQ 2C9CA 1OH6A 5IDVA 3NVAA 4KITB 3KJIA 1KKLA 2F1JA 3ADKA 2VSOA 3OAAD 2QBYA 3CX7A 4V0KA 4RD2A 2RCNA 4BLQA 2WJHA 3IO3A 2IWHA 2KSQA 3EWSA 3SS8A 3T1OA 2C96A 4E07A 4I1VA 2VRWA 3BC1A 1G18A 3LY5A 1PLKA 2QL6A 1QDEA 3RS7A 3VR1A 2E87A 2NZJA 1Z22A 5DISB 4OJKA 1XMSA 4L15A 3AGPA 1IN5A 2CHVA 2IWRA 4QGHA 4TLAA 1KI6B 1FX0A 4BLRA 4TWZA 1XTQA 3ZZUA 4YXWD 3MCAA 3CUEF 5B30A 2GXUA 4YLGA 3MGCA 4FCTA 4GMDA 4NZYA 2ECKA 3PEUA 4EJSC 1XD2B 1E2EA 2N46A 3QIAA 4QRHA 4DLTA 1CBUA 2QENA 3IEUA 1SHKA 3VKWA 2ZETA 1CIPA 4LOAA 4A2PA 1W2GA 3WMFA 1TX4B 2YZ2A 2CVHA 2JJ1A 1QVAA 3THXA 3RHFA 1KDRA 1KJWA 2NOAA 1UKZA 1X8KA 4IOMA 2GJ8A 2JASA 4ACBA 3IHWA 4CT5A 1WCV1
chains in the Genus database with same CATH superfamily
1JR3D 1KBQA 5TGDA 3CX3A 2RGCA 2PRKA 4M86A 1L4FA 2QGZA 4JL8A 1X1EA 5BSTA 3EQZA 4MZDA 1N1EA 3O4JA 3T4PA 2OCXA 3A6ZA 5FULA 2VEDA 3SZUA 3VJLA 2JCYA 4UMVA 1Y4SA 3V97A 2UDPA 3O1IC 1BS1A 1USVA 3MG9A 9LDBA 3W1EA 3KAQA 2AXPA 4YT2A 1IJBA 2LCIA 4TGLA 1NJ5A 4ZT7A 4HMPA 3LG2A 3IUQA 3I37X 1XEWY 1HQYE 1T2CA 2CE2X 5AW8A 5AW6A 3L41A 3CONA 1C4XA 4Q18A 4YMIA 4Z8YA 4DZTA 3WLNA 1ZKMA 4U7DA 1TKCA 5HYVA 3UT5B 4U2BA 3OPYI 5I7SA 4YWHA 3USCS 4EKEA 3KOZA 1BD4A 5SZJA 1B6SA 1X8JA 1BVUA 1QFXA 4YJHA 4DV0B 3SZRA 4KPFC 4KVGA 1ZXBA 1UXHA 3KHKA 3NHUA 1WL8A 4IQFA 5JD6A 3T95A 5G1NA 2ZAIA 3GVIA 4LSMA 5HFJA 4F4HA 2IYZA 2QG4A 1P2TA 3PT5A 1JJBA 4MQBA 5AKZA 5EJIA 1N5KA 1RLTA 4DBLE 3JR7A 2IZ7A 2NP7A 2PLAA 3M3HA 3HKEA 2EP7A 1PJ8A 3IR5A 3PIRA 1ZIPA 4Q9AA 2GK7A 1KFBB 3PC8A 3G49A 5H02A 3VU1A 1XQYA 5HDBB 3JQAA 4G4JA 3QX7A 1SQ6A 4FR5A 5ESWA 3TSYA 4JT8A 1N4DA 5EZSA 2EWVA 1BX1A 1F2UB 4XUCA 4MKFA 2JJMA 5LNK1 1GKUB 1X7YB 1E4YA 1C50A 3JYPA 2NVBA 1Z5VA 4CZ2A 4YEDA 4TUYB 1AF4A 2IYXA 3TJMA 4AJJA 2PUDA 4GX5A 1W4ZA 4IQ0A 4N0DA 4IDDA 3OQMA 5BQ5A 3FMPB 4BO1A 2NUPB 3OZWA 2BD0A 1SA0A 1JALA 3DO5A 1N78A 2CVQA 1PQUA 2AOVA 4YP7A 4ED9A 3NR2A 4IHQA 3H5TA 3QXXA 1XMOB 1XDSA 3QKRA 3B78A 3RRYA 3H2SA 4YACA 1JZSA 1FYWA 4O2AF 3WLPA 1D2RA 1YRHA 1U7HA 2JCBA 4DDMA 4UTOA 4WK2B 1TCUA 1RJGA 4MI6A 3SVZA 4E0BA 1PBNA 1QV9A 1E2JA 1HDOA 5LWQA 1J1IA 5AJZA 7MDHA 5JC1A 5KTNA 2G6TA 2I66A 1HE3A 4D1YA 1CVLA 3RH0A 3DLAA 4PINA 4OY3A 1LNZA 4N8SA 5ILGA 1ZM2A 1HY3A 2PRIA 2CSXA 2DKFA 4X1YB 5B1IA 4NNJA 1D2GA 2RK3A 2BFFB 2FR0A 4QOEA 4M54A 2PZEA 2YV4A 4O6VA 1L5HA 3PUJA 3MGAA 1ZOPA 1CD5A 2BDTA 2Q4RA 2HBRA 3GCDA 4HWGA 3RU7A 1B26A 4MPRA 3MWKA 1UXIA 4XGRA 2ZFUA 2ZB4A 1GQRA 1EZ4A 1X2BA 3PD7A 4PGAA 1IQRA 1KYYA 3WRVA 2QQEA 1UQUA 3C24A 3OEEA 5D5PA 3RHTA 1UBKS 4NYIQ 4RK0A 1F60A 4AJPA 4EPVA 5TQ0A 1MAVA 1DDIA 1FRQA 2V65A 3GPCA 1I3MA 1R4AA 5HKBA 2VPXA 2B1QA 2VZEA 4M9XA 4L8LA 2NUTA 4WT7A 3HPRA 3PWZA 3SQMA 3AUAA 3PXDA 5G0SA 3V3KA 1WSBA 2V7PA 4BFYA 1WDMA 1SVOA 2WE8A 3MD9A 1U9JA 4TTTS 3V34A 4CBVA 1K3UB 5KTYA 2BI4A 3EA5A 3H3FA 3HYTA 4KX5A 4Q4LA 3A0UA 4Q93A 1CUAA 4H3SA 2PTHA 1W36B 4C21A 1IUKA 2ONKA 2NU6B 2FMTA 1GDTA 2WA2A 4OYRA 4QYMA 2ZIAA 3C1TA 1Q3HA 2JBHA 2VT2A 5LZ5A 2NPFA 4B3RB 2GK6A 4MUXA 1E4OA 1DS6A 1F4LA 2ZYTX 2HZ7A 4EK9A 1O9GA 3B1XA 3S27A 2VDKB 5DPMA 3KD3A 3RW9A 1BGVA 3R7LA 1B76A 2EX0A 1KYXA 4HRVA 3OPYB 4JL6A 4DCMA 1XDUA 5C5CA 1RTKA 1BMDA 4YRMA 1DEKA 3KVOA 5ITZB 2YHIA 2Z6VA 3Q2KA 3TZ6A 4IVQA 5AI0A 1EBFA 1P1KA 1TA0A 5E9WA 3E4CA 1FLVA 2Y6UA 2GZ3A 4XUEA 4DLBA 1HE1C 4XFKA 3TOSA 3N2EA 5E4FA 2E49A 3I2FA 4FDAA 2XOKD 1N57A 5FHRA 1QOPB 4WLEA 1H4TA 1K3FA 1VSQA 2PX8A 2XVAA 1ZU4A 1J7JA 3ORHA 4WJLA 1C4KA 1R5BA 3CRVA 3V7FA 2Q21A 1KEEA 2XDWA 1I2ZA 4P4UA 4YMSA 4MVCA 4ZC1A 3WWDA 1XWWA 5HGJA 1RAEA 1Y4AE 2A5GA 3GUZA 4AO8A 2A9FA 2VFAA 4KV9A 2Z9CA 1O5OA 1WTAA 1DHTA 3E1GA 4CQJA 3ZKWB 1V1JA 1J2UA 1JR3A 4MYRA 3KB1A 3WL6A 5I45A 3AOGA 5EEHA 4FYWA 4PTZA 2XY4A 5E2IA 4AJ1A 5JUWA 3DBLB 3A7DA 3ZGYA 4S12A 2P0YA 3GGDA 1GN9A 3JZAA 4HDNB 4DKXA 2WD9A 5ETJA 4X24A 4MYSA 1PL7A 4KR6A 5BN3B 2DXIA 4WGGA 2WF8A 2GUWA 221PA 2Z4RA 3OOYA 4E13A 2X8JA 2DQSA 4DBZA 1GYQA 3SXUA 1EFUA 1NNEA 4MHTA 3KELA 2QRZA 5DO9A 4NFYA 3LHKA 4MHOA 4GL2A 4XIGS 1P0MA 1PT8A 4EY7A 4RK7A 4FGJA 4JMPA 1RKBA 3GF4A 1RPJA 1SELA 1SUFA 1N34B 4A5SA 1FNMA 4BC0A 1PZNA 1T3TA 5KSOA 2PL1A 3NRBA 1PI3A 2G36A 1IEVA 1TUIA 1Y3HA 4NR0A 3WRYA 3SDSA 5GGYA 2BR5A 2IP1A 3EHEA 2P4SA 3K30A 2I99A 4KACA 1ZH2A 3MUFA 4JVLA 4V1CI 4JEMA 2PZJA 4BO0A 4U9UA 1K66A 2Q8QA 2JD0A 3I9FA 4HNAA 4V0QA 5E7MA 4RLFA 3D2LA 4YRDA 2HK7A 4K81B 3ZDQA 3VYUB 2IDKA 4C6TB 4PHGA 2QJOA 5B3JA 3ZK7A 5AXAA 4E5SA 2LXNA 4JFRA 1RXUA 4PO1A 4AQYB 4KFTA 4HLDA 5GZ6A 2O5CA 3GGOA 3IOCA 3WLQA 1SXJB 5ALRA 1DTEA 1MORA 1PT6A 1X38A 5ALGA 5FWXB 3BIFA 4E03A 2ATVA 3FBTA 4DLUA 5F3WB 1AN9A 3G79A 2W71A 3QPWA 5FFNA 3TRKA 5KJCA 3AVQA 5ECDA 5EE0A 4DIEA 4EBBA 2WJWA 2P6PA 4EEXA 2PZFA 3PTAA 2XRFA 4ZYLA 1UM9B 5EHXA 1AOXA 4FFDA 4LWOA 4P7JA 4PLGA 1R6AA 3DEIA 3ZLUA 5CBKA 3Q87B 3A1CA 4FYVA 3DZFA 3U7JA 3AQ4A 3UW3A 2OO3A 3T7RA 4RV4A 3TX2A 2O1WA 3L6BA 2QTNA 1M2GA 4N0PA 2XE4A 2QAIA 3EXHB 3PQEA 4BQEA 3MILA 1KJ8A 3LC0A 4F5DA 2B0JA 2I2WA 4H4DA 2I29A 4YJFA 5LMUB 2V7GA 1UINA 4DCJA 3TAHA 3I45A 3HVHA 5K2MA 3TCNA 5E1BA 3LRXA 3D3QA 3Q10A 1J2TA 4B6OA 2A9JA 5FI1B 2E4XA 3VPFA 4AJOA 3E4DA 1LF0A 3QUCA 2C2MA 2PWZA 3GLIA 4ADSG 2JAUA 4QUGA 4N76A 3KKPA 1OLXB 3EVTA 1NURA 2BWJA 2PV7A 3ZPXA 1E2BA 2D4HA 5L3ZA 2FSVC 5TQ2B 3CJQA 4YRGA 3L6OO 4ZO7A 1G20E 1YVPA 4QG3A 4HZUB 1XVLA 1U04A 3GJ4A 3ZV5A 4BFVA 2AMJA 1H3NA 2X0NA 3R6WA 5KS2A 4PZZA 1JNXX 3D3WA 4QGAA 5AP9A 1FP4A 3QKWA 4KN8A 4V0OA 2HDHA 5FBZA 2XQKA 3TLJA 2C2OA 3K0FA 2KLHA 2P5TB 3L0SA 2QRUA 5JROA 1WHSB 4C2TA 3I9V6 3UMRA 1PNRA 3IB3A 2H52A 1YZYA 4FWBA 1PQ4A 3D6MA 1MIOB 5MGNA 1R4ZA 2GJAA 1DRJA 1ODSA 4K3VA 1M2EA 6Q21A 1NJ6A 4QEKA 1CY2A 3MFQA 1IFXA 2SKCA 3FGPA 1H2BA 3HGTA 2QR5A 3MJFA 4OSEA 2N3ZA 1KQPA 2G7ZA 3LL7A 4E2FA 1T9ZA 1P29A 2JEZA 4LDJA 2WP8J 3WRWA 3MHPA 3FKJA 5C1IA 3V7NA 1TO2E 4FBLA 5LOVF 1DXOA 4CN8A 1BDHA 1FTNA 3QUBA 2OCLA 4AMZA 3QNWA 1Y6RA 1U31A 3OIDA 2GXQA 5FOUA 3TTWA 3WWCA 4KP7A 3VOSA 1U2QA 5CFMA 3K2IA 1W5FA 1E89A 1O58A 1QVRA 4PO8A 2ZJ1A 3RAJA 1YI8A 3BN3A 1V7CA 2IZ1A 1V25A 2NQ8A 3LT1A 1R74A 3SF8B 2ZJ6A 1MXFA 2A0YA 2KB0A 1N77A 1DBIA 4QTYA 1E3WB 5TS3A 4BNGA 2I2XB 4G01B 1UC4B 2IRWA 3HSKA 4L8FA 4LXUA 2VHYA 3ZZ0A 3FAKA 3VO1A 4HAZA 3GQVA 3RS4A 4DA9A 1ECBA 4Z7NB 1N0IA 4B9AA 3DZJA 1Z08A 2Q5HA 4FDUA 4M9UA 1CDZA 1YDFA 1Z4IA 4Q24A 2P67A 4KSCA 5ALSA 3MYYA 5EEGA 3TD2A 3DTTA 4KVFA 1X7DA 3HCAA 1SHJA 1O08A 2AFIA 3C45A 3JWIA 1I36A 2X9GA 2EEPA 1JKFA 5EQJB 4YP1A 1O3YA 1QM5A 2HTFA 3PU6A 5EE1A 5B1HA 2GEUA 4C06A 2F3SA 4PSVA 1MVNA 4N65A 4WK4B 3REGA 5IDWA 1KFEB 4V1CB 2XOKA 3GK3A 1CLUA 1G8HA 1L4YA 4MUIA 4UARA 3ROEA 7AT1A 3H42B 1T15A 1ZN2A 4I50B 3HUUA 2PMFA 4V38A 5AI8A 3BFJA 1CFZA 3RVBA 4FB5A 3CBQA 1ZH0A 3WLEA 2PGDA 2R97A 2ZRIA 4PZDA 3C98A 2C2XA 1NC1A 1KEUA 3AVYA 4QQ8A 1M2NA 2DE0X 5CEEA 5KYYA 1OXVA 2CCGA 2NM0A 2P1DA 2XUQA 4KQCA 1SGWA 1FQKA 1X7GA 4LXTA 1DAHA 4HNHA 2RCYA 5FTMA 3C8HA 1B74A 1KZ4A 3OHPA 1OSNA 4TLLB 1BYIA 1SQFA 2C9YA 2NZXA 5CVJA 3SZMA 4FX2A 4L75A 2QZSA 3WGKA 1S89A 4L5BA 4KK3A 4U5XA 2NO0A 4I9FA 1EZZA 4XAQA 2P6NA 1P9LA 1QHHB 1Y5RA 3K15A 3W2IA 2G06A 1PK8A 2KYRA 2R11A 3A4LA 5BVGA 5IXSA 1T1GA 1XZFA 4QHTA 4KI0A 1PJ2A 3GV0A 4IJ6A 4K88A 4EWLA 1E2PA 1BVYF 1TM4E 2Z5GA 3RAEC 3EJ6A 4UNSA 3RVRA 5ADHA 3JQBC 3HL0A 4MUMA 4LSWA 2XLCA 3RG2A 4DUZB 4IIXA 4FE4A 3LLVA 5AVZA 4ZVRA 2P9JA 3VAZA 2FI1A 2YXBA 2J1LA 3TYXA 3WDSA 2BGWA 2HCJB 3BK7A 3S4YA 2WZQA 1IVYA 3DE7X 2F8LA 1FDOA 3IRVA 4IMPA 2G0AA 3CKMA 4JYPA 4R2KA 4XYEA 3ZJYA 4HUTA 1F5NA 4PZAA 4BXOB 1I10A 1PVOA 2GEVA 4HCJA 3I9LA 2P41A 2WD7A 3QLVC 2A4MA 4B35A 1PZMA 1NQOA 4FHGA 1RZVA 1NONA 5KYGA 2ZAMA 4RVCA 1KSHA 2IH2A 5LUBA 1JAIA 3HEAA 4OP2A 4RA9A 2R84A 2AUNA 2I2CA 2ODNA 2BZ1A 4J90A 4KGZA 5HK8A 4G9EA 4N8EA 3RNLA 3B12A 4DY4A 4JX9A 5JMWA 1WD7A 2YYSA 3BCRA 4ARZA 4B4KA 5KINB 1CUJA 3O4HA 1G2IA 4O29A 1G21A 1AIPA 4YO8A 1Y6ZA 1T0UA 1X7ZA 3KZXA 3RTAA 3V4FA 1Z0JA 5BRNA 2V7UA 4AS2A 2ZQZA 2GD0A 3LQ2A 2CXHA 3B6MA 2BONA 2GNOA 5REQB 4U2EA 1HFJA 3ECCA 4YJ3A 4O2RA 4RVNA 3D8NA 4C89A 2GM4A 1VSVA 1N2CE 3B85A 5EE9A 1FL9A 1OX6A 3U0VA 2IQIA 5AM3A 2PSDA 2JAWA 3JXEA 1INLA 1G5IA 3QXGA 1IHOA 2KJQA 3BMNA 4LE1A 3WL7A 1H93A 4QZVA 3SYMA 3PKIA 4DSZA 1UDWA 2GWHA 4MVXA 4BWYA 3HYLA 4OG2A 3L4EA 2I8CA 2BGRA 4CU2A 1CRQA 4J1NA 4R4JA 1HEUA 1PGQA 4Z9FA 4DPMA 1R66A 1YB5A 5AJYA 4BP1A 3HP7A 3CSUA 2XUAA 3NHYA 5FOXA 4DMFA 1JBQA 1XCGB 2F90A 3GT4A 1E61A 5F2KA 1YZVA 1OIVA 3GZTB 2GT1A 1I3LA 2W2KA 4WCVA 5CB4B 4F3KA 1CE8B 3GVXA 2Z2ZA 1X13A 1UQRA 3MINB 2ZWOA 3HEBA 3V1YA 3AEXA 3OQBA 1BQEA 1Q15A 4GPD1 4QUBA 1II8B 1I9CA 3FUXA 3PFFA 4NBKA 5DIFA 4OUDB 4EKIA 1WULS 2ZR7A 3BGSA 4P82A 1Y8RB 5H9WA 1L5FA 4OM8A 1ISFA 3LBHA 1OXKB 5CDYA 2WAAA 2WTXA 3H2BA 4RIEA 1S3FA 2IZ5A 2QSZA 3LDAA 4JB8A 3O3OB 1J70A 5JH7A 3PGVA 9MHTA 3H7AA 1CQJB 1T8UA 1YE8A 4NJOA 5CNJA 2FWJA 1ZMOA 1LXCA 2YWHA 3NBYC 5CBPB 2DOKA 1H05A 5KDLA 1PHPA 1U11A 3EBLA 1C8KA 4DRZA 4RDCA 4BZZA 1M2VA 4M1WA 4QXOA 1X7WA 3KYDB 4LOLA 1YDWA 5C8YA 4DLNA 4GX1A 3U49A 3K1YA 5CFPA 4PQYA 4XZ3A 4K9NA 1MPXA 5DW3A 2BMWA 1K68A 4FX5A 3R7WB 3TL3A 3ZUGA 4A73A 1E6UA 3HWX1 2ZUFA 1DKOA 5CLIA 3RC9A 4P98A 3ZWVA 5ILOA 4MWEA 1FJXA 5AUPB 2IBSA 4YDHB 3TMYA 1DARA 2FQQA 1OIXA 3D8SA 4LZJA 2XNDD 4GKAA 3L82B 3RUCA 1O4VA 3N1UA 4D97A 4AWAA 4MVJI 5HOEA 1Y6GA 1U9IC 3RIYA 3NV9A 2VJKA 5FTJA 3VO9A 5K8IA 2EFJA 1YUBA 2WTMA 3GCWA 1V11B 2GDZA 2IPXA 3MFYA 3SC4A 2RGGA 3V6LA 4GMKA 5C81A 1QWOA 1QZTA 3HP4A 1HLDA 3NNDA 3ZJ4A 4ZRMA 1IXRC 1H2RS 1ZG3A 3ET4A 2PZMA 3FWYA 3W8EA 2GEKA 4MAFA 1FYDA 1ZVMA 4MQUA 2DKNA 1NFQA 1YE5A 4Y6PA 4NOMA 4JOBA 5I4CA 1QO0A 2YFYA 4KXVA 1WSWA 1JDNA 5BSVA 1CQXA 2B2CA 1KOFA 2O0HA 2ZIVB 1K63A 1P91A 4G24A 4AICA 3PPVA 2SNIE 4BLTA 1XLTC 2EIHA 2B21A 2VRCD 2A6PA 3B6IA 3EEIA 4Y9UA 2A78A 1G2OA 5K0BA 1Z37A 1P31A 1AS3A 4B76A 1U7UA 3QWFA 1T2FA 3NTRA 3GRCA 4TMZA 3SXPA 3EXAA 4Y2UA 5JJ5A 4GWLA 1LI4A 1XWIA 2ZE6A 3BQ9A 1DVRA 1JA9A 2WUDA 3CISA 3SLRA 3DE4X 1N3IA 1MZPA 1B8UA 3SKYA 5AMXA 1QHSA 1VJRA 1Z6GA 2PZLA 1C1HA 4P81A 1JDJA 2GUGA 4YB8A 3QJYA 3V55A 3U7QA 3UK7A 3A6DA 3BWDD 4H7IA 1YF3A 4HDRA 1QSGA 4ASUA 1A9TA 4O59O 5K0NA 3B9RA 1MW9X 4LYDA 4LY0A 1BA3A 5BW8A 3GPLA 4HQRA 4PZ0A 2NGRA 2YUTA 3JAKB 1WPGA 3S99A 1O0BA 2D7DA 2RHDA 3RODA 4QYIA 5LQCA 1XNRB 1QIDA 1SUPA 1SOAA 2F9FA 2G82A 3C3JA 3CPHA 4IWNA 3T7JA 2CLHB 5AOCA 4W7SA 1VKOA 4RD4A 5LMZA 1NXOA 3R6DA 5EWMA 3R5KA 1MOZA 3GAZA 4HB3A 4AN0A 2O8DB 1A7JA 1IB0A 3T15A 1P8JA 3ZE1B 4BU1A 1O6GA 2PHZA 1Q1GA 2F1IA 1C0PA 5CH8A 5ER9A 1J49A 2ACWA 3SXJA 2J8ZA 1KMHA 1HDRA 2NNLD 4IIHA 1OD6A 4N8DA 3OVMA 3S7TA 4BJHB 2XUKA 4B4DA 1KERA 4DMMA 2JL1A 1JEYB 4EMBA 5JXJA 3I1JA 2GJKA 1FQJA 2PAFA 2FLVA 1H4VB 1VJ5A 1YQDA 3WL8A 4PGFA 1Z0KA 5CNMA 1TYZA 2IBMA 2ZE8A 1ECGA 4RJ2A 3IL2A 2OCKA 4C05A 1F0KA 2DUUA 2VQ6A 2ZRFA 4F56A 3N2LA 4XQGA 3T3PB 4BMYA 2LIPA 5DTQA 4H59A 1RPAA 2PSEA 2X9QA 3VSEA 4JI1B 4GPEA 1ZM9A 5ILQA 1VRVA 1B0AA 3ADBA 1UZLA 1IMJA 4YMHA 1ZNXA 3F71A 2IS6A 4DRYA 3B3FA 2PFKA 2CVOA 1WVIA 2DWCA 2PKQO 3IIJA 2LCQA 1FRFS 6REQA 7GPBA 1MJGA 2QQFA 2JLBA 1G7CA 5KCMA 4YMLA 1XSEA 4MA0A 3OJOA 4J9VA 4JELA 1NTRA 1XRRA 1XVIA 1VL2A 1V1RB 2Q3HA 3D7RA 1EX6A 3K9CA 4AX4A 1EWYA 1W48A 1NU6A 1BHJA 1IJFA 4JENA 4EAQA 3FOEC 4P1ZA 2VQEB 1V4BA 3L1HA 4NEQA 5JRZA 2HU8A 3LY9A 3UHFA 1ZM3A 1DTWB 2WA1A 1DC8A 2HXYA 4Z4FA 1P0PA 2UYQA 1M54A 1D6JA 2OV4A 3QWHA 3BDIA 2CNDA 5JSZB 4P80A 3A3NA 1T5LA 1K8ZB 3WL5A 2QTCA 5A4AA 1CZOA 2GD6A 1UUFA 3LYHA 5B6JA 3DCIA 3PNPA 1E9FA 2FSGA 4HXYA 4KXXA 5FA8A 3QKSA 3T7IA 3PXUA 2QN6A 4DIDA 3ZV3A 5CA0B 1B7GO 1TVKA 3NT4A 1A3CA 1J4AA 4UHFA 2NQTA 4F4DA 3NC0C 5DRYA 2PX4A 2HWYA 5ISMA 2UVQA 3EIEA 5BNFA 1GZVA 3WMXA 1UJ4A 2VJAA 3I1FA 3NGLA 1XP8A 4IDNA 3OTHA 1EFKA 1KR2A 3JD0A 5ALOA 4K0KB 1I0LA 5CAEA 2H57A 3NT2A 4ZPJA 2WIDA 3G9TA 3G2KA 1WXEA 5AHOA 2OQRA 3GLKA 5DIZA 5F9HA 1BCSA 3STUA 2MIIA 3ROTA 2IEDA 4R7ZA 1Y7TA 4YRLA 5KOIA 3QE9Y 4LE0A 1AZLA 2WHXA 3SP1A 3UXHA 4YHHB 2ZM5A 3E23A 1AHNA 1CNEA 4L85A 1NVDA 1TVMA 3BMQB 2M98A 3RJ9A 1DAKA 4AY4A 2XNKA 1XK7A 2O7VA 4KPUB 1V3VA 5AD1A 3HGMA 6NULA 4N7RA 3OZIA 4YASA 1U5CA 5J2TF 3STXA 5EJ9A 3DDSA 3T3EA 3K1JA 1F2TA 3X1ZA 1FLDA 2D0PB 3ZI7A 2W6QA 4M1ZA 2EQAA 3LE8A 1Y8ZA 1S2LA 3F8SA 3CW8X 3H5AA 4YCSA 3T3OA 2J3LA 1CQIB 2XNDA 3A6HA 1YAJA 3FROA 3KAPA 2R00A 4O02B 2H7VA 4U6NA 5K0FA 2LP4Y 3O2SB 4UNNA 2BHSA 2E1RA 4H35A 4PX2A 1WKVA 2VDWB 5AHKA 3T6KA 5BYKA 3BE5A 4F9EA 4CKEA 5E3HA 5LP1A 3GZ4A 4ID9A 2XMZA 1OGYA 4Q3AA 1ST3A 2DG2A 4NZNA 4E32A 2P1RA 4JI2B 5DB4A 5CGZA 2Q9CA 4UASA 2NACA 5HTOA 4IEIA 4RCYA 1QZXA 1JU9A 2VLIA 3VKVA 2QX9A 4O4IB 4YRTA 4CV3A 1VTKA 4CF6A 2VRCA 1M2KA 5F78A 2Y2VA 3KYCB 1Z3CA 3B20A 4KDFA 4AECA 1PV2A 4AC9A 2ZRMA 5EQDA 4D6YA 4G6ZA 3VKHA 1RVDA 1I3CA 3FUTA 4KIGA 4LTDA 1HRKA 3JW8A 4AZTA 1JBKA 5M5BA 2ISQA 2IZZA 3MYRA 2I78A 3TGWA 4J07A 2H4XA 2HO4A 1TJ4A 3ELUA 2XUFA 5JOQA 1EIZA 1Q22A 2ZAOA 3NC1C 4G85A 3D0RA 4BMZA 1I94B 1E5TA 2YC4C 4P2GA 3HCDA 3PE3A 3EMDA 3LHFA 4CMGA 1XTVA 3E27A 1KA9H 3TDNA 5DEIA 5ULLA 3H2KA 2Q6LA 3CU5A 4EHHA 4PRZA 2BJVA 3SEAA 4F85A 2Q28A 3B3GA 4WTOA 1VYHA 3CKKA 2FW6A 1ZQ1A 2QMEA 2HOQA 2YJNA 2HM7A 1WU7A 3NEYA 1R3DA 4NE7A 3NYQA 4R1QA 1OFUX 1SO8A 3GOQA 1V3TA 4BQOA 4UNQA 2DLNA 4IJMA 1BN7A 1UFRA 5A5GA 3WTCA 5FEMA 1GNVA 2B6NA 1PWHA 2BFBA 4NU6A 3MTAA 1EUCA 1C41A 3C43A 1UK9A 3DLBA 3UB2A 3I2HA 4Y1RA 1OAAA 1U2PA 3EZ2A 4XD2A 3UCXA 1IY1A 2Q6KA 2ID8A 2A0FA 3LKDA 2JGDB 1Q0TA 4CTMA 3L1JA 2IPAB 1WBJB 1XTUA 2CNBA 4DR6B 3H11A 2CZCA 2XITA 1P62B 5E6UA 5D51S 3QI7A 2D1RA 3KDPA 1B1CA 4LHEA 1XOIA 1GPLA 1Y6JA 4LYGA 2C7PA 3DVLA 1BEZA 5CT4A 5BNZA 1TTHA 3GXBA 4FB4A 1MEEA 2ZSHA 1EGAA 4BX8A 3CVXA 2FY8A 2QRQA 5KHAA 2ODPA 1XPJA 3KL4A 3RAPR 2IHNA 3F97A 3NATA 3O21A 4Q66C 3NVKI 3D7NA 4A0QA 2YWRA 4AO6A 1L4BA 1M33A 4PNZA 3FDFA 1XALA 4JP3A 3GDHA 3K20A 4JBXA 2P4HX 2N42A 2R8YA 2DSTA 4FQ8A 4U6QA 4XJSA 4EO7A 4ZZ0A 4RULA 4RPHA 4HAOA 2AUMA 2GEDA 1BD3A 2AZMA 1GTRA 1C0KA 4FHDA 2J3HA 1DLJA 3CY6A 1L8OA 3HXTA 5B3KA 4BGDA 3KR9A 1KDVA 4F9GA 4MKZA 2WICA 4HTFA 1QYCA 1WW3A 1YQXA 4TT3D 3GQBB 3JQ8B 3ODPA 4I3FA 1D1TA 2P9QA 1ZK0A 1RWMA 4UBNA 1CZRA 2VUSA 1E5XA 4A23A 4M0EA 4GRIA 1P9OA 2BBOA 2Z09A 2HK9A 2IU0A 4EJ2A 4E1AA 2F9LA 3MS4A 1LBTA 1C3OA 1MEOA 4NK4A 1Z4NA 1M6HA 2DMRA 5L3RA 2ZQ5A 4JXJA 1Z8DA 2YQ5A 4F4CA 1XZQA 1DB3A 4KWCA 3DKRA 1QVVA 5DYYA 3DAGA 2WKPA 1AKWA 5ALNA 3EF0A 3QGMA 3UG7A 2GDJA 5JXHA 1JFVA 3C7KA 2ODEA 3I2JA 5HVNA 4LJ5A 2CVFA 3WTBA 1YWGO 3MWGA 1KIFA 1YCDA 2QROA 1ECCA 4XIIA 5JI3E 4DV5B 1X6VA 3IURA 1FSZA 3RBXA 2ZYWX 1NJSA 2DFVA 3INNA 1CPYA 1KO7A 3SYKA 4XYGA 5I5EA 2FPWA 1SC3A 2O3SA 1G0OA 1T1EA 3DFMA 5KUTA 1ZOIA 4IDQA 5FADA 3FVTA 3I73A 1C9NA 2JRLA 5A5DA 3CPJB 1XHEA 3T9CA 4ALJA 2VH2A 5DYWA 2QTLA 1EFPB 3QPCA 4DDTA 1DUVG 3KJXA 3FNIA 4V0RA 5DM0A 1M83A 3ZIUA 3NOQA 5CDSA 1F1BA 2WSSD 4JJFA 2ASEA 2ZTLA 1QGZA 2PBRA 2G9UA 5EP3A 1M34E 1HE8B 1WPXA 4M7OA 4XVUA 3EXG2 2XCOA 3PFCA 5BMVA 4OLJA 3DKIA 3KT6A 1GFIA 1XD2A 2XVXA 1AGRA 4AF7A 2A0KA 2R44A 3WR5A 2R4QA 4H7HA 5CDGA 4QUKA 3WYBA 1E6EA 5KVVA 4JITA 1FE8A 3RNOA 2B2NA 2XWJI 5J5CA 4EZEA 4TTJA 2X13A 4Z3KA 5H8WA 2GN8A 2VSXA 1YL6A 3DLTA 2Q45A 3H9GA 1RACA 1VJ0A 3VPAA 5EJ7A 3BGWA 2QYTA 4EYQA 1MU0A 3VSAA 1GFSA 1XZBA 4RH3A 1SD1A 5F2OA 2ZVJA 4DMHA 4JIGA 4I55F 3E22B 1NZJA 2B1GA 3BERA 4KWIA 1VIMA 2Z5VA 2WZDA 3N7AA 2R6CA 1MO6A 2WUFA 3FSJX 1L7AA 3KLOA 3GT7A 3OKPA 3DUFA 4PLTA 2X9VA 1YQUA 1HT2E 1MVLA 3FZEA 3HZOA 4K9RA 2ZIZA 2ZKIA 4CTKA 2IEAA 3W4JA 4Z9YA 1MRZA 4MLCA 3D31A 3H0CA 4EGAA 5L45A 2D1YA 2JCVA 5B2ZA 3HCWA 4XDGA 2Y77A 5JCOC 1J8MF 1KJJA 3UK2A 2D2EA 3SQNA 2VS1A 3GNLA 4OAPA 5BNWA 3A28A 3LP5A 3IQXA 3QUQA 1JQEA 4EELA 5KTMA 4MP8A 3H5LA 3PJDA 3KS9A 3R7NA 2YFKA 2HV8A 2NZ2A 3WWOA 4IH9A 4KG7A 4KPYA 3WGUA 1BZYA 1O87A 3NKFA 2Q49A 2XHEA 4JNCA 1ZN7A 2PQ6A 1JAXA 3GUCA 4U9HS 5AKHA 2PN1A 2Q7OE 3T5BA 5MFZA 1KRXA 3HXOA 4M1EA 4UM7A 3BORA 5EIAA 2I8LA 5I7WA 3UTDA 1NUAA 3AM5A 3O94A 4EA7A 1RJ9A 4Y9RA 2CWDA 3UH1A 2DFTA 5DLEA 3ZDFA 3EE6A 2W2LD 3GRFA 3EMKA 2WU0A 3DYVA 3HADA 4XTRA 3LYAA 3SU8A 4BLPA 4A36A 3O90A 3GLGE 3K09A 3W8NA 3HPQA 2IXDA 2W37A 3ZE7A 5J3JA 2J45A 1Y4UA 4IICA 1ACJA 1IDOA 2QL9A 2X8WA 4MSUA 5JQWA 2VF8A 3DL4A 4N0EA 3QELA 3MPUA 4AUKA 4CEIA 3Q12A 2GFHA 2QUIA 5K5EA 1OZHA 4HYQA 5JRJA 4PSKA 2ZRJA 2HBZA 4PSDA 5KAPA 4K9QA 4CI9A 4EFMA 3THXB 3WGHA 5A1TA 2P11A 1JG3A 1V1MA 4QAQA 3VX3A 2X1HA 5I9LA 1E5DA 2AYXA 3MJRA 1FFAA 2FPKA 3EGCA 2G76A 4B1FA 4KGVA 1L1EA 1YE3A 1S3SA 2FZVA 3BBLA 5U4QA 4ZO8A 5BR1A 2Y67A 3QVLA 3IPXA 4Y1EA 1PSZA 1L1RA 2XD9A 2J5KA 4TVOA 5IJXA 4AX8A 1X0XA 3Q8KA 3C3AA 3KZVA 2J3KA 4ZV7A 1EG2A 2I4LA 3CJTA 1WLYA 3SIWA 1XDDA 3K1TA 2AN4A 3AUUA 5JAOA 1YRAA 2G0TA 2EF1A 3AXSA 1V7ZA 1Q3KA 1FDUA 4GRDA 1KFJB 4LY3A 1IK4A 4X20A 1Z5WA 4Y6QA 1QUEA 1G60A 1T43A 1ZHHA 4OQYA 4PR3A 3COYA 1TIBA 2QTHA 3HLKA 4CG1A 5I9TA 3ZWPA 4MR8A 4OHBA 1TEXA 3U26A 4FFWA 1RRKA 4XIFA 3HSSA 2EERA 4BS9A 1E96A 1R6BX 1SXHA 2DQ4A 2VVTA 2RH9B 4YJHB 4TSKA 3AHFA 2Y1XA 3EZ6A 1JTEA 1L7VC 1M1ZA 3IC5A 1N2HA 4G37A 5DNDA 2QIPA 4ZAZA 5FUYA 4YRFA 5FWDA 5DYGA 3C8ZA 3DV0A 5IT5A 1FMFA 1POWA 4EZIA 4OBEA 1WJGA 5AK5A 1BXKA 2H2WA 2OYSA 1D6SA 3R3ZA 4GPAA 2WTUA 3MW8A 1BDMA 2OV2A 2IYLD 2XTNA 3AYZB 1J0EA 2VF5X 3FHJA 4AIRA 5DI9A 2H6EA 4BX3A 3X1JA 3Q5GA 1KI4A 1NN3A 1E6KA 1I8TA 2WABA 1K8RA 2V98A 4IKEA 1T91A 5DNCA 2C7BA 5KHLB 2OCAA 3HKEB 3KZCA 4LJSA 3IEMA 4OX9Y 2VWGA 4MYUA 1YNOA 1ULAA 1CDOA 1GOTA 1J9ZA 2ZTSA 2V7VA 3JQAB 4FNOA 4IOLA 4MV7A 4RHUA 1QCZA 1IHUA 1QRDA 1UKEA 1JDPA 1UADA 2QTZA 2GOYA 1W35A 3EG9A 4UUBA 1GARA 4P5PA 1XZDA 1FK8A 2V6IA 2MJLA 4NKRA 1EX1A 4OHRA 4KDCA 4ITUA 2UZ1A 3RK4A 4HK4A 2LZ0A 2H7YA 2OV6A 1EGHA 3DYIA 1E59A 3EBPA 3LQQA 5I9BA 5K0JA 5KYXA 2XVMA 4EI2A 5J1SB 3AHHA 1JHPA 1GQFA 4JI5B 3ZTWA 4C20A 1WMAA 3F1LA 1PDOA 3TIIA 5B7QA 1HG1A 1USKA 1GEEA 2G83A 3DFZA 3I53A 3NYRA 3B36A 5AXCA 4NPAA 5IHXA 5E95A 3NGMA 3PC6A 3QKRB 1L3IA 1GIAA 3CLTD 2Z57A 1X7XA 3QTLA 5GAJA 4E7PA 1OXTA 3LOQA 3HNRA 1G7TA 3GRUA 3B7WA 4ANFA 2VDQB 3HJFA 1KU0A 2FA9A 3IIMA 4RJLA 2IF2A 4R0MA 4F1WA 2X40A 3G23A 4MYCA 4RF3A 3S1AB 4CM3A 2C5AA 4L08A 4WKCA 4DDHA 1QYIA 3B48A 4AJNA 1E0SA 1BA2A 1NBME 1N7JA 2WSSA 2HIHA 3NHFA 2OBXA 3PLNA 4X93A 3UJDA 1AKNA 1P4RA 1C1XA 3JTMA 5GOZA 3K70B 3C6MA 3IERA 3FPAA 1MX1A 3FDZA 4V0NA 4MPTA 3LYUA 1RQ7A 4X44A 1LQTA 4YUXA 1L5HB 1PUXA 1HE5A 3KKZA 1IC6A 2O7QA 2JNWA 4FOLA 4JS0A 4KFUA 1J5EB 3EUEA 5F51A 4TX1A 1GT91 2DUWA 3ENZA 4MV6A 1Y8AA 5AT1A 1YS7A 3G2IA 1J39A 2DHCA 4IUCS 4JC5A 1E2IA 1Z0FA 3BIOA 3OLCX 2ZPAA 1ZGBA 3H13A 1KNQA 1OPXA 1M1XB 5ALQA 1Z12A 1SY7A 1E1MA 2BBTA 4QYWA 2XNSA 1KZHA 4J6EA 4DLLA 4Z2AA 4F93B 1JFTA 5KTKA 2X7JA 3AVTA 3M70A 3F6BX 3G6WA 3FPFA 3R3JA 4CMKA 5CVDA 1XEAA 3B38A 5BVHB 3BB4A 3C7AA 2FF7A 2NUTB 1ZGAA 3VR5H 3OTGA 4YPVA 2QRMA 3DUWA 4NDNE 4N4AA 2A3RA 3PQ6A 4W7IA 1EESA 4UXJA 2OAP1 3K4HA 4PRYA 3T4EA 1EH5A 3PUZA 1BAPA 4ZU3A 4QBHA 1LS1A 4RGBA 4YX9A 5BUQA 3UKDA