3ABOB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and ethanolamine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3aboB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aboB02
3ABQB 3ABSB 3ABOB 3AO0B 3ANYB 3ABRB
chains in the Genus database with same CATH superfamily
1U3WA 1RQGA 3DVAB 1H2BA 4LHZA 3UF0A 1JAXA 2IVFA 3LBNA 5DP1A 4RK0A 3GAMA 3H2ZA 3LL7A 5I4BA 5IHXA 3SC4A 2FW0A 3HYRA 3M1LA 4R2IA 5KNDA 4W1QA 3OIFA 5JSUA 3LKDA 2FR8C 2X8WA 2ATEA 1T34A 1C9NA 1ZMBA 1W88A 2OGZA 3TMMA 1ADFA 2WIKA 4L9AA 3L82B 2JAXA 4LYFA 3KQHA 1N78A 1NDUA 2RHRA 2EQ5A 2ZIXA 2ZPUA 3GLFE 1H42A 4FB5A 2X1MA 2PGDA 3ONVA 1AE1A 1ZM9A 1UJ2A 2C0CA 3IIEA 4MIKA 2Q6LA 3PWZA 3R0ZA 4RYLA 1YZYA 3UOAB 1A77A 2IPNA 2YUKA 3KPUA 4KGDA 1YVDA 4PX3A 4A82A 5DZSA 4CV3A 4OMDA 3VKHA 3GNTA 4RA9B 1LRKA 5CB0A 4QRDA 4BBAA 3UUGA 3K2BA 5EWMA 3Q2OA 4JJIA 3K9QO 1QGED 2ETXA 3BRQA 3R6GA 4PRKA 4GUDA 1T5DX 4RIIA 3S7TA 1JG6A 5I3ZA 3OCCA 3KQKA 2I7TA 2XOKA 2AJLI 2WT9A 4NAHA 3UV6A 4P84A 1TYZA 5CJPA 3VM6A 2BH9A 1O9GA 2QVZX 1HEYA 5KYYA 4ZOCA 2ADMA 5A7HA 2JGFA 2J85A 3EZ6A 1D4OA 3R3VA 1E7YA 2WUWE 2X77A 1GL9B 5EIOA 4BNNA 5BV1A 3CV3A 3BXEA 1U8AA 3K3PA 3RVSA 1MVLA 3TTXA 2OC4A 1Q12A 3ESRA 3VKWA 4PPNA 4AN4A 2IGBA 4PPQA 4MGHA 2Z6AA 2Q4EA 3VO8A 2I5PO 1VXOA 2G5CA 4X93A 3L02A 5I7SA 2EHDA 2VJAA 2LIPA 1V4BA 4FINA 1I1OA 5J23A 3R3HA 2EW8A 4JBIA 4LC1A 1VJGA 3O3MB 5DLEA 4DM4A 2OL4A 3I9MA 3AY6A 3DSRA 5C46F 3TWOA 5KIAA 1EK1A 1C3VA 3SYMA 1K8RA 1CULC 1XD2B 3UOGA 4IHKA 3EEOA 1ESZA 3NVKI 1CVIA 4F1JA 4L9SA 2GETA 1FBTA 1TADA 1X1BA 1NWHA 4FCTA 4IGIA 5CM9C 1CRLA 3ZD8A 2HRBA 2CWDA 1K6XA 3VX4A 5A4AA 3L3BA 1E59A 2JVKA 1QHHB 1AUPA 3KSUA 3PFKA 2X7XA 2FFBA 3QI2A 4H77A 4MKHA 3HA3A 5CVJA 3LVFO 1QQ6A 2KSQA 4Y1RA 4PNHA 5HOQA 5KX5F 2C03A 4LCEA 3GIDA 1MO3A 1NUAA 3LPMA 1QHEA 1TYBE 1F3OA 4NECA 4PZLA 2H1IA 1KFJB 1TTQB 3E2MA 4WJKB 1JZTA 4HK4A 1QX3A 4HDCA 1E2PA 1TGYA 1DIHA 3C6ZA 3ESXA 4ZI7F 2BW0A 1EIWA 3PUXA 1ULSA 1RNLA 4QU0A 1L8LA 1H9AA 1FYVA 3NAMA 4QFCA 2AEMA 2NU6A 3B1XA 4KQ1A 3ZWXA 4AY4A 1SXQA 1JWBB 1ZG3A 4KGVA 1A7UA 4JKIA 4Y18A 1ECFA 4C6TB 2O2IA 1NJFA 1YJBA 3WDMA 3EE6A 1KSGA 2F8TA 2QR2A 4JQOA 2QGZA 1SU6A 4KV7A 4MMXB 4TL6A 4J0JA 1Q7GA 3DKIA 2MR6A 3LU1A 1BKDR 2Q1WA 5LQSA 1NFRA 4CGYA 3I23A 4IS2A 2RGNA 3ROPA 5GP1A 1MZPA 1SEVA 3DM9B 3OZDA 3NATA 3V34A 2XXAA 1HLFA 2AT1A 5ALIA 4LGYA 2C0PA 3AKDA 4LOKA 1YJ5A 1AABA 3KP1A 1VXRA 2Q7DA 3ICPA 3VVLA 3H2SA 2BZ0A 3AH8A 3NHBA 5KJ1A 4FB4A 3PXEA 1AHIA 4MCIA 4OQFA 4X7BA 2KBFA 5FA5A 3RJTA 1ELOA 3GUZA 3FMIA 1TM4E 3SJCA 2G9UA 4C06A 4BJ1A 5J4KA 3ENZA 4L16A 2HIMA 2GLXA 1O8CA 1JLLA 1PGOA 2UZ1A 3G9XA 3H99A 3TIIA 2JH8A 4Q3DA 5J5VA 5HQ3A 2OSVA 2RGWA 2PLAA 2UZIR 2PJZA 3J7TA 3MJCA 1Z8DA 1RVDA 2C82A 3DWFA 5CB4A 2O07A 2DQZA 2HF9A 1R8SA 2WWWA 2WLSA 3FXAA 3KVYA 2WJZB 3RR2A 1E9SA 1RJDA 1OROA 3WQQA 5JSZA 1C29B 2EBHX 1JLHA 5IARA 7GPBA 5EQJB 5G1PA 1J25A 4TZ6A 4LZWA 1CRPA 4TV8B 1DT5A 2ABWA 3G1UA 4HOYA 4L4UA 1XRNA 4YDQA 2O5EA 4C7VA 4AUMA 1BZYA 2F3RA 2NUAB 5ARDA 1U81A 5JZ9A 2IY9A 3AR4A 4L78A 3IVCA 4U2BA 4BUJA 3BIXA 3IYLW 3U3MA 5C2JB 4CQNA 2F43A 1NQTA 2BD0A 5MGBA 3T5GA 2X8LA 4ZARA 3QK7A 4QYIA 5DP2A 2GZAA 2JLWA 2IOHA 2IF0A 2VYVD 3CYFA 2X0RA 3PHCA 5BWMA 1DNPA 3FJ1A 3KCNA 5H1YA 1VJ0A 4EECA 1WXFA 5T7BA 4D3FA 5TLSA 4KWCA 4MVJG 3DXXA 1PTJA 1GOTA 1Q95A 1BMFA 3IV9A 5HF6A 3CH4B 2F7SA 4FKBA 4QJ4A 4EY4A 4PC2A 1M0SA 2Z0MA 5BN4B 3ILYA 4KDFA 4KN5A 3VO9A 1E60A 2SKEA 2HK9A 2JRCA 4EGSA 1WR8A 2GNOA 3H4IA 1XTJA 2WVHA 1KOJA 3ESBA 3AUUA 3QKIA 4P35A 4BRUA 4IXMA 4X60A 2FZWA 1QO0A 1TAUA 1W5EA 1J0AA 4X94A 2IYTA 1XUOA 2JGAA 1I3KA 2O23A 2W6OA 3B1VA 5DHPA 3I9OA 2VJKA 3QVTA 4JLPA 1EQ2A 2FQQA 3BSFA 3RC2A 3RTBA 4YXFA 3TGPA 2GPYA 2MYPA 4KO3S 1XVVA 1F2DA 5DX0A 1O96B 1ZOOA 1Z25A 2NVWA 3C16C 1SU4A 5B6IA 4JI7B 4LDPA 3I9FA 5TXGA 3VZPA 2GO7A 3MT7A 2GHRA 4OAQA 3ZE0B 2Z2JA 2XNDA 4KUHA 4BNVA 4BFUA 4DLRA 1BXRB 4MS1B 3O2JA 2DPHA 1P1CA 2R5FA 1R4NA 1DAPA 3MD0A 4OXYA 2QF7A 2RGAA 4BFVA 4N5MA 1UWKA 1W8DA 2PV7A 2YYZA 3HRIA 4X44A 2H3EA 5H16A 1K7XB 1L2TA 3ZCVA 3LCVB 4D44A 3HKBA 3KQTA 4X7MA 3U3DA 4LE1A 2OCBA 1E1RD 3VC7A 3UY4A 4CMBA 1CHDA 2GPTA 3O92A 2A1UB 2NT3A 4LX0A 5J4YA 4IIVA 2HBYA 4YPVA 5LUAA 2RAVA 3GA7A 4HQOA 1E0JA 1TF5A 1Q1EA 1L1FA 3P7MA 3UTDA 4BJ6A 4YCCA 5AOAA 2PNFA 4MA4A 1EESA 2H5JA 2A0UA 3FYCA 2E6KA 3JWGA 4W4TA 3GDGA 3ZQ4A 4J1SA 4RD6A 4NU8X 4K6HA 1E9BA 3AHCA 4B2IA 3SP1A 4B74A 1XXHA 3H3XA 3HB5X 5JCXA 2VL7A 4DL9A 4U7PB 3I8OA 1O1YA 2PKQP 3FCSB 2ECPA 1JG7A 4MYCA 5IYZF 4BGVA 3I01M 5J5AA 1GPAA 2WIDA 3BH7A 3QU5A 5IS2A 1QKKA 5ITVA 1E3WB 1W52X 3O95A 5LQDA 2FEPA 2AFVA 4E3WA 2ZBRA 3GGDA 1U0SY 4B43A 3CLSD 4MQLA 2JAOA 1MAHA 3O26A 1A9XB 1JEYB 1IHXA 3CN7A 4D79A 2ZI5A 1GILA 1CRQA 1D07A 1VRCA 5HUQA 1O77A 2E6UX 2NYUA 1E4EB 3X1MA 4GOMD 1FQKA 4FGKA 3RU2A 4QAQA 4OP2A 1XV5A 4MCJA 4X6XA 4YAOA 1VGRA 2IYWA 4KIFA 3FDXA 3T9FA 5C5EA 3UMCA 1N2OA 2BGNA 3C1UA 3RREA 2OSBA 5KU1A 4IVNA 2H2DA 3U7JA 3CRRA 4J0IA 2BGMA 1VGQA 2C4WA 1F4LA 3RSOA 5LMZA 1VYUA 2PLNA 4FHEA 4FHGA 4GO1A 4YAUA 2H1VA 3LYHA 1ISRA 2C84A 4KVFA 3LXXA 3IDQA 4KUGA 5KQGA 3TJMA 5JRJA 1N2HA 2ZRLA 5TB5A 4XFDA 4KWIA 1N2CA 1X7XB 3BHMA 4RSRA 2QQ5A 2OGTA 1GPWB 2D5AA 2XGOA 5LQUA 2R6GA 2VCYA 3HR4A 2FOIA 2XTZA 4E1BA 1N0WA 4URYR 2JJ1A 5JBIA 2MYUA 1JALA 1Z36A 4BZXA 1N6OA 1TCBA 4FSHA 4WFKA 2R6AA 3IQGX 1BE0A 3RBVA 3NTXA 1OH5A 4Y7DA 3IKJA 5JFTA 1CLUA 2C59A 4MWTA 5JTUA 3S5UA 2H07A 1Y89A 2XVXA 5C32A 2IRWA 3Q2KA 3PPXA 2COUA 5SY4A 5JADA 1BVRA 1EVZA 1VOTA 3URMA 4TS9A 4U6SA 1S2NA 2OLJA 1UJ6A 1ZCBA 2OUIA 3BCUA 1IY2A 3H8SA 4YGXB 1B41A 4M46A 1Y3CE 2L82A 2P9EA 5FPTA 4U9UA 5JSKA 4D0LB 1G5HA 1GA6A 2OMEA 3DHEA 1JFVA 2A0WA 3VC3A 1NG1A 1U04A 1K8QA 3Q0EA 5KVCA 1WQ4A 3G9UA 1W9MA 5KC8A 2OM2A 2QN6A 1T6XA 4TMYA 4Z7QB 3DBRB 4ENWA 3BGSA 5REQA 2I4IA 4GKJB 5EWJB 1O97C 4QPDA 1M8GA 1VIVA 1P2SA 3CKKA 2XGSA 3AHDA 2R86A 2PU7A 5BXYA 3I2FA 4B4KA 1JDSA 2AVNA 4HN4B 5COQA 2Z83A 4PIPA 1B1AA 1BKSB 1I33A 4UU1A 2WQZA 3BXZA 3TMAA 3WNVA 4BLTA 4ZTUB 1W1WA 4BKPA 4AJEA 2OY0A 5EJFA 4FFRA 4J7CA 4I5DA 2WSYB 1IJBA 1KEPA 3WO1A 3OMXA 5CFMA 2MDTA 2W4MA 5BYBA 2A9KA 3M33A 1UAAA 1QPZA 4Q1EA 4WL0A 1X38A 4FYYA 1JWAB 1SVUA 1GUFA 4KPFC 1D04A 3M70A 1XQ9A 2VK4A 1J8QA 2C2ZA 4EMUA 4L3WA 2W2VA 4NSNA 1FTYA 2ENUA 3JAKA 3V3TA 1JIUA 1YJCA 2A5JA 4NBSA 1WABA 1MC1A 5B12A 2PVCA 7ABPA 3N2KA 2QYTA 5ESXA 5LJLA 1EFPB 3CX8A 4HWSA 3RD5A 1CIJA 2YWCA 1CUVA 3GJRA 1JNYA 3QMWA 3NR2A 2OLEA 3HBNA 1QP7A 1T8PA 3HKDB 3R5TA 2CC2A 2VXBA 1J2EA 3MTAA 5DHTA 2LP4Y 4AF8A 4AMBA 1H93A 1IB0A 2YJ5A 3U60B 5FP0A 1JYEA 4R8RA 1XQ1A 5EKDA 4EQ6B 5JQGB 4TRMA 3C4QA 3COVA 2ONCA 5DLPA 3DB1A 1C8KA 4EI7A 5KVAA 2NXEA 4WNAA 3F78A 4YH1A 1NF8A 4YJ3B 5EIBD 2AEEA 5K8IA 3COYA 1I4DD 3DOFA 4Q9KA 1B73A 2HMVA 2ZYVX 1ID8A 4OHPA 1NMSA 1EWKA 4DA4A 3QE0A 4KQHA 1WZUA 4RPJA 1KYXA 5HRCA 3F3MA 1T10A 2PRSA 4UNSA 3FBGA 4RSMA 3HCWA 3KL2A 4F2HA 1A1VA 4PXSA 4ZEVA 3BXPA 3M82A 4RUKA 4TTTS 4FMCB 4AB1A 2GM9A 4RGVA 4W1SA 5A2GA 2JA1A 1JN0A 1GWNA 1Z8FA 3TB6A 3D7RA 1YQTA 1W36C 2GFHA 3PQFA 2GAFA 3F4LA 3NM6B 2GXAA 3E81A 4YLYA 3NJ4A 3RTEA 3P2YA 2QXUA 2WFMA 1KZYC 4D98A 1OLXA 1FMCA 3OH8A 4AULA 1ISPA 5AM4A 4UU8A 3ISTA 1SRQA 4XFKA 5GY7A 3VJRA 5AM1A 2V0GA 3HB7A 4BHTA 2PZEA 1S7GA 2AQ8A 4RJIA 3F1LA 1ZOIA 4UJ5A 4G25A 4ACBA 1M5UA 1HE5A 3IL2A 4J7XA 1XJ5A 3AL0C 5CJ2A 4CMEA 2BSQA 4G5XA 2G06A 4GXNA 3GEEA 2B9VA 2WFAA 3RNLA 3EVDA 4R71A 3DMYA 4X0EA 1DX4A 1RAFA 2DHQA 1AUQA 2B94A 2PD4A 1KMIY 2J9XB 2ZT5A 4KMSA 5ER9A 4X41A 3KPVA 4ZHQA 5A9RA 4RD3A 4U9IS 3HZHA 2GZ1A 1GFSA 1ZL0A 1E0DA 1WM1A 2FPOA 3PEUA 1UBRS 1R4AA 4ID3A 4UXJA 5CT5A 5H3HA 1SCKA 3NHYA 1KYZA 3V4PB 2H5LA 2AFIB 1SVLA 4GZLA 1FQJA 4HD8A 1UQRA 1NXVA 4OKNA 3V4ZA 4I9HA 1ADYA 1NUSA 4L4SA 1NXXA 4AJ9A 3GFPA 3R5JA 1A8IA 2UUAB 3ORFA 3D9QX 1F9AA 1OTYA 4D9BA 4RPKA 1GHTA 1QG2A 1G2QA 3EYAA 3TR6A 3A4IA 1BD4A 5JMPA 3U7QA 1JPVA 2FV8A 2VRWA 5KNCA 1C9MA 3R5SA 3DWGA 4NCKA 1KPGA 4YRKA 5LJIA 3GP8A 3WGLA 5C4IA 1HYQA 1A8SA 1G8FA 4PLGA 3K1ZA 1K5DA 4FMBB 4FZVA 4M2LA 3CEHA 1QIEA 1Z28A 2V5UA 4RX1A 4EJSC 2GBPA 1KARA 4IILA 4JI5B 4XWTA 1XO1A 4EVRA 4XRGA 5CDFE 3RFFA 1E5XA 4RBNA 4UBIA 4Q4AB 4ZVNA 4B6EA 2ENWA 3IEIA 4I8IA 1UEJA 2ZRHA 4OXXA 4YJHA 4GECA 4Y60C 3QZUA 3U3RA 1HPLA 1ORHA 4D4LA 1OTHA 4P3KA 4ZRDA 1XNGA 1FFGA 4AG3A 4Z0HO 1HDOA 4Z9AA 4JB2A 3B2EA 3N74A 4KLZA 2BBOA 2BMFA 2IX9A 1OA0A 4HF7A 4BBZA 1EVYA 1BQ4A 2CD7A 1N7GA 1RI5A 4MR7A 3FOFC 1LDMA 2BBTA 1PSWA 1I3MA 3GQBA 4IP0A 4LV8B 5HNKA 3F47A 4B3BA 1I7DA 1GGVA 3DXYA 4ZU3A 3P0EA 4DEYA 1QNLA 3CZQA 3GLGA 1KRHA 3KJQA 1A9TA 4RZXA 4BVHA 1KJNA 1FLVA 3OQNA 2XJ9A 1WW3A 3BFXA 3EQ8A 2DWOA 2XQVA 3B3FA 3I39X 1AURA 3MGKA 1MNAA 1VRVA 2H4WA 1LI5A 2F3PA 2V59A 4PVCA 5EXSA 1U99A 1E3JA 3N53A 2PFKA 2ZR7A 1WJGA 3N75A 4HAXA 1GNPA 3EWNA 4HRYA 4ABTA 1P1JA 3ZXSA 3GRVA 3TKYA 1LTHR 2GAIA 2YHAA 3G8YA 3JQ8A 4RHEA 5FBZA 5IK2A 2R2AA 1TAGA 1ZIYA 1VE5A 2HCRA 3AFHA 2NU8B 3T0FA 1D1SA 4L0QA 3WKEA 10MHA 1PX0A 3VYVA 1BEZA 5TPWB 2GK4A 2PQ2A 3D4NA 3VR6A 4B3DA 2IYLD 2SKDA 2OCIA 5FBKA 4EA9A 1HQCA 4I3HA 2DT8A 2XMCA 5I7FA 4DADA 1Z07A 1DWOA 4TV9A 5IJ0A 2PN1A 3I32A 2PH5A 4EX7A 4D8VA 1DC8A 5AVZA 1OIVA 3ZW9A 3TPCA 2QX6A 2Q8QA 1HFWA 2YQZA 5KWEA 4D97A 5GQSA 3CZ9A 5FBVB 2PKCA 3DXZA 3KB6A 4UZFA 2D6FA 1NHNA 3QELA 3OTWA 1UT5A 3FNGA 4JYPA 5EMKA 4PHTA 3PNOA 2Z09A 5HF9A 2BFFB 2CHVA 3MMNA 3DFFA 2HSWA 1AQIA 3KX2A 1JWLA 1E9DA 3ZV3A 3D8NA 4IYJA 1VG9B 2YOHA 2QX8A 1QU3A 4MPRA 4DR4B 2ZI7A 3IHTA 4GP6A 1EAYA 4RENA 2H63A 1A76A 1PG5A 4OXIA 3ZHRA 3SBOA 4H0FA 4EQZA 2J46A 3DOUA 4YRMA 1IUNA 2I2WA 3TSZA 4X84A 2QZZA 1PE0A 2FQWA 3K0FB 4QTUB 4DBLC 5HX7A 3LVBA 4DV2B 2I4RA 4L0MA 4YRTA 5CFRA 1HT1E 3LHSA 5KQLA 1KU6A 2AQIA 3A0UA 4IJ6A 5EC8A 2WQ6A 1A72A 3AG5A 1MJFA 1OTXA 1GKIA 1THGA 4Q3KA 1N3BA 2P2DA 5G0TA 4ESOA 3ZDCA 4Y0VA 1U28C 5EHGA 2FLKA 3K2IA 4G37A 3C1OA 1Q91A 2BT4A 4BX8A 2HA6A 4Q00A 3JD3A 1FFCA 4DQKA 1JKMA 1RBQA 1IXZA 1QP8A 1EX1A 2EZTA 1AKMA 3G13A 1PZFA 1S89A 3GDOA 1LB1B 4NHEA 4O2BB 4DLPA 3M9XA 1HZZA 3PVCA 4XJTA 3KYCB 1O4VA 2JCVA 1TF2A 3OFJA 2AR7A 5BV0A 2GYVA 5ES3A 3EEBA 1D4AA 2JNWA 1OKKD 2MTBA 3DYBA 1H3FA 1C3LA 1DTEA 5JTTA 4XI9A 4XVQA 2ERCA 2RI1A 4W63A 3MZ0A 3FIJA 4TXHA 3B7PA 2WJ6A 4GMXA 2PH3A 4B45A 4BATA 4BX0A 4B83A 2EBWA 4X92A 4CQJA 2ZPTX 1HURA 2ZITA 4WLVA 5BQOA 5CA0B 1DEKA 5KVQA 3P45A 1MDBA 4IOMA 3TRIA 4PN7A 5BR1A 3V7FA 1IXRC 1UXKA 3JWIA 4PM4A 4QXAA 5F7OA 4U0JA 4NV3A 5C1IA 3WL3A 4JR0A 4BWYA 4MR8B 1X7HA 5D87A 1WLYA 3NEAA 1RJEA 4YPOA 3L0OA 1MU0A 4BMNA 3FNIA 1SKQA 3KZKA 3GJXC 4F21A 3FSRA 3FNFA 4IIJF 1RQLA 1P3DA 3NVDA 1CR0A 4C7BA 4DFDA 1BAPA 1JJFA 3FPCA 4BAUA 3FNEA 4YIHA 3HWSA 2DY0A 1QHXA 2XUJA 4IDGA 5I48A 2HB6A 2QD5A 4FEGA 5IP5A 2PGXA 4U7TB 5LZ8A 2J4CA 1ISFA 3I0NA 4HDQB 3WK6A 3KJZA 5B30A 3NAQA 2X0JA 1PWYE 1UOPA 2CNKA 3B1JA 4EF4A 2D0DA 3EBPA 1QCCA 1G8GA 1YR3A 1EK0A 3P9ZA 4P34A 4OQMA 3ZGOA 4GC9A 4RA6A 4X62B 4KPUA 5L6MB 1EGHA 2PY6A 3EJ6A 5ECGC 5IN4A 1PT5A 4Y2TA 1M2KA 4XSGA 5H0IA 4FMCF 1KI2A 2VDLB 5E8RA 3RF7A 1GU1A 3I2YX 4C0QC 4LQDA 3O8OB 5HKOA 4BLRA 3FJYA 4CKEA 3GLFA 1NBEA 1JA9A 4RF3A 4LNUB 4UATA 2GQ0A 3W5VA 4J4TA 1L3BA 4KQIA 2PXAA 4A0GA 4BC0A 3GMIA 2ZRNA 1JT2A 2CHEA 1AY0A 1G20E 1SULA 2AN4A 3IDAA 2I76A 1W2HA 2C4KA 1Z7GA 3HVUA 4OB6A 1I6MA 5GVSA 2J5KA 3IOEA 3OT1A 3IAM1 5DYTA 3EZ2A 2PCLA 3T99A 3LAWA 3QKSA 3VNAA 5KQSA 4F6CA 5DM0A 5ECYA 4XQEA 1T1EA 1KBZA 1EK6A 1PFKA 2GMWA 4JLVA 3R7SA 4DLAA 2XF8A 4TWJA 1PYGA 4CLRB 1E2JA 2CMDA 3QUSA 4HAOA 2GT1A 4HATA 4BYMA 4Y8VA 4EYOA 4NNJA 3EC2A 2ZE5A 4MGZR 3TLZA 4HB3A 3M6LA 2JLBA 1Z4QA 4HH3C 4C30A 3G49A 1UADA 2WYIA 3UHOA 2Y2UA 4F04A 1JAZA 3AKEA 3FPSA 3GPLA 2GN9A 2ID8A 4MO2A 3R9WA 1R1DA 5H9VA 2OKGA 4FR0A 1WLSA 4XCQA 1HDEA 5EL0A 3I5YA 3CRQA 4A2PA 4FFDA 3U81A 3ZS8A 3K8ZA 1R3UA 3BRWA 3TW8B 1ZGCA 4IBOA 2PNJA 2EFEB 3JQAA 2JJ8A 3NYQA 3HYCA 3ZDXB 1TQDA 1ODFA 1ZX1A 3KPJA 4IKPA 4ZVUA 4BUCA 3QOFA 2I7CA 3H5AA 4N48A 1C3OB 2F8LA 2BJWA 2QTMA 3FY4A 1K06A 1W47A 1X2BA 4XCXA 4BQFA 4ERNA 5C18A 2X2EA 2JC3A 3IAHA 4IUCS 2H7VA 1DTSA 4EOGA 3OE7D 3NTVA 3TCNA 1SG9A 2N47A 5CUQA 4FI3C 5FPPA 4HZIA 4ZOLB 2CJPA 4YQYA 2DUMA 4O0LA 3NONA 5GIOE 4V0KA 4I9GA 4PBRA 1ZGBA 1CY0A 5KX5A 5AJZA 4B8WA 4DRXB 1FDUA 3LGSA 3L1JA 2Q21A 1ODLA 1XQXA 2GR9A 1QYRA 2B1QA 4ZDKA 4Q6BA 3W5UA 4CKCA 4ARUA 2PE5A 2HV9A 3K0HA 4FHCA 4UM5A 3M3HA 4X71A 1E2NA 1X77A 1ST2A 3PFCA 1XMXA 2V6GA 4X1OA 2XNCA 5E6SB 4MLZA 1WU8A 3COJA 5B58T 4DOMA 2PUDA 1PEKE 3AR5A 1EFRD 3W5JA 4L9WA 2REBA 1N0HA 2DETA 2BKXA 4CQMB 3L05A 4DV7B 2N75A 1UM9A 2PZAA 5THXA 4RZIA 1MJ5A 1DCKA 4Q9IA 1LLUA 3A37A 4Q16A 2BISA 4RVGA 4EHFA 1TC2A 3A1DA 1V1RB 3HE3A 3LIIA 1F6DA 4CCSA 3ZI4A 1SVWA 1ZBDA 2AEFA 1FYFA 4G56A 4YJ2B 3H1BA 3EN0A 4IVRA 2P7IA 5T6MA 3T54A 1P0PA 1YRHA 1I3CA 1T8UA 4AKIA 3IJEB 4ENPA 1YMVA 4FBGA 2W90A 1ITZA 1Q1ZA 2SCUB 4IH1A 1UODA 3SMQA 5AESA 2BH2A 4JT2A 3D4LA 2QUZA 5IEBA 3ZX5A 4OSPA 3RRNA 4DY4A 2PXXA 3PB3A 4YDSA 3PDIA 4LNHA 5IMSA 2Q2NA 4N0PA 2VDOB 3KALA 4OJKA 2JGDA 2BZGA 2O6LA 1MABB 5JMTA 2PTHA 3WDSA 4YMWA 1PZXA 2OZLA 3C4JA 1Q84A 3AJDA 3GPIA 3N6XA 3PJRA 3LSTA 1M3SA 1QZUA 2A4KA 3CPJB 3HVJA 1NVUQ 1IEWA 1EJBA 1N5JA 1YS4A 2YQ4A 3ZPXA 2CGEA 1AA6A 4ZI5A 4E0BA 1GT6A 2PUFA 2OCGA 3DEYX 2WAXA 2B2NA 4AMYA 4DMLA 2YV2A 2IHYA 3HXKA 2WNHA 4L7QA 1SBQA 4MARA 4YB8A 1N3YA 1Z62A 3QOYA 3PQ4A 3HJFA 1WHTA 4JVMA 4ER0A 4MGIR 3WHKA 4LI3X 4CWAA 5K0FA 1BXGB 3NC0C 1TUIA 1W581 3NW9A 1QDEA 4NQRA 1HT0A 1MQ8B 3PCXA 2V7TA 4ITVA 1IN5A 4LJLA 4XGKA 3U3XA 2VH1A 5K4HA 1TMKA 1S8NA 3O8CA 4CQLA 2ZUWA 1RXVA 2IYUA 4PSKA 2Q9BA 3AKCA 1SBYA 3HCPA 3L8MA 1ILWA 3ZXYA 1XB2A 1JKXA 1RTKA 2GEFA 2J7PA 3CN9A 4U6QA 5DI3B 5IDYA 7YASA 3DL0A 3NP7A 4EF5A 4MWEA 1CJTC 5ALMA 4S1PA 4P3XA 1DV1A 4NFSA 4F45A 5I7OA 1TZMA 5HGXA 3UA3A 3WOHA 4MSUA 4R9NA 3UFXB 4AY3A 3P2IA 1BJTA 1VE3A 3E3LA 4WESA 3U7IA 3GDHA 3G0IA 1GIAA 5FPQA 2YWGA 1FYEA 3AFGA 3ZNOA 4ZI2A 2WWHA 3KETA 3SC2A 1Z75A 1FP4A 2NSJA 1P2VA 1WOYA 1NFQA 2FZVA 4BNDA 3R9IA 5DK6A 4DQUA 5AW0A 1RIIA 5B4TA 3RJ5A 1SD2A 3E0QA 1KS2A 1KZGB 4TMTA 3ZNQA 3ZWYA 1IN7A 2CVQA 4F4CA 2BCEA 4ND1A 1XTBA 2I2DA 4HLQB 5DBFA 4BDTA 3WR5A 1C7IA 4JP3A 4GPD1 1I3NA 1M0TA 4TMFA 5ALEA 3GNLA 1NIPA 3MELA 5CDUA 1MQSA 4Y1EA 1C41A 4NBTA 4KACA 1IBSA 2QD4A 1KY2A 2D1TA 4MDYA 4F97A 3BE6A 3RUCA 3JYLA 4GZ5A 4MUNA 1ZKMA 2ODQA 1MJGA 1O8BA 2JD1A 4C20A 4Q48A 4ESEA 5GZ1A 3SDSA 1M66A 5L40A 4HDKA 1VZ3A 2IZZA 4QSHA 1GSHA 2EGUA 4YDHB 1V3UA 2ZSHA 2YFHA 3MBKA 1OWOA 4MKFA 4XR4A 1DBRA 1RMYA 1LPMA 3K4HA 4XUGB 5FLKA 5FOUA 3VPXA 1J7JA 1VYTA 3Q9UA 1EHYA 1XELA 4LMAA 3QX7A 4I8DA 1N9KA 2WWRA 2VCEA 2ZJ8A 3MFYA 3ORRA 3SQWA 2XMDA 4RV4A 2OGSA 2A4MA 3U17A 4F06A 4MP6A 3OIVA 4JI1B 1AF4A 1DC6A 3LVQE 4AKEA 2H4XA 4NPCA 3EW9A 3WSVA 3B13B 5IYZA 3LCMA 4G1UC 3TPZA 1LGYA 1PG2A 1E1YA 1P4JA 4FFBB 4K6GA 5LCXA 1WKCA 1Z5WA 1NPTO 2J0UB 2W6JD 3DVAA 2BF4A 2CJWA 3MYYA 4FGLA 2ZUEA 2AG1A 2P4SA 4UPVA 4I66A 3LK6A 2QZPA 1QRUA 4DIKA 1E2UA 2R65A 5C8YF 1FSZA 4LZLA 3ZGYA 5F5NA 1KYWA 2MJLA 3G3EA 4ZZ1A 5B58C 4EYKA 5BMVB 3RWOA 1PJLA 3U1VA 4PFSA 3AM4A 3RARA 3MWDB 3PTZA 2MYTA 4ZV9A 1HMYA 1V48A 2VIIA 4B4UA 1LC0A 3SOPA 2ORWA 2NZVG 1A97A 3UZUA 3I9V6 3VAZA 4D1YA 1CDDA 1KEEA 3MS2A 1NQ5A 3B82A 4G23A 3VHRA 3A4NA 5CFPA 1EA7A 1N2SA 1LBEA 3VPAA 4BQNA 5A03A 1P19A 1ISIA 4ZWNA 3H9QA 3WHLA 2E1RA 2L2QA 4II7A 4ATNA 3F7OA 1RKBA 3LUFA 1K6IA 3QEBZ 3C3WA 1E4VA 4Q19A 1QK5A 4BAZA 4MW4A 2VG8A 4C7OA 4EBBA 1YOVB 2H2WA 4WK0B 7ADHA 1KI8A 3I05A 1I9GA 1Q3KA 2BMEA 2DQKA 3D6TB 4JJ8A 4QDOA 4C1BA 5BV7A 3QVSA 2WB2A 4C6HA 3AV0B 5DYIA 4R7ZA 1EDEA 1U2QA 2IPXA 2QTLA 4P4UA 1MF7A 3VR4D 3O9VA 4MVYA 2ZJ1A 2G0AA 3NOVA 4DXDA 5FUXA 5J58A 3BC1A 3UCEA 2WYUA 3FG9A 2RGDA 5FI3A 4EHHA 4XOUA 3OIDA 3T95A 5KQPA 3NGLA 1C50A 3R23A 2QJFA 1VI2A 3R40A 5T4EA 1XCLA 3JZIA 1E6CA 4F12A 4XX0B 2QUBA 1QRTA 2ZYTX 3E03A 1SAYA 2W98A 3FX2A 4ENSA 1NURA 1GDDA 3GT4A 4UEQA 2V7GA 3T5MA 3FPBA 3ZD7A 2WZBA 3V4LA 3FMPB 2ILVA 2TMGA 1ENYA 1X8JA 3IT0A 5B4UA 4TTSA 1G66A 2YFQA 4G0NA 5CG1A 8ADHA 4WN9B 4WBNF 3ICCA 3CUYA 2FG5A 1K8ZB 3ZCUA 4DQ0A 4GLOA 3SHVA 4DNFA 2F9FA 4L27A 3P9XA 2QLNA 2WP8J 3B2QA 2QTWB 1NHWA 1PNQA 1NKSA 2OCLA 1NP7A 1PJSA 3KEQA 3RYIB 1FRFS 3DZIA 3F8TA 3ZDEA 1WPGA 3VDQA 1RWKA 4TKMA 4YIKA 4QDUA 1N4AA 3JYNA 3HDGA 2R97A 2QRQA 2COEA 3R3ZA 2Q9AA 1V1JA 4RESA 2NXJA 2NZUG 4QTYA 1L4GA 3D7MA 1HEIA 1P7CA 3GJ3A 3MA0A 3N6RA 3QBTA 1IUPA 4MJ7A 1UC9A 1VECA 3ASZA 3KJGA 3PK0A 1LUAA 1TVKA 4QUBA 3LCRA 4UZEA 3VSAA 4CKBB 4EKIA 4KR6A 2G7ZA 2B61A 3PG5A 4ZQIA 1VMEA 1PVVA 1AKNA 4IEIA 3IMFA 4IV5A 2GD0A 2V7XA 4AJKA 1M83A 4ALKA 2YOGA 2W2OA 3AVWA 1XAGA 2R1VB 3LP5A 3PQCA 4BVEA 2P90A 1MX5A 3L79A 5JJIA 2ORIA 5AJVB 4DNOA 4W8OA 1JYFA 1TYCA 4DWVA 4UDNA 1ZM7A 3GRKA 1IVNA 3GT7A 3HP1A 1MO5A 3A06A 5DCUA 3RYCB 1LY1A 1L4LA 1UEXC 3DBVO 4OMUA 5HVNA 2QP4A 3VMFA 3VXKA 3RFCA 1Z5ZA 1OH7A 3U9TA 4KR9A 3KTOA 2GVZC 3W2HA 3FB1A 2OUKA 3ADKA 2IT1A 3DHYA 1Z0UA 4UHFA 2YBEA 3KHUA 3EG5A 2I0FA 4L8GA 3LYUA 3V42A 5AMXA 1E58A 1YNOA 3A9WA 1QNFA 1NW7A 3MBOA 2JLVA 4F2GA 1JIXA 3DOJA 3AYXB 3QLEA 2P5UA 2WJAA 2QTVB 4OL9A 4IIHA 3PHLA 2HTEA 1ODIA 4AROA 1ORRA 2GESA 1QSGA 2JDIA 2I3ZA 2OP0A 1CY2A 4MWOA 2GZSA 1MFPA 2BM9A 1IUOA 5CBPB 3I6ZA 3OX3A 3U4DA 3BZBA 1H69A 4IOJA 4NCBA 5CT8A 1ZESA 2LE0A 1EP2B 5TY0A 2G04A 1SU7A 3GLSA 2GBIA 2ZRCA 2V6JA 3NIGB 5E1DA 3ICWA 4IYRA 3ZHXA 2JLYA 4JI2B 1FRNA 5KTPA 1BD3A 4AS3A 2R2GA 3CWQA 4IMPA 2IZOA 1RM4A 4FGJA 5AOVA 1B76A 2Y1FA 3ZBQA 1GPDG 2YQIA 3N2GA 1GAEO 3M6MD 1N2ZA 2D1QA 2VYCA 1E6UA 4OYHA 4E3ZA 1FJ2A 1ULTA 3WGYA 4K6FA 2WD8A 1YOBA 1MB3A 1Z7EA 2DFTA 4IF6A 3T3DA 1K88A 4IEEA 4UU0A 4ZO6A 3G8DA 4KUEA 3ZHSA 3PNMA 3M6WA 4IGEA 5ALRA 4Y6SA 3PEVA 1XTZA 1S96A 3T7IA 3PD7A 1GCIA 1ZCAA 1QIDA 1T0IA 1QH8A 1SQGA 1RZRA 1ZD4A 3FROA 3JD1A 2AG6A 4RJTA 5KYKA 2C2YA 1KI7A 4JH0A 2AJDA 4D0SA 5K3OA 1XZEA 4LVUA 3V33A 3FB4A 1G21E 4YRAA 2V1XA 2NU7B 3P0FA 2TRSB 1DAOA 2XZDA 1GPLA 3PFGA 4MZXA 4OU5A 3AR2A 5F1OA 1KK0A 3M89A 3OY2A 5GMOA 3TPFA 3WS7A 3SAJA 4OFXA 4BKUA 5KNDH 2ZR0A 2AZ4A 3GGJA 3PIRA 4LX8A 4D9KA 4IO1A 2FPKA 2I87A 2JATA 1AKYA 2VHJA 1XEFA 2FX5A 3G6KA 3QFRA 3JR3A 4HC4A 3QFHA 1I1HA 5AW1A 5BN1A 3QGMA 1TPYA 4F8JA 4LSWA 2YRWA 3K0SA 3EW7A 3KLNA 3AQ4A 1B42A 5DMXA 3JWEA 2IY7A 3WSWA 1XZPA 1CKEA 3M1YA 5CDFA 3TINA 1U0HC 4A8JA 3ZWPA 1YJAA 4KAXA 2I91A 1C0PA 4PSUA 1XZ8A 1PBNA 5TT0A 2FUG6 3ZE9A 4CMJA 5LPNA 2C7PA 2MINA 2OCPA 3ENQA 5FOVA 1YL5A 5A71A 4WNYA 3BJMA 4AYTA 2AK2A 3GEMA 4PLTA 3VNQA 2DUNA 1IBLB 2LBPA 4N39A 1QORA 3L84A 3PNQA 3W9YA 3HB0A 1PR6A 3HO1A 4R4JA 3B89A 3HDTA 3JTEA 3T5TA 4TZ0A 3GNQA 2CZQA 4TZTA 1S3SA 4J4BA 3FDZA 2HA7A 3BD7A 4FDAA 3RJ9A 2O8CB 1A82A 1HTWA 1P29A 3UB2A 3EXIB 4QYTA 4WLNA 5U9CA 5FTKA 3EXEB 3KKQA 1GGKA 1WXIA 3RADC 3FTQA 3HCBA 3E8XA 2QU7A 3UC9A 3LKZA 1Y4ZA 4UUOA 1PHPA 1DINA 1ST3A 1XZKA 1ZSNA 3G9ZA 2W6PA 4MINA 3ZGVA 3SC6A 1JQ3A 1HLPA 2R1ZA 1X7GA 1XG5A 2IHKA 2VYFA 3N8IA 1QTIA 1HDYA 2K2QB 3FLEA 4R5HA 1U8ZA 3GP5A 2H4YA 3RS4A 3TTUA 4CIBA 5F7JA 2OE2A 4Z3OA 1OI2A 1LDEA 2ERYA 1JBQA 2ZB2A 3G85A 3ITKA 3KC2A 4A8PA 4B8ZA 4ZQBA 3SHQA 3L40A 1Q2XA 3SJZA 4K3UA 2HM7A 3WKDA 4JC4A 2ZYWX 4QDJA 5K05A 2XOXA 2C9YA 2F90A 2ZJ7A 5CNKA 3PUVA 1FFBA 3CFYA 3CLRC 4LA4A 4NYIQ 4GR4A 5D2CA 3ACDA 5JYCA 1QC5A 3DTVB 1RP7A 1F20A 3H11A 2DZDA 4LK3A 3ACBA 1DQNA 1BJRE 4XDHA 1QZXA 3PXCX 5D51S 2CLMB 2D5IA 5FNVF 2G4CA 1GNRA 3BWVA 3QU2A 1V41E 2PMFA 4FE3A 4MQBA 4Z53A 2JZNA 4A23A 2GTIA 2F62A 1QZ3A 2RH5A 3FVTA 3G2LA 1TO6A 1YZ3A 3GPCA 4AIIA 4Y6QA 5JRZA 3CRZA 1A8HA 2J87A 4HY3A 4BLWA 3KYIB 4HDAA 1H5NA 3BTUA 3RYTC 1UANA 4ZYZA 3H3FA 1XHEA 1ZMTA 3FUCA 4RHTA 3S1LA 3R7DA 3NYRA 3JZAA 5JAHA 1IWPB 2B8TA 3RRYA 4B48A 1SHLA 1UMDA 2ADOA 3OD5A 5AK5A 3N0XA 1KERA 7REQA 2FSGA 2Y99A 3RRMA 4KMOA 1OPRA 2OD2A 4NH4A 4HLCA 4BEVA 2QLBA 5FFMA 5DIZA 2JFFA 1Y8ZA 1P80A 1G8HA 2FMHA 1TZCA 4BPRA 1CLEA 3EVFA 1JG4A 2DHEA 1OBHA 5JR3A 5KYNA 2EZ4A 3H1GA 2O14A 2JLRA 3CUKA 3OQHA 2JIZA 4QOJA 1QE3A 2AJCA 2Q6VA 3WP1B 1KP9A 4HVAA 4R9VA 2BUAA 1GTRA 1RADA 2F4VB 4MKXA 4ZREA 1F7UA 3CNOA 3O3NB 1CZNA 4G9GA 4YJDA 2QL5A 3OECA 4LOJA 4PRYA 5BYAA 2Q6TA 3IEXA 1KMHA 4IHQA 3N07A 5BQFA 3GFTA 3MF4A 1R0KA 3RGWS 5KCZA 3H1PA 2CUTA 1ILEA 1TKBA 2UYQA 5CW2A 4DR1B 1IOVA 3CONA 3CO0S 4GBJA 4M1WA 2YNMC 2E82A 3DQPA 4NYMQ 1P2BA 1LF0A 4IZOA 5AI8A 1L5KA 4MQ5A 4QWWA 2OG2A 4IQFA 3SXJA 4BVLA 4AM8A 1OBCA 3V9PA 4L5JA 4G5HA 4JU9A 4NLLA 1KEKA 2PYZA 2AS0A 4NBNA 1RE1A 4HDSB 2H0AA 4LTDA 1A1SA 4BRSA 1LI4A 1E1LA 3EMKA 3GOQA 4V1CB 4UD6A 1GPYA 1UKEA 2JEYA 3T35A 2AH5A 1AKRA 1QQ7A 1M1NB 3TBKA 1R10A 1KKLA 4IHJB 2VRCD 3IP7A 4R84A 5CFZA 4XXHA 1AKTA 5C1PA 3TAUA 2ZP1A 1LSSA 3TW6A 2P68A 4MKRA 1HBJA 2YWHA 1E8DA 1NVAA 2A2ZA 3PFFA 1LDBA 4CW7A 1CEYA 3ROGA 2HMWA 2KM1A 1MX9A 1ZGZA 3B78A 3RK4A 2V54A 1NSFA 3V8EA 1XU7A 2VP6A 1TIKA 1AC5A 2ZU0C 1KEUA 1GZHB 1SBCA 4JSRA 2PMEA 3ZHUA 1ZIPA 1NTOA 4HTFB 3N3AC 4HUQB 1JPNA 1EXNA 1SXJD 2PGAA 3QKWA 3HKDA 4U2EA 4AC9A 4B3XA 3TECE 2R1TB 4LFBB 4LGVA 2FCAA 4YTEA 3HDJA 3AG6A 4IIJA 5IAOA 1L7VC 2VVTA 2ZYSA 2ZZKA 3ISJA 4O4LF 4OBBA 4NENA 2Q1UA 1TL7C 2J0EA 3TRJA 4D9NA 4E88A 3TLXA 5EJ9A 3CT4A 1BH2A 2QRVB 4KIWA 4X85A 1IDN1 5DM1A 1SZPA 4M87A 4BO3A 3TG2A 4LYJA 3DE3X 3MEQA 3CF0A 4FQ7A 5KC9A 1NE7A 1FRQA 2Y05A 3IMEA 4GAEA 3HHPA 4JC8A 2YY6A 2O0MA 4UBKA 3R1IA 4Q4JA 1YNSA 2OBYA 2CFOA 3DDOA 4E14A 3S68A 2QRMA 4PTZA 4C2BA 2CTOA 4S2UA 4X63A 3HCFA 4BECA 1QYDA 1MZVA 2IHZA 1FZQA 2O1EA 2W2XA 2ZQ5A 3BQNB 3B8EA 3QFTA 4PLCA 4WNIA 1JXAA 5FWNA 1Y3BE 3H19A 1D2GA 4GX2A 2PA3A 4ND8B 3UGTA 2FW6A 2H65A 5GZ3A 4HYYA 4L51A 4LECA 2P3OA 2ADFA 1G20A 3NM5A 2RJ3A 1APBA 3R75A 4ILEA 1HDIA 3K15A 3LHDA 2ZYGA 2VJMB 2LGJA 3MAAC 5EPOA 2OZVA 5ERYA 2OAEA 2AHRA 3QVUA 4QFMA 2IYYA 1NYQA 4C05A 1P77A 1OH6A 2ONYA 3PWSA 1EEHA 4RJLA 1F06A 1LBSA 4W5QA 4G5YA 3RSCA 5AKIA 3JALB 3D3QA 1ISHA 1R0SA 3IEPA 2NZ2A 1JMVA 3OEHA 4QLOA 1HDGO 4F4HA 5DO9A 2YKGA 2PKXA 2W0SA 1O6FA 1IE3A 1OZGA 2VBIA 3EQZA 2ZSDA 3ZCPA 1IQPA 4MRRA 1LW7A 2QJRA 5ECWA 5KKAA 1RHQA 2XWBF 1Z0IA 4ANFA 4CR8A 1VIAA 1C1XB 4HSEA 3TQ6A 2BUBA 2EF1A 1ZIDA 4LFAB 1YIOA 3UGQA 4DPMA 2G9RA 2PD3A 4G85A 5FPYA 1GGHA 3UAVA 4ERXA 5KB3A 3FHTA 1HC7A 3HZOA 2Y0PA 2BEVA 5HZMA 4RK1A 4HV4A 3N7TA 1JDVA 4J91A 1ZQ1A 1E8NA 2ECQA 3OJEA 3PENA 1CYDA 4LJYA 2PX5A 3WGJA 4CNQA 1ZNXA 4ED9A 2B1IA 5LVAA 3IDOA 1GGEA 2EF0A 4N12A 1H5QA 2ZRJA 3DLHA 4FYIA 1T3GA 3DOHA 4F2PA 4A10A 2HCFA 3VZSA 5KWSA 1PUIA 1P2TA 1NOJA 1Y8QB 3MMPA 4C4AA 5YASA 3RUEA 2J6CA 2GD1O 3B36A 1R88A 3DF9A 1V71A 1FK8A 3FWPA 1XJCA 3IUEA 4RVHA 3WKCA 2JIRA 4TPKA 4F91B 2Z4SA 3OF3A 1WF3A 2P9FA 3ANLA 3E1SA 1QR2A 5JPIA 3TLAA 4ER7A 2QBYB 1JLRA 1CKTA 2ESRA 4UTVA 3F27D 1JEJA 3H5TA 2K5UA 2I33A 1A9ZA 3QX8A 1NQUA 4WFQA 4MS3A 1KJZA 2ICAA 4Z3DA 4PNPA 4LOHA 4C4YA 4YX9A 1Z68A 3I4LA 5KVSA 3LWDA 1RAEA 4OHWA 5HM6A 4DMGA 3LLUA 2W4IA 4KQCA 1KAQA 3R7NA 3AETB 5H81A 1Y7LA 4TL8A 3A3KA 1JJIA 2VRBA 5F23A 2HCJB 3N0WA 1GAQA 3ZS9A 4JS0A 4BN5A 3HB1A 1MGOA 2XCTB 2KQUA 3RC8A 3PLNA 1Z4IA 3CJRA 3SYKA 2G0TA 5CA1F 5JXIA 1SRRA 4UCWA 4ZT6A 4LXXA 3TQCA 4DLYA 2R6CA 3ZV4A 1NW6A 3V55A 3T9CA 2EEPA 3O4GA 4RFSA 3NAZA 1A0OA 3P52A 4FKZA 4EW6A 4ZKDA 2FDXA 3ZK8A 3ZG6A 1DIRA 2P9CA 1Z35A 2HX1A 3WYEA 1E32A 1WY5A 1G98A 1CQJA 1FSFA 1PUJA 1R6XA 1W0CA 2JF0A 2DUJA 4HDRB 4EG4A 3JASB 2VQ3A 2XY4A 2I3AA 2N46A 1IY1A 2BFCB 4OFZA 2NUTA 1RYMA 1JFFA 4BTLA 1WZNA 2YMLA 4RH3A 2DGDA 3U40A 4BFSA 4DUGD 3BKWA 4E13A 1UMBB 4NPAA 5HBGA 5JYEA 1E6LA 2XA9A 3H1AA 3L5OA 2OK8A 3IT3A 1CR1A 2OORC 2HA0A 2Q0SA 3ZN2A 3Q8LA 3S28A 4HMPA 4BMDA 1RZ3A 2J3DA 3U7EB 1TUBB 2B36A 5C8XA 1KSHA 1YJ8A 2OOSA 1W6UA 1WIWA 2B9EA 4ZT3A 4OB7A 1U5AA 3DYIA 1WXHA 1J6UA 1HYEA 5H68A 3SIRA 1WQ3A 3BMNA 5F52A 3P0JA 1IJFA 3QJYA 3TVYA 3X2SA 6NULA 1WB9A 1F7VA 4YUWA 2VWPA 3EG9A 5ALJA 3ZTWA 3FFTA 2CNOA 3AM3A 4OQNA 2GKGA 1VI6A 4CDNA 1QF9A 2YINC 2ODEA 3M1AA 4XM1A 3P94A 1VLJA 3SE7A 1J24A 2BHRA 2DR3A 2FP4B 3E8MA 3HFRA 3IVAA 4PSDA 3WRYA 3PC8A 5B57C 5KTOA 2G1AA 3HM9A 4OLBA 3TRDA 1Z2PX 2HQRA 2B5WA 3UTCA 4A16A 4A0FA 1OLUA 3SEQA 3O1HB 4UZSA 1PJ2A 2DTEA 2ZYAA 3Q40A 3CLRD 4ALNA 2NTVA 4AN1A 2ZS9A 3MS4A 4Q3LA 3FKQA 3IOBA 3A6HA 4KAFA 4LXYA 3ABIA 3FNBA 1HLDA 1WCIA 2YWRA 2EHJA 5D3ZA 4XE5A 3T1HB 1N2BA 1Q50A 1R5OA 3LRXA 4R1OA 4YLEA 3H75A 3IHKA 1C0EA 1ORDA 3I92A 5H4HA 4CTMA 1Q5PA 2JCYA 5K8JB 2JAUA 1X1DA 3W77A 1XT6A 2NM0A 1SFRA 4AX8A 4CIWA 1T1GA 5DVZA 4RTJA 3LTNC 5KJFA 3FCXA 1XZDA 1I11A 1FCJA 3L7OA 2X4LA 3RLIA 2V6IA 3RVNA 3WRVA 1KIAA 4BWFB 4E21A 1BXKA 3OMLA 3A1TA 4QTXA 1CQXA 4UM9D 4BC1A 1BSVA 4BGDA 3ADOA 1PZGA 1ZCJA 2HSDA 1O54A 2JJYA 4AJJA 1D1TA 5CHYA 7MHTA 1SBIA 1H8ED 4MUBA 1H3NA 4XW2A 3ND7A 2A7QA 1SU8A 2GXQA 4Z7OB 4RYDA 4G4GA 4B6RA 3KAKA 5ISMA 3O75A 3SQNA 2Q1XA 1QHFA 3KD2A 4W9RA 5BUZA 2X5NA 3EIHA 1Q6ZA 2CLSA 2XDYA 3TQRA 2Q3EA 3IX7A 5GOZA 4CL3A 2BEWB 2NVOA 4D3SA 3BSWA 4QRIA 2RDMA 4I1IA 3L8EA 4XM2A 2MIIA 3ROKA 2QZSA 1Z15A 3E7PA 3GUYA 3IAS6 2JBAA 1I13A 1PQPA 2QE7A 4OYYA 5FWYB 5BNFA 4YMGA 4Q6WA 3NJ8A 4FJ1A 5C8VA 4D6PA 1CERA 1L5SA 2ZJ2A 5BW4A 2ZULA 5FWDA 4KR0A 5LXTB 1HG0A 5IM4F 1V3TA 5FAXA 1UJ4A 4D6XA 1VBFA 3QXGA 3ZHZA 1BH6A 3IVXA 1YB2A 1CY7A 4LRSB 3WRWA 3A3YA 4Z4FA 1Q19A 5EUMA 2CHFA 3T7EA 3HLYA 4HQFA 4P98A 3D5TA 3WZLA 3LNCA 4BZZA 1YBHA 4GMGA 1MOPA 2H0RA 1PLKA 3CF4A 5IJ9A 5HUHA 4UFPA 1KDYA 4U0KA 4GBED 3ESQA 4QGBA 4E2FA 1KEWA 1ZWKA 2A3RA 5AK3A 5B1SA 2J32A 1NYLA 2QPTA 4Q1CA 2YWJA 3CLUC 2CEKA 4I6JA 2Q07A 1P2UA 3VPBA 3QPDA 5IJZA 3ROTA 5IVPA 1CR6A 4CMGA 5K09A 3QEJA 1ZR4A 2I6TA 3OQBA 2IU4A 3WIBA 3LPLA 4H6XA 5I4KA 3IUJA 1IZYA 1UIRA 1Y5IA 3HY6A 3JYQA 3QF4A 4PTLA 5D1NA 5GM1A 3TQHA 3ZCXA 3GVCA 3YASA 3VSEA 2HJGA 4OHVA 4HGPA 5C8YA 1PFQA 3THYB 1CUHA 3LX6A 2JKZA 4F3TA 4C4ZA 2AOVA 2CVFA 2WF5A 3P96A 5DGHA 3LBFA 5FR1A 4F6RB 1YFLA 1OB2A 1QKJA 2CLEB 5FI5A 5EVCA 4Q4DA 3STUA 3AERB 3LA6A 4H18A 3DDSA 4YJFB 3M2TA 3DBIA 3DBLB 3DH0A 1UK9A 3DTYA 4J49A 4LJAA 4HEA1 4K9LA 3TI7A 1OWNA 5K3CA 4MVJM 5U4XA 2VAMA 4K3VA 3VUFA 3BBPA 3QQPA 2P62A 1JU3A 4PYRA 4BJHB 2EJTA 1O0CA 3WX0A 1ZI6A 4EKEA 2HCBA 4ZJUA 1FFAA 4QICA 2H9IA 4QBFA 5I7VA 3I5XA 5JHGB 3O5AA 2J3MA 2BM1A 2M98A 1WHSB 5C34B 3AHGA 4AJIA 5B64A 4X9XA 2NYRA 1WD5A 1H2RS 1XD8A 3PUZA 4OK6A 3L6RA 3ZGNA 4I46A 4XH9B 3ZIAA 3KTAB 1E99A 3H6GA 3CPEA 3HNOA 2BGJA 1SURA 2LDBA 3PNKA 4IW3B 5CLQA 5G4KB 1CHNA 5JO9A 3GOHA 2JZOA 4EVQA 4M0PA 2G82A 5BWBA 5FF9A 1C30A 4R1TA 3W3ZB 1RQNA 3WBJA 5KNBH 2O2DA 1ONBA 5EWLA 4GNRA 1Z6AA 3R3UA 3R41A 2I9KA 1SWVA 4BNMA 2BFNA 3VJLA 4KK4A 3LC2O 3K73O 3C3PA 4JYZA 1D9ZA 1ADBA 2O2GA 2EWMA 2KB0A 4TKZA 3P9YA 2ANBA 1X7DA 1FUEA 3WGZA 1W44A 3B85A 1UJMA 2A0FA 3LFUA 4UEWA 4XPIB 3WLQA 3KD3A 4RVNA 4MLDA 4RELA 1YB6A 3GZJA 2PGOA 4GD3Q 1UK8A 4G1CA 3ZW7A 4BMVA 3A4VA 3VTKA 1M1ZA 3BFKA 1KDOA 2Q6KA 4M0KA 3F4BA 1KP3A 4MRPA 4NP6A 4WJLA 3KEOA 4D56A 3KU4A 1MIOA 3BE5A 3BK2A 4WBNA 1ZMOA 2X3YA 3UJ3X 3IKTA 3HKCA 5DI9A 4Z2YA 3WYNA 2YN4A 4M1OA 3VO1A 1MRSA 4V3BA 1T0UA 4HB4A 1B8OA 1GEEA 3DWEX 4HSGA 3U0BA 2DLNA 3MMZA 4DYHA 3Q98A 2ZAYA 2P0AA 4FD2A 2EZ8A 4ZAWA 4C0JA 1QFMA 3IP8A 4KO8A 4RTLA 1QHIA 3B2NA 3GAZA 4KIGA 5CXXA 2D59A 3CLKA 3KFXA 4NJMA 3CR8A 3PQDA 3NEPX 1PYDA 1FRVA 2OV3A 1A7JA 4YV7A 3NTQA 4O02B 4QD3A 4YAIA 4B4VA 2ODWA 2BEJA 1U7UA 3I1YA 4MW2A 2DPYA 4BQOA 4ZMSA 2RHWA 1E2IA 4MWDA 4RMGA 1EUCB 1ZK3A 3TYXA 4P5DA 4EHBA 3JQFA 4KE7A 2PSDA 3Q6MA 3UKJA 2Y9MB 1QYWA 3OUZA 4W99A 3OAAD 2MYNA 1GQRA 2XCUA 1N2XA 4GC5A 4O25A 5DNWA 4XB2A 4TKUB 3F5FA 5TMEA 5F2NA 3FYDA 4WPGA 3HYNA 3PS9A 2Y8EA 2WWIA 4JUBA 2C2HA 3AFOA 2W8BA 4LJ9A 3C74A 4QQNA 4RVDA 1E66A 3LL4A 5ENDA 3SMVA 1P4HA 2YH2A 3CPHA 2OHGA 5EAIA 1UZAA 3PUWA 4YQFA 5LZ2A 4QUGA 5HK9A 2P78A 2UYOA 2WHEA 1X94A 1B2RA 1F8UA 1SUEA 3WL6A 3X44A 5JAPA 5BN5B 1PDWA 3MW8A 3GLVA 2LR0A 3EA5A 4RV9A 5EQTA 9LDBA 3W8RA 3NT2A 1RKVA 3ICOA 1PGQA 1TX4B 4O2BF 1A96A 1NF9A 1CUJA 2ZZMA 2YS6A 2BMVA 3UXMA 1YB7A 4ZOAA 4OX9Y 3K6KA 2MHCA 3F3SA 4JYMA 3U4QB 3V7NA 4Z4CA 4Z51A 4B75A 5K8VA 4RWZA 1W7AA 2QM8A 3HGMA 1D2EA 1OAOA 1JGTA 2IGTA 4YJGA 5MGNA 4LMBA 1JZSA 2Z58A 3R77A 2VPYA 2H92A 1ZDMA 5I7UA 1DSSG 1MCZA 3IESA 4XYBA 5IEJA 3EDQA 2C31A 2AUMA 3D3WB 4L4XA 1UBLS 4BO0A 1G3IA 2YV5A 3L6EA 4IIFA 5EGSA 3ZCTA 4N6NA 4M37A 5JS2A 3VSDA 5IT9A 1DUSA 2XRFA 4W5JA 3HL4A 4X24A 2ZIVB 1E18A 1N77A 3DNMA 1I2DA 1FTWA 3UMGA 3HNRA 3ZJUA 3Q6NA 4HAVA 1NBAA 1FLDA 1EFTA 1PG0A 3ETEA 2QGFA 3HZZA 4H1TA 2P40A 4UMFA 1RE0A 3V7UA 1XDZA 4C87A 3A4MA 5E0OA 4EAQA 1BDBA 5K3BA 2HV8A 3WGKA 4NU6A 3CW8X 3I5MA 2HD4A 5JEDA 1G21A 3QLTA 3UMFA 4ZYYA 3TD2A 1DDOA 1ZH6A 2AE2A 1ZHHA 3F5MA 1YCDA 1YR1A 3LLVA 1LEHA 3OJFA 4OSOA 4X64B 1CNMA 3X2FA 4UHHA 4P8RA 4FSXA 1RM3A 5FA8A 3RPEA 1SVIA 1RC1A 2H6EA 4QELA 1YJQA 2V97A 5EP1A 2O7RA 3VPGA 2HO5A 4C0HA 1ZH8A 1V1MA 4MQEB 5KTKA 2D7LA 2Q3LA 3CKYA 4Q21A 1UL1X 4FR5A 2BTQB 4Q3OA 2QVLA 5G1NA 1U5BB 4H35A 1SC1A 5CX1B 4LJ4A 3W78A 1KO1A 5E3HA 1AUXA 2OEPA 4QU9A 2P4UA 2A8YA 3IDZA 2VTVA 3LCJA 3MLAA 5DHUA 5H7XA 3RJZA 5J4VA 4MDFA 2BFEB 4ZCRA 3AUFA 3EOAI 2VZ9A 4ND2A 4URZR 1A04A 2EL7A 2WSSD 1Y9EA 3OZGA 5HKAA 2C3OA 3PNYA 4I2VA 4A03A 2WU0A 3KR9A 5TNXA 3L4EA 3WV5A 4EELA 3WGMA 3AHFA 3FCYA 3LT2A 3B52X 4YV1A 1RBMA 2OHFA 1NBMA 3LVRE 3L41A 4M6WA 5DHQA 5JJBA 1YR7A 1FQOA 2E4YA 1P31A 2RI0A 2ZBVA 3A6EA 4LY0A 1NMXA 1W6RA 3TUJC 2R79A 1J9GA 1L9XA 1JDJA 3PT9A 4V0ME 2BAGA 2AXQA 5CLGA 3RSSA 1F3LA 3F7NA 1I7NA 3Q6IA 4X8HA 1YH3A 1JEEA 4YBZA 5KSZA 2IEIA 5LMNB 4FU0A 5AOCA 3EXG2 2ORED 2J9FA 3MCAA 5I9BA 4FMPA 3DMTA 3HUDA 1HQYE 4KTVE 1AB6A 3HV0A 4CNBA 3OZSA 3NANA 4DIBA 5IHPA 3DCJA 1R66A 1Y6GA 1JR4A 1QH0A 3TTYA 1KEZA 4XYLA 4DSUA 4H1UA 2ZM6B 1KYVA 1TIPA 3DZKA 3NGXA 4AJ1A 4CM8B 2HJVA 2VF5X 3DEZA 5IZ4A 1US8A 3VSCA 3OFNA 1IU9A 1JU4A 1K27A 1KC3A 1RLMA 1ZD1A 3KKKA 4P4SA 4R2MA 1HSZA 3UW3A 3TLGB 1V64A 1SOAA 3Q3CA 3NWPA 3BRCA 4Q66C 5T4HA 4C22A 4RE6A 4WE3A 3O1JC 2HZ7A 5GPBA 3FFBA 1G291 1UFRA 4JOSA 3FYHA 1XFDA 1XZQA 3PTLA 1DKMA 1OFTA 3N1UA 1LZLA 5ILOA 3DTNA 4YT5A 4XEHA 3H18A 2XODA 1GCGA 1H0HA 4O1IA 4QGFA 3FLAA 3SJUA 3E9RA 5AW9A 3TX2A 1LVUA 1VL5A 3GIWA 1NVKA 4D92A 2IPLA 4KSBA 5CVEA 4X20A 3ED5A 3EFBA 1R9NA 5F2KA 1DT3A 4J0EA 2YDXA 3RKSA 3V1UA 3I28A 4UHKA 1GGNA 1RZVA 1P5HA 1KDPA 4GM4A 2XSZD 2JEZA 5NLLA 2NXNA 3MPOA 5K6AC 2PMKA 5FNVA 3A3PA 2JGMA 2YYSA 5D1HA 1JLKA 3CX3A 2Y0EA 3HEAA 3WLIA 5DSXA 1SBTA 3VFDA 2EG9A 2NVUA 2P6OA 1P1IA 3DFZA 3LCCA 2PM8A 3BE4A 3I1IA 3OG9A 3QMVA 2OESA 4IINA 4LJ6A 4PZCA 3VVCA 1GL6A 2ZAOA 3ZWCA 4IIBA 4L15A 4NJOA 1TJ5A 1M67A 3PRKE 4LJSA 2AMVA 3CNHA 1ZXLA 3L06A 3GQVA 4IH9A 5LIPA 2MSLA 1IN6A 4Q0MA 2KX7A 1Q7RA 2QIOA 2XYVA 1XDDA 4MV5A 1BS9A 4O6VA 4RQBA 1KDVA 3SJBA 2ZG6A 3OX4A 4FNOA 4B8YA 1E7WA 1V7CA 4A8JC 3U6BA 3CLUD 3NRCA 3I6BA 5BWOA 1BGXT 1Q83A 1KIMA 3NHWA 5CYOA 3STVA 3EXHA 1QRRA 3EY9A 1R7RA 2XWPA 1LFDB 2MSWA 2YS7A 1X8XA 4TWBA 3AJ9A 3FYTA 4CUJA 3VJKA 3C8UA 1KS9A 2B30A 2WABA 4QXMA 2Q4BA 4ZVPA 4NMLA 3IT1A 1KRXA 1KK2A 4OHMA 4UNIA 2PL1A 1VHTA 1N25A 5GGXA 1SXIA 2FQ1A 1LNQA 2BHLA 5HGJA 2V9PA 3G0CA 2TS1A 3Q7TA 2A1TS 1KWGA 2A94A 2GN1A 2REOA 3FYSA 4EPRA 2WM8A 4ER5A 1G6KA 1OREA 2O48X 3JAWB 4NRDA 1OH8A 3KAQA 4U39A 1WO8A 1Z3CA 3A3NA 4PG4A 4XD7A 4WXYB 1RRKA 3ONEA 3QVGA 4FOOA 1PWHA 3QUAA 4ARZB 5KHAA 4EX6A 1GCAA 2VSQA 2QG6A 3BCRA 1ADGA 1LS6A 1Q22A 1HSNA 3EDRA 3NHKA 3CUUA 4NTZA 2WTXA 3ZTYA 1HG1A 1S8OA 4COKA 3AVPA 3O82A 4EM6A 4J7UA 3A6DA 4ZMBA 4C76A 3QPUA 2Q3CA 2GWHA 4RMJA 4BRWA 2PS3A 2YY7A 3GX1A 5JNSA 2E4XA 4BEJA 2AOUA 4X91A 4QDKA 3DT9A 5CYGA 5J4HA 3CA8A 4JI0B 4NEGA 2C04A 3ONNA 5FUMA 3QEMA 4BXOB 1XEXB 4B2YA 1DMRA 1XU4A 3ZXXA 2PRIA 5JVDF 5LQAA 4HN2A 5G41A 3ZXIA 5DN6D 4RPHA 4H59A 1JAIA 3FR8A 3I4FA 5EE5B 5A7FA 4B3RB 1GPBA 2EJWA 4Y6RA 3RH0A 4PWYA 1O9HA 2CLHB 3IMKA 1PZEA 4G67A 4US2R 4K9MA 4TQGA 1GXSA 1I10A 4KJXA 3GF4A 1C2TA 3CR7A 4DC1A 3NQ41 4BP3A 3E58A 1TLTA 4WTOA 1P4AA 2F1IA 4GXQA 1ZFNA 2XE6A 1YZGA 3QOXA 2PMDA 4OATA 1EE1A 3SSNA 1BKYA 3KOOA 1VFPA 2WIGA 1Z63A 2CXXA 3L8FA 3H84A 5EZYB 4WK6A 3DP7A 4N1AA 2TSYB 3A1WA 4X90A 1JSXA 3T7SA 2XNKA 4O4LA 2Q5EA 3D7SA 3OPVA 1EUDA 4F4JA 3PP8A 1EMDA 3NX4A 1BX3A 3VNSA 3R5XA 3WWDA 2C97A 4ZVLA 4EY5A 5H4GA 4BBPA 4MQUA 1QIIA 2AK3A 4KVAA 1W4CA 2PX3A 4E5DA 4U1RA 1VMKA 4D0RA 2ACEA 2ZTSA 2RCNA 1I6KA 1EVLA 4YAEA 4BRZA 4WZ6A 3C2QA 2O52A 3AUAA 3P8ZA 1B93A 1EUYA 4WK2B 4XLLA 5L3RA 3PNSA 4OJNA 2NIPA 4U7WA 2HA4A 1CJUC 4IGKA 1LXCA 3UYLA 2WJJA 4TSFA 2JAQA 5ENVA 2FZGA 1P9NA 4WIAA 2D00A 1U0RA 1GG8A 5C4MA 4AT1A 4PN3A 2H1LA 1T6YA 2IYEA 3U9SA 5KHOC 2LKDA 2IKSA 3P4YA 3KRTA 4JJFA 2VOEA 4M3NA 3IA7A 5IAAA 3PPWA 3JD0A 4EDHA 4ZJPA 2RHMA 3FLMA 2GCIA 3WNZA 3GJYA 2G09A 3IRUA 1FUYB 3IQWA 2HU8A 3UJ8A 3W6OA 1RPAA 3DT8A 3FUUA 3CX6A 3WK8A 5JRDS 1AZSC 1YRLA 3C6YA 3UJ7A 2C2BA 8GPBA 2W6IA 4RY9A 4AMUA 1U2RA 1U80A 3RC7A 1RTTA 1NU8A 2MOKA 4KPEC 2AOXA 3ST7A 2R8ZA 4FDMA 5E9WA 3TBHA 3VKUA 2BFBB 3VQTA 4UOEA 3D4BA 5IT5A 2AYZA 1NE2A 3GL9A 4G4JA 3TW0A 1SPBS 4A8TA 2WOJA 2OVBA 3BMQB 1YKFA 1I6LA 1L4UA 2UVPB 4YBRA 1DEXA 1U2DA 1LLQA 2ZYRA 4CJXA 2IXAA 3QW2A 4M1KA 2OPHA 3VBCA 1U2ZA 4CTJA 5LZ9A 4UTXA 4GPTA 3T5DA 3EFOA 4DV1B 1EQUA 4YS6A 3SHFA 4HXYA 1B4DA 3O31A 1DX6A 4GYYA 2F17A 2JANA 1Y1KE 1Q20A 4KXMA 1LNSA 5K0JA 1AM4D 4S2EA 5CDGA 1T0BA 4WBXC 2FGJA 2Y1CA 3CW9A 3WGOA 2FUNB 1FNMA 1Q15A 1Y80A 1BJKA 1JG2A 4QTTB 4V38A 4BP8A 4RIEA 4D0NA 1K63A 1U2EA 5EHQA 2HWXA 4WT7A 4XDZA 3T0GA 3X43A 3FOEC 3MOSA 1FW6A 3UKOA 1SCUB 1AD2A 1ZCZA 3KLMX 3INYA 1C5KA 1MO4A 1UBJS 2CF5A 1M6WA 3CH5A 4OIFA 2GN8A 1QGZA 2A0XA 1OFUA 4YMVA 3C5WP 1KSJA 2VNSA 4MV7A 4DCNA 5FLYA 4MWGA 4RDCA 4UUPA 2Z6VA 5CLIA 2Y4NA 3MJHA 4UUNA 2XT0A 3EXFA 4BO9A 3H0CA 2O2SA 5J2TB 4TN5A 1BVHA 4RKWA 3W2GA 4QGGA 1Y1LA 1S01A 2QDXA 1TCVA 4RW0A 1NY6A 1PR9A 4XWOA 5F98A 1WZ2A 2NV2B 4JT4A 5IU6A 4INOA 3PJEA 1AGXA 5FORA 4RK7A 1DC5A 4Q3EA 3ZBTA 5FOSA 1WE2A 3PRHA 5BYKA 2J0QA 1ZGJA 4BX9A 3NI2A 3ZWNA 3HB9A 1DAIA 4NATA 1W85A 3SLGA 2HXYA 3PYXA 1EM8B 3RVQA 1PD1A 3U44A 1QTRA 3RUDA 2Z4RA 5KSOA 3WTBA 2CRJA 3WGTA 3FH0A 1MV5A 4AO6A 5HCUA 4JJ7A 4G4SO 1GTSA 2JHCA 4DNPA 2RHOA 4Q15A 2HRQA 5CA1A 3JQ6A 3V1LA 4HNAA 4IFIA 4ZVKA 1A7AA 1G64A 2XAAA 4FOSA 5M34A 2EXXA 1Z7BA 3OCWA 3FUXA 5JDIA 4BV2A 1BDIA 1SUFA 3CPSA 3DC7A 3ZEAA 3EZNA 5JH7B 3UBTA 5T41A 4YCNA 1BDMA 1E3SA 3EZLA 3BA1A 1D6SA 4LIPD 4P4NA 4TTAA 4HYEA 5H83A 2XQFA 4A36A 1U02A 3QSGA 1BU5A 1R9MA 4LXGA 4AJNA 2X8JA 1A2QA 2QX4A 3K31A 3M4NA 5BW5A 2FWIA 3O2NA 1C9KA 1J0DA 3FGHA 1DAEA 4L4YA 4UFNA 4H27A 3AT1A 4Y2QA 2DAPA 4BNUA 3ZU3A 4X61A 1TRKA 3Q7QA 4H17A 3UCXA 4GZ3A 5HOEA 1GZ5A 5JAQA 1J1IA 2QN9A 3V2IA 1UBOS 1XMQB 1T8TA 2ZE8A 2Z1NA 4MTLA 1QCYA 1U7ZA 2FW8A 3VC2A 2RHTA 3ZU6A 4YUYA 3RSHA 4JEUA 2KWIA 4LY3A 5F21A 1EVEA 3KPYA 5CCEA 3GXBA 3MTJA 4ZHSA 5JAZA 2CLLB 1ZVMA 3H5OA 3MB8A 4ZD6A 2QSYA 4FWIB 4YQZA 1XKTA 4DCUA 3S27A 2UYGA 3HMKA 2AE1A 5HF5A 5B7PA 2NPIA 1DXHA 4Z1MD 3JW8A 3JQCA 2NTEA 1M1YB 2C4MA 3JRNA 3M49A 1L1RA 4NBVA 3QXSA 3AC0A 3K4QA 3AB7A 4YMUA 1GUAA 2BEUA 2CXUA 1JFTA 1ZVQA 2Z8YA 5IZCA 1ZIXA 1SHZA 4N47A 4WASA 5KOHA 3IP1A 1SUDA 2FFHA 5EJ6A 1E6KA 2ZB8A 3UMBA 1TEXA 2BV3A 4ZVSA 1Y1PA 2ZWIA 4HS9A 1EFVA 3GG2A 1BYIA 3A2LA 4BVGA 2A5GA 4M9SA 5LBUA 5BSWA 3B1ZA 5C53B 1LA2A 4UARA 1T43A 3LFTA 4LZNA 1NTRA 3SD7A 3WGQA 1RU3A 1JQLB 1COWD 5DTRA 3BGIA 2B78A 1MB2A 1PTKA 1R3DA 3N8HA 2KE5A 3IQHX 4KBFA 4EPYA 3MWKA 2OZKA 3V6LA 1EJ0A 4RF5A 3G79A 2YHBA 1JHRA 2FTKE 1E0SA 2H29A 4EW3A 2ZVDA 4E2WA 1BIFA 1H0SA 1J7KA 2GBGA 4QWMA 1ORVA 2RAPA 5CM8B 4CLHA 1HMEA 3QX9A 5HJ5A 2PWZA 4BN4A 1XEWX 3ETLA 3OBBA 2NXCA 5LA6B 3RK0A 3SNKA 4EBFA 3H2GA 1G7RA 2FJPA 3BL6A 1U0OC 5IPFA 2XZLA 1SUPA 3NHMA 4MR9A 1R4MA 3MNFA 4EJMA 2GBLA 4W82A 1EB9A 1E9AA 1GUDA 3GROA 1UPBA 1USWA 1YMQA 2G71A 4IUYA 5LQJA 2FY8A 3AP1A 4B82A 3DEIA 2Z04A 1FFWA 1L7RA 1Q21A 1VJ5A 2AOTA 2QMQA 2CK3D 3V8QA 5I4CA 2V98A 3LKVA 4FFWA 1MG5A 1X86B 3TNJA 3LY9A 1T2FA 1DKQA 3BA6A 3V8RA 1NW8A 3SZRA 1H1LA 3BMOB 3ECSA 3JRWA 3M6AA 4LXUA 4P2BA 1ULUA 2XD9A 1YULA 2F6RA 3AR3A 5ESRA 5IKXA 1PJAA 4GVLA 3PRYA 1CDZA 1AS0A 5EZYF 3KB2A 1RYBA 4BWGA 2X15A 3EUWA 1J20A 2XRMA 4PC3A 5IMBA 4C7XA 721PA 2QL6A 1IJEA 4RLQA 4U2CA 1HI9A 4WCDA 2QT1A 5SYAA 3W4JA 3PUHA 4EZEA 4X7PA 3SQMA 4DT1A 5EKSA 2F3QA 1RLUA 2BFDB 2IDJA 3Q3IA 4Q4HB 1GV1A 2OCYC 2XWQA 1BE6A 3SFVA 3P9NA 3REGA 5C51B 4L6IA 1HM5A 3DDCA 4OG2A 1HMFA 1G8AA 4ZO8A 1Y42X 4NONA 4NICA 2NO5A 1JA1A 1VL0A 3T3EA 4A7PA 5BOSB 1X92A 1RXWA 2ZIWB 1SCJA 3PHGA 1M2OB 3IP5A 4KXUA 1VSTA 2L19A 3PGKA 1M6VA 4A15A 4FT2A 2RBGA 1MJHA 2VWQA 3D8TA 4IQ0A 4LXTA 4NCXA 3ANNA 4DZTA 5B2FA 3CO5A 2AZDA 4NOKA 2QAJA 2FWBA 4WOCA 1BX0A 4QSMA 5KOJA 4NCHA 3C70A 4P82A 4WEQA 1BW9A 3RIMA 3WI7A 4ARCA 5TMPA 1G5IA 4X6UA 1JAHA 2PKYX 1PFVA 4OB8A 4H4EA 1ZJ4A 3E53A 4A73A 1NRIA 3HJRA 2X4IA 2JBWA 2IYOA 2ZIFA 1DL5A 3OE1A 4OK5A 3F6RA 4PHGA 2AI3A 4Q02A 4ZPXA 1ZRHA 4DIOA 2IHVA 3L0IB 5JAUA 1OX4B 1SIUA 3NBQA 3NVMB 4CEIB 2IYNA 3KOZA 4CMIB 2HF2A 2R4TA 3MCUA 5HRUA 5AVSA 1ML4A 2M6KA 4WZAB 4UAJA 5K1ZA 5EPUA 4GE3A 4DQDA 1LBHA 4C2TA 1NJ8A 3FUVA 4FHDA 4L02A 4TLMB 3N58A 5AO9A 1KPIA 1P3Y1 4A4DA 2P2SA 2RK3A 4KFRA 3VISA 4F96A 2C4UA 1PTJC 4GOKA 4C4XA 1HV8A 3I12A 5B1DA 3I42A 2HWWA 3FPEA 1H05A 2WJ4A 3OHPA 5C52B 1SNYA 1V96A 3S29A 1BCRB 2P11A 1WG8A 4H1HA 3AEQA 5H5JA 2QTCA 1OILA 2PEZA 4FDUA 4J9VA 3RCBA 1UM8A 1PO7A 3TZCA 5CFOA 3TO5A 2P79A 1BN7A 2QN1A 1YT5A 3M81A 1QCDA 4YWJA 2Q2WA 2RHCA 1ZVJA 4MQFA 3CINA 4TTIA 5AW7A 3PQEA 3VKVA 4P2GA 2NN3C 2OXTA 1Y33E 3KFLA 2WHRA 4G0ZA 4JL6A 2DCMA 3SYRA 2DVMA 2P91A 2PPVA 1XC7A 5HS4A 1PT9A 3EC7A 2YHIB 1WDMA 2PT7A 3CVVA 2I1QA 1OLOA 1V8DA 4KSYA 3W2EA 3VA7A 2YZ2A 1FA9A 2VYVA 1BHO1 2QD2A 1NPDA 3EASA 1H6CA 3QLUA 3UK1A 3W6ZA 5IF3A 5KYUB 1OXTA 5L7TA 4YN3A 1KK1A 3GPBA 2X3FA 3TQTA 3MWEB 4AO7A 1E5QA 2I6GA 4W9NA 1RWXA 4E09A 1UPUA 3DONA 3HEMA 4FLEA 4MVJH 3DZHA 2R8EA 4MDHA 1RWPA 5EXTA 1T25A 1MP0A 3TOSA 2FPIB 2Q41A 4WINA 3H0EA 4RTKA 1SQSA 4I50B 5JROA 4M9ZA 2Y0DA 4RJ2A 3QTTA 2VNIA 3JQGB 1JB1A 4LDQA 2ZBQA 4G0XA 4PQGA 2WVGA 1IZZA 3OJ0A 2J3LA 3C43A 4DSTA 2PUGA 4TM8A 2P2CA 1ZN7A 1VKNA 1SKBA 1WXQA 2EP8A 2WM9B 3F9CA 3OTIA 2GCGA 1RWQA 4JKOA 1GO2A 2OO5C 2O4UX 4OHOA 4FBLA 5KDLA 1QWOA 2CXPA 2QTZA 3TL2A 3AIMA 2AFHE 2IIQA 3VZRA 5AQ1A 5GJBA 1AU9A 3GH1A 1NOKA 4XUCA 1U1FA 1U7XA 4CEJA 1SK8A 1U2TA 3OWOA 1YS2X 1W88B 1A3CA 1BOFA 5DEOA 4J3NA 3H04A 5K8UA 1UEIA 4K2AA 1E5VA 2ZIXB 3KJEA 4W5TA 3K7EA 1K6MA 1NSTA 1N0VC 4LEIA 4N03A 4X1KA 3CM0A 1QV9A 4C0WA 4RD2A 1E1RA 1UOOA 2CL0X 1I3LA 5EP3A 4DBLE 3I5UA 4DQLA 2X0EA 1WCYA 4QRHA 5M5BA 1YQ9A 4V24A 3SIPA 4JLKA 5EWMB 3AYZB 3K53A 2XH8A 4DM3A 5P21A 2C2WA 2G77B 1PIWA 2BJVA 1Y5MA 2H54A 3A1UA 3IB6A 5LWQA 4BL5A 2QN8A 2V7QD 1CUCA 2XR1A 1L1QA 3B51X 5AI0A 3WHPA 4RD4A 5KYYB 2HHHB 3WKAA 1AKUA 5H3CA 3U2QA 4JLNA 4O2BA 5D3MA 3FCUB 1QUEA 2Q6OA 5BQ5A 5CB6A 2AKEA 4ZTBA 1E1NA 5CIWA 3U3ZA 2O8EA 2HA3A 2DFKB 5JDCC 2UYCA 2CNWD 3AFNA 1QQTA 2ZRMA 3FVVA 1SA0A 2ZWMA 1J0XO 3FPHA 3E8SA 2IEDA 4JSTA 1GUYA 2NGRA 3AU8A 3EB9A 3PEEA 4YRDA 5EUBA 1PL0A 4EA8A 2OYCA 2EKZA 5CFLA 3PC4A 2GA8A 1EZ4A 2QD1A 4DCSA 3QY0A 3C6QA 1NJGA 4JK3A 1QQ5A 5JG7A 1HYBA 5INTA 3FCOA 1Z82A 4FONA 5KTSA 1Q1GA 1OF1A 3WRXA 2BOVA 5AKEA 1ATZA 4JELA 5DTMA 2W6QA 3ZY6A 5KNDD 3PE6A 3HA7A 2H8KA 2QYOA 1H8HD 4YRGA 3B20A 5BV2P 3GFSA 3SIWA 1UDXA 1AQNA 5BRNA 1MH9A 3EK2A 1HE1C 2OKCA 3DZCA 3UAWA 1K7EB 3JZMA 2DFNA 2WKQA 1SKYE 4F60A 1DZ3A 3IMGA 1GG5A 2ONZA 2XB6A 1IPEA 4Y1RB 4TMXA 3UWPA 4K6KA 2XEDA 2PH7A 5HCIA 4YMLA 4IDOA 4FN5A 2YWFA 3RT9A 1Z56C 3TW4A 3GEIA 3ADBA 4Q9NA 3RFTA 1EUZA 3VPFA 2PAAA 1DBQA 2Z8XA 3EFHA 5LYJF 3R4VA 1QOPB 1ZJ6A 4XOIA 1NQXA 3I76A 4S1NA 4PGAA 3INRA 3W06A 2AG0A 1U1EA 2B98A 2C78A 2NU6B 4L7VA 4MZDA 5EG5A 4EB3A 4QE3A 1MGPA 3EOZA 1FP1D 2O57A 2JFOA 2R00A 4PX5A 5LQCA 1JR6A 2QKYA 4Y98A 4D9GA 4IIEA 5BQ3A 4Y67A 1A2KC 4M89A 2G80A 1TO2E 4DLTA 4F3CA 2HT1A 2FR8A 4NCAA 4V0MA 2ACKA 4DZZA 3OIWA 1KMCA 1CE8A 3EY4A 1RCUA 5K0SA 2HIAA 2WV7A 1WDLA 2YXDA 2Q0XA 3A6PC 2Z2XA 4GWLA 4LHYA 1Y98A 2B6HA 3PUYA 3T1YB 2FFJA 2VYNA 1ECBA 3D8SA 2XXAB 1XFAA 2QV0A 4C7JA 1P3JA 4E5PA 2NZXA 5JYBA 2BBSA 3AF3A 2DPMA 5AFSA 3SBXA 4WVLA 1YONA 2JHAA 4ENTA 1R9JA 1KF0A 1Z2CA 3G2IA 2BKLA 2JIQA 3AOEC 3Q41A 3O4JA 2VJNA 3GI1A 4PCAA 5JFGA 1Q11A 1LBIA 4EEZA 2F67A 1I5EA 4NESA 3FRIA 3EQ7A 3PC7A 1R2QA 2I2CA 1JLLB 2UZ1B 1DBPA 1HDXA 1RKXA 2VR1A 3C4VA 1MNQA 2G0NA 3H1FA 3L7IA 3MWYW 4YXWA 5HQ3B 1HE2A 3N59A 5AJXA 2VT6A 2R8PA 2JFUA 1IC6A 3K1AA 5CVVA 4C78A 3KELA 5JYDA 3AU9A 1D2CA 1KDRA 1YE8A 2YXEA 3TIGA 5B4VA 1F8YA 4QZVA 4W7IA 5JSZB 2G8NA 2RH9B 5CXUA 4RTOA 2EW1A 4QUJA 4A5SA 1OWLA 2IXGA 5BWLA 2QQEA 3IXQA 1RXYA 5K3DA 4J0KA 4CHTA 5H82A 2VQEB 1QMPA 3DZBA 2BGGA 5JLJA 2AN3A 1AKQA 3KYDA 2O54A 3IKVA 4TYPA 1M5RA 1MBZA 4BZWA 1M9NA 4BY9E 5ITWA 5ALPA 2F43B 4QPZA 3TOVA 5LLTA 1H2FA 3F6YA 4QYIB 5J4LA 3T52A 4XQCA 1L5VA 1CNFA 3D4OA 3NDJA 4J29A 4PYQA 5G0WA 1XMVA 3AGQA 5CEFA 1E6EA 1NN1A 2WJWA 1O0SA 3KEGA 1Y6ZA 3D64A 1U0EA 4OHRA 4FQ8A 4Y2XA 4DV5B 1DDGA 2Q7XA 4UEOA 1X13A 1RRCA 3G2NA 3G0HA 1YACA 2WWYA 1ZK1A 1G7SA 2O1XA 3OA0A 4E15A 1P2DA 2DKFA 3HBAA 1WBDA 3A9VA 4RMHA 1SC3A 1NJ2A 4R1UA 4E46A 2J3IA 2HQBA 4MV4A 1NMYA 3A4TA 1KQOA 1VSVA 4M8KA 5J2UF 2OXRA 1P9LA 2L18A 3JVDA 2HK6A 4HJRA 4JKYA 4YHHB 1I80A 4CFZA 1W0KA 1LJUA 5EE9A 5JU6A 4CMEC 2WTBA 1RM5A 2AQKA 4B4DA 2P27A 4QQKA