3ABOB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and ethanolamine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
b'ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 73
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3aboB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aboB02
3ANYB 3ABQB 3AO0B 3ABRB 3ABOB 3ABSB
chains in the Genus database with same CATH superfamily
2BM1A 1HSMA 1EJ2A 3DMTA 3QE2A 4O4LB 4QVKA 3VNUA 2WILA 3WGQA 4YRNA 1ZKDA 3EJWA 4K8RB 1A8HA 1G8KA 1BCRA 1LRLA 3KZKA 1CJVC 2BE7A 4B7XA 1YQDA 3HXLA 4GDMA 1SVWA 4O5OA 4B3FX 5CT8A 1FFHA 2KWIA 2WUDA 1ZJ4A 1KZGB 1DRJA 3HBLA 4O5AA 4BZPA 1L6IA 2G28A 2H3EA 4Q15A 4YV2A 3FTCA 2ZBVA 4IEIA 4TVBA 3FXAA 2C97A 5CEEA 1HFKA 5GADl 1GLGA 1P77A 1TO2E 2MSEB 5I7WA 1RJWA 4F1KA 3GT7A 2X13A 4HC4A 2RHMA 2IZ0A 3AB3A 4HGQA 4H4CA 5LSAA 1EDBA 3L7MA 2H1VA 1RJEA 4EDFA 5I8ZA 4G0OA 3ZCTA 2HNBA 1GNQA 4QD3A 1D4AA 3LIPA 3LW8A 4KDCA 3T99A 2PL3A 5ALQA 4DLLA 1PJAA 1PK9A 3W0LB 3DKPA 1Z22A 5EWMB 3UWDA 4BMDA 2ZSBA 4B71A 4AP9A 4ETIA 2J9FB 4YRAA 4DY4A 1Z5NA 2TMDA 4XVQA 5DWQA 4TXMA 2B1RA 3CE6A 5K3EA 1NF3A 2RGWA 2QAGB 2RH9B 3DCIA 4NZYA 5AM2A 4K9RA 4RF4A 1XMXA 2BN4A 2FR1A 1F2VA 5KOHA 2FU5C 1TQ4A 1H94A 1VPTA 4JOBA 1G66A 2WFLA 3JZIA 2CCGA 1KR5A 4YTEA 5DGTA 1QVWA 2VH5R 2W71A 2PAFA 3E1KA 3N6XA 4KHZA 5EWJA 4KHPB 2WNIA 2GN4A 2XAAA 2A84A 2NSDA 3IUBA 3GJ6A 3NJ4A 5ESXA 5TQJA 2OV6A 2UUPA 4QG3A 2QV7A 4OYYA 3ML1A 1N4DA 3QKRA 2R8RA 3AJEA 2FRDA 4YJGB 2O19A 4MTCA 2OGWA 3TIXB 1PT9A 5T8KA 2DEUA 3DZIA 2P91A 2SICE 4Q4JB 4GMGA 4K6GA 4UHBA 1MO3A 3E5RA 4IIUA 1LJUA 1WULS 1FQJA 4ZCSA 3ESDA 1U28C 1W4CA 4UZFA 1EFAA 3QKWA 4HADA 1NA5A 1HYQA 2Q8NA 3FGNA 1LVUA 2QL5A 2W2PA 3K0BA 4Q1VA 4OA5A 2P77A 5ILGA 1N9ZA 5HDQA 1P0PA 3DHNA 3MEQA 5JD3A 5BNTA 2QIPA 1ZXBA 3EC2A 3WDKA 4IJUA 3TAUA 3TW4A 4LZLA 5J23A 1HK7A 1QH1A 2H7YA 4QBHA 2EWMA 5JAPA 3CKLA 2FDRA 2D2IA 5LYJF 1HSNA 2CVHA 4JJZA 1GWNA 3KZNA 3P9IA 4REQB 1OH8A 3H9QA 3SZMA 1K6EA 1TUEA 3CLTD 4GQBA 5IDQA 2YASA 2D0DA 2DH6A 1RTTA 4OQ4A 4MUHA 3JAWB 4Z9FA 3NHFA 3FBWA 4MR7B 1E2NA 1SWVA 4L0DA 4QSMA 5CJJA 4UTVA 1HOXA 1J7KA 1TZMA 4WBNA 3LRXA 4A36A 3EZLA 5JS6A 4X45A 4OHOA 1AB6A 1J22A 2EL7A 2WUVA 2XXJA 3DNPA 3GBVA 4OFXA 4R83A 4BO3A 5CXUA 5LUAA 5TR9A 4N9QA 4P3XA 1ZQ9A 2Q3BA 3FH0A 3CO5A 2DHEA 4HTAA 4WE3A 4C4XA 4DF3A 4FDVA 4L9WA 2OESA 1RKVA 4Y1EA 3BMQA 1L4MA 3REOA 5L3VA 3R74A 1PLLA 1CS4C 4NZ9A 1J25A 1JJVA 2CK3A 4ROTA 2RGRA 5D8DA 3NMUF 1KZYC 2X3FA 4PLVA 2JEYA 3WYBA 1D2CA 1TZKA 1P4HA 1E6CA 2LNDA 5E2IA 5FPTA 3UPUA 1S6YA 3GQBB 2XJ4A 1W59A 1H5NA 1RRFA 2DTDA 4AAYA 1IY8A 4TLLB 2ZYVX 3OT5A 3U4DA 4Q3EA 4H3KB 3MCWA 3WADA 1YV9A 4B17A 3OKPA 4LMRA 4MJ7A 2RKBA 5DO9A 2ZB3A 3P9CA 2TYSB 2ZB7A 3DMFA 4GR4A 5IJ9B 1DV1A 5EJ9A 1WY5A 4UBOA 4DUGD 4L8WB 4J0EA 4GVXA 1OLXA 2A1UB 4JFAA 5DLPA 5K45A 1H2AS 1ONBA 2DFNA 3KAKA 3LTEA 4RZIA 1HZZA 1O6GA 4RO0A 1XVAA 1U8FO 1ZCBA 3I6YA 4LK2A 1ZIPA 4NATA 1XDGA 3WBBA 4FWIB 2BH9A 3RSZA 1QPBA 1G20B 3E4DA 4OQFA 1HETA 5HGXA 2GD6A 4XPZA 1UDRA 2Q5OA 5EA2A 4IJ6A 2YWFA 1R9MA 2CZCA 3F47A 2YHIA 1M73E 4L8FA 2R8ZA 3QWIA 4YMHA 3HCAA 3C74A 4QT4A 2W6IA 2A0XA 4QJ5A 1J56A 3ETGA 4PZYA 4L2IB 2PGOA 2Z8YM 4GPEA 4QJ4A 2C00A 4EITA 4M55A 4O4IF 5B2FA 3WL7A 1SZCA 3K8OE 4B3JA 5KQPA 4WDQA 1MC1A 1GNLA 3C3YA 4MXDA 4NK4A 3FNEA 4G37A 1NURA 1YIAA 4ZV9A 4KQEA 1IJEA 4QRHA 1Z26A 4G5GA 3O82A 3UYLA 4LQ4A 5EP4A 3IUYA 1SK9A 2YN0A 1IHDA 1C7JA 1LLFA 4M8LA 3B2EA 4DQDA 2NUAA 4WL0A 5KNCD 2RHHA 1L4UA 3EEBA 2O0MA 3TD9A 3WGLA 4YJ3B 5TJ9A 2BEVB 1DXHA 4NU5A 4X93A 4PPFA 5JALA 3AR6A 1TM5E 3BD8A 2ZT7A 1YQQA 3P2YA 4RQBA 4O02B 4BGUA 2R1VA 3DC2A 2YWHA 1XF9A 4JCCA 3GC6A 3IXQA 2HUPA 4Q02A 4K6FA 3CLSD 1HSZA 5FOWA 3SR3A 3I9OA 4DGSA 2UU9B 4RYDA 3A9RA 1E8MA 2IEIA 4LSGA 4CTJA 1C1HA 1KY5A 4MMYB 4XB6B 3A6PC 3OLYA 1GPDG 1R1DA 2ZYGA 3RVJA 3AKYA 3HEAA 3A6EA 2VP0A 1J4AA 1QIEA 5A5GA 3KL4A 1A97A 3LUAA 3TIVA 1R4ZA 2R9VA 3WRYA 5ALXA 1Y8AA 2AMYA 5FNVF 4NQRA 2CDRA 1JBEA 4JVMA 1R2QA 2O8DB 2BISA 1EVJA 4FFLA 3UM9A 1U0OC 2P3LA 3MINB 3KU4A 4PYMA 4KLCA 4O6VA 2ZUVA 3VH2A 4NJMB 4UVHA 4N01A 2QPLA 2YN2A 3AEUA 4RZHA 5C46F 1MNAA 1U7WA 1FMJA 4AUEA 4CKEB 5ALVA 4FC7A 2C04A 5KTTA 3LNTA 3BIWA 5BSRA 3VJKA 3NRJA 2XQJA 3MELA 5IJ0B 3F73A 2BKXA 5JTTA 5KU1A 4DJDC 1IXYA 1RQLA 1ZC4A 2D1FA 1GNRA 1HFEL 1EUCB 2BI4A 1L0BA 2KLBA 3GLRA 4WD3A 2PX6A 4G0NA 3T3GA 1JJAA 5DYWA 3AB7A 1K7FB 1HFWA 3QIAA 1GOTA 1Y3IA 1UQRA 2Z4SA 1GPKA 4NQZA 3VV2A 1SN7A 2Q99A 4N18A 4JEUA 4OXRA 4UHCA 3GGCA 1BG6A 1OAOA 2CLCX 4BVLA 3SSAA 1JHOA 4OXQA 5HKLA 5IXYA 1OLUB 3DOOA 4MH0R 3PHJA 3K5WA 1M1NB 1G16A 1SXJA 3DOIA 4CT0A 2ZTMA 3ZCRA 4YA6A 4LFBB 1DJPA 2GM3A 4YUYA 1DX9A 4PO9A 1N2ZA 1U0FA 1EUZA 1G19A 2B4RO 2P5YA 1JIQA 4IJMA 1UBOS 2RI0A 4Z3DA 2HA7A 2OD2A 1X7WA 4XSVA 2NZXA 4RE6A 2ZQZA 2ADOA 3K0CC 1FBNA 1NW3A 1GNTA 2NTEA 3EIHA 2JH8A 2ZUDA 3SC6A 3UAVA 4E3WA 3TSWA 1U9JA 2PKYX 2O9JA 3D7MA 5DHTA 1CFZA 1KI3A 1XAIA 3R7FA 4C9BA 1U8XX 1O7JA 3TJRA 4D5GA 3GJ5A 4EVRA 3EK2A 4HDNA 5KYWB 5INTA 4U7GA 2RB4A 1E79A 2ZWVA 4PYNA 4KAAA 2LEFA 2Q5IA 4PGAA 2BMDA 1AKTA 1WV1A 3FYUC 4K9SA 1YBHA 3AHFA 3CRNA 5B1YA 2OQIA 4TTSA 1ISMA 4IUCS 3QI2A 1SBYA 1YD7A 5AI6A 3ENVA 4KL8S 4RA9A 5GV8A 1DMSA 2NN3C 4WFKA 2I76A 3M70A 3RROA 1GV0A 2QRNA 6CHYA 5DXAA 3NIWA 2CJXA 1NHWA 2CL6X 2PX3A 3DBIA 4KBGA 5JY1A 2HHHB 2Q1TA 1O2DA 2HPVA 5G3YA 2WHPB 3MGCA 3EBLA 3U44B 2VDRB 4MINA 3GP3A 3ILXA 3HKEA 3SKYA 1E3WB 3D02A 3DUFB 5JH7F 3ZXUB 3OQNA 2QW0X 3D8BA 3T6KA 3UC9A 4HRAA 3CEJA 3UXHA 3VVBA 4F60A 2RH5A 1RHJA 3GZNB 4C7VA 3FLBA 3HVJA 2X0IA 4QLOA 1C9EA 2ZEJA 3EGXB 5EHIA 1QH8A 2PH5A 3EVCA 1BKYA 2P2GA 2B36A 1T1RA 2NLOA 3N58A 2MYPA 3IHLA 3QVLA 1U90A 4KYUA 3VOSA 1NFQA 1U3WA 2NG1A 4WK0B 4QEKA 5CDHA 1CW2B 3AEKB 2CUTA 3EYWA 3WB0A 3B1FA 2R00A 4HZUB 2HHCA 3VUFA 4CM8A 5LDHA 5BO5A 2V9CA 4N54A 4TRNA 2IKQA 4ES6A 1XXLA 2AJDA 2P40A 2P7HA 1S3FA 3DBOB 5CFPA 3KCQA 5EPUA 1VECA 2PNFA 3HKCB 1U31A 2V3WA 2Y1DA 4C21A 2F64A 2LXNA 3ASZA 3QOWA 4F12A 3C8MA 4J2OA 4BCBA 2VT7A 4MA4A 1R0XA 3NRBA 2XIQA 4I5GA 3MLEA 4LDJA 1QOZA 4ND2A 1W8IA 4RABA 3ZWVA 3HEMA 5JSZA 4NI5A 2AK2A 4JENA 2XUKA 5EZ5A 3ABOB 3KD3A 2BELA 3GDHA 1T2EA 2A7QA 4GQIA 4HN4B 1JEAA 4S35A 1GPNA 1OPXA 3SF0A 1N9GA 1RQPA 2J33A 3CLRC 3T54A 5EHNA 1ZIOA 4MPJA 4BKOA 1RJDA 5C52B 2FQWA 3BMNA 3WMGA 3OIGA 3DDSA 4EHIA 3DF9A 3D8HA 3N3BC 4BCDA 4CKWA 3HU5A 4BEJA 3ZKWA 3FBTA 2GOYA 1JXMA 3CCBA 4U8HA 1Z18A 4MARA 4PLTA 4EA8A 5BUCA 4O25A 2WABA 2HU8A 1EFRA 1VZ2A 1C0EA 3MJDA 1WRBA 5FYQA 3PD0A 4IXMA 1QQ6A 4UMFA 1Z8DA 1DO0A 3VOAA 4PU0A 1JLRA 4HJRA 3IQZA 4ITVA 2FRDC 3N75A 3PITA 4WZBB 3V9PA 2V0GA 1EYZA 3GQVA 5T8KC 3CVUA 1NMEA 2XB8A 1AA9A 1E1CA 3ICVA 1JVSA 3RNOA 3VXKA 4DUYB 1YE3A 3MIIA 2ZB2A 3C39A 4M36A 1E7YA 1T5OA 1SCKA 2P9EA 5D5HA 5B1IA 2VEDA 3V8QA 1HT3A 1KE1A 4C4SA 1OXTA 2I6GA 3CURA 3HN7A 2GPBA 1UKYA 4IL5A 2OCIA 4NJEA 5JSKA 4C06A 5JPCA 4J75A 2KW5A 3ESYA 5FEMA 5GPBA 1LJ8A 1UXHA 2C9ZA 2C54A 1FJHA 4ZAWA 5EZYF 1Q1QA 1Q5PA 3ZDZB 5ENVA 2CXNA 4EG6A 2X8LA 1YRAA 3CF6R 4TKVB 1TCUA 5TQ0B 4EKYA 4GBED 1CY1A 2ZWIA 3H5AA 3F2VA 2P9YA 4G3XA 3TJZA 4L5BA 4OY3A 5FWDA 1WCV1 1YC2A 4HL6A 3EVBA 2V5UA 4Q1CA 3MJSA 3RAPR 4MV6A 3AKDA 5AKJA 1B8VA 1KMIY 1P1BA 4AZTA 3OOHA 3V6MA 1IHOA 3YASA 2WJAA 3ZHOA 1LA2A 5T3UA 3FSGA 3MAGA 1KVUA 1FS6A 3VKUA 2WYWA 3WTCA 3DJYA 2RSLA 4ARIA 3PNVA 1O4WA 3WLJA 5E9QA 1N2JA 1NI3A 3L0IB 4XRRA 4ZYYA 1L4FA 3THSA 1E59A 1ZZEA 4BQEA 2YWBA 3FZYA 3KT6A 2UYCA 3NBUA 2BD0A 3WDSA 2QQGA 2ORVA 2J85A 2Q62A 3LX6A 4IKOA 4Q4AA 4XLLA 4DXDA 2FSVC 4MRMB 1X1DA 1JMVA 3LWNA 1RLOA 2J4FA 1DDOA 2Y2VA 4QUGA 5FT9A 4F3CA 3DV0B 4XFDA 1ZGBA 4DNQA 3NM5A 5KX5F 3BWVA 2QR5A 2PM8A 1E9SA 1WZIA 3FG9A 3SXUB 4MUAA 2Y92A 2WYIA 5AH0A 1V7ZA 3ZY3A 4BYGA 4WUTA 1GU1A 1E2LA 5FOTA 1PU2A 1ZH0A 5T5QA 2FF7A 4O33A 2VDPB 5F2EA 1IEVA 1M1YE 3L7LA 3SHWA 2WPDA 5EJFA 2B4KA 3LY9A 1J7JA 1UK9A 3NW9A 1AF7A 3TLBA 3KTAB 1I80A 5LMUB 3IRVA 1UF9A 1O03A 3U39A 1HZZC 3X1JA 2VWHA 1EI9A 2Z4RA 1U7TA 5JARA 4N6OA 3WLNA 1NQTA 4KAJA 1TVMA 2W4MA 3FB1A 2WF6A 3LCRA 4QOGA 4RPHA 5EQTA 2ZRHA 4TXJA 4D4LA 1Y82A 4O8ZA 1IJBA 1SCNE 2BGJA 4G5OA 4UU8A 3O8RA 5HIJA 2QYOA 3IC5A 2O0LA 2VQ6A 3GROA 3BFVA 3C6BA 5SV2A 1Z2NX 4X8HA 1XA4A 4EI8A 4DV6B 3CX8A 1YMQA 2CMGA 3SIRA 4EZEA 2QP3A 3TLKA 4ETMA 3OZFA 2QSUA 2YOGA 3LUGA 4ZI7A 2PZJA 3IQGX 5TEWA 3ZDQA 1C3OA 5AK0A 1VG8A 2HB6A 1P2DA 2W6NA 2ZBEA 4LWZA 1OIWA 2WAOA 2P5SA 1UPBA 2QP4A 3TLAA 4LZNA 3FWYA 2YX1A 2PBFA 1CUAA 2B1GA 1HRKA 4US1R 2WQ7A 1UOOA 2NPOA 3PT5A 4MQ6A 2XNJA 3GU3A 2G9ZA 3I5AA 4QNMA 1IY2A 2C58A 2JFXA 4QGHA 4E2ZA 4MJXA 2QRMA 3BJZA 4KVZA 4CUZA 5IK2A 1CEXA 1FX0B 3EQ8A 1JFFB 2XHEA 1L7BA 5SZIA 3CVWA 1PT7A 1ZBDA 2OA0A 3MF4A 4IHQA 1NXSA 1TFUA 1V16A 1XRJA 4YQFA 1FNDA 2HXSA 5FO0A 3L9XA 4IVPA 2PYZA 3HTXA 2P3QA 3OEYA 5A5VA 2WAXA 3WI7A 2HMUA 2V4MA 3KE8A 5JISA 1KGSA 3H2SA 3VZBA 1KC3A 5JR3A 5DT2A 3SBXA 5JASA 3ZVMA 2YW2A 2AYZA 3LJKA 2PDAA 1Z75A 2VAVA 5AW3A 4RHUA 4WNAB 5E2AA 4LNAA 1P29A 5MDHA 4AY2A 1OT3A 1PJZA 2OLEA 1NE7A 1JEQA 3EA0A 4YPOA 4ZYLA 1EX6A 2RGBA 3WWCA 4KMOA 2AW5A 1ZRNA 2OBNA 2YWDA 4KQ1A 5FR2A 3VQTA 3WRYC 4A7PA 2XB2A 2BRUA 3HDQA 3CWZA 4KGVA 4MEJA 2BR4A 1JIVA 1PTJA 3AR9A 2OLKA 2EHDA 2IXBA 3HR4A 3IAHA 3IJEB 3AW9A 2DTEA 2O4CA 4N0PA 1L3BA 2EKLA 3L6OO 4H60A 5C2JB 1Z06A 3LKZA 1MOQA 3SZRA 2Q4EA 1F48A 1V3UA 1RAAA 2GETA 4ZARA 4O4HA 3N2GA 1L7OA 1F2TB 3ZDCA 2JAWA 4B4DA 1LU9A 2ZITA 2EFCB 4G5YA 5IU6A 1V5GA 2WW8A 3NBQA 1KVTA 2Y77A 2Q8PA 5IVIA 1L1RA 1MAHA 3A14A 1KMNA 2REQB 5DYIA 4YXFA 4BTLA 4INJA 3SYTA 2QTVB 2BCJQ 2N1MA 3GCDA 5BRAA 221PA 2AJLI 5JXJA 3CH6A 1HE2A 1U9CA 2RJNA 1PL0A 3FCXA 2A59A 1ZNZA 3OJEA 2BM0A 4WASA 1ADCA 3JYLA 5JCJD 4M6WB 5KNLA 2BYTA 3PX2A 1JDJA 2A9PA 4MVJF 4PSVA 1J9EA 3CBGA 3BH0A 1UP4A 1EWRA 4DTCA 4RZUA 1CR6A 1JKFA 4DVGA 3GLVA 3CMCO 4C6HA 1GKLA 3CYFA 1XYYA 4II3A 2G67A 4WSOA 5F23A 1ZVKA 5K3FB 3R5XA 4N0DA 2I29A 4OI1A 4GBGA 5BSGA 3I9MA 2HDOA 5I47A 1O89A 2A5LA 4HDRA 4LHVA 3G9ZA 4Q7JB 4D6PA 1GRVA 1LNZA 2WM2A 3L77A 3ZY5A 1E5LA 3WNQA 1Z6QA 2I4LA 1IVYA 3QY9A 3OX1A 1X92A 1H65A 3BVPA 4OKNA 4EK9A 1KSHA 4UJ3A 4W99A 4EQ6A 3E8SA 1U63A 5TQ2B 3NJRA 2R7NA 3AUSA 3AR4A 2YIDA 4HVTA 2BGGA 3RFCA 2HI0A 1XRMA 3C1AA 3P7MA 1G8FA 1LX6A 1K97A 1PW5A 1RAEA 2Q27A 4OGLA 1IWBB 4QUDA 4R2IA 2VHWA 2C5BA 2R87A 3WL8A 1Z0FA 2PV7A 3FPHA 2Z08A 4CIBA 2Q7DA 4FFBA 1IAQA 4BNGA 2JLWA 3L6UA 2Q4BA 5LP1A 4J1NA 2A14A 4EB3A 4EJSB 3RTEA 3JR3A 1X15A 2WMOB 4J0GA 4DQVA 2WR8A 3AMVA 4ZC8A 3LOQA 3T7RA 3W05A 2GBLA 1KQOA 3V4VB 2FR8C 3HVRA 2D0PB 5FULA 2ETXA 1M2VB 1VSUA 2IDMA 3FCUB 2VYVA 2A0WA 1N2HA 2O8FA 1F6DA 3NC0C 3SF8A 2NTJA 5LB2A 5I48A 3L02A 1K7EB 2R7AA 3C4QA 3U9SA 1S2NA 2HLPA 3T5PA 1CD5A 3Q3VA 4KW7A 1RS0A 4PG8A 2BMWA 2O0KA 4YONB 3G2PA 1OWMA 1DAEA 1Z35A 5K6RA 4P0PB 1FRQA 2R8BA 3ER8A 3DFZA 4GLBA 4S1NA 4XM2A 2ISCA 2WQZA 3K70C 1EVYA 3DEJA 1DWQA 4MB6A 4HBGA 4GX2A 3FCSB 2Z6AA 3CVJA 3RJ9A 3RLFA 1KYWA 2BDTA 4GUAA 5F9MA 1EJ0A 1JHVA 1Z39A 4H7PA 1TT7A 3DXYA 3PUWA 1F5NA 2H1WA 1OZ0A 4QDZA 2YYAA 3HC7A 5K1ZA 2FZGA 4B6EA 4DA8A 4D3FA 2E87A 4U63A 4MVXA 3N0XA 1BXRB 4CV1A 1T4GA 1WHSA 2QI9C 3IR5A 4BAGA 1QCCA 2AOVA 3IBSA 5JO9A 3DHWC 5DLDA 1EFUA 3K9FC 5IT9A 3OSZA 4RJTA 3RI3A 1GTL1 1QP0A 1Z4LA 3QUBA 2QVZX 2GM5A 4CF5A 4NZOA 5D3ZA 1GAEO 3S81A 1J97A 2PWPA 5BOSA 3PVSA 3NU1A 4S24A 2OCAA 1U6JA 4JDPA 1VXOA 1BD3A 3OMXA 1ZONA 4PXSA 4LOLA 1KDRA 2EFHB 4LMPA 1B16A 1YCFA 1XMJA 2IIPA 1YR3A 4P2BA 2OHGA 1NBAA 2QK4A 1IBLB 5F64A 4ZZ2A 1XMQB 3T5MA 1XF1A 2HAEA 3STWA 4O4LA 2GN0A 5FF9A 4HATA 3ECCA 4AMZA 2RHLA 3BHMA 2RBGA 1LQUA 3JYHA 5HKKD 1N2SA 3VSDA 4QE3A 3KHKA 3E7WA 1QP4A 3GGSA 1CDDA 1QZTA 3KT0A 1VFNA 1JMKC 3JVVA 2DBZA 3VU9B 2YY7A 5KJCA 4XI9A 5F33A 1L5GB 4J7UA 1MU0A 3GMTA 4L22A 2O8EA 2GM9A 1LDBA 1PJSA 3V32A 3ZWQA 1BQ3A 3B1ZA 3OIUA 4KXNA 4P82A 4YEDA 4MIKA 4RY2A 4ZCPA 2R47A 1N3YA 4XJVA 4B3HA 4D0LB 5KTPA 3R4CA 5C4GB 4BB9A 2QN6A 5JRZA 5AI5A 3M1LA 1XQXA 4OJNA 4Q7QA 5AESA 4Y9SA 4PX3A 4A6EA 5E0OA 3ABSB 3EF1A 1E2PA 5JD5A 1M2WA 1W75A 4B6RA 1D0IA 4LRYA 1RLMA 1O96A 1LWMA 2J9FA 2ZAYA 4P32A 3A36A 1IUKA 2ZIAA 1EVZA 3TIGA 1NXXA 3I2KA 3WJ7A 3E22A 3Q6NA 2PUDA 1ELOA 4TQGA 5E38A 1HQCA 1NY5A 4MWZA 1Z74A 2DR0A 3LQYA 1MW8X 2WWYA 2H2IA 2HJWA 2EF0A 3M7IA 3BE8A 1S1MA 1XRQA 2QD2A 2QVBA 4JZYA 4NY1A 2X5KO 3GYBA 3K4QA 1Z08A 2ZTVA 5DTJA 3N7TA 3QGMA 1CR1A 5BSMA 2EP7A 2R2GA 1TE2A 3ZWYA 4AF8A 2HR1A 2FOIA 5HMMA 2EXXA 2G88A 1XTPA 1L5WA 5AKXA 1Q0RA 3GDGA 3U16A 4MGEA 4QUHA 2JBHA 2LW7A 3EEFA 3GEGA 4F2HA 5JI3E 4TUYF 1YASA 1HFJA 2EFEB 5DCWA 4E4YA 2YY5A 5K8TA 3M5CA 5EZSA 4R98A 5DBEX 4Q4JA 3LHKA 1DCFA 4BNYA 2WD7B 1ORWA 2OG1A 4DUGA 3AF6A 3FOAA 1E3SA 2L18A 4MA0A 1W34A 3DBVO 1EM6A 4B44A 4ESHA 4IHJF 1HE4A 5EMLA 1TU0A 1G8PA 2Y27A 1HE8B 2FMHA 2IIQA 4BBAA 4CF3A 1JFVA 3ZW8A 1WZUA 3F49S 5TJHA 2CXOA 3HCPA 4PZ0A 2XUOA 3B51X 4NU0A 3V8VA 3DHYA 4UQLA 2NZVG 3VVMA 4IM7A 4MDEA 1WD5A 1MDBA 2GBFA 5DX1A 1PR4A 2GXSA 5JSHA 1B0PA 1QTRA 2H51A 5AJVB 5EKXA 4QXPA 1L5SA 1KYZA 2YXLA 4QT0A 1K6JA 5AW1A 4KRXA 3KEGA 3CRVA 3L43A 3HJAA 5AJHA 5CYOA 4Q19A 3TKLA 3UF0A 4BIIA 1N92A 5AVOA 3JQPA 3EAQA 3MOIA 4GGMX 3D3JA 4NBUA 4Y60C 1NVVR 1QHXA 2GF9A 4EVQA 4HB4A 5D1NA 4KKVA 1JJ7A 1YJ8A 1RHMA 2DPGA 5CMLA 3TNDA 4DV2B 2ZJFA 1T8TA 1UDWA 3PF9A 4PZAA 2PSDA 3KYDA 1JI3A 3LPNA 4EL0A 5KC8A 3T1OA 4HDMA 3TG2A 3A6HA 2XGMA 5KNCA 3OPVA 1QHSA 1QVVA 3M5PA 3VJLA 1J2RA 4D9MA 5LMZA 5EXTA 1E2DA 4C2UA 4PCLA 4M1QA 2WIGA 3D7SA 2IW1A 4QLBA 1R4NA 1FP2A 1MHPA 3C8DA 2EWWA 3JY6A 4L4YA 3TQOA 3ZQJA 4EW3A 1VBMA 5LBTA 3WP0A 5BWOA 4BO9A 3GQBA 5IAEA 4BQOA 5AK6A 3WRXC 1KOGA 1TJ5A 4EHFA 4JYMA 4X60A 2PJZA 1VGRA 1PWXA 2VPIA 4NV3A 3I83A 3KJXA 4NJOA 4EL5A 3OT1A 1EVLA 1JDBB 2OBLA 4Z2AA 4DMUB 2UUBB 5BV8A 1FX1A 2KB0A 2A1UA 3FW1A 3GDFA 2GZRA 3OECA 4GMXA 2NU9A 2DBRA 4QGGA 4DRXB 2JB9A 4PAGA 4O3FA 5CEFA 2QQFA 3CZMA 3IIEA 4FMBB 4MK4A 5H80A 1BOOA 2I3BA 1E6LA 3VKVA 4EPXA 5BV1A 2OT3B 5CK5A 4JBHA 3SR0A 2DBYA 3F71A 3I9FA 3A4VA 3D4NA 1G20A 3A9VA 1NHGA 1HTTA 3L1JA 1R7RA 1Z7WA 3TQIA 3BSFA 2R8EA 1JLSA 4GPIB 5AHOA 5LNK6 4QQRA 3LL7A 4U2DA 5JJLA 4RKFA 4QYTA 1U9IC 4J90A 4NK5A 2WZBA 1AM4D 1B00A 2ZS7A 3NATA 4CM4B 4B09A 2BSQA 2BRUC 2V6MA 4AI6A 4C7BA 3GG9A 4B4WA 1P3JA 2P90A 4L2IA 4ECEA 1PAUA 4MW0A 5DCYA 2PS9A 3HVKA 3C3XA 3D2AA 2WC1A 3KTFA 4I99A 4JEIA 5A4IS 2ECOA 2GZDA 3VYWA 3MWDB 1MVLA 1DO8A 2R84A 4FBGA 2VUHB 2EZ4A 1HDXA 3E5MA 3MRTA 5ALTA 1BHO1 3E81A 2CYBA 4XYLA 3WNBA 2EYUA 2RHGB 1DX6A 1UINA 4HAIA 1NXQA 1GZVA 4YJ3A 2BEVA 2GZMA 2F1OA 3ZGOA 5TT1A 2EZUA 4MWDA 1SPXA 2FN7A 4IIEA 5KIAA 2WRZA 4C07A 1XEXB 3NYWA 4RJIA 2O2CA 1NQVA 4TV9A 4IQ4A 3JASA 1KO5A 2FJPA 4R7ZA 4TYMA 2YWJA 3EW7A 5HUJA 2H92A 3P0HA 3F6YA 4AMGA 4FWTA 1NV8A 3I04A 1QB7A 2E4UA 4K9KA 3PFNA 3P9RA 1I11A 4UAUA 1FFYA 4TMYA 4RUKA 1CZLA 2I62A 2WMNB 5J2TA 2ZSFA 2ASEA 1KEKA 2PQ2A 1QFXA 2HHAA 4UW9A 3DM9B 1Z36A 3BZBA 4A73A 3QUSA 2DB3A 4C4TA 2ZIZA 5GZ6A 2O8DA 1BXZA 4YC7A 1ZD2P 4CQJA 3EWIA 3QSGA 4HAYA 1QRTA 4WUVA 2QRLA 2QLMA 4X1YB 5AIAA 2GYYA 2QD4A 4IF4A 4BYMA 5KZMB 1R8YA 2Z83A 4NJMA 3IUSA 4ESEA 2JGJA 1WDLA 3KDAA 4BY9E 5GM2A 1W25A 1CWUA 3T41A 3EUFA 4CKEA 2D4HA 1GSIA 1Y6QA 1OXVA 2GASA 5KDLA 5BYJA 1FFBA 1NVKA 1R8JA 3LUJA 3MLBA 4P7FA 3O8LA 2Z8ZA 2CF5A 3IAXA 4ZQGA 1AQJA 1K7XB 3JQ6A 1D3AA 5M34A 3GA7A 3K72B 2GAOA 4RTPA 3I32A 4ZANA 4EO9A 3G1TA 3O7MA 4M1MA 1Z0AA 3N7AA 3GNSA 4E5SA 2C4VA 3VVLA 4D79A 3GUCA 1C7EA 2B5VA 2Y0CA 1USKA 2ID4A 3CZAA 4IJVA 5DCLA 5KVCA 2X2EA 3GFPA 4MV0A 1M1NA 1DPGA 1KSFX 2Z2KA 1W1UA 3Q8XB 5F5LA 2JGIA 4TLDA 1THZA 1W4LA 3OIVA 5JPDA 3GEMA 1Z68A 4M9UA 4PR0A 1JI0A 1V6CA 3LC7O 4V0QA 3TFOA 3W4KA 2SCUB 5AO9A 1SQ0A 2HU7A 1XJWA 5FI1B 4BLUA 4I4CA 3INNA 4IOKA 1A8QA 1RE0A 5D5PA 1LC3A 4DBLE 3C6QA 2VHQA 5HJEA 1NTOA 5FPSA 2NPIA 3ES9A 3LVQE 2FP4A 1NXOA 3IS3A 2ZUSA 5J1TB 1M8GA 4D9FA 4IDHA 1JKMA 1RBZA 3GFOA 2FVXA 3SQXA 5I9TA 3S40A 3UC5A 5F7OA 1WCYA 4E11A 2YUIA 3P5SA 2BHLA 2NZ2A 3CX7A 4ZQEA 3SHVA 3DDWA 4URZR 5DW3A 1VJCA 1SVMA 4FQ7A 3OH8A 5HK9A 5IT0A 1NUPA 3CIOA 5DNYB 1PJ8A 3EQ9A 4FGJA 3R9IA 5HE8A 1T0IA 3DZFA 1NJ6A 1XVVA 5KYYA 1JE1A 4Y9DA 5THXA 1E5XA 1ESNA 4Q37A 1I7DA 3L79A 1QCZA 5EAIA 3TH5A 4V2IA 4RVCA 4A0GA 1FFWA 3R7WB 3VC7A 4B31A 4IV0A 3M6WA 4W5JA 1CR2A 2X8BA 3PDIB 3Q9SA 2GZAA 3FLEA 4RCVA 2P9CA 5ALLA 1U7ZA 2LCFA 1O8BA 5CXSA 1LPBB 2AVDA 1V0JA 3DUFA 1RWVA 4ZCLA 3ZV4A 3SVLA 5G1NA 1N34B 1QMGA 2HFJA 2O6HA 3D64A 5SZHB 5EQDA 3FPLA 5AVUA 4C7MA 4RH3A 2AEJA 2WHRA 1U4NA 2MSDB 3M81A 4OQMA 2RK6A 3TXYA 2QMYA 2C7RA 4LVCA 5LQDA 3FCAA 4BMCA 2PGLA 4ZODA 1V7QA 4PLZA 4BU1A 3IULA 2VPTA 1CETA 1R4MB 3KYCA 4JLKA 3WDLA 5JW6A 3JQDA 5K3BA 1AQ6A 2NVBA 3DFUA 2EVWX 3JYPA 3V1MA 1GEGA 4RK7A 3VNSA 1L8AA 1SKAA 3AEKA 5K6AC 1DKUA 3GJXC 4MZDA 3A6KA 4HVCA 1VYTA 1ZI8A 5CT5A 2BFFB 2E4AA 4JI1B 4BVBA 2AQIA 4HYEA 4MRPA 4YMGA 1AHNA 2R7LA 4Q9AA 4CZ2A 3VKHA 1V95A 2R79A 4LJKA 3KLMX 1Y8CA 3MMNA 3T4PA 3WWPA 2J45A 4KZKA 4JT8A 4NZMA 3TLMA 3HKCA 5CUQA 1ZFNA 3FNFA 5I9NA 1I33A 1WXQA 3EPJA 3CLTC 2WPNA 3CA8A 4LXHA 1FDRA 4D4KA 2WIKA 2YR0A 4UPVA 2ZDGA 4YMUA 5L7TA 3E8MA 3C7AA 1LF0A 1TL7C 3NHYA 4XXHA 4QBKA 1JNXX 1UC8A 4IGEA 4FFMA 3SXPA 1ZUWA 5CCBA 5ARCA 4GVPA 3IRUA 3K2EA 5LDDC 3KAJA 3JRNA 4GRAA 3HYRA 2PUFA 1FBTA 1XA3A 2QAGC 1Q22A 1KI9A 4O2AB 1S8OA 5DI3B 5DOZA 2QWXA 4HAXA 4YWHA 2ZIXA 3M3DA 1XZJA 6LDHA 5AW0A 1LSUA 1WJGA 3BWYA 4CU5A 2EP8A 3A58B 3HCOA 1TTQB 3RODA 3VSBA 5DLYA 3AHIA 1B1AA 1GUBA 2V0CA 2YWEA 1E7RA 3FRJA 4YAJA 4ZQFA 1VP9A 4K1LA 3AG5A 3M4YA 4QYXA 3L7DA 1NT2A 2GMWA 3W9UA 1XHFA 2I3DA 3G9UA 3HY3A 4ZEVA 3Q12A 3DWEX 1V2GA 2Q3JA 4DW8A 5CVTA 1T0HB 2HU5A 2Q4OA 3CR7A 1TQ6A 3O8BA 2DTXA 3T9FA 2IXAA 4KN6A 3HXMA 3I9V1 2PA3A 1NR1A 2SNIE 4TWJA 2RC5A 4HHEA 1Z3CA 1OYOA 3M6UA 3UPDA 1IXRC 3G2JA 2C4WA 1CDZA 3BILA 2VP4A 5ARBA 1XPRA 4YRJA 1WQ3A 4A0QA 3IGFA 3BMCA 1M72A 2QN8A 4BNMA 4C0HA 4J07A 4UVEA 2YHUA 3R5HA 4BMYA 4UTNA 2FWJA 5CB4B 2BC9A 1OXMA 3SU8A 4O8CA 2QP9X 2ZRDA 4ZT6A 2VZ0A 3ZD6A 1A8SA 1ZUHA 1Y6RA 4DY6A 3PZBA 4NS1A 4O1HA 5ADHA 2VDNB 1P80A 1UMCB 2YXPX 2GEKA 3LUKA 3Q8MA 1AZWA 2V5VA 4W8OA 2QN1A 2PLRA 3OJFA 1JU9A 3OO1A 5JXGA 2HIGA 5KC9A 5LQMA 2AC4A 3AK4A 3B38A 2R1UA 5CH5A 4F2GA 1F9AA 2VNIA 1QJCA 3QVWA 4IIJA 3ZBQA 1VYHA 2X5JO 2ZU0C 1GRQA 4UM8B 3FHTA 3AVTA 1ULSA 2ODQA 1J2UA 4F4HA 3P2IA 1D0VA 1VLMA 3TUIC 1BA3A 5H8WA 3H05A 2QLJA 3WJ1A 4BNZA 5REQB 3GGJA 1KMHB 4AJEA 1D03A 2X86A 3FD8A 4KLNA 2MWMA 1OI7A 2DM6A 2I22A 2XOKD 1T10A 4GP7A 1USWA 2QUZA 4MRMA 2RGAA 2X2OA 1DX4A 1JT9A 4KOAA 1N5KA 4PC7A 5IVHA 3PEUA 4TKUB 1WE2A 2QDKA 3EF0A 2XUJA 3LLCA 1U80A 3DV0A 4K03A 3JQEA 3JYNA 3PHCA 4Y30A 3MAJA 4B5LA 1QU2A 3C6KA 3OCZA 4KQ2A 4X71A 3CLSC 1PFKA 2ZANA 4TRRA 1J0XO 4U2EA 1KQNA 2AWNA 2OKGA 4ECAA 5FPKA 4FR0A 2CNKA 3EE6A 2BGLA 5GAJA 2J9ZB 4Y3UA 5M2QA 1SCUB 1DJOA 1GAQA 3A1DA 5EE3A 4U2CA 1PP4A 2Q1XA 3KTAA 1U3GA 1GKUB 2X76A 1Q16A 2VZ9A 3P9SA 4FYHA 2ZSKA 4YMIA 2ON6A 4TZTA 2GR9A 1ONOA 1C9KA 2W6PA 1OILA 4L07A 2B94A 4CFYA 4FYJA 1SEVA 3VR1A 4IINA 4Q24A 3HFRA 3ZLBA 5BXYA 1ACJA 2AG6A 4N5IX 4BEBA 1ZESA 1QZXA 4P7GA 1NVFA 1FFAA 2IT1A 4IILA 3KSUA 2NV6A 2G71A 5K99A 3GRAA 1EGQA 5T4BA 1FZTA 1ETUA 3FYHA 3W2IA 3CGGA 2GHRA 5FI3A 3F74A 1I6LA 1IQ0A 1CE8B 2PD6A 2VH1A 4OP2A 3HCNA 1JYSA 1OTYA 2JCGA 3G13A 1VKOA 4IRMA 4Q7MB 2C82A 4HDAA 3AI2A 1FNCA 4B4UA 4DVJA 1TA4A 4L50A 2NPFA 1OJLA 4WV3A 3O8OB 3QFSA 3SMQA 1HEIA 2PT6A 3PNMA 4YGYA 3BZWA 4PYIA 3JVIA 5ALWA 2D5IA 4JXJA 3BRCA 3WYAA 1E77A 1EDOA 2HLHA 5HHTA 1EX1A 3LM8A 3MWGA 4FSXA 1Z0UA 3ZDYB 4PGGA 3PJRA 1T2VA 3O4GA 4AQ7A 1JFFA 3B1KA 4GS5A 4MVJI 1X14A 1RM5A 3LDAA 1DCMA 4MUEA 1SVLA 3UPTA 1EQUA 1NJGA 4CG1A 3GARA 4YECA 3QNUA 3T34A 1MKYA 2IZ6A 3FMVA 3AHDA 3MJFA 3QQPA 3EXFB 5JCJA 3GLHB 4GM1A 5C7OO 1OI4A 1UZLA 2LD4A 1EH5A 4TXLA 1KFKB 1NJFA 4Q3AA 4N7BA 4HH0A 3DH0A 3JWIA 2I6SA 3R0IA 5JI2E 2QNRA 1AURA 3ESAA 4FUTA 5FRDA 1A9PA 5SZKB 4LOIA 1G4AE 5TLSA 1T2NA 1Z3IX 3AM4A 4KK4A 3JD0A 5C1PA 3W90A 1RMYA 2RC6A 4I5EA 5G53C 5KNCH 1DIGA 2TMYA 3I6MA 1XPUA 4CVNA 3RYCB 4F11A 2CV1A 1N5OX 1TJNA 3PFGA 4DWVA 2PFGA 3PDWA 2WVHA 4HQRA 4BV8A 4LTNA 2X9LA 4JFRA 2QI9F 3IPRA 1DC5A 2R11A 3EVGA 4H16A 4UATA 3TZBA 1RRKA 2EAUA 3NO4A 4YCSA 1II9A 3L0SA 3O9VA 1IBSA 4Q4CA 1ESEA 1VDMA 1ENOA 1VGQA 3IPAA 3NH6A 3GN2A 3K4HA 2IYEA 3TOSA 4IIFA 1JKIA 5AM1A 1WXWA 3G0GA 1EXVA 4DSNA 4ZCIA 1CZKA 2EDCA 1JG6A 1ORTA 3PWTA 4YVFA 1N1EA 4LG1A 3TZEA 1X8LA 1YFZA 1E3MA 1I7LA 3T35A 3OFSA 3VDXA 4AFNA 4X8LA 2VS1A 1TZBA 1M7HA 1Y3FE 3NYQA 4NCJA 4HNSA 1X39A 4EW2A 5A9RA 5GZ3A 3ZV7A 5IWCA 1NBOA 1P5HA 1SXGA 4G4SP 2QRVB 4B3XA 1DJQA 4OGKA 4B0PA 2REQA 1EBUA 1LW7A 1ICEA 3G23A 4BKQA 3FTEA 2XGJA 2QTVA 2XRMA 2XTZA 2P7IA 5LBIA 3FRIA 5JUWA 4L5JA 1B93A 1FRZA 1HMYA 2PU7A 4LPKA 2B78A 3W5VA 2I91A 5DASA 1QIDA 1XEAA 2VWGA 4REOA 5KPJA 2I67A 3KZOA 4XOUA 2ACEA 4IMPA 1FJGB 1BAPA 3NWEA 2H9YA 1XZKA 3OY2A 1YVEI 4PX2A 2V8BA 1BH6A 3L0ZA 5FWYA 2A0YA 2OB2A 1XNRB 4KPGA 5E3JA 3R8CA 1F2DA 3SQLA 3VAYA 4MWSA 5DM60 1KPGA 2OMKA 2AJBA 3RBAA 2P6UA 4KIGA 4LYEA 3N86A 1OB5A 1J2JA 1XSEA 3DXFA 4PZLA 2C99A 4X00A 3FKQA 1SKYB 1XWWA 3ZHRA 4WJKB 2FFBA 3TM4A 2NW6A 1CJMA 3GA0A 4HDCA 3L4BA 1QE5A 3JATB 3PEEA 1QGZA 2Z43A 3HEBA 2O5VA 2I4IA 1US8B 3FUUA 3IUEA 4DV0B 1KJYA 3C5VA 2ODTX 1H2RS 5TQ2A 4AY5A 3NCHA 1PW7A 3RC1A 2EGHA 2B4TO 3GIWA 4QSHA 2CUNA 5ALYA 5FYDA 3ZQ6A 3QV1A 1TYCA 2ZWOA 3OZUA 4Y9RA 3HR7A 3WK6A 1AC5A 2YC2C 2JJMA 3IXMA 4MR8B 3T1VA 2HA5A 3FOWA 1L5HB 1X8JA 3IAAA 1VBFA 1WXGA 2RHBA 4JOSA 5DN6A 3AJ8A 2VAPA 4AJ9A 1F60A 4OVKA 4MVCA 2VSXA 4BTVA 2QROA 3V8NA 4EJSA 1CZHA 1XX6A 1H9BA 4MV5A 1D2EA 2WIDA 3E3OA 1AQNA 4AMUA 4D57A 2J0EA 2G6TA 2I8LA 1W5AA 1WSDA 2YV1A 4GM4A 1RWQA 2OCLA 2ODEA 1M2VA 5ALIA 2GCNA 3WSVA 5LOVA 1X7ZB 1XTVA 1AA6A 4D6YA 5DPMA 3UAYA 1PL8A 4ZK6A 1U1DA 1DINA 5DGHA 3TVTA 5GOZA 1M1YA 4BX0A 1DELA 4ZKDA 4B9AA 4R3WA 3HWSA 3F96A 3AFIA 3SBDA 1ORIA 3TQCA 3X43A 5HX7A 5BSVA 4Y2JA 2FJ0A 4AVYA 5THKA 2C0PA 1ZGJA 3AEQB 3IQIX 2JH9A 3PTZA 5IBRA 1X9IA 1RYMA 2BCEA 4CMIB 2KE5A 3MTGA 3CSDA 4I9UA 2ZTUA 4TKLA 1Y37A 2QG9A 3HS3A 3KB1A 5BNWA 5AOBA 2E82A 1CJTC 4W5WA 4YAFA 1YUBA 4EZIA 3NX4A 1GDTA 4F06A 4Z6KA 2IHTA 3C3PA 1UAAA 3IFSA 1QOQB 2A5GA 1NN5A 1NVVQ 1CZRA 5C1DA 1KO1A 2RI6A 2FSGA 2YTZA 3L7NA 4K6MA 1ZR4A 3P19A 5EP2A 2OCPA 4OLJA 4CQLB 4COOA 4E07A 4NULA 5HIAA 1ISRA 4XGNA 1L6RA 1A0OA 2GDZA 1TD1A 2M6KA 1YJCA 5C8ZA 4RIEA 1F38A 1T5LA 4MP8A 4FFWA 4PZUA 1JN0A 2IPMA 2ZKLA 3UKJA 4F1JA 5J1SB 4DKJA 1GZ4A 3NZEA 4XWAA 2A4MA 2JCXA 3RRMA 2VBGA 3M6FA 3O9ZA 3CPHA 1A76A 4Q1BA 2PZFA 4H3SA 4W6QA 5D6NA 3LF1A 3TIFA 5J5AA 1QQ5A 3BEDA 2Q1SA 4IDCA 3C0KA 4L57A 4ENWA 2H29A 4RIFA 1XAGA 4GI5A 3L0CA 4XWKA 3DMPA 3HP4A 5EKSA 5GVSA 1EGAA 1Z0SA 3N76A 2J7PD 3ZHQA 3WZLA 1Z28A 4YAUA 3ZCQA 4AW9A 1KZ4A 1FB5A 3CUWA 4IMRA 5AHRA 5CFLA 2PVPA 1E3DA 4ZOAA 1UKVY 2V65A 1RAIA 2D1QA 1E4EB 1F14A 3D0OA 3F5MA 4I4TF 3S2YA 4DWJA 2FEAA 2HA6A 5EZQA 4Q6WA 2XOEA 1XXHB 3RPEA 1CUJA 4G8BA 4KMSA 4BLQA 3A1WA 1PR2A 3RE1A 3SJCA 3K2BA 1SQFA 3HVIA 2WSIA 4JELA 4ZTZB 4LECA 3QM1A 4QULA 1QKKA 1BRTA 2FZEA 1O94D 1J5NA 3ZGZA 3UMFA 2GRUA 4XYGA 5ARDA 1I2AA 2VEOA 5G02A 1I7QB 3EVZA 1TVCA 1YQ9A 1O77A 2A2ZA 3ND5A 5JWHA 3AI1A 3KR9A 2JK0A 4L95C 4PRYA 3VPCA 1DOHA 2ZSDA 3NGXA 1YBFA 2P69A 4LOHA 4MI1A 1Q14A 1RMQA 2J4DA 1H93A 3HB0A 4PG4A 1WWKA 2A78A 4PLWA 1S1CA 3ZIAD 1OX5A 1E1MA 1Y9DA 1TQ8A 2G0TA 1QRRA 3DYIA 1RHQA 1BEEA 4G6ZA 4HFRA 5DH9A 3IPYA 5JNLA 1YK1A 3FZQA 4S1PA 3W1WA 2P0YA 2XUFA 3EA4A 3IT1A 4DIDA 3NDBB 4MDHA 2WU3A 5K8VA 3NETA 2IUYA 1WP9A 2B3DA 1HDZA 5EMMA 2WNHA 1TU3A 4N7RA 3LUFA 1ZJ6A 2LRHA 4IV5A 4Y18A 4EELA 1UM9B 4PG7A 2X0RA 3JAKA 1L5RA 5TB5A 4BE4A 4CG3A 5EPOA 1EHYA 5JZOA 5A1TA 1GQRA 1CY2A 3ETDA 2WJJA 3ZK8A 3ZDDA 1C7IA 1ETHA 2JDID 3PNYA 4DZZA 4JXXA 3FFAA 4HLDA 2BFDB 3BSYA 4KRYA 3KEFA 3F0TA 5BURA 3C6ZA 1AO0A 4JC8A 4K9PA 1NLFA 1QLHA 4ZKEA 2NM0A 2JJQA 4QBIA 4URUR 4BGVA 1TYDE 2ZQYA 3HJFA 3X1MA 4BWVA 1U2QA 1V1RB 2R1ZA 3AUFA 5K3SA 3ESRA 3QMWA 3D5QA 1FUUA 2IF0A 4UC0A 5EIBD 4YPFA 1U5AA 2VT6A 3V4SA 4MP3A 3P45A 2ILVA 2NO1A 1YO6A 3A37A 5JE8A 3U56A 2X2PA 2XEDA 1DPFA 2YUTA 2XWQA 3SK0A 4JUDX 4DCOA 4ZYUA 1XZ8A 3HCRA 1ZD3A 1A71A 1H66A 1U9ZA 1BMQA 4ZO4A 5FUMA 2CV2A 2Y05A 5E4JA 1H0RA 1QHYA 2VJOA 2F1IA 1YCHA 1DT5A 3DDHA 1I4EB 1DKLA 2OHHA 2X40A 4I7EA 4OSPA 4G97A 3NHAA 3RRFA 2JBAB 1MCZA 4HCJA 2JVKA 2PUEA 1W9HA 1WV0A 1J8FA 5DHRA 3O91A 3H19A 2XB6A 3JWGA 2Z2YA 4MB0A 3IO3A 1LS6A 2ONJA 3P32A 2VHUA 2UVPA 3BGIA 4XR9A 4MO9A 2DFTA 2R96A 3L1KA 4LF7B 4PNPA 4K5QA 3IV7A 3T0GA 3DR3A 4ZTBA 4LQDA 4OJQA 2WNSA 1PG0A 5FBZA 4GZ5A 3RT7A 2AMJA 1PQWA 3QA3E 1Z4NA 4XKJA 5AQEA 5JSUA 1PTKA 4W1QA 4YIHA 3ZXXA 3SYMA 4ZRMA 1AY0A 1KERA 4IZ6A 1RXUA 1XV5A 1NUQA 2BMJA 2IELA 3H04A 3ZWKA 2XUHA 2FE4A 3TRFA 4HWPA 4R81A 4QU0A 1M0SA 1UEIA 1DO2A 1H2WA 5FLEX 2PRZA 5TC4A 5JMTA 4KR9A 2OXEA 5CM8B 5TDHA 3QUCA 1QK4A 2BFAA 2AQHA 3A4TA 1KKUA 4L5IA 5HZKA 3JPWA 2C88A 2DUJA 4IDBA 1FYFA 1ZN9A 2EBHX 5J4HA 4MQ4A 1H22A 1FCJA 3OZRA 2JATA 4PE5B 5ALKA 3BL5A 2X0DA 3B6EA 1K4KA 4FEEA 4GBMA 4QYIB 1Z2DA 3GH3A 5EP1A 4O2LA 5LQKA 2V9ZA 3UT5B 2BBTA 2MR5A 2AG1A 4HNHA 2HX1A 4CM4A 1F3LA 1GTSA 2BFEA 1XZPA 3NOOA 3QITA 3OPMA 3MJTA 3EISA 2D7JA 3QZUA 2VWPA 3SAJA 3JVUA 1G18A 2PRSA 5DE3A 3QYFA 3RAJA 3VKFA 3KCNA 3UXYA 1T5BA 2IYSA 3IEUA 5BRNA 2I80A 2DUWA 3V1UA 1W52X 2JLXA 2G83A 3K9BA 3KR2A 3MWDA 3H5IA 4X95A 1EZ4A 1BS9A 2DKFA 3L40A 2D5AA 3MJRA 4NBLA 4D02A 1V5WA 4HB3A 4ZQCB 4NZNA 1WKVA 3L49A 3RIMA 4IDOA 6GPBA 4ND7A 3SJ7A 2PL5A 3DOUA 3UUEA 3ZU2A 3CW8X 3G8CA 5CK4A 4M1OA 2HPHA 2V4ZA 3SEZA 2KBFA 4BLPA 3U40A 1VKNA 3FOFC 1AUOA 1FDVA 1ORDA 3QKSA 1YR9A 1PS8A 4IZIA 4LC0A 3DWIA 3LQQA 4O4LF 4ENPA 5J43A 2JA1A 2VTBA 2EKQA 3T1YB 2QGNA 2VT2A 4DRZA 2E1RA 1JT2A 4JJ7A 3NC1C 4ZV4A 3SEAA 3FTFA 3HO8A 1P72A 1Q83A 4IFEA 1OVGA 2JCVA 2R8YA 3QBJA 1PSZA 5ICGA 1LI4A 3H2BA 3USCS 4PONA 2V58A 4P4SB 5A3SA 3WA7A 1JG1A 5A3VA 1SUPA 2GAJA 3G7UA 2Q5CA 4BNIA 3EYAA 1JHZA 1WG8A 2O7VA 4G5HA 4OCZA 4DMHA 4M86A 4OHPA 5GVRA 2X5XA 5LUBA 2ABWA 3IDZA 4DCGA 5I7AA 3HU1A 1FYEA 4CIWA 4WXEA 3GDOA 4MGYR 4MVYA 1QPGA 1NP3A 2YHAA 3OQJA 4HH4A 3QNMA 4JUIA 4RVNA 1Q12A 3L4BC 4JOCA 4NRDA 1PN3A 5I9SA 3T5CA 2H1LA 4KJZA 1MC8A 3LBIA 3WKAA 5FX2A 3VR2D 1KEEB 1RRVA 2CF6A 4BKUA 1YB4A 2DLDA 2XMQA 4KZPA 2BHRA 4TMZA 4EHHA 3HYNA 2XUZA 5KX5A 1C3LA 3PNKA 2IHJA 2CXTA 1TAHA 1R5JA 1U0NA 4UM5A 4YT5A 2G70A 3VYVA 4UHEA 2GLTA 3WQBA 4NE2A 3GJSA 2O2ZA 2ZYWX 1AHHA 2K5UA 1QR6A 1XB2A 3NFRA 5GV7A 3WKCA 3V3TA 5F3WB 4S0ZA 1FLAA 5A5DA 2P2DA 3H6KA 1YB6A 2QXTA 4N40A 621PA 2Z9BA 4ZAXA 1GUZA 5CD1A 4CIAA 3QPVA 3G3EA 2VUTA 3NHMA 4EJSC 3KQVA 1WMSA 5JU6A 2YBDA 5FBHA 1C1XB 1B3BA 2C2MA 2C92A 1MOSA 3IB6A 3TCNA 3RIGA 1V8ZA 4ARUA 3IKTA 3I1JA 3WWOA 2QR2A 4ZAFA 1V35A 5B53A 2Q3DA 4G1UC 4P80A 4DCCA 1U5BA 2CW5A 2ECPA 2IYRA 2NNWB 3ME5A 1CUZA 1ZINA 3ADKA 2FI1A 2WMDA 5BW5A 2OV3A 3D2LA 4PQRA 2C57A 5EYPA 1LLUA 3NOVA 2W2MA 3BCSA 3ZJUA 1KDPA 1LLCA 2ERCA 4Q93A 3E5HA 2JAHA 1FVOA 1D2AA 1OFGA 3LDGA 1NULA 1ZLYA 2ZE7A 3F3KA 1ZNWA 4D96A 4PIVA 5B3LA 5KMGA 2IBSA 2VDWB 5AM5A 2IODA 4EHLA 2VHYA 1GCAA 4H7HA 3EXG1 1PD0A 1R5OA 1SQ6A 3EC7A 4PQYA 2CBZA 4QM6A 4YP9A 3REQB 2OORA 1THMA 1NN0A 3KETA 1JVBA 4TQUS 3UJDA 1O0BA 3WQRA 3MS2A 1GDHA 4ONEA 2C42A 4QM7A 5TMDA 4RJJA 1T8PA 4D41A 3R7WA 4XEHA 2FDXA 2PCJA 2PUTA 2F62A 4YMWA 1UT6A 3UAWA 1JA1A 3OPYA 1ZHHA 3C7CB 3IP8A 4MSUA 2FUEA 1KF0A 1F0YA 2O2SA 4XH9B 3KOUA 3QH4A 3G2OA 5LJIA 1Q0PA 3P1JA 4ALLA 1FQKA 5HMLA 2PPLA 4NYMR 5DLQC 4WLOA 5IAGA 4HNUA 2YOHA 3WO1A 3D8RA 2O8BA 1ND5A 3OUTA 3AIMA 4LMBA 5E7IA 2F3PA 3BK7A 2R48A 2DPYA 4BVGA 3U0VA 1JP7A 1NC1A 2C7VA 4G41A 1NVEA 4RBNA 1L7VC 1G7TA 4N5MA 3F6BX 1KR2A 2IHVA 3A9CA 3FYTA 2YNMD 5B1EA 4HEJA 6Q21A 3VR5D 3IVGA 1L5YA 1M2JA 1QTQA 2EX0A 1GR1A 3PS9A 3GEHA 5HQ3A 5C18A 2YFHA 1R0CA 2BAGA 5CG1A 1AV7A 1N7JA 2EQZA 2BFFA 2KLHA 2PZGA 3RYIB 3NIBA 3AY3A 1T2DA 1TUBA 1WM1A 4K05A 2ZSHA 3T3IA 2EG5A 1KMMA 3DTVA 3KBBA 5IDVA 3RUAA 5C8YB 3ADCA 4N82A 1N2CB 5T41A 3KIPA 2HIAA 3MWEB 4C6SA 1Y4AE 3U62A 1CERA 3TTVA 1T9ZA 3N87A 5KKCA 5ICMA 3OZXA 2VTVA 3BWDD 5L6MB 1FPQA 2VQ3A 1PZXA 4OXIA 4IYRA 3BK1A 1Z17A 3VV3A 2PA0A 4QNNA 3ZWWA 1JPNA 4CTOA 5DTRA 1N7HA 1B2LA 3VM6A 3ZD7A 3IBTA 3UQYS 5L3RA 4KQIA 4CLRB 2BJWA 1Z9BA 5CLIA 1ZO8A 4MUKA 4WIAA 4ZEMA 2GVNA 3BGVA 1T0PA 2C9MA 1UOEA 1P0FA 2X7JA 3MN1A 4O2AA 5DI3A 3E53A 2XOKA 4Z9AA 1V5IA 2MMGA 3RUFA 3GXOA 3IQEA 1T9GS 2GSDA 4Y2XA 3TTXA 2W6ZA 5E3IA 2PX2A 5SYMA 4GXTA 4HQFA 5D87A 2WDPA 1NDUA 1XU4A 5EE5B 3HWX1 1GGMA 2QV0A 4M0LA 4EYSA 3HXQA 2Y0BA 5CBPA 3BL8A 2VZ8A 3QVKA 4J0HA 4YJ3F 1RAHA 3PE3A 1T8UA 1NFFA 2NU7A 3ZWCA 3BXFA 5F12A 4CLXA 4BRUA 3BFKA 3S1SA 4RX1A 5BN4B 2QDXA 1P60A 1Y3CE 3MCUA 5K8IA 1P7VA 3H4VA 3PSHA 2CT8A 4G07A 4IIGA 2B37A 3BA6A 4HR7A 3U4CA 3AEZA 5D3QA 2D3TA 1NVDA 2C5GA 2IUEA 4ITRC 3O4RA 3VU1A 2P62A 3I12A 4U6SA 4WNYA 4YUVA 2YCBA 4FFVA 2HQSA 3M1YA 2IEGA 3F6CA 3QKUA 3A06A 5IBCA 3I8XA 5DX0A 3CRRA 3MWFA 2JBWA 3AVPA 1GUDA 1T26A 4DG5A 3ONDA 4UTRA 2NIPA 2BZSA 4K26A 3O83A 2XGGA 3KSZO 1LQTA 1MAVA 2Q1WA 5I7HA 4DV5B 1GPAA 3LDFA 2WQ6A 3BG5A 4D0GA 2HJGA 1FYDA 4L6CA 4N8DA 1UMCA 4BZQA 1Y42X 2HDWA 2ATEA 3H13A 2XZTA 3QE4A 1WOYA 2V03A 3EULA 3OA0A 2MSCB 4MYCA 4B34A 4XQ0A 1WCXA 2GPYA 2IHYA 2QY9A 2GCEA 3O03A 1DLIA 3DR5A 1PWEA 2BV3A 5AJTA 3AY6A 4A5SA 3BGDA 3OMLA 4LXGA 4YO8A 3CR3C 1Y8RB 4H2DA 5AR1A 3S1LA 1SK8A 4M87A 3L82B 1ISFA 2F6RA 2JIQA 3DGFC 2C2YA 5REQA 1KMHA 4OP3A 1UKEA 3CH4B 1D2MA 5AKYA 2NZUG 4E21A 2HWXA 3CTPA 4WECA 3SIPA 4RZSA 3U1VA 2WKPA 3HABA 1PQ4A 2R6DA 4KPFC 4ZHSA 2D00A 5CA0B 3B9BA 1JAXA 4ZU3A 2WOJA 1N78A 1MIOB 4TKUA 3WR5A 2BFOA 2O2DA 5IYZB 4OQDA 4H1TA 3Q10A 2D8MA 4AICA 3DAGA 1NXPA 1V8OA 1U0TA 1NG1A 1UXGA 2VSOA 3ZWOA 5CR9A 1H05A 3I4FA 4RWZA 5DTEA 1VHDA 4RL4A 4O63O 3AV3A 3GYGA 5J2UB 4V0LA 1HE5A 1SBTA 4KXQA 3TAXA 5DX8A 3UXEA 4UOZA 2ZYUX 3INGA 1XVIA 3T7JA 3QPBA 3DBHB 4INAA 4K9OA 5EJIA 1JDBC 3N2ZB 3WNDA 2Q3EA 2XNDA 4H1UA 2OC9A 2D13A 2N46A 1P4SA 1O9HA 2WHQA 3NHWA 1NN3A 4DCTA 1IMOA 5JJKA 3N8HA 3T3DA 1CUFA 3PHGA 1QH0A 3OO0A 4E09A 1RWMA 3O1IC 3WY9A 3B1YA 2ZTLA 1I0IA 2G80A 4FI3C 2J5BA 2JD1A 3DZGA 3UUWA 3V4PB 4XASA 1SD1A 5KYTA 1I2DA 3NHKA 2F43B 2PMDA 5JVDB 1EA5A 4PRLA 3EIFA 3PUIA 1YZVA 1FXWF 4FKBA 4QDXA 3G2QA 5ECDA 5FQOA 3VSCA 5HCUA 3ELBA 3KJHA 3BD9A 3CT6A 1G7SA 3ZWAA 5BOVA 1FRNA 3D1LA 4Y6PA 4IPTA 2I1QA 2AMVA 2CKDA 1IPHA 2I4RA 4JASB 1O0SA 1NPYA 2WTXA 3GAAA 3RIXA 1JSZA 3L1VA 3O8OA 5A9TA 5CDTA 1G3MA 3BFJA 2M9MA 1GZ7A 1VKHA 4P2GA 2WT8A 3H8WA 2IHZA 3CRZA 1EM8B 3ELYA 1KFJB 1T6BY 1I1HA 2L19A 3AH8A 2QZPA 3NV7A 1GRNA 1VYVA 3Q85A 3EPKA 2DT8A 4G4SO 4QUIA 3TZKA 1IAVA 2NAFA 1XJCA 4LDQA 2IZZA 3IR7A 1TCBA 3CIFA 5ANRB 1IY9A 2ZU6A 4EPWA 5LQAA 3EXFA 4H1WA 1RI3A 3A3YA 2W22A 4FMDB 4NPCA 1LD3A 3T4XA 2JAUA 1WNTA 3R0VA 3KB2A 3WGJA 1X1BA 3IVRA 1VPLA 2VG8A 4CDMA 5KYVA 5HRCA 3VNRA 5I7FA 4HAWA 2GNAA 2JVIA 2WU1A 5IF9A 4ZT7A 2LDBA 1DC6A 1LGYA 2VJNA 4UAJA 1QP7A 3T52A 1Y5RA 3IKJA 4EA7A 1DXQA 3C41J 3CKKA 4IQ8A 4QPNA 5A71A 4PSUA 3IL2A 4AKIA 4JJ8A 1TOAA 3K5PA 1L4YA 2QS9A 1M2NA 2JCYA 2F9LA 1P7WA 4KXMA 5L45A 1F8FA 3UK0A 3EY4A 2XDWA 2H9AA 3PLRA 2FGJA 4FQ8A 1WP4A 1ZLXA 5AVJA 5TY0A 3SX4A 4XDZA 2F3TA 2IUUA 2RG7A 4GP6A 4ZVQA 1PF7E 1CRZA 1WDMA 4E5DA 4GI1A 3QE0A 4TL6A 3F9RA 4CV2A 3JQFA 1JHPA 3R4VA 5I45A 2A9JA 2JJ2D 1AHPA 4G0PA 4X63A 3V6LA 3W8NA 3Q88A 2QE7D 4FFDA 2R85A 4PFSA 5K6TA 1BXGB 2EW8A 1X1SA 1VE9A 5I9BA 2YRQA 2ZR9A 2H54A 2LIVA 1A9QA 2B20A 3K8YA 1X3LA 1DFGA 1J9GA 2G4LA 3OF3A 4KQWA 1V39A 3KZCA 3VVCA 5LOVB 1V96A 3FDZB 3TEJA 4JVOA 5K4AA 4Y7DA 2HRZA 2J9RA 5F52A 1WDTA 3CO0S 2C5SA 3FCCA 3N8KA 1AJEA 3IP1A 3JARA 3QELA 4LOAA 4MZXA 3TBKA 4XD7D 2XE7A 3V8BA 5LZ4A 1FNSA 1T2FA 2HA3A 3BCHA 2VNKA 4P98A 4WA7A 4NAUA 1ZGCA 4QJ3A 1GGHA 3VDMA 4XQ9A 5LVAA 2C4TA 1UFRA 1X1AA 2ESRA 2GQ0A 1KH1A 1E3TA 3NTVA 2H4WA 2HT1A 1EP2B 1W5TA 4H6VA 9GPBA 1JIJA 2EQAA 1ENZA 4HF7A 1CQJB 4RV5A 1GCGA 4YCJA 3RJ5A 2C8LA 4W7HA 3CF2A 4UOQA 1GKKA 4F71A 3LOUA 3OM9A 3OZIA 4OJYA 4KQFA 3KLOA 1JQKA 2VJQA 3D1VA 3UWOA 4X24A 3LRPA 1EX9A 3Q7SA 4KQGA 4LHWA 1T34A 1RJFA 1WDKA 4KQXA 2JAPA 2WK1A 1P73A 2ECQA 2R5FA 4XFKA 3WFJA 4F3NA 2BKEA 3TZ6A 3E0QA 5BR4A 5ERGB 1P3DA 3JATA 4ZO7A 1MGOA 3I9LA 5FKJA 5JNUA 3H0EA 1JQDA 1U2TA 4JROA 2GPWA 4DR2B 2XBUA 2YMQA 1D4FA 1RVV1 2ZZNA 2IS2A 1IZ0A 3A9TA 5G1OA 2X77A 4JI3B 3NWBA 1TO6A 3A31A 2BGKA 3PEVA 4MCJA 4P4UA 4L74A 1G1MA 2OORC 5T3YA 4E2XA 5I9IA 4BB5A 4WN9B 2I0FA 1E8DA 3ED1A 4DANA 3CWQA 4HXYA 5J4VA 4XPIA 4E08A 4EHJA 3KQLA 1B15A 3QXXA 4ZICA 1R0RE 1N7GA 1H1DA 2OD7A 4DM4A 2JLVA 5KEIA 2GGSA 3VBEA 4CL0A 1R74A 4TN1A 2DT5A 4KE8A 4Y6QA 1JNYA 1LF5A 3AILA 3AW8A 2AOTA 3F46A 2VBIA 1BN6A 1Z5VA 3KOXA 4FONA 1LH0A 3U7IA 1PE0A 1S7GA 3WIVA 4QVGA 1RYEA 4Q82A 4ZC1A 2PLNA 1ZOIA 3I3SR 2EIHA 4OHXA 4AY3A 3A1TA 2J7PA 2W0SA 5BSTA 3ET5A 1MC4A 5LP6A 1LPAB 1VB5A 2F1KA 2OHJA 2I55A 3R09A 4M0EA 5TMEA 3WOHA 1WMBA 3ORFA 3G0IA 3FNBA 4RZ3A 4RDCA 3NKFA 3U3KA 5F77A 3KZVA 4RE5A 3FHLA 3U3XA 4O08A 2O2HA 3E5NA 3H75A 3NOXA 3DWFA 1XC7A 2ECKA 5CP8A 3WE7A 3ELDA 1FUKA 2E6UX 4TMKA 5FFNA 5JIBA 3OJXA 3FFTA 1GILA 1K9SA 1Z5PA 4JH0A 4F2DA 1XEWY 3URKA 3T7TA 4YRMA 3PIRA 1N1DA 2A0KA 3QEMB 1IEWA 3AEQA 1KK0A 4TTTS 4ZO6A 2CRJA 2FSSA 2HLDD 1W2HA 3EZ2A 3PICA 5IC5A 4CMIA 5K3OA 5K9ZA 1CXZA 4YR9A 2ZAGA 5DP2A 4LXQA 1Z0IA 2NSHA 4EGQA 1C0IA 2JEOA 4U7HA 1LBIA 2F9FA 1ZHFA 1F0KA 3DONA 2B3TA 2YINC 2NU8A 3P9NA 5FAXA 1EP3B 2AE1A 2FLWA 4GF5A 3WISA 3ZIAA 4JB0A 2JZOA 5KJ6A 4AUNA 2BI7A 2XD9A 3TMMA 1A7KA 3AWDA 4Y2TA 5DZSA 3CRMA 1DE0A 4J4HA 4MA5A 1G5TA 4ZMRA 5JCXA 4WFIA 1CJUC 2YZGA 1NOJA 4TROA 3DYBA 3PEFA 5HIMA 1U0SY 2OAEA 4JUCA 1BHJA 1Z4IA 1P1IA 2HC9A 3O93A 3QVOA 4PC6A 2FMIA 1X13A 3SQOA 1QYCA 4Q4HB 3D6VA 1KE2A 5A5EA 1EESA 2P0EA 2R1TA 2FVYA 2JDIA 5C5IA 2B8NA 2CBXA 2YH2A 1EIZA 4IH1A 4UEWA 2GAAA 2H52A 2KMLA 3UFBA 2A30A 2XSZD 3HZOA 4BB0A 3AR3A 4JD5A 2CNDA 2QL7A 1DKNA 2DPMA 2YHSA 2HSGA 4V02A 3O1JC 1D2RA 4E1BA 2C2HA 2QTBA 1H0KA 5FTWA 2A6PA 3ZYCA 3B6MA 4NENA 4X9XA 4ABTA 3SYLA 4CV0A 2W2QA 1Z2EA 3NKLA 2A0UA 4OPMA 5EJMA 3UMCA 3VHQA 3WLIA 1IN6A 3KPVA 4BCCA 3QUTA 1KIFA 2JVJA 3W5AA 3DE3X 1XXHA 2D5BA 1R0KA 3DPIA 3PWZA 1ODJA 3FVTA 3OKCA 4JSRA 4E1VA 3D3QA 4OQLA 4ZI2A 5CEJA 1QIHA 2PH7A 4L8YA 5M3BA 2ZRQA 4RD2A 5JQGB 2G9QA 2WZDA 3HJBA 1Y1KE 5TX7A 1DS6A 1LSSA 2I03A 4GW3A 4P3KA 5JADA 4BVHA 4YDQA 1TQ2A 5I9LA 5YASA 4CNQA 1G2QA 2QRQA 5COAA 5KSZA 5H83A 3VOBA 1EFLA 2DQYA 2ZRPA 4Q9NA 5E4FA 1C8KA 1NVAA 4DIUA 2Q6IA 1CQWA 2Z98A 3HVHA 3NGMA 1OWLA 2M98A 4QL3A 3VZPA 2GD2A 1GQFA 3TPZA 3EMKA 3CKMA 3CH7A 1W2WB 1JHYA 3NORA 3LQRA 2OYCA 3RS8A 4MI9A 3KQSA 3IAUA 5LB4A 1OH7A 1I3NA 1VIAA 1X80B 2LBPA 3RHZA 3W78A 2G08A 3ROXA 1VZ3A 1YGYA 4V0SA 4OLAA 1Q15A 2P68A 3PDHA 4R2HA 4YAEA 2PIDA 2DUMA 3ENWA 3KQMA 3PG5A 4R1UA 5AOAA 4M7OA 3R9XA 1E1YA 2BEWB 2PSJA 2VXCA 4TMWA 4BC0A 1TMKA 3ISVA 4Z2YA 3V1NA 1UM9A 4MUIA 4KYVA 4MPRA 5C7LO 4M8IA 2GB4A 1TJPB 3SEQA 4PGFA 2WB4A 1IM8A 2LCQA 2PNJA 2M1ZA 3MWYW 3L7OA 4XOIA 1K63A 3NHSA 3K1AA 1RCTE 3A2MA 4JI6B 4F4UA 5AT1A 4HNVA 1MA3A 1HL7A 3EB9A 3QP9A 3NNDA 3PLNA 3QBDA 2D0IA 4FHEA 4M49A 4R0NA 2FG6C 2NO5A 2IUSA 3WMRA 2R4UA 3K2QA 4EKNB 4WGFA 3UAZA 5AVQA 2N0SA 2ZS9A 3MYRA 2P4HX 1E2KA 1V1RA 2OP1A 3B7PA 4C6TB 2HREA 1UJNA 1HKUA 2VYFA 4H31A 4B40A 3HA3A 1RPZA 3I45A 1Q1NA 1S2LA 4D44A 3PUJA 1G9XA 1OFVA 1OXXK 5DSTA 4L3VA 5ALEA 5A02A 3GGPA 4MLCA 5DB4A 4IS2A 3R76A 3RVMA 2H4HA 4KXVA 3WWDA 1SBQA 4AZ3A 1E69A 3SVZA 5LQRA 5G3ZA 3O3NB 3A4IA 2ZYAA 1G2PA 3LA8A 1V63A 3JD3A 3VUEA 4ACBA 3LYLA 4DV3B 1RZUA 4OREX 4XVRA 5F7XA 4ESOA 2CLMB 1R6BX 1KK3A 4PNHA 5AVZA 4X7RA 1THGA 2VAXA 3VI3B 2XB9A 1QRSA 1NFRA 1ZP6A 3DTYA 1UMDB 4NCIA 4TWZA 5DYYA 1JG2A 2IFTA 3BWCA 5SY4A 1GJRA 3WK4A 3QLJA 3KUUA 2QRKA 1RJ9A 2Y93A 3D2CA 4OBWA 3KOYA 4D80A 4FTWA 4F96A 5AK3A 3AR8A 3NWOA 3ZLJA 3F27D 2GN6A 5FA5A 1F7VA 2A9OA 2XMRA 4YACA 2H5EA 3FUCA 3KQWA 2I8AA 5FDFA 2JNWA 3GAMA 3A6FA 5HM6A 1J0EA 3BORA 4NESA 3FI9A 4M1WA 1ESZA 3RBVA 1FDTA 4DADA 5FTKA 1VIDA 2XCUA 5DHUA 3UH0A 4XUEA 4E5MA 1Q7CA 2D5CA 2H31A 2BFCB 3NT5A 5KJFA 5EVCA 2HQBA 1XJ5A 5CT6A 5E6SB 1YQEA 3T1HB 3RWOA 2IYLD 2VNAA 1DCTA 1ZD1A 1UBHS 2NUTB 1G2IA 2WHXA 2PRIA 3ETLA 3H65A 4LYFA 1Q50A 4IYJA 1T91A 1BFDA 3MC1A 2K2WA 4K86A 2UYGA 1H0HA 4PYKA 2Q5QA 5AOVA 1Y1RA 4RADA 2A9FA 1N2BA 1LPNA 2XE8A 2IPXA 1PQUA 1QDLB 2JLBA 1MZVA 2KSQA 5TT0A 3UT5A 3GRUA 2CHQA 3VR2A 1MPXA 3W8FA 3N2YA 4Q1DA 2JH3A 3AIOA 1JHXA 2UYYA 3RRBA 1GAXA 1WCIB 1JTFA 3RU9A 5JWRA 1BCSB 1ZBQA 3OOEA 3T95A 2Q0HA 2H1FA 1TI7A 4W7SA 3ASYA 1EEXB 5F4ZA 3G7SA 5TSDA 2YS6A 4ZDKA 3HBJA 3WMEA 4OKSA 4BFUA 1HUQA 1I32A 1N75A 1OLSA 1QNLA 3E18A 3F8SA 3JQFC 3JSXA 1FP4A 2RJOA 4NICA 1VA4A 1E9AA 2ZS8A 2ZPAA 5B7NA 2P27A 2OGZA 3OJOA 3ON5A 4L5AA 4WBXC 5EJEA 2NQ2C 1KI4A 4B6PA 3ETJA 3HE3A 2ZR7A 4PLCA 3UVEA 1KHTA 2JLUA 3R20A 1P0IA 4MNTA 1DTEA 2GS9A 2O05A 3CLHA 4OYRA 3QENA 2GCPA 3G2KA 1TDJA 4BJ3A 2Q5HA 2WD9A 4GT1A 2X9QA 1KP2A 3PXUA 5TPWA 1GG2A 1LY1A 1V8BA 3KL2A 2SKDA 4R1MA 3SDBA 3CLUD 3ET4A 5J4KA 1AKMA 1QTNA 1EUDB 3FETA 4A0SA 4L73A 2OXIA 3ED5A 1M5UA 4FT4A 1SFRA 1I4DD 1KZ1A 1TM4E 1NM5A 1YULA 2QAIA 1RU3A 4Q7LA 4P4SA 3ZZNA 4CN8A 3UA4A 5EIAA 5C4MA 1CFJA 4R51A 1COWD 3G9QA 3QVSA 8LDHA 2NO7A 3EDRA 1A5TA 3WSWA 3UK6A 3O4JA 3X1DA 3JQGA 1Q6YA 2WWRA 4IUDS 2G1AA 4DNPA 4EABA 5B7GA 3AZQA 3FCYA 4RXUA 4TKMA 4ISBA 2QSZA 1TTTA 1T4CA 3RJTA 3AFGA 3GNLA 3SCZA 1CJBA 3LF2A 4FU0A 1JAYA 2EFDB 2FWPA 4YJHA 1JB1A 3DFKA 4J4BA 3VH3A 4CFZA 1KEEA 2Y8EA 1I1QB 1M6EX 1NN1A 3G79A 4HDQB 4M7PA 1GTVA 4MW6A 5E9WA 5E1BA 3VPHA 4R8VA 4AZWA 1TFRA 2YRWA 2UYHA 2DECA 5B12A 3HLYA 1ABEA 1L7EA 4MS1B 5HS6A 4GDFA 1MG0A 1RR6A 3H1TA 1SM4A 1FUYB 4GECA 1NZFA 1IZ7A 4IJKA 5GGXA 3I72A 3WG9A 1J2EA 3WK5A 1CC1S 1C7FA 2C5LA 2JD0A 4K8OA 1JLMA 4QHTA 2G36A 1C7QA 2O3SA 1E9BA 1W1IA 3CEPB 1LPOA 2AZTA 3M9XA 1UDXA 3O94A 4GWKA 2YNMA 4MR9B 4FK8A 1W0JD 3DYVA 2QL9A 2R6FA 4M7RA 3VR5A 2AEMA 3FAZA 5HKOA 2XVXA 4FS8A 5LKAA 2B1IA 4AJJA 3MMPA 1TJ3A 2AX4A 1O6FA 2B92A 4LYHA 2XVMA 3HYSA 4IEEA 4DPMA 5F21A 3CB4A 2LE0A 3EVTA 2LCIA 4NR0A 3UW1A 4DGQA 2G7ZA 1ONSA 4Y0AA 1D7AA 5KTOA 2Q5LA 5BNFA 3C7KA 2G1JA 3T3NA 2NQTA 3WK8A 4P08A 4BNKA 1UPTA 4RD6A 3KZMA 2HZ7A 4TLEA 4KRFA 1LPSA 1TO1E 2C2ZA 3ZR4B 1RI5A 4HG2A 3R8FA 4W5QA 3P9YA 3Q7EA 2D5LA 2PZBA 3FCEA 4H6XA 3RFXA 3MW8A 2DY0A 1FFXA 1R8XA 4UFNA 1DBVO 5LLSA 3ZVKA 1O94C 4ZJPA 2VDWA 2VDUE 2XDQB 1UBUS 1E2MA 2KS6A 3OWXA 3WIOA 3RS7A 3CJQA 3REQA 3BWXA 5K03A 2RAPA 2LIPA 5GGYA 1ID1A 1GLVA 5F51A 4G5QA 2VPYA 4W63A 1WF6A 4L51A 4NOMA 1FTYA 1JYFA 4JP3A 4Y2GA 4PW0A 3GLGE 1YHYA 2MDTA 1JIKA 4AROA 5K2MA 2FEWB 2C8KA 2PSHA 4BMNA 3JQBC 2OAP1 1XD2B 2ZP1A 3V55A 4PEVA 4EEKA 1OBCA 2BEUA 3PXCX 3JQQA 1ZI9A 3B1VA 5E4TA 4PHGA 1TAGA 2VA9A 3DLHA 3BOSA 1QHGA 1EAYA 1FTSA 2A1TS 2KQUA 3F8WA 3H0CA 3AG6A 3G5MA 1A9XA 1SU7A 1XAJA 5A03A 2HTFA 4M21A 1X38A 3LI2A 3N5KA 3LSTA 3IKMB 4H35A 2NVWA 5EIFA 4BNDB 3V97A 2ZATA 2O5EA 1R0LA 2HLNA 2P2CA 3G8DA 3NANA 4ZYTA 5AQ1A 5JS8A 1GT0D 2AF4C 2CMHA 3BYZA 3C3BA 1OYVA 4CMKA 4RM3A 2XCIA 1DBSA 5GJCA 1C3EA 4LKRA 3L92A 3RYIA 2NO9A 3LXXA 1MVNA 4FXPA 2VOJA 3W4JA 3VGPA 4INZA 1RCUA 2BKVA 1GYRA 1V4BA 3WKDA 4M98A 3Q3HA 4FI3F 3PYXA 5K7SA 4J7CA 1KQ3A 3K71B 5JOQA 4B46A 4UVDA 3TW0A 4QR9A 5KDDA 4BO1A 3GLIE 5FFMA 1VPVA 3D3NA 1PSWA 1ECPA 1O54A 4ZQHA 4BVKA 3QFFA 2I7CA 2PWBA 3AFHA 1BN7A 4CLDA 4YMSA 4H6PA 5B1HA 4CLRA 4ZVOA 5JEDA 4D8UA 3U19A 1P6XA 3TZLA 4FGLA 3LPLA 4OBEA 3ZS9A 3WMWA 2DKOA 3W6UA 4YJ2A 5ES3A 1B0ZA 4XUDA 5EESA 5HVNA 3H16A 5C31A 4E5NA 4Y6OA 3TNFA 4FOOA 1XJQA 5FI5A 1OWPA 1RYDA 4Y2VA 1NUAA 3L4KA 4D82A 2FXVA 4H3VA 3IVXA 3IR6A 1NIPA 4C0LA 2PMWB 3IILA 3NBXX 1WUTA 1D07A 3AHJA 1M2HA 4HGPA 1GPBA 2ZM5A 2FUG6 1MEEA 4I55B 4FR5A 1A2KC 2QYHA 4D9JA 5AW2A 1CPYA 3DMDA 1D9XA 3ORHA 4GNKA 4OJKA 5IC6A 5A6VA 1NMZA 5IBPA 4ZAZA 4C08A 3HCBA 2X0KA 1ONPA 1TK2A 1WX1A 3WTBA 4LY3A 3UJAA 1UBGA 3PPXA 3EXHB 1J42A 1YQUA 1KPIA 4YT8A 2JFZA 4UBJA 4YIKA 1K8XB 4FDTA 1O95A 4Z99A 1UFOA 2O1XA 3CNEA 3DJFA 2P9GA 1RC8A 1F8GA 3H17A 3HN2A 3IMEA 1FMLA 1M6WA 4I14A 3LC1O 4MUGA 5F3DA 4BDTA 2A4KA 3L8GA 1KEUA 5KQGA 3U09A 1LTQA 2C07A 4P22A 3P9ZA 1IUOA 1T5HX 4HP8A 3QJ5A 4QUJA 4HUTA 5A1JA 5AM3A 3PQ8A 1Z7YA 2YV4A 5KHOC 1FU7A 1NDQA 3DKRA 4H7IA 5DWVA 4I1PA 2QTLA 1QH9A 5D7BA 5G4KA 4ARAA 4EI7A 2C03A 4BB6A 1II8B 3LQFA 1FZQA 2CNNA 1T2CA 3EODA 2XMZA 2OFXA 1IUPA 1AKVA 1PGJA 2XPCA 5HFNA 4CM7A 5K8JB 3NBZC 2MSWA 3MD9A 2OVFA 4DSOA 3JQ9A 3LG2A 3ANXA 4H1HA 3AONB 2C3PA 1W47A 4NBVA 4Q47A 4FD3A 4RFLA 4ZVVA 3EGDB 2ZRNA 3OEWA 3ORQA 2UUCB 3UOWA 1RXVA 1WMEA 3NEAA 5JJBA 1YAJA 5AUPB 1U02A 1ZNQO 3LGSA 3Q1LA 3QK7A 2AA3A 5CA0A 3RUEA 4D9BA 5I51A 1LBQA 4TTIA 1MIOA 4G01B 1G21E 5IYZA 3OOSA 3UMYA 3S6JA 4C22A 4OMDA 2EWVA 2QF7A 3LLUA 1KTVA 1WQ1R 2Y1FA 2W6MA 2C4NA 2BFWA 3BAZA 3X1XA 1XMSA 4HX2A 1JHDA 3LDHA 4LJSA 3V80A 1VYUA 4AZSA 1LK0A 4L3OA 5J2UA 3W79A 1U6KA 4R4JA 1SKMA 3I5XA 1WR8A 1JWLA 4DIFA 1XIVA 4PC1A 3DBHA 4XRGA 5JDIA 1V3TA 3V8EA 5JS1A 1MB0A 2EW2A 4AF7A 4RGBA 1CEQA 3FHOA 5A3JA 1ABBA 3U2BC 1HYBA 2H7VA 5F2KA 1NMYA 1N3IA 2O06A 3NYRA 3OLWA 3Q2OA 5DMXA 3SLKA 3BCUA 4ZIRA 3K6SA 3LCMA 2QUAA 4EZBA 1J1UA 4NDZA 2GXAA 4LGMA 3NDJA 1FTWA 4MVJM 1R88A 2I2XB 4KMMA 2XBLA 3UMSA 4HLUA 1JEEA 5CVVA 4O4JA 2UZ1B 1IHXA 3VAAA 5HQJA 3INRA 2JJ2A 1JR3E 2F43A 4M8KA 4QECA 5JVDA 1KAOA 2XCOA 2FEMA 2XA1A 3E3LA 3TZQA 5DGDA