5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
source organism Brucella abortus biovar 1 (strain 9-941)
molecule tags Oxidoreductase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
3NJ8A 5C7IO 4E2XA 4ZICA 3GFBA 4B4WA 4WLFA 2BLLA 3GNTA 3HADA 3LT0A 4L4RA 3SBOA 2HK9A 5TX7A 3PI7A 3ROQA 3MOGA 3VH2A 1XQ1A 3I4FA 4LN1A 4WUVA 1B3RA 1DRVA 2GF2A 5JLAA 1V3UA 1U3WA 3P2OA 4Q3AA 5JC1A 4H16A 3BMQB 1YOVA 4NK4A 4I5EA 4BO0A 4NU6A 4INAA 1C0IA 3GQVA 4MKZA 4CV2A 4XYMA 1NTOA 3LSYA 2B37A 2VHWA 5JY6A 1E3EA 3VPXA 3HDQA 4JROA 2G5CA 1W8DA 4N54A 4DQVA 4NBRA 4R54A 1E6WA 5CDTA 1ADFA 3DBHA 4MP8A 4I9NA 2NTVA 2AW5A 4FQ8A 4Q9NA 2WJPA 3C1AA 3AM3A 4YT2A 5L51A 5A5FA 1FF9A 4IJVA 1YDWA 3VC7A 3EZLA 1UAGA 3QWHA 1PGJA 2Q3EA 4IDCA 4L76A 4YWJA 3RKUA 1EK5A 2C2YA 4XEHA 5DNAA 3Q1LA 2BGLA 1FJHA 1KEWA 5KNLA 3JQAB 3DZGA 3ADOA 5L45A 1ZFNA 1MXFA 1DB3A 1NR1A 3D64A 3O4RA 4ESOA 1D1TA 4ALIA 3ZW8A 4CQLB 2Y66A 3GVXA 1QLHA 4IDAA 4FW8A 4UEJA 4OOFA 1GY8A 1YL6A 5TS3A 1DIGA 5L7YA 4WEOA 1R4NA 3ZCXA 2DPGA 4B3JA 3H6KA 1P0FA 4WE3A 3DTTA 4IGEA 3RD5A 4BGVA 1JTVA 2Q1WA 1A5ZA 2CDAA 4PLZA 4XYBA 4AFNA 3R6DA 1U2GA 3B1JA 1E7QA 4RVHA 1W4ZA 3QVTA 3RAJA 1PJ3A 5KVQA 4BGEA 3VOSA 2BRUA 3KETA 4CV1A 3BMNB 1L7EA 1IL0A 3E03A 3F47A 3IC5A 1LDYA 4PLGA 2QRKA 5FF9A 4XCVA 4JIGA 2X86A 1GPJA 4UVIA 1EE9A 5TIIA 1E3SA 2J8ZA 3M2TA 1GUFA 1IHYA 3GHYA 3OICA 3E5RA 4LVCA 5L40A 4D44A 3GR6A 4IIVA 3UOGA 4UEOA 4E32A 4DMMA 3MJ4A 4P4LA 3OIDA 4Q3DA 1UXHA 1U7HA 2OP1A 4J7XA 1U8FO 2VOJA 4OOEA 3ZWXA 4BNYA 1HDOA 5T5QA 4PFJA 4J2OA 3L9WA 4IMRA 5CG2A 3BHMA 3DZKA 2DTDA 2O4CA 3F1KA 3PTZA 5EINA 1VJTA 2O7QA 3RC1A 3G17A 3L4BA 3AY7A 5I7SA 4O63O 1GFSA 3WGQA 4K28A 2I67A 3AY3A 3HDHA 5AXCA 3R1IA 4EITA 1LA2A 4BO3A 5B37A 5L95A 1Z7BA 4N7RA 1JW9B 5G4KA 1RPNA 4L8VA 2O4UX 1QRRA 4LSWA 1H94A 2LDXA 3WBBA 1JVBA 5TQVA 4B3HA 3U4DA 1YH3A 2Q1UA 4CQMD 1HE5A 3RU9A 2C7VA 1YGYA 2DU8A 2H1SA 2O3SA 2X5OA 1ZKMA 3W6ZA 3AY6A 4CR7A 3RUCA 4BMVA 3QVOA 5JYDA 4IDEA 1B3BA 4K1LA 2E82A 2Z95A 1NPTO 2HAEA 2X0IA 1T24A 1QYCA 3H2ZA 3PQFA 1YB1A 3K31A 4IXWA 5KJEA 3SJUA 4RVDA 2FPIA 1ZBQA 4YAJA 2ZK7A 3WYCA 1X7GA 2OOSA 2X22A 2Q99A 3PJGA 5C7OO 3L4BC 3HB5X 1UP7A 3ZWMA 1GCOA 2WM3A 4RVUA 4TZTA 2AQKA 4BKQA 5KJFA 2CD9A 3QLJA 1E7WA 3QW2A 1XG5A 2PR2A 5KKCA 1PU2A 1RJWA 2EGHA 1E3WA 5L7WA 1PIWA 1GADO 1RM0A 1HDGO 1XWFA 4AJLA 4YT8A 5JBIA 3T4EA 3IKTA 3HSKA 3WLEA 5IN4A 3O38A 1KETA 3ETGA 4QT0A 4P4NA 4CM8A 4J6FA 3RJ5A 3M6IA 2AG5A 2E6UX 1W0CA 2X7HA 3A4VA 4Z6KA 1U9JA 5U4QA 3UUWA 4YPOA 4FBGA 1JDJA 2R00A 5ENVA 1Z75A 2EEZA 1OZAA 3PRJA 4CR6A 4M54A 4NFHA 1XGKA 4MP3A 5BT9A 2Y1EA 3JQ8A 1QSGA 3ETDA 4PG5A 2PZJA 3WLFA 3ZWNA 4DYDA 2O7SA 1IPFA 3HQ4O 3CZMA 1ZK4A 2OMEA 3ZN2A 3C24A 4YYZA 4R9SA 4UUOA 1UP6A 2DUUA 2I76A 3I6IA 1FK8A 4QECA 4U5QA 4YB8A 2I3GA 1RM4A 2AXQA 2Y0CA 2PGDA 1LLDA 4MVJH 1GR0A 3HDYA 4WCDA 3GMDA 2ZCUA 1B15A 3S1LA 5J23A 4KUEA 2HDHA 3PFWO 1ZH8A 1EQ2A 1DIBA 3FBTA 1PJCA 1LSUA 2E37A 5DCWA 3FNFA 1J0XO 1M6WA 1PGPA 3FBGA 3MZ0A 1T1RA 7ADHA 4QQRA 3UFXA 5TJ9A 1Y5MA 1RWBA 1ZJYA 2R00C 3PEFA 4XIJA 5JAIA 1ZJZA 4BO9A 4GVXA 3V2UA 4NFSA 4BV9A 4YR9A 3ITDA 2UUPA 1PJLA 4MO2A 1WNTA 3GVIA 3I9NA 1ZXBA 3L07A 2VT2A 4C7KA 5KJ1A 1UDAA 3KTDA 5TRTA 4XWYA 2ZCVA 1VSVA 1QV7A 3GG9A 4JQCA 1U5AA 4NJMB 1OC4A 4YACA 2EGGA 3A14A 3V5NA 4D43A 1XSEA 4PLVA 2VNSA 1BRMA 4CM4B 2VWHA 2UYYA 5T67A 5MGBA 3I9KA 1NX6A 3ZU4A 1YL5A 3EW7A 4IM7A 4MOWA 4XYLA 3LT1A 1YQDA 5AXBA 3VPFA 5FEUA 1SEVA 3KYDB 2IEDA 2YHIB 4CLRB 1ZNQO 1XHLA 1EZ4A 2ZQYA 5DBIA 3ZHYA 1QYWA 4WLVA 5DULA 3CMMA 1H6DA 1Y1PA 4BHTA 4DWVA 4MINA 1K89A 5IG2A 5JC8A 4IQ8A 1BTOA 4FB5A 2BFAA 1UXGA 5KJCA 1OC2A 3LF1A 1WDKA 5TT0A 3W8EA 1R37A 1Y5RA 3L0DA 3TOZA 3VKVA 1QV6A 5I7FA 1LX6A 1QORA 1ZW1A 1YB4A 2CMDA 2EKLA 2Z1NA 4TRJA 4FGWA 2V65A 5GMOA 1KVUA 4OH1A 2H63A 1C0KA 4UEKA 3D7LA 4CMEA 1T2DA 3OHSX 4R68A 3PYMA 2EP7A 3JQ9A 3GY0A 2DBVO 3ABIA 3ANLA 2BGKA 3A9WA 3VH4A 4E0BA 1EK6A 3DZFA 3K8ZA 3NGXA 4JBHA 3WOHA 2QG4A 2NQ8A 4DQUA 3F9IA 2NVUB 1IYZA 4GWGA 3BTSA 4HFRA 1D7OA 3QJ5A 4FCCA 4J3FA 2OFPA 3TZQA 1X7DA 2BI7A 1I3MA 4ALLA 1ISJA 4JNKA 1LSOA 1EVZA 4ROSA 3NTRA 3U0BA 2IZZA 1JAXA 3DONA 5IZCC 2QRLA 4P22A 2YQ5A 3G79A 4KMSA 2O3JA 3AJRA 3D3WA 6LDHA 5JDIA 3BMOA 3BAZA 1H5QA 3GN1A 1T4BA 1HRDA 1HETA 1ZK0A 3PYLA 4GWKA 4ND4A 1Y8RB 1T1SA 4DLAA 2D0IA 4AJOA 2Y1CA 4ZVVA 3JYQA 5TC4A 4PGFA 3RVDA 1ZIDA 1ZCJA 5COQA 3HFGA 3JQ9C 1OI7A 3FRJA 1VC2A 1PS9A 3LQFA 1GDHA 2I5PO 1A7KA 4R3NA 1T2EA 4L75A 2J3IA 1TLTA 1TA4A 4CUKA 4II2A 4ND5A 2Q46A 1YL7A 3ZWBA 4LK3A 4WLOA 4IUYA 1O94A 4EUHA 3DDNA 1B8UA 4LISA 1WPQA 3IOYA 3KYCB 2F1KA 4WCFB 1DO8A 1MFZA 3AOEC 4AJJA 1P1RA 4MPDA 4UUNA 4DBZA 1DRWA 4E5PA 1O8CA 5JCXA 2IXBA 1Z7EA 3V8BA 3WR5A 3DFZA 5U9CA 4R01A 1N9GB 3EYWA 4HBGA 3HN2A 5IXYA 3GUYA 3ONFA 4ZA2A 3D4PA 3MJSA 1JWAB 3QQPA 1GYQA 4R5MA 4DMLA 2NSDA 1PZHA 3M1LA 2WD7B 3WQSB 4HY3A 1DFIA 2HRZA 1PJTA 1FDUA 1HDXA 1SC6A 2P9GA 2VRBA 1HDYA 1PWZA 2Q4BA 4OQYA 4NFYA 2C07A 3GUCA 1T4DA 1U3TA 1I01A 3QP9A 2YFHA 1CF2O 3Q11A 4LCEA 2O23A 1ZSNA 4QFCA 2BI8A 5F1PA 3W8FA 4BNGA 1E5LA 5B12A 5KWEA 3DAGA 1KVTA 5KVCA 2BF7A 3CH6A 4B4UA 1MG5A 3E5MA 4D3DA 1Z74A 3RC9A 5K6AC 2DFDA 1HDRA 1P3DA 1ZO8A 4JBIA 3N7UA 4EJMA 1P0CA 1ULUA 2Y1DA 4EEZA 1V0JA 4GX2A 5CDGA 2GLXA 3NT4A 3FPCA 2PLAA 3AUSA 5EQFA 2AE2A 3DBRB 3L6DA 4RPLA 3AK4A 1DIRA 2B4QA 4I08A 4J9UE 4H3VA 2G1UA 1YBVA 3NT2A 3VPSA 4J43A 3DBLA 2O3RA 3HHPA 2Y67A 4DL9A 4FFMA 5EQDA 4I8XA 3OJ0A 3P2YA 3PHHA 3WWYA 1QG6A 2BFPA 5JSFA 2CVOA 4QXMA 2IXAA 3SVTA 3WMXA 2VHVA 4U6SA 1HKUA 1GYRA 1VRWA 3PP8A 4HWKA 4E2WA 1K2WA 1F14A 1N8KA 2C20A 1TVEA 4WKGA 5ER9A 2QW8A 5GZ3A 3PIDA 1YDEA 4BNIA 1U3UA 3PGXA 3X2FA 5G0WA 1JQBA 1PX0A 3FWZA 3D3EA 1UXIA 3H9GA 3I6QA 3BTOA 5TLSA 1B14A 3KEQA 9LDTA 3N74A 4B3IA 3PFFA 4AJNA 1A9YA 4UULA 1IE3A 2PY6A 2VUUA 1WMAA 1GL3A 1IULA 3FTNA 4WOJA 3PWKA 1NWHA 3AI3A 5A4DA 3TSCA 2VTEA 3Q0EA 1DHRA 1G0NA 1ONOA 4KDFA 1HZZA 3BHJA 2HQ1A 3D1LA 3QVXA 5LCXA 1VLLA 2Z1MA 1GYPA 3I5MA 4ZQEA 3GRPA 1NFFA 1HZJA 2PNFA 3MEQA 4W9NA 3ZV5A 2ZB3A 1PJBA 5JDCC 3RUFA 4EUFA 4WGGA 4KTVE 3RSHA 4YJGB 2VYNA 4GVLA 3HB4X 4F45A 1KC3A 5ADHA 3PLNA 3Q6IA 4WOKA 5B4TA 4Z3DA 2D3TA 1E5QA 3PQEA 3QIVA 3KV3O 4PG7A 1DPGA 2WMDA 2NACA 5C7LO 3KOUA 4OSOA 4PVCA 4WECA 4E3ZA 4BVAA 3LC2O 1O95A 4FFOA 1OAAA 1WAMA 1X0XA 1VJ1A 4F6CA 1NNUA 3IP1A 3AM4A 1BXZA 3HWRA 1IUKA 3NTQA 3S55A 1BDBA 2ZIZA 1QLJA 4PLCA 1P1HA 4YQYA 1S6YA 1UXKA 4BNVA 1MLDA 4TRNA 3D5QA 1XQ6A 4W4TA 4NR0A 1NFQA 4BNNA 2EV9A 1JKIA 4AJHA 2GNAA 4RLHA 4W9NC 3ROKA 3DHNA 1YQGA 1KERA 1NP3A 2DTEA 4MIYA 3GGGA 3GVCA 2OHXA 1Y8QB 3FNHA 2DAPA 4CM7A 4Q39A 3I83A 1GEGA 4B7UA 2XXBA 3GRKA 2EXXA 4H7PA 2GN8A 4RPGA 5EERA 4DRYA 1ZVMA 4QO8A 5BR7A 1EQUA 1I0ZA 1IPEA 1JKFA 2AQHA 3KLMX 2ZTMA 4PG6A 3U4CA 3OFSA 3PPIA 5JAQA 2XF8A 3K30A 3AI1A 3U3XA 5BNFA 4YCAA 2NVWA 2FPPA 4M89A 2Q1TA 3V1UA 3ZWCA 4BMSA 2B5VA 3H2SA 5AXDA 3RBVA 3VPGA 1MGOA 3DBHB 3DL2A 1M75A 3UCEA 3B6ZA 3FN4A 5U1PA 1UDCA 2Y68A 3IJRA 1NVTA 4GMGA 3DMTA 4Q3CA 3NDJA 2WSBA 4BO4A 1LI4A 1PJ4A 1PJSA 5JAMA 4BNWA 2CDCA 3AUAA 2IE0A 3PDJA 1JN0A 4MJLA 5TJHA 1NQ5A 2GSDA 4A5OA 5DDIP 1M6HA 1R4MB 2NM0A 3A06A 4IINA 5JXWA 3INRA 4TKMA 3K96A 1LXCA 4E4YA 5JMPA 1ZXLA 1Y6JA 2G0TA 1PWXA 1RM5A 5CEEA 3OQBA 4GKBA 3ZU3A 4W99A 4FC6A 2HK7A 4A26A 1H6BA 3MCVA 2AMFA 3RC2A 4OKIA 4AJIA 5IFLA 3G0OA 1UR5A 5EIOA 1R4NB 4ZQBA 1PS0A 3PJFA 4KTTE 1Q7BA 1BG6A 1C1DA 2EIHA 3CPSA 4FSHA 4ZU3A 4BKUA 4BB6A 3RC7A 3BZUA 4KWIA 4JGBA 4NNJA 2P5UA 4B4VA 1JU9A 2PZKA 2CY0A 1HDZA 4YJHB 3PHJA 1YWGO 2I66A 4ALKA 2FR8A 2B5WA 2RH4A 3PHGA 3EC7A 1ISMA 3WYEA 3VZSA 3WJAA 3E9NA 4KUGA 4KUHA 1R66A 2VN8A 4FDAA 5G0SA 3F1LA 4BO6A 1S7CA 5I7EA 4CLOA 4DVJA 3JV7A 4GX5A 3T7CA 4BO1A 4OXKA 4EBFA 1AXEA 5CDYA 2I9PA 1Q7GA 4U0JA 1I24A 2YV2A 2E4AA 2EWMA 2VNAA 3VDQA 4AJ4A 4RJTA 3G3EA 1NASA 2GZ1A 1PR3A 2PZMA 2VQ3A 1M2WA 2ZYAA 4JXKA 4WNIA 4ZRMA 3ZHXA 4QFDA 3RUDA 3KSZO 1G1AA 1K6JA 3TZHA 4DTIA 4YAGA 1ZZEA 2UDPA 4BO7A 4OGWA 3CUKA 1G6KA 4CJXA 4ILKA 1QXSA 1DBVO 4OJNA 3ICCA 4M8SA 4U8GA 1Y7TA 5DOZA 4DBVO 3NJ4A 1BW9B 1GQQA 3FSRA 2O50A 4U7WA 3BHIA 4RPHA 1YRLA 1ADGA 4J90A 2FSSA 3NT5A 4RF2A 5F1OA 1HEUA 3H5AA 3GPIA 9LDBA 1O5IA 2ZTVA 4TRMA 1PZGA 1CQJA 4I5FA 3WXBA 3IDSA 4EZBA 3AI2A 4ZRNA 3BTUA 2X8LA 1KOLA 2CF6A 1C3VA 4YT5A 2IZ1A 3IKVA 3PVZA 2GASA 2PKQO 3H5RA 1P1FA 4E12A 2GERA 3K6JA 3P19A 1A4IA 4HKTA 4PLWA 3MTGA 3WSVA 5GZ1A 4IS2A 1F06A 1E1LA 4BKRA 3GZNA 2D1YA 3DFUA 5EL0A 4ND2A 3DHEA 1F12A 4GMFA 1AHIA 1D3AA 3OA0A 4HXYA 1WMBA 4NBVA 4Z9XA 2ZB8A 4K6FA 1V9LA 2WE7A 2WTBA 4FJ1A 2IYOA 1H2BA 1T2AA 1R6DA 3ZV6A 4B4OA 5JY1A 3FTPA 5DP2A 4JLWA 1ADCA 5G2OA 4RGBA 1YKFA 2D8AA 5DOVA 4OKNA 2VYVA 2ZB7A 4IDDA 4CM9A 2DT5A 3PJDA 3B1FA 3L9XA 3A28A 4LSMA 5A1TA 2CDBA 3BYZA 2W2LD 4CM8B 3OEYA 1GZ4A 3JQGA 1O89A 3JYNA 4E2YA 1J6UA 3HDJA 3FWNA 4FOSA 3UCXA 3BXXA 3AUUA 2BMAA 1KC1A 3JD3A 4CMBA 4CMAA 3WGOA 4O5OA 4J2HA 4RL6A 1AGNA 1VI2A 1OBFO 1PQPA 2G82A 2VYND 1SOVA 3OJFA 5A05A 2GRAA 5A02A 5A9RA 4EYEA 1PJ2A 1LRJA 3DO5A 3C7CB 3D0OA 1C14A 3DTYA 5ITVA 1DFGA 1X15A 5B1YA 2C2XA 1VM6A 4E6PA 1MG0A 4CODB 3BA1A 5G4LA 5K0ZA 4MVJF 4JBGA 1WW8A 4XB1A 3GA0A 3FNGA 5IZ4A 2O3UA 4IPTA 2HMVA 3RFVA 3KYBA 3OJEA 2HJSA 4D7AA 5HRUA 3JYPA 4XZ3A 3TZ6A 2GCGA 2W90A 2ZTLA 1A4UA 1DOHA 3QWAA 4J1TA 3WB9A 2A9FA 1KY4A 2RH8A 3BMNA 3CEAA 2FPGA 3PQDA 3PJEA 3KRTA 1YBMA 2AHRA 2NTNA 1IHXA 1ZSVA 4KZPA 1Q7CA 4R3WA 4XJSA 5JO9A 3RWBA 2Q1SA 4XR4A 4IS3A 4PG8A 5CAEA 1SOWA 2CNBA 2WWRA 1E0DA 4X54A 2RIRA 1W73A 2ILTA 2OP0A 3OP4A 4L9RA 3FR7A 1I2BA 3H65A 4IZHA 2VT3A 1DJNA 4YRAA 3WICA 1Q2XA 4BNFA 4BGUA 4J91A 1AN9A 1NR7A 4RDHA 4IBOA 3GNSA 3C1TA 3INTA 4IIUA 4YRDA 2VZ8A 2ZB4A 2B69A 3QV1A 1E7RA 1M67A 5KCZA 1LDMA 5CPFA 2Q2WA 4CMGA 3PYXA 2OL4A 2W2KA 4FFLA 4ITUA 3JQFA 1A7AA 3WBFA 4XIYA 3EY4A 3GLQA 2VUSA 4L73A 3VH3A 4XRGA 3SJ7A 3ZU2A 3P5SA 3H9JA 4RVSA 4BO5A 3UN1A 4Y6PA 2YUTA 4BNHA 2FMUA 1FDSA 3WGGA 5JS6A 1I3NA 1RM3A 2J6IA 1D1SA 4YDRA 1WDLA 2LDBA 3K2EA 5THQA 1BSVA 4CUJA 4UAGA 4AICA 5IAAA 1DHTA 1CRWG 5TF4A 2Q45A 4KQWA 4URFA 2EG9A 2H6EA 1YXMA 2DC1A 2A92A 3LT4A 1PR9A 4PLPA 4B79A 3IAHA 1CETA 4WJZA 4NI5A 4BGIA 2ZYDA 1R12A 2QZZA 3ZDFA 2PH5A 2C5EA 2NU7A 2BFMA 3AOGA 3HNPA 3KO8A 1Q0QA 2X9VA 4D3SA 3I23A 3DZBA 3WNQA 1AXGA 1KS9A 2Y05A 3ZHBA 1OFGA 3ZNQA 2BHLA 5A9SB 4R41A 1VSUA 2WYWA 5FYDA 1LDNA 2FRDA 3AM5A 3VDRA 4ZN6A 5AQ1A 1LDBA 2CFCA 3F46A 2VHZA 3HG7A 1C1XB 5C37A 1KEPA 2PWZA 2QQ5A 3ULKA 1NWCA 3IIEA 4XYGA 3B20A 1NBOA 3RUEA 3UW3A 2VRCA 1ENPA 3OIFA 1YONA 4GX0A 4IMPA 1LBEA 2AEFA 2QHXA 3F5QA 1I2ZA 5JMWA 1DRUA 2NTJA 3ZI0A 4JN6B 3SX2A 4WASA 1LSJA 4YQZA 3LC1O 3VZQA 4HFMA 4PLTA 4R1TA 3RBZA 5L53A 1H9AA 2JCYA 3ZWYA 4BNUA 5CDSA 3GNQA 2P9EA 3I52A 5A3JA 1H6AA 3I9OA 3GEDA 4E13A 3GHHA 4GBJA 1WDMA 4AG3A 4ALJA 3BIOA 5JFOA 2R2GA 4E5NA 1F17A 4CMHA 8LDHA 1Z73A 2XXJA 3DEYX 5JYEA 3IUSA 1EMDA 4R51A 5HS6A 2DM6A 2AA3A 4O59O 3K73O 3SEFA 4MIEA 3WMWA 2OGUA 2HMSA 3ASUA 1N92A 3QA9A 3EHEA 1I30A 3NYWA 1ENZA 1VKNA 4ONEA 4JP2A 4IQGA 1P44A 2V6GA 4IQ0A 5LDGA 3WG9A 3K9QO 1WZIA 1YVEI 3EMKA 3H9UA 4PVDA 3UKOA 1N7GA 4AJEA 3ZNOA 1N5DA 2BKAA 4TZKA 1P45A 2JFFA 4KQXA 4HFNA 4RQTA 2P4QA 4CM6A 3U4HA 2X9GA 1BGVA 1HE3A 5EN4A 3KHUA 1E1MA 4F46A 5ILGA 1NHWA 3ZWWA 1ML3A 1TB4A 1LUAA 1SAYA 2JFHA 3FCOA 3QRWA 5CP8A 3RQSA 5BSGA 1LLQA 2G17A 3HZZA 1DEHA 3MJVA 1E6UA 1EDZA 4J9VA 4NJMA 3NX4A 4PLYA 3RUAA 4CMEC 4YJFB 5C5IA 1ISHA 4RF3A 3LU1A 2VYVD 4CM9D 1R0LA 3VKUA 1X13A 4G5HA 4G65A 3DHYA 3KYDA 2GGSA 3V2HA 3FHLA 4HADA 1CERA 1E1KA 3CXRA 1C0LA 5JE8A 1E1NA 1CJCA 1Y9EA 4FFRA 4C4OA 4BIIA 2X1HA 2DFVA 1WP4A 2NUAA 1VE9A 1I3LA 2D4AA 1U7TA 1KVRA 5K9ZA 1R15A 2OORA 5ER6A 1SZJG 1EUCA 5JDIC 4BNKA 1QMGA 4LW8A 3JQAD 4II3A 3BMCB 4RQUA 3STHA 5EMHA 3WTBA 1J5PA 3PZBA 3HFSA 2C5AA 2B83A 3E9MA 3FD8A 3RKRA 2Z5LA 1VJ0A 4CMCA 3Q2KA 1BVUA 2QZ9A 4IZIA 1PJQA 3GC6A 3ADPA 1ZK2A 4RO0A 2X58A 4D3FA 1Q0LA 3ASVA 3SLGA 4ZQHA 1V8BA 1N1GA 2EW2A 1GD1O 2HRBA 4PLFA 1H93A 2NU8A 4CMKA 3W8DA 3GAFA 2UAGA 5DCUA 4J1SA 4R16A 3OQ6A 1U2DA 1CWUA 3LLVA 4ID9A 1EE2A 1A9ZA 2E49A 2HO5A 1M66A 2GN6A 5ICMA 3ANNA 4DYVA 2FZWA 2B4TO 4IDGA 1V35A 2FP4A 1PTJA 1ENYA 1W6UA 1KY5A 4Y9DA 4IDFA 4YAEA 2RBEA 4A10A 5G0VA 1LNQA 1XELA 3AFNA 2IDZA 3W1VA 1Y8RA 3RCBA 2IZ0A 2VHXA 2VTDA 4BNZA 1Q0HA 2UV8A 4KWHA 1LSSA 2Y1GA 4NMHA 4ND1A 4XQ9A 1ZEMA 4NQZA 4B7CA 3GH3A 2HKIA 4A7PA 2ZATA 3PGJA 2VOEA 3GPDG 4CQMB 1VPDA 3COSA 4DQXA 3OECA 4XA8A 4PZDA 3VZRA 4BNXA 1NQAO 4UVGA 3JCZA 2GZ2A 3ENNA 1DXYA 3H3FA 3ANMA 3GK3A 4NBWA 3ST7A 1SEPA 2FOIA 2J5QA 4W82A 4XQEA 4XX0A 5I7VA 2OBNA 3KYCA 1GPDG 5T64A 4CPDA 4WCFA 2PFGA 1ADBA 4J7CA 3RIHA 2GUGA 1NPDA 3TZKA 4AL4A 3DAPA 4D41A 3UVEA 3JQBA 1NAIA 3KB6A 1BXGB 4ZHSA 1LEHA 1N9GA 1CDOA 3W6UA 3LC7O 1NVMB 3P7MA 4E5KA 2FR0A 5IJZA 2Q2QA 1ORRA 2SCUA 3WNVA 1PL7A 5EJ2A 3UF0A 1I32A 3ONDA 4L4XA 4QUKA 4HNHA 1NQOA 4JX8A 1TT5B 2Q4EA 1JAYA 3GEGA 2YHUA 2X5KO 1LRKA 1MB4A 1PL6A 3GG2A 2PD4A 4ND3A 3JQ7B 4O6VA 2NADA 1LTHR 1LQUA 4CLXA 3ZWPA 1K6IA 2W2LA 3QE3A 1ENOA 4K9DA 4M87A 4BNLA 2W4QA 3WFJA 3CKYA 1MX3A 3C1OA 4JJFA 4LRSB 3DC2A 5ITWA 3O8QB 3OMLA 4N5NA 2VCYA 4BUCA 3MTJA 4YAIA 1WWKA 2JCXA 4CL8A 3CINA 5F21A 1QKIA 1R0SA 3VVCA 1IOLA 1X7HA 2QX7A 4TWRA 3EDMA 4I9UA 4OXYA 4EUEA 1MP0A 4CMIB 1R16A 3T7EA 4UVHA 4TROA 2VRCD 4EW6A 4EEXA 3RBXA 4TMFA 3GVPA 4FIZA 3WWZA 2VHYA 4CLEA 3KXDA 1OMOA 4QEDA 4BO2A 4D42A 3DBRA 1NXQA 4FN4A 3I9JA 1O9BA 4RZIA 5H82A 6ADHA 4BQPA 3W4IA 1UDBA 4R69A 4GGPA 3RU7A 3JYLA 3SC6A 3WGIA 3Q9NA 3NEPX 1MC4A 3WSWA 1MFPA 5TSDA 1AE1A 5T6BA 5BNTA 3O26A 4RDIA 4J7UA 4NG5A 8ADHA 1FXSA 4MP6A 3KVOA 4CV0A 2P4HX 1EVJA 2PH3A 1E3LA 2VWPA 2D2IA 3OM9A 4W7HA 1U5CA 2PK3A 1XYGA 1O6ZA 3K92A 2GR9A 1TT7A 2X23A 4LRTB 1HLPA 4LMPA 4NHEA 1FDVA 1YBAA 5AXAA 1C1DB 5G0UA 2TMDA 5HBRA 2ZKLA 3TL3A 1B7GO 3TZCA 2J5RA 3WGZA 2Y1OA 4OQZA 2JL1A 4OXNA 4UREA 3NDIA 1YOVB 4MKXA 1PS8A 1YJQA 2D5AA 4NH4A 4HV4A 4QTZA 2I3AA 1FDWA 1I2CA 2C0CA 5AOVA 2GYYA 4WNCA 1QYVA 2PD3A 2X6TA 2B0JA 1E77A 1P1KA 5L9AA 4OAQA 5IDWA 2TMGA 4XGKA 5H81A 5DZSA 1VL6A 4EDFA 2O3QA 1B8VA 4YJGA 2GO1A 2NNLD 2OZPA 2PGJA 2XOXA 3S2FA 2ZQZA 1GV1A 3KZVA 3UGKA 4GKVA 2P2SA 1IZ9A 3ORFA 3PZRA 1EVYA 5DP1A 1IB6A 1NPYA 1XA0A 4GQAA 1BVRA 4E5YA 1EEHA 2JFGA 4CLDA 2B4RO 3ZV3A 4DGSA 5G0TA 3DQPA 1SCUA 1SPXA 5DCYA 4HUJA 1F8FA 4J0EA 3W4KA 1K6XA 1DC6A 2POQX 2PKRA 2PV7A 3DZIA 4CR8A 4QX6A 5JW6A 4W6ZA 1PGOA 3C7DB 3OBBA 1X14A 2X0RA 1RYDA 2J5KA 1IZ0A 2GZ3A 2IODA 4NJOA 4BMNA 4J4HA 1HYGA 5DF1A 4NBUA 5IN5A 4P38A 4DC1A 1GEEA 3DMTC 1JWBB 3H5NA 4Y98A 4WLNA 4R5HA 5BQFA 1Y8QA 3DMYA 1UZMA 2UUOA 1N1EA 1H6CA 4N18A 3QWFA 3GZNB 1KIFA 4IJKA 1GQ2A 4I9HA 1V6AA 5CEFA 4R1SA 1WLYA 5AYVA 3L6EA 1U4SA 4FR5A 3BTVA 3PWZA 4Z0TA 5CEJA 2FWMX 1EBFA 1PEDA 3WX0A 3WFIA 5FI3A 3HJAA 1KEVA 2G76A 3EGOA 1I36A 3M2PA 1LC0A 4NPCA 5DBGA 4YTEA 1GZ6A 5CPBA 2W98A 4TVBA 5F3RA 2NU6A 3JQGB 3JD0A 3K5PA 3MJTA 3UHAA 1DJQA 4NBTA 5G4KB 5GZ6A 1YB5A 1XIVA 5A06A 3I1JA 3OETA 2HLPA 1T25A 2HU2A 4IDBA 3TJRA 4J1QA 3CTMA 3JQ6A 2DPHA 1WVGA 3E18A 5JCJA 2BGMA 1H2HA 2VZ0A 4KOAA 1R4MA 1SB9A 3C8MA 4LCJA 3RASA 1SBYA 4UVEA 3RUIA 3IMFA 2FN7A 3GAZA 3PHIA 3DR3A 4RCVA 5KTKA 4XD2A 4Y67A 2YJZA 4WLUA 1LDEA 2HMWA 4LMRA 2GN9A 2J3JA 4Q3EA 2O3TA 2FZEA 4R4JA 4DPKA 3U62A 4B8ZA 1XEAA 3JQDA 1SNYA 3U49A 4FFNA 3L6OO 2JJYA 1YO6A 4KDEA 3GDGA 3AWDA 3PLRA 2JHGA 3PWSA 3TF5A 2O2YA 3SC4A 1CQIA 3TRIA 2V6FA 4D79A 1DIHA 3S2EA 3JTMA 4E33A 4YJHA 3BMQA 3OJOA 4J4BA 2D59A 1E3WB 3MJEA 4BS9A 3FPLA 3MOIA 1B26A 3K2BA 4FJ0A 1LRLA 4GH5A 1LQTA 2O2SA 1V3VA 3DB2A 3OQ1A 3GFGA 3F6YA 5JPIA 3GN2A 4RPJA 1ZMOA 4MVJE 1P74A 1PQUA 3W4JA 4M1QA 2YYYA 3FR8A 3DOJA 3PK0A 3S2GA 2EHDA 3WTCA 3O9ZA 2YQ4A 3JD1A 4ZGWA 5B4VA 1ULSA 3QSGA 3VPHA 2GD1O 4JJGA 4IJWA 3I9LA 2DQ4A 2EJWA 1E6EA 4M49A 4IY1A 3WGYA 3JQ8B 2I99A 1PZEA 4R1UA 4WPGA 4XDZA 1NVGA 2AQIA 2W2KB 4Z0PA 3JQAA 1B16A 1PQWA 4E21A 3DZHA 4B8WA 1AUPA 2NQTA 1XCBA 4HNGA 4LGVA 4XJTA 5CFZA 4G2NA 4CQLA 5TNXA 3V1YA 4XGNA 3CIFA 1EBUA 2I6TA 1BW9A 4FGSA 5T57A 3MWEB 4IXTA 4RF5A 5KIAA 5L3ZA 1PL8A 2WEKA 3EAGA 4RORA 1T2CA 4R1NA 3U9LA 3UH1A 4TQGA 4XRRA 5LDHA 4J16A 3NDRA 4NK5A 3SXPA 4K26A 2CZCA 1CEQA 3TQHA 5HS4A 5L7TA 2EKPA 4BV8A 1XDWA 4A0SA 5IDQA 1DFHA 2RHRA 3QY9A 3LYLA 1YE3A 2HSDA 1DDOA 4WEQA 3LT2A 1TEHA 3F4BA 2FHSA 3ZV4A 3AU8A 3TNLA 4JCOA 1WZEA 2DBQA 3GT0A 3E48A 2W8ZA 4NIMA 4G81A 4OSPA 4UVDA 4EGFA 1C0PA 4HFJA 4RLSA 4XGIA 1QP8A 1HE2A 5ILOA 4XQCA 4K6CA 1DSSG 3FI9A 3JD2A 5IXSA 4MVJI 4TRRA 2PKQP 3V2GA 4FPXA 1I8TA 2GN4A 3DAFA 2VZ9A 3ZU5A 2NU9A 3NTOA 4TVOA 4A03A 1G0OA 1YS4A 2CSUA 4GPD1 4A73A 1MA0A 3I4CA 4AVYA 1H0KA 1HF3A 3JYOA 4O1MA 1TXGA 2AEMA 3AUTA 4P4GA 4PZEA 2Y1FA 3LLSA 4C7JA 2ZYGA 4PLHA 1P1IA 1UXJA 5GY7A 4A2CA 1O0SA 4MVJM 4M86A 1Y9AA 4TKLA 1NAHA 3KM0A 4N5LA 2F00A 4DXHA 4NU5A 3D4OA 5I8ZA 1RKXA 1VL0A 3VH1A 2UVDA 1F8GA 2PA3A 4CV3A 3OSUA 2VWQA 2JKVA 4A27A 1I5RA 4DREA 4FS3A 4I5GA 5HWSA 4S1VA 3IUPA 1HYHA 4MIOA 1EFKA 3TFQA 5BSEA 1XLTA 3QWIA 5F5LA 3HUDA 1E7MA 2J3HA 5HA5A 4R9RA 4N5MA 4EJ0A 2H9IA 4Q3NA 1Z6ZA 5KOIA 2NVBA 2CVQA 4DLLA 1PSDA 2EP5A 4F6LA 2CVZA 4MKRA 2RHCA 5BSFA 3JQFC 3EUWA 3AU9A 1T2FA 3ZWAA 3VHRA 1L7DA 3H7AA 1QYDA 1J4AA 3GVHA 3CSDA 5JO0A 4ALNA 1LLCA 3X2EA 3F5SA 1MXHA 2X4GA 4BOYA 3TFOA 2HUNA 4ZQGA 1ZMTA 4Y6SA 2BFOA 1JVSA 3DBVO 2X0NA 3I3OA 5BSHA 3PIIA 4XYEA 1HSZA 3D3WB 3DOOA 2WYUA 3G49A 1Y81A 3OJLA 3BMOB 3EVNA 4FOOA 3ZZNA 4DIBA 2RCYA 1KVSA 3QVWA 3FNEA 4JK3A 5MDHA 1K5HA 3QWBA 2X9NA 3G1TA 1NHGA 3LZ6A 3KSUA 2DLDA 2A4KA 1CYDA 2V6MA 1VKOA 4EI2A 3I9MA 2FSVA 2VWGA 4RV9A 3TL2A 3U09A 1DC4A 4GGOA 2Y0EA 3F3SA 2YFQA 3AW9A 4U0KA 5F1KA 1P1JA 1ZEJA 3IJPA 3MWDB 3IP3A 2P91A 4PIVA 3PDUA 4J49A 1UZNA 2OBYA 2QYSA 4GX1A 1HWYA 1Z82A 3RUHA 4BQRA 1ISIA 4MVJA 3VVBA 4OM8A 2OXIA 5F5NA 3ZHZA 3PHLA 4NDNE 1E3IA 5IZCA 4CM5A 4E31A 4RVGA 5A5EA 2C29D 2DKNA 3GMSA 5JCJD 1YQXA 1T26A 1GZ3A 4F3YA 4BO8A 4IGFA 4OHUA 1MUUA 4FD3A 1K0UA 3WIEA 1B0AA 3MJCA 2O48X 4ZD6A 1KVQA 1M76A 1IY8A 2Y93A 4Z9FA 3B1KA 3RFTA 3WGHA 1DAOA 2YDXA 2YV3A 3EZYA 2JD1A 1LC3A 1A71A 1BHSA 1ID1A 3TPCA 1GUZA 4P8RA 5COAA 4S3MA 5A9SA 3R0IA 3KEOA 3ITKA 5TGDA 5IDXA 1V3TA 3JQEA 4GLOA 3WDSA 2C54A 4L4SA 1UAYA 1SO8A 3IS3A 4BNMA 2B35A 2RAFA 4FC7A 3WGTA 1P31A 4PRKA 2V6BA 1BXKA 1C1XA 2AE1A 3TN7A 2JCVA 1KBZA 1FMCA 2Q49A 3RI3A 4E2ZA 4CM4A 4QO7A 3AOEA 1PGQA 2CF5A 4KP7A 3ZW9A 2QRJA 2QYTA 2E48A 3AFMA 2DBRA 1U3VA 5DT9A 2DBZA 3O03A 3S2IA 4L0QA 2YHIA 1ARZA 4CLRA 1HDCA 2P5YA 2AQ8A 3TOXA 1XU9A 4HX5A 1ZSYA 2BELA 1Z45A 2EJVA 1ZK1A 2YDYA 3L77A 3ONEA 5CHEA 3OH8A 1P9LA 3GGOA 2QIOA 3C85A 3D4NA 5C3MA 3DBLB 4PZCA 1WXDA 3L4SO 4OIMA 1ZK3A 1XU7A 3V1TC 4NZ9A 1GV0A 3ROPA 4DLBA 1GQYA 2ZJ0A 1HYEA 1E92A 3GDOA 2C82A 1E7SA 3KUXA 1JLLA 3OEWA 2C59A 4XQGA 4ALMA 3GGPA 4YJDA 1OOEA 3WQRA 2FY8A 4JP3A 1U1IA 4Z3KA 3LK7A 4YXFA 1SB8A 3C7AA 1EUDA 1X1EA 4PN3A 5L4NA 4XB2A 5JNLA 4EJ6A 5K6AA 4BKOA 5FWNA 3NAQA 2FR1A 4Z9YA 1DC3A 4OL9A 2NVUA 2ZTUA 5DN9A 2XPCA 5A3VA 4Z0HO 3ROMA 1FDTA 1JKJA 3JQCA 3E1KA 3QVSA 4D0RA 3CMCO 1KYQA 3IQDB 3R3SA 4YBZA 2EW8A 2Q2VA 2YW9A 1K3TA 1D8AA 1HSOA 1ONPA 1LJ8A 5COBA 4D46A 4WK6A 1I3KA 2WDZA 4FFPA 3OF2A 4AJPA 2Y99A 3KBOA 3T4XA 2V7PA 1DAPA 1RYEA 2WE8A 2OUIA 1TI7A 1QYXA 5BNIA 1LU9A 2X0JA 1NFRA 5IF3A 3C3XA 4YEDA 2JHFA 1P33A 2NWQA 2R6JA 3RROA 3QHAA 1X1TA 1N2SA 2EF1A 1UZLA 4B7XA 5THKA 1D4FA 2EERA 1GTMA 2HMUA 4XKJA 4XR9A 3HN7A 4YJFA 3ZNPA 4BB5A 3ETEA 1HLDA 1U28A 1EDOA 1GCUA 3TWOA 3FF4A 1I33A 4DIOA 2A35A 3H9QA 1JA9A 3NKLA 4GI2A 2HMTA 1HXHA 4GSKA 3INGA 5H83A 3VTZA 2DUWA 1A27A 1UJMA 2IYPA 2PD6A 2WD8A 3D5TA 3NGLA 4O0LA 3G1UA 3WQQA 5A04A 3ZNNA 5EESA 1L1FA 4DPMA 4DIFA 4GSLA 1ISFA 1HTBA 3DXFA 2NV6A 4CMJA 5JAZA 3UICA 5ENDA 4I5DA 2HCTA 5HM8A 4ZQFA 3RJ9A 5DBFA 1U8XX 2A94A 3ICPA 1A72A 1LDGA 4YAKA 5KKAA 4BNTA 3BMCA 4E5MA 1DLIA 4ZJUA 4D0SA 4CUZA 1F0YA 3OIGA 4J0FA 4OO3A 2DVMA 4Q3BA 3UAGA 5A03A 1EUZA 5JDCA 2B36A 3F4LA 3GEMA 2X5JO 2WD7A 4E30A 5L4LA 3LF2A 3Q2IA 1BDMA 2ZJ1A 3VZPA 1E3JA 2BH9A 3N58A 5ICSA 4M55A 1MV8A 5KJ6A 5I8WA 4DUPA 3WJ7A 1NQTA 1NYTA 1Q1NA 2OO5A 1X0VA 5FFFA 4BNJA 1CIVA 4PCVA 3VTFA 2DTXA 5CG1A 2PTGA 2P68A 3R3JA 5A9TA 2JD2A 5IDYA 4BL5A 2CUKA 4WCFC 3GF4A 2C7GA 3EVTA 2JD0A 1YJ8A 3ZGYA 2IEBA 4Y8VA 3VAZA 4QSMA 2EKQA 4PRLA 4TSKA 1ONNA 3JQBC 3UCFA 3B70A 4OMUA 3WYBA 3NUGA 1ZUD1 4W7IA 5T8KA 1MC5A 1XR3A 1E7YA 3KLPX 1GU7A 4U6QA 5ES3A 1QR6A 3H9EO 3ZH2A 4OYRA 4RPKA 3CE6A 2YZ7A 3HE3A 3ZWOA 4GLLA 2YY7A 2H5LA 4AJKA 3RFXA 5KVSA 3IL2A 3TDKA 3JD4A 3NRCA 4GL4A 4AJ2A 3LVFO 2NLOA 3LDHA 3Q3CA 4UUPA 1HL3A 3M1AA 3E82A 4CQMA 1UUFA 1KEUA 1ISGA 3H4VA 5AVOA 1DC5A 1SMKA 4DC0A 1BMDA 4J4TA 3UXYA 5I9LA 2AG8A 4MVJD 7MDHA 1BWSA 1I10A 5FI5A 2XAAA 1PGNA 3JSAA 2D5CA 5HTOA 4I1IA 4H15A 4JJIA 3DWFA 1B2LA 2I65A 3OA2A 4WLEA 3KSDO 5EPOA 3WIDA 1BXGA 2HJRA 4AJ1A 4CM3A 3NV9A 5TT1A 1DLJA 3GOHA 4IJUA 4UUMA 5T8KC 4PG4A 1N7HA 2Q50A 1J49A 1GUYA 1PZFA 4GAEA 5B4UA 3H8VA 1EVIA 2IRWA 1AHHA 1DIAA 4MDHA 3DZJA 4YT4A 1UH5A 4RZHA 1TT5A 4D45A 3CZRA 4Y6RA 3ON5A 2Y0DA 3ENKA 4LVUA 1NM5A 3E9QA 5CDUA 5KVVA 4FJ2A 3GDFA 3JQ7A 3ZWVA 1U4OA 4CM1A 1GAEO 5I9MA 2P9CA 3E6AA 3U5TA 2BD0A 2ET6A 4CLOB 3O8QA 1HT0A 2VUTA 1VL8A 4RVFA 4YRBA 4BKPA 4CL3A 2PGLA 4MVJG 4CMIA 4XDYA 2WYVA 2PZLA 3S8MA 3U4IA 3SLKA 4YA6A 4DA9A 1B8PA 5I9NA 1R0KA 2GDZA 2HK8A 3Q9UA 3E8XA 4L74A 2GPTA 2J3KA 3GZ4A 4MVJP 2JAPA 3PXXA 2AEJA 4HP8A 3A1NA 2YV1A 3EK2A 5LC1A 1LLUA 1EFLA 5L4SA 1XKQA 1P77A 3DOCA 4DPLA 4RF4A 1UP4A 4J1NA 3WS7A 1H9BA 3H3JA 4CLHA 2JAHA 1HE4A 4YVFA
chains in the Genus database with same CATH superfamily
1QQ5A 2B9EA 2JLWA 3BJZA 2GDJA 2O2IA 2EWVA 3G6KA 4BMCA 1AV7A 1QGED 3LUBA 4PIMA 3R0XA 4YMTA 4WK2B 1R0YA 2Z57A 3GFBA 5LZ4A 3TMYA 5ALVA 4HQFA 5JAUA 1GRNA 1SUCA 3AP2A 5K0EA 1FL9A 4PGAA 5AH0A 4C78A 3GELA 3R23A 3D8TA 4L4RA 1R8JA 1R8YA 2DZDA 2AF3C 2QRQA 2A3RA 4BZXA 3MOGA 3ZCRA 1EVEA 1XQ1A 3AM1A 4ENPA 3O4GA 3NVAA 4LWOA 3TXYA 1XAJA 2NSHA 3D9QX 3WGNA 3LA6A 1EKXA 1RWPA 1T36A 2WA1A 4K8RB 5DTMA 5KHAA 2H92A 2I22A 3P2OA 2RK3A 5IBRA 2OXRA 3HZHA 4OD0A 3WQBA 4NU6A 2XBUA 4INAA 3EGIA 1CFZA 1U2ZA 1OV4A 1RHJA 1LPPA 4AKIA 2YOHA 1ZD3A 4NJEB 2AZXA 4RVNA 5JY6A 3VPXA 2ID4A 4KLCA 3GRRA 4DLXA 2G9VA 5KYUA 4F9TA 1UBTS 1P2DA 4NULA 521PA 2CCGA 1A2OA 2OK7A 3KP1A 5AVJA 4R54A 5CXUA 1V4NA 1JHXA 4MP8A 4NCKA 2C1EA 5K0FA 3NFYA 1PKEA 4RBNA 4BX2A 2W0MA 4CT5A 2HO4A 4Q9NA 4JMLA 4Y2JA 3PJRA 2BGGA 1Q19A 4IEEA 4B3TB 2CJFA 2NZWA 1TM5E 2QXUA 3AM3A 1NI5A 4MPTA 4YT2A 4P5DA 3EZLA 4YWJA 1PGJA 2Q3EA 1S3SA 3RKUA 3UV7A 2C2YA 5HSGA 3B9BA 4GO1A 2HU8A 1W4BA 1FJHA 1I3OA 3WMFA 1OCEA 4JMPA 4DIUA 2TRSB 3ADOA 1DEKA 1U65A 2HGZA 2QS9A 5EQTA 4RHXA 2ZYTX 1LWOA 3O4RA 3ZW8A 2M1ZA 4CF3A 5JSHA 2ODPA 1FBTA 4UEJA 4MCAA 5JEDA 2WG1A 5TS3A 5L7YA 4E5VA 1B41A 2GJ8A 4JJ6A 3TRDA 3BGOS 1K08A 2IYNA 3ZCXA 5CFMA 1N1MA 3JY6A 4JITA 4B3JA 4XVCA 1EWQA 1P0FA 2G71A 4WE3A 4UDYX 5DTJA 2SECE 3NXKA 1C9YA 4LDJA 4DIDA 1YFKA 2AYXA 3R6DA 2CXRA 3LBAA 3B1JA 3RS4A 1LB1B 2ERYA 3OWXA 3LW8A 3QVTA 4I50F 3RAJA 3I92A 1D2GA 2IQ5A 3QUSA 4WBXC 3VOSA 2ZWOA 1Y5NA 4MKGA 4CV1A 3BMNB 1VMKA 2P75A 3RGGA 4DA6A 1L7EA 3AF2A 1IL0A 3F47A 4A82A 3IC5A 4FCVA 3EG9A 5FF9A 4XCVA 5BQ5A 2YASA 3NCHA 3CR3C 3ZWQA 4UVIA 5B53A 3ZJ4A 3A1SA 3U3MA 3BHNA 1X1DA 3GHYA 4PO9A 3C39A 4HWGA 2ZRKA 1Y3HA 1NBIA 3E5RA 3MCTA 1NNI1 1OX5A 4NQRA 3FZYA 5L40A 3FOFC 1ODLA 1EXMA 1W85A 3BWDD 3CW2A 2PZGA 3I23A 4IIVA 4UEOA 2FX3A 3CEHA 3SNHA 3STXA 3UOGA 5FP0A 4E32A 2A0XA 4TKUA 5DI3A 1UXHA 3PFBA 4NCHA 4KE9A 5DX0A 1UQUA 2AXNA 3CN7A 1U8FO 4OOEA 4O2AB 4UUBA 5I4BA 2EZ9A 1W7AA 1QX4A 3O3MB 1RJDA 1FW8A 3MUNA 1C7EA 5T5QA 2P4SA 1GVHA 2JDID 3L9WA 3MHPA 4IMRA 1FTNA 1ZM2A 3MTAA 3DZKA 4JI4B 4ZOLF 4PFSA 1R88A 5EINA 3ZYCA 3HP4A 5CB8A 1XCPA 1ZN9A 4IZ6A 5H3LA 5KPDA 1W93A 3G17A 3JWGA 3RTGA 3UT0A 1KK2A 4JSYA 4AB1A 3MC1A 4W9RA 3HDHA 5AXCA 3R1IA 3BWCA 4ETWA 4GD3Q 3VSBA 1OA1A 4MV6A 1MO6A 4QDJA 3W05A 4DXAA 5IJWA 3Q72A 2DWPA 4H0FA 1JW9B 1E99A 5G4KA 3ZGLA 4TZ0A 2XCIA 1VKJA 3FTCA 4PQEA 3GFFA 5T4FA 4EG8A 5C1PA 4L8VA 5KYWB 1QRRA 4LSWA 2LDXA 1RE0A 1AK2A 1Y3BE 3CRRA 4PAMA 5TQVA 5DNDA 1M1YE 2WJVA 5EMLA 1IXRC 1I1OA 2YIJA 5DHQA 3FNBA 4CQMD 4B35A 3VSCA 2O3SA 2QMUA 3BD9A 5F3DA 3COJA 4B09A 2QTMA 3AKYA 5FBKA 2PEZA 3QKTA 4B7AA 4BMVA 1PWEA 4RZQA 2PTHA 3T7KA 4BXOB 4BY9E 2E82A 5MF6A 5HKLA 16PKA 2IYVA 3R7NA 3F9RA 1RHUA 4IOLA 1QF6A 4CKWB 4AO6A 1QYCA 2AWNA 1T15A 1YB1A 2PSFA 3K31A 3R40A 4QXRA 4UJ5A 1YR9A 3TB6A 5TMPA 3ZC3A 4XLLA 1Z6AA 3SE7A 1KDZA 1L7NA 1X7GA 1WMEA 3U7QA 5B5SA 4ZI5A 1KXZA 1W0KD 2EEPA 2X22A 3PJGA 1M2HA 3AVVA 5L3RA 2QVBA 1EA5A 1UP7A 3TG2A 4AQ7A 2I4IA 3ZWMA 1XQVA 3BXZA 4KXVA 2Y4OA 3PC7A 5D3MB 3UQYS 1IHOA 1NMSA 2CD9A 2Y9MB 5SY4A 3T1TA 3QW2A 3BH0A 1OPRA 1XG5A 3N8HA 1E64A 1KKLA 1MBZA 1PU2A 2BJHA 2EGHA 3NUQA 3A36A 4OQNA 1E3WA 3VJMA 1B1AA 1C7FA 5F78A 1GADO 1RM0A 1ZKDA 1X7XB 4AJLA 4YT8A 5KMGA 3T4EA 2GILA 5FBLB 1O57A 3HSKA 3ZE8A 3EXIB 5BVGA 3NNSA 3MAJA 4ZU6X 1KETA 3KAJA 5ITZB 1DEXA 3WZ2A 3SQXA 3ETGA 3AONB 4LNUB 3C5EA 5L6MB 1FNSA 4J16C 3R7SA 4FYXA 1QPZA 2VXYA 1A88A 3G0GA 1A1SA 5EP4A 4RDXA 5JH7F 4TTSA 3V48A 1S2MA 4Z6KA 2PYDA 1PR1A 3LYAA 2H4FA 1H3NA 3E9DA 4F3RA 4YPOA 5LNK6 3LUGA 1G4HA 4WZAE 5ENVA 2WQZA 4X94A 1Z75A 1W5SA 4PCLA 3VYSB 2YRXA 2QE7A 3U4QB 1LBIA 2REOA 3ILVA 4EO4A 1QSGA 3MB8A 4L85A 2ENWA 4KEAA 4DS3A 1QU2A 3OURA 1TLLA 2OYCA 4RIIA 1YB2A 4LX0A 1NW9B 1VG0B 4Y0NA 2PSHA 1MJ5A 3HQ4O 4HN2A 4XLZA 4XVRA 2X14A 5DHSA 3F67A 2WM8A 1V4BA 2AG6A 2A9RA 2V55B 4IQ4A 2FVYA 4MARA 4MUGA 4L4YA 2COUA 5C5DA 5IC4A 4RFSB 4COKA 1PL0A 4DNFA 1G7SA 3ONVA 4QWWA 1FK8A 4FEYA 3WRXA 4Q9LA 1AH2A 1T1EA 5FNZA 3UC9A 3WJ2A 3OLZA 1RM4A 1R6UA 3HP1A 4ZGBA 1Z2NX 1V2GA 4P92A 2HCRA 3HDYA 4GYKA 4PSDA 1LV8A 2QUBA 2GOYA 3A6HA 5FOWA 1B15A 3RIXA 1H9CA 2YNMC 2XUZA 2WKRA 2Q7OE 3MD9A 1EQ2A 1MMFB 3W06A 3U37A 1LSUA 3G7NA 3H1EA 3IAUA 5DCWA 1J0XO 1MKYA 1MO5A 2PVSA 3FBGA 3M9LA 7ADHA 3UFXA 3WL7A 1KEEA 3B82A 4EHLA 2VDOB 3HLYA 2K7ZA 3HJUA 1AKWA 2KB0A 2DGDA 3DG9A 2IKQA 2RIPA 3PEFA 3G8DA 4QICA 4E08A 1RCFA 2XB4A 2IITA 1OVGA 2ZJ2A 3HJTA 4GVXA 4HSGA 1U2RA 5AOCA 3ITDA 2QTLA 3AMVA 3V2UA 4Z2AA 2ZTSA 3G9ZA 1WNTA 2OAGA 3FYUA 3TQQA 2DG2A 4N41A 3UV6A 1Q1AA 1ZXBA 2WNSA 2UYOA 4C7KA 3L8EA 1NL3A 3KTDA 1ESMA 2NNWB 3EDCA 4XIIA 1VSVA 2B21A 3Q5EA 5AFSA 4EJ2A 2CLCX 4HVTA 4ETIA 5I5EA 3U9SA 3A6PC 5CB6A 4YACA 1F0PA 3BRWA 5FTNA 3CNQS 1GNLA 1QX3A 2HC9A 3C6MA 4YRRA 2FG6C 1XSEA 4CM4B 2WTEA 4IF6A 3SFTA 3M5CA 5I7RA 3PNBA 3N2GA 4OPMA 3DMDA 3H1TA 4U2GA 4P0PB 3EW7A 3OKPA 1RQNA 2J48A 3N8DA 1SEVA 2YRFA 3KYDB 4GMHA 1ZNQO 4P35A 5AICA 2P6UA 1XJ5A 1RI4A 4JP8A 2MSCB 3GX1A 2EG5A 2RB4A 2YRWA 1I9GA 3QEJA 1TA0A 1QYWA 2XCUA 2OYSA 2CXXA 1X77A 1RS0A 3A4YA 4MINA 3PUKA 2AI1A 2NUAB 1BE1A 2VP4A 4A6XA 4AMZA 3G13A 5HVNA 4MHTA 1OAOA 5KJCA 1FCJA 1PR2A 1QOPB 1GXSB 2J9XB 3LF1A 2AV6A 2YHSA 4HNAA 2IL1A 3AW8A 3FYUC 4POAA 3VKVA 5TQ0B 4QGFA 3V4VB 2CMDA 1YVPA 1YB4A 2GK3A 3ZEIA 4UFOA 1JEDA 4KPUA 1KVUA 3PICA 2BF4A 1UDWA 3CZAA 1JLLB 1JEYA 1OU0A 4XGQA 4NHOA 4PX3A 5A7HA 3T5AA 2BSXA 3FCAA 4RZ2A 3GY0A 2Z43A 3PQ7A 3A9WA 3RS2A 1COWD 1NBMA 1EK6A 4RIEA 1N5RA 4RIHA 5BV2P 2P9BA 3RT7A 4Q15A 4OH7A 4HUQB 4O4LB 3BZBA 2Q3JA 3WLJA 4MQMA 4V02A 1JIKA 1RXIA 1SQGA 2XCOA 3DZ8A 3F9IA 4TLDA 3T6KA 4J0IA 4ZEWA 3ZG6A 2R7LA 3KS9A 1QFJA 4OAOA 2HHHB 2BHNA 3B53X 2I55A 2QQ0A 2IU4A 4FMBB 1MOQA 4K40A 4P81A 1ISJA 1RXWA 2H1CA 1L1EA 1P4HA 1R5JA 2ZOSA 4HMQA 4TS9A 1JTFA 1BC5A 1MENA 1CJUC 1RXCA 4FNAA 3U0BA 3LTNC 2IZZA 3SU8A 5IZCC 2FYTA 1KA9H 1VRVA 1MDBA 1KIAA 1QTNA 2BBSA 1IBCA 2F3PA 3O83A 2IPMA 4KXLA 4MI1A 3G79A 3SZGA 2O3JA 3D3WA 3V2IA 3TLKA 3IBTA 4C08A 5LVAA 5LU8A 3SFVA 3G8YA 2IJGX 4QODA 1X19A 2WJWA 4D8XA 4KGXA 3HKEB 2AC2A 4EYQA 1HRDA 1TEXA 5ALZA 1ML4A 1ZK0A 4XH9B 3QJYA 4G2TA 5M7EA 3OPVA 1T1SA 3BWEA 2GPBA 4QTXA 3DKIA 4ZVVA 3JYQA 1C2YA 4PGFA 1CC1S 5H68A 3ISVA 4EHBA 2RGRA 3HFGA 4TVKA 1AGXA 5AJYA 3RNOA 3WLMA 4HEQA 3MTBA 3ZQKA 3EWIA 3OOHA 2R5WA 4L75A 3UOWA 4KHPB 2J3IA 3AESA 1Q44A 4A6PA 1CJVC 1KFCB 1NOIA 1PT9A 2EYUA 2C31A 3PEUA 3R7LA 2X6RA 3ZU6A 3MFYA 4IUYA 2WVHA 4O25A 4EUHA 1OLOA 4ZQCB 3B7GA 1B8UA 2WZCA 4CTKA 2QSZA 2X9LA 4JI7B 1YQTA 3DLIA 3ZJYA 2F1KA 5FBWB 2XMRA 1MFZA 4EKDA 3FYDA 1IN6A 1G6OA 4MPDA 3PQ4A 4OP3A 2PUGA 1QZ3A 3B1VA 3CW8X 3SQOA 1XLVA 1BROA 3DFZA 2CUNA 1V95A 4EKIA 5F35A 1XEWX 1K7EB 3HN2A 2GM3A 2C9OA 3F7NA 4BWVA 4CT4B 5E8RA 5IXYA 4ZA2A 4B46A 3D4PA 3AFHA 4URWR 2VHTA 3CNNA 3RAFC 3OQPA 5CW2A 3C3YA 1JWAB 1NNSA 4OBBA 4QJIA 3SJBA 1QTRA 4DQ0A 3DCJA 1P1CA 3ASZA 3M1LA 3C3WA 2MT9A 2WD7B 2QLMA 1DFIA 5BORA 1PJTA 5I01A 3R20A 1FDUA 1HDXA 1E2DA 1SC6A 2GA9A 2P9GA 4IG9A 4QEZA 4ZOBA 3BB4A 5DEOA 4ZTUB 2BFEB 4OQYA 1U94A 4A6DA 1QNFA 5AHOA 3EGWA 3VPDA 4L08A 2C2GA 1UBUS 2F48A 2DJIA 1VLMA 2EF0A 1CF2O 4XI9A 4QFCA 2O23A 1XEXB 5BYJA 3V34A 4V39A 1XZJA 2PG3A 2Q0XA 2QT0A 3W8FA 1TYBE 1IRXA 4CN8A 5B12A 2QD1A 3LXRA 4JKIA 1K6MA 2BF7A 2YVQA 5I5GA 2NP6A 4RD6A 1XK7A 1XJCA 4C7BA 3M3HA 4PTLA 4NKRA 4JEMA 3AV0B 5GJWC 4MW9A 2JBAA 3SQNA 4A9AA 2WFZA 5C8YF 1C3OA 1QJCA 3IRVA 4NYJR 4BJ5A 1P0CA 1C1YA 5IYZA 4YS6A 3NT4A 1F1BA 1CG6A 2F8LA 3NV7A 1SZCA 2PLAA 4EL0A 1E4VA 1DTEA 1SFRA 4YJ2F 4LYHA 2IY9A 3EIHA 5A0VA 3EVBA 2QTTA 3OC6A 1U8TA 2EVWX 3R5JA 1F9AA 1C0EA 2B4QA 2BFDA 1GGFA 2WMYA 3PIRA 4I08A 4J9UE 3ITNA 4KN9S 2IYEA 4D6XA 2I6QA 5EHIA 2QE7D 3HHPA 3OIWA 1F5NA 3MSCA 5EQDA 4I8XA 1LY1A 1PHRA 1ZC3A 2VH5R 2OBFA 3A6EA 1W4RA 2QX4A 4DDTA 3WMXA 2JLCA 1HKUA 1V7ZA 3OTQA 1VRWA 2VJMA 3QU9A 3EPJA 1QVZA 5EIHA 3KKMA 3NP9A 4YWHA 5K0NA 5JAPA 1K2WA 1Y6QA 2IVZA 2LV8A 1N8KA 4B5LA 1U2EA 4DJAA 5LM3A 5ER9A 2VKTA 5A6VA 5C8VA 2VHQA 5AIAA 3QELB 5AVZA 1L7QA 3KPUA 3NFRA 3PGXA 5IKXA 1N2BA 2O7RA 3FUXA 2OPBA 4OKSA 1IATA 4Y6OA 3X2FA 3A0RB 2VHUA 2QRZA 3OOJA 1B23P 5KREA 2PA0A 1EJ2A 1X80A 2FZLA 3H9GA 4ZAGA 2V7QA 2BC9A 2APJA 3KEQA 2WHPA 1WB4A 4YRSA 3HFJA 2DFPA 4P6VF 1KK3A 3UGJA 1L6IA 2G0NA 5KNDH 4UULA 4AC9A 1VPVA 1FNCA 3FMIA 4QRDA 2OLEA 1WMAA 1W29A 4JL5A 1IMOA 5IHPA 5GONA 3PWKA 3DV2A 3H2GA 4C7MA 4AN4A 2VTEA 1DO2A 1P39A 4I2VA 1YS7A 3RLFA 1DAMA 2ZBPA 3B8HA 1N2CE 2HQ1A 4C88A 2LCIA 2IYFA 3D1LA 2FWIA 1A82A 1FNBA 2Z1MA 1G3RA 1XLUA 2JHAA 4EHNA 1N6RA 4FYIA 3LFHA 1Z4NA 2BPOA 3BRWD 1PVDA 3D2AA 2GPSA 3L1UA 3L82B 3MEQA 3VR1A 4F7WA 1X39A 2PUFA 1PJBA 5TDHA 4HNSA 4L57A 4MRPA 4FK8A 1PWHA 1L5WA 4Q21A 4L51A 3MD0A 4EUFA 1IN1A 3QVGB 1ISSA 3QTLA 2PGOA 2B1JA 4EI7A 4GVLA 4QD3A 1SUFA 2IYWA 3HB4X 4TQUS 3SVZA 1W581 3GRFA 2BBOA 2P3OA 3FJ1A 3PLNA 1CY4A 3Q6IA 3PGA1 4UHCA 4WOKA 5ADHA 2OO5C 5FDFA 1X7ZA 3JX9A 5LOVA 1PJ8A 4X3CA 1NN3A 2XZLA 4ER7A 1DPGA 1KSGA 2OVBA 3HKBA 2DPYA 5DLEA 2C7BA 1BE8A 4BVAA 4FFOA 1KAOA 3LCMA 4OREX 4I8IA 4AULA 4F0JA 5IW8A 4UTNA 2GCOA 2FRXA 3O8RA 1BXZA 1RRKA 3H05A 5GOTA 5ECWA 5EXEA 4B2PA 1TTPB 1P6QA 2VBCA 1GN8A 3BM5A 3RO7A 4P3NA 4YQYA 2R47A 2EX4A 3DE6X 4TRNA 1UMCA 1VGVA 1IEVA 1XQ6A 4YI3A 3AUYA 1GSIA 1P61B 1NFQA 4YP9A 4BNNA 2EV9A 5AW4A 4TL8A 4AJHA 4BFCA 2UUCB 4RLHA 4EYGA 5HCNA 4DCNA 4PO8A 4QBHA 1NBMD 3BBLA 3R5KA 3DO6A 4MIYA 2QR3A 3SC2A 3ZVKA 2O1SA 2OHXA 2PE5A 2C2KA 3UHPA 5BY2A 2DAPA 4AN1A 3STWA 4RPCA 1G8FA 3IHKA 2JK0A 2R1VA 2VC2B 2O6HA 4QJ3A 1PD0A 3O74A 5HZMA 5DBHX 4F4IA 1RWNA 4O1IA 3TCNA 1D1QA 1UQTA 4H7PA 4WIAA 1LBQA 4D4LA 5EERA 2ZWAA 4C29A 3E9EA 3I2IA 3L01A 3ADBA 4YIKA 2ZGVA 1EQUA 2ISSD 2G5TA 5BR7A 5IKPA 3EVZA 4PG6A 3JVUA 1PKXA 3ENWA 3PPIA 1X9HA 2WSLA 1HG0A 3QUCA 4HWRA 1A9OA 2XF8A 4BC1A 5B7GA 3QF7A 3BT7A 5BNFA 2CYAA 1TRKA 4TGLA 1V43A 4YCAA 3FYHA 4MAFA 1TNDA 5KYUB 2Q1TA 2ORYA 2B5VA 3RBVA 4C30A 1NN1A 1HNNA 1P7PA 1H69A 1EP2B 1MGOA 2FXIA 3JR7A 3L79A 4GPIB 3UT5A 5JJIA 3FN4A 4ND6A 1UDCA 2Y68A 4R84A 3DMTA 3NDJA 4BO4A 5C7YA 3DEHA 2P5SA 5JAMA 2NW6A 3AUAA 2YXBA 1T1GA 1JPJA 4MJLA 5A1JA 1NQ5A 3HCWA 5M2QA 1R4MB 3SMVA 3ACBA 4WXHA 3K96A 3QY0A 3KIPA 4E4YA 1YR3A 4S1OA 5FUBA 4HG2A 5IARA 5J5VA 1WXQA 4NYMR 3OQBA 3PD1A 5ERGB 4GKBA 2VP0A 3O5AA 4G07A 4L2IB 2BAGA 4FC6A 5E3JA 3RTCA 1E3DA 3MCVA 3NVDA 2K7FA 2OC9A 4WCVA 5LMUB 1S1CA 4MR7A 3PNPA 4X63A 5DM4A 5F76A 3QMMA 1ORTA 1N8SA 3RVMA 5BR1A 1IBLB 4FNOA 1DT5A 1H65A 1PS0A 1V16B 3IJ5A 5DGIA 4M3NA 4KTTE 3D7NA 1C1DA 2RGWA 3E7DA 1XZQA 1PFUA 4OUDA 4BKUA 1S8AA 2FA9A 4F96A 1Z36A 3VM6A 4A2WA 1VBKA 3BZUA 4J76A 3ZUPA 5LWHA 3HKDA 5GPBA 2EJBA 1J70A 3EGDA 1CQIB 2VRNA 1JU9A 5JTUA 2XVXA 3B5JA 2RE8A 2HWYA 1HDZA 3KJZA 1NJ6A 5IJ0A 3QE4A 3RRBA 3GJ7A 4IXDA 4YX9A 4ARIA 2I66A 4JASB 1OWPA 5D7BA 5AW6A 1NLMA 2PT5A 2I3DA 2RH4A 3JASA 2I2DA 3F73A 4G67A 3IDOA 2PAAA 1SXJA 1KZHA 1KAEA 5JZOA 2H17A 2HA4A 4NZPA 5EZYB 4BO6A 2G6TA 2QLJA 5AKKA 3A9VA 5I7EA 3PI6A 3EULA 4CLOA 1SVSA 1AKYA 4YV2A 2H51A 4H1HA 1GNSA 4BO1A 2E1PA 2H1HA 1RJGA 2JCSA 4HZIA 5CDYA 1GWNA 1RBMA 2I9PA 3PGVA 5BP7A 3M83A 4RJTA 4G1EB 4AJ4A 4BN0A 4JI6B 3G3EA 5FRDA 2PZMA 1KMQA 2WM9B 3D8BA 1M2WA 2ZYAA 4IKEA 4WNIA 3HU2A 3K0AA 4QFDA 3FYTA 3MYYA 4ZRMA 3RUDA 3GFSA 1G1AA 1K6JA 1Z35A 1ZZEA 5B1EA 1GG9A 3DLTA 4JUFA 3W79A 3DOEA 4DV1B 2IVFA 3WL3A 4CJXA 3EZXA 1QXSA 4IG4A 5DSTA 3WBJA 3R0JA 4KCGA 3KXLA 1MNAA 1VKZA 2OZLA 4WXRA 5E1MA 4YI5A 1Y7TA 1I7LA 5EE3A 3PFKA 1WP9A 3B51X 3C45A 4QUGA 1BHQ1 2J3QA 1SU8A 3ABOB 3FSRA 3WADA 5BNZA 5EOVA 4ZMSA 4W5RA 2R87A 3BHIA 1ZM7A 4LDQA 1KDRA 1MH1A 1TZCA 1TQ8A 1SXHA 1Q57A 2Z58A 3ZVMA 4V0NA 4FCTA 4RF2A 4MHOA 4YJKA 3VYUB 1DQZA 1YC5A 2ZTVA 3FCXA 1PZGA 2KHZA 1D0VA 1P2TA 5CK5A 5CB4A 3AI2A 3DE2X 3BTUA 3M9XA 4ZRNA 2GZMA 1C3VA 1QRUA 1ZICA 2PIDA 3PVZA 3TLBA 2FMTA 2OCDA 3LFTA 4E12A 4HKTA 4PZZA 4D9IA 3DV0A 1GUAA 5GZ1A 1AQ6A 4BKRA 3ZE9A 2J31A 1GPNA 2V7QD 3FG9A 2EFYA 1GRQA 1PNVA 1JIJA 1F12A 1ULZA 3DHEA 4IWXA 5C31A 3ZHRA 2N9UA 5SYNA 2B4AA 3B9PA 4K86A 1AHIA 1TW3A 3LY7A 3JPYA 2N46A 4JJ8A 4NBVA 4Z9XA 2G40A 2WTBA 4HVLA 2IYOA 1H2BA 2QX8A 1T2AA 2ZJ4A 4CKBB 3JVDA 3ROGA 4IJ5A 3FDXA 1QG2A 3PDHA 3FTPA 3Q9SA 1ADCA 1JXQA 2PKWA 1RYFA 3HR8A 1CUHA 4GPEA 4RNCA 4I1YA 3ZQUA 3ZVNA 5DOVA 5KYYA 4OKNA 4CM9A 2ZB7A 3AVOA 4PXYA 3JQRA 1K86A 2DT5A 3HKCA 3PJDA 3WNBA 5A1TA 3LKZA 2CDBA 4F3CA 4LYEA 1MCZA 1DJLA 2CC2A 3EQ6A 1RXUA 2I87A 5HGJA 3X1ZA 3JQGA 2DEUA 1CK4A 5B30A 2BHRA 4PHFA 3FFWA 5IBQA 1R18A 1ZUWA 3FWNA 3HR7A 5E9JA 2QN7A 1WQ4A 2P6RA 1N57A 4CMAA 1KC1A 3ZHUA 4FILA 5EE5B 3WLNA 4QVKA 2CHVA 2XTZA 3CG0A 3CLSD 5CFPA 4TZ6A 4J8PA 5B58T 2YMLA 1MDFA 1SUIA 2GPYA 3OX4A 3AHHA 1JQ3A 1RYYA 4OHVA 1KEZA 1A9QA 2GRAA 2Z8XA 5BO5A 3RABA 5A02A 1PK7A 1PJ2A 1R8XA 3FYSA 3CPJB 2B2XA 1IJBA 3DO5A 4MRVA 3BL8A 3JW8A 3PCRB 3EF1A 4B7ZA 1JIQA 3D6AA 3N5CA 2FB9A 1B6SA 1ND5A 2R1TA 3E2IA 4E6PA 4QARA 4ISBA 2W2VA 3BA1A 3RHFA 1JP7A 4MVJF 4EMSA 2R2AA 4GNKA 4JBGA 3FNGA 5J4VA 2WUDA 4LRYA 5A5VA 5GTDA 4NXMB 5BQPA 3N6RA 4B40A 3IBFA 4DLPA 3R7FA 3OJEA 5BSVA 2J4CA 1EFCA 3R09A 3ZK7A 2HJSA 1DZ3A 4D7AA 5HRUA 1EG7A 3WNDA 2C7QA 2TS1A 3DULA 1S01A 4U7PB 3AF1A 3JYPA 5CGQB 1FYXA 5IX8A 4M8KA 1TCUA 1A4UA 3PDIB 4TMZA 1GOTA 3VV3A 4FYPA 2BP7A 4LF9B 2OV8A 2UZ0A 3VU9B 2G5GX 4QFMA 4UNRA 2HEGA 5CDHA 1EGMB 4P82A 5JO9A 7MHTA 2CJWB 1WETA 3EXHA 3AUJB 3U7IA 2YJ3A 2GRUA 3ZEAA 621PA 2AMVA 4HZUA 1IK4A 3I1FA 2V6IA 2VNKA 1IJEA 3FYUB 2ILTA 2OP0A 4HAZA 4TS3A 3FR7A 4C6RA 4YDSA 4IZHA 1FYEA 1DJNA 1YUNA 3MMXA 3WICA 1Z15A 4JUAA 4RDHA 4HNUA 2BEVB 3GLVA 1V7PC 4IBOA 4RSHA 1QHHB 2NXEA 2J7PD 5CCDA 3V7YA 5GJCA 1PFVA 1WW3A 4Y1RA 1QF9A 2XQGA 3E3LA 4FZ3A 1LV7A 4OQQA 2GAIA 4I2NA 3GXOA 1UJBA 2ZB4A 2VZ8A 3K9LA 3M4XA 4BAUA 5LMNB 1HUQA 2H57A 2F1JA 1A8IA 5CCBA 5LFAA 1LDMA 2ZW9A 3N2GB 1Z22A 4NAUA 3LP8A 3FOCA 2I3ZA 2X6QA 1D6JA 3CF4A 3JQFA 1A7AA 3L92A 3A05A 4IDOA 4XIYA 3GLIE 4L73A 4XRGA 2VK1A 3URMA 1ZI9A 3KAKA 3G82C 4AZ3B 3DP9A 1MW8X 1Z4LA 3UWKA 4JXXA 1CS4C 3N2ZB 3V3TA 4BNHA 1D8TA 2UXBB 3OVMA 3ODPA 4EG6A 3K2EA 4N3CA 1X1SA 1B73A 1BSVA 4TVSA 4ZEVA 2XOEA 4QOSA 3UBMA 4XWOA 2V97A 2ATIA 3HO6A 4I50A 3AHEA 4ZP1A 5IAAA 1DHTA 5FUVA 5LKAA 1KO7A 2QZPA 1RQXA 4URFA 4Q9IA 2EG9A 4QJ4A 1YXMA 1Z6QA 2A92A 3D3JA 3KYIB 2DQKA 4KPUB 1AKEA 1PR9A 4X8OA 2XB2A 3PHCA 1PDWA 3FOWA 4NI5A 4WVFA 2X8JA 4QXOA 5FV7A 4TTAA 3UJCA 3JXEA 2C5EA 1F0KA 1GN9A 2NU7A 4JOCA 3E9ZA 2X9VA 1A9SA 3OCVA 3EDYA 3ZHBA 3KDPA 4ZJZA 2XMQA 1RAHA 3VBCA 1OXBB 1QIMA 3F3YA 3FMOB 1WD5A 2C4WA 2WYWA 3R5HA 3T9FA 3OZGA 1LDNA 3T38A 5AQ1A 1WPRA 3HGQA 1EYZA 1QH1A 1LBTA 3HG7A 1QHYA 4ZOLA 2QQ5A 3FDZA 4JVNA 3AR5A 1WW2A 3KKNA 3WC4A 3B20A 3BILA 1VI5A 1OX6A 4IVQA 2REBA 1G42A 1XJWA 5FWDA 1T6NA 2UYGA 3E7FA 4NCAA 3C98A 2YIMA 2CFIA 2PCLA 3UW3A 1SXJD 2VRCA 1NVAA 4JSTA 4CU5A 1V1RA 3OIFA 4IMPA 3CUVA 1NVXQ 4ZOQI 5C52B 4XVUA 1GG2A 3QU2A 4KVAA 3BFXA 4Y7CA 3WWPA 2REQA 1I7NA 2AW3A 1Z0JA 3K5WA 4YQZA 1JDBB 3VZQA 4HFMA 4YHBA 3RBZA 4C06A 3UPTA 2JGDA 2QZJA 3JARA 5CIQA 3RF7A 2VF4X 4BVLA 1YR2A 2BBWA 2W5UA 3GNQA 3IQGX 4INPA 5EUBA 3JAKA 3T1VA 4OIFA 2CGEA 4FBMA 5A3JA 4E13A 1SBTA 3P45A 1MABA 1ZUHA 2OV2A 4GBJA 3GQBA 3AESB 1Z4QA 2QTVA 2PAFA 4AW9A 2IHJA 2G4VA 3LVQE 1UL1X 4RD2A 4CMHA 3S5UA 2ERXA 3GLIB 4AS3A 3MINA 1NRXA 2L18A 2XXJA 4CG3A 3DEYX 4BV3A 4QUBA 2YIDA 3CBGA 4YMSA 1E2EA 2ESRA 1NYRA 3DDSA 4BRWA 3HM2A 2AA3A 1OR8A 2FF5A 1FJXA 5F4BA 4LTNA 3WLRA 3ZE0B 3WMWA 4B34A 3ASUA 5CTAA 3U44A 4AK9A 4P7FA 1T5SA 2C78A 3I1IA 1ENZA 4I55F 4G5QA 4AF6A 3N0VA 2H3HA 4JP2A 3ZTYA 3TECE 3I2GA 1HQDA 1Z5GA 1P44A 4BUJA 2I7CA 3RNLA 1VYUA 4J0KA 1ST2A 3PD7A 1WTCA 1SUEA 2RKOA 4B3CA 3GWGA 1QIEA 2VXCA 5JCOC 3CT4A 1G63A 1DMRA 3TD6A 1R6VA 2CL7X 1OTYA 1N6IA 3L7LA 3O84A 2AOTA 1KIMA 4KQXA 1VMIA 4TZKA 1Y37A 1PYDA 5IMBA 5CAEB 1BGVA 4X71A 1HE3A 4LOLA 3U4HA 2GYWA 5H0IA 1QHXA 3PQ8A 5KOJB 3QRWA 4G1FA 5CP8A 4G4SO 1BWPA 3QYAA 5JH7A 3TQFA 2QPLA 1D2NA 3OE7A 2H06A 2PH1A 3L6RA 4J9VA 1EP1B 4DADA 5M5BA 1JDUA 4HQLA 4LMAA 2ZWPA 4A8HA 3HCAA 2JH9A 4CFSA 1I4EB 4LIPD 4RF3A 5KHOC 3F5MA 4BLOA 3K7EA 2OKGA 4J7AA 1KQNA 3LU1A 3VDNB 4CM9D 4KXMA 5AVYA 3T94A 1P2VA 5JSZA 4CF5A 2ATEA 3VKUA 3H8WA 1WZUA 1OKKA 1OHHD 1C3OB 3CRQA 1RAIA 1IFXA 1D03A 3PL1A 1LPBB 2E21A 3OOWA 4KX3A 5EP3A 2R8XA 2ANCA 5K09A 3CXRA 4ZTBA 1U9IA 1CE8A 1ADJA 2I4OA 1L8QA 4MVCA 1CJCA 1OFIA 1Y9EA 4X9XA 4RH3A 4F06A 3KTFA 3KXIA 2J0VA 1JG4A 1JSZA 3OWHA 2V45A 3WWEA 4F9EA 1WP4A 4MYTA 1D7AA 1EK0A 1WXIA 1ZVQA 2BFDB 2DWUA 2J46A 4JBYA 4KWCA 2D4AA 1I3LA 2Q7DA 3T34A 4ARUA 3QX3A 5CXXA 3W9BA 3JPWA 1YZKA 2CUZA 1Z5ZA 1FBNA 1DBSA 1U1CA 2YINC 2OWDA 1SZJG 5JDIC 4C4RA 3JQAD 4II3A 4ZMBA 3AR6A 5J2UF 3VHQA 1TMOA 3ER8A 5L3QB 4TTRA 1QKJA 3FAZA 3B6KA 3WMGA 1LPAB 2Z5LA 5HX7A 1VJ0A 4OHFA 4QUDA 1OQAA 1DC7A 1G8YA 2LGJA 5EJ9A 1SUSA 2OOKA 4GXNA 3AL3A 4MQUA 1RJ9A 4UMDA 1PJQA 1ZK2A 3EIQA 4D3FA 1Q0LA 2JFPA 3I45A 1CUZA 1WUIS 3EQ8A 1C3LA 3Q8LA 4ZQHA 3K5HA 2XKKA 3PWTA 4QA9A 5EXSA 4MYSA 3BSYA 2JFYA 5IAGA 4R1MA 4N03A 2UAGA 4MA4A 3K1JA 1BRTA 1S3IA 3DE5X 1U9IC 1A9ZA 2YWHA 3F7MA 4RGYA 4YRFA 3I42A 2Z2XA 3VYWA 1GGVA 4DZZA 4EGJA 1XWWA 2FZWA 3BPSA 1W49A 4IDGA 3VJKA 2AX3A 2DUNA 2FP4A 3PS9A 5GONB 5F7OA 1QP0A 4URXR 1UK6A 1E8DA 1KY5A 2AH5A 3CZ9A 3K4HA 1SVMA 1JB9A 1W87A 4N40A 4Y9DA 2IUEA 2RBEA 2SKDA 3L18A 3PKZA 2JFZA 4A10A 5IAOA 4DCVA 2DX7A 3LUHA 1XELA 1WEHA 4XVQA 4UTVA 4LYGA 1XNRB 4ND7A 5K5EA 3RLIA 2O8CB 1A0OA 5K4AA 5GVRA 3VUFA 4V03A 2IHNA 3TXXA 1F0NA 3RCBA 4JA0A 3A9SA 1D2AA 2Y1GA 2EGUA 4RGVA 3K0HA 4C0BA 4YPVA 3NIBA 4DV7B 1RRFA 1C7QA 1ZEMA 2E87A 2EL7A 4TX1A 4DNOA 2IS2A 4NQZA 4D02A 4IO0A 4LX8A 4A7PA 2A9OA 5DGHA 2ZATA 3DB1A 2VO1A 2VOEA 2HYDA 1JG2A 3GPDG 1TVMA 1WMSA 2DMRA 4ZV7A 3IDAA 3VO9A 4E15A 3HCCA 3COSA 2G4CA 3OECA 2NUTB 2XI4A 4RHTA 2ZUTA 3VZRA 3W9UA 3IPYA 1SZDA 2QE6A 2GAOA 2GEKA 2XNKA 4N3AA 1N36B 3GK3A 4MVXA 4NBWA 2FOIA 5IEBA 4XQEA 1TCCA 3CCBA 2E2WA 2YS6A 3HKBB 3KYCA 1GPDG 2GHIA 2HQRA 3P8ZA 3EJWA 5BWOA 3CVWA 3I6BA 4WFIA 5K0GA 2ZWVA 1ADBA 2VLIA 4AG5A 3RIHA 3TZKA 3U39A 4AL4A 1KGDA 3JQBA 4RK4A 5LPNA 1DTSA 1N9GA 1CDOA 2A0WA 5AKIA 5IASA 2ZVQX 4GKKB 3N07A 5DTEA 2WPNA 3LC7O 3K3PA 4ZYLA 2D2VA 2FR0A 3ZYZA 1IG3A 5IJZA 1UMCB 3IBSA 4AKSA 2C9ZA 4HQ6A 3ETLA 4INOA 4KB5A 3H7IA 1V25A 3DMPA 3ONDA 4Y30A 1NQOA 5T3UA 3RAPR 3W5SA 3WRYA 1YKGA 2BMVA 3LFUA 1ATIA 1TT5B 3DPSA 4QLAA 1EXDA 2Q4EA 5EIXA 5AR1A 4PBRA 3OFNA 3C41J 3SC2B 2PD4A 4ND3A 2DB3A 2XE7A 3QI7A 1S8OA 1NMZA 2GPWA 3OC0A 1QVRA 3G89A 5KTRA 4G0PA 2ZJ8A 1XF1A 4M87A 2J6BA 2R1VB 4BNLA 3CKYA 5F3WB 1LVUA 3HWWA 4YAIA 3NGMA 3MTJA 3ZD9A 1WWKA 3CF4G 3CINA 1QKIA 1GKIA 1RWOA 4TWRA 4YMWA 3R9IA 2XHEA 5C3UA 4EHJA 2DJ5A 2F8SA 1ZU5A 2W6NA 2O8DA 2QM0A 3T7EA 4KV7A 1LPNA 2M6LA 1WULS 4AUMA 2VRCD 4EW6A 3CVXA 3ZXYA 1RBYA 1R0RE 3PSAA 4PYNA 4EEXA 3I0ZA 3KOXA 2NO6A 3C7TA 3PTAA 4WOPA 3WWZA 2B30A 3CO0S 2GKSA 1V45E 4BO2A 1H23A 2BEWA 3DBRA 6ADHA 3I9JA 1BCSA 5H82A 3UGQA 2WAYA 4RANA 4BQPA 1Q6YA 3O3CA 1Y6ZA 1V26A 1UDBA 1A7UA 1HO3A 3LKVA 1XZEA 3LOQA 4K6MA 4R69A 3RU7A 3WRYC 4K8OA 1L7MA 2OA0A 2JRCA 4TUYF 1UWVA 2PUVA 2JW5A 3TI7A 4AUEA 1I4TD 3WSWA 2FSIA 2CV1A 1AE1A 5T6BA 3EPRA 5BNTA 4O4HF 4Z53A 2J9FA 4A8JA 4NG5A 5HOQA 4R8RA 4MP6A 4WGFA 1ADYA 5DXFA 4NZYA 3QW4B 2P4HX 3A2NA 2DY1A 1E3LA 1FRZA 1FQKA 1ELOA 3KTOA 3B85A 3VSDA 4M98A 4K9RA 3K92A 3OOEA 1ZYUA 1J42A 1UXOA 1BFDA 4OK6A 4R98A 5LQUA 1FPMA 1TMYA 2ZVJA 4UBIA 2VPPA 3FGZA 2VUHB 3PVCA 4LMPA 5AXAA 5AW8A 2P41A 4F4DA 1C1DB 1TO6A 2TMDA 3M5PA 2VJQA 2ZKLA 3OE1A 5G0UA 2QTWB 3JR3A 1IIRA 3EXEB 2BTQB 3ER6A 2BGWA 4GMKA 4LJRA 3V8VA 2O0MA 5F2NA 2Y1OA 1SCDA 3WK8A 1NRIA 1AKTA 3J7TA 4UREA 5AM1A 2HQSA 3OY2A 4XFDA 5IJ0B 3A6ZA 3HI4A 5C8YA