3HYTA

Structural basis of gdp release and gating in g protein coupled fe2+ transport
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
245
Chain Sequence
b'KKLTIGLIGNPNSGKTTLFNQLTGSRQRVRKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
molecule tags Metal transport
source organism Escherichia coli
publication title Structural basis of GDP release and gating in G protein coupled Fe(2+) transport.
pubmed doi rcsb
total genus 81
structure length 245
sequence length 260
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hytA01
5CYPA 3T15A 3BFXA 5CIWA 5BYKA 2CCKA 1P2SA 4QOSA 5BYJA 3DL0A 4CEJA 3P4YA 3RYTC 3DZDA 1L8QA 1DBSA 2W58A 3QPVA 4Q7KA 3GJ6A 2GEDA 3LVQE 2CLCX 4ILEA 1KIMA 2FH5B 3OE7D 4OQXA 1XXHB 2B8TA 4WVFA 4A4DA 3CF2A 4B2PA 3JVUA 2MSEB 1GNPA 421PA 2EU8A 2FX3A 2ZRKA 1GRQA 1Z5ZA 1MKYA 2Q6TA 1GKYA 4NH0A 4A2PA 4DUGA 2O52A 1DAFA 4F4JA 1E79D 4C0BA 1II0A 2BEKA 4GMDA 1KSGA 1JR6A 5EUQB 4QBIA 4A9AA 2WZQA 3WP1B 3DMDA 1S8FA 1LF5A 2CL6X 3U60B 4LJ9A 4G5OA 3RSOA 4OK6A 2ZEJA 2VTKA 5JZVA 4BUJA 3E1SA 2QGNA 3ASYA 2BDTA 5G40A 2I1VB 3GJ4A 1DG3A 1MRSA 4Q1EA 4HLDA 3U7GA 4O2LA 3EX7C 3ZVNA 4HAWA 2ZRCA 4PQFA 3VR3A 4DJTA 3AVYA 2VSOA 2QRZA 3CO5A 1IOZA 3U7EB 1UAAA 5EXPA 3RWMB 4HLQB 2PH1A 3V9PA 4AKEA 1F48A 4UNRA 2WJHA 2WJIA 1OYYA 5DO9A 1UBCA 3GJXC 2E87A 2JAQA 2VLIA 3I1FA 4MKGA 5EUMA 1E9EA 1LTQA 4OI4A 2J46A 4LJ8A 1O3YA 1XTRA 1Z2AA 2VBCA 2KBFA 4PC6A 3HPQA 4Q9IA 3I32A 5GVSA 3CPJB 2PZGA 1P9RA 1HE1C 1T3LA 3RS4A 4GMXA 3U3JA 3VKHA 5G3ZA 2QT0A 2VP4A 1I4TD 2GZDA 3B5JA 3SYLA 2EW1A 1Q22A 1SHZA 2QBYB 2DCUA 3QE0A 1UBEA 3A58B 3QJYA 3T5GA 2AK2A 4E22A 1OKKA 1VCOA 4A36A 4L4UA 3LH5A 1OT3A 3UMSA 3U5ZB 3B82A 1E6CA 4G01B 4DDVA 2GWHA 5KYKA 2QMEA 2V54A 4KAXA 1L7VC 2WV9A 1SVOA 5DE3A 1N2CE 4C7OA 1W0JD 1E96A 2N1BA 3THXB 1D9ZA 1GTVA 2EVWX 4BPBA 4TLBA 1X6VA 2GNOA 2V7QD 2YZ2A 2WTUA 5F9HA 2QQ0A 3I5XA 3KB1A 4URVR 4DLRA 5HPYB 2Q3MA 5FBQB 5KPJA 1BMFD 1EESA 4BLQA 3N2EA 4QM7A 1E2QA 5H70A 3AKEA 3KJEA 1GM5A 1E2KA 3CF6R 1XJQA 3QVUA 1P2TA 2PBRA 5JRZA 4II7A 2BBSA 2CE2X 2WWXA 1W5TA 5D3MB 1CJVC 1AQYA 1XMJA 1G4AE 1NG1A 2F3TA 4X8OA 3DO6A 1W2GA 2OZEA 4IVRA 1SKQA 2GXQA 3K53A 4C0JA 2DBYA 4IEEA 3NHBA 1E2FA 4GBMA 3GCGA 4MH0R 3PFIA 3EZ7A 1UF9A 3AGPA 5DHAA 4KODA 3R8CA 1KDOA 4XD7A 4NCKA 3W5JA 3L43A 1NMZA 2QM8A 4LV6A 1E98A 1A4RA 3D8BA 2IUTA 2TMKA 2ASEA 2LWIA 4ZDKA 3GJ8A 3VU9B 2PMKA 2ODWA 5C1BA 4UXIA 5LD2B 3L82B 2W2VA 4A6XA 2GZAA 3QVVA 1G5RA 1P72A 5J4YA 1L2TA 1KI6A 4LBYA 4U02A 2YWEA 5EJEA 4DWJA 4GOKA 4FD2A 4DCNA 5JI2E 1PLLA 1JJ7A 3C15C 3TW4A 2RHMA 3PUXA 1AKEA 2W0SA 1KJWA 1YKSA 4M9QA 4KXFB 3AVVA 2AXPA 4WA7A 3QXSA 2J7KA 1OFHA 1X1SA 2D2EA 3IILA 3K70C 2J0SA 5BN5A 1RRGA 1NY5A 1IY0A 1UKVY 4DCTA 4CEHA 3U44A 4PC7A 4JYCA 1XWIA 1YR7A 5CB8A 1US8B 2G88A 4ZCIA 4JVNA 3TW8B 5EP3A 3QSYA 5FL7D 2ZE6A 2JASA 4MGYR 4AKIA 4LPSA 1HTWA 4JYBA 5HCNA 1XCMA 1E1RA 2FWRA 2QAJA 4OI2A 4Y0AA 2FF7A 3NEYA 4A8JA 4K81B 2G77B 1SGWA 4KSBA 2H17A 1E3MA 1Q44A 1GWNA 3HPRA 3X1ZA 5DI3B 1R2QA 3LXXA 4WW0A 1XD8A 4M2LA 4AD8A 1TAGA 3OIUA 3WMFA 1JEEA 4ACBA 1XU4A 3A37A 2R6DA 5DI9A 1CJTC 4EPRA 4I81A 3OAAD 4NYJQ 4MRSA 1IN4A 1E4YA 1KOFA 4BECA 1NVWQ 1L4UA 3T35A 1OH8A 2BKEA 2ZRJA 3NG1A 3NBXX 1AM4D 2ZSAA 1W36C 3GJ7A 4V0OA 2ZXUA 2X19A 5JSZA 1XXHA 3S1AB 3NBYC 3U6BA 5JBQA 4C7OB 3VR5A 5EP4A 3AUXA 2BMDA 1ZNWA 1WA5A 3CX8A 2GKSA 1NIPA 1LS6A 4M1OA 3V4FA 1CR2A 1T4GA 2PT5A 2IYZA 2WHXA 2AXNA 4G3XA 3GP8A 2REXB 1NRJB 1VG0B 2D62A 5HKKA 2ZI7A 4HAYA 4D25A 1XTKA 1HURA 3QPUA 1WXQA 4Q02A 4IVPA 5FR2A 4OHVA 3GLFB 1OFUX 1YZQA 5TVKA 5CJPA 4TTRA 1ESMA 2R6CA 3GJ0A 2W6JD 2DFKB 4H9GA 1HT1E 1S4QA 1H8HD 1YZKA 2RGGA 4Z8XA 3C41J 3PJRA 1AQUA 1P9NA 3UMRA 1IN5A 4MYUA 2P6RA 2ZI9A 2WKRA 3HU2A 4A2QA 3WNCA 2VO1A 5EP1A 2QP9X 5DNYB 1XD2A 3K09C 1DPFA 2P65A 2O8BB 1CR4A 4PAQA 3A4NA 1E9FA 2XSZA 4MGKR 3THXA 2NGRA 1AGPA 2CE7A 3EXAA 1TF5A 4R2IA 2YOFA 5JFGA 2KWIA 2ZRMA 2O8FA 1GOTA 1QVAA 3SFVA 3SR0A 2FPKA 4DC9A 3ADBA 1FQKA 1N6RA 2YOHA 1K5DA 3M0EA 3VAAA 3THYB 5L3RA 3VU9A 3DDCA 5G53C 1TX4B 1XNJA 2FFQA 5TY0A 3AVQA 1ZNYA 3V00A 3ZIAA 5FTNA 3P27A 1SXJA 1XF9A 4QBHA 621PA 4M53A 2RGCA 2ZRNA 4X8LA 2W00A 1E9BA 2J0UB 1QDEA 5TMPA 2H5EA 4NDZA 3U3KA 1YR8A 4LJYA 3PV0A 4CZ2A 4B73A 5EXSA 1KYIA 2VEDA 2IHBA 5CITA 2OV2A 4OHZA 4XD7D 3IIJA 2ZI6A 1Z0JA 4C4PA 6Q21A 4B3XA 3EARA 4NYMQ 1B23P 1DARA 1TL7C 2KB0A 5F2EA 3T1VA 3ZD6A 2NO7A 3QIAA 2Q0HA 1KI2A 1TQ2A 2QU8A 2RB4A 1KDRA 2GZHA 2O8CB 2NPFA 1CXZA 1X8LA 4ZIRB 1S3GA 3BB3A 5H1YA 4L8GA 4ZDIA 1J2JA 1VYTA 2AK3A 2KJQA 2ZQ5A 2WWIA 2K5UA 3EPJA 1A82A 1M7GA 4FMBB 1Y3AA 3ECCA 4JL5A 3WMGA 4M4SA 1IXSB 5KDOA 1D2MA 2O5VA 1OXXK 3W8RA 4B3CA 4AIIA 1N6HA 4KFRA 3NTUA 2XTMA 4OHWA 4JLJA 3H1TA 1PJRA 3CF0A 3TQFA 3F5FA 5BN4A 1HE8B 3H2YA 3MFYA 5J4VA 1BKDR 1YZTA 4JZKA 5EE9A 2DWQA 2EFGA 1SXJC 5E7JA 2GA8A 1G1MA 3BH0A 2C04A 4EKDA 5KDLA 5EXTA 4QHYA 4B32A 2X2FA 1EFRA 1W7AA 3HP1A 3FB4A 1QHIA 3RSLA 2FDCA 3N2IA 3DPUA 4EPXA 3KDSE 4BQSA 1SVWA 1P2VA 4ON9A 5JLJA 1TF7A 4LRWA 4QM6A 1RJ9B 4NCHA 4WAUA 2SHKA 3CR7A 3BFVA 4TQ9A 4DDWA 2XB4A 1VHLA 1EXMA 4B6EA 1YHNA 2C8VA 4FIDA 4N1AA 1JPNA 2ZRHA 2F9LA 3K0CA 3GLHB 2O0JA 3LBHA 3LY5A 4TL8A 1P73A 1DO0A 1TUEA 4PSVA 2ZYWX 4FWTA 5JJLA 2JLRA 4IDOA 4NTZA 2CDNA 2HJVA 4B43A 4WXPA 2G9NA 2F1HA 2GILA 2IXEA 3EZ6A 3NBZC 2ZI4A 4AKHA 4HI0E 2VP2A 2XJ9A 3NC1C 4BLSA 2ZRIA 2AX4A 1N6NA 2G1JA 1RIFA 4KLNA 3RANA 1KMQA 4XWOA 3K9NA 1EWRA 3EWSA 2Z0MA 5IHPA 1FUUA 4V0NA 3QNUA 5GJCA 2QGZA 1Q57A 3EA0A 3K9GA 2A2ZA 1PV4A 1AN0A 4OKSA 4V0ME 1XPUA 1ELOA 2O0HA 1DELA 1E99A 3K0EA 2V9PA 3B1WA 2CL0X 2WIBA 1EFCA 1XP8A 1Z6TA 3ZS8A 3B1YA 2X2EA 2QROA 3GD7A 4IOKA 5FTMA 3UANA 5KOYA 2IXGA 4Q18A 4WZBE 4XTRA 1E79A 3B60A 1GL7A 2OCYC 4FN5A 3E5HA 4C0QC 1Z6YA 5LBIA 3GLIE 1WQ1R 5D3QA 4KFSA 4G5QA 1KK2A 4QHTA 4X8MA 5AUNB 2H1LA 3MD0A 4F92B 2EWWA 4DLVA 2FZLA 1RRPA 3H86A 1RYFA 1XPOA 5JSZB 5IDVA 5B57C 2ODNA 2QI9C 2VP6A 3W34A 2AWNA 2HYDA 3S1AA 4TMVA 5AUQA 4B6FA 2WIAA 1UEIA 2JIZD 5IK2D 4BEJA 1QHXA 1KI6B 5CJ2A 2FSHA 5F3WB 3B78A 2QORA 2Q3HA 3CNOA 5CDFA 4QG7A 2FSFA 3U3OA 4FCVA 1XEXB 2IYQA 4B2IA 2VHCA 4DKXA 2ORIA 3AVPA 4IFBA 5AJVB 4Q47A 2D4HA 4NE2A 2FV8A 4L9SA 5FL3A 3K9HA 1G8YA 2KSQA 1LFDB 2BM0A 2BJWA 4UJ5A 2WBLC 1NN0A 4XH9B 2A9KA 4N0EA 2RGDA 3CRMA 4D80A 3NBFA 1D2NA 2EYQA 1GZSA 1W0JA 2QA5A 4BLPA 5CYOA 1JI0A 2JA1A 2PL3A 3T1OA 4U7DA 1NKSA 4F4IA 4NKRA 2ZUBA 1U98A 2A5YB 3RWOA 1KI7A 1XEFA 1JXMA 3BGWA 5CM9C 2WWFA 4CIDA 2IX3A 4AC9A 4O0MA 3REGA 1Q0UA 3OEED 3TQCA 1J8YF 5FPTA 4OHYA 4OK5A 3L8ZA 3RC3A 2VSFA 4TT3A 4GT1A 3O47A 4IOLA 3BD9A 1N6OA 3GJ5A 4KYIB 4AYTA 3ZZ0A 5ANRB 5UKDA 3CIOA 3MLEA 2NMVA 2G83A 1S96A 5B58C 3OESA 3TRFA 2C96A 2CL7X 4Q4AA 3PUVA 4MGZR 1XTJA 3VX3A 1E0SA 5LB2A 5TARA 2XNDD 4W5HA 4M1KA 3KXKA 1XEWX 4JT2A 3RS7A 3X1DA 2FFHA 1NMYA 2QT1A 3MSXA 2PLFA 2ZYTX 1YR6A 2BCGY 1DOAA 2ECKA 3AF1A 1IN6A 3KUDA 4XTCS 4XIGS 2IEYA 1XTQA 3LQQA 2XOKA 2D7CA 2XJ4A 1U99A 3SHWA 2YKGA 1E2GA 3QKSB 2WICA 4TT3D 2JDID 4HDCA 4PHFA 3BS4A 4Z1MD 5JHHB 4TN1A 2ANBA 2VF8A 2ZYVX 3SJBA 3ZZUA 4R71A 2QP4A 1OIVA 2WOOA 2WM9B 1II9A 4ARZB 2GJ8A 3DEFA 4BFZA 2RCNA 4GI7A 1TNDA 5FR1A 3B8HA 4MRNA 3IO3A 4Q9JA 3G0HA 4DHEA 2Y8EA 4BGDA 4DEXA 5IT5A 2OESA 4RD2A 2OM2A 2DHRA 4DSOA 3QXJA 3IEUA 2ZRLA 4P32A 2JGNA 4JLVA 2V8OA 5KSYA 1U81A 3GFOA 4JIMA 4RVCA 4RFSB 4A0FA 4RZUA 4D0GA 5BQ5A 1G41A 5BW8A 3ND9A 1GP2A 1KDTA 1OH5A 4QJ4A 1NVVQ 2B7CA 2D7DA 2WWYA 2PT7A 4DLTA 1WE2A 4TL9A 4F38A 1CEEA 4ESVA 2AFIE 2C03A 4GL2A 4EJSA 1W2HA 2XOKD 2O8CA 3MCAA 1QRAA 3W6OA 3BORA 2O8EA 1PUJA 2WWHA 2D06A 3C14C 3Q72A 4E07A 2UVQA 4TMXA 4B74A 3EAQA 3MWKA 1KI8A 4MYTA 1AS3A 3A1VA 2Q9CA 2ZPTX 3QF7A 4KV9A 5FH9A 2CCGA 1AKYA 2GCOB 3TUJC 2FGKA 1OIXA 1XEXA 4NCIA 4N0DA 4CW7A 3X1WA 3ZDQA 2FZ4A 1S1MA 2BIFA 1CRQA 1CJMA 3FGNA 3MMPA 3CKLA 4RKFA 3H0KA 4M1YA 1VTKA 2X8AA 5B30A 4YXWD 5L3QB 5CB6A 1MH1A 2VA8A 1OE0A 1ZD8A 3CX6A 4NMMA 4KBGA 4V0LA 1N6KA 2X1VA 2YC4C 4LPKA 1GL6A 1ZINA 3CZQA 2XZLA 2BBOA 4TYWA 1T0JB 4OJQA 3AKDA 2REBA 2XXAB 3AP3A 4LYJA 1U9IA 4UJ3A 2A3RA 2GDJA 4PSAA 1TQ6A 3O8RA 1Z3IX 4B3BA 3BERA 4IEIA 3OZXA 5H8WA 3LD9A 4AY2A 4Q66C 3EIEA 3X1XA 3Q5EA 3O8DA 1NLYA 2EYUA 2P0EA 1GUAA 3AM1A 5TB5A 4NPHA 2RMKA 3AUYA 2YOGA 2AWOA 1KMHA 2HLDD 3ND8A 4LHYA 3FFAA 4LUCA 4MQBA 2QP3A 3T06B 4XOIA 1R5OA 5FOTA 1K5GA 4D6PA 4BFWA 1F2TA 1NBMA 5FUYA 1FZQA 2MMCA 5CLLA 5DSZA 1MOZA 4KJZA 4QBGB 2BVNA 1GILA 1Q12A 4DZZA 2ZS8A 3L0PA 4LJ5A 2ZJ8A 1KY3A 2DPXA 4X8HA 1OB2A 3OEEA 4ZCLA 4Q5IA 4EPVA 3AF4A 2A78A 3FE2A 4GRAA 1OIWA 4M9ZA 3U3RA 1ZMXA 2VHQA 2PCLA 3PEYA 4Q4JA 4IOJA 4OL0A 2IWRA 1P5ZB 2I1QA 5EE3A 4I1SA 5AJYA 2ZI5A 1KAGA 1U9IC 2L0XA 2CJWA 4GZLA 1KZ7B 2G3YA 3QKTA 2DWOA 2NG1A 4QL3A 4RZXA 1KO7A 1JQJC 221PA 1X86B 3TUZC 4LZZA 1WMSA 4PAMA 4DDUA 2CMKA 2WMOB 2RHDA 4JLPA 3SS8A 1Q1EA 3WYAA 1J99A 1CULC 1HUQA 1F5NA 3A1UA 4YDHB 1YR9A 3WNBA 1RRFA 1EG7A 4IDHA 4DSNA 3IPXA 2IYUA 2B8WA 5JJKA 1T5IA 4HAZA 1ZC3A 1P9WA 2J3EA 4KSCA 1FNNA 3QEJA 3WYGA 3KKNA 5IRCD 4A92A 1W4AA 3CNLA 4PHTA 3WBJA 3REFA 2VRWA 3KQNA 3C7KA 1ZP6A 1FTNA 3QBTA 1FP7A 3DOEA 3BB1A 2HEIA 4EAQA 2BMJA 1WRBA 3TAUA 3W8NA 4XWAA 1W4CA 3KB2A 1XMVA 3EZ2A 3DM5A 3VR2A 3A4MA 3GEEA 4IDPA 2OBNA 3QF4A 1G5PA 4CT4B 1W48A 3B7GA 4K8OA 3ZGXA 4DSUA 4BZXA 4LX0A 3EWAA 1S2MA 2G1KA 2ZRPA 1DE0A 2PZFA 3E70C 4G1UC 2EFEB 1ETUA 4C3ZA 2V3CC 2QN6A 1PLKA 4PO9A 1W49A 3T1TA 2RGBA 3BH6A 4NYMR 2C78A 5FFMA 3D31A 3RDPA 2N46A 3TSOA 5JS7A 2NOAA 1UBGA 1VCNA 1DG1G 2OCAA 3BE4A 3FHCB 4HAVA 4XSGA 2GETA 5JCPA 2ATXA 1VCIA 4HEJA 1E94E 2H8KA 4KO8A 4BFTA 3KXIA 2JLSA 5L3QA 4R9UC 2HT1A 2QENA 2HF9A 2H92A 3U2QA 2ONKA 1QHSA 1ZU5A 1C1YA 3FOZA 4AK9A 1LB1B 1DTSA 3GFPA 4PC1A 1ODFA 2R65A 4XVRA 1IXZA 3KJGA 3NIBA 3MWYW 1XD9A 3MG9A 1OV4A 4ZV4A 2J41A 4EFNA 2JLUA 3OEHA 1CR0A 2NTYC 2F9MA 2R6FA 1T6NA 2AKAB 1YJ5A 2WAXA 1TTTA 2RAPA 4NCNA 4MDEA 1P75A 5E3HA 1CTQA 1XJ0A 4RD4A 1T5LA 4HUQA 3WMEA 4WZ6A 1KZGB 2OILA 1G3RA 4IXNA 2ZI3A 1Z47A 3FMPB 4MITA 3WYFA 1CJKC 2H7VA 1NSFA 3SBDA 2IYRA 1U8ZA 3BIFA 1G20E 3W3AA 3KJIA 2GRJA 4E09A 4OQFA 2PLRA 3CUEF 1Z0FA 4CGZA 4US0R 4R98A 1T8UA 4JLOA 3PVSA 2Z43A 1SULA 4MRVA 3I62A 3GLGA 4J0QA 4Q1AA 1J8MF 4A82A 2PCJA 1Q3HA 2YINC 1XTSA 3GLIA 3K9LA 1BMFA 1GAJA 1E9AA 1FL9A 1XRJA 3P32A 2XGJA 3HU1A 4LV5B 4LCBA 5EE1A 3K70B 3SU8A 2ZU6A 2QUZA 4I99A 2HLDA 2WSSD 2JLWA 4R7ZA 2IK8A 2GJSA 1AGRA 2CXXA 4TL7A 3SYKA 1Z8FA 5HZHA 1VIYA 1NBMD 1RC8A 1YZLA 1VG1A 4Q03A 2P3SA 5GJWC 2NIPA 4EPWA 5C2JB 3CONA 4YC7A 5DYGA 1Z0AA 3PENA 4DIDA 4LBWA 3RS2A 4JVLA 1QVRA 3F8TA 4I1VA 5LD2C 1DAGA 4B3GA 4C9BA 5FUVA 3B13B 1CP2A 1OH7A 1PLJA 4KU4A 3BAFA 1H8HA 4OI1A 1IQPA 4I1OA 5EZ5A 1RKBA 3THOA 2WKPA 5AR1A 1G6HA 3CPHA 4M1WA 1YU9A 5K8TA 2ZE8A 1GNQA 4FMCB 3KQKA 4CYMA 1Z0KA 2QPOA 1C9KA 4D26A 1KDPA 1LVGA 2J0UA 3UWKA 4B3DA 4A1FA 2HYIC 4YMVA 3GLHE 3U4QB 1CLUA 1KKMA 3JZMA 1WDTA 2J7PA 1OXVA 1VKJA 3L8YA 3NH9A 3LX8A 4P0TA 5FBWB 2ORVA 1MABB 3EIQA 5DI3A 1OH6A 5J47A 2QM7A 1OHHA 3K0CC 3OE7A 1M6NA 2HXYA 1SZPA 3LBIA 1N0VC 2XITA 3WY9A 2RKOA 1YE8A 4NONA 5L3SA 4K46A 1RPZA 2CJWB 1G17A 2NO6A 3PUYA 5FBLB 3B85A 4A0HA 5KNCA 3VFDA 2XX3A 1ZD9A 5FBVB 1G3MA 3BFKA 1KKLA 3SI7A 1XX6A 2A5JA 1ZUNB 2ZJ5A 3PCRB 1R5NA 1PUIA 4RCYA 4DLYA 4FCWA 2ZUCA 4CF7A 3KZ1E 5DN6A 2WSMA 1E9CA 2ZRFA 4IW3B 1OYWA 2ATVA 1Z0DA 4URYR 1J7KA 5JWHA 1ZCAA 2IW3A 4RD1A 4OJKA 5CK5A 4ZI2A 1N5JA 5C4GB 1BYIA 1SXJB 5FOWA 1TEVA 2WJJA 2BC9A 1F6BA 1KJZA 4M22A 2GHIA 3QEOA 2H57A 2DFNA 4MDFA 4UKDA 4DT1A 1RE0A 2AHOA 4NHOA 1XZQA 4BEBA 5HR5A 1SHKA 3RS5A 5FPKA 3GLFE 4ESHA 4RSGA 3GMTA 4E03A 2CEAA 5J5CA 4MA4A 5JJIA 4TWZA 3TGPA 2IHYA 1N6PA 4MYCA 1E1QA 3I73A 2IT1A 1QHYA 4LHWA 4B71A 2REOA 4D4JA 2OCBA 3C16C 2IS1A 1Z2CA 4YQFA 2QG6A 3SJZA 2OSBA 4MYHA 5JCZA 1I4LD 2OFXA 1Z83A 1G21E 1QZXA 1T3HA 1X8JA 4JT4A 2ZUDA 4U00A 1ZAKA 5CLQA 4Q9KA 3W6PA 1E0KA 1KTVA 4DDTA 3B9QA 2O8BA 2NQ2C 2YWGA 3IEVA 4FMDB 2ZR7A 4C30A 2EFDB 2C77A 1E2EA 5SZIA 2GK7A 4EPTA 2Q9BA 2JLVA 1NL3A 4TYNA 4DBLC 2ZU0C 3IUYA 3LFUA 3D6TB 4HUTA 3O8CA 4A0GA 2LKCA 3KXLA 2R62A 2BJVA 1SQ5A 4BLRA 4BFSA 4NL4H 1AS0A 3AVUA 4BFXA 3A4LA 4US1R 2IXFA 2ZYUX 4Q21A 4DLWA 4DRZA 2IYSA 1XCGB 4BZQA 3FVQA 1US8A 4O25A 5C46F 4W7SA 1D9XA 1E1RD 1W4BA 2CCJA 4Q1BA 2UZIR 3LA6A 4CEHB 1BIFA 1DS6A 1VG8A 1XDBA 2BBTA 1KSJA 2I4IA 2BWJA 3PEUA 2YHSA 3K0AB 2W6ID 3FKSA 1MO4A 3KKOA 1D2EA 5J4LA 3L0SA 5EQTA 3AF2A 3GLGB 1G7CA 4GDFA 2GEVA 2VP5A 1OKKD 3VNVA 3PQCA 1KNQA 4ZO4A 2GXAA 1BOFA 4UNPA 5HZKA 1YZUA 4HZIA 4ASUA 4YXWA 2DR3A 4JKIA 4C0LA 1VIAA 3Q9LA 5C4MA 4EFMA 2XNDA 3C5HA 1T3SA 5KSOA 2BCJQ 1GITA 2I3BA 1LV7A 4GFDA 2GBLA 5A0FA 3U7FB 1CF4A 4PR0A 5AJZA 5G3YA 1G7TA 1ZNZA 2ZRGA 2XZPA 521PA 3TBKA 4BWYA 3VR6A 1MO3A 5CDFE 3QENA 4HB3A 2FFBA 1G64A 2ORWA 4OBEA 2QPAA 3LV8A 4JL8A 4HATA 1JAHA 4Z54A 1ZJ6A 2QRNA 4HDOB 3DOFA 1VDZA 2JIZA 4LJ7A 5BWMA 3ADKA 4IOMA 4QHSA 3U3MA 3THWB 3T61A 1ONBA 2IUSA 4LJAA 3KKMA 1E0JA 3T1QA 2GTPA 4BFYA 3Q8XB 3TVDA 4ZI3A 1GFIA 2F1IA 2C2HA 1Y63A 3QXXA 1Z63A 2WKQA 1Z6GA 1OHHD 2FE4A 3CNNA 3M4YA 4IRUB 3VR1A 2VF7A 2LCFA 4HZUB 2FSIA 5P21A 2C95A 4ZIRA 5FOVA 3K0AA 3QXHA 1OXSC 5J4HA 1G7RA 2ZS9A 2OT3B 4PZZA 3BWDD 2MMGA 4TYPA 5H68A 3WXMA 5KNBA 2O8DB 2FOLA 4TSFA 5K8IA 4DIEA 1IHUA 3IGFA 3P1JA 1RYHA 3K0FA 1YRAA 4TL6A 3MWLA 4JJZA 1L4YA 1XD2B 3UK6A 5LDDC 5KPDA 3Q3JB 2W0MA 4LHXA 3FKQA 3N70A 1NVVR 1ZM4A 3LLUA 1IJFA 1UKZA 3CRQA 4Q1DA 1KSHA 2ZJZA 1M8PA 1QHNA 1ZU4A 2MSDB 5HE8A 1Q1BA 3JVVA 2RGXA 4TTPA 1N0UA 2ONJA 2IYWA 1OW3B 3AB3A 4NCJA 5AK0A 1EWQA 3R8FA 1KK1A 3J81k 2ZJOA 5DYIA 2YWFA 1CIPA 3OFND 3RAPR 2B6HA 1G7SA 4AYWA 5FTJA 5J4KA 2ZROA 1NN5A 4V02A 5E95A 4OQLA 1E2MA 5AWFC 3EC2A 3AEZA 4RD3A 4Q7LA 2WPDD 2A5GA 3LW7A 5HKKD 2ZSBA 1N3BA 2ZE7A 3Q85A 3L0IB 2C9OA 3TSWA 2GCNA 2A7QA 1CJUC 2H16A 3ONWA 1W0KD 4FMCF 3WP0A 3ZVMA 4DLZA 1JR3A 1XB2A 4Z8YA 3AKYA 1SXJE 3QOFA 4A6PA 1JNYA 2R8RA 4IFEA 4IDNA 3BBPA 4KFTA 1MR3F 4B47A 2ZJ2A 1TPZA 1NLFA 1AJEA 3HDTA 2W2TA 3RRMA 2XZOA 5KDDA 2DYKA 4JLKA 5DISB 5HCIA 1NIJA 4DT1B 2BEJA 2OXCA 3R20A 1WP9A 3AVTA 1WF3A 1FUKA 1W4RA 4RJLA 4JLBA 3CH5A 3CR8A 3W3ZB 1Q3TA 3L2OB 1LY1A 2WJVA 2XTNA 3I3SR 3PUWA 4PQRA 1FP6A 4KLZA 1K8RA 1YZGA 1KNXA 2QEQA 4QGAA 2GVDC 4M9XA 2O8EB 3ADCA 2ZS7A 2JLXA 1E2JA 3B1VA 1OFTA 4M21A 2BV3A 3LVRE 1Z08A 1S9DA 3CRW1 4GSYA 2RH5A 3D7MA 1ZM3A 3OAAA 2QSYA 1EK0A 3SN6A 4LOAA 1IXRC 1VMAA 2CNWD 1W0KA 2JEOA 2PJZA 721PA 4P3YA 3UG6A 3RHFA 4GP7A 3CB4A 4C2TA 3CX7A 3QG1A 1G9XA 5LPNA 1ESNA 2OE2A 2CK3D 4LGMA 1VYUA 4S2EA 2GCPA 1MABA 1UM8A 1GKIA 1R5BA 1C4OA 3GEHA 3ICQB 4DUGD 1SVLA 1R4AA 2OAQ1 3ZH9B 2JDIA 4Z1MA 3SDZA 3SZRA 4DEYA 3LNCA 4C0HA 821PA 3EG5A 121PA 4D0NA 2NZ8A 4ABYA 4PX9A 2CNWA 1E32A 3ZQ6A 1Z29A 4PSKA 1QBKC 5FTLA 1P4SA 1G3QA 1FX0A 1G3UA 3VTKA 3KJHA 1U8YA 1JJVA 2FPLA 3TKLA 3IQWA 1P62B 3N5CA 1KGDA 1XBTA 1DEKA 1JECA 3WRXC 1E2PA 2ZR0A 1GVNB 4PQYA 2ZE5A 2W6JA 1F2TB 4FMDF 2IL1A 2EQBA 1ZIPA 5TXGA 2BBWA 2QNRA 4GOXA 4TMTA 3CZPA 4JLNA 1AA9A 1P3JA 1D5CA 1WBBA 1JQLB 2FU5C 5E7IA 3MJRA 1ZYUA 2CHGA 1ZUHA 1UDWA 3ZS9A 2HV8A 1QG2A 1P7CA 2IYLD 4MKFA 1YQTA 1ZBDA 4H1VA 5FOUA 4GP6A 1NY6A 2JJ2A 5JS8A 4P4SA 4LJ6A 4ZPXA 1DAMA 2QAGC 3ZJYA 4V0KA 4Q4LA 3THWA 2JCSA 1OLOA 3K09A 4HZUA 5JMTA 1SVMA 1TEXA 3FMOB 1DAKA 2QTHA 1GG2A 4H1UA 2YV5A 5A5GA 1ZC4A 2AD1A 4AWXA 1JB1A 2ZSDA 3CBQA 4M1MA 4V0MA 3EPKA 4B35A 2ZTSA 4XJXA 1W46A 4IXMA 1R0ZA 3EA5A 4EPYA 3DVLA 1TU3A 3RABA 2AL7A 4MGIR 4EFLA 2VHJA 4BASA 1G8GA 2IYXA 5FTKA 3OF5A 4FCTA 2JJ1D 4NBSA 4TMZA 1FMLA 4KFUA 1A1VA 4AKGA 2P6UA 3ZVRA 1M7HA 1ZNXA 3IIKA 4DLUA 1OFIA 1A2BA 3LO5A 3SYNA 5JECA 1UADA 4GPTA 3HR8A 3CWZA 2A5DA 5GADl 1JBKA 2V7QA 1V5WA 3RVBA 3EPLA 4M1SA 4JBWA 1YVDA 2F3RA 3GFTA 4OQMA 4RFVA 4W9MC 1MV5A 4YMUA 4N3NA 2VHUA 2JJ8A 3PR1A 3DKVA 1XMIA 1QHHB 4B75A 4JS0A 5DHFA 1XZPA 2H18A 4HLUC 4CRWB 3SBEA 2PMDA 3QY0A 4B33A 1B0UA 3AP1A 4EUNA 2YVUA 3WRYC 4PO8A 3GEIA 4JBYA 4YONB 1PVOA 1SVSA 4AURA 4M0LA 3A36A 1CS4C 1EFRD 5TDHA 2V4ZA 2FN4A 5FI1B 1S9HA 5FOXA 4C0SA 4TZ0A 3PIRA 3VHLB 5L3SB 2QE7A 4G5RA 4JL6A 5EZ6B 2FA9A 4LBVA 4OYHA 3KX2A 2ZJAA 3BOSA 2A30A 2QMUA 3NEJA 1NNEA 2OG2A 2WVJA 2OO7A 1N5LA 4TZ6A 4KHZA 4P4TA 1VPLA 1KY2A 1A7JA 4NYIR 4RD6A 2VQSA 4I4LA 4JMPA 3LW8A 3C8UA 2A5FA 2PZEA 4F4CA 2F1JA 3ZIAD 4LK2A 1IN7A 1W5SA 2D3WA 1LNZA 2YYZA 3TH5A 3WHLA 1Q20A 3UKDA 1H8EA 4L16A 1TQ4A 2J0QA 3IDQA 4TMWA 3HYRA 1GRRA 1GRNA 3I72A 4LV8B 2KI5A 5FPSA 1NI3A 3ETLA 4QC2A 2QQEA 2ZJYA 2BHRA 1E2DA 2VH5R 4PFSA 1HEIA 4QBFA 3VQTA 4US2R 5KU1A 4CEJB 1KK0A 4KITB 2CVHA 1EFTA 3T34A 2FPMA 4A15A 5K8UA 4GOJA 3OHMA 1N5KA 3D3QA 1XXHE 4HB2A 2FJUA 4G5SA 4JSYA 5JHGB 1Q1ZA 1SKYE 3H84A 5K8LA 2R9VA 5D3MA 4D4MA 5JEEA 4LI0A 1Z06A 4A8JB 3P4XA 1ZM7A 2CHVA 4PC3A 1P2UA 4ZDJA 2QMHA 1XFAA 2Z4RA 2XTZA 3K0FB 5BN3A 3UG7A 1KAOA 1TADA 3B1ZA 2C9YA 3GLGE 1Q1QA 1RW4A 4Q4HA 5EE0A 5HTKA 2XSZD 1SXJD 1T91A 3QKRA 1ZRHA 2Z5FA 2HT6A 1Q21A 1JAIA 2EFCB 4R2HA 4DCUA 3FMFA 3I92A 2IF0A 5C18A 5IK2A 1EX6A 1WB9A 4NU0A 3I5YA 5A4JA 2HF8A 2NZJA 2V55B 3Q5DA 3WBKA 1FW6A 2B21A 1EFUA 1HT2E 3TR0A 3CLVA 4DB2A 1NJGA 2J87A 3NXSA 4LC1A 1UKYA 4BLOA 2GF0A 4Q4JB 1N6LA 4EJSC 1V43A 1LW7A 2OAP1 1I2DA 3FPAA 2F43A 3E2IA 2ZVPX 1QF9A 4LYHA 2Q21A 1U94A 2PEZA 2WMNB 5TV2A 2OXRA 4BRUA 3KQHA 1K6MA 2Z83A 2HCBA 1Z28A 1UJ2A 4HUQB 5KUTA 1QHHA 3BRWD 3QG5A 1BH2A 1D8TA 5KTYA 3FDIA 1HA3A 1HYQA 2GVZC 1FX0B 4QNRA 3U6KA 2V1UA 4B2LA 3FFBA 4LYFA 4HAXA 3KQLA 1U8AA 2VHTA 2IYVA 2DFTA 3IBGA 4QNMA 1TU4A 2N42A 3LQRA 4E5UA 3NDPA 4ZCMA 3NDBB 2YC2C 3OFNA 1BYUA 3LWNA 2NO9A 3VHXA 3P26A 4I1UA 1U0JA 3AGQA 2PEYA 1COWD 4HB0A 4IDQA 1ZUIA 4Q4HB 4TLCA 1II8B 4ZKDA 1NN3A 3TR5A 3W9YA 2IS2A 3I61A 5E4FA 3MRSA 2ZSFA 3SEAA 1F60A 1N0WA 1CU1A 1R7RA 2QAGB 1KI4A 2GJAA 2YJTD 5FI0B 2BMFA 3THYA 1FNMA 1ANKA 1VYVA 2BKUA 2Z4SA 4Q01A 5KSPA 1RRCA 1GIAA 3ASZA 3WNDA 4GZMA 2VP0A 3GJ3A 4LYAA 2QTFA 3IHLA 2RGNA 5DLQC 4FXPA 4F91B 3MUFA 4S35A 4RKEA 3SOPA 1ZVQA 3R9XA 1UPTA 2UKDA 3PEVA 3R7WA 4M1TA 1YRBA 2P67A 4PZLA 2OLKA 1FTSA 3AF0A 2QY9A 1D6JA 2O0KA 1IN8A 2FG5A 3OIYA 2Z6VA 4IVQA 1UFQA 4F93B 4A2WA 4FW9A 1E9RA 4WBSA 4PANA 4UNNA 4B48A 4C0AC 3TK1A 1S1CA 2GJ9A 1RFLA 1ZCBA 4PPNA 4QGGA 4RFSA 2GK6A 1X1RA 2ZVQX 3W5IA 1M34E 1TQDA 3H4MA 4AI6A 5F98A 3ZQJA 4EQ6B 2JLYA 1RJ9A 2CLSA 1OXTA 3BH7A 2JLZA 4TQAA 1G8FA 2CLDX 4MUBA 4QJ5A 3FYHA 4TYQA 2FSGA 3I8XA 2ZETA 4WXRA 3FMIA 2FEMA 1M1YE 4DSTA 3UMFA 5LB4A 3C4JA 4BFUA 3C5CA 3P20A 3LDAA 4WZAE 4D81A 4JLAA 1Z07A 4QGHA 1UDXA 3FTQA 3PXGA 2OLJA 1G291 3FWYA 3O8BA 4OI0A 2ZRAA 1DO2A 3KQUA 2WOJA 4XVUA 1KHTA 2CK3A 2VYFA 1E69A 1AK2A 4FWIB 1R8QA 4TMKA 1G18A 1R0XA 1I2MA 1WCV1 3DKPA 3TSZA 4DXAA 2IYTA 2MSCB 1A5TA 4BLTA 1HH4A 4KVAA 3HWSA 3SQWA 3TVTA 3FHOA 4KBFA 4WIAA 2VPPA 3BJIC 4NYIQ 4DLSA 1R10A 4D82A 3LAWA 3RRZA 3TIFA 3ADDA 4LBZA 1PZNA 2VP9A 2WSSA 3K1JA 4PPGA 1DAIA 1LS1A 3IPYA 5M04A 2IA5A 2AR7A 3KKQA 1KI9A 5G41A 1IY2A 3SE0A 2OHFA 4HLUA 5CK4A 2ERXA 1E2HA 2ZREA 3GLHA 2WAYA 4QKQA 1ZW6A 3M1IA 3CPEA 1F2UB 1CRPA 2ZRDA 1M74A 5B64A 1U0LA 4DCSA 2C9CA 2ZSEA 4Q9HA 2F7SA 4PHHA 3RS0A 4QRHA 1NMXA 1KJYA 3AVXA 4L15A 4LHZA 2KE5A 1S0UA 2F6RA 3QKRB 1NP6A 2RGEA 3NKVA 2ZRBA 1MO5A 1LF0A 1JXOA 1E2IA 3F3YA 1NJFA 3T5DA 1QHGA 4DB4A 1P6XA 2ZR9A 3A1WA 1SKYB 2ODEA 2FNAA 2GXSA 2F55A 3A1TA 1DAHA 1GKUB 2OFOA 3BK7A 1HQYE 1IY1A 1G6OA 1II8A 4LJ4A 4LC0A 5DIFA 3AVOA 2R44A 3ZYCA 5SZJA 3UPUA 3QPWA 2EFHB 3KTAB 4LDJA 2WWGA 2DY1A 2J5XA 2JJ1A 1KO5A 5JWOA 3QF4B 2R6GA 5EP2A 1GL9B 1GDDA 2UZ3A 2P6NA 2GBLC 2WWWA 4URUR 3IQXA 2D74A 1IJEA 1E0AA 3AV0B 1W36B 2GAOA 3GPLA 1ZM9A 2D2FA 3GLIB 2AD5A 4V03A 4B44A 5FPYA 4BRWA 5KO2A 1HQCA 3CH4B 4HSEA 2ZAOA 3NVAA 4POAA 2VIIA 3AVWA 1ZIOA 3HJNA 3LLMA 4XSHA 3QI2A 1KK3A 4MRRA 1S3SA 4KCGA 1TUIA 4D0LB 5IF9A 1NKTA 3A8TA 3KFVA 1KO8A 1W44A 2QMOA 1NVXQ 1AS2A 2VL7A 3I4LA 2HUPA 1TMKA 4ACAA 3X2SA 4UNQA 5ELXA 2IEZA 2J59A 4XVQA 4QXAA 4P31A 4PXAA 1RVDA 3QKUA 3OEHD 2OBMA 2QPTA 3DM9B 2ZM5A 2LKDA 2YWHA 1VCMA 1GNRA 1GSIA 1MRNA 3QXCA 5AJWA 3TNFA 4DVGA 1FFHA 4TTQA 2G6BA 3LX5A 3ZZTA 5JWRA 3VNUA 3IKJA 3EPHA 3VX4A 4TLEA 3PEWA 3UATA 4TQUS 2C99A 4DLXA 3U4QA 1N6IA 2ZJBA 1P61B 3V4RA 4G5GA 4ZDWA 2E1RA 2IWHA 2X77A 1A2KC 5GVRA 3W6NA 4MUAA 4UXJA 4LHVA 2FEOA 5FUWA 3NC0C 1EFHA 3LRPA 4QGFA 2NO0A 2OUKA 3Q7PA 1AZSC 3QKSA 2C98A 4B76A 4EIWA 2HXSA 1T9HA 2CBZA 1W36D 1OB5A 2V6JA 4LWZA 4M8NE 4Q1FA 3ZD7A 4OHXA 1FMJA 3F0TA 2Q3FA 5FPHA 2ZIAA 3DHWC 4Q4AB 1UBFA 4G0NA 2J1LA 1N5IA 1EGAA 1UKEA 3TUIC 4WOPA 1G8PA 3RLFA 3RNLA 4CVNA 2EWVA 2C5LA 1IAQA 3OIVA 4PPFA 1YZNA 4URZR 3SQXA 1H65A 4O2RA 1SVKA 3M6AA 3U7HB 4UQOA 2QSZA 3EW9A 1JEDA 3LXRA 4TLAA 5GJBA 1HV8A 4LY6A 2HJGA 1G19A 3UXMA 3FKSD 4HB4A 2XNSA 4PO1A 3SJCA 3UIEA 4BZPA 2GF9A 2W6IA 1G5TA 3SC3A 1JR3D 4JSTA 2GXUA 1F3OA 2F43B 1R0WA 1Z6AA 1I4DD 2FGJA 2G0NA 2G0TA 2YNMA 1CBUA 3CRVA 3EASA 2GESA 4FINA 4Q19A 5BXQC 2J9RA 5JEDA 1NLZA 3MGCA 2V1XA 1VECA 4B3FX 1P60A 3K70D 4EQ6A 3X1YA 2AFHE 4O3MA 3DMNA 4Q1CA 4D4KA 1G8HA 4RZ3A 1T0HB 1IM2A 1NF3A 4Q7JB 3CWQA 1BO6A 2J0VA 2Q9AA 2R2AA 3R9IA 4YDSA 1U90A 1E1QD 2W2XA 3FHTA 5FL7A 2BM1A 3AH8A 5E7MA 4TYYA 1NG9A 1X3SA 4AG6A 1E2LA 3HR7A 5SZKB 5AUOB 4UXHA 3BB4A 1DVRA 2ERYA 1CR1A 2ZANA 3SHFA 2QL6A 4JLDA 3DZ8A 4OK3A 2P5TB 2FMXA 3VKWA 5JI3E 5DH9A 1R8SA 2QTVB 4ZKEA 1HY3A 4YLGA 3IHWA 3JZAA 1AZTA 3LBNA 2KBEA 4Q7MB 1XEWY 3TJZA 2R6AA 2IYYA 3EIHA 3OIWA 4JBXA 3AP2A 4RCZA 3IO5A 1J90A 1NVUQ 3RRNA 1KO4A 3WHKA 4Z51A 3NH6A 3RRYA 2OFWA 5F9FA 4AG5A 1DADA 2WJGA 3KTAA 1X8KA 4ARZA 4D4LA 2GJKA 1IONA 4C2UA 4RY2A 8OHMA 4YMSA 4UNSA 5CIQA 1R0YA 3AF3A 3CW2A 1KI1A 2GAAA 3HU3A 3QUSA 3SFZA 2PX3A 2ZITA 4P33A 3R7WB 4QJ3A 4TSFD 1ZM2A 3TE6A 1TF2A 1XJCA 2HCJB 4GNKA 3MJHA 3TAHA 1BS1A 4HAUA 3B6EA 2IBMA 3IIMA 1O87A 3VKGA 1U2RA 4L5BA 2BMEA 1E2NA 2JLQA 1E4VA 3HYTA 3KFXA 5FBRB 4C0KA 2XXAA 1G3IA 4M9SA 2J7PD 1QG4A 2P2LA 1E9DA 1U0HC 3NHAA 1WBDA 1KSFX 1W47A 4A0RA 3UWOA 3PITA 4IKEA 4PC2A 1M2OB 1Z0IA 2PX0A 2OBLA 2CHQA 4EJSB 1KMHB 1F2UA 4JKYA 1NN1A 2ODBA 2B7BA 2DFLA 2O8DA 4OQNA 1JR3E 2VSXA 4Y0VA 5FUXA 1FPMA 1EX7A 3I8SA 5B2ZA 4W5JA 1OSNA 1H8ED 4URXR 4IJMA 2XB2A 3VMFA 3A1SA 1N25A 5DGXA 2F1RA 3L0OA 3K8YA 5DN6D 4FI3C 4CEIB 5L3VA 2IS6A 4RD0A 4BE7B 4URWR 1ZD1A 4PTLA 1KI3A 4HLCA 4Q00A 4P4SB 5KNDA 3ZVLA 1JALA 3G82C 2RGAA 4RZ2A 2QBYA 3SJAA 4YMTA 3ICEA 2V6IA 1IBRA 1DAEA 2NPIA 4NYJR 3VR4A 1JPJA 1RZ3A 2AN9A 5EE5B 4QFMA 3K0SA 1VG9B 4JJKA 3PUZA 5L8VA 4D2IA 4L9WA 4MRPA 1G4UR 4IHQA 4P4UA 2ANCA 2IF2A 3BC1A 4U5XA 4JVSB 1G16A 4TLDA 2GCOA 3KKPA 1XCPA 4JLMA 2JATA 5FOSA 5GJVC 3RS3A 5AUPB 2OCPA 2W83A 3B9PA 2WJYA 1UEJA 1OXUA 1XTIA 2RGNC 4PAOA 4PHGA 3CRRA 4YMWA 4EDHA 2HDNB 1W1WA 3TMKA 3NWJA 3QQ5A 1MO6A 3U61B 3A6PC 4F7WA 1T8TA 2E9SA 2JJ2D 3GLFA 4B34A 5J40A 4XWKA 3W90A 3RC8A 4ASUD 5JRJA 1Z6XA 4Q48A 2OEPA 2DWPA 2ZAMA 1M7BA 1COWA 5AJXA 2QAGA 5KHOC 2DB3A 4HDQB 2PJRA 1FQJA 3AKCA 4CDGA 1MT0A 2QZ4A 2B92A 1Z22A 4DCVA 3QBVA 2P5SA 2QE7D 2IC5A 4CT5A 4A8JC 1KO1A 1OPXA 1XMSA 1J70A 3AQ4A 2XAUA 2IS4A 4ITRC 2O8FB 1OJLA 1OF1A 1SVIA 3R9WA 2IUUA 4MKHA 3EC1A 1VHTA 3ZLJA 1AIPA 5CM8B 3U44B 4PPQA 5HE9A 3BXZA 2BOVA 3KL4A 4W5WA 4AYXA 4PZYA 3SNHA 4JVMA 2WPDA 4ERNA 3EZFA 2AKYA 3CM0A 3G5UA 3MWJA 4NZYA 3Q7QA 3B1XA 2NO1A 3PG5A 1E9SA 4Q9LA 1R6BX 3EZ9A 4KVGA 1NSTA 3B2EA 4KYUA 3KUCA 3MAAC 1NBME 4NP6A 2J45A 2CVFA 1FOEB 4HYYA 4MKIA 1XPRA 4KI0A 5KSZA 3TLXA 4BFVA 4LSGA 5EXXA 5SZHB 2FFAA 3T12A 2XEXA 3IBYA 3GQBA 4CEIA 2GEUA 1CKEA
chains in the Genus database with same CATH superfamily
4CEJA 3KR1A 4KOEC 1P2SA 4UEOA 3MIZA 4MV4A 5DM0A 2ZUVA 3TTXA 3K20A 1K6EA 4NJOA 2H4YA 4YRFA 2AQHA 2JJQA 2CEKA 3MIIA 2W48A 1LQ2A 2VXOA 3LVQE 3TSAA 2F9FA 4OQXA 3GBSA 4BATA 2NVBA 1XXHB 4A4DA 5B55A 5FPQA 2P9YA 5A06A 2Y1EA 4I5DA 2NADA 2IVFA 1N2ZA 1XRNA 2VJBA 3HCWA 3NT4A 4J7XA 1EB8A 4WY8A 421PA 1TGYA 2ABWA 2P2YA 4A0SA 5HBRA 2Q6TA 4HQKA 1LRKA 5HDBB 2XQVA 5TPZD 2JFXA 4KWEA 4NH0A 1EEXB 2YYYA 4F4JA 4WESB 4TUYB 1II0A 3DZFA 2AKEA 1LK5A 2GUGA 5ALXA 5I45A 4DR3B 1JR6A 1JE0A 1SK9A 1H05A 1I3LA 2WZQA 3DT9A 4Q82A 4QBIA 4WKOA 4ZVRA 4YREA 3WP1B 3T41A 3VNRA 4C7MA 3AEUB 3D7NA 2OCIA 1S8FA 3NCTA 3INNA 2EW2A 3NWPA 1RS0A 2CD9A 1IIRA 2H7XA 2JHGA 3IUBA 4G5OA 1SBIA 4JBGA 4KNWA 3UMVA 1ABBA 4UM8B 2VTKA 4BUJA 1P0MA 3NALA 3E1SA 4MX8A 5K2OA 4LKRA 2BDTA 1QGUA 1NNUA 4EJFA 1MRSA 3I9OA 3BTSA 4Q1EA 4EK9A 5HX7A 1DWQA 1H66A 1XZKA 2WU8A 3VUEA 2QRZA 3DYVA 1XT6A 1U3WA 1WHSA 3OJXA 4PRYA 4RHTA 4UBMA 2W4IA 4UNRA 3R41A 3MRVA 2WJHA 2Q7OE 2Y99A 4Y7DA 3TRKA 4F3RA 3WQSB 4P22A 3TEJA 2E87A 3HUFA 3N7TA 2B2NA 1W93A 4MKGA 4NNOA 4W82A 1NJ5A 1FJ2A 3ZS9A 1U2ZA 4MK4A 4BNHA 1WKBA 1Z2AA 5E0OA 3IALA 1IQRA 1PL0A 2EBHX 1X39A 1JEOA 2I29A 3I32A 1O58A 3OJEA 4XLTA 2PZGA 5EWJB 5GVSA 3LDHA 1EUDA 2P77A 5JS2A 3VKHA 4CM4B 2CMHA 4E2ZA 2VP4A 3WGZA 5H02A 4YRPA 3LPLA 3SYLA 1Q22A 1SHZA 4Z3DA 3RFTA 1ZRNA 3QE0A 3A58B 3H5NA 5JMPA 1OTYA 1O6CA 2BEWA 2CVZA 1L8XA 3MJCA 3QJYA 4IJQA 4E22A 5KWIA 3LH5A 1USUA 2D00A 5DHRA 1Z6ZA 2UYQA 3JQ6A 1RJGA 4OMCA 4CG1A 3PYMA 2GEJA 4G01B 4DDVA 2GWHA 1WKCA 3TEFA 3FNRA 3FDFA 2RBGA 2P11A 2V54A 2HKIA 4KAXA 2JGAA 4BX9A 1SVOA 5BUCA 1CQIB 5KNCH 5IKOA 3KEGA 3UHOA 4P9NA 2N1BA 4BO7A 3BE5A 2J33A 1GTVA 1A04A 2P4QA 2ZM6B 1AF4A 2QY6A 1R6TA 1GG9A 3ZCVA 1COZA 3DR5A 1U7DA 2ZIXB 4XDZA 2H1FA 4RM2A 1R8XA 3VNAA 1Z2OX 3I5XA 2QMYA 2W70A 2VKTA 5IKXA 4N76A 3DHYA 5KPJA 1GCAA 5JDCC 5AKYA 5LDGA 4R5MA 4YO8A 3KOWA 2QYSA 2QM0A 3WI7A 1GLGA 3MZ0A 4NK4A 3F2VA 2PMFA 4ND6A 4WMLA 4CMBA 5D7BA 3G02A 5EAIA 2YXPX 2CE2X 2J6IA 1SKAA 1W5TA 5DTRA 1L8OA 4WFQA 4IUCS 4MZDA 1W2GA 2C0CA 4UW9A 3RTEA 2GXQA 4FSHA 1NHGA 1DMRA 3K53A 2Q2QA 4Z6KA 1WXFA 2LCQA 1P4RA 5BV2P 5KJFA 1WPQA 1NNLA 1JLMA 1U8CB 4WSOA 3BCHA 3DAOA 3PIDA 1YI0A 2W2KB 4M55A 3AU8A 1LXCA 4GBMA 3GCGA 3I83A 1N34B 2HWWA 4B17A 3AL2A 3EZ7A 3FZEA 3PKIA 1YIOA 3Q3CA 5DHAA 2FWBA 5EVCA 3ZHOA 4XD7A 1QM5A 2CLLB 1DOHA 3HKDA 4CQNA 2Z1NA 4LHSA 4LV6A 4DPLA 1L5HB 3D8BA 3K2EA 3FCAA 4L4YA 2PVCA 3NV9A 3WL8A 3BAZA 4MVJD 2TMKA 2ASEA 4Q3EA 5JBIA 3ZDFA 3KEQA 5CX1B 4DA0A 5LZ4A 1TCBA 3NAZA 1JUDA 1I1NA 2PMKA 1FNSA 4LOJA 1VL8A 3L82B 2CC2A 1DBVO 4OKIA 1HDXA 2Z3WA 3ABSB 1G5RA 1ZMRA 1T24A 3E0QA 2HPHA 1L5ZA 3VYVA 5JALA 1CERA 4KPEC 3VJMA 5SYAA 1DZ3A 2WF9A 3PDIB 2D13A 3U3DA 5F9MA 4QDZA 2E48A 4AMZA 4O4IA 4RTMA 4DWJA 2EKQA 3GEBA 1PLLA 1BGWA 1JIUA 1GPYA 4LY9A 5GTDA 1AKEA 2W0SA 2G36A 3RBZA 5BMOA 5BV8A 5K4HA 1SKMA 1YKSA 4RF4A 1WPGA 5ENVA 2BF4A 2PUGA 1OFHA 2GNAA 2PS9A 2D2EA 2HRRA 2XADA 3IILA 1M67A 2J0SA 2PUJA 5JC1A 2EEPA 5BN5A 1V6CA 3LCJA 4XSVA 3OIGA 4GKVA 2ZATA 3DZBA 1ZIYA 3WX0A 1UKVY 4OSPA 4PONA 3GU3A 1Y82A 2B3TA 4B5LA 4WL0A 4XEUA 4DCTA 3U44A 7YASA 1KIAA 5DWVA 1XLWA 4ISBA 2NZ2A 3RRBA 1NFQA 1BZYA 1US8B 4ZCIA 4ZGWA 1KFKB 2WFLB 1XZ8A 2CSXA 3FNEA 3QSYA 1WEKA 4MGYR 1G38A 1VYHA 4LPSA 4Q0MA 4OGGA 5AW0A 4OLAA 1JHVA 1NT4A 4E5VA 1XCMA 5ALPA 2ZB8A 3ZGYA 5HYVA 4B0OA 5B3JA 9LDBA 4K81B 2OB2A 3OQOA 4KSBA 2QU7A 3RJTA 3SHVA 2NV2B 3HCEA 3KVOA 5DI3B 4LVUA 1R2QA 3LXXA 2XE7A 1J25A 4MQUA 2XA2A 3HDYA 1K98A 4DNXA 2OPBA 3RG8A 2GD0A 1XU4A 3A37A 3ASUA 3M6UA 4GYWA 5U4XA 5DI9A 4CF4A 1CJTC 2H31A 3TZHA 1DAPA 4EPRA 4ZEVA 4MS4A 5ITWA 4I6EA 2XYPA 1E4YA 4PF1A 4REMA 4BECA 1NVWQ 2PXAA 3DMPA 2ZRJA 3NG1A 2ZSAA 4R31A 4KV7A 4MUNA 3E5MA 3I12A 1B6GA 2BW0A 3GRRA 3HJFA 4OAOA 1EHYA 3H4IA 3UCXA 1FXWA 3FPKA 3V5NA 1RAFA 2A7XA 4MCIA 4TS9A 3RADC 5TQ0B 3GGJA 3U6BA 5JBQA 1X80A 1CUIA 4RY0A 1L5FA 2PRKA 1OI7A 3JD2A 4DSZA 3HDHA 1V0JA 2R6HA 3AUXA 5EP4A 1GPNA 5J9FA 1EUCB 5GZ3A 2BMDA 1ZNWA 3H19A 5U1PA 1YWGO 3T3GA 1UXKA 3FX2A 1Q7GA 1EK2A 4HGRA 1ACMA 4I8IA 1LS6A 1SURA 1TUBA 2NTVA 3QOXA 5IBQA 3HUTA 3UTCA 3V4FA 1CR2A 3ZW7A 1IG3A 4TTJA 2FXVA 4G3XA 2O05A 1QIHA 4YCAA 1MAHA 2RGWA 2FPWA 3G2IA 3ZD8A 2ZI7A 5F23A 4D25A 1JQBA 1ML3A 2UUOA 4M9CA 4OP2A 2W6CX 3BSFA 3TW8A 5FR2A 2VNIA 3DLPX 1OFUX 4XPIA 5TVKA 4YRLA 4NBLA 4G1BA 3H2GA 2G07A 5I7SA 3ZZMA 1EXVA 2R6CA 1T6ZA 5CU7A 2WQ6A 2DFKB 3KR0A 1YZKA 1W34A 3UWPA 1TM2A 5M2QA 3CRZA 1UFKA 1GPKA 2A35A 2OWDA 1PUXA 1M2HA 1TI7A 4HNUA 2PSHA 5E4TA 2VO1A 2Z8ZA 3MRXA 4YUZA 1G6KA 5DNYB 3QUBA 1RE1A 4WFJA 2OYSA 3CNEA 4A5OA 2DOKA 4WGGA 2P3LA 5H7XA 5ICGA 4XYMA 2XSZA 2XQGA 2NGRA 1AGPA 3EBOA 4J3JA 2O7SA 2NSLA 3ZBPA 3CLUD 1U7OA 3TIIA 5JFGA 4C04A 1C1HA 1PL7A 2VN8A 5ALNA 1MDFA 2FPKA 2P3OA 4MPPA 1FQKA 1RXUA 3FHLA 3ND6A 1G5FA 3TZLA 3WRVA 1E0DA 3ZCTA 3JYHA 4IVNA 1Z13A 3JAKB 1SD1A 4HQLA 3VU9A 2QJRA 1RMQA 1XNJA 4ZCSA 3BCRA 3AETB 3D7SA 3FSRA 2ORYA 1M0TA 4QBHA 2WIGA 2PAAA 4YRJA 2P9HA 3T3EA 1E9BA 2J0UB 1NXPA 4GPAA 1M33A 5E6UA 2BYTA 1QDEA 5TMPA 2ZCJA 1YCHA 3T9EA 8LDHA 5AKXA 4ZMRA 5AW4A 1YR8A 4LJYA 3PV0A 4CZ2A 5AK3A 1IG0A 2BKXA 2IJGX 4B73A 2O54A 1KXZA 1DQRA 3R75A 2IBSA 3LFTA 3IP1A 2CLHB 5TE9A 1P2DA 3ZD9A 4BL5A 2BDUA 3PFWO 3G8YA 5CITA 2R7NA 3HABA 4BVJA 4DHWA 1XLTC 2M32A 2XZTA 3A10A 4RXUA 1B1CA 1Z0JA 4HNSA 2A0UA 1G1AA 1IEVA 4I1IA 4NYMQ 5DHSA 1DARA 1TL7C 1UPAA 3JS5A 4M0EA 3RVQA 4H4EA 5LQSA 3ZDRA 3QIAA 4Z1MD 1QRDA 2PVSA 5D84A 3TCNA 4RFSA 2QU8A 1YQEA 3Q87B 4PX3A 1CXZA 1NTRA 1YI8A 1X8LA 4I55B 3GUHA 3DSRA 3C7CB 3S68A 4ALKA 3VA7A 1DFHA 4KNYA 3PLRA 4EA8A 4D02A 4ZDIA 2OKCA 3O4HA 2I78A 3G1TA 5K8VA 1HR0B 4BJ6A 1JFLA 2H1RA 1UBKS 2RB5A 2E6UX 3TPCA 4BNNA 3KXPA 3TQRA 1D2MA 1VLHA 4B3CA 1IVYA 1ENYA 3S8EA 1BN6A 1LBSA 4KFRA 1XDGA 2XNKA 3NTUA 4QFBA 1SCQA 2FW1A 2MHCA 3H1TA 4GVLA 3F5FA 3MTIA 4OYYA 5J4VA 2O2XA 3MFYA 1YZTA 5F7JA 4C20A 1CFJA 1KJNA 2WWRA 2P4SA 2DWQA 1GRCA 3A1DA 3H11B 3K0BA 3PF9A 4IIBA 1G1MA 4CIVA 2WF8A 1W9MA 1UIMA 5EXTA 3E9RA 5E6SA 1INLA 3M5DA 4DCPA 2AVNA 2EX1A 2RK6A 3C70A 3MUOA 3ON5A 5JCJA 1YA6A 1DKLA 2ZIXA 4UM5A 1I5EA 3LWZA 1POXA 2QE6A 1NPYA 1ZN2A 4TWAA 1YL7A 3SC4A 4Z9XA 5AVVA 3OM1A 4IMJB 5AI8A 1B15A 2OXEA 1SNYA 4ZU1X 3DFUA 6REQA 5IC5A 4EPXA 1P2VA 5JS1A 3BCUA 5H16A 1TF7A 3T6KA 3TOXA 1RJ9B 2VZ9A 4WAUA 1K8YB 1GT6A 2SHKA 4U5QA 1CQPA 3BFVA 4TQ9A 3SEZA 3TZ6A 1NUHA 4DDWA 4ZMSA 1IE3A 3GFVA 1XKTA 4B6EA 3IP9A 4HWTA 4RSMA 1JPNA 2SCUB 2F9LA 1JR2A 2ZRHA 3AHEA 3K0CA 4BO3A 3W5AA 2XDAA 1DO0A 1U1DA 3URMA 4C2AA 2WR8A 4NWIA 4X6YA 4RIGA 2ZYWX 1WHSB 2DH5A 2NAFA 3WWDA 3PNVA 3CUSA 5C35A 4JSRA 1W0CA 4B6JA 2EL9A 3LTEA 3NJ4A 3O8NA 2HV9A 5AH0A 5LVAA 4WXPA 2EP5A 3NBZC 4Q3LA 1FJHA 3WGQA 2ZI4A 2E37A 4AKHA 2VP2A 4GKAA 1N8NA 4R6WA 2CJYA 3NC1C 1N6NA 4QREA 3RANA 5C1PA 1EWRA 2Z0MA 4Y8VA 2WJAA 1FUUA 4V0NA 5HRCA 2WLTA 5EWJA 3PYLA 2XYHA 2QGZA 4LC9A 5K3EA 1GGJA 1CB0A 2XIQA 1L4LA 4HK4A 4AMYA 4RH3A 1Z2NX 5DLDA 3HS3A 1AZLA 4DG8A 1U3TA 1Y7TA 3BMNB 1XPUA 1ELOA 2BLLA 1DELA 4EG3A 3K0EA 2QLNA 4DEVA 3I9NA 3TTUA 5LIPA 1A1SA 1EFCA 2WA1A 3CT6A 4L76A 3A04A 2X2EA 3B1YA 3NWOA 1Z3CA 5FTMA 3FTDA 3NBMA 4HMOA 4JB2A 2IXGA 2GN1A 4MHOA 3G5AA 1H85A 4WZBE 3OM8A 3NANA 3PFCA 4UCWA 5KVAA 4KXWA 4ETIA 4EYSA 2OCYC 4FN5A 6AT1A 5D3QA 4EI7A 3A9CA 1V8BA 3B3FA 4CM4A 2P7HA 1B8NA 3JQCA 5D7NA 1VL2A 2EWWA 1TK3A 2GM9A 1T1GA 1U0FA 3IR7A 2CB0A 2IXAA 2X40A 3AEUA 3CKMA 4ZQFA 4CIWA 3EGEA 4OXIA 1PFGA 1PJ2A 2EKDA 4EF6A 1RYFA 2HA4A 4B6OA 5B57C 2A1UA 2ODNA 2VP6A 4BBAA 2HYDA 4TMVA 4B6FA 2WIAA 4LJKA 2X5OA 4GPZA 1UEIA 4YDRA 4EEXA 2JIZD 1MNAA 1JEYA 4BEJA 1MP0A 3CX3A 4EKEA 1QHXA 1KI6B 1E3TA 1V39A 1Y34E 4LF7B 3WWOA 4MOWA 3B78A 5H80A 2Q3HA 4GHWA 4G6ZA 4QG7A 3IPRA 1B8OA 4LTDA 2CV2A 1N0IA 1KARA 2VRNA 4Y6QA 3FCUB 1VMDA 2IYQA 1QQBA 4DKXA 2ORIA 3AVPA 3SSNA 1Y8QB 3WK9A 3A1NA 3P9KA 4Q47A 1Y37A 4BQIA 1QRSA 1H4QA 3TXYA 2FV8A 2Y0DA 3ICWA 1WHTB 3EXEA 3RARA 3K9QO 1G8YA 2KSQA 2VAMA 3SKYA 4UJ5A 2QVCA 4DDHA 4ZYXA 5DBFA 1KP9A 2RGDA 3CRMA 2ADMA 2WRZA 2EYQA 2AB0A 3ZGNA 3SHTA 2JAUA 4CPDA 5KWEA 3AOEA 3LSTA 2PUHA 1YNOA 2O7RA 3A6GA 5DFAA 1XAJA 2PL3A 4G1MB 2C97A 2ZUBA 1VBFA 4KX3A 4MB6A 2FZWA 5KOIA 4W5NA 1XEFA 1Z88A 4XZ3A 3VV2A 2QV7A 1WETA 1E5XA 2WWFA 4CIDA 4CQMA 2XNCA 2ZTUA 3BJEA 4S1WA 3ZWMA 3CLRC 2XKKA 4NV1A 4JUBA 4CKBA 2XVYA 4PRLA 1E1CB 4BNVA 4EHIA 3COSA 3ZW8A 3CTPA 3H17A 3E9NA 3K1YA 3KV3O 4X97A 1YTUA 4LNHA 4O02B 4GT1A 1NXSA 4OM7A 2JK1A 4F3YA 3BD9A 5JVDA 1E89A 4DIKA 3ZZ0A 5UKDA 1PF7E 4UBOA 3CLKA 3GRYA 5ITSA 1S96A 1QIGA 2VJQA 2ZDHA 2QD1A 4OOEA 3TRFA 5A1TA 5B58C 2C96A 3C3AA 1TO1E 2OFPA 1UBTS 4ARUA 5LWQA 2Q3BA 4ZZ2A 1W4LA 2H07A 4GI1A 1USIA 2PYIA 3LPDA 4W5HA 1FQOA 1QOPB 4JT2A 2G1AA 1L6RA 3R6GA 1QC5A 2FFHA 1GXSB 1N5RA 2QT1A 4Q4DA 2FJ0A 2ZYTX 3KPVA 4GMGA 1DXQA 5HKBA 2BCGY 5F21A 1P0IA 3AF1A 4F3NA 3AEYA 2OPHA 3AOGA 3T1HB 4P84A 4MW7A 5AT1A 3SXUB 4N8EA 2IEYA 4G67A 3LQQA 1OX5A 4B79A 3DVAB 3IR6A 3SHWA 2GK3A 4C4TA 5JZ9A 2YKGA 3ECSA 2WICA 3K72B 4TT3D 3V9AA 5JHHB 1VSTA 1ZNQO 1BQEA 3SJBA 2ATIA 1E1DA 3OJLA 1CQWA 2WOOA 2VAWA 5AKLA 2F2TA 3D8UA 1NF9A 1FUEA 2GJ8A 3DEFA 3QFCA 4JU9A 3KG2A 1VDMA 4HNQA 5AK4A 3MMZA 2XQFA 2PRZA 4FB4A 5D1NA 1TNDA 2GM4A 3DLHA 3L4BA 5FR1A 1TJPB 1KPHA 4MRNA 2A4MA 3DOIA 4RJ2A 3S28A 3SOZA 4DHEA 2RHTA 3G0HA 1N1MA 2HD4A 2WJPA 3MWEB 4XJVA 4Z4QA 1Z0ZA 1NR7A 1VPVA 3D4PA 4O08A 2BEUA 2OM2A 1N3LA 5DXFA 4L07A 4J2TA 1SXQA 3ZDEA 1Z6QA 4P32A 4YUXA 4ZOCA 5KSYA 3MUEA 1RYBA 3LVFO 4LXGA 2WTEA 4AULA 2H4JA 4RZUA 1DKUA 3DOHA 4S3MA 5BW8A 4TLMB 1YMQA 3INYA 4Q05A 2AXEA 4TTSA 4BPRA 3K32A 1G5QA 5EEHA 5HK8A 3JWIA 1UMDA 3NTLA 4JLUA 4QJ4A 1YD7A 2DMRA 1M10A 5LBUA 1NHWA 4TL9A 4F5YA 1CEEA 3ZV7A 1HK7A 3PPYA 1T4CB 1M73E 1YDWA 5G1NA 5A7FA 4BIIA 3LUFA 1N5MA 3ANNA 2TMGA 3G2HA 3MCAA 3PC4A 1GU0A 3AL3A 4RMIA 4DY4A 3VI3B 2I4NA 3REQA 4LRYA 1PUJA 3ZHQA 2D06A 3JQ8B 3BZWA 4UVDA 4BVFA 4CHGA 4B74A 3EAQA 4C3UA 4E07A 1KI8A 1Q0SA 3Q9SA 4QOIA 2WV7A 2DFDA 3P9XA 1P5FA 1PL6A 1JPVA 3QF7A 4GI3A 1O0BA 3CKKA 3DTVB 3G2NA 1AKYA 2GCOB 3OZCA 2JCVA 2F4VB 2FGKA 4NCIA 3GJQA 3MA0A 3ZDQA 5AQEA 1RAAA 1CZUA 1L4GA 1RM4A 1W5AA 3FTNA 3MMPA 3VC7A 4RKFA 1Q7RA 3LDUA 4M1YA 1VTKA 3LY8A 3V2GA 4A10A 2LUOA 1MH1A 2VA8A 5H4HA 2WZDA 2IV2X 3CX6A 2N9UA 2WP0A 4QECA 4C78A 3IUPA 5JFOA 3WOVA 2UU9B 3S2YA 3HL0A 1DZIA 1ZINA 1G66A 3H5LA 4XQEA 3OQIB 5ALFA 2ZKLA 4FT4A 3WMRA 4OJQA 5JXJA 1FTQA 2PPLA 4ZIRB 2XXAB 3RYIA 4IQ8A 2HCFA 1DTWA 3AP3A 2AC4A 3OTGA 1XKXA 4ISCA 1Z5VA 2GCIA 3RSGA 4QWWA 4BKRA 3OPYB 1HEYA 3ZV5A 3NM6B 3MTBA 2WK1A 4DUZB 2YN2A 4KQHA 3HB5X 4PSAA 5LXTA 3OTOB 3MW8A 2VTBB 4RVGA 4WNCA 2QUHA 2GBFA 4IEIA 3TWOA 3OZXA 1OQAA 1W88B 3R6DA 4JJFA 5KTKA 3DBRA 4DV5B 2HU2A 1C3XA 3CW8X 4YJKA 3X1XA 3G7SA 2WSBA 3PHHA 1YS4A 3M4NA 1GUBA 1Z5OA 2EYUA 2O2CA 2P0EA 2FMFA 4KSYA 5FWYA 2XBMA 5IAJA 5TB5A 3DAPA 4HGQA 2VDWB 2AWOA 1KMHA 2HLDD 3ND8A 1QU3A 1T8RA 1F4PA 4LUCA 4YI5A 4E5PA 4XOIA 3JWHA 1AUVA 2FR8C 2DPMA 1WMFA 1F6WA 1BDMA 1F2TA 1NBMA 4MWOA 5J2TF 4BFWA 4IJ5A 1B8VA 1SHLA 2FMUA 2JFOA 1D7OA 1BEEA 2XRMA 4AZ3A 1WZIA 1H9AA 2EL7A 4Z0TA 2LV8A 2PFSA 4AUEA 2W43A 2NVWA 3UB4A 2Z2JA 2XUJA 4LXYA 3N2KB 5IVIA 4OHBA 1GTJ1 3L0PA 2ZJ8A 4UVEA 4EF5A 3MTAA 1L7RA 3FE2A 1OIWA 1MC4A 4B7CA 4F4DA 4CLXA 4B2YA 2ZXFA 2BHLA 3DR3A 3P0RA 4PZPA 4IP0A 2I1QA 3E5NA 1G8AA 3MC1A 5EE3A 1U3GA 1R4NB 4UAJA 4A73A 2ZI5A 3RFCA 2PZBA 4R83A 1H1LB 1SCAA 5JD3A 4CQMD 4QUKA 3BGDA 1UODA 3QKTA 2OORC 1QGDA 1I1QB 1EVLA 4K40A 4WCVA 4ZTZB 4JUFA 1N5DA 4HTFB 3PGMA 3FY4A 1NYRA 2V9CA 3P0IA 1X86B 4DQKA 3D64A 1LSSA 2DETA 1WMSA 3QP9A 4E46A 4FW8A 3SS8A 5CPBA 3AEXA 1XU9A 3KTFA 4R3WA 3IPLA 3WYAA 2BGWA 4B3BA 1CULC 1K8ZB 4K5QA 4AN0A 5BPHA 1RC1A 3WNBA 1RRFA 2CNDA 1EG7A 4TSKA 4X20B 1TJNA 4DSNA 1BVYF 4ZJUA 1PNTA 2GN0A 1I14A 1JEYB 2IYUA 4BN5A 5JJKA 1FEZA 4PZ9A 5EYPA 2VOEA 2J3EA 2RKWA 1FNNA 2DX7A 2VNKA 1Y1QA 2WD8A 3QEJA 4MVJH 4KSCA 1FU4A 4CQLB 3CNLA 1XGKA 4YJFA 2GN2A 2VRWA 3KQNA 3C7KA 1FFWA 2J85A 1RQ2A 1C3OA 2QD2A 4QPDA 1QGOA 1KVSA 3DUWA 2C8JA 2DTDA 3K15A 3TAUA 1U2TA 1WHTA 1UQRA 2J9FB 3KR9A 2WKWA 2W37A 3KB2A 3E0XA 3P9SA 3P9QA 1XMVA 4PGGA 1RI2A 3VR2A 1B14A 3GEEA 4MR8B 3HM9A 2OBNA 3QF4A 1G5PA 3DFMA 4K8OA 2QTCA 1QRRA 3S70A 1LDMA 1GAWA 2OP1A 1S2MA 4KWTA 2ZRPA 3GFBA 2PZFA 3E70C 4BNWA 4ABTA 3D1LA 1YK0A 2VPYA 1PLKA 2H2IA 1W49A 1H5QA 3QELB 2RGBA 4C3ZA 5CTAA 2C78A 3I2HA 2X5XA 1P5JA 3TSOA 3C6XA 4JJAA 1N3IA 3PD0A 4REQA 2XGGA 1UBGA 3BZBA 3GLGB 4A5SA 1YRWA 4GX0A 3KJZA 4IJUA 3A28A 3OIFA 2HPAA 4Z4HA 5IAOA 2V6MA 1LGYA 3V2UA 4C03A 4BFTA 2Q4DA 2PBZA 3BRCA 4OF4A 1LDYA 3QFTA 4I6JA 3ZWVA 2VCYA 3GR6A 3GYGA 3WBBA 2PY6A 4XJSA 1E7MA 2OENG 1Y8QA 4LXTA 2R65A 4CMJA 4S24A 1IXZA 3A26A 3TZEA 4OB6A 4FHCA 1XDUA 3MG9A 4L3VA 1MQAA 4YT2A 4ZV4A 3PZRA 2JLUA 4LZAA 1T6NA 2HU7A 4P86A 2BFAA 5JNRA 2J5QA 2ZW9A 1RQNA 2E1PA 2WAXA 2WB4A 4DRXB 1P31A 1V3TA 2HNBA 4IGEA 5FYQA 1CPYA 2C1XA 5GONF 1T5LA 3W7VA 3CB2A 4WZ6A 4ZO8A 2ZUWA 4IXNA 3UT5B 2CJFA 4ZJPA 2ZI3A 2I4OA 4H7JA 3SBOA 1UBJS 1NFFA 2WYUA 4AO8A 4DDKA 5HKLA 1Z7YA 3GRUA 3PK0A 1RLTA 3KU4A 3WGYA 4H35A 2IYRA 1BC5A 2HNKA 1O95D 2HQBA 4FIZA 3W3AA 1GDTA 2GRJA 4TXNA 5ENZA 3CUEF 4NOKA 3GGPA 4US0R 3TEMA 3NBQA 1WWKA 2MT9A 3LY9A 3P9IA 3Q5GA 3ROEA 4UDYX 3WO0A 2Z43A 4HP8A 4G1EB 1OGYA 1GEEA 1X0XA 3PNBA 5LP6C 1KZYC 3GP3A 3MFQA 1A7AA 1JWBB 2C83A 3G3EA 3S5JA 3ZDBA 4IIHA 4F84A 2H00A 2HQOA 3HADA 4IIXA 3GLIA 4HEA6 1ZX1A 2WAAA 2Q29A 2BHSA 2ZJ6A 4GX5A 3D8TA 3HU1A 1ZRMA 2AOUA 4LV5B 3KEFA 3PA8A 2ZU6A 3HL4A 5IXSA 4PYNA 3K70B 2V7BA 2WUDA 1B3BA 2QT9A 4R7ZA 4GOMD 2OXIA 4EGSA 2GJSA 1B7GO 1YCGA 1AGRA 2BCEA 2CXXA 5JNTA 2QR3A 4GIBA 1NBMD 3GOQA 1QRUA 4IMPA 2HF7A 1YS6A 4Q03A 3LOUA 1A95A 2IXBA 2P3SA 1OTXA 4JYMA 2WSYB 3QVXA 3NB0A 4YP1A 5AVKA 3RC1A 3CONA 4YC7A 5BRNA 2H9IA 4R1NA 4DIDA 4LBWA 3RS2A 5JZOA 1QVRA 4PYJA 4O0LA 1TU0A 4C9BA 4IV0A 5K8CA 5MGBA 5KI6A 1NBAA 1GTSA 4KU4A 3T7SA 3D3WA 1H8HA 1ZCZA 3D3JA 1A5ZA 1AKVA 2GM5A 2WAOA 5AR1A 5KTRA 3WK6A 3L6RA 4M8IA 4QO8A 1CD5A 1JEAA 4FMCB 4XX1A 1L1FA 4CYMA 2XQIA 2ZJ3A 1MQ9A 1XL0A 4J1TA 5T8KA 2J0UA 5E6UB 2WUGA 3ISVA 3UWKA 4B3DA 4D6YA 4PRKA 4P7KA 4S1PA 3GLHE 1CLUA 3JZMA 1WDTA 5CVCA 2J7PA 3C3DA 3NH9A 2C42A 3A31A 3NKLA 4LYEA 4P0TA 4PINA 4F8EA 3VOAA 3I37X 1WCIA 2PMCA 5DI3A 2A88A 4TPKA 3EXFB 3EA4A 1OH6A 4CDRA 3PXDA 5KKNB 4NBVA 4CM3A 1B73A 1L5RA 5AW6A 1ESEA 2P0YA 2Y92A 2X3FA 3O82A 4EO4A 4DA4A 2CJWB 3RAJA 3B85A 4BJ5A 2WTNA 3F4BA 2WC1A 3RNOA 3CGWA 1G3MA 3BFKA 5FO1A 6NULA 1NQOA 1X1DA 1XX6A 1ZUNB 2ZJ5A 3P2MA 3PCRB 2F3QA 4O1IA 1HOXA 2H0RA 3HCPA 2Q5OA 4EMBA 1ITZA 2NT4A 1AKNA 1L3IA 1FCJA 1Z0DA 2D0DA 4I6GA 3PNKA 4URYR 5JWHA 3G0BA 3F49S 3RHSA 4AZ3B 4RD1A 4OJKA 4CM6A 3HCDA 3DXXA 3K1TA 1ZL0A 4UE6A 3O5AA 1PR4A 3EOAI 3N8KA 3E3AA 4I4CA 1D8AA 4JD5A 3OMXA 4LWOA 1ZHHA 2IV7A 2IIBA 3TW6A 3QTBA 1VSBA 5BYAA 1EUCA 1OBCA 1Z34A 3Q2IA 1D0IA 1XIVA 4LFAB 1JMVA 1QB7A 3TB4A 5C7IO 2BFOA 5JAHA 4RKYA 4QE3A 4DCCA 1OROA 4R05A 2DPGA 3GMTA 5HJ5A 1TTPB 2G5GX 1HNZB 2AOWA 1ZGAA 4N49A 4R6XA 5JPDA 3ZE7A 5F5LA 3LL4A 3ZHXA 2XNHA 2B61A 2GX6A 3R24A 3AI2A 3UGKA 3TGPA 1DTWB 2BFWA 2ZYIA 4UBIA 2HLPA 3UQYS 2REOA 1W96A 2IS1A 1N2BA 2QG6A 3O2JA 3DV0B 3OQIA 1NVMB 2PKRA 3DD5A 1I4LD 4IKOA 2YXBA 3ETHA 4IJWA 5JTTA 1G21E 1XLTA 5DM4A 1B8PA 5PGMA 4U00A 4JT4A 3EMDA 4F0JA 4E70A 4DR6B 4RE5A 4R7TA 4D8VA 4XOUA 1DC5A 3W5VA 4C08A 1VGQA 1LPSA 2ZR7A 3LM8A 1MX9A 1WZNA 4MI9A 2P9TA 5SZIA 3E8SA 2GK7A 4LOIA 2OD9A 3HCAA 3P5SA 1Z7WA 1XVVA 2HGSA 1P1FA 3D3WB 2YDYA 3IUYA 3O83A 1YJXA 2P2NA 3R09A 4OG2A 1X7XA 3GG9A 2EGHA 4YP6A 1P5RA 2BJVA 4CXMA 3AVUA 3LK6A 3A4LA 2IXFA 3GV0A 3HLTA 4JI1B 3AFHA 5LQDA 5D5HA 1A71A 1EVKA 3ESZA 1J0CA 3WFZA 4EG4A 4IZIA 3C3EA 4XYBA 1YR2A 2OOSA 3C7AA 1US8A 4O25A 2INGX 1W4BA 2PX5A 5P8WA 5A2QA 4Q1BA 3FPBA 1DS6A 2BBTA 3EQ8A 4HTAA 4JY7A 3MCTA 3KP1A 3W2HA 4AF7A 1T2EA 2BWJA 2PKWA 2CWWA 4M6WB 1YFJA 4PNHA 5BSHA 4EG8A 1KAHA 2YHSA 3K0AB 2RE8A 1DIBA 4Q9NA 2DULA 3NMUF 1I2CA 1D2EA 3R5SA 5ETJA 3L0SA 2FKNA 3QPCA 3QOYA 2QR2A 4BNJA 2GN9A 5GINE 1AQ6A 4WZAA 4P7JA 4D45A 4FILA 4ZVUA 4BZZA 3K6SA 2AJDA 4WECA 4YRBA 1FJGB 4PBTA 4FKMA 1P7ZA 1YZUA 4YXWA 2YWBA 4C0LA 1VIAA 4E1AA 4RNCA 3ZU4A 5LQKA 5C4MA 3EDRA 3U81A 1Y5MA 1YB2A 4K9LA 3D7LA 4TT8A 3UUFA 3ZDZB 1Y4UA 3C5HA 2BCJQ 5I7RA 4GFDA 2GBLA 1XLUA 4Y9UA 5A0FA 2QR5A 4B6PA 4KRGA 1YDFA 3IAM6 2Y77A 2A0FA 3UMCA 3ER8A 2ZRGA 4I4TA 4BCDA 4KACA 1YQQA 4RNDB 5BO5A 5CDFE 2JW5A 5BVHA 2NV0A 1C30B 1Z4MA 2CV0A 1C9JA 1REQA 4QPJC 2VXBA 3D6NB 4JL8A 1U0SY 1PSDA 4QARA 4B4KA 1BE0A 1L1RA 1OBHA 1P39A 3DOFA 4MARA 5DEIA 4F2DA 3OIDA 4GKBA 1P29A 4LJ7A 3NJRA 5BWMA 4I9UA 2WG2A 5TNXA 5CBPA 3HN7A 4EARA 3MBOA 4M38A 4BNGA 2I2FA 4LJAA 2DT8A 3KKMA 4FOPA 3T1QA 4BFYA 3TVDA 4DY6A 2B2XA 5IULC 2XYGA 4ATNA 1GFIA 1DBPA 1GZVA 1KJJA 1YBMA 2F1IA 3W1VA 2X4DA 3EXHB 2WKQA 1Z63A 5DNWA 3CNNA 1W8DA 2D8AA 3TQSA 4OX9B 4U6SA 4IRUB 3QFHA 3V8MA 3GW8A 2VF7A 3F4LA 4HZUB 2FSIA 4GWKA 4ZIRA 4X7RA 1JB9A 2HK9A 1U80A 4GM4A 3CNHA 3BGOS 2BR5A 3EVCA 5BW4A 4GYKA 4XVHA 1XAGA 4TYPA 2FPPA 3C8MA 2IGBA 1TEHA 3WXMA 2CFIA 5KNBA 3UVEA 3QV2A 3SM3A 2FOLA 4TSFA 2RJNA 1X7YA 3IT0A 4DIEA 1IHUA 3P1JA 4GG1A 3K0FA 3ABIA 4GBGA 1YRAA 1H6BA 3V8NA 1BMQA 3D6HA 3MWLA 4BUZA 1S2LA 1XD2B 3UK6A 3IS3A 1JX6A 1LPAB 2R11A 4FS3A 2OECA 3K2QA 3LLUA 5F78A 1V47A 1HI9A 4YJ3F 1HDGO 3UC5A 1QHNA 1Q1BA 4PG6A 3RBAA 1C7IA 4TV8A 1FPQA 4OM8A 1U7PA 4TTPA 2QUKA 1YJ8A 4NDAA 5AP9A 3BULA 1N0UA 3RT9A 1TA4A 3IESA 2GZ2A 2YWFA 1CIPA 4JP2A 3F6SA 3GEDA 3IBTA 1JLHA 3S2EA 4EVRA 4FYPA 2WWTA 2XMBA 2Y1OA 5FTJA 2QN3A 1V8PA 1YJQA 3QI7A 4J75A 1OR8A 2IGTA 2ZROA 4V02A 1TJYA 4ND8B 3ZH2A 3M6XA 4M7OA 4AMUA 1DINA 5K45A 2XMSA 2A5GA 5HKKD 5DHQA 4TKZA 2JZOA 3T94A 2XTAA 5EXDA 3Q85A 3CVXA 4O2BB 5TJHA 3O38A 3T95A 2GCNA 2A7QA 2R25B 4DMGA 3QUQA 3W9SA 3ONWA 2MDTA 1ENOA 1XVTA 3I9LA 3A2LA 3ODPA 1W0KD 1ZI8A 2WT9A 3EDQA 1QUEA 1WABA 2OBFA 4FMCF 3HBMA 2PS3A 1EWKA 2QTRA 5D3ZA 1JR3A 2WE8A 4DLZA 1EHCA 1SXJE 3AKYA 3R76A 3CXUA 2GEBA 3FN4A 2VYCA 3IBFA 3NU1A 2R4QA 4IDNA 4JMLA 2ZJ2A 1KJ8A 4ZVKA 3RT1A 5EIBC 4BRSA 5EESA 1G2PA 3U13A 2V7PA 3U17A 1IXKA 2XZOA 1CVRA 3STTA 1T8WA 5BUZA 1GA6A 2AUMA 2PS1A 5K0FA 3OECA 1GQRA 2GYUA 2X0NA 4DT1B 4A6EA 3AVTA