5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
source organism Brucella abortus biovar 1 (strain 9-941)
molecule tags Oxidoreductase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
4JJGA 4NQZA 2ZJ0A 1E1KA 1NYTA 2B5WA 4N18A 1Y9AA 1NVGA 3I1JA 3S2GA 4F6LA 3OIDA 1GZ3A 4OYRA 4FIZA 5ER6A 4YAKA 5LC1A 1OMOA 3TZKA 3WS7A 2UUOA 4XB2A 1PZEA 4B8ZA 1PIWA 1CWUA 1H9BA 1DHTA 1ZMOA 3NKLA 5I9MA 3ENNA 4BV9A 2D5AA 3QWAA 5GMOA 4AL4A 5IDWA 4J1TA 1NHGA 5G0WA 5K6AC 4BKPA 1R66A 2JKVA 1UP4A 4PVCA 5I8ZA 5KVSA 4QUKA 3BYZA 1PGQA 4PLZA 1M6WA 3AU9A 3LYLA 2X9NA 1JN0A 4MVJE 1ORRA 4ZN6A 4IQ8A 3FI9A 1RM0A 3L4BA 3OH8A 3ROKA 1T2DA 1IZ0A 4L73A 1I24A 3HB5X 1LLQA 1HLDA 3DDNA 4TKMA 1MV8A 3Q3CA 3GRPA 1PGJA 1RM5A 2RIRA 3DBVO 3ON5A 4TMFA 1EVIA 4DC1A 1YL6A 4IDFA 1U8FO 4FOSA 4LSWA 3GT0A 1ONOA 3K73O 4Q3DA 3RVDA 4BB5A 2HJSA 2OXIA 3F46A 3U62A 1B2LA 2YDYA 3ZWAA 4DL9A 1GCUA 4BNGA 2J5RA 4YT4A 1LRLA 1MC4A 2D2IA 3M1LA 1C3VA 1SZJG 4AJIA 3JYNA 1A7KA 2IEBA 1PTJA 4H3VA 5EINA 4CLDA 2HO5A 3EZLA 5TNXA 3F9IA 2X1HA 4CMCA 4BB6A 5IFLA 1GUZA 2EF1A 2HQ1A 2C7VA 1YXMA 4ITUA 2I65A 3C7AA 2E37A 1CF2O 3CZMA 1V8BA 1VSVA 2RH8A 3M2TA 3MTJA 4YRDA 4MPDA 3OM9A 3TZHA 2VUSA 5JO0A 4DIBA 3NT5A 5T5QA 2O7QA 1X15A 4RLHA 2O2SA 1BXKA 1DSSG 2VTDA 2H63A 3RROA 2V6FA 4TRJA 1VL8A 4W4TA 1GUYA 2Y0CA 3H9JA 1EEHA 2D3TA 2ZCVA 3INRA 3PYXA 3PWZA 1JVBA 3OJOA 4E2XA 1Q1NA 1JAXA 1OI7A 4LGVA 4R16A 3JQAA 2CF5A 4BNLA 1GR0A 2I76A 1KIFA 2O3SA 4YWJA 4AJLA 1T1RA 1PQWA 4Y6SA 1KYQA 1DAPA 4UREA 2GR9A 1EFLA 3EDMA 3OICA 2CNBA 4BIIA 4HV4A 3ZNPA 1NVTA 3PFFA 3PGXA 4QSMA 4R41A 2WEKA 4PZDA 4PG8A 1MFPA 4HWKA 4WCFA 2Y0EA 3WIEA 1LXCA 3UCEA 3G3EA 5JE8A 2VN8A 4Z3DA 3WB9A 1SB8A 3L6DA 1R4MA 3PXXA 5JXWA 1EFKA 1W6UA 1U5CA 3DMTA 4MVJD 4Z9YA 4F46A 2HDHA 3UGKA 4OH1A 1JWBB 2DLDA 3MTGA 1P1JA 3C3XA 3WJAA 3SXPA 3JYQA 3WYBA 4LISA 3Q11A 4WUVA 4I8XA 2LDBA 4R1UA 2Y1OA 3GPDG 2NACA 1H6DA 1MP0A 5HA5A 2VZ9A 1N8KA 1HXHA 1ZNQO 1ZCJA 3K2BA 5KJFA 3UXYA 1O95A 3ZDFA 4CMKA 5ILOA 4AJNA 1IOLA 4B7CA 4CMJA 4BKOA 1EVJA 1C1DA 1T2FA 3JQ9C 2AA3A 2VNSA 4GH5A 2J5KA 2X6TA 5BNIA 1VKOA 4BGIA 3B1KA 2PNFA 3LSYA 1DIHA 1E1NA 1CERA 1ISFA 3PJDA 1I3NA 1CRWG 4LSMA 4DQUA 3RKRA 4NJOA 3TWOA 2GASA 1U3VA 2JHFA 4FS3A 2HK9A 4F3YA 1U3UA 1YH3A 1I3MA 1PWXA 4C7KA 4ZHSA 1K89A 1KVTA 3ZGYA 4WLVA 5HBRA 4XYGA 5A5FA 2QIOA 2XOXA 3DQPA 3HHPA 4BNMA 2GZ1A 3AUAA 5U4QA 3AOGA 4MP6A 1LSUA 1DPGA 3D4PA 4I9UA 2D4AA 4NPCA 1LDEA 1ZO8A 5T57A 1CJCA 3T7CA 3F5SA 2ZQYA 1UXHA 4R9RA 4UUPA 1P0FA 4UVGA 3KEOA 4BMVA 4RDHA 4IM7A 1X1EA 1SBYA 4OOEA 4JJFA 3AWDA 3U0BA 2Q49A 1F14A 3I52A 3MOGA 4A10A 3SJUA 4I9NA 2DC1A 3ASVA 1H2BA 3ROQA 3ADPA 1PQPA 1ZZEA 3QJ5A 4HXYA 4KOAA 3GMSA 1QYWA 3AK4A 3PI7A 2PLAA 1TVEA 3TSCA 1PJ4A 2YQ4A 3X2EA 4J3FA 1E7RA 4K26A 2YZ7A 4MVJH 4M1QA 2JJYA 2IXAA 3GZ4A 2AMFA 2AEMA 3EY4A 2YYYA 5CG1A 5JAQA 1RM4A 1V35A 3NEPX 3CSDA 1E1LA 3IP1A 4L4XA 4MIOA 4Q3CA 4EBFA 1R6DA 2EGHA 2UUPA 2OOSA 5T64A 2NLOA 4YQYA 2WD7A 4W7IA 4OKIA 3AM5A 5EERA 4ND1A 5DP2A 4NU6A 4UAGA 3U4CA 2DT5A 1XIVA 4GGOA 3PGJA 1K6XA 4BL5A 4P4NA 1CQIA 3OJEA 3FF4A 4YJHA 3ZHZA 3BTSA 1E6EA 4DWVA 1RWBA 5F3RA 2CDAA 5C5IA 3D5TA 4EZBA 1U5AA 3OF2A 5FI3A 3ZWXA 3KZVA 1OBFO 1GU7A 3U3XA 5JW6A 3TZCA 2D59A 4UVEA 3IDSA 3JYOA 3R3SA 2YUTA 2C59A 4E30A 4AJEA 4YJGA 1PJBA 3CEAA 3DBHA 5DOVA 4XQEA 2Y93A 2Y05A 3O9ZA 2H5LA 3W4IA 3SX2A 4DYVA 4D41A 3IOYA 5DBIA 1LDMA 2J5QA 2ZKLA 1IE3A 2G1UA 3PZRA 4CLRA 2RAFA 4GVXA 2QW8A 3PLRA 3RKUA 1LU9A 3WYCA 5IXYA 1QSGA 4G81A 5TGDA 4EW6A 3W8EA 2HMVA 2PKRA 5BNFA 1DXYA 2BI7A 3EC7A 2X5OA 4WOJA 5TIIA 3RC1A 4A7PA 3FR8A 4BNKA 2OBNA 1I3KA 1VJ0A 4HUJA 3JQDA 1DC6A 3AI1A 2HU2A 1ISJA 3I9KA 3LK7A 3R3JA 4B7XA 3TL3A 4YXFA 3AU8A 3GHHA 1YL5A 3QQPA 4Y6PA 1SEVA 3MZ0A 3HFSA 3WGOA 4YAEA 2XF8A 3QSGA 3DAGA 5JFOA 4BHTA 4OO3A 4E31A 2WM3A 2FR8A 1ZK3A 4RVSA 4I9HA 1QYVA 1OOEA 2O3TA 1QRRA 1UDAA 3ZHYA 3QVWA 1LQTA 2VQ3A 4IY1A 2WMDA 2X0RA 1SEPA 1NASA 3CE6A 3ONEA 3WMWA 1YB5A 1LSSA 4O63O 4MP8A 1GYPA 1QMGA 2FPIA 4J2OA 2EXXA 4BNNA 4WNIA 4TRMA 4XQGA 5BNTA 3D3WA 2Q99A 2Z5LA 4XZ3A 3PHLA 4MIEA 3BMQA 2Y1GA 1ISGA 4MKZA 1GZ6A 1YJ8A 4PG7A 3S2FA 2VOJA 4YACA 4CV3A 4GSLA 4AJPA 1B8PA 4ZQBA 5K6AA 2GD1O 3RBZA 1UR5A 1YBAA 1BXZA 4TZTA 1KETA 3DO5A 3VAZA 1G6KA 2AEFA 3S1LA 3P19A 1WDMA 1Q7CA 3RUAA 5FF9A 2PD4A 1HEUA 4BO3A 2E82A 4FFMA 1E3SA 3WBBA 1R0LA 3B1JA 3GQVA 4M8SA 5G0UA 2B37A 4BNHA 4KZPA 4BO9A 3S8MA 3JTMA 5DNAA 1P1KA 1SCUA 4MOWA 4CMIA 4CR6A 3DFUA 3D7LA 3B20A 2R00C 4JIGA 3M2PA 1LEHA 4C4OA 3WICA 2GZ3A 4DQXA 1EUDA 1VLLA 4NBUA 3PQDA 2PH5A 4NBRA 2EWMA 1EVZA 2NV6A 3QWFA 2CUKA 4E5YA 2C5AA 2GCGA 3GY0A 2CVOA 1LDGA 1YE3A 4GQAA 2NU6A 2VHZA 3TNLA 1PJ2A 1XWFA 3KXDA 3MEQA 4XEHA 5COAA 3W4JA 1CEQA 4CM9D 1QORA 1UDBA 3V1UA 1D7OA 5HS4A 4YAIA 3D4NA 1HZZA 2XPCA 3N74A 1DC3A 1DIRA 3RUIA 4OQZA 4BNVA 4BV8A 3N7UA 4EUEA 4CR7A 4FW8A 3JD2A 2J3HA 3S2IA 3F47A 3IKTA 1NPYA 1N9GB 4Z0PA 3CMCO 1Q0HA 5G0SA 3L4SO 4CLOA 4YT8A 3D1LA 3DBRA 3DFZA 3WYEA 3ZWCA 3PLNA 3INGA 4RQUA 3QW2A 1ID1A 3UHAA 3AI3A 4OQYA 2NWQA 1PEDA 5KJ1A 3DZJA 2BELA 4JQCA 1KOLA 1LQUA 4BKRA 3WGGA 8ADHA 3GFBA 3GVIA 3I9NA 5A05A 4EEXA 3AOEC 1GY8A 4MKXA 3HJAA 1C0IA 3JQ6A 3ZNQA 4ZQGA 2I3GA 4IMPA 3NGLA 5IZCC 5EQDA 5DZSA 3NT4A 3E82A 2YFHA 1P9LA 3GNTA 4P22A 2Q2QA 2B36A 2VWGA 4WE3A 2EEZA 1PL8A 4KQXA 4OJNA 4W9NA 1E7YA 1IULA 1U2DA 3P7MA 1XQ6A 3NTQA 3RASA 4WEOA 3GVHA 4ALNA 3NGXA 1EK5A 4BO4A 2Y67A 1K3TA 4JXKA 3GG2A 4P4GA 3I6QA 4NZ9A 3FPLA 1O8CA 2P2SA 3WWYA 3HNPA 1LRJA 2PY6A 1IUKA 3DZGA 1HE5A 3HWRA 3JYLA 1Q7BA 4XYMA 4ND2A 3NUGA 3I23A 3JQ9A 3LLSA 4I5DA 5JDCC 3UKOA 3DZIA 2CFCA 5IDXA 1WDKA 4EUFA 1F06A 3UAGA 4YTEA 4FFLA 4BOYA 4D45A 1DDOA 4LRSB 4NFSA 5U9CA 1M67A 1V0JA 1IHYA 4IJUA 3GAFA 5GZ1A 3S2EA 5G0TA 4EEZA 4HFRA 5MGBA 3P2OA 4II3A 2E48A 3UUWA 4GGPA 4IXTA 1HDGO 4PVDA 5T8KC 3AUUA 1BW9A 1Z82A 1A72A 4AG3A 1NVMB 3TOXA 1X1TA 1JTVA 4E4YA 4QECA 4FFNA 3H4VA 4CL3A 5C37A 2VYVA 3AUTA 4UEJA 4IDGA 1VPDA 3JV7A 2BHLA 4LCEA 4XYEA 4IJVA 4NBWA 4R3WA 2J3IA 1ML3A 1HDXA 4R5MA 2VRBA 4N5MA 4AJJA 3KVOA 3ZNNA 1NR7A 3H5NA 1XDWA 3AM4A 1T25A 4DLLA 1F12A 1VJTA 3O4RA 2Q4BA 2CVZA 2J8ZA 2HMSA 1UP6A 4W82A 3EZYA 4G5HA 5AXCA 5TX7A 1KS9A 3AUSA 3FNGA 1X7GA 3ZNOA 2J6IA 4BO0A 1H2HA 1HYEA 1F17A 1EK6A 3ANLA 3I9MA 4E5KA 3OIGA 3U4HA 4U7WA 1FK8A 3D4OA 3MJCA 1YKFA 1O9BA 4PLCA 1E3WA 3UCFA 1S7CA 1DRVA 1R4NA 2JFGA 1ZEMA 1WDLA 4O59O 4YA6A 2J3JA 3NX4A 3KV3O 4RPKA 1VSUA 1GQYA 1ULSA 5EN4A 3UW3A 4UVHA 3VTFA 3HSKA 3WGHA 4JBIA 2AQ8A 2PGJA 1W8DA 4II2A 1KC1A 2QYTA 2CDCA 1DO8A 2PZMA 1B15A 4BNYA 1YL7A 4XRRA 4J6FA 1K0UA 4ND5A 2GN6A 2IEDA 3RIHA 4ONEA 4BNIA 5B4VA 3HB4X 3HQ4O 3H5RA 1H5QA 3WOHA 4PLFA 1HDYA 2FP4A 4IDCA 2OGUA 3A06A 2H1SA 3BHIA 3C7DB 5KTKA 1YOVA 2NADA 2OUIA 4KUGA 2FPGA 2AEJA 1I36A 2JCYA 1R0SA 1VKNA 4B4OA 4Z6KA 4ZRNA 1GD1O 1C1DB 1PJCA 1S6YA 2NQ8A 2O48X 4QTZA 3RWBA 5B4UA 1YQXA 3GLQA 3KOUA 2DVMA 2PD3A 3G79A 1DBVO 3U4IA 4RV9A 4BNXA 4Q3NA 4YJFA 3D5QA 1WZEA 1DC5A 2X23A 3RUFA 2QQ5A 3LT1A 1X0VA 4YCAA 1D3AA 2PZJA 4KDEA 4HFNA 3NYWA 1K5HA 1DEHA 1XCBA 2AQHA 3EVTA 1NP3A 3RC2A 5CEEA 2QX7A 2Y0DA 4RF5A 1XEAA 1XGKA 1JKIA 2OP0A 2TMDA 4RZHA 4CM4A 3EMKA 5JMPA 3RUEA 2PKQP 5JCXA 5JYDA 2X7HA 3PIIA 4RO0A 5L4NA 1EMDA 4FJ2A 3W8DA 3GGGA 4BO5A 1PS0A 3OFSA 4LW8A 1TT5A 5L95A 2Q45A 1P74A 4BNZA 3JQ7A 1HLPA 1I3LA 2HK8A 5TRTA 5I7EA 2PA3A 3JYPA 3Q9UA 4Z0HO 2G5CA 3JQAD 3NTRA 3RJ9A 5DDIP 1FDVA 1YQDA 1EE2A 3VC7A 3JQFC 3ROMA 4CPDA 4GWKA 3RUHA 3VDRA 2C5EA 3E6AA 5TT1A 1HRDA 3WNVA 3KSUA 2VCYA 4FQ8A 2Y99A 3ORFA 4CLXA 3Q2KA 3CXRA 3DR3A 3K92A 1Y8RA 3KM0A 3EGOA 2EW8A 3L9XA 1B14A 4ZU3A 4NIMA 1PZFA 1IY8A 3V1TC 1DHRA 2WD7B 2JFFA 2CMDA 4BMSA 1YBVA 1PGPA 2BGKA 4CUZA 2ZK7A 4CM8B 3E9QA 2O7SA 3G49A 3DZHA 3D3EA 4E21A 5C7IO 3SC4A 4DPMA 5IZ4A 2W8ZA 4BO8A 3ICPA 3AW9A 4WNCA 4CM1A 1BVUA 2HKIA 2YY7A 1QLHA 2NU7A 1RJWA 1XU7A 1I0ZA 2FR1A 2X22A 1NQOA 2R00A 4IINA 1VL0A 1PSDA 1DFHA 1EBUA 5TS3A 3E48A 4CQLB 3GDOA 5CDYA 5DCUA 3H9GA 3VPSA 2P4HX 4ND3A 4Z9XA 3BMNA 2EV9A 5HM8A 5ITVA 2IDZA 3WR5A 3QVOA 2CD9A 4B4UA 4J43A 1H6AA 3KYDA 1NHWA 2OMEA 3RD5A 3LC1O 4FN4A 4E2YA 5ENDA 4HNGA 2ZB3A 2O4CA 2I9PA 1MC5A 3KYBA 4GSKA 3QE3A 4CLRB 3GNSA 4QXMA 4E5NA 5CEFA 4PLWA 3UOGA 1BXGA 1MA0A 3ITKA 3ZU3A 3GZNA 5H82A 1HE2A 1RKXA 5G2OA 1MB4A 3FSRA 1Q0LA 3NDJA 3PHGA 2EKQA 2FMUA 4N5NA 4W99A 3DZKA 3TF5A 3B1FA 1LTHR 4AJKA 1RYEA 2Q3EA 2B5VA 3H9QA 1WXDA 1A4IA 3U4DA 4WLOA 3VPHA 5A04A 1M6HA 1O94A 4OM8A 5I7SA 2O3QA 4MINA 4MVJG 2ZYDA 2BF7A 1CQJA 4QO8A 4J2HA 5JAIA 1IB6A 1GCOA 4GX5A 5F5LA 4E5MA 2OORA 4Y6RA 4HY3A 5BR7A 2VHWA 2NU8A 3BMOB 3AOEA 5I7VA 3TJRA 3L0DA 2XXBA 1YONA 5F1KA 1PJQA 1WVGA 4PG5A 3UH1A 4DGSA 2IYOA 1DJQA 4JJIA 2B4QA 5H81A 2C0CA 2GZ2A 1I2ZA 4K6CA 5DBFA 1BWSA 3SLKA 5EESA 5JDIA 3GEGA 1YS4A 2HLPA 3MCVA 1GYQA 2FR0A 2IXBA 4J4HA 4NR0A 3CMMA 3A14A 3FHLA 2VYNA 3NAQA 4AVYA 4DTIA 2BFAA 4FCCA 3ZU4A 1U4OA 2JCVA 2V6BA 3D3WB 3BIOA 5LCXA 4E33A 3FPCA 4D0SA 3GDGA 3GMDA 1PR9A 4NU5A 2HRBA 1PGOA 4XR9A 4TSKA 1R12A 5TJHA 4BS9A 3NT2A 4HBGA 1J5PA 3VZQA 2I6TA 1I30A 4JP3A 1SPXA 4FC6A 5DCYA 1BDBA 4TVOA 4BGUA 3JCZA 2Y1EA 2ZTMA 2PFGA 3GH3A 2A92A 2FWMX 2IZZA 5A1TA 2F00A 1DIBA 4ZJUA 5JDCA 4P8RA 3IC5A 4PLPA 4EJ0A 1H9AA 5DN9A 5JC1A 3JQ8B 1DAOA 2QZZA 4DVJA 4WEQA 4EDFA 2O3UA 3C1AA 3GN1A 3PRJA 4BKUA 2EG9A 3PJEA 2I66A 3UICA 3SC6A 5L3ZA 5A03A 3F5QA 1I33A 2I3AA 2YV1A 4GWGA 5TT0A 2D1YA 4CQMA 1C1XA 4RPHA 5CP8A 5GZ6A 4BO7A 2HSDA 2PZKA 3E03A 3ZZNA 1EDOA 2RHCA 1KEWA 2IYPA 3OQ6A 1LC0A 1ISHA 3N58A 3PPIA 5JYEA 3A4VA 2EJWA 3KRTA 1O5IA 4OIMA 1PZHA 4BVAA 1JAYA 1FDWA 1N7HA 1TT7A 1GFSA 3KYCA 1KEPA 4FGWA 4DYDA 3LF1A 4IZIA 2PGLA 1ENOA 4L4RA 3PP8A 4XGNA 3ASUA 3DONA 3BMCA 1KC3A 2X5JO 3K6JA 1HDRA 1KY4A 1N2SA 4WLFA 1PR3A 4JLWA 1QYXA 3Q6IA 1LBEA 3OEWA 3PJGA 1ZFNA 3ANNA 5HTOA 4YAGA 4S1VA 3I4CA 4Y8VA 4KUHA 1GV1A 1Z74A 3IJRA 4DC0A 4YDRA 3AM3A 4IS2A 4FB5A 1D1SA 1BSVA 3ZH2A 2ZB8A 4E2WA 5I7FA 1PJLA 3VHRA 2TMGA 1X14A 1V3TA 4PLGA 1NBOA 3WSWA 5JAZA 2X86A 4TRRA 5DULA 2X9VA 4CMBA 4LMPA 2WYWA 2B83A 4JCOA 2H9IA 2W4QA 4BMNA 3QV1A 4U0JA 2OHXA 1GTMA 1J49A 4ZA2A 4OXKA 2P9EA 1SOVA 3DAPA 1I10A 2BI8A 5HWSA 5CAEA 1R0KA 1WP4A 1MG5A 2RBEA 4PRLA 1ENYA 4Q3EA 4L75A 4FPXA 2W2KB 5IZCA 3HDQA 4P4LA 1E7WA 4YEDA 3RI3A 3ONFA 3PWKA 1IYZA 2Y1DA 1QYCA 4QFDA 3ZWOA 3VPXA 2R2GA 1U7HA 4AJHA 1ADBA 1C0KA 3FBTA 1ZKMA 3LT2A 3V8BA 4BKQA 3LT0A 4YAJA 1XR3A 2DBQA 2IE0A 2SCUA 2WYVA 4J7UA 3JQEA 3O8QB 1EBFA 1LLCA 2IRWA 3LC2O 4EI2A 4OAQA 1GDHA 3F1KA 1IPEA 3BTUA 1NXQA 1F8GA 4J4TA 1KEUA 3EHEA 2DBZA 1UXIA 3MOIA 2JD1A 4WLUA 3BAZA 1U9JA 4RLSA 4CM3A 2JCXA 4EGFA 5A3JA 5JPIA 3ZWPA 1ADFA 4YT2A 3OP4A 3ETEA 5BSFA 1NQAO 1P0CA 4ZQEA 1E3LA 2NM0A 4KMSA 4A26A 4RJTA 1LC3A 4DUPA 3ABIA 3ZCXA 2X8LA 1ZW1A 1HF3A 3RUCA 2FSVA 3GG9A 3WGYA 4D42A 2PGDA 3ETGA 1NFRA 5F1OA 4B79A 4GLOA 4M55A 4XA8A 1UXKA 3VKVA 1Y81A 2QG4A 5F1PA 5G4KB 3KSZO 5IG2A 2B0JA 1I01A 2WD8A 4EUHA 2YV3A 2G76A 3VOSA 2NTVA 5L7WA 4PRKA 3GR6A 3DBLA 3HZZA 3RU9A 1B8VA 1ADCA 3EAGA 3DWFA 5IAAA 1QV6A 2ZJ1A 1T2EA 1DFGA 4S3MA 2O2YA 9LDTA 1GQ2A 3X2FA 3C1TA 3KUXA 3IUSA 4RF4A 1QG6A 2O50A 4U8GA 5GZ3A 4A03A 4JX8A 4R51A 1J0XO 5K9ZA 3D64A 4J1QA 3I3OA 4YT5A 1SO8A 2YDXA 4Q9NA 2ZIZA 2A9FA 3CH6A 5IN4A 1TEHA 4QQRA 3LC7O 4E13A 4CR8A 3L77A 1AHIA 4DQVA 4K6FA 4B3IA 1HWYA 3JQFA 1LI4A 1E5QA 4WLEA 3GUCA 2GDZA 1Y1PA 2IZ0A 3GC6A 2E49A 2PR2A 3HE3A 2GRAA 3C8MA 3H2ZA 4CLHA 3DXFA 3W1VA 3F3SA 1ZJZA 4OXYA 1Y8QB 4OXNA 2C20A 3S55A 2Q4EA 4DPLA 4W7HA 4OOFA 3INTA 3E5RA 4Y67A 5A9SB 5JSFA 3H2SA 3ZWWA 3DC2A 4IQ0A 4NJMB 3RAJA 3SEFA 4GKVA 2RCYA 4GPD1 2VRCA 4BNTA 3LVFO 3WDSA 4YYZA 4NFYA 2V6MA 1Q7GA 1CYDA 2P5YA 2XXJA 1PX0A 5IXSA 5F21A 3OA0A 5FYDA 3OEYA 3HUDA 5L9AA 3WTCA 3U09A 3BTVA 4G65A 3FWNA 4QEDA 1GEEA 4RQTA 2ZYAA 4FR5A 3QWIA 3RBXA 5IN5A 4DREA 2VWHA 5THKA 3AY6A 5EIOA 1AGNA 1I5RA 1TLTA 1HT0A 2E6UX 4L8VA 1HL3A 2QZ9A 4TQGA 5CDTA 3IKVA 5CPBA 4ALKA 2PK3A 3G1UA 4O1MA 1WZIA 3JD4A 1LNQA 4B8WA 5CDSA 1NQ5A 1C0PA 4NI5A 4BO6A 5LDGA 1FDSA 1T4DA 1L1FA 3VZPA 3QWBA 3W4KA 1MXHA 1SOWA 3RJ5A 1M75A 2B69A 1SMKA 2A35A 2A94A 4M89A 3FNHA 2AHRA 4M49A 5BSHA 5L7TA 1C14A 5KWEA 3I4FA 1ZXBA 2VYVD 1LJ8A 3GPIA 4RCVA 5A9RA 2YHIB 3PJFA 3QHAA 1LUAA 1SB9A 3Q0EA 2JL1A 3VVBA 1DIAA 3MJ4A 3I9JA 5DT9A 3E5MA 5AOVA 4X54A 1LX6A 2NQTA 2GN8A 3GEDA 3VZSA 4CM6A 1G0NA 3COSA 3FN4A 1D1TA 1VM6A 4R4JA 2PZLA 5JNLA 1U8XX 2I67A 2NNLD 3FBGA 3E18A 5AXDA 3Q2IA 1AHHA 1ZUD1 4UUMA 3H5AA 1U2GA 4IGFA 3GA0A 3JQBC 1M76A 4B7UA 2CDBA 5L45A 4XJTA 3NJ4A 4XWYA 4OSOA 3ULKA 1T2CA 2DU8A 5L4SA 3MWDB 1L7DA 3G1TA 1KY5A 1W4ZA 2WJPA 1NAHA 2DQ4A 1MGOA 2VWQA 4Z9FA 1WMBA 1VC2A 4FOOA 1HYGA 4D3SA 3RC9A 1ADGA 1QR6A 2C07A 3OETA 4R3NA 4NNJA 1PJTA 2ZTVA 3WIDA 1GV0A 3ZWMA 5JY6A 1U3WA 4BNJA 3M1AA 2W98A 3OQ1A 3WTBA 4CODB 2WDZA 3NDRA 5A3VA 3WXBA 4MO2A 1KERA 1Y7TA 4CMAA 1N5DA 4R69A 2Y66A 3KETA 2B4TO 1AUPA 2Y68A 4OGWA 3LF2A 4RVUA 3UN1A 3RFVA 1HE3A 4DIFA 5EQFA 4IGEA 3JQGA 3PFWO 4BQPA 3QP9A 4N7RA 6LDHA 4U5QA 2DM6A 3NDIA 1UUFA 3ZV6A 1Z73A 3HDJA 4F6CA 3QWHA 4J1NA 4B4VA 2AG8A 1F8FA 1HYHA 4MP3A 1YDWA 4KP7A 1UZNA 1NTOA 3KYDB 3DZFA 1XLTA 1OC4A 3WGIA 1DOHA 3UF0A 4LVCA 1H6CA 1TI7A 4C7JA 4URFA 4L74A 3JSAA 2X5KO 4E3ZA 4EJMA 4D0RA 4CUJA 1XQ1A 2YV2A 4WK6A 2Q1UA 2GO1A 3IUPA 5ILGA 1P44A 3VH2A 1PWZA 3A1NA 2P5UA 3OBBA 1QV7A 1LDNA 2YHUA 1V3UA 2GNAA 3DTYA 4TROA 8LDHA 4XX0A 5KOIA 1DRWA 2B35A 3JQAB 3UCXA 1UDCA 3A9WA 3P2YA 2BRUA 1JQBA 1JVSA 4F45A 5KNLA 1EZ4A 3GHYA 2DFDA 3ST7A 3ZWVA 4LVUA 4QT0A 2YFQA 3EUWA 4J16A 5KVQA 2C54A 4WCFB 2BGLA 1A9YA 1B26A 2AQIA 4A0SA 4WJZA 4XDZA 3WMXA 4B4WA 1KVRA 3ZV4A 1R4MB 3FNFA 4LMRA 1E77A 4PLYA 3ZW8A 5JS6A 1SAYA 1HZJA 2E4AA 4R1SA 4LK3A 3VTZA 2P91A 4GLLA 3I9OA 4MVJM 4XIYA 1YRLA 4BGVA 5KVVA 4DRYA 2HK7A 3CINA 1P1FA 3K96A 2D0IA 3BHMA 4INAA 4RPGA 2HMUA 4IDAA 3GK3A 4JN6B 1IL0A 4AJ1A 2JD2A 4YPOA 4J0FA 4WGGA 4Q3BA 5BSGA 4MDHA 3CTMA 3GGPA 1Y5MA 4R68A 2J3KA 3VKUA 1GADO 3Q9NA 4WASA 3FCOA 1I8TA 3HFGA 5B4TA 2BKAA 5MDHA 4L0QA 1TXGA 2EGGA 4FJ1A 5B37A 4J90A 3SBOA 3KBOA 1X7DA 4NBTA 2IODA 2FPPA 1ONPA 3SLGA 5AQ1A 1NAIA 1AN9A 5K0ZA 1G1AA 2O3JA 2VHYA 2FHSA 1R15A 3TRIA 4IDDA 5AXAA 5TLSA 2NUAA 3DHEA 1V3VA 3WG9A 5GY7A 3W8FA 4UVIA 5JCJA 1JDJA 4O0LA 4JROA 4IIVA 3JD1A 2GYYA 4PLHA 5TJ9A 4N54A 2X0JA 3U49A 2EHDA 1A27A 4GKBA 3ENKA 1NNUA 4A27A 1GEGA 1QKIA 1N9GA 2RHRA 3KEQA 1E7MA 4XDYA 2FY8A 1PQUA 4PLTA 4XD2A 2JAPA 1WWKA 1M2WA 5C7OO 1NM5A 4I1IA 1HDCA 4XIJA 2X9GA 4DBVO 1D4FA 4MKRA 1YJQA 3ETDA 1N7GA 3DTTA 3IS3A 3L6OO 3R6DA 4PIVA 4CLEA 1P77A 3HDHA 3WGTA 1O89A 3ANMA 5KKCA 3BXXA 2VTEA 3H7AA 5I8WA 1Q0QA 1UAGA 1GPJA 4GMGA 3ZU5A 4FDAA 5A9TA 4NG5A 1B3BA 2BD0A 2YW9A 2ZTLA 5DF1A 3MJVA 2IZ1A 1UZLA 4Q3AA 1CIVA 1RYDA 3O03A 3GVPA 3B6ZA 2P9GA 5JMWA 1U3TA 3I9LA 4RVHA 2C2YA 3JQCA 5ICMA 1MUUA 2VYND 1P45A 1XKQA 1M66A 3KO8A 3WX0A 2GPTA 3KB6A 2BFMA 2ZCUA 2DTXA 1K6IA 1H0KA 3PVZA 1ZMTA 1YO6A 1ISIA 3CUKA 1UXGA 3BA1A 4YJHB 2Z1NA 3H3FA 4YVFA 4NH4A 3U5TA 3NRCA 5ER9A 3F1LA 5IJZA 5DBGA 2HRZA 6ADHA 3K8ZA 3RBVA 2V7PA 2ZB7A 4FBGA 2EKPA 2QRJA 1EE9A 4G2NA 4L76A 1U7TA 4PFJA 4QX6A 1Z7BA 4TRNA 4J9VA 4NFHA 5B12A 3DOJA 2AE2A 4YJGB 3DBHB 3I6IA 5JY1A 2O23A 2OZPA 2Q2WA 4IZHA 4YRBA 7MDHA 2BFPA 5KJ6A 5JBIA 2EKLA 1J6UA 1P1RA 1Y5RA 1CETA 1PL7A 4IJKA 2F1KA 5FEUA 1KEVA 2DUUA 4CQMD 4XGKA 2AW5A 3FWZA 4J49A 1ZK2A 4CL8A 1ZSNA 3IJPA 3AFNA 4XRGA 3DHYA 4XR4A 3AY7A 4ALLA 4N5LA 3HN2A 1E0DA 2Q1SA 4J7XA 1YDEA 4W6ZA 4PZEA 1HSZA 4RL6A 1YBMA 3C1OA 4QO7A 2Q1TA 3PZBA 3DMYA 2NVBA 3FTPA 3PDUA 5JC8A 5EL0A 1N92A 4CJXA 1QP8A 2EP5A 1Z6ZA 1B7GO 1NWCA 1A9ZA 3DBLB 1OFGA 4A73A 1JA9A 3WNQA 4EITA 3RQSA 1QXSA 2JHGA 4ESOA 5KCZA 1ISMA 1AXGA 4ALIA 2JFHA 4ZQFA 1HKUA 5THQA 4UEOA 3QA9A 2AXQA 2AG5A 2ZB4A 4YQZA 5G0VA 5TF4A 4RVDA 1H94A 1E3EA 4GVLA 1JLLA 4TZKA 3T4EA 2WE8A 1NPDA 1ARZA 1K2WA 3GUYA 3P5SA 3JQBA 5T6BA 2YQ5A 4NMHA 1R16A 4CV2A 5TSDA 3QVXA 2V6GA 1FDTA 4J0EA 3TDKA 4RF3A 4BQRA 5KKAA 4ALMA 1WAMA 4CUKA 5FFFA 5CG2A 2JAHA 3BMQB 2W2LD 1AE1A 2DAPA 4WLNA 1XU9A 3DEYX 3O38A 9LDBA 4RPLA 2HCTA 2GUGA 3WWZA 1UZMA 1BHSA 3WLFA 4BUCA 4DMLA 1XSEA 4W9NC 3RFXA 3SJ7A 5ICSA 3E1KA 1X13A 3O26A 5ENVA 3PYMA 1T1SA 4B3JA 2NVUA 4I5EA 3WQSB 4RGBA 5JO9A 4M86A 1NR1A 1GUFA 2FZEA 4ALJA 1JW9B 4H16A 5A02A 4CMEC 4E6PA 2DPHA 4LRTB 4HADA 1O0SA 5L53A 4IBOA 4WKGA 2ZYGA 2VZ8A 1P1HA 1NFFA 1T2AA 4CMIB 3ZHXA 4AICA 2VNAA 2NTJA 2OBYA 2FN7A 2WTBA 3F4BA 4YR9A 5DOZA 2A4KA 3ZV3A 3V2GA 5C7LO 2Q50A 1A5ZA 4XQCA 3L07A 1E6WA 5COBA 1ZJYA 4ZQHA 5T8KA 2PD6A 4RVGA 3WBFA 4CM5A 3MWEB 3EVNA 1HTBA 4UUOA 3DOOA 1U1IA 2HMTA 1D8AA 5U1PA 3PK0A 3H65A 3FD8A 4K9DA 1UXJA 5IDQA 2ZQZA 1K6JA 1PU2A 1YGYA 2WWRA 3PTZA 3R0IA 4E5PA 1TB4A 1U4SA 3H9EO 3U9LA 3PHIA 3DL2A 5IF3A 3LDHA 4D44A 3PHHA 4PZCA 4DXHA 3SVTA 4BO1A 4L4SA 2Y1FA 4XYBA 5COQA 4CLOB 5HS6A 3NV9A 3DBRB 4E12A 4J91A 5CFZA 3BTOA 4P38A 5KJCA 3PYLA 4IJWA 2BGMA 4M87A 1LRKA 2VZ0A 5J23A 2FOIA 4KQWA 3ZV5A 2OP1A 2W2LA 3VH3A 1ONNA 2DFVA 1V6AA 3MJSA 3ZWYA 2NU9A 3A28A 5I9LA 4NK4A 5L7YA 3ROPA 3HG7A 1LDYA 4EYEA 1ENZA 4RZIA 2VT2A 3KLPX 2P9CA 4MVJA 3TL2A 2X0IA 1PJSA 2PH3A 3M6IA 5G4LA 3VDQA 2I99A 4Z0TA 2AQKA 2HJRA 1MFZA 3EYWA 2GERA 3GVCA 1PS9A 1DFIA 4JGBA 4CM8A 1DJNA 1ENPA 3I5MA 4E2ZA 1P1IA 4ND4A 4NDNE 1GZ4A 4PGFA 1ZVMA 3G0OA 3ONDA 3QRWA 1T4BA 4Y98A 3TN7A 2Q1WA 4Z3KA 2VRCD 1HETA 4R1NA 1B3RA 4ZRMA 3GGOA 2X0NA 3GDFA 3ZWNA 1BMDA 3E8XA 1GAEO 4XYLA 1AXEA 3T4XA 5T67A 4CQLA 3LLVA 3KHUA 4XGIA 4KTVE 3H8VA 1ZK4A 3IQDB 3C85A 4IQGA 3BHJA 1H93A 3CKYA 2FZWA 4HX5A 4KWHA 1X7HA 4M54A 1A7AA 1W73A 2UVDA 4R54A 4BNWA 1X0XA 4DBZA 1MLDA 2EERA 4HKTA 2Z1MA 4J9UE 4MJLA 1HDZA 3L9WA 3R1IA 1EUCA 2HUNA 1N1GA 2GGSA 2QRLA 3HN7A 4UVDA 3JQGB 4BO2A 2QYSA 4O6VA 2P68A 2GN4A 1YB4A 3L6EA 4K28A 1BW9B 3H3JA 4E0BA 1IHXA 2R6JA 1J4AA 5L40A 1XA0A 2UYYA 5L4LA 1E7SA 2GLXA 3JD0A 3CIFA 3VH1A 1OAAA 3RC7A 2Z95A 2AE1A 2PV7A 3G17A 3GRKA 1ZBQA 5EPOA 1HE4A 2D8AA 2DBRA 1BG6A 2VHVA 4FFRA 2V65A 3OQBA 5ES3A 4A5OA 3WGQA 3C7CB 3D0OA 3WGZA 1I2BA 1NFQA 2C29D 4QFCA 2GSDA 2WSBA 5AXBA 1E5LA 2G17A 1GL3A 1DIGA 3BMOA 3QVTA 3DZBA 4GL4A 4LCJA 3W6ZA 4GAEA 3VPGA 2POQX 1IPFA 2OFPA 4R1TA 1E6UA 3WQQA 4TVBA 4JBHA 5DP1A 4TKLA 1VI2A 4TWRA 3UVEA 1GPDG 1MXFA 1PS8A 1QLJA 3F4LA 3TOZA 4CV1A 4H15A 1GYRA 1P31A 3AI2A 4OSPA 4R01A 3E9NA 3ZW9A 5A06A 1DLJA 3PDJA 4AJOA 4J7CA 3LZ6A 1BRMA 1UJMA 2PTGA 3GF4A 1E3WB 1YWGO 2QRKA 1HSOA 4NHEA 2GF2A 4KDFA 1VJ1A 1R4NB 2C82A 3RFTA 1LDBA 4ROSA 4DLAA 3TPCA 4D46A 1YB1A 4DMMA 3OMLA 3I83A 5ADHA 3L4BC 4D7AA 5ITWA 2P4QA 2NVWA 3EK2A 1JWAB 3IMFA 1P3DA 1LLDA 1U28A 2C7GA 1BDMA 1YVEI 4HFJA 2QHXA 3JQ8A 4XKJA 2YJZA 4DIOA 3RU7A 4RORA 4E32A 4JNKA 4UUNA 1Z7EA 3V2UA 4XJSA 1EDZA 4CMGA 4IPTA 1T24A 3FNEA 1C0LA 3H9UA 1YOVB 1PZGA 3AY3A 4FSHA 2DBVO 2NTNA 3MJTA 2DTDA 3PQFA 4FFOA 1N1EA 1SC6A 4IMRA 3ZI0A 3ZU2A 3FR7A 4FGSA 1XG5A 4HP8A 3H6KA 4FD3A 4WOKA 3VZRA 4D3DA 4CM7A 1G0OA 2DUWA 4YJFB 5JAMA 5KJEA 1JU9A 1DLIA 4MVJP 1BVRA 4GX1A 4PLVA 1RPNA 3PEFA 1YQGA 3WQRA 1Z45A 2UAGA 4XB1A 2ILTA 1NWHA 3RUDA 2Q2VA 5KVCA 2DKNA 3PQEA 1PGNA 1ZXLA 3Q1LA 4KUEA 3E9MA 4CM4B 1ZH8A 2B4RO 1UH5A 1ZIDA 4D79A 4BNFA 5CDGA 5I9NA 5C3MA 1TT5B 3GVXA 3PWSA 3TQHA 4IS3A 5BSEA 3B70A 3JQ7B 5TC4A 3OHSX 4UEKA 5AVOA 3ZN2A 1E7QA 7ADHA 4KWIA 1RM3A 2DTEA 3WLEA 4OHUA 1KVQA 2DPGA 3AFMA 3RSHA 4GX0A 1ZSYA 1TA4A 2ET6A 5JLAA 4IDEA 4FFPA 1VRWA 4WCFC 3C24A 1P33A 2VOEA 1UP7A 4YRAA 3HADA 3LT4A 2FSSA 1I2CA 1OZAA 3HDYA 2W2KA 4U6SA 4AJ2A 2X4GA 4YBZA 1WNTA 5JDIC 3DMTC 3TFQA 1Y6JA 1Y8RB 2HMWA 3DAFA 4L9RA 4PCVA 4GI2A 3FRJA 5BQFA 5CHEA 2VWPA 5HRUA 5KIAA 1H6BA 1I32A 1B8UA 1JKFA 1E92A 3IIEA 1ULUA 3K2EA 3V2HA 1NX6A 2I5PO 1Z75A 5BT9A 4YB8A 3IAHA 3O8QA 4AFNA 4K1LA 3FTNA 2WE7A 2O4UX 1Q2XA 4RPJA 3UFXA 1SNYA 1MG0A 4MVJI 4NK5A 4CMEA 2ZTUA 2W90A 1MX3A 1EQUA 1VL6A 4CV0A 4HNHA 4YJDA 4DA9A 4WPGA 1XELA 2EJVA 5FWNA 1NQTA 3RCBA 3QY9A 1EQ2A 3WSVA 1ZEJA 3GN2A 1UAYA 3WFJA 5IDYA 4OKNA 2BLLA 2O3RA 3JD3A 1BGVA 1FXSA 2EIHA 3BMNB 2Y1CA 1EUZA 1FDUA 2PWZA 2EW2A 2XAAA 1DB3A 2WYUA 4GBJA 3VH4A 3QVSA 5TQVA 3W6UA 3DHNA 3GEMA 5B1YA 5G4KA 1LSJA 4RF2A 1ZK1A 4CM9A 4O5OA 3EW7A 1WW8A 3GNQA 2GN9A 3V1YA 3IP3A 5CDUA 2G0TA 3F6YA 1DC4A 1WMAA 4PG6A 3KLMX 3ADOA 5JCJD 4U0KA 4R5HA 1BXGB 4JP2A 3PHJA 4ZICA 3GZNB 4PN3A 4ILKA 1FF9A 4RVFA 3K5PA 4BNUA 2FRDA 3WJ7A 1IZ9A 3CPSA 4JK3A 2ZATA 1CDOA 1NPTO 1E3IA 2Q46A 4IDBA 1EVYA 3K31A 4GMFA 5CEJA 5L51A 1QYDA 3TFOA 4BGEA 4Y9DA 4XCVA 1B16A 4IIUA 4Q39A 4AJ4A 4JBGA 2VUTA 2C2XA 3VPFA 1L7EA 1LSOA 1Y9EA 3OA2A 2RH4A 3TZQA 3KTDA 1KVUA 3KSDO 4DPKA 2HAEA 3T7EA 3V5NA 3GAZA 3OIFA 4EJ6A 1V9LA 4R9SA 1JKJA 5A5EA 1GQQA 1OC2A 4NBVA 2D5CA 3GFGA 4IXWA 3BZUA 2X58A 5A4DA 2CY0A 4MVJF 3CZRA 2BFOA 3OECA 1Y8QA 1R37A 3K30A 4MIYA 3TZ6A 2BMAA 5A9SA 4OMUA 3NTOA 4J1SA 5FI5A 3NJ8A 5AYVA 1WLYA 4NJMA 4FC7A 2PKQO 3LQFA 4D3FA 3STHA 1A4UA 3OJ0A 4FJ0A 4WCDA 4XQ9A 2CVQA 2CSUA 2JD0A 1ZSVA 1E3JA 4I08A 1PL6A 2VT3A 5CPFA 1ZK0A 4ZD6A 1O6ZA 4GX2A 2EP7A 5F5NA 4CMHA 3ZWBA 3ZHBA 3ITDA 3AJRA 4ID9A 2NVUB 3DOCA 5EJ2A 4A2CA 2BH9A 2VHXA 4IUYA 3LU1A 4J4BA 4DLBA 3VVCA 5DCWA 4LN1A 1A71A 2UV8A 1B0AA 4I5FA 4HFMA 2G82A 4RDIA 2OL4A 1PJ3A 4OL9A 1F0YA 4CQMB 2CZCA 3MJEA 2UDPA 1C1XB 1W0CA 4B3HA 3IL2A 5LDHA 2VUUA 4ZVVA 3PIDA 1FJHA 3OJFA 3QIVA 2NSDA 2H6EA 1WPQA 5H83A 1DRUA 4UULA 1LLUA 5EMHA 1KBZA 3KYCB 1BTOA 1XYGA 1LA2A 2OO5A 3BMCB 1KVSA 4U6QA 1VE9A 4KTTE 1XHLA 2CF6A 1FMCA 4D43A 3ICCA 2LDXA 2YHIA 3OJLA 1HDOA 4I5GA 3OSUA 3WFIA 4WECA 3GOHA 3K9QO 4H7PA 3DB2A 4ZGWA 1E1MA 4PG4A 3QLJA 1T26A
chains in the Genus database with same CATH superfamily
1E1YA 2UZ0A 3QBDA 1T9AA 1M1YB 2FPMA 2NMVA 1EP1B 1FU8A 1Y9AA 2WJZB 3I1JA 3IR5A 4C0AC 3OIDA 3NFRA 1QPBA 1T0BA 5ER6A 3T3DA 1OMOA 3TZKA 3ZYCA 1LV8A 2BMFA 1PZEA 2M9MA 2UUOA 3CZ5A 4PX9A 1YHNA 4ZIRA 2MMGA 4ZHQB 5EJ8A 1CWUA 3H97A 3NAGA 2Y71A 5TE9A 4DNQA 4C06A 3WB2A 4Y6OA 1JJFA 1K92A 2B8WA 3FVTA 5CB6A 1TYZA 5HJEA 5M7EA 4JLBA 4F1KA 5DSZA 2AS0A 4OFWA 3OQIB 3CJTA 4GXNA 3WMFA 4J0GA 4QC2A 2H1OA 3K9GA 2F3UA 4RZSA 1EZZA 5BQPA 2RAVA 3I1IA 4PSVA 2V8BA 3EXG1 3PFGA 3V4VB 4EAAA 3RPEA 5AVTA 1UMDA 2HA7A 3DP7A 3FI9A 3NFYA 3OH8A 2Q4DA 3R40A 1H3EA 3ZDZB 4YNBA 3IBFA 2ZITA 4L73A 1YQEA 4KSBA 3I6ZA 2Y76A 3C8UA 1F6DA 1HLDA 4QG3A 2ZGVA 5EXXA 1MV8A 5IT9A 1PGJA 2ZUDA 3ON5A 1TGYA 3QNUA 4FXPA 3O8LA 2CHVA 3Q4GA 4Q3DA 3RVDA 3K73O 4PAMA 1FFCA 2Q5JA 4OJKA 2OWDA 3R9XA 2DKOA 2OXIA 2AV6A 4OLHA 2LBPA 2P2ZA 2Q9AA 3G5MA 3KE8A 4MWSA 4KGDA 2OCLA 3L1VA 2WYHA 3TMAA 3ZIAD 1GCUA 2PUAA 4GI1A 1MC4A 2ACVA 4GZ5A 3W0LB 4B83A 3L7DA 4KODA 1RADA 2XHZA 4AJIA 2PUGA 4H3VA 2GNOA 3CT6A 4IJ6A 2HO5A 3H9BA 4LOKA 5TNXA 3H83A 2I3DA 3T5BA 1K4YA 2ATXA 4CG0A 5IFLA 2XCSB 2PBZA 2YASA 3DMRA 2AN1A 5TQJA 1WMFA 2C7VA 2W43A 5I45A 4HXFB 4Y2XA 3OJCA 4Q93A 1E2QA 3SM9A 4MA5A 4FHDA 1SBHA 2JIZA 1PSWA 4FB4A 2N0SA 3KAJA 4ID3A 2ZE5A 2VHCA 4BLQA 3ZZMA 1ULZA 2VUSA 2ZPAA 4MAFA 1OX5A 2GZDA 3EH2A 3QXHA 4IV5A 3HKDA 1X15A 3M33A 4YLYA 3QFSA 3UMCA 2O2SA 2X7XA 3VR6D 5JIBA 4DV4B 3S28A 3E81A 1NF8A 3WDLA 1DSSG 4ZXFA 2GM9A 3NVMB 1GUYA 2OD9A 2Y0CA 2GHIA 3I2GA 4FHCA 4F21A 2F4VB 2MOKA 3BXZA 1P7WA 3INRA 5C34B 5CNMA 2YWHA 2RHGB 2E4VA 1SC3A 3OJOA 4E2XA 5K6TA 1ZIOA 1EHIA 2QTAA 3EVDA 1L7BA 4BNLA 3PUIA 2FUNB 1KYWA 2I54A 3DEKA 4H3KB 1WNFA 3MMXA 4AJLA 1YI0A 2WW8A 4E09A 3GT4A 1NBME 1DAPA 1RFGE 2GR9A 2H31A 4Q7JB 5FFMA 4HV4A 3OTWA 2OD7A 3ZNPA 1NVTA 3T6KA 4KRXA 5E9WA 2VXOA 5D3ZA 3THOA 4PG8A 1MFPA 3GFQA 2Y0EA 3WIEA 5CTJA 3WQHA 3UCEA 1SQGA 4RJ2A 3T8YA 5JE8A 4Z3DA 4AU1A 4BRZA 3LKDA 3ZVKA 2YYSA 1COZA 4N0EA 4RIEA 1U2QA 1SB8A 2X3YA 4HWGA 3H17A 3L6DA 4JVOA 5FLYA 3PXXA 5A1JA 3CH7A 3ISJA 1LPPA 5DSXA 3KVRA 2HDHA 3NALA 3TSYA 1SQ6A 1CTQA 2RHMA 4IILA 3VI4B 3I8SA 1JWBB 1E2JA 1XEXA 2DLDA 2QUKA 2XDQA 3AEUB 3BWMA 3MTGA 3OCJA 5KO2A 3C3XA 4WA7A 3U4QB 1S8OA 3C6KA 3LP8A 2PXCA 3H04A 1FFBA 1LVUA 2VT6A 4NMWA 3RFFA 1KJ9A 1S3IA 3PKJA 2XWQA 5FORA 2NACA 1H6DA 3LUHA 3DT6A 3T5TA 3UXMA 2HA3A 3WYGA 4BYMA 2X6RA 1J90A 2XB4A 3K53A 5A4AA 4RVCA 5KJFA 4HGPA 4NZNA 3BDVA 1ZX1A 3UXYA 1L5VA 3KFVA 3ZDFA 1EFUA 1V9CA 2P90A 3LYAA 3UAOA 4AJNA 4CMKA 4DCMA 5ILOA 4G0WA 3SSAA 2GCPA 5F35A 3L05A 3ESXA 2BKVA 3A04A 1C1DA 4GO1A 2VNSA 3FTDA 3BERA 3BCRA 3KZNA 3L1IA 4W1QA 5EMLA 3ZQJA 5JHGB 2J5KA 1GPBA 1JVNA 2A30A 2IVFA 3ANXA 4TTQA 1U7XA 2QLNA 1M2HA 1GPNA 3TZLA 3WYNA 2W7TA 1AKEA 4PTYA 1GRNA 1CNFA 2FEWB 4NJOA 1PT8A 3FLAA 3VSEA 1U3VA 1F8YA 2JHFA 5CVUA 5D85A 2P9BA 1GFWA 3CRRA 3MD9A 2HK9A 4ZT4A 2ZTHA 1YH3A 3RRJA 3M8KA 1TTPB 2PLFA 3BE4A 4NEGA 5CM2Z 3EEYA 3P2EA 5HBRA 3FSGA 4M6WB 4XYGA 2VBCA 5A5FA 2QIOA 4LXTA 1LLFA 1Q5PA 2REQA 2WBLC 3UATA 1SKYB 2GNPA 1B6SA 4OV6B 1FP4A 1JHVA 2G7MC 1L5MA 2GZ1A 3AOGA 3CF4G 4XCXA 5U4QA 4MP6A 5JD4A 1LSUA 1DPGA 4S24A 1N57A 1N5OX 1IWBB 2B1GA 2H2FA 3X43A 4FKMA 2D4AA 3HB0A 1B00A 4EB6A 1OGYA 3P9CA 5LIRA 3UTDA 3G7SA 4KKXB 5BSMA 4OB8A 4XFDA 1CQZA 3DEFA 3Q3VA 1ZH6A 1X1EA 1SBYA 2IGTA 4JJFA 3U0BA 3IHWA 4ECAA 2FPWA 4RSHA 3DSRA 3OO0A 3NNSA 2D0DA 2XWSA 3GUVA 1Y4ZA 1ZNWA 4I14A 5CLJA 1KJ8A 5JZMA 4UBOA 5KNDD 3H4IA 1Z4QA 3I61A 2ADOA 1NBMD 1XVUA 2CCGA 1KO4A 3AK4A 4ZT5A 3QMMA 3PQ8A 3PI7A 3HVRA 3ILHA 3NIFB 4FI3F 1TVEA 3W78A 3WE7A 4ZVTA 2YQ4A 1N3BA 3ASYA 1FJGB 1JI3A 1Q7TA 2W48A 3IIMA 2B9EA 2XSZD 1VRCA 2YZ7A 3RK4A 3FWYA 4QJ3A 4I1UA 2COKA 2CB9A 421PA 2VP3A 5JJ5A 3WL8A 2AEMA 3H5LA 4HT3B 3G1WA 1AMNA 3IEPA 1EIWA 1RM4A 4V1CI 3IP1A 2BFWA 3C4JA 2FN3A 1ZM7A 2H9AA 4MIOA 4UZFA 3CONA 4O4LB 2XDAA 1E5VA 5HOEA 2QX6A 2OOSA 1G3IA 1BYIA 2Z3VA 2VPIA 3LQ2A 4YQYA 1OE0A 2PN1A 3BJRA 3NBYC 3AM5A 4XW2A 1PAUA 4NU6A 4XGRA 4UAGA 2WJ3A 4RK1A 3RVQA 4BL5A 1G59A 4H7IA 1M6VA 4GUDA 4EHIA 1WPXA 3M6UA 2OV1A 3GFRA 2JS7A 3B3FA 4DWVA 5BWBA 2WZCA 1RWBA 4P0TA 1PK9A 3D5TA 5FUBA 3AHCA 3SHQA 2HF9A 4FN5A 1FNMA 4YAFA 4XDGA 4RY8A 4I46A 3CE9A 4KYTA 1CY1A 2QV7A 3BXEA 4MVYA 1NOKA 1M7BA 1JQKA 2C59A 2NOAA 2PSFA 1WB5A 4CW7A 4YJGA 2YC2C 3RT7A 1EE1A 5BN5B 2J46A 2WUEA 1RI1A 3O9ZA 5BQ5A 4LDQA 1KDZA 3R7FA 3VYWA 5CW2A 4HRAA 5IS2A 1HC7A 2C7RA 2ZJ3A 4Z2YA 1RRGA 3H11B 1LY1A 5DBIA 1Z6QA 3PC3A 5JVDA 2FRXA 4AJ9A 5IJXA 4N41A 1AKWA 3PE4A 2GS9A 4GFDA 3QPCA 4CLRA 1DWOA 2RAFA 2HM7A 1O3YA 4V3CA 1ESNA 3ZD9A 3RLFA 4DEYA 2AT1A 1XJ5A 5D51S 3WYCA 2Y92A 5IXYA 1NU8A 3FMOB 4EW6A 5IKEA 2DYKA 1VMEA 5BNFA 1A5AB 5IYZA 4J94A 3OTQA 4HEJA 3RSLA 1KTIA 3JZIA 2X5OA 5FNVA 4KIUA 5TIIA 2IYLD 2R0QC 3UQYS 1DV1A 4TL7A 1C8BA 1Z0UA 4HUJA 2AZXA 1IEXA 4BWGA 4YR7A 2Q0XA 1ISJA 3M5DA 3PU6A 3ZI7A 5DTIA 4B7XA 4MWCA 4IJQA 2C7BA 3BWYA 5ERYA 1PI3A 1RRVA 3N0TA 2VH1A 4A6EA 2FCRA 2PGOA 4HDAA 1JU3A 3W5AA 2Z57A 2JGMA 1DCMA 1V8OA 2PV0A 1NT2A 2CVPA 4UBJA 3WGOA 2HR1A 4PS1A 4XM0A 4BHTA 4E31A 2PUHA 4NL4H 4I9HA 3P9YA 4M1KA 5FOWA 1RP7A 2O3TA 3CR3C 4PZLA 1QRRA 3RJMA 2QRNA 1YI1A 3FW1A 3WL7A 3LECA 3SE7A 1Y5IA 3DLCA 3ZHYA 1YZHA 2AH5A 5I6DA 3AEQA 3ILSA 1OXSC 2QWXA 2PX5A 1JJVA 4LXYA 4TMXA 5E7JA 4C01A 1SEPA 1NASA 1EK2A 2IP2A 3CE6A 4XVQA 3ONEA 1UDWA 5F9HA 1K3FA 1UJ6A 1YVDA 3EA4A 3NHKA 4O63O 4C4PA 4XX0B 2RD2A 4MP8A 1GYPA 2EFDB 3FPEA 1SXPA 3QYAA 2H9YA 4BLVA 3REGA 3EISA 3ODPA 1IVNA 1RXWA 5EP4A 2OO7A 2Z9BA 3VU8A 4S12A 1V9SA 4E14A 4UOEA 3PHLA 4BZQA 2WIKA 5DX1A 3BMQA 2Y1GA 2ZRJA 4QGHA 1GQSA 5L3VA 1GZ6A 3S2FA 3HC7A 2AJDA 4NBNA 2QKYA 4CV3A 4EL0A 3HXKA 4WKCA 4ZGWA 1J22A 2H0QA 3GA5A 2WF7A 1D5CA 4M21A 3VYTB 2Y2UA 1Z12A 4C5AA 1UR5A 4K8RB 4TZTA 4Q47A 2XWPA 4D9MA 2A9KA 1NVEA 1H8ED 2F3PA 3IMEA 4C3VA 1RXIA 1E9RA 3P19A 1SWVA 1J39A 3EIEA 2HA2A 1VKHA 2ZRMA 4QDKA 4LGMA 3ROTA 3TLGA 2HWUA 3IPXA 1QS0B 5KSZA 3MJDA 2I0FA 2CEKA 4IGAA 2JLSA 3HLKA 1PR2A 2O2JA 2C2BA 1ZD5A 2FNAA 3D54D 2V0NA 3MINA 4OIFA 3BH7A 4QKQA 3H13A 3Q5DA 4M0UA 2QTTA 7REQA 1P1KA 1NRWA 5E6RA 2XMGA 4HAOA 5K3SA 3SIXA 5HQ3A 1YZYA 2PKCA 4NMLA 1M74A 2PBRA 3D7LA 1N6KA 3L0BA 3O84A 3FTEA 4JIGA 4O2AF 2XD4A 4DCGA 1L5WA 2XB8A 5ADVA 5IKPA 2OXTA 3SQDA 4C2BA 3T1OA 2GZ3A 4YRMA 3ZIUA 4FSDA 3DQZA 5KYXA 3SVLA 3PQDA 3FYDA 3STVA 3K0KA 1GOTA 2FPPB 1S5PA 1Y9ZA 4WADA 2GCGA 1DMSA 3GMIA 3RB8A 3IPCA 1YE3A 4LRXA 1YS7A 4MR7A 3UJ7A 1QHXA 4ZT3A 3T38A 2ZI3A 3BSWA 4LUCA 2L2QA 3FVRA 3MEQA 3W4JA 1CEQA 1T15A 4FDMA 5BUQA 1CR1A 2MCFA 3EWIA 2R4QA 3D4NA 1T9GR 2A3RA 2OZLB 2Z9DA 5ULLA 3TJZA 1Q0TA 3IAAA 1PQ4A 2NUPA 1GTG1 1CS0B 1ODLA 1TGVA 2D1QA 4HS9A 4YUVA 4BV8A 3EIHA 4CR7A 3K8YA 3GLTA 4BQOA 3IKTA 2VTKA 1N9GB 1QNFA 3D1JA 4F8YA 3WHPA 3U5ZB 1GITA 3AHEA 4H3HB 2VZEA 3JWIA 4CLOA 1NVKA 5LD2C 2G67A 4TGLA 4UU1A 3T35A 3ZWCA 1XPOA 1QZTA 1TK2A 3DYIA 4RQUA 4H7JA 3DF7A 2BISA 4OL0A 4FFWA 3X0DA 1NBAA 4PTZA 3MT0A 4OQYA 2NWQA 3DOUA 2Z2ZA 4HATA 4B9AA 4RC9A 3UT6A 5JD5A 4Q03A 3RLIA 4O29A 1LF0A 3WB0A 1LQUA 2WNHA 3GVIA 1AK1A 4M1MA 3AOEC 4IG4A 4MKXA 3IJ5A 3EGWA 4O4JA 4QBKA 3C7KA 2IY7A 2Z4TA 2V59A 4ZQGA 5E7QA 3ZNQA 1VHLA 1WF3A 2JHPA 1Y0BA 2Z43A 3LNTA 4O2BA 3E82A 5IZCC 1AQUA 1WETA 4BLUA 1NV8A 4RK6A 1H69A 3PNPA 2B36A 2VPYA 2P4SA 3LXMA 3W2HA 1PL8A 3GWZA 4XX1A 4G0MA 1LPBB 4D97A 2BKXA 3MUNA 1U2DA 4MGEA 1ZRNA 2VJKA 3DKVA 4YECA 3NGXA 1EK5A 3A6JA 4IDQA 3STXA 4BO4A 5D84A 1RZRD 3W3AH 3DJYA 5DNUA 5LP6B 3FB4A 4ZANA 5IJ9B 4NZ9A 3SHTA 1H85A 1UXOA 2XIQA 2ERYA 2Z8YM 5G3YA 1O8CA 1OX4A 2AFHB 3HKEA 1LRJA 4PGAA 3I72A 1ZONA 2LGJA 1MAWA 1TJ5A 1TU4A 2VJBA 4FNAA 4LE0A 1NQUA 3JYLA 3HWRA 3Q10A 5FBKA 3RGGA 3X1WA 2ZJAA 4XYMA 4TPKA 1EWQA 5HCNA 1D6SA 1U04A 3EWSA 3LMKA 3NUGA 3VUFA 2TMYA 3E22A 1X8JA 3TRJA 3HBMA 2CFCA 3SQLA 4N3BA 2QMEA 3E7FA 1QRUA 3B78A 1E8MA 1E3MA 2Q1YA 4DSNA 1H2AS 4ZI7F 1DDOA 3I0NA 2R68A 3R41A 1BWRA 2H65A 5B1HA 3Q7TA 3I3SR 2PQ6A 3ET5A 4CTNA 5KYYA 1W581 4Z4EA 4D0LB 1NV9A 1V0JA 2COEA 2FU5C 2IXGA 1SRRA 4HNSA 4X24A 1N8TA 1E8DA 5GZ1A 4JVNA 4CIDA 3G23A 2YCLA 5ARCA 3CBQA 3JYHA 3DE4X 2XMQA 2M2IA 2OHGA 5MGBA 3THYA 5HIKA 2E48A 3D81A 3UUWA 4GGPA 2XV1A 1THZA 4PYOA 5E3IA 4NCHA 3FLMA 5T8KC 4YCMA 5B7QA 3IQZA 4H7DA 4QG7A 1RT9A 1GFIA 5K09A 1XTUA 1XQWA 3NWJA 3QHQA 3KWJA 3NM4A 4OP2A 5BN1A 1X1TA 2GB4A 3DMHA 3IILA 4RADA 4N9QA 4M4SA 1MAAA 5DE3A 2ZRNA 5UKDA 4G0ZA 4GR5A 4BRUA 3AIMA 3WV4A 4AY3A 3MSCA 2H2GA 4DG5A 1MAVA 4P7KA 3T0GA 4JLNA 2GTPA 2A5YB 1DQSA 3JV7A 3BEDA 3KSBC 4IJVA 3WLJA 3MS7A 1FYEA 2N1MA 2PKXA 4R3WA 4RMGA 3V8QA 13PKA 4N5MA 2XBUA 5GOTA 3KVOA 3ADBA 1LX7A 3A6HA 1U6IA 3ZWAA 1ONBA 2O2IA 3KTOA 2ZS7A 5CK5A 2CVZA 3RS9A 1UKBA 3ABRB 3BEOA 4FILA 4XPIA 3AHDA 4PQYA 1JS1X 5CA0F 3FNGA 3HXTA 4UHJA 1WL8A 1NNEA 5LZ2A 4BXOA 4BO0A 1KOGA 3VV3A 3IUQA 1W44A 4NU0A 3ANLA 2BGNA 4UCFA 3RVMA 1DCKA 1G8AA 1ULAA 3AKEA 1FK8A 4ENUA 2J0QA 2P4EA 1ONSA 1P2FA 4OA5A 1O9BA 4OI4A 1E3WA 3UCFA 1SKUA 1XEWX 3CUUA 1RAFA 3JSXA 1R4NA 1TE2A 3LD9A 5EIWA 1J0AA 1ZEMA 3VXKA 1IY1A 1WDLA 2WFMA 4KQEA 2J3JA 4O59O 5T4EA 5EHXA 2AZDA 4DDWA 5EN4A 3T7SA 4U7HA 1EXVA 3HSKA 4GOJA 3KC2A 2IZOA 1Y42X 3TBHA 3GFFA 2PGJA 2WIGA 3DQQA 4TMTA 4UJ5A 2QYTA 4F3TA 2NSLA 4PQRA 2EQ5A 2IPAB 2PZMA 2XMBA 2XUFA 5JSKA 2BKUA 4UUBA 4LOJA 1YL7A 2CXUA 3KD3A 2QN8A 5BP7A 2FZLA 2DFKB 1E66A 4ND5A 4YH1A 3UPDA 5ALPA 4JDUA 5HSGA 2P9QA 1RAIA 4UPEA 5B2FA 2IS4A 4ONEA 4XLZA 3NTLA 3UY4A 3LRTA 1TAGA 3H5RA 3TTXA 3LWNA 3VC3A 1HG1A 1HDYA 1KFCB 1OUMA 5MFPA 1B43A 4JYZA 2OGUA 5EYPA 1WQ4A 2ASVA 2YXLA 3A06A 4G86A 2ZYUX 3COWA 2CXOA 1OH5A 1UBNA 1BAPA 2DR2A 2ID7A 4Z6KA 3KPUA 4M9ZA 3RAFC 3PS9A 1G5TA 2QP4A 2XR1A 3H99A 1T0HB 2NQ8A 1ZS9A 1XCPA 2BSAA 3OHMA 4F4FA 3RWBA 5C80A 2IHTA 2IUSA 4D6XA 1VBNA 1W47A 2PPVA 2PXAA 3MK31 4LZZA 3U4IA 4L5AA 3G79A 4RV9A 1YNOA 4B6EA 4LTMA 3TOSA 1GGHA 4YJFA 4ZMRA 4IQFA 5E9AA 2QQ5A 2ZUBA 4NG4A 5BURA 1T1JA 3M1YA 2YR0A 2F8MA 1TLFA 1K5HA 1XTKA 4WK4B 1ZY2A 4OATA 4BYGA 2DT8A 4IH9A 1LI5A 1C50A 2GBCA 2X8JB 3D59A 4OUDB 1A8IA 1XGKA 2MDTA 1OLOA 5ILQA 4KIFA 4CM4A 1NJ6A 1Z0DA 2PKQP 4X00A 5JCXA 4K2AA 4LRYA 2XUZA 2X7HA 1XEWY 3IE2A 2NAFA 4EPXA 5L4NA 3IKJA 3QE2A 4FJ2A 4PX3A 3GGGA 4JVSB 2W11A 3CRW1 4BAUA 1PS0A 4DLZA 4ENRA 3CNOA 4RKRA 3C98A 1A98A 2CNWD 3JQ7A 4KN5A 5I7EA 1I3LA 1AQ6A 4QD3A 5HQTA 1Y8ZA 1SKMA 2HQOA 2I2WA 1ST3A 3JYPA 4PPNA 4Q4DA 3DFKA 3H5TA 2GCOA 5KI6A 5D1NA 1SBTA 3PUZA 4CF4A 3NYRA 1KBOA 1QHGA 4OSEA 2XUJA 4ME6A 3P71T 4B85A 5K8JB 2IPXA 3GL9A 2BHRA 5FCDA 1YJ5A 3NCHA 4CPDA 1JI0A 1H22A 2C5EA 2CJWB 3E6AA 3HB7A 4X41A 3JATA 1IAQA 2IL1A 3UAVA 5FPKA 2JARA 5K0BA 3T3EA 1QIDA 4FQ8A 1LK5A 1V6SA 1ADYA 4CLXA 4GGMX 3CXRA 2AFIB 4FYKA 1OLSA 3ZBQA 4PAOA 2WT9A 5I3ZA 1QAOA 1Y8RA 2B30A 2HCBA 3STWA 5KVAA 1YUNA 1QKJA 3E9RA 3EGOA 2PQ2A 2HZBA 3LKZA 5AQEA 1XMVA 2LRHA 2WKRA 3L9XA 3ZXUB 1YQQA 4M9XA 2WQ7A 1UFQA 1MH1A 1B14A 1KARA 2ORIA 4LQDA 4NIMA 1A9SA 1DHRA 2DFNA 5K0NA 2JFFA 3R7WA 3PEEA 1SN7A 1YOBA 1XDDA 2CE2X 3SF0A 1Z5UA 1XZAA 5I7OA 3S2UA 1PHRA 3KDPA 3IOMA 2X4IA 4YRZA 4KYVA 2WDPA 4WAUA 4DPMA 3L18A 3CLTC 4JKIA 5IZ4A 2W8ZA 3G2QA 4BO8A 3HCCA 3ICPA 4Y7CA 2HKIA 4Q4LA 1IHPA 5CFOA 1IJFA 3B5JA 5A5GA 3CJRA 2VBFA 2QZSA 1EXWA 1XU7A 3CH5A 4NTZA 1IBKB 2FR1A 2X22A 1C4KA 2LV8A 4G63A 1W5BA 4UKDA 3AL3A 3E48A 2FFQA 1DEAA 3RADC 4CQLB 5CB0A 1DKNA 2Z58A 1SH7A 3VPSA 3H9GA 5JAHA 2DXIA 4NCBA 2IIQA 3EB9A 3TRDA 2IDZA 3WR5A 1U0NA 2A0WA 4TUYA 2CD9A 2X4LA 2FPOA 1OLXB 1K8QA 1UWLA 4J43A 3KYDA 4H7HA 4MROA 5ESRA 2VI5A 2OMEA 3RD5A 3LC1O 4IVRA 5AJWA 1BA3A 3CW9A 5CA1B 4WZAB 1LJUA 1S2DA 1MB2A 2O4CA 3ONNA 4MUEA 1MC5A 3CNBA 1E5TA 5ALMA 5LXTF 1EUCB 3TR5A 3WLRA 4GSKA 1A69A 1OHHD 1VDMA 3A7DA 3GP3A 1NJ5A 2I3ZA 2WICA 4MWGA 5GTDA 1EHCA 1FU7A 1T91A 3UOGA 1FFWA 5EIHA 2C3MA 3R9IA 3O1LA 4MRAA 3RV4A 3A0RB 2IKQA 3VDXA 5FKJA 3E27A 3OEEA 2P6UA 1MB4A 1U99A 4F06A 3FSRA 3NDJA 4W99A 2EKQA 2ADMA 3IT3A 4E08A 1Y1QA 2WB4A 1OFVA 3B1FA 4RELA 3TZEA 1K3UB 3SR0A 2KLHA 1WXDA 2V74B 1O94A 3BF7A 4OM8A 1ZH4A 5T4FA 1VXOA 2P6MA 4MVJG 3UMMA 4BBPA 4JI5B 4LDNA 3BWVA 3MOSA 2QRUA 3N75A 5KQLA 1EA5A 1XZMA 2QTNA 1KI4A 4LC9A 3OLQA 4E5MA 2SNIE 4HWSA 4Z4QA 4MGHA 1XWWA 3E5HA 2WMYA 4D1YA 1YONA 2DFLA 4I1PA 2IHKA 1G2PA 1WVGA 4PG5A 3R6GA 1VLHA 4CF5A 3FF1A 1JAZA 2GZ2A 3SLKA 1U9ZA 4KXXA 2JZOA 4X6UA 3BORA 3TX6A 4R7TA 3QEBZ 3PDWA 4AP6A 3CFYA 2CJYA 2GEVA 4NXMB 1U1EA 2WFAA 5F33A 4D3YA 3A14A 3HCBA 2VYNA 1NVVQ 4C20A 1DAGA 1E96A 2RGGA 4G4SO 4B84A 4DIMA 3E4CA 4IV0A 5KYWA 4Q6BA 3FPCA 2JJMA 2ZRKA 2XZPA 3MCUA 4RCYA 1OWPA 3CSSA 3LHIA 1YVPA 3T1VA 2Y9MB 4LJKA 3RTAA 4OQQA 4I1SA 3VZBA 3I2KA 1R12A 4LF7B 4OQPA 2G9ZA 1HOTA 1P72A 5EPEA 1SUAA 1QHHB 1YQWA 2I6TA 4FEYA 4KKVA 2R47A 4DBLE 1J0CA 1WCIA 4OMCA 4FOLA 1BDBA 4JS0A 4BGUA 2QR2A 2OV4A 3IERA 1YJCA 3JCZA 3ESYA 1ZMRA 2PFGA 4JGIA 4WESA 1EG2A 1MJNA 1A8PA 4L6AA 1CUHA 3ZOKA 1DIBA 2A9VA 2UZ1A 2XQFA 4N7JA 3I34X 3EIWA 4L4ZA 1H9AA 5JC1A 1DAOA 1FP2A 3O0TA 5E6SA 1GTRA 2QM8A 2QTVA 1QIGA 3GN1A 4C4XA 5IH7A 2R6DA 1A3CA 1TF5A 2VF2A 4QHSA 3IR6A 1N2CE 3PJEA 4U2BA 3KOWA 3ZLBA 2GCEA 3R3UA 5CXXA 3RV3A 5JQWA 3AF1A 3LQYA 5A03A 1KRXA 3U40A 4JI8B 4RV5A 2YV1A 3UJ9A 3GYGA 3CZAA 4GWGA 4PYKA 4Q7QA 1E9FA 5HCUA 2P9ZA 1FTQA 2PZKA 5IABA 1W19A 5AT1A 3ZZNA 2D2XA 4DV1B 2IYPA 3O0DA 1MHPA 1ISHA 3OZBA 4YMIA 3PPIA 1SU8A 3NMUF 4WX2B 2NP7A 4D25A 4OIMA 3KK0A 2YY5A 2W4MA 5AOAA 1WKBA 2FB9A 4JZKA 1JAYA 3EUFA 1M1NB 1LD3A 1JIIA 4P6VF 3LF1A 3SDBA 2W00A 2PGLA 3WRYA 1P60A 1JX6A 4MHTA 2EATA 3BMCA 1N2SA 1ZM3A 1QQ5A 2PLNA 1NNLA 3A2MA 3ZHSA 3IVXA 5JHHB 4H7FA 4I36A 1ZD9A 5E0KB 5H16A 3EWNA 3KJXA 3ZE9A 1TPZA 4N6GA 2ISSD 2EG5A 4Y8VA 1WQ3A 4L72A 1HFJA 2QDXA 2ZSKA 4MEJA 3HO8A 3U7GA 1DQZA 2I4NA 1WB6A 3A1VA 3JY6A 3EQ6A 1HNNA 2WAOA 1V4VA 3AM3A 4IS2A 4ER7A 1D1SA 4FB5A 4ZEVA 4RTQA 1YRAA 3HBNA 4AO8A 2ZRFA 3R4VA 4MV5A 2ZIWB 1Q1GA 2AUNA 3EDYA 5H3CA 1LPSA 1X14A 1CIPA 4PLGA 3WSWA 4MYCA 4CN9A 5FBVB 5TQ2A 2Z2YA 3NP7A 4UE2A 4ZZ3A 3B3GA 3L8MA 4F9FA 2C0QA 1GNSA 4QU8A 4MW5A 4JAVC 5E1OA 1JMKC 3I8OA 1FRZA 3A6LA 2G4LA 1JG4A 2Y6UA 2JKZA 3RT1A 4CT4B 5JAPA 3DAPA 2BI8A 4G1UC 5HWSA 1J23A 4O0MA 4CEIB 2QUAA 2K2QB 4MLDA 4RW0A 1FUEA 3LQQA 5E4YA 1S4MA 4RGQA 4ZV9A 1RKQA 1QO0D 3AONB 3CPHA 2Q3MA 1TRKA 3K15A 1TYBE 4GZ3A 2PWAA 3ZI4A 1JFTA 2JJ8A 3HDQA 5CX1B 5LZ7A 4D9NA 4P4LA 1SXJA 4XVHA 1U1FA 1DV2A 3PQ6A 3ONFA 2VAVA 4CGZA 1W4CA 1OTHA 5IPFA 1W9HA 3VPXA 3B1VA 5EKTA 4PFQA 1ECGA 2ZR8A 3U9TA 4JUBA 4DILA 1UMCB 4EF5A 1EB9A 3K0AB 3ABOB 3OTGA 4BKQA 4EHBA 1PN3A 2SCUA 2WZBA 2WYVA 1PX2A 3OKCA 4FW9A 1CY0A 3B7PA 5PNTA 2ZI9A 3JQEA 3OZFA 3TAHA 3T3IA 1HQCA 3UT0A 1LLCA 4F5YA 2HCJB 4N0DA 3EGCA 5KQPA 3BTUA 5ITSA 1XBTA 1H65A 5CNJA 2ZRGA 3NM6B 1M2EA 1R5NA 4I3FA 3BAZA 2JCXA 4PHHA 2GM3A 1M10A 3WB1A 3PNMA 4MWDA 2P8SA 1UK6A 1DI0A 2FG5A 4RJTA 3I6BA 3RC8A 1WZNA 2X8LA 3MMZA 1HF3A 2G77B 3RRMA 5BSKA 1K06A 3HYTA 1TJYA 3RUCA 4JCCA 1JBKA 3GG9A 5FOXA 4ZVMA 2GBFA 1NFRA 5F1OA 1BCRA 3QV2A 3VKVA 4XA8A 1UXKA 4IVNA 3SBEA 1S9DA 2FXVA 5M29A 4PO8A 1JU4A 3MLBA 4FFBA 1T3ZA 4UHBA 1JH8A 1TYCA 2C4TA 5JPDA 2EFEB 2BVNA 3VHLB 4EUHA 2FW8A 5M2QA 2G76A 2RGXA 3BDAA 5AKEA 1G3QA 3D3KA 4PRKA 4YRPA 3CYFA 3HZZA 5F5XA 5FI0B 4RTSA 1ST2A 3HU1A 3ZGLA 4MICA 3TKAA 5ESDA 5ALVA 5B57C 3JVEA 1ZD3A 5TXGA 3BZWA 1RXCA 2BGJA 2ECQA 4MS1A 1FXUA 4L1KA 2FWIA 3WI7A 1GQ2A 5AW4A 1FSGA 1NM5C 1P17A 4RZ3A 3X2FA 3C1TA 2O50A 3EZ9A 4P3YA 4U8GA 3E8SA 2GM5A 2R2AA 1RI5A 5GGXA 1C4OA 1NUQA 1J0XO 2XB9A 4PS0A 3D64A 4HH0A 1YB7A 4EG7A 5K9ZA 1HEIA 1OB5A 1SO8A 2YDXA 2DLNA 2VVTA 4MK4A 3WLAA 5ALUA 1G7TA 3V1NA 1PR1A 4CR8A 4FYVA 5F2NA 1AHIA 4DQVA 2AOWA 4K6FA 4YCBA 4F8EA 3JQFA 4OXIA 4OHOA 4YUZA 3BJIC 2JI6A 2Q0QA 5P21A 3SYMA 4DA4A 2BUAA 4WLEA 1J7KA 1K5GA 2NN3C 5CB4A 5JJCA 1EYZA 1ZL0A 1CRPA 3PEUA 3K94A 2E49A 2J6HA 2EDAA 3P9IA 3C8MA 3H2ZA 4CKWB 2ATIA 2WT8A 5H5JA 5ELXA 2MSDB 3MGGA 4RTRA 3BIJA 2IBMA 1G2IA 4HAYA 3EMDA 3F3SA 1ZICA 4KRYA 2CXSA 2JNWA 1SG9A 5TMEA 1ZI6A 4BX9A 2C0PA 4OOFA 3R5JA 2PVCA 1CDEA 4JYBA 4TT3A 4Y67A 3QG1A 4CDMA 2GRJA 4FHFA 5A9SB 3GJ3A 3MUOA 4B80A 4IQ0A 3QI7A 3HMQA 5FOSA 3ILVA 3UB3A 3AVPA 2Z1DA 3VR3D 2GK7A 3RAJA 3SEFA 4CQNA 1K97A 2I6SA 1UBHS 3PV0A 2PJDA 2EKDA 2PX2A 3PI6A 1JNXX 1JQ5A 3II6X 3LVFO 4F0JA 1U8ZA 1A9OA 4ENQA 5K0GA 2I2BA 3F8TA 4XWOA 1G8PA 4UJ3A 2QMQA 4R84A 3V4RA 4BMCA 2A1TS 1E1RA 2OV6A 5CD1A 5FYDA 3VU3A 4DR2B 1J0BA 5L9AA 1FTYA 4RNCA 3BTVA 3OT1B 1KYZA 1QYRA 1IXSB 2X19A 4RQTA 1RE1A 2I9KA 3QWIA 5AM2A 1UL1X 3Q41A 2VWHA 3DNPA 4ZAWA 5GGYA 3W6OA 1TF7A 4DREA 1AGNA 2B99A 4Q4AA 1TYEB 4RTPA 1Z88A 2E6UX 2VNHA 4JVLA 2FWRA 4UPDA 2XMRA 3HKBA 4P3PA 1JHRA 4M0CA 2QAGB 1NN5A 3ZY5A 4CTJA 1SU7A 1QP0A 2QA5A 3TTVA 5IARA 1F4PA 2V58A 2C95A 3A1TA 4B8WA 5CDSA 1ZRMA 2W2MA 1EFVB 4LZJA 2ST1A 2VDRB 4TV9A 2PSEA 5INTA 3HK2A 2Q3LA 3TMKA 3UWKA 1CE8B 4QXPA 2BV3A 1QCCA 1ZCAA 5HK9A 2UZ4A 2ECKA 3KZCA 4X8HA 2H57A 3THXB 1M75A 2GM4A 5FRDA 3U1TA 2XRMA 3EC2A 2A35A 2CW5A 4M89A 3FNHA 4BIMA 2XXAA 5CX4A 2FGJA 1SBQA 3DMDA 5L7TA 1JDTA 4RK4A 2OQVA 4HXEB 2HYDA 4Y2HA 1Y3BE 2AOUB 3ER6A 5DPMA 2ADFA 5FLXA 1ZXBA 5FTWA 2VYVD 4RCVA 2D7JA 3GPIA 5F4ZA 4JKOA 1CK4A 3QG5A 1F38A 3QHAA 1RHUA 1LUAA 3PD1A 5G1PA 2LD4A 3TQQA 2J3EA 1DIAA 3MJ4A 3VVBA 4KK4A 4I0WB 2BEUA 2GHRA 2RGWA 3IT0A 1T4MA 4BV3A 2QVCA 1W85B 2Y1LA 3KAKA 2VF4X 3FN4A 1D1TA 4C87A 2PUBA 1KMMA 1Q77A 2JJ2A 1OLUB 1EX7A 2O8CA 1AHHA 1OI2A 1HFWA 5AUNB 5HKKA 1KZ6A 3CF6R 2BFEA 2VHQA 4IGFA 4ENSA 4Q15A 1M76A 2QPOA 4G1VA 1Z6XA 1ZNYA 1HE1C 2IBSA 1NDHA 3OLVA 3L8ZA 3NUQA 2XMZA 2II6A 2PLRA 1W35A 4YX9A 1Z15A 2CHGA 1OA0A 2VDMB 4XWYA 3LG2A 4D3XA 1JSCA 1VE5A 2IU6A 2OPHA 2L69A 2IOFK 1L6IA 1DQRA 1MQ8B 4PAGA 2DQ4A 3UXHA 1AY0A 4FMDB 2VWQA 4P7FA 4UE6A 2C5HA 1RBZA 1WMBA 1VC2A 2FTKE 4HAXA 2PMCA 4IKEA 4RFSB 3VNQA 4CKEA 5HFAA 3EVFA 5CCEA 3LX6A 2R96A 1QR6A 1SIOA 2CUTA 4NNJA 2VDJA 4NDAA 1DCFA 2A84A 2EIXA 2VPPA 3WIDA 1JQDA 3NC1C 4F5DA 5LMCA 4LPKA 2IH2A 5JCOA 1B1CA 1G5RA 1Q1QA 5K3DA 4CTMA 5KYUB 4E15A 5A2GA 2W98A 2JCGA 3AJEA 3NS7A 3SU8A 2PUFA 3NDRA 5A3VA 4A1FA 4MO2A 3ER8A 3Q0TA 2J3DA 3EIFA 4C0HA 1ZQ9A 1IOWA 3DT9A 1HNZB 2FEAA 1U8TA 3HDGA 2ALJA 2WF5A 4QTXA 1NYQA 1BE8A 3EIXA 3N86A 1H2EA 3RFVA 4M1WA 4AMBA 5EQFA 4DIFA 3DWIA 4MCAA 2IV3A 2EZ9A 4IGEA 3JQGA 5DXAA 1GT91 3TXYA 5CW1A 3KR9A 3LGSA 6LDHA 3Q87B 3V8PA 1ZIYA 4LBVA 1Z33A 4HQLA 4QJIA 3UW1A 4D0NA 3ZBPA 1NLZA 1E63A 3HDJA 1TOAA 4H31A 4IUBS 3G59A 1JTFA 2M98A 4C4RA 2XUQA 3QYFA 1F8FA 1HYHA 4MR9B 1AVTA 1JLSA 1YDWA 2EP8A 2WHPB 4LEIA 1NTOA 4MP3A 3QLUC 4PCLA 1XLTA 3ONWA 4WKOA 3PJRA 1DOHA 3DNFA 4Q00A 3SQMA 1H6CA 4FX2A 4KQIA 4C7JA 2JLWA 3V8MA 2ZM5A 3NIWA 4KXMA 2ZJ2A 1QBKC 5JS1A 2IW1A 3ELBA 1MX9A 5HMLA 4GPTA 1R5OA 4TXLA 4E3ZA 2C00A 1DAKA 3AUKA 2YX1A 3D6AA 4N01A 1QE3A 2GXQA 1XQ1A 2YV2A 4AYXA 4D0RA 1ORDA 3RTBA 2A1TR 1NGSA 1P44A 2ZBEA 2P5UA 3S5UA 1QV7A 1L7QA 2YHUA 4P7GA 5DYGA 1XUOA 3M82A 1V3UA 2GNAA 1C1HA 4TROA 1ATIA 2J9XB 4DY4A 3JQAB 1VIYA 2PZEA 3HVHA 5FBQB 4HGQA 3TH5A 1ZM2A 1RACA 3GW8A 3HRIA 1K7XB 3E7XA 2AX4A 2RHBA 1EZ4A 4MZXA 2WWTA 3ZX5A 4EYQA 4NMXB 3ETCA 3LCUA 4ER6A 3TW8A 3EARA 3BJEA 1BZYA 3BWXA 2B8NA 4EZEA 4QUJA 1W75A 3RARA 5ELLA 4ZCTA 1YAHA 2NU8B 4ZZ2A 5KX5B 3LFHA 2QAIA 2ES4A 2TSYB 2I1VB 3BWCA 4WCFB 2BGLA 4ZO6A 1FLDA 1GR1A 5I9TA 1Y48E 1ABFA 2WSSD 1B26A 3UHJA 4C6TB 5KTSA 2QV0A 1Z4LA 5HIAA 4QYWA 1AKYA 4EAQA 3QEKA 2ZZNA 1XJQA 1TO2E 4IDNA 2F8TA 3BXOA 4HOYA 3FNFA 3DEZA 1D9XA 1E77A 4EL5A 1SAYA 4R1SA 1PD1A 2IPMA 5GPBA 2P91A 1KY3A 3I9OA 4KGZA 1H3FA 1YRLA 3OZVA 3PC8A 1R6BX 3CINA 1EI9A 3GLVA 3OZRA 4MV8A 1YCFA 3GLIA 1YS1X 3K96A 4DR6B 4INAA 2XTAA 1DKPA 1I7PA 4RPGA 9ABPA 4H9GA 4PYQA 1EB8A 3C5CA 1HTTA 3DNMA 3TDMA 4AJ1A 5J2UB 2JD2A 4HSEA 4MDHA 4TTIA 1WBDA 2J3KA 1KK1A 3AUJB 3NLLA 3Q9NA 3TIFA 3VKUA 1Z56C