3HYTA

Structural basis of gdp release and gating in g protein coupled fe2+ transport
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
245
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVRKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
publication title Structural basis of GDP release and gating in G protein coupled Fe(2+) transport.
pubmed doi rcsb
source organism Escherichia coli
total genus 81
structure length 245
sequence length 260
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hytA01
1NN1A 2DPXA 5A5GA 5ELXA 1E1QA 3I3SR 3C4JA 3K9HA 2QSZA 1YKSA 1Q44A 2EU8A 3PR1A 4LWZA 5B30A 1P60A 1KOFA 3ONWA 2NQ2C 2W00A 3QPUA 1GITA 5EXTA 1J7KA 1KDOA 5DE3A 4MYUA 4LCBA 1HE1C 5JWOA 2GJ8A 5H70A 4K46A 2BV3A 1P9NA 1G7TA 4IKEA 2F55A 4EFNA 1ZCAA 3V00A 3MWKA 3A37A 3GJ4A 3REGA 2WJYA 3DKPA 4JMPA 4B32A 4TL8A 3H84A 4A4DA 4JVLA 3LQQA 1AS0A 2A7QA 3O8BA 2QBYA 2Q3MA 3EA0A 1H8HA 1MO3A 3ND9A 2JIZD 4L4UA 4JS0A 5G3YA 1W0JA 3AF3A 4BRWA 1W1WA 1AK2A 2YYZA 1OKKD 3AUXA 2IS6A 2ZUDA 1T91A 3J81k 3A6PC 5FOTA 4B6EA 2REBA 1SVKA 1T6NA 4RD1A 1IXSB 1XD2B 2IF2A 1QHHB 1T4GA 1GL9B 3I4LA 2ZRHA 3PIRA 4BGDA 2H7VA 4C9BA 3UG7A 1W4BA 2NPIA 3EZ7A 1JECA 1KI8A 4MUBA 2F1RA 1N25A 3TBKA 3TUZC 2JGNA 5B57C 4XWAA 4KLNA 3U4QA 3B1VA 2WSSA 3ETLA 3KJIA 2BCJQ 1NLYA 2TMKA 3CNOA 3IBYA 4JLVA 4JLKA 5JHHB 1IM2A 3L0SA 4ARZA 1AZSC 4MGKR 2WBLC 2IYLD 3KQLA 2DFNA 2W6IA 2J45A 4NYMQ 1ONBA 2BMEA 2LWIA 2BEJA 4DLUA 4HLCA 4JLDA 2GEDA 1G4UR 4XTRA 3WY9A 4WZBE 4AY2A 1A5TA 1YE8A 2RGNC 1PUJA 4TTQA 1NN5A 2A9KA 3I8SA 5L3RA 1XEWX 1I2MA 3EZFA 2O5VA 1IY2A 5C1BA 1UBCA 1SHKA 2IWRA 3BH7A 2V3CC 5LBIA 1VCOA 5KYKA 3OEEA 2G9NA 1UBGA 1G5PA 2BM1A 2FEMA 3DEFA 3KXIA 1GKIA 4OHWA 4PC2A 5UKDA 1NI3A 1E2JA 2EFGA 3EARA 2C98A 1TU4A 3ZD7A 2AWOA 2C96A 3B8HA 3L2OB 2QN6A 2ZS7A 4HB0A 1CXZA 2QY9A 2BBTA 4L8GA 1W0JD 4LY6A 2B6HA 4MKFA 5BQ5A 3EIQA 5GVSA 1M1YE 2RHMA 1LVGA 1RKBA 3UMRA 3B9PA 1YJ5A 2GILA 5TMPA 3IBGA 4KYUA 4PANA 4DEYA 3TW4A 4GP7A 5FBWB 5AJYA 3NIBA 1G3IA 3PEVA 2CNWA 2J1LA 2NZ8A 1R8QA 2R65A 3BH0A 4QOSA 2P67A 4IJMA 5HCNA 5J5CA 2IXGA 3OFNA 4AKGA 1D6JA 1VHTA 1W48A 4B35A 1YU9A 5KHOC 2WSSD 2ZJZA 1ZJ6A 1KO4A 1S9HA 3TSOA 4Z51A 3QG1A 4JBXA 4MRVA 3BBPA 4A9AA 1TQ6A 4GOXA 3IEVA 3KB1A 1IHUA 4Q03A 1XXHE 3QKRB 1NJFA 1ZD9A 5E7JA 1CLUA 4UNQA 3X1XA 3M0EA 1KK3A 1E2IA 1RC8A 3CO5A 2PEZA 3DO6A 2R6GA 1OLOA 3NC1C 2FSFA 1J90A 3KUDA 1NP6A 4NYMR 4C0HA 4NYJQ 2XGJA 3UMSA 2RKOA 3M1IA 4JLOA 4KSCA 4BPBA 3CF6R 3KXKA 2ZI7A 3P20A 3HYRA 2QNRA 1MRSA 1SKQA 1PZNA 3WMFA 4BECA 4HDOB 1Z07A 4Q19A 5DGXA 1XJQA 1Z0KA 5FTJA 1Z6AA 2YNMA 4V03A 4LZZA 4Q4HA 4AYTA 2XZOA 1QVAA 4P33A 5TV2A 3QBVA 2IBMA 1AA9A 1TMKA 2VPPA 1BO6A 1W36D 1D2MA 2JLQA 4EQ6A 3IPXA 5EE1A 2ZR0A 4FXPA 2GF0A 1E9FA 2JASA 2ZEJA 5CDFA 3W90A 3ZVRA 4OQMA 4YMVA 2VRWA 3K53A 2WKPA 2QT0A 2FZ4A 2W6JA 4PPGA 4D26A 1MABB 1N6KA 2G1KA 3RYTC 4MQBA 1VG1A 2CNWD 2FPMA 2JDIA 1X6VA 3LW8A 5FUWA 1JQJC 3C5HA 4JLPA 4M1MA 3I5YA 1OF1A 3OFND 2A5JA 4BWYA 4F4JA 2BMDA 4ZDWA 1JAIA 5EQTA 3ND8A 4Q1DA 1OSNA 4E22A 2E9SA 3UPUA 4MYTA 4KVAA 2WAYA 1KO7A 2EFHB 4YDHB 3MMPA 2CK3A 5AUQA 4OHZA 3A1SA 3CZPA 1UADA 2CLCX 3RWOA 1SXJE 2Q3FA 5FOWA 5CB8A 5DO9A 1GUAA 3DM5A 1AQUA 1YR7A 1XWIA 4DCSA 4LJ8A 4CEHA 4V0MA 3TR5A 5FR2A 3DZ8A 2WKRA 2WJHA 1W0KD 1W5SA 3PFIA 3ZS8A 4TZ0A 1KJYA 1Z0FA 5TXGA 1X1SA 1P2SA 3AUYA 2G0NA 2O8EB 2JLYA 2KSQA 3NH9A 2GXSA 3K1JA 1NIPA 5G53C 3EPHA 3GLFE 3KFXA 4YONB 3CPHA 1II9A 3RWMB 4V0KA 5L3SB 3AVUA 3GLHB 4A82A 4DDTA 1E1RD 1CF4A 2ECKA 4NYJR 4Z8XA 4II7A 4BE7B 1M6NA 4KBGA 3D8BA 1FL9A 3GQBA 1YZNA 1FW6A 1U2RA 4Q48A 1G4AE 3N5CA 1T9HA 1Z28A 4GL2A 3VKHA 3VR6A 1EFUA 2EFDB 3VR3A 4EFLA 2JLXA 4FCWA 2VF8A 3ZIAA 3CM0A 2HF8A 3AF2A 1TU3A 4IEEA 1AGRA 4BEBA 2BM0A 3QEOA 4NBSA 3RANA 3JZAA 3QJYA 1CJTC 4QGFA 3EPKA 3I72A 2W6JD 4HDQB 3A1WA 1JEEA 3GJ0A 1KSHA 1LNZA 3FGNA 2CCKA 2XXAB 4WOPA 1BH2A 3K0CC 4RSGA 2XOKA 1DAFA 3UIEA 5C46F 3FKSA 4LUCA 1JXMA 2SHKA 4PPQA 5TB5A 1DAMA 1D9XA 5KNDA 4JL6A 1UPTA 1G20E 2HDNB 3CX8A 4QC2A 1NBME 3EASA 1S3SA 2I1VB 3N2IA 5CYOA 6Q21A 3B2EA 4PFSA 4RVCA 3W6OA 3K0AB 5E95A 3S1AB 1G1MA 2CK3D 1SXJB 2YV5A 4F92B 1G21E 5J47A 1CR4A 3H86A 1US8B 3QIAA 1XD2A 3SEAA 1QHHA 1L4UA 3VX3A 4HI0E 4C0BA 1IN8A 3AGPA 2IUUA 5DIFA 4BASA 4Z1MD 2QMEA 4U00A 2WM9B 3IHLA 4G01B 1HT1E 5DI3B 3T5GA 2X1VA 3GLFB 4Q7MB 4DLRA 1VIYA 1EFTA 5KPJA 2NO7A 1SVMA 2ZR7A 4Q4AB 1ZBDA 3X2SA 3TH5A 5FTLA 2IYVA 3RS2A 3T06B 1Z5ZA 1XCGB 1N6RA 2VHQA 3BS4A 4QBIA 2OCAA 3SDZA 4GRAA 5GJBA 2ZROA 2V4ZA 4LHWA 4HSEA 1S0UA 3E2IA 1DTSA 2Q9BA 3EWAA 1XDBA 3VR2A 3ZIAD 5KO2A 3WHKA 1L4YA 1U0LA 1F2UA 2WOJA 3KTAB 3O47A 4PZLA 1E0KA 2ANCA 1XFAA 1SVSA 1AGPA 3FHTA 2OCPA 3B5JA 2OT3B 1P5ZB 3LLMA 5EZ5A 5G41A 1QDEA 4A36A 1XEFA 2QM8A 1KNXA 4LBZA 5G3ZA 4KODA 4YMWA 2XOKD 3PVSA 1G64A 1OH7A 2BHRA 3FKSD 4M21A 1Q3HA 1OYYA 3LRPA 2DWPA 2FV8A 2YKGA 1HA3A 1RVDA 1EESA 4DSUA 2J59A 3QXSA 1BKDR 4TQUS 2G6BA 3AM1A 5F3WB 1E99A 4CYMA 3HYTA 4I1UA 4JJKA 4Q21A 1IXZA 2EWVA 3PEWA 3R8FA 4KLZA 1U9IA 4OI1A 1UBEA 1F48A 1JEDA 3BC1A 5JRZA 1UJ2A 2WWWA 1EFRA 3AQ4A 3U44B 4Q1AA 1E32A 3RSLA 5AJVB 3H2YA 3VAAA 5FOVA 1Z22A 4BLOA 4OBEA 5CJPA 2BCGY 2V1XA 4KBFA 2WTUA 2PJRA 4R9UC 3SZRA 4RD6A 4EJSB 4I1SA 1R0YA 1YR8A 1KO8A 1VHLA 4TMTA 4FMDB 4MUAA 1IN7A 5J4LA 3BIFA 4UQOA 1E4YA 1LW7A 3WP1B 1VG0B 2RGCA 5BN5A 5KNCA 1ZM9A 1CR2A 3CUEF 5CK4A 2QTFA 3CX7A 4AWXA 3NEJA 3C16C 3QG5A 2QRZA 2YINC 1IN4A 3KX2A 2NPFA 2ZU0C 5LD2B 3THYB 3MSXA 3D3QA 4HYYA 1ESMA 4DLZA 5EXXA 2X77A 1OE0A 1NVVQ 2W2TA 1IBRA 1YZKA 2BJWA 1P3JA 5FI1B 1VG8A 3RS5A 3VFDA 3L0PA 4OYHA 1XTJA 1T3LA 2O8CB 4R71A 2HT6A 1S4QA 4JVSB 4RCZA 5EUQB 5JSZB 4Z8YA 1GDDA 1G18A 4W9MC 3PENA 1GILA 1OJLA 1JR3D 4X8MA 4YXWA 5EXSA 4QBFA 4E09A 1ZNWA 1EWRA 2F7SA 2FSHA 1GZSA 2ZJ2A 4DSNA 1JALA 5KOYA 4NCHA 1MABA 2ZETA 4LHYA 3VR4A 5AJWA 2DFTA 2GZDA 1AM4D 4OK6A 1OB2A 5CJ2A 1EFRD 1S2MA 4EAQA 5LPNA 2PLRA 2ZS9A 3ZQJA 2OLJA 1X8KA 3BERA 1DEKA 1S3GA 4KHZA 3B9QA 3F0TA 4GPTA 4UJ3A 3H1TA 3VHXA 2QENA 1ZRHA 2YVUA 2W58A 2YWEA 4HAVA 1E79A 3PUZA 2GWHA 2RGNA 1S96A 1OIXA 1XB2A 1W46A 3JVVA 4TLAA 4DLYA 2VA8A 4B2PA 1OXUA 1XPOA 2ZRMA 2RB4A 4WW0A 4CEIA 2C99A 3OZXA 1G16A 1A2BA 2JJ8A 4D0GA 3A58B 3I62A 1R5OA 4A0RA 2CHGA 1WP9A 5J40A 5KU1A 4P31A 1H65A 4IXMA 2R62A 3WYFA 421PA 4QNRA 1R0XA 5TY0A 1WQ1R 5DH9A 2Z5FA 4UNNA 4W7SA 5L3SA 2XAUA 2FGKA 4IFBA 3TQCA 4EPVA 3GLHA 4LOAA 1J8YF 2XJ4A 1JJ7A 3A1TA 4ZCMA 2WZQA 2PBRA 2ZPTX 3MWLA 1LV7A 4XVQA 3I32A 4FINA 5JI2E 1NVVR 2NO9A 4KO8A 4B3DA 3R9XA 1Z2CA 4LBWA 5B2ZA 1NN0A 3UK6A 4QBHA 3REFA 3MAAC 4PQRA 4E5UA 4D4LA 1VDZA 4FMBB 4IFEA 2CLSA 1TADA 2ZJ8A 1T0JB 4EPYA 3CH5A 4LSGA 4JT2A 4U5XA 2IK8A 2ZSDA 3P4XA 2O8BA 3QNUA 4XVRA 2XXAA 1W36B 3IIJA 3KUCA 4Q7JB 2P3SA 2RAPA 3GFTA 2AL7A 4ZCLA 5AUPB 2GK7A 2XTMA 2J7PD 5CDFE 3SN6A 4PAMA 2A2ZA 2AHOA 4DKXA 2XZLA 1OT3A 3F3YA 2BWJA 3A36A 1E94E 4DLXA 4DDVA 1A2KC 1KI4A 2REOA 4C2UA 3U3MA 1XJ0A 2XITA 2XNSA 3K0AA 5F98A 3KKPA 3NC0C 1IY0A 5HCIA 3RLFA 4HAXA 3U2QA 4A0HA 3ZS9A 3HR8A 3TJZA 3WNBA 4CIDA 2PMDA 4A1FA 1US8A 3EC2A 2FFBA 3KQNA 1ZP6A 1E9EA 2RGXA 1SVWA 3Q7PA 3CNLA 3OEHA 3U7FB 3B13B 2QSYA 4DWJA 2PX0A 4HLUC 2PT7A 4C7OB 2GEUA 3RAPR 3U6KA 3ZZUA 5DI3A 1EGAA 1G3QA 3B1WA 3GLFA 2DHRA 3L82B 3KFVA 2OLKA 4QHYA 1ZM4A 4S2EA 3LWNA 1SULA 4V0ME 2D4HA 1WXQA 4X8HA 4EIWA 1HT2E 4H1UA 3B7GA 1KI2A 1GOTA 1EX7A 2MSDB 3CX6A 1ETUA 2BBSA 2QPOA 2R44A 2WIAA 3ZGXA 2IYSA 4LBVA 4CW7A 1DAIA 2HYDA 1KKMA 3HPQA 4JKIA 3A4MA 1S9DA 2IEYA 4LC1A 3RNLA 2NO0A 3PV0A 2ZJYA 4Q1EA 4Q4HB 3TSZA 5C2JB 1DAGA 4PAQA 5EE3A 3U7GA 1FFHA 2ZXUA 3OESA 2XZPA 1XEXB 2JLVA 1B0UA 4RJLA 3H4MA 1KDTA 1TPZA 3AP1A 2R8RA 4PR0A 4KYIB 4YC7A 2BKEA 3CRW1 3QSYA 3CWZA 1NMZA 3A8TA 2CCGA 3T61A 2QT1A 2IX3A 4P0TA 4PHTA 1MOZA 2RCNA 5CLLA 3AKCA 4WAUA 4NU0A 1G7SA 5CK5A 1E0AA 3MFYA 4G5QA 4RY2A 4PPNA 4QJ5A 1YZLA 2FZLA 2Q21A 3T34A 3GLIB 4CEJA 1VECA 2XX3A 5H8WA 2VP6A 4TYYA 2B8TA 5FL7A 3CLVA 3MJRA 4Q9HA 1Z6XA 1ZIOA 4HAUA 1RPZA 1G17A 3U44A 2D2FA 2AXPA 3K9GA 3O8CA 3ZVMA 5DNYB 3OEHD 1JNYA 2QQEA 3GLGB 4WA7A 1E3MA 3K0SA 1NJGA 1SVLA 3AH8A 2VP0A 4FD2A 2JLRA 4EUNA 2QI9C 3GJ7A 3AVWA 3FDIA 3ADKA 4DEXA 3LFUA 2RMKA 4EJSA 5TVKA 2FX3A 4MDFA 4CGZA 5SZKB 1JPJA 1UDWA 1RFLA 1DOAA 1LS6A 5CIQA 5KDOA 4G0NA 5KTYA 2OCBA 1TF2A 1E2GA 3E1SA 4GBMA 5A4JA 1DG3A 2JLSA 4NH0A 1WBDA 2DB3A 5JEEA 5BXQC 5JJKA 2IT1A 2IYYA 1QHNA 1IN6A 1NNEA 3WNCA 4TZ6A 1XRJA 2RGEA 3SE0A 4C0QC 2GNOA 2GCNA 4IVPA 3THYA 2RGAA 2IL1A 4EPRA 2V8OA 5HE8A 1E9RA 4OI4A 1G9XA 2WICA 4M22A 1OH5A 4TLDA 1D2NA 2O0JA 4HAZA 3EG5A 1F60A 2WJVA 2C03A 2H57A 2O8CA 2HEIA 3NTUA 2ZI6A 4TYPA 4LGMA 4NHOA 2Q9CA 5JSZA 1N2CE 4A8JC 3SS8A 1HE8B 3I5XA 3P32A 2DY1A 2HCBA 2UVQA 2DFLA 3BB1A 1RIFA 2J0VA 4MRNA 4RD4A 4XH9B 4H1VA 3SHWA 1BMFD 5C4MA 2XSZA 3DVLA 5JWRA 2IS2A 1S1CA 2I4IA 4LYAA 2A78A 1OXTA 5HTKA 5JZVA 2CMKA 4JLNA 3EXAA 4PQYA 5FL7D 4PC1A 2WSMA 2R2AA 1XPUA 1ELOA 2XTZA 3UKDA 1GG2A 1E4VA 4QJ3A 4AKEA 1RYFA 3K0EA 3AVXA 4DT1B 1OIVA 4URXR 3HP1A 3W8RA 4PSVA 3W9YA 1KI6B 2IUTA 2ZI4A 1QZXA 2N46A 3KL4A 4NCJA 2OM2A 1CKEA 3ASZA 2IYXA 5SZJA 1SVIA 2KE5A 3TK1A 1ODFA 2A5YB 4AC9A 4PSKA 2BDTA 2ZSBA 2FFHA 1GAJA 4QGGA 4FW9A 4DB4A 4OK3A 2AK2A 3TLXA 4BZPA 3PCRB 2V6IA 2ZUCA 3IHWA 2FA9A 1DAHA 4MGZR 3RRZA 1G7RA 1WMSA 2G83A 2VH5R 1F2UB 2HUPA 4MRSA 1E0SA 2QTHA 5IRCD 3VX4A 3A1UA 3NBZC 4LV6A 3U6BA 2ORIA 1QHSA 1NMXA 1NVXQ 2DFKB 4G5SA 4JYCA 1KIMA 3KJHA 3I8XA 3SHFA 1KHTA 2HV8A 2XSZD 4LBYA 3NBXX 2FG5A 2ZSEA 1OPXA 3DM9B 1GRQA 4KFSA 1TEVA 3LA6A 4URYR 3SJCA 1CJKC 1UKYA 4ASUA 1IAQA 2ZRJA 4L5BA 5JFGA 4LPKA 2H92A 2ZRBA 4GSYA 1R5NA 3W5IA 1HQYE 4UXHA 2F1IA 2BBWA 4EPTA 2IXFA 3WRYC 3BFVA 2CJWB 2DWOA 2AN9A 4IRUB 1CR0A 3SYKA 1RYHA 2CBZA 1GRNA 2ZAMA 3SR0A 1WB9A 1VCIA 4CF7A 3FOZA 1YQTA 1M34E 1KDRA 3ADBA 1KDPA 4P3YA 3VHLB 4IHQA 1W7AA 4A2QA 4TN1A 2HJVA 1RW4A 1YHNA 4OI0A 1TF7A 1M7BA 1U0JA 2ORWA 2ZE6A 3FB4A 1X8LA 3RRYA 1Q21A 2J46A 1R6BX 4QKQA 4BFZA 4Q9KA 4C7OA 3PG5A 1G8HA 1K5DA 4PPFA 1JBKA 3D6TB 3SYLA 3BB4A 3X1ZA 1ZUIA 3EC1A 1W0KA 2FSGA 2OSBA 4JVNA 1OFHA 4JT4A 2GK6A 4URWR 4W5WA 1X1RA 1AS2A 4Q00A 1E9AA 1CRQA 1KK0A 2GJ9A 2QMOA 3W8NA 2JLUA 2IS1A 2ZREA 2JJ2A 4TQ9A 4Q1BA 2DBYA 5B64A 3B1YA 2V1UA 2E87A 1YZUA 4DRZA 4C0JA 5TDHA 1E1RA 5FUXA 4AIIA 221PA 2ORVA 4LI0A 4OHXA 1UF9A 1ZUHA 2JA1A 2H8KA 1J2JA 3GLHE 5FOUA 5F2EA 1VG9B 2GZHA 5KSYA 1Q1QA 3T35A 4JSYA 4TT3A 4H9GA 1Z47A 2F43A 4PHFA 1E2QA 1MO6A 4I4LA 1XMSA 4ASUD 5AUNB 5LDDC 1XEXA 1ZU5A 5BW8A 5GJCA 1NKSA 4LHVA 1ZNXA 4URUR 2V55B 5JCPA 2R9VA 2DR3A 2NMVA 1K8RA 2QAGC 2V54A 2VO1A 4B2LA 1FP7A 2DCUA 3GLIA 3U3JA 4FMCF 5JS8A 3LDAA 3OF5A 4JIMA 1GL7A 3BORA 4LJ9A 5D3QA 4KFTA 2GETA 2ZVPX 3LAWA 3GLGA 3D7MA 4LJ6A 4PO8A 1KYIA 4MDEA 2ZS8A 4L9SA 4M1YA 3TGPA 4F7WA 4IW3B 1FUKA 3W6NA 1W49A 1JQLB 4QRHA 5FBRB 2VHUA 2UZIR 1F5NA 4CEIB 1R2QA 5EP4A 3QPVA 4HEJA 4Z1MA 1OH6A 1VCNA 3TAHA 2ZYTX 2FJUA 1GKYA 2JJ2D 4R98A 1Z2AA 2OHFA 4ZI3A 1UKVY 1HY3A 4AD8A 2WJGA 2R6FA 3WBKA 3IIMA 3OE7A 3U7EB 5DYGA 4US0R 2GBLC 3QENA 2EYUA 1N6HA 2ZJOA 5JS7A 4A15A 1YRBA 3AP3A 4RD2A 2J0UB 2GZAA 3MJHA 4NCIA 3GEIA 3NKVA 4TT3D 4BLTA 5FTMA 3Q85A 2ERYA 3M6AA 1II0A 3UMFA 1OFUX 2QGZA 4Q9LA 1R4AA 3BXZA 4W5JA 3EW9A 1HTWA 2G3YA 1P9WA 1N0WA 5E3HA 4HB4A 2O8BB 3QBTA 3FMFA 3KDSE 3THWA 4YMSA 5G40A 5JJIA 1VYVA 2WKQA 1KI3A 3DDCA 3MG9A 1Q22A 4JLMA 1GL6A 3QF4B 1XX6A 2Z4RA 2C9YA 3HPRA 3KQUA 4Y0AA 3MLEA 4E03A 3VMFA 1A4RA 4MKIA 1LFDB 1NSTA 2OFOA 3AVTA 2NO6A 1N0UA 3B78A 2B7BA 1T8TA 4ZI2A 4DIEA 1PV4A 3SNHA 4I81A 1PJRA 5L3VA 4O3MA 2J0QA 4DT1A 3WYAA 4ZDIA 2HT1A 2NOAA 1HQCA 1GFIA 1KI6A 2YC4C 2OILA 4QG7A 3T5DA 1YRAA 1QG2A 3NBFA 2JLZA 3QXXA 1FMLA 3THXB 3AB3A 4DLVA 4IVQA 2YWFA 1Q0UA 1W5TA 4X8OA 3E5HA 2QROA 4JBWA 3ZJYA 1ZVQA 1ZM2A 5AUOB 4TLBA 4WBSA 4CDGA 2VP5A 3MUFA 1Z0AA 3C15C 1M7GA 3X1YA 3OE7D 2H17A 4B48A 3C5CA 3QXJA 2F9LA 4P4SB 2XJ9A 1Q1BA 1VTKA 2LCFA 4F38A 4XOIA 1N3BA 4Q1FA 3I73A 4D0NA 4D81A 1OV4A 1C9KA 4EPWA 3DHWC 4OI2A 4DBLC 1N5LA 3CRVA 3AP2A 4MRRA 1QHIA 4JL5A 2Z6VA 2ZSFA 3GPLA 4P4UA 4UXIA 2ZM5A 3MD0A 2RGDA 3LH5A 2N1BA 5IHPA 2VHTA 3TAUA 2FFAA 1XTSA 2X8AA 3ICEA 2RH5A 3U7HB 1Z06A 2PCJA 4US1R 4IDNA 1JR3A 1UKZA 2G1JA 2IYWA 3B1XA 4Q47A 4AG5A 3K70C 4FCVA 2WMNB 1TQ4A 2FU5C 1WA5A 1T0HB 2EFEB 3VU9B 1FTSA 2QGNA 4N3NA 4QGHA 2CJWA 4CEJB 2OG2A 5FTNA 1KNQA 3MRSA 1KKLA 1SQ5A 1OW3B 1KAGA 3GEEA 4NE2A 4ZPXA 1PLJA 5JECA 1ZW6A 3RVBA 2YHSA 3K09C 4AI6A 1DARA 1E2HA 4KU4A 1XD8A 3A1VA 4JSTA 3FKQA 3Q5EA 2FPKA 3RS4A 1DG1G 2OXRA 1SGWA 3OAAA 1TTTA 4TSFA 1E2LA 2VBCA 4Y0VA 3DOFA 1CS4C 1R8SA 1NY6A 2NIPA 1KY2A 1EK0A 1G6OA 2WVJA 2C5LA 4LHXA 4OQXA 4TYNA 4BLRA 4NYIQ 1U99A 1TQ2A 2AFIE 1F2TA 1NN3A 3WHLA 4B71A 3O8RA 4RFSB 1PLKA 3RSOA 2VEDA 2XTNA 3T1VA 3ZVLA 5F9HA 1E96A 3LBNA 2J3EA 5CM8B 2ZYVX 1HYQA 1GIAA 2CL6X 3FFBA 2CL0X 2IHYA 1II8B 2C04A 4DIDA 1Y63A 3NWJA 5J4YA 3CZQA 5JHGB 5KNBA 3NEYA 3AVVA 4D25A 1TAGA 1NRJB 3EZ9A 1BIFA 1LF5A 2KI5A 1AQYA 4IDQA 4B47A 3CW2A 4DCTA 2ZRPA 1G41A 5HKKD 1W47A 1UBFA 4UNSA 1KMHB 1GRRA 2F9MA 2GXUA 3SQXA 1FX0B 1ZCBA 4R2IA 1SZPA 2PLFA 4WXRA 3PEYA 1G19A 4LPSA 2NO1A 2R6DA 4GNKA 1E0JA 1OXSC 3GJ8A 2OBLA 3NXSA 2J7PA 2VSOA 4MYCA 4Q1CA 3IDQA 3QVUA 5BWMA 5FFMA 4IXNA 5K8IA 2HLDA 3OIWA 4M1KA 5GVRA 3SJZA 2QP3A 2GAOA 1P75A 1ZNZA 4F4IA 1Q3TA 4OHVA 4QJ4A 2MSEB 2WWFA 3CH4B 3WNDA 4X8LA 3U3KA 1U8ZA 1HEIA 3OAAD 4R7ZA 4LC0A 4TSFD 2QEQA 5A0FA 4KJZA 4M1OA 4M8NE 5IK2A 4RCYA 1CU1A 4LJYA 4IDPA 1T3SA 1VPLA 2ZRGA 2ZJ5A 1T5LA 4PZYA 2V6JA 4JBYA 1Z8FA 4PZZA 2JLWA 2FE4A 4IVRA 2FDCA 1KO5A 1U0HC 2QP9X 4KFUA 4PHHA 4EDHA 3IUYA 4PC7A 5FUVA 3IPYA 4GFDA 1E2NA 2IEZA 1E69A 1L7VC 1I4LD 1TL7C 4B76A 4BFUA 1X3SA 2O8DB 1N5KA 1N6LA 4QXAA 1T3HA 821PA 2J0UA 3EIEA 1FMJA 2D3WA 3FFAA 3MWYW 3P4YA 2OBMA 4TYQA 4TMKA 4M9XA 5H68A 1HURA 3IO5A 2PZEA 2VQSA 3CBQA 1MT0A 2PJZA 1W4RA 5FPHA 4DJTA 2HXSA 4M9SA 1SHZA 3Q3JB 3R9WA 2Q3HA 3B1ZA 3TE6A 3W6PA 4CT5A 2WWHA 1TEXA 4V0LA 5D3MB 4CRWB 1OHHA 1CEEA 4BFXA 2IA5A 121PA 3NHAA 4A92A 3QF4A 2GEVA 3HDTA 2HLDD 1TNDA 2WWXA 2OFWA 4KAXA 1J8MF 1C1YA 1UM8A 3LX8A 4C0AC 2RHDA 4HB3A 3U61B 4I1VA 3KKMA 2BIFA 3ZVNA 1NG9A 1E2FA 2PT5A 5HZHA 2ERXA 2IF0A 1T8UA 2YOGA 3LXXA 1KMQA 4FI3C 8OHMA 1KZ7B 3B85A 3BE4A 3GLIE 2WHXA 1WBBA 5IK2D 1IY1A 3PEUA 2OUKA 5EP3A 5EJEA 2O52A 1DELA 2VTKA 5EP2A 3THXA 3GLGE 3QQ5A 1D2EA 2VP9A 2P5SA 1KTVA 1VYUA 3KXLA 1NKTA 4TQAA 1KK1A 1SVOA 2ZIAA 2VHJA 3K0FB 1IOZA 5KSOA 4B43A 721PA 4EPXA 1A7JA 1E6CA 1NIJA 1QVRA 1XTKA 3UWKA 3FYHA 3WXMA 1XTQA 3ZZTA 3GFOA 3AF1A 1QHYA 1MH1A 4NDZA 2L0XA 3V9PA 1ZM7A 3CR8A 4P4SA 4BZQA 5BN3A 3T1OA 4Q18A 1NVUQ 1RE0A 2PH1A 3AKEA 3L8ZA 5FBLB 1H8EA 3PITA 1ZC4A 4PC3A 1FNNA 3L43A 3TNFA 4F93B 4GMXA 1K5GA 1M2OB 4OJKA 3QUSA 3BGWA 1CJMA 2IXEA 4B3FX 2C78A 3CONA 3WP0A 1KI9A 2PZGA 3VKGA 4A0FA 3DKVA 4BFVA 1E2KA 2F43B 1Z6TA 2YOHA 2ZSAA 3PJRA 4BFYA 1NL3A 4GZLA 1N5JA 1OHHD 2JAQA 5L8VA 5EE0A 1Z0DA 2FFQA 2GESA 3LQRA 2GRJA 3FHOA 4BRUA 3VNUA 2CHVA 5GADl 1CP2A 1BMFA 1XCPA 3BD9A 3QY0A 3VU9A 1TUIA 3TSWA 2AWNA 3BJIC 3ASYA 4QFMA 4BQSA 1CRPA 1RRCA 2OFXA 2ZRFA 2CCJA 4TWZA 4B2IA 1QHXA 2P2LA 4AYXA 4DUGD 3GP8A 1LTQA 5HE9A 5L3QB 1KO1A 4YMTA 4TMWA 4DSOA 2VF7A 4RKEA 3IQXA 3TUIC 4ESHA 3WMGA 4WZ6A 1W4AA 1GSIA 4GI7A 4WZAE 1KY3A 2ATXA 1R0ZA 4PHGA 4L15A 4M2LA 2CXXA 2F3TA 4LJ4A 1YVDA 4JKYA 3TVDA 5EE9A 4Q9IA 2ZRLA 4DXAA 2AD5A 3CF2A 1XZPA 2Q6TA 4FCTA 1CJUC 3KKNA 5KPDA 5KUTA 1JR6A 3LW7A 3SI7A 4HLQB 1OIWA 3PXGA 1DAEA 1P7CA 1XMJA 2D06A 2HCJB 2LKDA 2ZRNA 4G3XA 1H8ED 4ITRC 4ACBA 2UZ3A 3RRMA 1BS1A 2OAP1 1Z6GA 2WAXA 4QM7A 3EPLA 2GJAA 2J7KA 4RFSA 3K0CA 3RHFA 1XJCA 1LB1B 1P72A 3EA5A 4KFRA 1TF5A 3EIHA 4TYWA 4Q5IA 2QG6A 1J70A 2P6NA 2R6AA 1JPNA 4NP6A 1LY1A 4LV5B 2B7CA 2FGJA 2XNDA 4QM6A 1JXOA 4PAOA 3KQHA 1XD9A 3CNNA 4KITB 3UANA 1II8A 2ONKA 1COWA 3C7KA 4PXAA 3Q5DA 5AJZA 2BMFA 4RD0A 3THWB 1KI7A 3T1TA 5FH9A 2QZ4A 1XCMA 2FH5B 4DCNA 1FNMA 1GTVA 2WJJA 3ZQ6A 2EFCB 4UNRA 1KMHA 2OO7A 1FX0A 3SC3A 3GMTA 1JR3E 3UG6A 4OHYA 2OAQ1 2IUSA 4Q66C 2XEXA 4LHZA 4D0LB 5LB2A 3TIFA 2I1QA 3EWSA 3IILA 4IDHA 3Q7QA 4CT4B 4XWKA 4XJXA 2D62A 4KSBA 1M74A 1NBMD 4LRWA 4P4TA 4PC6A 3G82C 1NLZA 4NL4H 3K8YA 3DL0A 3E70C 2OCYC 1E9DA 3QVVA 1QF9A 3LVRE 3LBIA 1NVWQ 3KB2A 1CJVC 1ZUNB 1NY5A 1HV8A 3FMIA 2XB2A 3GJXC 5DYIA 1WE2A 5BYJA 2YZ2A 3V4RA 5JJLA 1Z63A 2AKYA 2YJTD 2ZRKA 5EE5B 1RJ9B 2VP2A 3GFPA 5J4VA 3KJEA 4IOKA 4M9QA 4ESVA 1QBKC 4B6FA 5E7IA 4O25A 3RC3A 3DOEA 4IOJA 4Q02A 1XZQA 3FE2A 4C0SA 2EQBA 5CITA 1UEJA 5JCZA 1P9RA 1FZQA 2W2XA 3N2EA 2ZYUX 3JZMA 4DDWA 2Z83A 5CB6A 4Q4JB 5C4GB 3I61A 4DLWA 3M4YA 2XNDD 2O0HA 4QNMA 3HU1A 1MO4A 1G3RA 1Z0JA 4XVUA 2O8DA 4HZUB 3F5FA 5FUYA 1COWD 3UWOA 3L8YA 1NMYA 1JI0A 1D8TA 1E9SA 2BC9A 4JLAA 2WOOA 3QKSA 1RZ3A 1I4DD 4B3GA 2QA5A 4V0NA 3AVYA 1FOEB 2WPDD 2QAJA 2A5DA 3GCGA 2AXNA 1E1QD 3L0IB 1D5CA 2ZRAA 2K5UA 3BOSA 1G3UA 3K09A 2ZTSA 2HXYA 4RD3A 4C0LA 3ZYCA 2DWQA 3QEJA 4Q7LA 4B3CA 5D3MA 2X19A 1V5WA 2I3BA 2ZI3A 4YDSA 4A6XA 4DHEA 4C3ZA 1N6IA 1OFIA 4HDCA 2QUZA 2GCOB 2ASEA 1BYIA 2FSIA 2QPTA 3SJBA 3V4FA 2Q0HA 1UDXA 1YZQA 3TRFA 1ESNA 5M04A 1TX4B 4G5GA 3LVQE 4XSHA 2X2FA 5DN6A 1KZGB 2AR7A 2R6CA 2CE2X 3C41J 4TL9A 5FOSA 4D2IA 1UFQA 4DSTA 5KSZA 1H8HD 2PX3A 3EAQA 4HAWA 3U60B 1P2UA 3NVAA 3PUVA 4ZO4A 2ZAOA 2VL7A 3TR0A 2CE7A 1JB1A 4MGIR 5FL3A 4ZDJA 5C18A 4U02A 4A2WA 1S1MA 2E1RA 4Q7KA 3LNCA 5AWFC 4DLTA 4ERNA 3Q9LA 1EXMA 1GNQA 2QP4A 4WXPA 3K0FA 1RRGA 4XTCS 1W2HA 3DMDA 4P32A 3T1QA 1K6MA 2ZITA 4A8JB 2EVWX 1ZM3A 4QHSA 3K70D 1F2TB 2X2EA 4OL0A 1N6NA 1UEIA 1VCMA 5F9FA 1YR9A 5DI9A 3R9IA 1SKYE 4NTZA 2UKDA 3LY5A 4G5OA 4MA4A 1IXRC 2FNAA 5CLQA 2CHQA 2C2HA 2HYIC 5HZKA 2W6ID 3GJ5A 3VR5A 1E9CA 1SXJC 2F6RA 5FPSA 1NSFA 1HH4A 1IJEA 3BFXA 2IYRA 5SZIA 2ZJAA 4NCKA 1GM5A 3IIKA 3R20A 4K81B 3RDPA 1GNPA 5JMTA 4TMXA 3OEED 3WBJA 2ZE7A 1P2TA 4AG6A 2XB4A 4FWTA 4I99A 4M1TA 1KSFX 1Q20A 1S8FA 1T5IA 2C77A 2VP4A 3LO5A 4UKDA 3ZD6A 3UATA 3AEZA 5DN6D 1FUUA 4NMMA 1PVOA 1WRBA 2CVFA 5J4HA 2IYUA 2N42A 4HATA 3QXHA 4Q9JA 4CZ2A 5L3QA 2D2EA 3KZ1E 4AK9A 5FBQB 5FBVB 1MO5A 1MRNA 4RFVA 5J4KA 3VNVA 3FWYA 2RGGA 4O0MA 3W3ZB 1PLLA 3P27A 3SJAA 2GXQA 4QHTA 4M53A 2WWIA 5CIWA 4UNPA 2FOLA 2VSXA 2BBOA 1NLFA 4B33A 3GJ3A 3DZDA 3OIVA 4M0LA 4GZMA 2DYKA 5FOXA 5IDVA 4C2TA 1FQJA 4IDOA 4XD7A 1FPMA 3K9LA 3FMPB 1NG1A 5KDLA 1P2VA 4JJZA 1ZD1A 4KCGA 1P4SA 4M1SA 1SKYB 4D82A 1XBTA 4DDUA 2FWRA 2O8FA 1E2MA 2REXB 5JWHA 3BH6A 5P21A 4UJ5A 1BOFA 4GOKA 1XXHB 1XTIA 1G5RA 2IYTA 1GWNA 1FTNA 4OJQA 4QGAA 4TMVA 3EX7C 1JJVA 2OZEA 4RZXA 3CIOA 2BMJA 2F3RA 1G6HA 1VKJA 3NDPA 4ZIRB 3U5ZB 3B82A 3RC8A 1MR3F 2BEKA 4DZZA 2H16A 3LLUA 4UXJA 2Z43A 3QE0A 1AZTA 2VLIA 3A4NA 3THOA 2AKAB 2Y8EA 1M8PA 1Y3AA 3KJGA 1M7HA 1IJFA 4D4JA 2WWYA 2OESA 3ADCA 4EJSC 1ZINA 4HLDA 3FMOB 3H0KA 2VIIA 3BAFA 2IHBA 1QHGA 2C9OA 4TLEA 1JAHA 1XMVA 2KBFA 1R10A 2QMUA 3IEUA 4HLUA 4B75A 4F4CA 1VYTA 2B92A 4D80A 1E2PA 2PZFA 3LV8A 2MMGA 3TVTA 4JZKA 2ZU6A 2GF9A 2W83A 3WYGA 3MWJA 4V0OA 1DS6A 4ACAA 3TKLA 2CL7X 2P6RA 5EZ6B 4POAA 4AKHA 3AGQA 2QL6A 4YLGA 3X1DA 1R0WA 5LD2C 4Q01A 3WRXC 4C0KA 3EZ6A 3GJ6A 3OIUA 1G7CA 2JDID 4GT1A 2VYFA 2Z4SA 4PTLA 4BLQA 5E4FA 3LXRA 3NDBB 4ILEA 2CDNA 4FMDF 4PSAA 4XD7D 3SFZA 2ODEA 2P5TB 3VQTA 1LS1A 2H1LA 2P6UA 4LJ7A 4EKDA 1U8AA 1ZU4A 1EFCA 1RJ9A 4FMCB 4OQNA 4S35A 3AF4A 4BFTA 2NTYC 4LX0A 4J0QA 4C4PA 2WMOB 1XU4A 4PX9A 4M4SA 3AV0B 2ODNA 3SBDA 1CBUA 1KI1A 2WIBA 5ANRB 3I92A 5FPTA 2AD1A 1ZC3A 2OXCA 4ZKDA 4G1UC 2BJVA 4LJAA 4Q4JA 1U8YA 2C95A 1J99A 1Z6YA 3CWQA 3OIYA 2QAGB 4MGYR 2YC2C 1L2TA 4HZUA 4V02A 5GJVC 4GP6A 2ZR9A 4JLBA 4MH0R 4MRPA 2NGRA 4NCNA 2J41A 1WF3A 3LX5A 2GVDC 2NZJA 3W34A 1DVRA 1WDTA 2YWHA 1F3OA 2ZE8A 4DB2A 4TTRA 4B34A 1DAKA 1VMAA 1ZMXA 3OHMA 2QQ0A 2IC5A 3X1WA 3VKWA 4A6PA 2G77B 1Q57A 4PO1A 2ANBA 5LB4A 5HKKA 2ZI9A 1Z3IX 2KBEA 4I1OA 1OYWA 2GCOA 2A3RA 4KV9A 1W2GA 2B8WA 2GHIA 2H18A 5IF9A 2EWWA 1OB5A 3AKDA 2BVNA 2VHCA 4KVGA 4LYFA 4TTPA 4XSGA 3G5UA 4D4KA 1KJWA 2GXAA 2ONJA 4RZUA 4FWIB 2FEOA 3ZLJA 1Z29A 4RKFA 4O2LA 3SU8A 4HAYA 621PA 3CRMA 2QRNA 2V7QA 4OK5A 3PUXA 2OEPA 4MKHA 3MCAA 5JI3E 3CKLA 2EYQA 1BYUA 2RGBA 4LDJA 4BUJA 2CEAA 4MITA 2J87A 3VR1A 1DE0A 1I4TD 2A5FA 4QL3A 1XTRA 3QKUA 4A8JA 2GDJA 4DCVA 1WCV1 4N0EA 1W36C 5K8TA 3QKTA 3RS0A 2BKUA 2PCLA 4ZCIA 1ZYUA 4HZIA 5DLQC 2FPLA 4NZYA 1OXVA 3TW8B 4JL8A 2OBNA 4ZKEA 3AKYA 2C9CA 4BLSA 2GJSA 3HWSA 3QKRA 3R7WB 3U3OA 2CLDX 1HUQA 3Q72A 4BEJA 4KXFB 1AS3A 2AX4A 2JCSA 1RRFA 3PUWA 4ZV4A 4E07A 1EX6A 1B23P 4HUQB 5IT5A 2QE7A 1Z08A 2WV9A 1MKYA 4M1WA 4ABYA 4D4MA 4MYHA 2W2VA 3ADDA 4D6PA 1OXXK 4CVNA 2AFHE 3FPAA 3IO3A 4DC9A 2OV2A 5B58C 521PA 3KKOA 3MGCA 1D9ZA 2WJIA 1ZD8A 1X8JA 2HF9A 2V9PA 5HR5A 1P73A 2F1HA 1EWQA 1KAOA 3B60A 4IOLA 2D74A 4RZ2A 5TARA 4US2R 4FIDA 3IGFA 4URVR 1G8GA 4TL6A 5CM9C 4JYBA 5DHFA 3Q8XB 3NG1A 2KB0A 1GVNB 3FTQA 1N6PA 2PEYA 2W0MA 4LV8B 4KI0A 2QU8A 4DLSA 2QPAA 1Z0IA 5KDDA 1EFHA 2V7QD 3CPJB 2QBYB 2A30A 2QORA 5JEDA 4LJ5A 3W3AA 4N1AA 3CB4A 1E98A 3QOFA 1P61B 2QM7A 4RZ3A 1P6XA 3BRWD 3BWDD 1Z83A 1I2DA 2WWGA 3QXCA 4AURA 4OQFA 1GP2A 1R7RA 3I1FA 2VSFA 1O3YA 2B21A 5KSPA 1R5BA 5E7MA 3AVOA 4YMUA 5BN4A 4K8OA 4C30A 4G5RA 4NYIR 2W0SA 3RS7A 1FQKA 4BFSA 2ZQ5A 5FTKA 1XXHA 3RABA 3K70B 4ZDKA 4BFWA 2YOFA 1XF9A 2GTPA 3NHBA 3SFVA 1UKEA 1ZIPA 2IW3A 1CTQA 1AIPA 1KK2A 2MMCA 2G88A 4JLJA 5EXPA 1W4CA 1ZAKA 3U4QB 1L8QA 3HU2A 1KSJA 2GKSA 4Q4LA 5FPKA 1ANKA 5BYKA 1DPFA 3PQCA 5JLJA 4ARZB 3QKSB 1OFTA 2QE7D 4ZIRA 5GJWC 2O8EA 4TLCA 5K8LA 3JVUA 4IEIA 4ON9A 3GD7A 3VTKA 4B3XA 5DSZA 2NG1A 3HR7A 3QI2A 5EUMA 3SOPA 3CR7A 3A4LA 4NONA 1CULC 5JRJA 1N0VC 2KWIA 3AVQA 1QG4A 3C8UA 1XNJA 2ATVA 4F91B 1AKYA 1C4OA 4L9WA 1LF0A 3ECCA 4YXWD 1XMIA 2IS4A 4WIAA 1E2DA 2Z0MA 2JJ1A 4Z54A 2A5GA 1Q1ZA 2GVZC 3T12A 3TUJC 4U7DA 1N6OA 2J5XA 3KKQA 2FN4A 5HPYB 3NBYC 1YZTA 3TQFA 4R2HA 4NKRA 4AYWA 3CF0A 3CRRA 1U94A 4DUGA 3G0HA 5DISB 1VIAA 2AK3A 3N70A 4L16A 5DHAA 1EG7A 1MV5A 1RRPA 1PUIA 3RS3A 4XWOA 3U3RA 3FVQA 3IKJA 2Q9AA 1O87A 3IQWA 3UXMA 5AK0A 3TMKA 4NPHA 2FMXA 4JVMA 1DO2A 1NF3A 1V43A 3ZH9B 1E9BA 3D31A 3ZZ0A 4AKIA 3S1AA 1DBSA 1E79D 1U98A 3P26A 4FN5A 1TQDA 2JEOA 3SBEA 2GAAA 1SXJA 1AN0A 3B6EA 3DMNA 2D7DA 4M9ZA 5AR1A 2YWGA 2LKCA 4GMDA 4DCUA 3F8TA 2FF7A 5JBQA 4GDFA 2J0SA 1KSGA 3NH6A 4N0DA 3P1JA 3ZDQA 3HU3A 4LYHA 3FHCB 1X86B 2P0EA 1XPRA 1F6BA 2QAGA 4TMZA 4B3BA 3EPJA 2CVHA 4Q4AA 1A82A 3SYNA 1XP8A 1G291 5H1YA 1Q12A 5FPYA 1AKEA 4BLPA 1CR1A 2ZE5A 5FI0B 1G8FA 3K9NA 3QF7A 4PO9A 2GCPA 4HUTA 3ICQB 4XIGS 1G8YA 1TUEA 4PQFA 3KTAA 2HJGA 2JJ1D 1GNRA 2H5EA 2MSCB 3AVPA 2ODWA 1YZGA 1AJEA 4LK2A 2G0TA 3L0OA 3HJNA 3SQWA 4GOJA 2D7CA 2BOVA 1W44A 4EQ6B 3R8CA 3GEHA 3PUYA 1KJZA 2O0KA 4YQFA 2P65A 3CPEA 2ZRCA 2ZYWX 3KQKA 2ZRDA 1G3MA 1E2EA 5EP1A 3O8DA 5FR1A 4HB2A 4WVFA 1NBMA 2IWHA 2C8VA 4QBGB 1A1VA 1XEWY 3LD9A 4MKGA 5SZHB 1N5IA 2GBLA 2ZANA 5K8UA 4LYJA 1CIPA 3DPUA 1GKUB 2ODBA 1Q1EA 1DADA 3BFKA 2ZVQX 3QPWA 2OE2A 4EFMA 1SXJD 4B44A 4TL7A 3AF0A 2JIZA 3T15A 2KJQA 1YR6A 3BB3A 4OKSA 3WMEA 1OKKA 1U90A 1QRAA 1IN5A 1ZNYA 1DO0A 1UAAA 4IOMA 2O8FB 1IQPA 2F1JA 2QMHA 1IONA 2GA8A 3LBHA 2ZJBA 2ZUBA 3W5JA 4A2PA 2EW1A 2PL3A 2IYQA 3RRNA 4CEHB 4DVGA 1P62B 2PMKA 3EZ2A 2GJKA 3CRQA 1G5TA 3C14C 4BZXA 4B73A 5CYPA 4URZR 1U9IC 5AJXA 2ZI5A 2JATA 1OH8A 1U81A 3R7WA 4A0GA 4O2RA 4OQLA 1G8PA 2QTVB 4W5HA 4B74A 2ZRIA 1FP6A 4HUQA 2J9RA 2IYZA 1KGDA 3BK7A 2WPDA
chains in the Genus database with same CATH superfamily
1IB0A 3JQAD 4TT8A 1E1QA 2GBFA 2YXNA 1OX4B 2J3JA 3K9HA 4KZPA 2WHRA 4I50A 2FMIA 2IIVA 4P34A 4YRPA 5LU8A 4LWZA 2H1RA 3VPBA 1M1ZA 4NF2A 3M5DA 1DOZA 1F2DA 3U0BA 4DGSA 3L8MA 3QPUA 3LUBA 3G2JA 4EITA 3H65A 5EXTA 5AJHA 1A8PA 5BRNA 3GBPA 5E8RA 4MYUA 4FFSA 4HNAB 4JH0A 3H8VA 4LCBA 5FT9A 1NQUA 3GG2A 1XQWA 2ZB3A 4Y2UA 4PZDA 1Z9BA 4II3A 1ARZA 2AHRA 5CNJA 3MWKA 5CXXA 1AF7A 3VPSA 3GJ4A 5BVHB 3H1EA 4JA0A 2O2EA 3R2JA 2PAAA 3D0OA 4L6AA 1ZD3A 2WMDA 3E82A 1PZEA 3G7UA 4YFVA 3UNXA 4IWNA 2EQAA 3LQQA 1AS0A 5L3ZA 5T57A 1IJKA 1AKQA 1G6Q1 2ZQYA 5HJ2A 3OT1B 4D41A 1QRSA 2QBYA 2JFGA 1UT8A 2JIZD 1QIMA 5FWYB 4GRDA 3KEGA 4QYWA 1FYDA 4BRWA 4YMIA 3DEHA 5CHYA 5BO5A 4GVXA 5CX1B 1A50B 1JLHA 4NBRA 1VI6A 2ZUDA 4JR2A 4KN9S 2OWDA 4PS1A 5PNTA 4BNDA 2OZKA 1H0RA 2REBA 3GDHA 2XY4A 3HA2A 2X0FA 5JSKA 4RD1A 3HCPA 5EI5A 1Z8NA 3RSGA 3I4LA 3PIRA 1L5VA 3UG7A 3NAMA 3A9TA 3PI6A 3AFMA 1YS1X 3EZ7A 2OCXA 1KOLA 3WJ2A 3H75A 3M2PA 4ZVVA 5IAKA 4EI7A 3NDIA 3TUZC 3FCCA 2OGWA 1GZHB 1Q7CA 1A5ZA 3E7FA 5FLXA 4OQ4A 4BVJA 3QWAA 2OBFA 3VXKA 3B1VA 4BMPB 3DKKA 1ZSVA 2BCJQ 3BXXA 3EGEA 3CNOA 2HU2A 3L0SA 1M5RA 3ZDFA 4RZIA 1AZSC 3LLCA 1EX9A 1LVHA 4MGKR 4S2UA 5C5CA 2EJCA 4O1MA 4MVYA 2GZ1A 3RVRA 2BSXA 3KQLA 1U63A 1QMPA 3KD2A 2J45A 5BNTA 1QGED 2LWIA 3FW1A 4PRLA 2JKVA 1G4UR 2V7UA 3KLMX 4R8LA 4RNCA 4TTQA 3TTXA 3HFRA 2YYAA 1NN5A 5L3RA 3KPUA 3LDUA 5B7PA 1N2CB 1T9GS 4G1BA 1XLWA 1I2MA 2PSSA 3NIDB 3EXIB 4KN8A 1IY2A 1X13A 2CGEA 2YY7A 4OMCA 3U9SA 1SHKA 4G4IA 1VKNA 1YL6A 2IWRA 2V3CC 3HDJA 3CF4G 1XDZA 2VRCD 1U3GA 2P3OA 4W5RA 2G9NA 3OA2A 5LMCA 3DEFA 3KXIA 1GGEA 1F4VA 2V58A 4F21A 1M6WA 1QE0A 3FM9A 3R7FA 4O5AA 1FDUA 3BCUA 3L6DA 1NI3A 5IMBA 3WGHA 2CZGA 3PPWA 1GZ5A 5KNBH 1QU2A 3T3OA 1PNOA 3D0RA 3TLBA 3ZD7A 1U31A 4WUVA 4TUYB 3B8HA 3L2OB 1NGSA 2V7WA 3MYYA 4HB0A 1Y48E 5G0WA 2VJKA 2BLNA 4L8GA 1W0JD 4MKFA 4PLFA 1OZAA 5HM8A 3HLKA 4MQFB 1M1YE 3E61A 4RTRA 2VT2A 3P52A 3VDQA 1LVGA 1KFBB 4NJEB 5TMPA 1TDJA 2NYVA 3TW4A 1BDHA 1SA0B 1JQAA 2DBVO 2R84A 2YXEA 1G3IA 1GGMA 5JAMA 1HO3A 2PZMA 2TS1A 4AO6A 4AS3A 2W90A 3GUVA 5HCNA 5H80A 2CWWA 2B7LA 1B74A 3OFNA 5K3CA 5BW5A 4AKGA 3IUBA 1D6JA 1U0GA 4NVRA 1KH1A 2OD9A 4DY4A 4N7JA 5JAHA 3WGGA 3DULA 1PQ4A 2VQ6A 1S9HA 4X93A 5BYBA 3T4XA 4JBXA 5AW8A 3HJHA 1GZ6A 4Q93A 5IAGA 1ULTA 3E22B 3KB1A 2Y1FA 3S99A 3WNVA 2J3HA 6AT1A 3IEVA 3T0GA 1RD4A 1N5OX 4IGAA 4UNQA 3M0EA 4TQGA 1RC8A 2G8NA 2V4UA 3OZIA 2FXVA 2PEZA 4BMCA 1YACA 5AHWA 3OECA 4YCMA 1WABA 3RTCA 1OLOA 4EYGA 5AW1A 1E8NA 2FSFA 2Q7DA 3W8DA 4H7DA 3FBTA 3UMSA 4KSCA 5AI9A 3KXKA 2DZDA 3WB2A 4J0JA 4C0WA 4C7OA 3P9KA 2WFZA 4BO5A 5KKNB 4ER5A 1PZNA 4XB1A 1PSDA 4PBTA 1P1JA 3WIEA 5KX5B 3P0RA 5FTJA 2PDAA 2C2YA 3WKEA 1FRZA 5FLEX 5HILA 5BNWA 3E84A 3RR2A 3KKKA 1OLSA 1QVAA 4P33A 4D44A 1AQ6A 2FPXA 3PFKA 5HP4A 1AA9A 1WXFA 4HYQA 4WRRA 1D2MA 3HKDB 4EQ6A 2R8EA 3WL8A 1IEQA 5EE1A 5TLSA 2GF0A 1IPHA 3W90A 2FN8A 3JYHA 1FCJA 2XNCA 2CMDA 2HA3A 2VRWA 1D8AA 1R6AA 3NUGA 4PPGA 3R44A 1N6KA 3P2OA 5LQAA 2Q8QA 3F6SA 3L01A 2NZXA 2CNWD 5DRTA 5AW6A 1G55A 1QAMA 4I1RA 3JYNA 3UWSA 4Y67A 4FR0A 3N5KA 1JQJC 3PTAA 4JLPA 3CUWA 4RTNA 3I5YA 3HV2A 2GRAA 3RHSA 5KQLA 1UZAA 4KQIA 1JAIA 5EQTA 5L40A 1PL7A 4BQFA 2Q1SA 1OSNA 4IJQA 5BN4B 4MYTA 1I6WA 1YV9A 2I3GA 4TWIA 1R66A 1M2EA 4OHZA 2VK2A 3F1KA 5CBPA 5KB3A 4FGLA 1DWQA 2GBCA 2P68A 4QWMA 4EWLA 4YRKA 2ZJ6A 5CB8A 5DO9A 4BNMA 1RBQA 1AQUA 1YR7A 4ENTA 2VXYA 4JOBA 5HCUA 2AZTA 3KXDA 4V0MA 3TR5A 2WKRA 2WJHA 2QJOA 1JU9A 5WRFA 1VGVA 3N2GB 2A0YA 1U28A 1Z0FA 3OWXA 5JDIC 5TXGA 2XAAA 4ZOLB 1P2SA 1D6SA 3ABOB 3LL4A 3MRXA 5BUCA 5E1MA 1TVKB 3C3CA 1IPFA 1NIPA 2H85A 4GXQA 4L02A 5A5EA 5IPFA 1USGA 3CPHA 3T9BA 1DC5A 2I7DA 3MOGA 2P9QA 1LQTA 4V0KA 3RWMB 1OT5A 2B2CA 3HDVA 3GLHB 2BELA 4DDTA 1XRSB 1N2EA 4OAPA 4II7A 3Q2KA 4BE7B 1M6NA 1PJAA 1Q6YA 4A2CA 4D4HA 1F06A 4OLFA 4C4OA 1RLUA 4WEOA 1R12A 1T9HA 4UHJA 3ZXXA 3VKHA 4O4HB 1EFUA 4PX5A 2LRHA 1L4KA 4GSKA 2PM8A 2VF8A 3IYLW 1AQLA 4FCWA 2HF8A 1TU3A 1AGRA 1NOIA 2JLCA 3QEOA 4A5OA 3A4YA 4U2CA 1UP4A 3PRKE 4HNAA 5LMUB 3JZAA 3QJYA 2HR1A 4CTNA 3I72A 2W6JD 2FCRA 3A1WA 3M89A 3FGNA 3MUEA 4GEGA 3FVRA 4WOPA 4X44A 5BVHA 3E7PA 4F8JA 4IBOA 4OFBA 1C7IA 1JAYA 3H18A 4RSGA 3K1ZA 2B82A 3WJAA 5HUQA 1RMTA 3EBLA 1DAMA 1O6ZA 2FAXA 2EZ8A 1UPTA 3OT1A 1A9ZA 4J0HA 1X2BA 5GM1A 2GYWA 3E9ZA 3MBKA 1NBME 3M5PA 1QWSA 3KEMA 1S3SA 3LY9A 5CX1A 2P9YA 3GRZA 1QUFA 3QLUC 3K0AB 3QX7A 2CK3D 1BVHA 1SXJB 1IVYA 4HC4A 3Q0TA 1Y6RA 2WD8A 2NVUB 5C31A 2GPSA 3DEZA 4IH1A 3SEAA 5KU7A 4TSRA 2PSHA 2FWIA 3MCVA 5GOTA 5JG7A 3KHSA 2H2AA 2C9ZA 1JILA 2OO5A 4UPVA 1IN8A 4Q9DA 5LLSA 5HIAA 2FHSA 3KALA 1XTZA 3QM1A 4QUBA 5CEJA 5IVIA 4U00A 3NCTA 1HT1E 3ZW7A 4CL0A 4DDKA 1WCWA 2WJZB 4O4IB 4D9EA 2W2KB 3FZYA 4E70A 4DLRA 1EFTA 2F1OA 3L40A 2IHVA 1NJSA 1XK6A 2XCIA 4H4DA 1QCYA 4JMLA 4QT0A 1XZIA 1C0KA 1CZHA 3B3AA 3F67A 4Q4AB 4HRXA 4NXMB 3X2SA 1VXRA 4UBMA 1MV8A 4WN3A 5FTLA 5JXJA 1OI7A 2Q1YA 4MRMA 3T06B 3IKVA 3EULA 3SDZA 2YUIA 2YYYA 2EG9A 1ZWLA 2X5NA 5AI5A 3T7AA 2V4ZA 2XIQA 1Q0RA 4O59O 3LX4A 3MT8A 2MYNA 5F7JA 2EJBA 1A8IA 1DTSA 2Q9BA 3DCYA 1IE3A 1SBHA 2TYSB 2MIIA 1WVGA 2VTDA 1U0LA 3KTAB 3WHKA 1NUAA 1N2CA 3O47A 3L4BC 1XA0A 5BWCA 3EXIA 1RHKA 4WECA 4AQDA 4DSZA 1AGPA 1UFKA 4N40A 2X1MA 4KO2S 5KYUB 4NARA 2YHIB 2ZDHA 5AM0A 3B5JA 4N76A 2PIDA 4N5NA 5G41A 1T5HX 5DOZA 3VGJA 1SCUB 1KNXA 1PF7E 3G89A 1P45A 5G3ZA 4ZJUA 3RT7A 3PF9A 4IMJB 5B3LA 2IXDA 4KODA 5HRCA 5ICEA 5JC8A 4OHOA 3WI7A 4MS3B 3LRPA 4CHGA 1EHIA 3PHIA 5KNDD 1BJKA 1TCVA 3ZCUA 5BUQA 4WESB 2QXYA 2FV8A 1N7IA 1LLUA 1RVDA 3HLYA 3V1TC 3WBBA 4MQFA 1BKDR 4TQUS 4YCCA 5HFNA 2PUAA 2IY8A 4L7VA 3IALA 3U4AA 4NJEA 5F3WB 1J0BA 1JIKA 3ELBA 4REMA 5FNVA 1SA0A 1L4GA 2EWVA 2JFWA 4R9VA 1U9IA 5JRZA 5LLDA 1IMOA 1UJ2A 2H5LA 1UMCB 1SBYA 1D6NA 4Q1AA 5TVGA 5B1IA 3U9TA 2FPGB 5BSVA 1ZGBA 4HPWA 2CXHA 3VAAA 1XHFA 4DV1B 4CV3A 4H7EA 1Z22A 4BLOA 2VUTA 4OBEA 4DR2B 2YTZA 2E4VA 1T9CA 4PLZA 1SUDA 2A86A 3HJBA 4GLLA 2G06A 4JASB 4M7OA 3JQFA 1K5PA 2C8LA 5EFOA 2C7OA 4M8LA 4EMTA 1R0YA 4UHFA 1KO8A 3Q3EA 2J30A 3ZWQA 5L4LA 4FMDB 5FEMA 1NT2A 5EJ2A 3B2QA 4PLVA 3S2UA 3WP1B 1VG0B 1ZM9A 2GBPA 5AICA 1PVVA 5ES4B 1CR2A 2QJTA 2QTFA 4XIIA 1NBAA 3CX7A 1M1NB 4LA4A 2M1ZA 1VL5A 3NEJA 2Q9UA 1F7VA 3J7TA 1LBIA 2QRZA 1IN4A 2YINC 3KX2A 5E6UB 3VR2D 1JDVA 1YGYA 1DPGA 7ABPA 4GSLA 5IZ4A 3H2KA 4CXMA 3H8JA 1YJAA 3LT4A 3H3FA 4IJKA 2DR0A 4REQB 1JU4A 5ECWA 5DNCA 4S04A 4D7AA 1N34B 2W2TA 5EZYF 4F12A 1LJLA 4NU5A 2HK9A 2AZXA 2YXPX 1VG8A 2GTHA 3VFDA 3R6DA 3L0PA 4EW3A 3PUKA 5JAUA 2R7LA 5FWAA 5H81A 5IUJC 4JVSB 2A35A 3F9CA 1RI1A 2I78A 2I6QA 3TFQA 4CMGA 1GYRA 1D2AA 2AN4A 3PENA 4K03A 5DNAA 3WIUA 4BLWA 7ADHA 1PDVA 1B8PA 2HJRA 3HYNA 3K4HA 3HKDA 4QBFA 5LOVF 5AHRA 5E0OA 2NUAB 3ANMA 2NZYA 4BQQA 2JCYA 3SC2B 3ZDXB 1PJZA 3GAMA 4NCHA 3IP7A 3A9UA 2XKBA 1MH9A 1O0CA 2GZDA 1L5MA 1AM4D 1D2CA 1VHDA 2R48A 3CSDA 4OK6A 1QIJA 4M36A 3NANA 4DVJA 5B6PA 1OB2A 2PLRA 5B4UA 1P7ZA 3HCCA 4J3NA 3DL7A 2O3JA 3W5SA 2OLJA 3C3JA 3BERA 1DEKA 2YS6A 1SVUA 2GHQA 3JSXA 1Y4AE 4MIEA 5J58A 3OZEA 3H1TA 4HQFA 1THTA 3KCNA 3IERA 3SXPA 2O2GA 1I2AA 1DRVA 2YVUA 1VMEA 4DE5A 1ISGA 2WM8A 1GT6A 1PZMA 2H1IA 2VDWB 1CD5A 4ADSG 2GWHA 2CDAA 3OD1A 4IIUA 3DDZX 1W46A 3QBJA 4R0NA 4FZJA 2VA8A 4TLAA 1GY8A 2TMDA 4QLAA 2BF7A 1XN1A 5DWQA 1NQXA 5REQB 3IR5A 4MS1B 3GWGA 1L5HB 3CLRC 3IA7A 3AZQA 3HYLA 2GM3A 1UDCA 1V3UA 3LIPA 4EMUA 4CEIA 1P7PA 1A2BA 3MBOA 4HRAA 4KDRA 1B8VA 2DOKA 3C4VA 4CKBA 3I62A 1WP9A 4XOUA 1EUYA 1CIJA 2OV3A 2IE8A 1R0XA 1G63A 1TVKA 1WQ1R 2WYWA 3FJOA 3GEGA 3OWHA 5DH9A 5TY0A 3O3NB 1C4XA 4W7SA 4XPZA 1SUBA 3QE2A 4QLOA 2H4FA 2PANA 1MX5A 4IFBA 3GLHA 1R18A 3TQCA 3A1TA 1E1DA 2WZQA 3CNHA 3OIGA 3L6CA 3V8BA 4XVQA 1ZJJA 3G0GA 4M87A 3TLGB 1NVVR 4KO8A 5JI2E 3C3MA 2C5BA 3R9XA 4ZQGA 2W42A 3A1CA 4JBLA 4MXDA 3EY9A 3FYSA 3UK6A 3EJWA 3OPMA 3GOQA 3REFA 5CXSA 1DJOA 1S4MA 3RUCA 1ESDA 3FIUA 4YRGA 5JFOA 5BWNA 4ZHQA 3UQYS 1CQPA 3URMA 1W96A 4K9OA 2JJQA 4U5XA 4JT2A 3HDQA 4WXEA 1NDQA 3U1VA 1JEAA 3EEIA 2XDQB 5KJ6A 4QFDA 1JFVA 1BXZA 1NRIA 3KUCA 5AKHA 4Q7JB 2P3SA 3GFTA 3Q12A 3QVSA 3F5DA 5LP6B 2WUGA 3ED5A 5DM60 2XCRB 1SXHA 5D1HA 3B20A 5TEWA 4A8PA 4JQZA 5EHXA 4PE5B 2RH8A 5CDFE 2A2ZA 2XZLA 1OT3A 1S2LA 1SELA 3AEXA 3EMBA 4RZQA 2Q99A 3VTAA 2Q3LA 3KTFA 1VI5A 4G84A 4D57A 1GPLA 3C1AA 5HIIA 4I14A 4ND7A 2E4ZA 4L75A 3F6YA 4NU8X 2VCEA 2XNSA 3KVVA 2Z95A 3K0AA 2DTDA 2GTIA 1F4LA 2L17A 5FBHA 2YVAA 3KKPA 1S2OA 3EGVA 1UKCA 1K97A 3RLFA 4QFBA 3TJZA 3ZCQA 4CIDA 4Y6GB 3V8NA 4A1FA 1ULZA 1OU4A 1WXXA 1ZK4A 2ZPUA 1NQTA 2BZGA 1E9EA 3INNA 1JZQA 3Q7PA 4GPZA 5IT0A 1SHTX 2HSJA 4KRXA 4H3HB 4HQOA 1BFKA 3QFTA 4EG6A 2QSYA 4OBBA 1M0SA 2PX0A 4Y6QA 2G04A 3VA7A 3ROMA 1GKLA 2PBZA 3ZZUA 1G3QA 1U0NA 1H2HA 5J9FA 1HTBA 1JVNA 3B1WA 4O4IA 3IPRA 2DHRA 2W2KA 2FG6C 2IHUA 1HI9A 1JTVA 2CXSA 1ZICA 4BKPA 5FIUA 1YKGA 4FI3F 4YCJA 3RBZA 1PFWA 3VPAA 2D4HA 1WXQA 2Q6LA 3KYDB 3QJGA 4B80A 2ZT5A 2OQ2A 4MYSA 4BXOB 1EYZA 2UVPA 1NMEA 2AI2A 1N7GA 2VDKB 3WGUA 3OQHA 4IS3A 2QPOA 5LCXA 1ISHA 2WIAA 2IZ0A 2PKWA 3TIIA 4TSKA 4CW7A 5CCEA 1FMCA 1AD2A 2FETA 3A9WA 1A3CA 3RNLA 2X7XA 5AI0A 2LCQA 5KYUA 1BVYF 2YHIA 4NATA 1XYVA 1GGKA 1KMNA 4MWBA 3HVIA 2E37A 1SCUA 4L08A 4HVTA 1GNSA 4ZTBA 1NVKA 5E7QA 4RJLA 2H54A 5AIBA 3H4MA 3HJFA 1N2GA 3AP1A 3DVAB 4Q0MA 4YJFB 3QSYA 5H16A 4MS3A 5KAPA 1E7YA 1ULHA 2C3PA 2QT1A 1BVUA 4R8VA 4WESA 4PHTA 2IX3A 1L3CA 2RCNA 3PPIA 4NU6A 2PBLA 5LBUA 4EMSA 2O2DA 4RY8A 4ND8B 1KR5A 5C7LO 3KJXA 4G5QA 4RY2A 1AB5A 3RJMA 3DOOA 5JYCA 3GLIB 1JJBA 1GTRA 1P1RA 1W6RA 3LZ6A 4CEJA 1YO6A 2XX3A 3A6ZA 1CZOA 2GGSA 2VATA 3L46A 5FL7A 3HXMA 4TYYA 4HAUA 2WW8A 3GRCA 3PJDA 4RH1A 1UMCA 1RABA 2D2FA 2AXPA 3K9GA 3UFBA 5IG2A 3O8CA 2FPGA 2O3QA 4QPZA 1CY4A 1L8OA 3G2MA 4YT8A 5DNYB 4BMYA 1ECFA 5IXJA 3EMKA 4E2FA 2JLRA 4JYZA 2A59A 3EFOB 3AVWA 3ADKA 4DEXA 2RMKA 1TK3A 1Y6ZA 2COEA 3D5QA 1DQSA 3QYFA 1GSAA 1UDWA 2DGDA 2IY7A 4RDHA 4Y9RA 2UYCA 2C7RA 4K05A 5KDOA 2PGJA 1U1CA 1E2GA 2NWQA 5A4JA 2BGWA 1DEOA 2ISQA 3PK0A 1U9ZA 5BXQC 3PYLA 1PR1A 1IUNA 1W76A 4MEAA 5AW9A 2FUCA 1XRJA 4RK1A 4QJBA 4OXQA 4AG3A 1M1NA 5CAEA 2Z9BA 3WDKA 1UOPA 5FLKA 2GCNA 3QUTA 1JLRA 4IVPA 5E6UA 3THYA 4EY4A 3UT6A 1DBWA 2V8OA 1EDOA 3FWHA 3D5TA 5C8YB 1J2YA 1YXMA 1E9RA 1IHXA 3R5SA 2FZKA 4FILA 2WICA 3I0ZA 1N2ZA 3LCVB 4M22A 1FTGA 4REQA 4TOIA 3SKYA 3TQOA 3USZA 2ZXEA 4ZYUA 1NC1A 3DW3X 3V8EA 1HDGO 2QN9A 2C2BA 2ZB4A 1FP4B 4N01A 1I4OA 1VP3A 2V5VA 2A7XA 3DQPA 4NHOA 3MT0A 4R7GA 1M66A 4PW0A 4YI5A 3FUTA 3RVPA 2X40A 3E18A 4A8JC 2VRCA 3SS8A 2DMRA 3P32A 5IH7A 3BB1A 2A88A 1RIFA 2J0VA 3MLBA 4XH9B 1P6UA 4H1VA 5DYWA 2QX6A 1JA1A 4B7CA 4RPGA 3M1LA 5C4MA 4XWTA 2PGOA 3FB1A 2CVQA 1Z8HA 3DVLA 4L5YA 4LSMA 1EEHA 4YAFA 4G2TA 5KYVA 1T2NA 5JWRA 2IS2A 3QFHA 2CF5A 4J0DA 3AG6A 3NFYA 1YIAA 1SUWA 4LGYA 3RCBA 2OC9A 4ND4A 3FHJA 4PQYA 4PC1A 2WSMA 2QTLA 3EIWA 1XPUA 4G0WA 1JHAA 4IQGA 4NS4A 1Y3IA 2XTZA 3JYQA 4LKOA 4PYLA 4K7JA 4JQCA 2BFEB 4WZAB 3UJ8A 3UKDA 4YV7A 1E4VA 3MJ4A 4AKEA 1RYFA 2A9FA 3K0EA 3P0HA 3FWKA 4ALIA 3HP1A 2QOEA 3W8RA 4R0MA 2C2KA 5C3MA 4AUMA 4WKPA 2Y1OA 4HSGA 2VDWA 4NCJA 2OM2A 4I3HA 2F48A 2IYXA 4M88A 1SVIA 5SZJA 2H1OA 3CGGA 1E58A 3BJEA 4YMGA 2FSSA 5REQA 4MS1A 4HGRA 1L5HA 3GCXA 4AC9A 3OEYA 2CBXA 2BDTA 4BN4A 3S2YA 3RWBA 2B78A 2ZVJA 2IV2X 4B4DA 5C80A 3FCSB 5JASA 1A9OA 3MNFA 1HL7A 4IO1A 4F9EA 4FW9A 3TLXA 1OFGA 3EG9B 1IK6A 2V6IA 4G0ZA 3OE4A 1Z3CA 4FX5A 2CVPA 3LGSA 2DPYA 4EY8A 3AV3A 3RRZA 4NIMA 1WMSA 2G83A 4I9HA 4XRGA 4UPDA 4B81A 2HNBA 3NIFB 3TLGA 5HRAA 1L8XA 3URKA 3VX4A 4TLLB 5I47A 5B37A 3A1UA 3NBZC 4X0EA 3GGJA 5K4HA 3U6BA 3IMEA 1RAEA 2D8AA 1QLHA 1PKXA 2WIFA 4JGBA 5CXQA 3ZCXA 4P3OA 3HABA 4G5SA 3P96A 4JYCA 3I34X 4RSMA 4D79A 3I8XA 3DOHA 1KHTA 4OU5A 3O8QB 4LBYA 1YCFA 2YQ4A 1ACJA 1ZUD1 2D00A 2FG5A 1WSWA 1OPXA 3LUCA 3DUFB 1KFJB 1UINA 2QGFA 4LXIA 2G76A 3HL0A 1TEVA 4KFSA 3SJCA 4DCOA 1MHPA 2WFMA 3CZ9A 1UKYA 1MD9A 1OPRA 3CLHA 2ZRJA 4L5BA 4GMKA 5LP6A 1MAVA 5JFGA 4I66A 1V8DA 4N65A 3UJDA 4XSVA 2Q4TA 2ZRBA 1SBIA 1HQYE 1WQ4A 4K0RA 4EPTA 2IXFA 3F6EX 3H83A 3BWXA 3HXQA 3FR8A 1E59A 2BONA 2C4WA 3EVZA 4KE8A 1GRNA 3H9UA 2WD7B 3LIIA 1VHQA 4DARA 1VCIA 3GDOA 3FOZA 2Y4NA 1IRXA 2BI7A 2Q3CA 1UJ6A 3EAGA 3P5SA 3TTUA 4R2MA 1W7AA 3DP7A 4TN1A 2OGSA 4H35A 3FCEA 3Q3VA 2ORWA 2ZE6A 4ETNA 4LQ4A 1NVBA 2W6CX 5CG2A 3THYB 2E6KA 7YASA 1X8LA 3IVMA 2J9ZB 2ON6A 1RU3A 3QVXA 3W3AH 3L3BA 4EZIA 5TPZA 1DSSG 4D3DA 3BA1A 4D9CA 5AFSA 1QYXA 3K6KA 4XFKA 3D6TB 4AXBA 4K87A 4R2KA 2K7ZA 1C1HA 4NG5A 3EC1A 1QX4A 4MWSA 2FSGA 5IC6A 3FBWA 4YJHA 1OFHA 1RQLA 4TM8A 3KYDA 4W5WA 5IW8A 4F2HA 4QVKA 5A4AA 4Q00A 1E9AA 1C7ZA 2PXCA 2CLHB 3U13A 3OMLA 3BFJA 4HHEA 3W8NA 2KW5A 4AL4A 4BXOA 2IS1A 3YASA 3B1YA 3PX2A 3T95A 3IKTA 1Z13A 5KQPA 4YPFA 3H5IA 2PIAA 1DHTA 2Z3ZA 1U6KA 4CT0A 2X0IA 1KFKB 221PA 3JQ7B 2H51A 1YC5A 2H8KA 1JIJA 2FKAA 1ISFA 4YRMA 4ZQHA 2NU8A 1XF1A 1XKTA 1U3FA 2XRFA 5FULA 2HCFA 2X5KO 3VNRA 4DW8A 3OJEA 4J07A 5LDDC 4OQQA 4RQAA 4YCBA 5BW8A 1T1GA 3DVAA 4OXYA 4YJFA 1NKSA 4AJJA 3W7AA 1WB4A 1ZNXA 3KLPX 3OF3A 4URUR 5H3LA 1Z6QA 4B6RA 2HQSA 4D8TA 1D5WA 2OQRA 1URPA 4NEHB 4B17A 4ND8A 2NMVA 1M34B 1K8RA 2QAGC 3DEKA 3MJEA 4O6VA 4TROA 1FP7A 4XQCA 4B2LA 3CURA 4JB2A 2GA9A 3BF8A 3U3JA 1I7QB 3WAGA 3GLIA 3FUWA 1YK0A 3QELB 5BOSB 2K2QB 1NU6A 2D2XA 4H1TA 3LHDA 3IEMA 3TB4A 3T4EA 5TJHA 1KZ4A 5ENVA 2DJ5A 1RQRA 2GETA 2DBQA 2ZVPX 3FNFA 3Q6MA 3D7MA 4Z4EA 4PO8A 4ONEA 2AI1A 3IUSA 4MDEA 3CA8A 3ZZMA 1I5OA 2MSKA 1WV1A 1TXGA 2XUDA 4R2XA 3EFOA 3C5EA 4B4UA 3I9V6 1MEOA 2IPAB 1ES9A 1P19A 1RPTA 1SBZA 4QRHA 2D13A 1U1FA 1WW8A 2YASA 1RJWA 4MO9A 4R6XA 4UD2A 4X54A 1SRRA 5EP4A 5BV1A 4DR7B 3JTMA 3TAHA 3M6VA 4BN5A 4DQDA 5FAKA 3HQ4O 5TMBA 3QWHA 1KJ8A 3FSEA 3IDSA 3TM5A 1HL3A 1GKYA 4EJ0A 3OLQA 2FQWA 5KOJB 1K6IA 2QHXA 4IUYA 4ZI3A 4Z9YA 2R6FA 3WBKA 1KPGA 3OE7A 4YP5A 5DYGA 3LECA 3BKWA 2JFPA 3PGLA 4US0R 1GL3A 4OHCA 4JU8A 1SCKA 4YREA 2O59A 3C8HA 3QENA 1YT5A 3V3TA 1FLDA 4IQFA 4A15A 4C20A 1IEVA 1P4RA 2P1ZA 4L8YA 1T15A 3KJZA 1WAMA 4BLTA 3AYXB 1IMJA 2P7HA 3HDYA 5BWLA 2V5AA 1OFUX 1HC7A 1BQ3A 4UEQA 3E8MA 4RIHA 4ZYTA 4W5JA 3GI1A 3ANNA 1EUQA 5E3HA 2RSLA 3EUFA 4ECAA 1KL7A 3KDSE 2A84A 4RIEA 3WNQA 3L18A 3TIXB 1W0CA 4BYMA 4W8OA 3HUUA 1ENYA 4M8KA 4MLCA 3E9DA 1M2VB 3CLRD 3DDCA 3R0QA 5CNKA 4NJOA 5EVJA 4ZCQA 3SDBA 5CG1A 4O02B 2J48A 3F73A 4CQJA 5FQNA 3A11A 3HP4A 3X44A 2I7CA 1B16A 1S8NA 2HDHA 3CNQS 3H6GA 3EE6A 4MKIA 1H2ZA 1JRLA 2OFOA 3AUUA 3KEOA 1KJIA 1UBLS 4I8IA 1N0UA 3B78A 3L1HA 1T8TA 4U8HA 3AVTA 4DIEA 1PV4A 2BFEA 4WZAA 3KKZA 1PJRA 5L3VA 3GLSA 2J0QA 2ZBQA 3KYCB 1PFUA 3OQ1A 3TRHA 5DDIP 3WYAA 2HWYA 4KNYA 1THMA 2HT1A 2JD1A 4CR8A 1ACLA 4GX1A 2OILA 5LDGA 1NJ1A 4PXSA 4MV6A 1NAIA 3NBFA 4M89A 2NXNA 2PKXA 4MVXA 4PNEA 3HJCA 2GLTA 4E15A 2Q4DA 4INPA 1SR8A 4LRYA 3K94A 2NNWB 1TOAA 1W94A 4EEKA 5IEJA 4IVQA 1KP3A 4CKEB 1Q0UA 3V8VA 4JJIA 2C4HA 2QROA 4F8YA 4GBJA 3EAFA 4NULA 4E33A 2IQ5A 1MNAA 3WV5A 3HFSA 2BH9A 2UZ1B 4UDNA 4C7MA 1ETHA 1HSZA 2H17A 3ADPA 4J8PA 1WZEA 3QXJA 1LBQA 3D2LA 4DNPA 1K3TA 3MMNA 3EG9A 1TJPB 1P80A 1MORA 1WPXA 3A4TA 4CGYA 5GZ1A 5L7TA 4XOIA 4FXOA 1AVTA 1GTG1 2B4KA 2DRIA 5E0KB 2FRDC 3DH0A 4HY3A 4D0NA 1OV4A 1MNQA 2N3ZA 2SKEA 3FROA 4OI2A 5A4DA 4E5PA 1K5HA 2B4QA 3HCBA 3OLWA 5EPUA 4OJTA 3MEQA 4GKAA 4IVNA 2ODQA 4TWAA 1I33A 2O5CA 3CRVA 3OX1A 3Q9SA 1Q0ZA 3LC1O 2ZSFA 3RBVA 2JAHA 1AKMA 3IQDB 3R5HA 2GNAA 3FGOA 3O8QA 1E60A 4OXRA 4RDIA 4DYVA 1TT7A 2N1BA 1QWOA 2E48A 2R8BA 4EL5A 4QPDA 2VAPA 1Y7PA 1XTSA 2FFAA 2X8AA 3DUFA 3EIFA 2RH5A 4GI3A 5DTEA 3VDNB 2FW1A 4CR6A 5JRDS 5C3UA 2G1JA 5K9ZA 1MG5A 5LZ4A 4FJ1A 1EVLA 2WMNB 2NUTB 2XUIA 3NBAA 5LXTA 2RAFA 4DPKA 4Y6OA 4I6EA 4IFIA 3VU9B 1GPWB 3IAS6 4AJ9A 1M10A 2PSJA 1MC5A 4C21A 3R23A 1ZD4A 2JFVA 4D43A 4IYJA 5IC5A 1E5QA 4BWFB 1P8JA 3BXOA 3A6GA 1I8TA 2WD7A 3H9EO 5J5AA 4I4CA 4ZPXA 1PLJA 5EWJB 5JECA 4EY3A 3CTMA 3HCOA 2QU7A 2YHSA 3RVBA 3HY6A 3GZJA 4NRDA 2FEPA 2FK8A 1GPJA 2HLHA 4AI6A 2VJBA 1E2HA 1JL3A 2ZJFA 4W1QA 4QECA 4RPHA 1XRRA 3H5RA 5AQ1A 3V33A 1CQWA 1PDOA 3TQHA 4OA5A 3IDOA 4INJA 5GONF 4TSFA 1ZLXA 3JALA 4TWRA 3N6VA 1ENOA 2EL9A 2OOSA 4Y3UA 1N0HA 3TNJA 4GM1A 5A2GA 2GPYA 4EYQA 3WRWA 5KJ1A 1GCOA 3N28A 1YQWA 1KY2A 1EK0A 2XUAA 3NORA 3PA8A 1UBSB 3LG2A 1PV2A 1V1MB 3ETGA 5SYAA 3RRBA 1K08A 3BICA 1SURA 2JBAB 2AFIE 3SQDA 3O8RA 3DV9A 4TGLA 4RFSB 3TXYA 3ZWYA 5FA5A 1FLNA 4GD3Q 2ZCJA 5K03A 4M0CA 4B3HA 4ZTUB 2Y0BA 3OWOA 5D85A 3O95A 1C1XB 3LBNA 1Z2NX 4QTUB 4E11A 1G66A 1XTTA 2PWBA 5CFZA 5IWAB 1HYQA 5KPJA 1KDVA 3FFBA 3OLXA 1EJ2A 1SUAA 2B36A 3V55A 3FCOA 2CL0X 2VUSA 4R51A 1QH8A 4EGJA 4C2BA 1DKMA 1HE3A 1Z6PA 2ZULA 1II8B 1TKAA 4D02A 1FK8A 5HDQA 1G8MA 3NWJA 1AUQA 3PE6A 4G8DA 4DIDA 3OT4A 3RLIA 2XW6A 3NEYA 4FCCA 3GFRA 1TAGA 5IFKA 1L7AA 1K4YA 3EZ9A 3OF2A 4KPEC 1LF5A 2HHAA 4PLYA 4WDQA 4L95C 1Y9DA 1E1LA 3COPA 2ZRPA 1J0XO 2VNIA 5SV2A 5HKKD 2ZSHA 1W47A 4NH4A 3OQ6A 3UHPA 1GRRA 4PSCA 1OXMA 1L7BA 3I05A 1GUYA 2AMFA 2PLFA 2A1IA 5L6LB 1YK1A 4FFVA 1YRHA 3PEYA 2OFFA 4OIMA 4E32A 3GCDA 2FRXA 3NXSA 1TIBA 2IIPA 2ZAIA 3QVUA 1I5RA 3PA6A 4IXNA 2W4IA 5G0SA 4RZSA 3E35A 5KWJA 2FDXA 3TOXA 3BMCB 2BUCA 5GVRA 1LQUA 3KJFA 1AV7A 1FUYB 1P75A 5CW2A 3X2EA 1JQKA 1ZNZA 4JJ7A 3E7DA 3G8AA 1Q3TA 2O05A 4OHVA 4OSPA 4F4IA 4YCSA 4AJ1A 3WNDA 2BI4A 1HEIA 3BF7A 3PL1A 3D8HA 1V4BA 4JBNA 4H27A 5C5EA 1CU1A 2CSXA 4DCJA 1T3SA 5JPIA 1EK2A 1NV9A 1VPLA 3DYVA 2ZRGA 2YNMC 5EPOA 5EMLA 1QFZA 2IZ6A 2Q5LA 2PRJA 2J5KA 1W52X 2Q2QA 1Z8FA 3AERB 2IXAA 4LDQA 4PZZA 4QDKA 3ZTTA 5TQJA 2C9DA 3FNBA 8AT1A 2FDCA 2MTBA 1GG8A 2WNIA 4KLAA 4N54A 4YV2A 3KBBA 2QP9X 4X9XA 4EDHA 3GDWA 2B1GA 5KOJA 4FNOA 1J0CA 3PL5A 3E9NA 4F9GA 1W29A 2IEZA 2XHEA 3HXLA 3IP8A 2LZ0A 2QRQA 4DZRA 1HZZA 1G8JA 1XAHA 2R11A 2ERCA 2AJBA 4KW7A 4LZWA 1ND6A 5JC1A 3WAJA 1ZVJA 2X2OA 2I6UA 3HADA 4P6VF 4B76A 1X3SA 4DMLA 4I55F 4CKWB 4W1RA 2JRCA 4E7OA 1N6LA 4YWJA 1JU3A 2RH9B 3WRYA 2XVAA 4E46A 3MWYW 3P4YA 3PJEA 4BNZA 3FKJA 4YT4A 4JQSA 4TYQA 3IE1A 4JOSA 3IO5A 3CEPB 4G6ZA 4DR4B 3CINA 4AP9A 4ZTZB 2VQSA 3RUDA 3CBQA 1RXVA 2RHJA 5HQTA 1Z5OA 2NM0A 5FPHA 3FTNA 4HP8A 2PN1A 4M9SA 1F8UA 3GGDA 3GXOA 4J0FA 3WDSA 3RIYA 3B1ZA 3ZIAD 3GRVA 3IUPA 4QXMA 4YRQA 3ROXA 4CT5A 5CVTA 2K7FA