3HYTA

Structural basis of gdp release and gating in g protein coupled fe2+ transport
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
245
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVRKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis of GDP release and gating in G protein coupled Fe(2+) transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 81
structure length 245
sequence length 260
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hytA01
1U0JA 1H8HD 2VIIA 4JSYA 5CB8A 2G1JA 5FPTA 2Z5FA 3E1SA 4A8JC 3SQXA 2ODNA 2XNSA 4I1OA 1W0JD 2ZE6A 1VPLA 4BEBA 1D2MA 5EXXA 3BE4A 2KJQA 5EP1A 3GLIE 1Q1ZA 2MMGA 3ZIAD 1KO1A 3HU1A 2ZE5A 3PCRB 4XJXA 5DGXA 4BUJA 1UEIA 4L9WA 4PO9A 4V0ME 5FI0B 2ZSEA 5E7MA 5JHGB 1XXHE 3DM5A 3DPUA 3W6OA 5J4VA 2HXYA 3IILA 1W4BA 3NC1C 1EK0A 5JEDA 2ZU6A 4DLXA 1YQTA 2CLSA 2OILA 4WVFA 3UKDA 5BW8A 4DHEA 2LWIA 2ZJ8A 2QAGC 4PANA 3BD9A 3K0EA 4W9MC 2ZJAA 3MSXA 1IOZA 1ZU5A 2PX0A 3GLFB 3SR0A 4PQYA 2W2TA 3MWJA 1LY1A 4OQFA 4BLSA 1T0HB 4B44A 1UKVY 3K0AA 4JLDA 2VP5A 3GJ6A 3WMFA 1ZM2A 2ZJBA 3OFNA 3KKMA 1MABB 1FX0A 1ZMXA 4PC2A 1II9A 2OE2A 4C30A 4AYTA 3VAAA 2XTZA 3ZVLA 1LF0A 3GPLA 5JI2E 2XSZA 2FJUA 1X1SA 2NO9A 3C7KA 4LYAA 1F2TA 1CTQA 1OH5A 3ZVNA 4BLPA 3OE7A 3EZ9A 2ZI3A 1N6NA 4US1R 2L0XA 4LC1A 1XCPA 2OV2A 1OFUX 1RJ9B 1BYIA 1I2MA 3BGWA 3SOPA 4BLQA 2AHOA 2X2FA 4EFLA 4L4UA 3PEUA 4KITB 4Q4JA 1GL9B 2P6NA 4JMPA 4JL5A 1OXTA 4MYTA 1G4AE 1U9IA 2Q3MA 1A2KC 5IHPA 1AQUA 5FPYA 4IW3B 5EQTA 1IXSB 4HUTA 3EPJA 4C0JA 1A5TA 2JIZA 2FEMA 3U3MA 3UANA 4MRNA 2QQEA 3Q5EA 1NI3A 1NVUQ 1II8A 3HDTA 4G5SA 4GI7A 2H5EA 3MUFA 1E9AA 1QVRA 2EFCB 1OW3B 2CJWB 1VYUA 5G40A 1GFIA 3OESA 2AN9A 3UK6A 4DZZA 1G8YA 1SHZA 2ODBA 3K0CC 4Q00A 4Q47A 4HDCA 1YR7A 2WJIA 2ZM5A 1CULC 1EWQA 3OF5A 5DE3A 2WTUA 3LQQA 1QHHA 4D81A 2AFHE 2GK6A 1VCNA 2W6ID 3ICQB 1T3HA 1KDRA 1TF7A 1MRNA 2ZTSA 1ZCAA 5C1BA 2BM1A 2BIFA 5F9FA 2GNOA 1JBKA 1KDOA 2B7CA 1S9HA 5AUQA 1XPOA 3C14C 1ZC4A 2WWWA 1E69A 2DYKA 1KAGA 1U8ZA 2NO1A 3GLGB 2R65A 2UVQA 2W2XA 3LLUA 2HF9A 1RRFA 3UPUA 5TY0A 2KSQA 3WXMA 4KXFB 1G5PA 4MYUA 1YU9A 3WNCA 1R0YA 1LV7A 3K9NA 4XIGS 4GPTA 1P6XA 5HTKA 2QT0A 3QF4B 4MRPA 1DARA 5FTMA 3A36A 2VP2A 5CLLA 3FFAA 4XTCS 2GBLA 3GJ7A 4OJQA 5JLJA 5FOSA 3ZDQA 2A5JA 4XVRA 5CDFA 3RNLA 2ODWA 2WJGA 3MWKA 5C4GB 2FEOA 3EWAA 4TTRA 4LJ4A 821PA 3ZZ0A 4LWZA 3U7GA 1E2KA 1N6KA 4GZLA 1E2NA 3FMPB 4B6FA 1E1QD 2C96A 3B60A 3EW9A 3I8SA 3SQWA 4R2IA 1OH6A 3K09C 3DKVA 3U3JA 3CR8A 4MA4A 4Q7KA 5DYIA 5L3SB 3MFYA 4PHTA 1KJYA 4B3CA 3Q9LA 5A4JA 1W46A 5G3ZA 2JLQA 2QAGA 1J8YF 4KVGA 3LD9A 4ZDJA 3I73A 2P5SA 1F6BA 2Q3FA 1NJFA 4BZXA 2GTPA 2CVFA 3QG5A 4Q9IA 1CLUA 3LVRE 521PA 3TH5A 2WSSA 4DKXA 1LNZA 3WRXC 1D5CA 2Q9CA 2QE7A 3A4LA 2O8BB 1NMYA 2C8VA 1E9DA 4PFSA 3L43A 2IHBA 1SXJD 1OE0A 3K53A 4I99A 5IF9A 3PVSA 2GHIA 3GP8A 3GLIB 2QRZA 3UG6A 1N6RA 3RWMB 1HEIA 5HZHA 1DAEA 5SZKB 1JEDA 2J7KA 3DZ8A 3P4XA 3GLFA 1KDPA 3OEEA 3SJCA 4M22A 3X1YA 1MABA 2GETA 4QGAA 5FR2A 1GKYA 2H1LA 4EDHA 2VH5R 4RD6A 3IHLA 3ND9A 5B2ZA 4PQFA 5AUNB 1XTIA 1TQ2A 4B3DA 4IJMA 4LJ6A 4NMMA 1NN0A 4O25A 1U99A 1CS4C 1IONA 1KSHA 4B75A 4CW7A 4DDUA 4F91B 2JDIA 5SZJA 2JASA 3C5CA 4NYJQ 4ABYA 3QENA 3PIRA 3AF2A 4Q66C 4UKDA 3MLEA 2XZOA 3K1JA 1N6IA 4DCVA 4AY2A 2IXEA 5EE0A 3VR6A 5KDOA 4UNSA 2J7PA 2XGJA 1A82A 4Q1AA 5FH9A 3EPHA 1XMIA 1D8TA 4IOMA 1YZTA 1TU4A 3L0OA 4JBXA 2ZAMA 2BV3A 1PLLA 4LPSA 421PA 3LA6A 4BQSA 3D3QA 2PZFA 1CRQA 3PFIA 1N6OA 1JJ7A 1WF3A 4B74A 4G0NA 4NL4H 1N25A 4A36A 2CJWA 4MQBA 1IXRC 1ZINA 3QJYA 1S96A 2W00A 5EUQB 2PT7A 4TQAA 3P4YA 3KKQA 2J0VA 2Q9AA 4B6EA 2V7QD 1UBGA 1T8TA 5KPDA 3FHTA 1SVKA 1FUKA 3PUWA 4TQUS 4JLKA 2IF0A 3EPLA 1TMKA 1PVOA 2ZJOA 2GJKA 3QVVA 1YE8A 1NLYA 1S0UA 1KI8A 4HAVA 4Q9HA 3AVYA 2HYDA 2IYQA 4E22A 3NXSA 3BK7A 3R8FA 3MWYW 4KU4A 2YWHA 4WIAA 3W34A 4OI4A 2OBNA 2PMKA 2NO6A 2OBMA 2ZJ5A 4FMCB 2V3CC 4RD4A 3K09A 1V43A 5DHAA 3S1AA 2OXRA 1P4SA 5GVRA 4GMXA 2J45A 3QF4A 1YR9A 5BYJA 1GNQA 1XD2A 3U6BA 4NDZA 5F3WB 3RSLA 3UIEA 2WKQA 2H18A 3NG1A 1E2MA 2FSIA 3W3ZB 3WHKA 4B35A 4B47A 2DPXA 4TYQA 3WMGA 3AVOA 4JYBA 3D7MA 4Q18A 2XXAB 1G8GA 2V9PA 1DTSA 2HJGA 1AZTA 2A78A 1CJTC 2DCUA 2CVHA 4OHYA 4RD0A 4KSBA 4WZ6A 1NBME 1NY6A 1KI6A 2PLRA 1NF3A 1NSTA 3NC0C 5DI9A 1N6LA 3KL4A 4KVAA 1PV4A 1GM5A 1R0XA 3LRPA 3RANA 1DG3A 5L3SA 5FL7D 4LZZA 2ZR7A 1XEWY 2IWRA 2XAUA 2C5LA 4Q4AB 4XTRA 4PZZA 4C0LA 1Z08A 3TR0A 1NG9A 3BORA 4AWXA 2Z43A 4M1MA 3V4FA 3VNVA 1Q20A 2WWYA 2Z0MA 4KBGA 2ORWA 2V8OA 4PC3A 2CDNA 4LYJA 2BBOA 4Q48A 3PQCA 1CJMA 4IHQA 3QOFA 4EIWA 4OI1A 3K0SA 2QPTA 5LD2B 2RKOA 2O8BA 2YKGA 2ZANA 1XEFA 2RHMA 1XTJA 4B33A 1MO5A 3EIHA 4KODA 4TT3A 1TF5A 2CL0X 2CNWA 4E09A 4MDEA 3U60B 2QA5A 5B58C 2PMDA 3SI7A 4A2WA 1SVLA 4B71A 2WJVA 1JI0A 1VYVA 2YINC 4BWYA 4DWJA 2OBLA 1XEXB 4LY6A 4OHXA 3CM0A 2IW3A 3X1DA 1VIYA 3EIEA 1E2GA 3SJBA 2GJ9A 4GSYA 5FPHA 2EQBA 3VTKA 1C1YA 3VHXA 2PT5A 2IYYA 3SNHA 2IYUA 1G291 4BE7B 5FOWA 4ZIRB 3KKOA 4D4KA 2IS2A 4F93B 3SHWA 4PAMA 4Q4HB 3W90A 2BM0A 3CNOA 1UBFA 2D2FA 3L2OB 1NG1A 2KBEA 1DELA 4Z1MA 3GJ0A 2C9OA 2QMUA 4YDHB 4G5GA 1LVGA 4BZQA 1FTNA 2WZQA 1E79D 5JSZB 1IJEA 2ZI4A 1V5WA 1NVXQ 4TWZA 1XEWX 3N5CA 4BFZA 5KNDA 2X8AA 3K70B 1P72A 1R0ZA 2IHYA 3FMFA 1YRBA 4P0TA 4CEHB 3AVVA 4EPTA 5M04A 5CM8B 3RYTC 4BRWA 5KYKA 1VG8A 2VSOA 2VP6A 1E9BA 1NY5A 1FMJA 5K8UA 6Q21A 3B9PA 3QY0A 2QEQA 3CRRA 3SEAA 3B9QA 5JCPA 4JBYA 1S8FA 5HE8A 3BRWD 2RGCA 2O0HA 2XJ4A 1EFHA 4TYPA 1VYTA 2HT6A 2FDCA 2QSYA 1AGRA 1JAHA 1D9ZA 2MSCB 2QORA 1JR3D 4DT1A 5H8WA 4ILEA 5LDDC 3U3RA 1GRQA 1IN8A 3WYFA 3B78A 1QF9A 4X8HA 4B76A 2R6GA 1R7RA 4JVMA 3HYTA 4PO1A 3CO5A 3DEFA 2A5FA 1Z8FA 3JZAA 2YYZA 2ATVA 3VR2A 4YXWD 4CEJB 4KI0A 3KUDA 1UDXA 4IXNA 1H8HA 1JXOA 1G64A 3ZQ6A 2ONKA 4LHVA 2FOLA 3W6PA 1YR8A 2RGBA 1W0JA 2ZE7A 1XDBA 2QROA 4QG7A 1W0KD 2JEOA 3CRVA 2FPLA 3A1SA 2P3SA 1QHIA 1CR1A 3ZIAA 2AKYA 4M1SA 2NOAA 3OIYA 1KI9A 4JLOA 2X19A 5CIQA 1XJ0A 4M8NE 1J70A 3KFXA 1T3SA 5KO2A 1Q44A 3ZYCA 1M7GA 4XWOA 1COWD 3T34A 1FTSA 2UKDA 3PG5A 3KJHA 1KO5A 3LO5A 4A0RA 2XXAA 3KXLA 4XWKA 1FFHA 3A58B 4KLZA 2GJSA 1G20E 2N42A 2CMKA 1MV5A 2CE2X 2IC5A 3ZVMA 4RZUA 3QXJA 4MITA 4US2R 2DHRA 2VRWA 5EXTA 5CM9C 5SZHB 1ZP6A 2ZRHA 4TLCA 1BS1A 5HE9A 1G21E 1HA3A 3HU3A 1T5LA 5B64A 5C2JB 1G6OA 4CT4B 4HUQB 1NLZA 5F9HA 1E2HA 4O2LA 3NTUA 2J59A 4EJSC 2H57A 3THXB 2GKSA 3IDQA 1YR6A 4Q4AA 1SXJC 1T91A 4NCKA 2HCJB 2RHDA 4PXAA 2BEJA 2ZI5A 1SKYE 2B8TA 3MJRA 3BIFA 3BFVA 5K8TA 4IEIA 3QSYA 3KJGA 2ZYUX 2G77B 4TLBA 1NSFA 1P2VA 1S2MA 1SHKA 2QGNA 4C2TA 2CCJA 4TLAA 4JIMA 1E2PA 4A15A 3CPJB 3GD7A 3Q72A 1NNEA 2ZQ5A 3C41J 3KQUA 1CR0A 4YMWA 4ZKEA 4Q7MB 2PLFA 4MKFA 1FL9A 4K8OA 5AJVB 4NYMQ 5BN3A 3QXHA 2K5UA 1JB1A 1Z0KA 3SJZA 3VMFA 2DFLA 4MRVA 3UATA 3BOSA 1W48A 2WAYA 4ERNA 4QNRA 1FNNA 1FQKA 3TIFA 1OH7A 3O8CA 3PUYA 2JLVA 3UXMA 2WAXA 4ACAA 1XEXA 2W83A 5H70A 2AFIE 4AG5A 2VL7A 4NZYA 4PX9A 3RRYA 4QJ4A 3SN6A 1DO2A 2G6BA 2GA8A 4MKGA 3D31A 1G19A 1GUAA 2XZLA 2BMJA 4Q4HA 1KYIA 2W6IA 3KX2A 3TMKA 1FW6A 1XMVA 5AUPB 1GKIA 4XOIA 2YNMA 4A1FA 3EZ6A 3IIJA 3T1TA 1FPMA 3MWLA 5A0FA 3ZVRA 3QXXA 2A30A 1P62B 4D2IA 4Q4LA 4I1SA 5AJWA 3RWOA 5EE9A 3SC3A 2XB2A 3T1OA 4BPBA 4QBHA 1N5JA 3THWB 3SJAA 3Q85A 1AKEA 1HQCA 5FBVB 1U9IC 2ZRAA 2C2HA 1MO3A 4HB2A 3TVDA 1DAKA 1KOFA 2CE7A 4DIDA 4AIIA 5J4LA 1R5OA 3V00A 3VU9B 4DDWA 4EQ6A 5DNYB 4LX0A 1F60A 4DLWA 1KZ7B 1TX4B 4YDSA 3EZ7A 4DC9A 1CJKC 1D9XA 5FBQB 3SU8A 1WBDA 2FGKA 1S3GA 3MD0A 3AEZA 3AVQA 2F43B 3AGPA 1E1QA 1P5ZB 5JFGA 1GIAA 2PJRA 1YZLA 4J0QA 1Z6TA 3L8ZA 3DOEA 4CEJA 1KO7A 1WXQA 2BMEA 4EPYA 4TYYA 4KFRA 3CRMA 4WZAE 1OKKD 2DWQA 4PTLA 1R8SA 4A2QA 1WRBA 1DAFA 1TL7C 2HEIA 2QI9C 4JYCA 1KIMA 4AKEA 5KPJA 2FF7A 5DYGA 4B3BA 3CH4B 5KNCA 4NCHA 1ZRHA 3NVAA 1OB5A 4Q1CA 2EFGA 3UWKA 4QHTA 2D06A 2X77A 2ZRFA 1II0A 1X6VA 3HYRA 1SXJA 1L4UA 3B5JA 2FPMA 3Q7PA 5KSPA 2BWJA 3R8CA 1E32A 1X8LA 1P73A 3H86A 5EP3A 4UNRA 5KUTA 2GBLC 1ESNA 4LJ9A 4M1TA 1HUQA 4PZLA 2ZEJA 4FIDA 5LB4A 5E4FA 2NIPA 3GLHE 1KMHB 3PV0A 4DSTA 3ASZA 3U3KA 1TQDA 2ZRDA 2DWPA 4HUQA 3C16C 4LK2A 4POAA 4ZV4A 5D3QA 3I61A 3THXA 4ZKDA 1WBBA 2CK3D 1JNYA 4Q1EA 1E0SA 1XMSA 2PZEA 4JVSB 4MUAA 4V0LA 4XVQA 1DPFA 1VMAA 1SVWA 4D0LB 2D74A 1M6NA 4LHXA 2Z83A 4I1VA 1W4AA 4MKHA 3X1WA 2FSFA 1I4DD 1F2UB 1RRPA 2C99A 3T35A 4LJAA 4RVCA 5DI3B 4XVUA 2GRJA 2AD5A 1HTWA 4LPKA 2AL7A 2PX3A 4PZYA 2F6RA 5GJCA 4NCNA 2OAP1 3IHWA 4OI2A 2NMVA 2V6IA 4U00A 4KAXA 1JAIA 1D2NA 2F3TA 2NZ8A 3W3AA 3K0FA 1DG1G 4JLAA 4TN1A 1XWIA 1ZM3A 2LCFA 3F8TA 2NPIA 2G3YA 1W5TA 2GCNA 1E2JA 1UADA 5H68A 4BFUA 1G7CA 4HB3A 1MT0A 3E70C 1L2TA 1I4LD 1QHGA 1ZBDA 2A5YB 1CR2A 2HF8A 1W7AA 2Z4RA 3EASA 1FP7A 3B85A 4LJ8A 1Z6GA 2BKUA 3KFVA 3WMEA 1TQ4A 1T9HA 3AKCA 3THYB 2CHGA 1NP6A 2V7QA 4KFUA 1R4AA 3CR7A 3OEHD 1Z2CA 3LXXA 5JHHB 2GCOA 2WICA 2WOJA 5JWOA 1PLJA 4EPXA 5EXPA 5FOXA 1H8ED 1G17A 4N3NA 3LLMA 4KV9A 1JPJA 4U7DA 3DMNA 3VR3A 3IPYA 2HLDD 4DEXA 4V0OA 3B2EA 1S4QA 4KO8A 2ZSBA 2JJ2D 1X86B 2AR7A 3AP3A 4X8LA 1QBKC 4D4LA 5K8IA 1QRAA 1XTQA 4NKRA 4PAOA 4LSGA 3THOA 4FWTA 1KI2A 3THWA 1A7JA 2ZAOA 3LBHA 2Z4SA 5FTJA 1SVOA 3IUYA 2EFDB 1CU1A 2YWGA 1KSGA 4P33A 2QP4A 3T61A 2D4HA 5FI1B 3R7WB 3RS2A 5K8LA 2A5GA 4LRWA 5DO9A 3H1TA 3MMPA 4NCJA 4DIEA 1AZSC 2C77A 4C9BA 1MOZA 4EAQA 4WW0A 1E9SA 1XF9A 2WBLC 3MCAA 2ZJYA 2ZJZA 4GP6A 5FFMA 5FR1A 4OQLA 3TUJC 4DCTA 3K70D 4WA7A 3AM1A 4MDFA 2F43A 2BVNA 3H4MA 4P4SB 5A5GA 2VA8A 4KYUA 2SHKA 1KY2A 1Z47A 4HZUA 2ZUBA 2J9RA 4KSCA 1U0LA 1TU3A 1E6CA 4K46A 2ZRPA 3O8BA 2JLZA 5FL7A 4RJLA 4P4TA 2F9LA 1P60A 3FWYA 1N0UA 1OFIA 2JGNA 3U7EB 3KKPA 3FMOB 3N2IA 3PUVA 1ODFA 4HLUC 4M1OA 2VHJA 3B8HA 1NIJA 4IOKA 1XMJA 5E95A 1U81A 2E87A 1UF9A 2MMCA 3RLFA 4ZDWA 2P0EA 2KWIA 1E1RD 5JS7A 1Z0DA 2Q6TA 3WBKA 1KJZA 1X1RA 3T5GA 4R2HA 2FNAA 3WYGA 2JLYA 2IEYA 1NKTA 5EZ6B 1IAQA 4Q7JB 4FI3C 4QRHA 4HAWA 2XTMA 3EC2A 4I81A 1QHXA 2JLRA 4DDVA 1EXMA 5DLQC 4LV6A 3EA5A 4LBYA 1Z0JA 2O0KA 2OM2A 1UKZA 3DZDA 4XWAA 4EFNA 4LCBA 4TYNA 2VF7A 2OCPA 1NN1A 4V02A 5F2EA 1RVDA 3WP1B 4Z8YA 5LPNA 1RYHA 2ZUDA 2XOKD 3AVPA 4NH0A 1F3OA 1NVVR 1U94A 3BC1A 4LHZA 4R71A 2REXB 3UMSA 2GAOA 5EE5B 4Z54A 4DB4A 5FBRB 3TUIC 3CIOA 5JJLA 3LBNA 4A6XA 121PA 1F2UA 4GRAA 4HATA 5E7JA 3ZH9B 4RCZA 2VPPA 5DI3A 4PPFA 2P65A 2JJ1D 5FTNA 1AQYA 4ARZB 1XXHB 4M53A 1E79A 3KQNA 4OHWA 4P4UA 1X8KA 2G1KA 2G83A 1Q1QA 5FTKA 4E03A 4JZKA 1HYQA 1TPZA 2IL1A 3VR1A 4OQMA 2OLJA 5HZKA 5JRJA 3E2IA 1LS6A 3KZ1E 1BMFD 2O8EB 2OAQ1 2H16A 5AJZA 1NBMD 2F9MA 3TBKA 1K8RA 721PA 4RY2A 1PUJA 1Z6YA 2CLDX 2YWEA 1KNQA 1RJ9A 2BOVA 2AX4A 4Q19A 5KDLA 3HP1A 3WHLA 1OB2A 2ZI6A 4H1VA 1JR3A 3THYA 5TARA 1KAOA 4H1UA 1US8B 2AWOA 4UXHA 4GOXA 5KTYA 1E4VA 3IBGA 2ZS9A 1IN7A 3FKQA 1UKYA 3QXCA 2QSZA 2QAJA 3GMTA 3B1YA 2G0NA 4JBWA 2TMKA 1JEEA 2PL3A 2GJ8A 1Z2AA 2LKCA 2BBWA 1DAIA 4LV5B 4YXWA 1NVVQ 3WRYC 3W5IA 1T6NA 3NKVA 4QHYA 3LQRA 3CNLA 2QP3A 1TADA 1AS0A 4UJ5A 1CIPA 1W0KA 4KBFA 1OXUA 3SE0A 4DSNA 3W8RA 3QBTA 1ZNZA 3QIAA 2OLKA 2NO0A 4YMSA 1WDTA 4RZ2A 3A6PC 3KB1A 4JLMA 4M1YA 4AURA 2R2AA 3QNUA 1ZAKA 1RC8A 1EWRA 3LXRA 2GAAA 2IBMA 1TUEA 1G41A 4OBEA 1COWA 1FZQA 1G8HA 2FG5A 2IEZA 3BWDD 5TXGA 4MYHA 2O8FB 1IQPA 3O8RA 3VKGA 4HLUA 3VX4A 4R98A 1Q0UA 2X2EA 2ANBA 1N6PA 2BCJQ 1Q57A 3R9WA 1OXVA 3GLGA 4OKSA 2WIAA 3KJIA 5L3VA 2V1XA 2ZU0C 4ITRC 1MH1A 4P4SA 4NE2A 4M2LA 2ZI7A 4M1KA 4CDGA 2WWXA 1W36B 2BMDA 1DBSA 3AP1A 2VYFA 3GJ3A 1G8FA 1KI4A 1TNDA 1OXSC 3OHMA 4G5QA 4MYCA 3FPAA 3AV0B 4WXPA 3SYNA 5AJXA 2WWGA 1UJ2A 2VHTA 3LY5A 2GZDA 2O52A 2VSXA 3U7HB 3B82A 2O0JA 1KO4A 4PC7A 1X8JA 2D62A 3N2EA 2ZXUA 2XJ9A 1GOTA 2ZROA 4QJ3A 2AXPA 1F5NA 2OCYC 5EE1A 1I2DA 3DKPA 1E0JA 2ODEA 4A92A 3QPVA 4PO8A 3A1VA 4ZCMA 4C2UA 4DLVA 5EP4A 4CF7A 1ELOA 4S2EA 5P21A 1G3UA 2AWNA 3IEUA 4O0MA 2OEPA 4QKQA 1CP2A 2FX3A 1G7SA 1IY0A 1Y63A 3QXSA 3QKRB 1SZPA 2I4IA 2D7DA 1J2JA 3I3SR 1E2QA 5HCNA 5JRZA 1NL3A 3AF3A 3AQ4A 1VG0B 3ZJYA 4D4MA 2FFAA 4HB0A 2YVUA 2FE4A 3QEJA 2GCPA 3AUXA 1OPXA 1W4CA 1ZD1A 3AKDA 1EFUA 3LNCA 4CRWB 3TJZA 3I1FA 4KHZA 1U8YA 1OT3A 3L0PA 3RHFA 5FBWB 5B57C 4PPQA 1KKLA 4P32A 1GP2A 2O5VA 2O8CB 3GLIA 1GZSA 2YZ2A 1AKYA 2QTVB 2BMFA 1DAHA 2ZUCA 2JCSA 3X2SA 4O3MA 5CK5A 1OXXK 4ARZA 4DXAA 4LDJA 1XXHA 5IDVA 4URWR 1HY3A 4OK6A 1KGDA 1KJWA 5TV2A 5CITA 1N5IA 2F1JA 2J3EA 2QRNA 5IT5A 4GFDA 2IF2A 4OJKA 3ADCA 5LD2C 1MRSA 2Q21A 3CWZA 1E96A 4BFVA 1OLOA 4F4CA 2P2LA 1IJFA 5HKKD 1DEKA 3M0EA 1UBEA 2EFHB 4RFVA 2ZSFA 1ZUNB 2F3RA 1W2HA 5KSYA 2H8KA 3SS8A 8OHMA 4EKDA 3ZGXA 1XJQA 2HDNB 3KJEA 3CRW1 2OSBA 4TSFD 4YMUA 4C7OB 4L15A 4BLTA 1QHYA 1ZNWA 1HT2E 3T06B 4F92B 3IEVA 3AKYA 5G41A 2QY9A 4UNNA 1Z22A 2WV9A 5FTLA 1EGAA 1US8A 1XBTA 3ICEA 3EG5A 2IYSA 4Q02A 4QC2A 3U44B 3TAHA 3BB1A 4ZI2A 3C8UA 2V1UA 4FCTA 1NN5A 3A4NA 4L9SA 2B8WA 2NQ2C 3AF4A 3GJ5A 4H9GA 4C0HA 2E1RA 1TAGA 3LBIA 4Q01A 1O3YA 3W5JA 1XCGB 4Q1BA 4D0GA 2LKDA 1EG7A 1OKKA 3RVBA 1M1YE 2EYUA 5H1YA 3NHBA 1LW7A 4DUGD 2WKPA 2BDTA 4TL6A 3UWOA 2GZHA 2GILA 4Q9JA 1BKDR 1Q22A 3K70C 5TB5A 3TGPA 1G8PA 3KTAB 2QMOA 5FUYA 4NU0A 1XNJA 5L8VA 4PSAA 1S3SA 3PITA 4WXRA 1K6MA 3LWNA 2DY1A 3T1QA 3K9LA 3EWSA 4LOAA 1TQ6A 5CYOA 1VCOA 2RGEA 5BN5A 2GXQA 2O8FA 1XP8A 2ORVA 1Z29A 1BYUA 4TMTA 1GKUB 2Q3HA 2ZPTX 1GVNB 2WWIA 1E2EA 2Q9BA 1E9CA 2IYXA 1GL7A 5JCZA 3LW8A 3O8DA 3IO3A 4AKGA 3TW8B 1Q12A 1DE0A 1GDDA 2DB3A 3SZRA 1HE1C 2C78A 3PEYA 3BH7A 2J41A 3FTQA 1KK2A 5GJVC 5CDFE 1Q21A 2NZJA 1W4RA 1YZKA 3UMRA 3JZMA 1GRNA 2CK3A 4D4JA 1YHNA 2J0QA 3L82B 3LX8A 4NYIR 4S35A 4DBLC 1VDZA 1AK2A 3AF0A 4TLDA 1DVRA 1G9XA 3QF7A 2NGRA 3IBYA 2RGNA 4G5RA 3FOZA 1L8QA 1A1VA 2QTFA 3MRSA 5JJKA 2FSHA 1M2OB 3TLXA 3CF2A 1FMLA 2ATXA 3H84A 1AIPA 1FQJA 1XTSA 3BH6A 3KDSE 4MKIA 3RABA 2IYRA 3P32A 1L7VC 3PEWA 2V55B 2JLXA 5DN6D 2ZYWX 2NG1A 3I62A 4A0GA 3QKRA 4W5HA 3AUYA 2OXCA 1SVIA 1ZD9A 2GDJA 3P26A 2VP9A 4FMCF 4NPHA 1JR6A 3KB2A 1EX6A 4Q21A 3REFA 3A37A 1UEJA 4W5WA 2FSGA 3KQKA 3T5DA 4GZMA 2ZS7A 4D82A 1JQJC 1EFRD 1KY3A 3WP0A 4QBIA 4QBGB 4ON9A 3BFKA 3CW2A 4CIDA 3TW4A 1VKJA 1ZM7A 1KK3A 2QG6A 3BXZA 2FMXA 1OFHA 1CJVC 1CXZA 2VEDA 4XD7D 3RAPR 3GLFE 4QHSA 2HYIC 1LFDB 3SBDA 4CVNA 4KYIB 4URUR 2GEDA 4OK3A 3OEHA 4FINA 1XZQA 5KDDA 4FXPA 2IUSA 2O8CA 2OCAA 3PEVA 3QKTA 3TSOA 1M34E 4GT1A 5CIWA 1H8EA 4AKIA 4Q5IA 3R9XA 4URXR 3V4RA 3RS0A 2VTKA 2GVZC 2ZE8A 4U5XA 5EZ5A 2QMEA 2HLDA 3KQHA 2X1VA 3DM9B 4LI0A 4A6PA 1KO8A 5D3MB 2JJ2A 4AK9A 2W6JD 4FN5A 4V03A 3K0AB 5KU1A 4LUCA 1Y3AA 1Z0FA 3KXKA 1FX0B 4B2IA 3NDBB 4UNPA 2ONJA 1EFTA 1QHNA 3FGNA 4ZIRA 2ZYVX 4GBMA 4V0KA 1G3RA 2YV5A 1AS2A 3CX6A 4JL6A 1RYFA 3IQWA 1T3LA 2FH5B 5KOYA 1E9EA 1U90A 2PJZA 1IM2A 4Q9KA 2GXUA 3PJRA 1M74A 5JSZA 1WP9A 4AI6A 2P5TB 3DOFA 1E9FA 2G88A 2IYWA 2VO1A 3DL0A 5AUOB 4Q9LA 5KHOC 4URZR 3U44A 1KZGB 4PPNA 3Q5DA 4K81B 4EPWA 4CEHA 2DFKB 1ZNXA 3TVTA 1P2TA 2GEUA 3HPRA 4URVR 4HI0E 2HV8A 3OIVA 1Z63A 1P75A 1E3MA 4BFWA 4PQRA 2HUPA 3U3OA 1LB1B 2ZIAA 3EA0A 4N1AA 1KK1A 2IXGA 1XTRA 1GWNA 2BEKA 2J0SA 3DDCA 1DO0A 3K8YA 2WHXA 4QL3A 4WAUA 4C4PA 2A3RA 3TK1A 4JLJA 3CKLA 3BFXA 4DLYA 3BH0A 1ZIPA 3EAQA 3QKUA 2BC9A 2JA1A 2A7QA 2RMKA 4LBVA 4JKIA 5J4HA 1OIVA 1XCMA 1M8PA 1E1RA 4WZBE 3AP2A 1VCIA 2GVDC 2BJWA 4MRRA 1RIFA 1YZGA 4A0FA 3U61B 1X3SA 3OAAD 4TMVA 5GJWC 1UBCA 3AKEA 5FOVA 4OL0A 4JJKA 4RD3A 2BBTA 4IDPA 4IDOA 4DLZA 1AS3A 2YWFA 3NIBA 3IIKA 5FUXA 5B30A 1DADA 5C4MA 4DB2A 1XD8A 3DO6A 1FNMA 1U2RA 2ZRKA 4JLVA 4JVLA 4RZXA 4TZ0A 2XOKA 4FW9A 1KMQA 5FUVA 5JMTA 4JLPA 2CL7X 4NCIA 4A8JB 4W5JA 3AVTA 4TMZA 1CRPA 4ZDIA 2ZR9A 1DAMA 3I72A 3N70A 1W47A 2VSFA 4LBZA 2AD1A 3PUZA 2RGAA 4IOLA 1OV4A 1ETUA 1J8MF 4QOSA 5IK2D 1MO4A 1W36D 2I1QA 2JJ1A 4DJTA 1M7HA 1W5SA 3Q7QA 2REOA 4I1UA 2VHQA 2FZ4A 1W49A 2NTYC 2GWHA 1P9RA 2JLSA 3A4MA 5CJ2A 3RS4A 4DSOA 3Q8XB 4RZ3A 3ZD7A 3AF1A 2QL6A 3GFTA 4X8OA 4XSGA 4JS0A 4YLGA 3M4YA 1S1MA 4PSVA 3LVQE 1UFQA 4FMDF 4MGYR 1BMFA 4DVGA 2QAGB 1NBMA 3BBPA 1KI7A 4II7A 3GCGA 3GJ8A 1QDEA 5BWMA 4TMXA 1AM4D 4CT5A 2QM7A 4CEIB 1N5LA 3O47A 1WE2A 3L0IB 2IS1A 3QUSA 4OHVA 3NH6A 3P1JA 2RAPA 3A1UA 3EX7C 221PA 3I8XA 2KI5A 1QG4A 4YMVA 1S9DA 4JVNA 4TQ9A 1I4TD 4ZCIA 3B1ZA 1SKYB 1XZPA 2WMOB 1UDWA 4F7WA 3FDIA 1NN3A 5JZVA 3TR5A 1BIFA 1RPZA 1QZXA 2FWRA 2J46A 3FKSA 4UQOA 4DCNA 2Y8EA 4KFSA 4GNKA 4BGDA 1Z5ZA 2DWOA 3CNNA 4AYWA 5KNBA 1E2FA 5TVKA 4TMWA 4DEYA 1T8UA 5D3MA 1DAGA 3L8YA 5C46F 1JALA 2ZRMA 1CJUC 2OESA 3P20A 1SVSA 4Q1DA 2W0MA 3REGA 4JKYA 3JVVA 4LYFA 3ZD6A 2CBZA 1D6JA 2C9YA 2DFNA 2HXSA 4JLNA 4ESHA 2ZRIA 5J5CA 2XZPA 1IXZA 3H0KA 1BH2A 5J4KA 3A1WA 4L5BA 3GFOA 2CHVA 2PEZA 3EPKA 1Z83A 5BN4A 1W2GA 1EX7A 1GNPA 1Z6XA 1NRJB 3C15C 4HEJA 4NP6A 3I5XA 1R6BX 1G18A 2OFXA 4ASUD 3PXGA 3K9HA 3I5YA 2ZSAA 4PSKA 2GESA 3C4JA 2WPDD 5JI3E 2HT1A 3IQXA 3GQBA 4GOKA 4HAZA 1PZNA 4DCUA 1K5DA 4BASA 5FL3A 3ZQJA 1PLKA 1W1WA 2G9NA 3RC3A 621PA 1IBRA 1TUIA 5J40A 2GJAA 1GL6A 3NH9A 2OHFA 1AA9A 4NHOA 2FZLA 4URYR 3VU9A 3TSZA 3RS3A 3GFPA 4KJZA 4P31A 3VR4A 3F0TA 2FFQA 4X8MA 4OI0A 5F98A 3NHAA 4LJ5A 4B3GA 4US0R 2ECKA 3GEIA 3CBQA 5LBIA 1M7BA 4JSTA 2QTHA 5FPKA 4CGZA 3B1VA 2XB4A 3MG9A 1KSFX 4DLTA 3KKNA 2B21A 1Q3HA 2EU8A 4AC9A 5HR5A 1OH8A 3EC1A 3X1XA 1KK0A 2FA9A 3GJXC 2ZVPX 3AVWA 5J4YA 4AYXA 3QEOA 2J5XA 3PENA 1KI1A 2IS4A 1YKSA 4B3XA 4BLRA 2A9KA 1RRCA 4LV8B 3D6TB 2EYQA 3AB3A 3CLVA 4OQNA 1IY1A 3S1AB 1B0UA 4WOPA 3IO5A 5FOTA 2A2ZA 3T1VA 4A8JA 1XD2B 4RKFA 1P7CA 3ADDA 4D6PA 2EVWX 4B2PA 4B73A 2FFBA 4M9ZA 4L8GA 2V54A 4KLNA 4BFSA 1MO6A 4HSEA 5AR1A 1KMHA 5C18A 4KCGA 4C0BA 3SFVA 1KI6B 2WKRA 2XTNA 3GJ4A 4FCWA 2ZRNA 3CB4A 2CCKA 2H17A 1YJ5A 2FFHA 2BCGY 3AVUA 4NYJR 4M4SA 5DSZA 2ZR0A 4TL8A 5FBLB 5HKKA 2ZRLA 3NWJA 4LC0A 1OHHD 4JLBA 4A4DA 4HZIA 3W6NA 3CWQA 2IX3A 5KSZA 1YVDA 3GLHB 2QQ0A 2ORIA 1ZYUA 4CEIA 3SYKA 4TSFA 5JWHA 1N0WA 1G1MA 4RKEA 3SFZA 3QG1A 2CL6X 1DS6A 4LBWA 4A2PA 4IFBA 1RRGA 4TL9A 4B3FX 2YC2C 4DLUA 1E94E 1YZUA 2XNDD 2BKEA 4HDOB 4BFTA 2AK2A 3RC8A 2P67A 4JJZA 2UZIR 1CBUA 1RZ3A 3OZXA 3G0HA 2DR3A 3ADBA 5AJYA 3W9YA 3MAAC 1WQ1R 2XITA 3E5HA 4M0LA 4QNMA 1W44A 2VF8A 2WWHA 4C3ZA 4F4JA 1NKSA 3HR8A 3KUCA 3TQFA 4DUGA 3PR1A 2IT1A 4FMBB 5EXSA 4EUNA 1TTTA 4QM6A 3K9GA 2N1BA 2IA5A 1TF2A 3H2YA 1XRJA 4TTQA 3I92A 3IGFA 4JL8A 1P9WA 4C0AC 2WSMA 1G5TA 2O8DB 2BHRA 1NVWQ 3VQTA 2QGZA 5CK4A 1ZIOA 1GNRA 4IFEA 1ZJ6A 3FKSD 3U2QA 5J47A 4C0QC 2PZGA 5L3QB 1ZC3A 2FPKA 2IYZA 3HR7A 3K0CA 1EESA 1LS1A 2IYTA 2ZRGA 3OFND 5CJPA 1FUUA 1KNXA 1XTKA 2QU8A 3BB3A 2XEXA 4NTZA 3CPHA 2GXSA 4G01B 4C0SA 3R7WA 2R44A 2XSZD 1YZNA 2RGXA 1IN4A 2QENA 5G53C 3ND8A 2ZREA 3ETLA 1F48A 3WY9A 1IN5A 1Q1BA 1SULA 3C5HA 4RD2A 2FGJA 1OJLA 1IY2A 3OE7D 3LFUA 4IKEA 4RFSB 2GXAA 2RCNA 2JLUA 1Z07A 2C95A 4YONB 4I4LA 4HAXA 4FCVA 1HURA 4TMKA 3TSWA 3QQ5A 1G16A 1OSNA 3LX5A 4DT1B 1JXMA 1BO6A 3CF6R 5BYKA 4LJYA 1CR4A 4HLCA 2JLWA 1E4YA 4LYHA 4BZPA 3P27A 1T4GA 1ZD8A 4LHYA 2J1LA 2JIZD 4HDQB 4CZ2A 4MGZR 1RKBA 2OUKA 5DN6A 3SDZA 1XB2A 3A1TA 4IVQA 1KHTA 4HLDA 3BJIC 1WA5A 2AXNA 2VP0A 1E0AA 2C03A 1ANKA 2R6CA 5JWRA 1SXJE 2OFOA 4Q03A 2KB0A 1J90A 1IN6A 2W0SA 4JT2A 4ZPXA 1EFRA 4IEEA 4B48A 1SGWA 3VFDA 4QBFA 3CUEF 3CZPA 2Q0HA 2V6JA 2ERXA 4HAYA 3VR5A 1W36C 4M9QA 4QGHA 4XD7A 1N6HA 2ZRJA 1YZQA 2XX3A 1OFTA 3T12A 2CEAA 2UZ3A 1SKQA 2V4ZA 2BJVA 2RB4A 4B43A 1KTVA 3DVLA 2CHQA 4MH0R 2YOHA 3EZ2A 4GP7A 1XU4A 4AG6A 4N0DA 1ZW6A 3FHCB 1XFAA 2RGNC 3LW7A 5UKDA 2HJVA 2J87A 4W7SA 1CF4A 1P9NA 1Z0IA 4B2LA 4OHZA 2ZITA 4TTPA 5TDHA 1VHLA 2PH1A 2YOFA 2ZETA 3QVUA 4M1WA 4QGFA 1HH4A 2W6JA 4GMDA 1E2LA 2R6AA 3GEHA 1N3BA 1UM8A 2IYLD 1XPRA 1E9RA 4D25A 4M9SA 1N5KA 3IKJA 4OYHA 1KI3A 2B7BA 2VQSA 2GZAA 2H7VA 3FYHA 3CZQA 4C0KA 1TEVA 5CYPA 3GEEA 3QPUA 3TAUA 3MJHA 4U02A 2IYVA 3GLHA 3HJNA 3I4LA 4V0MA 4HLQB 1Z6AA 3ZZTA 2OG2A 2WIBA 4TYWA 4RD1A 4CYMA 1R2QA 4XSHA 1JECA 1ZVQA 3SBEA 2EWWA 4E07A 1U8AA 1FOEB 2I1VB 3L0SA 4HB4A 1ZCBA 3R9IA 5HPYB 3QBVA 2IUUA 1XX6A 2NPFA 2ZVQX 3WYAA 2QP9X 1G3IA 1ZUHA 1Z0AA 4FD2A 4UJ3A 1G3QA 4ZCLA 4Q1FA 3TKLA 2O8EA 2ZRCA 1CEEA 2QBYB 3ASYA 2QT1A 1VIAA 2OCBA 2C98A 4DSUA 2PEYA 3TUZC 4G3XA 2R9VA 1AJEA 2ANCA 3R20A 2NO7A 1Q3TA 2D7CA 2ERYA 3BAFA 3ZZUA 4JT4A 3U7FB 3LH5A 2VBCA 2WSSD 1OIXA 4D0NA 4A0HA 4PC6A 2W58A 2QE7D 2B6HA 1L4YA 1GILA 4M9XA 2CLCX 1NLFA 2D2EA 3I32A 2IK8A 5HCIA 4FWIB 5EP2A 2EWVA 3ONWA 2J0UB 2OFWA 2WOOA 4ZO4A 2O8DA 1AGPA 3OAAA 3UG7A 4XH9B 1SVMA 3NEYA 4Y0AA 1RE0A 1ZM9A 2JJ8A 2DFTA 1R0WA 4AD8A 2ZJ2A 4N0EA 3OEED 5L3QA 5JJIA 4IRUB 1T0JB 3B1WA 3U4QB 2JAQA 2H92A 2GF9A 5IRCD 1G7TA 5CB6A 2QUZA 3LAWA 3QI2A 4F38A 3FHOA 4EPRA 4RSGA 4QGGA 2FU5C 2WWFA 4PPGA 1S1CA 2WVJA 4TLEA 3RDPA 4UXIA 5AK0A 4IOJA 1VHTA 2JATA 2JDID 2WJJA 3DHWC 1XPUA 3D8BA 1IHUA 2QZ4A 2I3BA 3PUXA 2F1IA 4QXAA 1QHSA 4RFSA 1A2BA 1TEXA 5BQ5A 1U0HC 1GITA 1ESMA 2F7SA 3RSOA 1AN0A 4EQ6B 1BOFA 4V0NA 3Q3JB 2P6RA 2J7PD 3J81k 5IK2A 2D3WA 1G6HA 2G0TA 3AH8A 2ASEA 5AWFC 2CCGA 2C04A 3EARA 4BECA 1P2UA 5GADl 4R9UC 3VKWA 2BBSA 1WB9A 4Q7LA 3MGCA 1UPTA 2R62A 1WCV1 1FP6A 3ZS9A 3ADKA 3F5FA 2VHUA 1NMZA 4IVPA 2P6UA 3QKSB 5KSOA 4NONA 3B13B 5CLQA 3QE0A 4QJ5A 5BXQC 2YJTD 4YC7A 3HU2A 2WJYA 5ELXA 3WNBA 1UAAA 1OIWA 3OIUA 4PR0A 3FMIA 1LF5A 4OK5A 4UXJA 4Y0VA 3RS5A 2RGGA 2ZI9A 2QNRA 3CX8A 1KDTA 3EXAA 3IPXA 5JEEA 1Q1EA 4FMDB 1QG2A 1RFLA 4P3YA 4Z51A 3VX3A 3TQCA 4NYMR 4A9AA 2QMHA 4EJSB 2FN4A 4AKHA 4M21A 1PUIA 2WM9B 4QM7A 4MGIR 3FB4A 4D80A 4DLRA 4DLSA 1SXJB 3TRFA 1N2CE 1RW4A 1ONBA 2OO7A 2R6FA 3B6EA 1HV8A 1U98A 4A82A 4GL2A 4IDHA 2ZRBA 1K5GA 4YQFA 3OIWA 2IS6A 3WBJA 1B23P 3BS4A 3M6AA 5G3YA 2EFEB 2VHCA 2E9SA 5DISB 1J7KA 1ZUIA 3LDAA 3AVXA 3LV8A 4DRZA 4MRSA 4EFMA 4RCYA 1YRAA 1LTQA 4B34A 3FFBA 1JJVA 5EJEA 3JVUA 3HPQA 1G7RA 3VNUA 1NJGA 1Z28A 3V9PA 3WNDA 1OF1A 2QPAA 3NEJA 4D26A 1A4RA 2F1RA 3NBFA 4OQXA 4YMTA 1R5BA 4NYIQ 1N0VC 4TZ6A 2RGDA 2KBFA 5DH9A 4IDNA 5JBQA 5GJBA 5L3RA 2N46A 2RH5A 3RS7A 4NBSA 4ASUA 2YOGA 1HE8B 3X1ZA 2WPDA 3ECCA 1EFCA 2IWHA 2F1HA 2IUTA 5E3HA 2WMNB 5GVSA 2R6DA 1Z06A 4ESVA 1E98A 1R8QA 2CXXA 1J99A 1JR3E 2ZS8A 1ZM4A 5EUMA 2QBYA 4DDTA 4IXMA 3K0FB 3NBXX 1VG9B 2FV8A 4BLOA 3G82C 1UKEA 1H65A 1OYYA 2B92A 1F2TB 5LB2A 3VHLB 4C7OA 4TL7A 3IIMA 1OYWA 4MUBA 1ZU4A 4WBSA 4Z8XA 3CF0A 2DBYA 4IDQA 1NIPA 1G4UR 1P3JA 3F3YA 1HT1E 4Q4JB 4IVRA 2PBRA 2AKAB 3M1IA 3KQLA 2A5DA 2J0UA 2AK3A 2GCOB 4TT3D 2CNWD 2KE5A 3NBYC 5E7IA 2PCJA 3G5UA 2ZYTX 3DMDA 4PHFA 1II8B 1PJRA 5FPSA 4BFYA 3BERA 1XD9A 3FVQA 3ZLJA 1MR3F 1GAJA 3BB4A 3TNFA 5ANRB 4BFXA 3U4QA 3CPEA 2W2VA 1JPNA 1KKMA 4BEJA 4O2RA 3KTAA 4GDFA 3CX7A 3CH5A 3GLGE 1D2EA 2YHSA 4BRUA 1QVAA 3QPWA 1R10A 2GK7A 4MGKR 1QHHB 1GRRA 1G5RA 4EPVA 2R8RA 3U6KA 4ZI3A 3SYLA 1E2IA 4KFTA 1GG2A 4Z1MD 2QPOA 3UMFA 1E0KA 5SZIA 2MSDB 2PCLA 2VP4A 3FE2A 3U5ZB 1GTVA 4QFMA 4UNQA 3NDPA 4PAQA 4DCSA 3B7GA 4G5OA 1NMXA 1Z3IX 3B1XA 5EE3A 1DOAA 4G1UC 4LJ7A 2Z6VA 4LGMA 3VKHA 1O87A 4F4IA 4HZUB 3T15A 4B32A 5FUWA 3EIQA 2OT3B 3TE6A 1E2DA 1P2SA 4HYYA 3KXIA 3CRQA 1VG1A 1C4OA 2WJHA 1G3MA 5DHFA 3QKSA 4E5UA 1KSJA 2REBA 1VTKA 1ZNYA 1OHHA 4L16A 3SHFA 2ZSDA 3RRMA 3AGQA 3NBZC 5JECA 4HAUA 3A8TA 2OZEA 4LHWA 3ZS8A 4ACBA 3RRNA 2GEVA 1WMSA 5DIFA 1E99A 1MKYA 4PHGA 2EW1A 3RRZA 1CKEA 4GOJA 4R7ZA 4PHHA 1JQLB 5TMPA 1VECA 1XJCA 3HWSA 4PC1A 2GF0A 2HCBA 1GSIA 3EZFA 3W8NA 1VCMA 4EJSA 5FOUA 5JS8A 1C9KA 1HQYE 1R5NA 2IXFA 2XNDA 2C9CA 2YC4C 1P61B 3CONA 4ZDKA 2QM8A 1T5IA 2MSEB 1SQ5A 2QN6A 2VLIA 2F55A
chains in the Genus database with same CATH superfamily
2WE8A 1ZD3A 3DCNA 4WLEA 5FPTA 3V3KA 2Z5FA 3E1SA 5JSQA 5JNTA 4RHYA 1J9GA 1GNSA 1YQQA 5ALFA 1I30A 3ZWQA 1W0JD 1A8UA 1QGUA 4QPZA 3J7TA 5ALRA 5DWQA 3TW6A 1O0CA 1VPLA 1CFZA 2NSHA 3KVRA 1JHXA 1PQ4A 1JFVA 1QRRA 5G0SA 3SY8A 5KSWB 1B1AA 1BE1A 1L5YA 1Q1ZA 1JDJA 1R8YA 1KO1A 3RROA 3O2QB 1FS5A 3H3JA 5DGXA 5JNWA 3JQFC 5F5XA 4KO3S 4L9WA 4PO9A 3IODA 4V0ME 4Y1RA 3TWOA 4ARCA 2X86A 4YJ2B 3GO4A 5JHGB 4RJJA 2O1XA 1DO8A 3DM5A 5J4VA 2IELA 5KYVA 2HXYA 1L4FA 4JK3A 5JEDA 4M38A 1F9EA 2O2IA 3H9EO 5JH7F 4GI3A 2CT8A 1Z4LA 1UXIA 2MIIA 3PDWA 2CLSA 2OY0A 1FVFA 4WVFA 1EJ6A 4CMJA 3WYDA 4IH9A 3D8HA 4NF2A 3CT4A 4C3UA 1P4JA 2XKJE 3IAXA 1DCMA 3K0EA 2ZJAA 4U2FA 2DGDA 3MSXA 5AOBA 3WR5A 5BVHA 1CETA 4BLVA 1W87A 1CQZA 3OX3A 4Z2YA 3WLPA 4AJKA 1MJGA 1PK7A 1QH0A 3R3XA 1TIPA 4HR7A 1SA0B 4JGIA 1T0HB 4OQFA 2AJ8A 4L5JA 4PZPA 3WMFA 2VP5A 2QM3A 3SHQA 1ZM2A 1H05A 1PR2A 1RMQA 1GYQA 2IP4A 2ZJBA 3OFNA 4NHEA 4QPDA 4JNCA 4QOFA 3PX2A 1NNI1 4C30A 1QUEA 3VAAA 3A1FA 5IG2A 3ZVLA 1M8JA 1WWKA 1DV2A 3D3WB 2I62A 4WXYB 5LOVF 3GPLA 3V2IA 4UU0A 4UCQA 3BRQA 3TLZA 2QOEA 4DSZA 1AXGA 2ZM6B 1V6CA 1F2TA 1Q1NA 3N6VA 2IZ0A 3GUHA 4PCUA 2I2BA 1QO0D 4KX5A 5DV9A 3NM4A 3OE7A 3EZ9A 1U1CA 1N33B 3UM9A 1QTIA 3QM1A 5EVJA 3NC4A 1XKTA 3OJ0A 4J29A 1KH1A 1QCDA 2Y9PB 3BGWA 4QGBA 3A6HA 4OVKA 2GRAA 5HUJA 4J9VA 4YAOA 5DSTA 4EFLA 4L4UA 3ZTYA 2ZSKA 4C4TA 3HEAA 1UPXA 1VHDA 2AOTA 3PEUA 4GBJA 2PLWA 4Q4JA 4YDRA 5GV7A 2NPOA 1OXTA 4MYTA 1G4AE 2WQ7A 1QAMA 2YXBA 4ZYXA 1G9TA 5FPYA 5B1EA 1HLPA 4HUTA 4Y9RA 3EPJA 1A5TA 1L5RA 3ESAA 2X0FA 5JE8A 2BM8A 2C82A 1NI3A 1NVUQ 2V4MA 4G5SA 5F35A 3ED5A 4EJMA 1WXDA 3PA6A 2XMZA 4OBWA 4ND1A 1MVNA 1QVRA 3A04A 2B1QA 3FTNA 3HFRA 4OHKA 1DBIA 1GFIA 2G08A 3VPGA 2BDUA 2OCLA 1SHLA 2CD7A 3ZHVA 4CWAA 1NC3A 2XCIA 4OO3A 1U1FA 3UTCA 4D3DA 3CJQA 3OOSA 4OGKA 1EXWA 1X9HA 2AQ8A 1CULC 2PKXA 3T6KA 1XA4A 4LOLA 2ACEA 3VO2A 5DE3A 2WTUA 1ECLA 1DNPA 3OQMA 3LQQA 5HF8A 2IPLA 4G5FA 1QHHA 2C5GA 1QQAA 1SG6A 4D81A 2GK6A 1VCNA 3DH0A 5BQFA 1V7QA 1VL0A 2EZ4A 1QNLA 5CUQA 1XRNA 4NENA 4RPLA 1M1NA 2ZTSA 5C1BA 3DZFA 3FWZA 3OKCA 3I2JA 5ESRA 1JFRA 2B7CA 2W93A 3HB0A 4IHKA 1S9HA 3ODGA 3BD6A 4M8LA 4NG5A 1QB8A 3LGAA 2BFMA 2C61A 2PKEA 3ABQB 4JGBA 4BTLA 1NBWB 1QKKA 2NO1A 4WZBB 2Q27A 1NF8A 2XNCA 3AJRA 4PZAA 3RUIA 5K0FA 4BCDA 2DQKA 1BCSA 2JF0A 3ZQUA 2ACWA 2KSQA 4WNAA 5TY0A 3SQMA 3WXMA 2MSLA 3KJZA 4KXFB 4ZYZA 4MYUA 1L3IA 2XUOA 1LNSA 1WZNA 2E3JA 4XIGS 2B1GA 2QT0A 4KYTA 3QF4B 4NG4A 1FDWA 4RH0A 5CNIA 3WAKA 1RKXA 5IJAA 2VP2A 5F33A 3P9NA 3FFAA 4XTCS 3GJ7A 4N7JA 4BNNA 2B6NA 2W8BA 1CY1A 5H80A 1NKVA 2FEOA 3FFTA 4FDVA 4E5KA 3TB4A 4KVZA 4MEBA 1N6KA 1RS0A 3FMPB 4B6FA 3HDJA 3JQ7B 3SQWA 1SKMA 4LYYA 4QOHA 1O2DA 1K3TA 4B2YA 3K09C 3LCCA 3QU9A 3TPFA 4ZU1X 5JQGF 2OO5A 3ISJA 4UU7A 4WKOA 3ZE1B 4Q7KA 5L3SB 3ABRB 1PYGA 3NALA 5B3AA 4AIRA 4ZFNA 5A4JA 3BKWA 1A77A 2QAGA 3S2YA 3AXTA 4KVGA 3P9CA 1CDEA 2QSUA 1LU9A 5KQLA 4OHBA 1FFDA 1YB4A 1KJNA 2P5SA 2JIOA 3EOAI 5F5NA 4C01A 1XGKA 3GW8A 3VVMA 4GLOA 4BZXA 2JGEA 2FP3A 3QG5A 3TB6A 1XF1A 4UW9A 1UIMA 3H75A 2VXBA 4WJKB 521PA 3OQIA 3C8MA 3E53A 3WRXC 1D5CA 2Q9CA 4WERA 1G66A 3VHRA 3HC7A 1NMYA 2C8VA 2J9FB 4LE2A 4P5EA 3L43A 4J0KA 5FRDA 2OL4A 3K53A 2QVCA 2AXEA 4MHSA 5IF9A 4P0PB 2CD9A 5CM2Z 2Y67A 3L02A 1WM1A 3PKJA 1FX1A 2QZ9A 3CIFA 3QWFA 2WHYA 4MAAA 4WBXC 1DAEA 4FYIA 2J7KA 4XPIB 2DQ4A 4FE4A 3ZJ5A 1YS9A 5A6SB 3LKDA 4R31A 3ZXXA 4BNIA 3F6SA 3KZVA 2YVQA 3EXG2 1PT5A 1F8FA 4JLSA 5T57A 3RPEA 1NFQA 3BTOA 3SJCA 1A9SA 2JFOA 3L40A 2HJ9A 5JCJA 1V71A 5L53A 4P6VF 5FR2A 1KIAA 1FJHA 1OGIA 4RD6A 1M34A 2C0CA 4NEGA 3CCFA 5B2ZA 3TPZA 5AUNB 3AUAA 4OXKA 4CL0A 4G2NA 3NTRA 3QEMA 4LJ6A 1FP1D 2CNKA 4KXNA 4Z9BA 4LXUA 4YEDA 4E11A 4B75A 3SSNA 1T2AA 4I1RA 3OO1A 4KUGA 3V7FA 2W2OA 1T1JA 2O2XA 1XK6A 1AH2A 5BR8B 3QENA 5HM6A 3U4MA 3V8NA 1F8UA 4MA0A 1NZJA 4UKDA 3KXPA 2Q3LA 3MLEA 2NU8B 5A02A 6YASA 4LRUA 4AY2A 1U5BB 3DE2X 4WNIA 2PUAA 3AW8A 1YBHA 2DJ5A 2QUHA 4KRGA 2J7PA 4L0QA 1A82A 2J9ZB 4P22A 2CN1A 4KOEC 4I4NA 4B6JA 4EUEA 2SNIE 4IOMA 2Y93A 2OQVA 1NQVA 4DCOA 3BPSA 1JFFB 2Y1WA 3T3EA 3MFQA 4OHRA 3VOBA 3QVXA 1WXIA 2XWBF 1JIQA 3ZE7A 4BV8A 2I80A 2QD3A 4IF6A 1WF3A 1O6ZA 2W5UA 4G0NA 2VK2A 4NL4H 2D0PB 4CMIA 2YIVX 2NSJA 4PEVA 3T9CA 1EK5A 5KOJA 1TA9A 1V8OA 2JJMA 1PGPA 2XDWA 5DYNA 3QJYA 5B1SA 2PT7A 4R2MA 5E8JA 1Q7RA 1BD4A 1DHRA 2BT4A 5CBPA 3ERCA 3U7QB 5JV5A 3ESZA 4U6QA 4C0XA 3DQQA 4N3CA 1T8TA 4HDNB 4P9NA 1KARA 4L28A 3DEIA 3BXOA 3H65A 5LQMA 2X6RA 1T2EA 3EYWA 5EIAA 1G42A 2HAEA 3G2MA 4POOA 1V4VA 2FPOA 4GLBA 5G4LA 4F2GA 5C8YA 4YRGA 1JHZA 3JVEA 4B4VA 2H3EA 3N2NA 1S0UA 5B36A 4FOTA 4PBTA 1PL0A 5BSKA 2IPMA 3MBKA 4GR5A 3F9RA 1NJ8A 5K99A 1A9PA 4E22A 1LPBB 3EN0A 4UMVA 4Q0MA 5KQMA 4KU4A 5HOQA 3DCIA 2OBNA 4H35A 4E3WA 2NO6A 1AZLA 5I7UA 1P81A 1WY7A 4LNHA 5IAAA 4G0WA 4G41A 2H7CA 4ZVTA 3V42A 4J4HA 3EZGA 1TTHA 3HCPA 3DYVA 3NHMA 4HRAA 1Y8AA 1XIVA 1CZLA 4GMXA 4IDBA 3F97A 3LA8A 1SC6A 2C2ZA 2L2QA 3PQ8A 4RJTA 3VMMA 3V2GA 4B47A 1EESA 5AXBA 2AN1A 3AYXB 2H5IA 2I4LA 5KU7A 3WMGA 3J7AC 3D7MA 1G8GA 2O3TA 2HDHA 1CEQA 2HJGA 2WJWA 1TOAA 5CA1A 5CCEA 1AZTA 2A78A 3M81A 3T0IA 4MP3A 1XR3A 1YRQA 2BKXA 2O7QA 3FWNA 4RD0A 1YVEI 3RS8A 4WZ6A 1ISFA 1GFWA 1J2RA 1HLFA 2DG2A 3EEOA 2YQ5A 5B58T 3CLHA 5EINA 1TCVA 2O1EA 3SIXA 5DI9A 5J2UB 2I8CA 1N6LA 5DXAA 4KVAA 4I2VA 1PV4A 1H23A 5BPHA 3H11B 4KDCA 4F06A 3LPNA 1HT3A 1PL7A 2HI0A 1WXXA 2WE7A 4MV3A 5AI9A 4EX7A 3IEPA 5KOHA 1R0KA 2DBVO 2ZR7A 4OQZA 3KZKA 3M6LA 5CXSA 5ILQA 1NHGA 2C5LA 2XAUA 4BKOA 2JG3A 5B3JA 2JGKA 4PZZA 4C0LA 1Z08A 1ZA2A 4AWXA 4RFLA 4M1MA 1CP3A 3H13A 4JQSA 3FUXA 4MWTA 3ESQA 4QDTA 2GEKA 6GPBA 4XW2A 1ONOA 2QJWA 1TJ5A 3T7DA 4KBGA 4D9EA 2V8OA 5EZYB 4KREA 2CDNA 1S2DA 1U9YA 1EE9A 1PF7E 2VPTA 2BBOA 4LOJA 5DZSA 3EH2A 3PQCA 3L0CA 4OGFA 4IHQA 4WK0B 5AW0A 4G0UA 5HX7A 1UK8A 1EB8A 3K0SA 3QLVA 3TE7A 1HQDA 3CPSA 4YRNA 4IFTA 4PGAA 4RV4A 4ZOLA 3AR4A 5LD2B 2PZJA 2ZANA 4KNYA 3CYFA 4FOLA 1CY2A 3D5TA 4K9MA 4Q12A 4JELA 4PBSA 3CKMA 3EIHA 1S3FA 1PK8A 1A7UA 4TT3A 1CQPA 2CL0X 2Q6LA 4ZAVA 3U60B 3L7JA 5B58C 1MG0A 2QW0X 1SVLA 3GUVA 2K87A 3I04M 2EZUA 1PU2A 5B3KA 2YINC 1EGVB 3JQAD 3RC1A 3LCVB 3UGJA 5H81A 5CRIA 5IMSA 4I55A 4R2KA 2VJPA 4TTJA 1E2GA 1D04A 2F3QA 1QK3A 2Q3EA 1RQLA 3DMYA 3Q3HA 2IZ1A 5D7BA 5LXTF 3ZDEA 4CUJA 5CEFA 2QRVA 3CZ4A 4FFBB 5H82A 1LRJA 1OLUA 4YVFA 1G291 4BE7B 3MJSA 4R69A 5G0WA 4BC1A 4HNTA 2Y6VA 4UEWA 5CVJA 3SHWA 1SUCA 1UC9A 3PLAE 2BM0A 3LY8A 1UBFA 1HC7A 2WDPA 3COYA 1HFJA 1NG1A 4E31A 4DZRA 3GJ0A 4GRDA 4MARA 5GM2A 4D57A 4YV1A 4J1QA 1LVGA 2BFEB 1R3UA 2EGUA 2WZQA 1OJ7A 1IJEA 1GTL1 1XEWX 3RT1A 1GUDA 2OHIA 2I34A 2R6JA 4AWBA 5BR1A 3K70B 6AT1A 4KRYA 2XRZA 1R6XA 1C8LA 3FMFA 2PS9A 1JDNA 1YRBA 2HFJA 4P0TA 3USZA 3IOBA 4CEHB 4ILKA 1NUUA 2WNIA 5CM8B 4O2BF 2Z2IA 3AETB 1NY5A 2CW5A 5T8KA 3QY0A 2JFNA 3KV3O 2QEQA 3CRRA 5KNBH 1KR2A 4IHAA 1MIOB 5ALMA 3HCBA 3NIFB 1B6GA 3FETA 4JBYA 5JCPA 2UXBB 1Z88A 1VC2A 5HE8A 2QTWB 1Q83A 2WTNA 2JGMA 1Z74A 2AQHA 3RCBA 3UAVA 1KPIA 1EFHA 3E6AA 3DP7A 3IBFA 3FAKA 3W04A 1AGRA 2MSCB 5A3RA 1JT2A 4DT1A 4WKBA 1C7IA 2ST1A 4IZIA 4J2HA 2FN7A 4XDHA 4ZQHA 4E13A 3O1HB 3AZQA 4B76A 1AKTA 2G36A 1UC5B 1NDUA 2GCIA 4KQIA 4URFA 3FTCA 1ZI9A 1VP3A 1ZPDA 2OQIA 3QVWA 4O0LA 4U7WA 1D2RA 2BFCB 3AY0A 1MJHA 2YW9A 3HYTA 1SBZA 4CKEB 2QZPA 4G07A 3DEFA 3NDRA 2RAVA 1UT6A 2Y99A 3EEYA 4I14A 4CEJB 4LNUA 3KZOA 4KI0A 4P54A 1UDXA 2AG8A 3PGLA 1K08A 4NFHA 3R23A 1H8HA 4IXNA 1E6MA 4ZOAA 5D86A 4BVFA 2WNHA 5SICE 3LBYA 2XKBA 3NTVA 2BGTA 2QROA 1IATA 2JEOA 2RG1A 1ZVJA 2FPLA 3A1SA 1XALA 3ZIAA 2AKYA 2NOAA 4ZVUA 3FDFA 1ZMBA 3KOOA 1KI9A 1YQWA 1JUDA 2E5FA 3KWFA 1XJ0A 1TKBA 4LWPA 1DPGA 1TVCA 1NQXA 3OZWA 3ND7A 2QB5A 3NM6B 1A1SA 1KO5A 1XDWA 2OAGA 3DBHA 1NOIA 4EI9A 2HA3A 2XXAA 3NKLA 3I3OA 1E3EA 4FR2A 1G20E 2AG5A 1N4AA 2CMKA 1MV5A 1Q2UA 2CE2X 2IC5A 2R4UA 5K3SA 4I8DA 4NWIA 3U19A 3JW8A 1QDUA 4BX0A 4OSPA 3ORQA 5EXTA 1G6Q1 3WWCA 1YFJA 3BA1A 1X2EA 1ZP6A 3NVMB 4TLCA 3FSRA 4BQOA 3B1JA 4ARAA 5B64A 3E9MA 4WEOA 3TFWA 5C2JB 3DD5A 4O2LA 4DCCA 1J9ZA 3ILXA 5FPQA 4DPKA 2ZCVA 2JJYA 3CUKA 4TXHA 1D7OA 5L4SA 4Q4AA 3GGOA 3DBRB 4MYDA 2FOXA 3IPLA 3VDNB 3BIFA 3AFNA 5EJFA 4F3NA 1ZWKA 4WXMA 5JXGA 4OGGA 1U5CA 1Y8CA 1JU3A 1J24A 1NRIA 1NSFA 1S2MA 2ILVA 3AHFA 4TLAA 4JIMA 2QYTA 3C6QA 1MB9A 3CPJB 3N0VA 3GD7A 3NLLA 3O3CA 4HTFA 3VXKA 4A15A 1NNEA 3FI9A 3KQUA 3GAFA 3EGIA 1N2ZA 4H7EA 4YMWA 4CF6A 1C5KA 5HGXA 4JV5B 3NNDA 4BBPA 3D81A 1SR8A 3E0XA 2PL9A 1W29A 4K8OA 5DLDA 1CZNA 1JB1A 2K5UA 1AOXA 2DFLA 4MRVA 4E70A 2NTEA 3R77A 2HWKA 4F46A 4XUGB 3LKVA 5B4TA 5CB4F 1RRMA 3PUYA 1M8FA 1TAUA 1PJ2A 1KQNA 3OOYA 2WAXA 4G97A 3KTOA 5H70A 1V1RB 5DYTA 1VLHA 2YHIB 5DEIA 4NZYA 3U7RA 2X0RA 2PN1A 1ID8A 4QJ4A 2JVIA 3L9WA 3SN6A 4RELA 4DV3B 4W6ZA 1OYOA 4ZRDA 3OURA 1YQXA 1ENYA 1OX5A 1ZFNA 3ESBA 5LIPA 4OHFA 1NUQA 4XIYA 2AUTA 1V8BA 3IP6A 4KJXA 4XOIA 2YNMA 3GEGA 3EZ6A 3IIJA 4KLRA 2PJDA 3A05A 1FDOA 5A0FA 2GLXA 5KREA 2ZBPA 3QXXA 3OTIA 4TN5A 1P62B 4I1SA 1DJQA 1T2VA 1T29A 1BJTA 2VYCA 1PZFA 2XT9A 1WNTA 2IYAA 3A3YA 3RLIA 1FY2A 5CDGA 4L4RA 1QYRA 1YS4A 1HQCA 3ESRA 2ZRAA 3QOYA 3RYFA 3FOFC 2PUVA 2YRXA 2C2HA 1I0LA 4NBWA 2FW8A 3TVDA 3UB2A 1KOFA 2CE7A 4M8SA 2WUVA 3RUFA 4AIIA 4WX2B 5BRAA 1YDFA 3CZMA 4WLVA 1O9HA 3AZOA 2PKYX 1OLSB 4M49A 3V00A 4G4GA 3WMWA 2QYHA 4OATA 3CLSD 2BZSA 3QUBA 4RMJA 2QRPA 1GZ4A 3GLKA 1F8XA 1FFXA 1GQSA 3UUWA 6REQB 5DNYB 1DRUA 1MD9A 3RF6A 3RT7A 1SVUA 3QW2A 4JI3B 3TD6A 5H3CA 4YDSA 4AJEA 1L7RA 1UANA 3R3UA 4KGXA 2FGKA 2FW0A 2WUEA 3FBWA 1XV5A 3GWZA 5D85A 2Q7OE 3TINA 2LNDA 3AEZA 3AVQA 3V4OA 3MT0A 2VBFA 3AGPA 5DBHX 1P5ZB 5JFGA 3VYTB 3WK8A 1H0KA 4BNKA 1Z7EA 3KSRA 1VJ1A 2YIJA 3SCZA 3ZHZA 5JU6A 2XYHA 2N3ZA 3WDKA 1QE5A 1EDZA 1NPYA 2D5LA 2VUSA 5K51A 1PIWA 1DTEA 1QC5A 2LIPA 4KFRA 3IVCA 1E3SA 5LQNA 4U9HS 2PYZA 1MXHA 1OKKD 1WR8A 4TVKA 1DAFA 1DSSG 1NU8A 1TL7C 2QI9C 4JHXA 2Q99A 5EA2A 3GP5A 4EZBA 3TG2A 1RCFA 1V96A 2QRMA 5DYGA 4GI1A 4B3BA 2B69A 3BZBA 3OZGA 4M0UA 4DY4A 2B99A 1OB5A 3I8OA 1XNRB 1J23A 4Q1CA 1G59A 1XOIA 2EFGA 4ZRNA 3WVNA 4QHTA 3V8EA 2NM0A 1NT2A 2D06A 1UR5A 2I7XA 1II0A 3NHKA 2HGSA 1X13A 2FY8A 1E2UA 2FPMA 4JC8A 1AXEA 3BMNB 3TD2A 5JZSA 2WNSA 4K3UA 1EQAA 3DZBA 2XRMA 2VDLB 3H86A 4NK4A 2DECA 3UK7A 4MUEA 4KE6A 2NADA 3OH8A 5KUTA 4M1TA 1ODTC 3RASA 4PZLA 1O4WA 3PNMA 5HDQA 1RPAA 4B4KA 4EY6A 2ZEJA 4J49A 5KYWA 4FIDA 3ZHQA 2XB6A 5T64A 2NIPA 3SJ7A 2AE1A 1WMBA 1XAIA 1KMHB 2C42A 3U3KA 3LNTA 4LK2A 4POAA 2ZWMA 1XEAA 5D3ZA 2HCRA 1SBNE 3SFTA 3PB3A 4Z4HA 3CLUC 4ZQCB 4EKYA 3CHYA 4Q1EA 1MV8A 3PX3A 1EFVA 5AHXA 4NDAA 3UOWA 3JYQA 1EH5A 2OO5C 5K0NA 4KR2A 1DPFA 1VMAA 3OQJA 4B7ZA 4B6RA 4BKQA 3STHA 1O03A 4E3ZA 5FI3A 1HR0B 3KKKA 4P7FA 4CKXA 3ITEA 1TGVA 2Q9UA 3A4IA 1PQWA 3D8RA 5IC6A 4RA9A 4LJAA 4RVCA 4W82A 1Z5UA 5CU7A 2COKA 1FUYB 4BCBA 2GCEA 1O96A 1UBMS 4M76B 5JNVA 4UPVA 3SEFA 2EQAA 5IJ9A 3HZOA 2O4CA 3BILA 4RPCA 2F6RA 4YCNA 4ZTUB 2RHRA 3GXOA 4BNFA 3B89A 4GM0A 3LFTA 4OHOA 1A9TA 4OI2A 4U00A 1QP0A 1RI2A 3NGLA 3TLGA 1D2NA 3ABIA 4TN1A 3W3AA 4JLAA 5IVPA 3USCS 4LHEA 3PPWA 4N41A 2G3YA 1SXQA 3CV3A 2GCNA 1V7ZA 2HU7A 4FFOA 1RAFA 1VJ5A 5K05A 1I3NA 1G7CA 3VR1A 2ET6A 3QX8A 1L2TA 2P9BA 4BL5A 1W7AA 3JYOA 1CR2A 1SG9A 2GK4A 1T0PA 2Z4RA 3PE3A 3TFQA 3ZUGA 3I45A 1A96A 1KEEB 1U8TA 1OBOA 1Z6GA 3B85A 2ZZKA 5KBYA 3KFVA 4IS2A 2RBEA 4AUKA 3E9EA 5KKCA 1E3QA 2ZXFA 5HKKD 3AKCA 1DIHA 1L6IA 1NP6A 2CHGA 1NI4B 3A11A 2BR3A 5TQVA 1ZSNA 2RK4A 4HHEA 1Z2CA 1URPA 5FFNA 1DX6A 1M83A 3EVZA 5C8DA 2WICA 1J2TA 2WOJA 1UP7A 1XLTC 2FUKA 1JH9A 4N5IX 1H8ED 1WAMA 5FLEX 5FQOA 3F73A 3TCNA 3A1DA 3KHUA 4DR3B 5AICA 3WK5A 4OLHA 3HUDA 4U7DA 1MC5A 1G5FA 3DMNA 3MQFA 3PFKA 4UAVA 4UHBA 5HILA 3VR3A 3VU1A 1H3EA 2YHAA 5IM4F 1XNHA 2AR7A 1E5VA 1C0IA 4D4LA 5K8IA 4NKRA 1OASA 3RVJA 3THOA 1KI2A 2QLTA 3MC1A 3OIFA 3THWA 4CTNA 3GIDA 2YZMA 2HDWA 3ZCSA 1KSGA 2EFDB 5G4KA 2QP4A 3T0GA 2HQBA 3T61A 4EHBA 5FI1B 1UK7A 1SBQA 1VQ1A 3GGPA 3R7WB 3ZDYB 3C3PA 3OU7A 1MNQA 2C92A 2F9FA 1CQIB 2H48A 4ENVA 1KFJB 1W1IA 5DO9A 4NCJA 2DT8A 1LBHA 4BO6A 2UUCB 1QVZA 3FPFA 4CFSA 3LPMA 4HQ6A 2BFFA 5NLLA 2WBLC 2WD7A 4GP6A 3AVYA 2QT9A 2BFBB 1Z4QA 3K70D 1JWBB 3DXXA 4S05A 4AMBA 2H9IA 1KQFA 4MDFA 4P4SB 4I3FA 2WG2A 5JC8A 5A5GA 1VKOA 2VATA 4QJBA 1Z47A 4WVLA 4BGEA 2ZUBA 2J9RA 2Z6UA 5HJEA 1B2RA 3ZU6A 4FSHA 4K46A 1YOVB 1L9KA 3FHJA 2XE4A 3WK9A 2VZ0A 1R16A 1XQ6A 4BO3A 1N2EA 3SDSA 4BO9A 2QZZA 3I42A 3P71T 2P90A 1GN9A 2HMYB 4A5SA 3U7EB 3TM4A 4ML3A 3IX7A 3N2IA 3PUVA 3U40A 1I6WA 1VZ3A 1ZH6A 3GFBA 1F6WA 5THKA 1EXNA 3B8HA 1WD7A 1P7WA 3BXFA 2PTHA 3CNQS 4JKOA 4HXYA 4WI1A 4ND8B 3BEDA 3DFFA 4BO5A 1U81A 4BBJA 2E87A 3VPHA 4TM8A 3WB0A 3RUDA 4ZDWA 2HJWA 4FDUA 2H06A 4HWKA 5JS7A 3SK0A 1XMPA 3WBKA 5FWDA 4F8EA 1IYZA 2FJ0A 1X1RA 2V96A 4O4JF 3WNZA 4MR8B 3UUGA 4BKMA 3VH4A 4DWWA 5JSUA 3WYGA 2V7WA 2X8WA 1HDCA 1NKTA 2XADA 4MS3A 1FS6A 3JWPA 3PFGA 5ALKA 1NVFA 3PDIA 4AULA 1BG6A 3EXEA 4QRHA 4UTVA 2XTMA 1UXOA 3EC2A 3HCCA 3OM8A 1ES9A 3WV4A 1EUCB 2JLRA 3WFJA 4ZZIA 4UM5A 4FC6A 4ZCQA 3DT8A 4TOIA 1BQEA 2AFRA 4HDMB 2E4YA 3EA5A 2EIXA 3EWNA 1IPEA 2VJCA 3D9QX 4LBYA 3DE4X 4B40A 1QPZA 1U1DA 5TC4A 5HQ3A 6ADHA 2VF7A 1PZMA 4YT4A 3Q12A 3F67A 1NN1A 1CCWA 1E4EB 4V02A 5F2EA 3CH7A 5CVTA 5LPNA 4FYJA 2IV7A 1N2CA 1JMYA 3H5IA 5J2TB 1RYHA 4JR0A 5KAPA 2XOKD 5E1OA 5HEKA 1XU9A 3RH0A 1D1PA 1F3OA 1XZBA 1YASA 2J6IA 2XDYA 3D4IA 3RFXA 4LHZA 1WDMA 2PYIA 3DDSA 1E1CA 1IBSA 4IMIB 3HJGA 2FK8A 2HU2A 2W6ZA 2OWEA 3TPCA 2VYQA 3M33A 5CD9A 2SCUA 4MVJF 1MQSA 4MWBA 1CFJA 1I1HA 3N2KA 4RSMA 3PJDA 121PA 1F2UA 1JI3A 1T8WA 2WG1A 3GT0A 4GRAA 3EDOA 4WKNA 4RCZA 5DI3A 1ML3A 4U3JB 3T7TA 3TLAA 2JIRA 2GB4A 5BV0A 3PPIA 4P98A 3DDWA 3CRZA 4P4UA 3C7TA 2JFPA 3G85A 2G83A 2JAOA 3UYLA 2C2WA 2JHCA 5FTKA 4E03A 4OXNA 4HGOA 2CJPA 1TPZA 4PWYA 3OJCA 1QRDA 3ONVA 1NW3A 1GNTA 1Z7WA 1DT5A 2AFVA 3TZHA 1D2CA 2OLJA 4RQTA 3MWDA 1LS6A 3KZ1E 4GUAA 1BMFD 3M6FA 1WEHA 4XASA 4NV1A 3WJ1A 4C7KA 1CUIA 3JQPA 4TKMA 3TBKA 5ITZA 2JVJA 1SFRA 721PA 1IBLB 3E7WA 1Y89A 1VGRA 1PUJA 3B5EA 3QITA 5DM60 4DS3A 1KNQA 1KYQA 2A3NA 3I12A 3TRDA 1VPWA 3K5IA 1U2GA 1Y9AA 4EGAA 3QU5A 4DJFC 5ALTA 3HP1A 1KL7A 2ECQA 3OCXA 4H3KB 2ZI6A 1O0SA 4H1VA 4LMBA 3RFUA 3WHLA 4HGQA 1KAOA 1ZH2A 1JYFA 2JAPA 3R76A 4B81A 3WJ2A 2AWOA 2R8XA 4GZ5A 5A9SA 4XKJA 1BX0A 3PWTA 1X92A 2I71A 2QRKA 2WF8A 4LOHA 5TF0A 2F59A 3O1JC 4C7MA 5KIAA 3FKQA 1W34A 5HW0A 3GMTA 1TVKA 2G0NA 5B1YA 2TMKA 4DCMA 4AP9A 2P9EA 4YXWA 1EEHA 1NVVQ 3BX1A 4HZGA 4IIGA 4OOFA 1IH8A 2C7BA 1WO8A 1YK1A 3NKVA 4HC4A 4QHYA 3PYLA 4DMMA 5D87A 4MP6A 2XYQA 1ECJA 3QYAA 2QP3A 1JU9A 1TADA 2Y66A 3LPDA 4BQPA 1RXYA 4UJ5A 4CG2A 1CIPA 4EI2A 1TJYA 2V7VA 2DUJA 2YWRA 2GFIA 3CFYA 3GPBA 1IY8A 1ZH4A 1ZNZA 2IOFA 3CUUA 2OLKA 2F2TA 3KD2A 3QOWA 1EYZA 1N5DA 3A6PC 3TDNA 3WLIA 3OTGA 4J8PA 2R2AA 4M1YA 4A5OA 3VR0A 2QRLA 3H6HA 4ZN6A 3LXRA 5C52B 5CA0A 2QSJA 2GM3A 3LP6A 3ZHYA 4Z4EA 4NAVA 3V55A 5BNWA 5BN5B 4YR9A 4X24A 2FG5A 5T8KC 4QLBA 4RACA 4C4XA 3VKGA 5HKOA 3UT6A 1WU8A 2C0QA 3A0UA 3FGOA 4R98A 3OUTA 4DCJA 2X2EA 1N6PA 2FE1A 3OETA 5DBGA 3DHNA 2PZLA 5I01A 3R9WA 5FF9A 1A04A 2WIAA 3DA8A 1F7VA 5I51A 2E5LB 3N39C 1H2ZA 2G9QA 3CZ9A 3BM5A 3IEIA 2WWXA 4M1KA 2BMDA 2AFHB 2PSFA 2PVPA 2G80A 1QQ5A 3ICOA 4J0FA 3AL0C 5D51S 1Y8QA 4NPCA 1E5QA 9MHTA 3F6CA 3AV0B 1QLHA 4WXPA 2DX7A 3LY5A 2VHTA 3PUKA 4X00A 5AM5A 1E20A 2O52A 4AJIA 3N87A 3IVGA 3Q2KA 4DUYB 2O0JA 1BWPA 1C1XB 1KO4A 1X8JA 2Z2YA 3JTEA 3VR4D 4HV4A 4GU5A 1KR5A 2LRHA 2ZROA 4EGJA 4ZYLA 1TO6A 3GRRA 1F5NA 1JR2A 2BHLA 3G49A 1I2DA 3PWKA 1E0JA 4TTTS 3I9KA 1C29B 3A1VA 3EZLA 2C2XA 1G2IA 4EW6A 4RZQA 5JTTA 3WK4A 4DLVA 3R0IA 2D1TA 3I39X 4PYLA 4DQ0A 4CF7A 3IELA 4HH1A 4ZC8A 4S2EA 4GBED 4MUYA 1Z7GA 3ZBQA 3R4CA 2G17A 2IQIA 2GR9A 3SQNA 2A67A 1IY0A 2VH1A 3WRWA 4PX3A 4XUEA 1CNEA 3RSQA 3LM8A 3IBTA 1IUOA 1QG6A 1KFEB 1SZPA 4DYVA 2D7DA 1TCAA 1J2JA 1E2QA 1FDUA 4UHDA 1GPNA 1JG1A 5HCNA 1H94A 4LWQA 4X1IB 4CF5A 1G38A 4HF7A 2O3RA 1SEVA 2FFAA 1YMVA 5TT1A 1H85A 4XGKA 2FE4A 3FAZA 1JKIA 5EWMA 4Z49A 2GCPA 3AUXA 1UIRA 3GYGA 4BN4A 4CLRB 4G0PA 1G0OA 3D8UA 4DWOA 1ZD1A 3N7UA 4EH1A 4RKRA 1PN3A 4DA7A 4RM2A 3L0PA 2XNKA 1OT5A 3RJ5A 1L5KA 1RZUA 4PPQA 4XQ0A 1JW9B 1TO2E 4PG5A 2UZ1B 1O89A 4P32A 4OIFA 4EZIA 2O8CB 4BX3A 1B3RA 1CRLA 1WL8A 1KH3A 1GZSA 1IULA 2YZ2A 4R8RA 5A3QA 3ANMA 3WIEA 1T4MA 5T3UA 3R9XB 5IKMA 3F6YA 3JR3A 1MBZA 3AEUA 2JCSA 3OU2A 3L7LA 4V2UA 4XUDA 4DXAA 4MWOA 3E5MA 1QM5A 3H5OA 4MB2A 1IXKA 1MMFB 3G17A 4MVJD 4OK6A 4OM7A 1LTHR 2QMZA 2QRQA 4UEKA 5T6BA 1N5IA 1D1SA 1P1FA 1T6ZA 2VS1A 2Q21A 4IPTA 4NBLA 4ZJUA 1E96A 8MHTA 2HNAA 1ORTA 2QTGA 7GPBA 2P2LA 4OFBA 1IJFA 4CM8B 3DE7X 4EG1A 1NE7A 1OMOA 4X90A 5E6RA 1JEQB 5FLYA 2GH1A 4FCCA 2EHDA 4GI2A 2ZSFA 2O1WA 1KQ3A 1EWKA 3VDRA 5A05A 8OHMA 1ACLA 2B7LA 3JD2A 2FETA 4JN6B 4EKDA 3DL2A 4TKVB 3ZGXA 4YMUA 5ENZA 1HG1A 2QRUA 3KJEA 1T9BA 3T7CA 4C7OB 3EZNA 1H2RS 4BLTA 3GDHA 3IEVA 2E2WA 4NABA 5KCZA 4Z4IA 4FR0A 4UNNA 1YZHA 2QTTA 4IM7A 5CGZA 1Z22A 4R7TA 2BGIA 4CL3A 4HYTA 4UQPA 4CU5A 1IQ0A 2JBHA 2V1UA 4MWZA 4A16A 5IANA 3K0KA 1KWKA 4IG9A 2B8WA 4K6CA 3AF4A 3P96A 3KQVA 2TRSB 3HUEA 4O4IF 1QP7A 3HDQA 1TAGA 3BQ9A 3W5JA 1O3YA 2NSDA 3R0JA 3EQ9A 1X0XA 5T67A 1Y8RB 1JBQA 2MDTA 4D56A 4J9UE 5JSKA 4IO1A 1C8VB 3UMCA 1DQNA 4DUGD 2Y05A 3H5AA 3N2LA 3V6LA 2BDTA 1AA6A 1WNFA 2GZHA 4TZKA 2VWHA 2WYUA 4R1TA 1IVNA 1BKDR 3NJ4A 4Y6PA 2VTBA 3OLXA 3ETEA 2HWXA 3Q3IA 1MB0A 1ZXXA 5K3AA 2ZWVA 1SUWA 3NHSA 2JFYA 5CDYA 4NU0A 1OYVA 1N34B 2B3DA 5L8VA 4NZPA 1K6MA 5E6SB 3DKRA 3LWNA 2EKQA 4TXLA 4EJFA 3GMSA 3AWDA 5CYOA 3GBVA 2IIPA 2NYRA 2RGEA 2GXQA 5BT9A 5EHIA 2ORVA 2XUPA 1KAEA 1BYUA 3KQTA 3GLUA 2AHRA 3VPAA 5F3DA 1GVNB 2BLLA 2AW3A 2WWIA 4WHMA 4QYIA 3G2HA 5HJ2A 4QPNA 3LW8A 3O8DA 3O8OA 5JOQA 1Q7EA 2MU1A 3ITKA 1DE0A 2BR4A 3GJYA 3DAFA 3HYNA 3JCZA 1HE1C 3O4RA 1ZMOA 4LQDA 4RTJA 3M6UA 2ZUFA 3EBLA 2G7MC 3VU8A 5CDFE 1Q21A 2L19A 4HH0A 2GYVA 1RWNA 1W4RA 4LK3A 5BMOA 4D0RA 3IKTA 4O2AF 1NT4A 1N2JA 3EDQA 3L82B 5K0ZA 1CZOA 3QEKA 5HFJA 2Q49A 2IPXA 2YY7A 1AK2A 2V6BA 4C4SA 1UMBA 5ALDA 1G9XA 2OLEA 2PM8A 2AJDA 2QQFA 2Q2QA 4G5RA 1V5GA 4I50B 3MWEB 5CX1A 5IDQA 1TO1E 3FOZA 1PWZA 2FSHA 4KZPA 2HU8A 3FPLA 2ATXA 3TEMA 3AM3A