5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
source organism Brucella abortus biovar 1 (strain 9-941)
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
4IZHA 4RDHA 2HJSA 5ITWA 4OOEA 4W7HA 1I2ZA 1OI7A 2YDYA 4EI2A 3JQ7A 3KO8A 3JQBA 1ARZA 1M76A 4HUJA 2EXXA 1CYDA 2X22A 4II3A 2X5JO 4NIMA 1R4NA 4MOWA 4UUMA 4QFCA 1CIVA 1T24A 3WJ7A 3BXXA 4EUHA 2V6BA 1XGKA 2X4GA 3BMNA 4DQUA 4FGWA 4KZPA 4CQLA 1PTJA 4MP3A 4BV9A 2C07A 4J1TA 5EQFA 1Q1NA 5ES3A 3QVOA 4E2YA 2QYTA 1TXGA 3L4SO 1PGPA 3O26A 4QXMA 3PJGA 1A27A 4W6ZA 1PL7A 3S2EA 4RPJA 1N7HA 1ZZEA 2CD9A 3DHNA 4UEOA 1PQUA 3C1TA 2Q2QA 3WMXA 4B4UA 1D1SA 3TL3A 4Z3KA 2AE1A 2OMEA 1OFGA 4K26A 2EKQA 3RBXA 2NUAA 3RFVA 2QZZA 4DC0A 2BGLA 4XRRA 1PR3A 3INGA 2WDZA 3NRCA 3E03A 3OA2A 5K6AC 1RWBA 1QYXA 2XXBA 2GF2A 3IIEA 4MKZA 4MVJD 1PS0A 1T2FA 3JYOA 4FC6A 4OH1A 4EZBA 4A0SA 4B4OA 1YDEA 3QWBA 3GDFA 3TF5A 4ALNA 2X5KO 4PLPA 3AOEC 2I6TA 2Z95A 3SLKA 1CEQA 4NFHA 2PWZA 4P4NA 1IOLA 1FDUA 2VNSA 4PG7A 4C7JA 4ZQGA 4ZU3A 4YRAA 1BDBA 4PLTA 1K6XA 3ORFA 1KEVA 4FGSA 3HNPA 4BGEA 3TRIA 3ZU4A 4KDEA 4YA6A 4TMFA 2VHZA 4RPGA 3VKVA 3GVIA 4CV2A 3FNFA 1QXSA 1JAYA 3NT5A 1HDXA 5FF9A 5A04A 4HFMA 2C2XA 3WXBA 4BNHA 1EUZA 2D2IA 3TSCA 4QQRA 1M67A 3RU9A 6ADHA 4WLFA 3QWFA 2J3KA 5L53A 5B4TA 3QE3A 4R1TA 4J6FA 2RHCA 2DUWA 1ZK4A 3ZWWA 4RLSA 1LBEA 5ADHA 4R69A 4KWHA 3IOYA 4IIUA 1IB6A 3S1LA 4J4TA 1YB5A 1H9AA 5K9ZA 3ZWYA 1T26A 2H5LA 2E82A 4L4RA 4DL9A 2IRWA 1V6AA 4BO4A 4OXNA 3K6JA 5TF4A 1KIFA 1WVGA 1JQBA 2DVMA 3IS3A 4Z6KA 5IF3A 4P4GA 3ULKA 3GHHA 5JC8A 4FCCA 4NG5A 2UDPA 3CE6A 2EJWA 3F3SA 4DIFA 5F5LA 3IKVA 2O23A 1OC2A 4F3YA 3SXPA 2O3JA 3I1JA 2HCTA 1B7GO 3JV7A 1RYDA 2DQ4A 2GYYA 4BO7A 5KNLA 2P5YA 3KEOA 1ZCJA 3HDQA 3KTDA 5DT9A 4E6PA 5DBGA 2GZ3A 2IYOA 2A35A 4J91A 2BLLA 5COQA 3WNQA 4S1VA 2GO1A 3HFGA 3GEMA 3UHAA 2WMDA 1LDEA 1D3AA 1P74A 3GG2A 4W4TA 1Y8QA 4BNLA 3VPHA 4LSMA 5C7LO 4RVFA 1E7MA 1LQTA 4L4SA 2WE7A 4LN1A 4NJOA 3C7CB 1LDMA 4PG4A 1UUFA 3ZW8A 5IDWA 5IZCC 2D1YA 1Q2XA 4PLGA 3WSWA 4JBHA 3WGZA 2QW8A 1VKNA 1SAYA 1Y8RB 4PIVA 4PGFA 4DMMA 1PEDA 2VHWA 1HDCA 2ZB8A 4FJ0A 4FPXA 3ONFA 3JD3A 3UFXA 1KVSA 1XU7A 2DBRA 1O9BA 4J7XA 4MJLA 5JY6A 4GWKA 5CHEA 3RBZA 3FWZA 4U6SA 4R1UA 1DSSG 5TLSA 2HKIA 1Z7EA 2JHGA 2VYNA 2W2LA 4CMCA 2CDCA 3UF0A 2Z5LA 3GZNB 4XGKA 1AGNA 2CVZA 5COBA 3OJOA 4IQ8A 3FNEA 2VNAA 3WGGA 3RAJA 5IN5A 3IQDB 1VL8A 1ZFNA 2O50A 1VPDA 1ZK2A 5G0SA 4R01A 3ZU2A 1AXGA 4B8ZA 4K1LA 5EN4A 4HV4A 3BMNB 3F46A 1ADBA 2O48X 4FDAA 3ZHZA 1KC1A 1YB1A 3O8QA 2W4QA 1JKFA 1L7DA 1NWCA 4IY1A 2ZB3A 1B15A 4YDRA 2POQX 5DBFA 5GMOA 1EQ2A 2DFDA 4B79A 5CDTA 2HAEA 1GYPA 2EW2A 1LDNA 5TNXA 2QYSA 4CLRB 2GN9A 1FDSA 2J3HA 3BTVA 4D7AA 4B3JA 4JLWA 3ZZNA 3ZHXA 1LA2A 1NFRA 1A71A 1E92A 1YQGA 2HDHA 3JTMA 3MOGA 3BIOA 1YWGO 3AU9A 1RM5A 2AXQA 4E21A 1T2CA 4IMRA 1QKIA 3R0IA 4QUKA 3K73O 1LRJA 4J3FA 5CDUA 2FR0A 2E6UX 1A7AA 2V6MA 5GZ6A 2AEJA 1H6DA 1E3WA 3H7AA 1DIBA 2X0RA 1A5ZA 4A7PA 2HK9A 3S2FA 3CMCO 3VTZA 1P0FA 3QWHA 3DBRA 1NTOA 3P19A 1GV1A 4IDGA 4RF4A 3V1TC 3U09A 4TKMA 5DOZA 2R00A 1UAGA 4ONEA 1I3NA 2J3JA 4EJ6A 2ZIZA 4G65A 3QW2A 1BW9B 2XOXA 3EVNA 5JY1A 1HYGA 1A4UA 1E1MA 1DAPA 2WYVA 5L7TA 3EK2A 2PTGA 1DHRA 3Q1LA 3DMTA 4OMUA 3GMSA 5GY7A 1ADCA 4QTZA 1HLPA 4WCDA 3A14A 5KJ6A 2B69A 1ONOA 2EIHA 3FTNA 3X2FA 1H6CA 2HUNA 4JBIA 2DTEA 4R5HA 1MXHA 4JCOA 2CDBA 2VTDA 1IULA 4JQCA 1R12A 1K6JA 4E5NA 3IUPA 3VAZA 4BL5A 2QRKA 4ROSA 1C1XA 3ADOA 5FI5A 4OAQA 4BNGA 3Q2KA 4YAEA 2VUUA 4W7IA 1EBFA 4AJ4A 4DVJA 1LNQA 1JLLA 2GN8A 4INAA 4YJGA 4GMFA 1DRUA 1H2HA 1HXHA 1HYHA 3GRKA 1WDLA 1PQWA 5JMWA 3HB5X 1R6DA 4FJ2A 4MP6A 2JD1A 1GQQA 1OC4A 2C20A 5IXSA 1B8PA 2AQHA 1N1EA 4WLEA 5EIOA 3UCEA 4FB5A 3QIVA 2W8ZA 3A9WA 3JQGA 3KSUA 5LCXA 2HMUA 2ZTUA 3CUKA 3JYLA 3R1IA 4R68A 1PJBA 4DREA 2JFHA 1PL8A 4NFSA 2DTDA 2W2LD 2VRCD 3OBBA 4CM1A 1QYCA 4I9HA 3MJEA 4XDYA 1NR7A 1KY4A 5JAIA 1IUKA 2Y1OA 2YW9A 1GAEO 2CUKA 1JA9A 5FEUA 3JQAB 4YJDA 2NU7A 5C7OO 1EVZA 4FFNA 5AXAA 1G0NA 3ZCXA 3ZNPA 4XJTA 4XQEA 1K0UA 2AQIA 1UXKA 3M2TA 4Y6SA 1I8TA 5H82A 3I9NA 3QHAA 5L7YA 1XLTA 1U9JA 3I3OA 2VWQA 3TZQA 3UCXA 2F1KA 4A5OA 5MDHA 3LT0A 4IJVA 4ALJA 4Y9DA 3OQ6A 4RZHA 5EESA 3AUTA 1HEUA 3W8FA 1YQXA 4E2XA 1ENPA 1Z6ZA 2C0CA 5AXCA 4LRSB 3DZHA 4PLVA 2PZJA 2GSDA 3ZWOA 2ET6A 1NVMB 3UGKA 7ADHA 2UUOA 4BGVA 2ZYGA 3HZZA 1Z73A 2UYYA 2WD7A 3DONA 3N7UA 4YT4A 4BNNA 5B37A 4FIZA 1UP7A 3RC7A 1DIGA 4RQTA 3SVTA 2BFMA 4WLUA 4MKRA 4YQZA 1ZXBA 2PZLA 4J90A 2NSDA 2JAHA 4YT5A 1I33A 1KVUA 1MV8A 1XYGA 3GN2A 2P2SA 1IPFA 1TLTA 2I99A 2VYVA 4JK3A 4NQZA 3RI3A 1F8GA 3AM3A 3MWDB 4DLBA 4BKUA 3LF1A 2B4RO 3K31A 3PI7A 5TT1A 3CTMA 3WJAA 5IAAA 4Q3AA 1EZ4A 5JMPA 1C0IA 1VC2A 3NTOA 1I2BA 4K9DA 4XYEA 2YFHA 5A02A 1FXSA 4FJ1A 3O38A 5JDCA 2DPGA 2Y1GA 3GVPA 4NBRA 4GSKA 1NHGA 3IAHA 3H8VA 2B0JA 3OJLA 4FOSA 4EW6A 3FR7A 3CH6A 5T8KC 4UEJA 4ZJUA 5A9RA 4GVLA 1R0SA 4MDHA 2O3QA 4MVJM 2Y0EA 3VPXA 2IE0A 3R3SA 5B4UA 3I4CA 4G5HA 3PFFA 2GCGA 1P44A 2VWGA 1DEHA 1R15A 3LK7A 1UDAA 4LRTB 4NBWA 3GT0A 1GL3A 4Y8VA 1VSVA 1IZ0A 1T25A 3HSKA 4XYMA 4U0KA 2IEBA 2W2KB 1XQ1A 4IM7A 1ULSA 3SX2A 1M75A 1HE3A 1YJQA 2AQKA 1NP3A 4IXWA 2IZ0A 4XCVA 4J49A 3DOOA 4YTEA 3SJUA 3JYPA 1Z74A 4MVJI 2Q1UA 4DYDA 4PZCA 5A9TA 3QY9A 3WGHA 1XQ6A 3WFJA 4A73A 1MC5A 4I5GA 1A9ZA 1ZH8A 4EEXA 3OA0A 9LDBA 1LSUA 4YJHA 5IZCA 1NQTA 4GVXA 1M2WA 1BMDA 1K89A 3QVSA 1H5QA 2RHRA 2DAPA 4LMPA 2YV2A 4OOFA 4YAIA 1XWFA 5K0ZA 1H94A 4LGVA 1EMDA 1Y9EA 3GAFA 2NNLD 3JQAD 2JCXA 1BXKA 4ZD6A 2X23A 4XZ3A 3AFNA 1ENZA 5THKA 5ITVA 3B1JA 3QWIA 3BTUA 2D4AA 3OECA 3EZLA 4CM8B 1E5QA 1M6WA 4FD3A 4WCFA 2BFOA 1YBAA 1BXGB 1R4NB 2EKLA 3AUUA 5JDCC 2WEKA 3S8MA 3TFOA 4TKLA 4K6FA 3FF4A 4FW8A 4NPCA 1X0VA 4MO2A 5T5QA 3HHPA 1E3WB 1Z45A 3L6EA 4RPLA 3OF2A 3O03A 4GKBA 4CM9D 2X7HA 4UVEA 2H63A 3MTGA 1ISFA 1PWZA 2EG9A 1UXIA 4OYRA 4F46A 2BMAA 3FTPA 2PGLA 4DC1A 1KBZA 4CUKA 3TJRA 3PWKA 2PLAA 3JD4A 3C8MA 3KYDB 3STHA 4IDDA 8ADHA 3P5SA 3ETDA 1P9LA 4IJKA 3Q6IA 4D46A 3ITDA 1CQJA 2B83A 1BRMA 1ONNA 2JCVA 5L7WA 2P4QA 1C0LA 4IGFA 3WTCA 4UEKA 1IPEA 4WNIA 5EERA 1PGQA 4M89A 3WG9A 3DQPA 3DZFA 4HBGA 4M86A 3GPIA 4CQMD 2C82A 4E5YA 3MWEB 2QRLA 4M87A 1WDMA 1VKOA 4FFPA 4WE3A 1N9GB 4J0EA 4FQ8A 4PLHA 2WTBA 3S55A 4AICA 1WNTA 3TOZA 4DBZA 1RPNA 1NAHA 3GG9A 1NM5A 5TJHA 2I76A 3F6YA 3G3EA 4DQVA 4XRGA 3WQQA 1EUDA 3Q3CA 3MJCA 3PIIA 1QORA 1DHTA 4URFA 1RM3A 1KEPA 1YJ8A 3KYDA 3DZJA 3ON5A 5EL0A 5KTKA 1TEHA 1GUYA 3DAPA 4BB6A 5F1KA 3D4OA 1SMKA 2CNBA 2B35A 1UAYA 1E3EA 3FRJA 3ITKA 3PDUA 5L4LA 1B3BA 3F9IA 4UVGA 3DAFA 1PJSA 4XYBA 4FS3A 1DPGA 4BIIA 3K2EA 3C3XA 1BGVA 4P38A 3ASVA 2ZJ0A 4EGFA 1PJ2A 5KWEA 2J5KA 3K92A 3HN7A 1I2CA 2B5WA 3H5NA 3KHUA 4TWRA 1WXDA 3OQBA 2Q1SA 3DMTC 3OP4A 3V2UA 4E32A 1D8AA 2E49A 4M8SA 1DFIA 1UH5A 2BGMA 1P77A 1E7YA 3DZKA 2EERA 1V35A 5KIAA 2PD4A 5U4QA 5JDIA 4HNHA 1R0KA 2EW8A 1PS9A 1P1RA 4B8WA 3DC2A 1WW8A 4OL9A 3GUCA 1NFFA 3I9MA 3NGXA 5JNLA 3D1LA 4J9UE 1Z7BA 2IZZA 1V3UA 1V3VA 3OJEA 5FWNA 4ZN6A 3NX4A 4Q9NA 3JD1A 4CV0A 1N1GA 4OGWA 5ICMA 4Q3NA 2NWQA 2G0TA 3RC1A 5J23A 1IHXA 1GEGA 2NU6A 2J3IA 4XX0A 3DZBA 4CLHA 1YE3A 4R54A 4BKPA 3AOGA 3RFXA 2GGSA 4MIOA 3VH2A 1Z75A 2FP4A 3JQAA 3QVWA 4IINA 5I9MA 5C37A 2JHFA 3AI3A 5IJZA 3D0OA 1SEVA 2EGGA 1Y9AA 4PG5A 3DTYA 4XQCA 9LDTA 4YBZA 4UVIA 4BOYA 3N58A 2JCYA 3NYWA 3ZWCA 1W4ZA 1JDJA 3HN2A 4BUCA 3QWAA 3T7EA 4BO6A 1K2WA 2GLXA 3RWBA 1EVIA 4M49A 3BHMA 3LC2O 3IUSA 3KRTA 4WCFC 2HMTA 4P8RA 2IDZA 2CSUA 3T4XA 1JKIA 2GRAA 2Y93A 4OKNA 2D3TA 2R00C 3U0BA 3KLPX 4FFMA 3PK0A 1F12A 3H9EO 4KOAA 2HRZA 4XGNA 3ZH2A 2EKPA 1DXYA 3A06A 4PVDA 4BNXA 3Q2IA 1VJTA 1QYDA 1S7CA 3QVXA 1PJLA 3PGXA 3JQ8A 5DF1A 3WOHA 4L9RA 4D79A 1GADO 1NPYA 1WWKA 3KM0A 4DYVA 3C1OA 3BAZA 3DB2A 2JD0A 4U8GA 5JCJD 5HA5A 3PHGA 1ID1A 3EYWA 3LLSA 3MZ0A 5IG2A 1MLDA 2BD0A 5EQDA 1E3IA 1QLJA 2Y1EA 3I6QA 4H3VA 4YVFA 4DBVO 1O95A 4N5LA 4D45A 3AFMA 1E3SA 1C1DA 3DBVO 4S3MA 5L51A 2V6GA 1YL5A 5DP1A 1N8KA 3CEAA 1HDRA 1AHIA 2P68A 4WLNA 2BI7A 3OM9A 3PJFA 2PY6A 1SB8A 4D44A 2B36A 1WZEA 2CZCA 1MG5A 3FHLA 5DCUA 4AJIA 2QIOA 1G1AA 4IS2A 1A9YA 4BB5A 1J4AA 3DL2A 3QSGA 3H9JA 5G4KA 8LDHA 1YO6A 4DTIA 4GAEA 3DR3A 4AFNA 3FR8A 4KP7A 3MEQA 4CMKA 3RD5A 3GVHA 1PR9A 3ST7A 2WWRA 1U3TA 3VPFA 3IP3A 5DCYA 3ZWMA 1U4SA 4FSHA 3UVEA 4I08A 2VOEA 3PYMA 1XDWA 3RKUA 1NBOA 3CIFA 1SCUA 2DFVA 3LYLA 5CDGA 3RUEA 3Q9UA 4DLAA 4DUPA 1A4IA 2Y66A 3DMYA 4IDCA 3ZV3A 5KKAA 5T8KA 4WJZA 2WD8A 3QLJA 1T2EA 2YHIB 3Q9NA 4A2CA 2VHXA 1V0JA 4HFNA 3UW3A 3PEFA 1K5HA 3K9QO 1ENOA 1E0DA 4GGOA 1UP6A 4BV8A 2PV7A 2I65A 3VZPA 4JN6B 4L74A 3RUHA 4FFOA 3BMQA 3K96A 4UVDA 1NPDA 1Y8RA 1O8CA 1B0AA 3A4VA 2B4TO 1TT7A 2D59A 3UXYA 5L40A 4CM8A 2RCYA 3UUWA 3OICA 4CMHA 3GUYA 1RM4A 3F1LA 4HXYA 4FC7A 3AU8A 2HRBA 2XF8A 2ZTMA 4JIGA 3QVTA 3ZHBA 3WB9A 1KYQA 4CLOB 3I9JA 1DO8A 4UUOA 4D3SA 1F06A 2OBYA 3T4EA 4E5PA 3OHSX 3LDHA 1U3WA 4CLDA 1E6UA 2AA3A 1EE2A 1E3LA 1GPDG 3LT1A 4ZGWA 4MPDA 5L9AA 1VI2A 4KUGA 1LRKA 5GZ3A 1RYEA 4O6VA 4LCEA 4JJGA 2DLDA 1XCBA 3ICPA 4OXKA 3NDRA 3PIDA 1B2LA 3D64A 4RCVA 2BKAA 4KDFA 2VCYA 3LZ6A 2X1HA 3BMOB 3U4DA 4E2ZA 2RH8A 2DU8A 4XQGA 3RUDA 1VLLA 2P9GA 3AUAA 3S2IA 2BI8A 2V6FA 4B7UA 4IJUA 2X9GA 3DWFA 3PFWO 3E18A 5JCXA 1MXFA 4DQXA 1YBMA 2GN6A 3OIDA 5BSHA 2A94A 4L76A 3ASUA 4BNMA 5IXYA 1YVEI 4YACA 1HETA 5H81A 3BHJA 3Q0EA 4UUPA 5JW6A 1ENYA 3WMWA 3ETGA 4W9NC 1X13A 2C54A 5HS4A 4KQXA 3IJPA 1U4OA 4YJGB 3AM5A 3KSZO 4JJFA 2VTEA 3KEQA 1U5CA 3I9OA 4JP2A 4CMIB 2P91A 3H9UA 1C1XB 3VPGA 3DBHB 3PYXA 1UZLA 2GR9A 1PGJA 1U1IA 5CAEA 4DLLA 3AUSA 3D7LA 3BMOA 4J1NA 3PLNA 2I67A 2QX7A 5JYDA 3H5RA 3GFBA 4MVJE 2NVWA 3GEDA 2WYWA 4IDAA 4MVJF 4PLCA 3WNVA 3GNQA 4JXKA 4YWJA 1V8BA 4RVSA 5EINA 4XJSA 2PZMA 1LI4A 1N92A 3SBOA 3BZUA 2ZCVA 4IDEA 2YHIA 3SC4A 4PLFA 2Q4BA 1Y7TA 2G82A 2J5RA 2DBZA 1GU7A 2Q1WA 4DPLA 4MIEA 3GGGA 2BELA 1YQDA 1HSOA 4XA8A 3ZNQA 3KUXA 4ALMA 4B7CA 4UVHA 2E4AA 5TIIA 4ZQEA 4GX5A 3PHHA 4GH5A 4A26A 3E5MA 2AMFA 1OMOA 5ICSA 2X0NA 3K2BA 4H7PA 1J0XO 1P1IA 2VUSA 3H3FA 1CDOA 2PK3A 4NHEA 4JJIA 4AJLA 1ZO8A 1LEHA 4ZQBA 5U9CA 2XPCA 2YV1A 4WLVA 4CLXA 3DHEA 4GLOA 3QQPA 2AHRA 3AJRA 1FDTA 4YJFB 1U2GA 3JQ9C 5A05A 1K6IA 5G0UA 1HSZA 1HYEA 2OORA 4E5MA 3ETEA 4UREA 3NTQA 4UUNA 1SOWA 2YUTA 4NU5A 1U7TA 5CEEA 3JQ7B 5A1TA 2A4KA 1AE1A 2Y99A 2CY0A 1I01A 2G76A 3FCOA 3K5PA 4QEDA 3LLVA 5DULA 5F3RA 1T2AA 5G0VA 3HFSA 3D5QA 3EZYA 3KYCA 5KJEA 4BO9A 4BNUA 4E30A 5AOVA 3BTOA 1LSSA 3FBGA 1LSJA 4FFRA 3W1VA 4NNJA 3A28A 3NAQA 2D5AA 4EDFA 1Y8QB 3DAGA 4E33A 2NADA 1JU9A 5KJ1A 3U4CA 3U49A 3HWRA 1XG5A 4ALIA 4WECA 4RLHA 1JN0A 7MDHA 1MC4A 3W6ZA 2FWMX 2Y1DA 3W8EA 1QMGA 4EEZA 2PZKA 2OOSA 3OSUA 4LISA 4YPOA 5CEJA 1GCOA 4TRNA 2YY7A 2FSVA 4EJ0A 1XSEA 4NJMB 3WQSB 2DKNA 3AM4A 2D8AA 4MVJP 1DDOA 3HUDA 1SBYA 2IEDA 2NTVA 4R3WA 4TZTA 1UJMA 1P3DA 3NV9A 2EGHA 4YT8A 5A3VA 4WNCA 3I52A 4J4HA 4RF2A 5HWSA 4JBGA 3LVFO 1HT0A 3CKYA 4RV9A 2IXAA 1ISGA 4XR4A 4RDIA 3LT4A 3VDQA 2OFPA 3DFZA 4ITUA 3W4JA 3GZ4A 4Q3BA 3WS7A 4BMVA 4CODB 5DN9A 1FF9A 2PKQP 1ZIDA 1EUCA 2CVOA 3VOSA 2WJPA 4QO8A 3VTFA 4D42A 3CSDA 5FYDA 2VRBA 2X58A 2ZCUA 4R1SA 5T57A 3V5NA 4RO0A 3C7DB 3H6KA 5AYVA 1R4MB 4NBVA 3UOGA 3W4KA 3F4LA 1HLDA 4HWKA 4CM4B 4EUEA 3U9LA 1XU9A 4H16A 4LW8A 4O59O 1PQPA 4CUJA 3E82A 3IJRA 4UAGA 2BRUA 2X5OA 3ZV6A 1P45A 3ZWXA 1GY8A 1GYRA 1ZJZA 2JFFA 1I24A 3JSAA 3ANLA 1LXCA 4CMAA 3TZKA 5KJCA 1NWHA 3TZ6A 3KOUA 4J4BA 1HF3A 1I32A 1F8FA 3WGYA 2CFCA 1PS8A 1PWXA 4CV3A 1CETA 2QG4A 3FBTA 4WCFB 3IL2A 1BSVA 4ILKA 4OQYA 1DFHA 1T4DA 4IQGA 4RF5A 1U7HA 1A72A 3ZWAA 4CMJA 5MGBA 3V1UA 3B1KA 4H15A 1L7EA 4LCJA 4C4OA 3PLRA 3L9WA 3WYEA 1KC3A 2X9NA 5CEFA 4W82A 5JPIA 1YRLA 4JROA 5TGDA 3RQSA 3TN7A 1DC3A 4DA9A 1HZJA 3MJSA 1Q7CA 4WOKA 3ZN2A 4A27A 4PFJA 1YH3A 4R16A 4DIBA 5CPFA 3L9XA 3VDRA 1E6EA 1ONPA 4KTTE 1HDOA 2AEMA 3TOXA 3ZWPA 4Z0PA 1DC6A 2F00A 3NDIA 4TSKA 3VZRA 3COSA 3PHLA 4HNGA 1XELA 1Y5RA 5AVOA 1PIWA 1ZVMA 4PZDA 5JBIA 1LC0A 2C2YA 4WPGA 3JD0A 5F21A 2OZPA 4D0SA 4ND2A 3UKOA 2NVBA 1ZW1A 4QFDA 4E13A 4DMLA 4L4XA 2HLPA 3NJ4A 2HQ1A 1IL0A 1E5LA 2WYUA 3GVCA 4GSLA 4J2HA 4TROA 4YEDA 4U5QA 1F17A 1LUAA 2VRCA 4KWIA 5KVSA 4JX8A 3G1TA 2AEFA 1J49A 4BO3A 1P0CA 2QHXA 3GAZA 1YGYA 1VSUA 2NVUA 5L4NA 2X0JA 3JQ9A 3PJEA 3TPCA 3WBFA 5T67A 1DAOA 5JLAA 1N7GA 1PL6A 3GEGA 4IJWA 2VN8A 4BKOA 5L95A 3BMCB 4HX5A 3RJ5A 3CXRA 3OETA 2HSDA 2Y0DA 3ENKA 1YONA 1RM0A 1ZUD1 3M6IA 5ENDA 4AJNA 3GZNA 3JD2A 1DLIA 1B26A 2Q2VA 5K6AA 1EDZA 3JQDA 1NASA 2C7GA 1AUPA 3C7AA 1HZZA 2PR2A 1FJHA 2OUIA 5GZ1A 3P2OA 5DBIA 4AG3A 4JNKA 5CFZA 5JAMA 4IZIA 2BF7A 2YHUA 3EVTA 4BMSA 2NTNA 3D3EA 1E1LA 3GC6A 1X7HA 4Q3CA 2ZTLA 3TZCA 4CL3A 4CMIA 4IDBA 4BNTA 5JSFA 5KVCA 3GGOA 3R6DA 3GGPA 4II2A 4RVGA 4MIYA 2JKVA 3ZWNA 1GTMA 1KVTA 3BTSA 5BNFA 1GYQA 4AL4A 4BNIA 1BXGA 4GX2A 2YQ5A 4XD2A 5JAQA 3JQFA 3V2HA 4E31A 4M55A 2YDXA 1UDBA 5TJ9A 3BHIA 2OO5A 1N2SA 1V9LA 2P9CA 3I6IA 3OH8A 3AW9A 3H9GA 1CJCA 1R66A 3GMDA 3ROPA 1JTVA 3CINA 1VL0A 3G49A 2NQTA 1H2BA 5A5EA 1YDWA 3NJ8A 1T1RA 3HB4X 3NUGA 4PRKA 3S2GA 4D0RA 5KKCA 1UP4A 5EMHA 1BG6A 4YRBA 1LQUA 3ZHYA 5COAA 4PRLA 2PFGA 1KVRA 3PQFA 5BSGA 3ZWBA 4CM6A 2O4CA 4U6QA 2ZB7A 1BHSA 2EP7A 2G1UA 2P9EA 1UZMA 4FN4A 2DM6A 1IY8A 4AVYA 4N18A 1X15A 1B3RA 2CF6A 5KVVA 4IGEA 4OXYA 3OQ1A 1HE5A 2B37A 1D4FA 3ZGYA 4ZQFA 3P2YA 3HDHA 4Q3DA 3ROKA 3D3WB 3GQVA 3RFTA 1GZ6A 4BS9A 4MVJG 1AN9A 1Y1PA 4OJNA 1XR3A 1R16A 2J5QA 4BNKA 4YXFA 3NGLA 4Y67A 1CF2O 4BO5A 1W73A 1HWYA 1VJ0A 4XGIA 3TZHA 5G0TA 5CDYA 1M66A 4BHTA 1IYZA 3K30A 3KLMX 1X0XA 3KVOA 3AI2A 5B4VA 1TA4A 3JQCA 4BNWA 4M54A 5LC1A 5U1PA 1OBFO 2NQ8A 4E12A 2H9IA 4GQAA 1GUFA 3WDSA 3H65A 1JKJA 2D0IA 1XIVA 2PNFA 3DFUA 1T2DA 3QA9A 1MFPA 1EK5A 1I10A 2AQ8A 2VQ3A 3PP8A 4YJFA 1ZMTA 3RUCA 1Z82A 2TMGA 5G0WA 1B8VA 4J43A 3TFQA 1P33A 1PJTA 1X7DA 5HS6A 3FD8A 2C29D 1E7SA 4OM8A 3KV3O 1PZEA 2VHYA 1HDYA 4TVOA 5JYEA 3WBBA 5JS6A 3LQFA 1NVTA 1S6YA 3VC7A 4J1QA 2QZ9A 4YAJA 1J5PA 4I1IA 3IKTA 3F5QA 3EHEA 2D5CA 2DBVO 1U8XX 1LLUA 4CM9A 2NVUB 5F1PA 1TB4A 4PLZA 1VL6A 2DPHA 1C1DB 3FNGA 3EW7A 3H5AA 2FPPA 1XEAA 3B1FA 1YBVA 3DOJA 4BO0A 2CF5A 5AQ1A 3TDKA 4QO7A 1NHWA 1EVYA 4J7UA 3OIFA 3AY6A 4D43A 2ZTVA 1GCUA 4R3NA 4KQWA 5THQA 4NBTA 3NKLA 3WGOA 1P1HA 1ULUA 3VHRA 3RSHA 4HFRA 3RKRA 3PHJA 3U3XA 4PVCA 2EF1A 3DZIA 4YCAA 5L45A 2Q45A 3JQEA 3V8BA 4CQMA 4ID9A 1BWSA 1NX6A 5KOIA 4MVJA 4I5DA 4WEQA 1ISIA 3A1NA 3TQHA 3QV1A 1PSDA 2HJRA 1XKQA 4TRRA 5BR7A 4GBJA 4PLWA 5AXBA 2NU8A 4R51A 3WIEA 3RASA 1Y5MA 3PTZA 4CLRA 2FRDA 1WP4A 1QRRA 3INRA 1MG0A 2O3UA 3VH1A 4MP8A 3NT2A 5A03A 1ZSNA 3DBHA 5L3ZA 4N7RA 3FSRA 1MUUA 4RVHA 2DUUA 3VZQA 3D4PA 5TRTA 5I7VA 3IDSA 3OMLA 2VOJA 5KVQA 2AG5A 1V3TA 2EWMA 1SEPA 3OIGA 5BNTA 2HU2A 2EP5A 1ZEMA 2IXBA 1J6UA 1GUZA 4LVUA 1A7KA 1NPTO 1DJNA 3WTBA 5A06A 3B70A 3L07A 1K3TA 3VH3A 2RIRA 4TVBA 5JCJA 1X7GA 4YRDA 4FBGA 3AI1A 3WLFA 3M1AA 1UR5A 4QT0A 3ZU5A 4BGUA 1N5DA 1E7WA 4ND3A 1HDZA 3NEPX 2BHLA 1Q0LA 2IZ1A 2CVQA 2BH9A 4HKTA 2G17A 3GRPA 3ZNNA 4AJ2A 5H83A 3DHYA 5A5FA 2Q1TA 1HE4A 1IE3A 4ND1A 1QV6A 4DGSA 3OJ0A 1W8DA 3G1UA 3SEFA 2NLOA 3ADPA 3ZI0A 2GDZA 4KUHA 1NNUA 2O3TA 4O1MA 1LC3A 5TSDA 4CPDA 1G0OA 4F45A 2PGJA 2W2KA 1WAMA 2JJYA 3RC9A 3ZU3A 4BO8A 5TX7A 4ESOA 1PZGA 3WYCA 1PJ4A 3U4HA 3GDGA 1ADGA 3ZWVA 1BW9A 4QSMA 2Q46A 4L0QA 4XKJA 1C14A 4CLEA 3WGIA 4XB1A 3WYBA 3RIHA 3GLQA 1F0YA 2DTXA 3GA0A 3KETA 1GR0A 3F1KA 4A03A 2Y67A 2W98A 3ROMA 4XIJA 3RBVA 1KERA 3FI9A 3NTRA 1R37A 2X9VA 4KMSA 3RUIA 2RBEA 1DJQA 1LDGA 5I9LA 1RJWA 4JP3A 5JAZA 1HDGO 1E1KA 3PWZA 2Q99A 4EBFA 4BVAA 2RAFA 1GZ3A 4BQRA 4CUZA 5I7FA 1ZK1A 1EQUA 1Q0HA 4RPHA 4BNJA 2GZ2A 1ZKMA 4NH4A 4R9RA 5JDIC 1U3VA 2ZJ1A 1I30A 1ZMOA 2GPTA 1H6AA 3H2SA 3GNSA 3HDYA 4CR6A 2TMDA 4E0BA 1PU2A 4NDNE 1EEHA 1QV7A 3PQEA 4F6CA 2QQ5A 3FPCA 2YJZA 2FSSA 1T4BA 1FDVA 2UUPA 5ENVA 3INTA 1C0KA 1FDWA 4BKQA 2VT2A 4AJHA 1CERA 1JW9B 5I7EA 5IDXA 3AK4A 5F5NA 2JL1A 3JQGB 3GPDG 5LDGA 3WR5A 3DBLA 1D1TA 4R9SA 3P7MA 3D5TA 3W6UA 2O7SA 2R2GA 4ZVVA 1GQYA 2DT5A 2OP0A 3K8ZA 2X0IA 3HE3A 1PJQA 1LRLA 1KVQA 3VPSA 4O0LA 2FMUA 1SO8A 2HK8A 3PGJA 2J8ZA 4WASA 4BNZA 4TRJA 2FPIA 2WM3A 3Q11A 4AJ1A 4C7KA 1WMBA 1FK8A 1WZIA 2FY8A 3G0OA 3LSYA 1CWUA 1P1KA 4FR5A 3OEYA 3DTTA 4B7XA 4NU6A 3ZDFA 4B4WA 3E9MA 3C24A 2G5CA 1EVJA 2Y05A 2C59A 4XB2A 3U4IA 3LU1A 2LDBA 4J0FA 3G79A 4E3ZA 2BFAA 1MGOA 4BO1A 3MOIA 4CMBA 3H2ZA 3DBLB 1LJ8A 4XEHA 4XQ9A 5G2OA 4A10A 3GR6A 4CMGA 2JD2A 4WUVA 1OOEA 4NBUA 2VYND 3M1LA 4PG8A 3VKUA 3EAGA 2UAGA 4I9UA 4EITA 3GK3A 3LT2A 5JXWA 1KOLA 2DBQA 4OHUA 5C3MA 3H4VA 2ZB4A 5IDQA 1YOVB 1PGOA 3RROA 5A4DA 3NDJA 3QRWA 2B4QA 2A92A 1H93A 1GFSA 3ONEA 2E48A 2VZ0A 4FFLA 3GF4A 5T64A 2R6JA 4PG6A 1LSOA 3WIDA 1YL6A 4L75A 3LF2A 3WGTA 3E1KA 4U7WA 4G81A 1TT5B 2VT3A 4W99A 1VRWA 1C3VA 1X1TA 1E77A 1P1FA 1EFLA 3E5RA 2OBNA 4AJJA 5BSEA 3BYZA 2FPGA 2VHVA 4TQGA 3TNLA 2O3SA 2GASA 3IMFA 3KYBA 3MTJA 4CM3A 5BQFA 5JFOA 2Z1NA 2YQ4A 1EBUA 4GMGA 1GQ2A 3IC5A 2WD7B 5EPOA 1PZHA 4CR8A 4BQPA 1LLCA 2NU9A 1Q7BA 2GNAA 3ROQA 4I8XA 4RL6A 1YOVA 3DEYX 2BFPA 3FN4A 1DFGA 3F4BA 2OXIA 4NFYA 4DIOA 3PZBA 4CM7A 3GNTA 1U3UA 5AXDA 6LDHA 3PHIA 1SNYA 3R3JA 1P31A 5TQVA 1AXEA 4J2OA 5DNAA 4CL8A 1ZJYA 1NVGA 3OFSA 4N54A 3VH4A 3WICA 2YZ7A 1Y81A 1ZSVA 2Q3EA 3V1YA 1X1EA 5KCZA 5LDHA 4RPKA 4RVUA 3PXXA 3H3JA 2W90A 1U2DA 3CZMA 4NR0A 2BGKA 3L77A 4Z9FA 4DXHA 4HY3A 3B20A 3G17A 3RC2A 4NK4A 1SOVA 5TC4A 4OIMA 4Z3DA 3PRJA 4Z9XA 3GDOA 1KETA 1QYVA 3C85A 3FWNA 2UV8A 3M2PA 4B3HA 1Q0QA 3DXFA 2FZEA 2HK7A 1NYTA 1NR1A 3GVXA 4IUYA 4N5NA 3HQ4O 2V65A 2V7PA 1O94A 2FHSA 1L1FA 3RUFA 4JGBA 1YXMA 2VUTA 1O0SA 1ISHA 1GD1O 3ICCA 5G4LA 4LVCA 5B1YA 5CG1A 1MFZA 3F5SA 4P22A 4GWGA 1MB4A 3AOEA 1M6HA 1NXQA 4XDZA 1I36A 2SCUA 1NQOA 4MINA 1EE9A 3ANMA 3D3WA 3JYNA 2O2YA 1KEWA 2XAAA 2FZWA 1GPJA 1O5IA 1ZEJA 4I5FA 5L4SA 4AJOA 3O8QB 3KB6A 3CMMA 3QJ5A 2ZQZA 4RQUA 1PX0A 2ZKLA 2X86A 4OKIA 3I9LA 5I8ZA 1GV0A 1ZSYA 3UICA 3WQRA 5I7SA 5ILGA 4RGBA 3ENNA 4Z9YA 4CV1A 3BMQB 4NMHA 5JE8A 2UVDA 1EK6A 1CRWG 1DB3A 3I4FA 4GPD1 1KS9A 4D3DA 1YL7A 4B3IA 1PJCA 1U8FO 2HMVA 4CJXA 2C7VA 5DDIP 1I3KA 3C1AA 3DO5A 3JQBC 3EGOA 1ORRA 2O7QA 2Q2WA 4UULA 1GDHA 5DP2A 5BT9A 5BNIA 3I5MA 3WSVA 2IYPA 2VYVD 4E2WA 3WLEA 1E7QA 4NI5A 3BMCA 5ER6A 1DC4A 3GN1A 4OSPA 4WOJA 3V2GA 2VZ8A 1TI7A 3ONDA 2VWPA 3WFIA 4IPTA 4AJPA 1PJ3A 3UH1A 3X2EA 1E1NA 3MCVA 3W8DA 4OO3A 4FOOA 3GH3A 2NACA 4IMPA 4TZKA 5CG2A 4MVJH 5G4KB 4Z0TA 3L6DA 2I3GA 3I9KA 1NAIA 2A9FA 2GN4A 4I9NA 2PA3A 1LTHR 3UAGA 3WWYA 4LK3A 4NJMA 5B12A 5EJ2A 3WX0A 4YQYA 4YR9A 5IN4A 4D3FA 1LU9A 2E37A 3TWOA 3DZGA 2Y0CA 3F47A 4BNYA 5IZ4A 1ISJA 1PGNA 1MA0A 2H6EA 3GHYA 3L6OO 4IDFA 3GFGA 1Y6JA 3JCZA 5CDSA 1O6ZA 1SZJG 4B4VA 4DWVA 1OAAA 4Z0HO 2OP1A 3JQ6A 4YB8A 1DLJA 5FFFA 1VJ1A 4GKVA 3UN1A 1HTBA 5FI3A 1BTOA 1JWBB 1KY5A 4AJEA 4U0JA 1DBVO 2P5UA 2AG8A 3EUWA 3E8XA 1EDOA 5JC1A 4K6CA 1I3MA 5JO9A 1JVBA 3KYCB 2IODA 4J16A 1BXZA 2JFGA 4I5EA 4PLYA 3MJ4A 2AW5A 1KEUA 1LLQA 4Q3EA 2I5PO 3CZRA 1XA0A 3D4NA 3EC7A 2VZ9A 4YAKA 2OHXA 1GZ4A 1WPQA 4ZRMA 3VVCA 4CM5A 2FOIA 2WSBA 3AY7A 4ZA2A 3I23A 1HL3A 2CMDA 3I83A 3T7CA 4KUEA 4X54A 4G2NA 3CPSA 4EYEA 2ZK7A 5CP8A 2QRJA 5DCWA 4DRYA 4NK5A 1YKFA 2I66A 1IHYA 3IP1A 1PZFA 1NFQA 2J6IA 2PD3A 1YS4A 3QP9A 5A3JA 4O63O 1VM6A 2I3AA 2PH3A 3PZRA 4GI2A 3ZV5A 4LMRA 4N5MA 1O89A 2GERA 1RKXA 1VE9A 1AHHA 1NQ5A 2EJVA 3KBOA 4XYGA 3WWZA 4CMEA 2DC1A 4IQ0A 2HMWA 2O2SA 3ABIA 1U28A 2O3RA 5BSFA 1C0PA 2Y1CA 3L4BA 3PYLA 5TT0A 3HG7A 2ZATA 1GEEA 4OSOA 5A9SA 3LC1O 2ILTA 2Q4EA 5C7IO 3GY0A 2RH4A 3EDMA 1P1JA 1H0KA 5F1OA 3LC7O 3JQ8B 1JWAB 1TT5A 1WLYA 4R1NA 1OZAA 2O4UX 1X14A 1SB9A 2P4HX 2HO5A 4D41A 3PQDA 4WEOA 1UZNA 1ZBQA 2ZQYA 4NZ9A 4DPMA 1W6UA 4PZEA 5I9NA 2PGDA 2YFQA 4PN3A 5C5IA 3RVDA 3E6AA 4ZRNA 1DRVA 1UXHA 1SC6A 4R4JA 4BNVA 1R0LA 3OEWA 2Q50A 4WKGA 3RJ9A 1E3JA 2YV3A 3SC6A 1F14A 1BVRA 3UCFA 1UXJA 1B8UA 1QG6A 4XWYA 4QX6A 1BVUA 1UDCA 4P4LA 4HADA 4BO2A 1I0ZA 3AWDA 2LDXA 2H1SA 4BKRA 4J9VA 1FMCA 1ZK3A 2X6TA 4J7CA 3N74A 4O5OA 2ZYAA 4J1SA 5HBRA 1DOHA 3OJFA 2EHDA 4L8VA 1HE2A 1QLHA 1U5AA 1ZK0A 3VZSA 4XYLA 1ZNQO 5HRUA 1H6BA 1WMAA 4RF3A 5JO0A 3ZNOA 3E9QA 4ALKA 4IXTA 5IFLA 1QSGA 4IIVA 3AY3A 1WDKA 2CDAA 3EY4A 1JVSA 1YB4A 3FNHA 3B6ZA 4YAGA 4GGPA 4E4YA 4YT2A 4WK6A 1G6KA 3MJVA 1SPXA 3U5TA 3JYQA 1DRWA 2JAPA 4CQLB 2OGUA 4YYZA 1MP0A 2NV6A 2NM0A 2GUGA 3EMKA 1T1SA 3KSDO 4WGGA 4IS3A 2FN7A 4KTVE 3ANNA 2XXJA 4LSWA 4XR9A 1EFKA 3W4IA 1JAXA 4Y6PA 4R41A 2YYYA 2B5VA 4BMNA 3NT4A 4RORA 3SJ7A 3FPLA 1LLDA 1N9GA 4K28A 5A9SB 5CPBA 1BDMA 2I9PA 1MX3A 3U62A 5HM8A 2C5AA 5KJFA 1QYWA 4WLOA 3MJTA 4EJMA 4M1QA 1I5RA 5DOVA 5I8WA 1UXGA 4GLLA 2Y68A 2OL4A 1DC5A 3VVBA 1IZ9A 4QECA 3PDJA 1DIHA 5HTOA 3RUAA 1I3LA 2Y1FA 3GOHA 3DOCA 4XIYA 1B16A 1QR6A 2PKRA 3WGQA 4ND4A 1E6WA 4MKXA 1R4MA 4ZICA 3HDJA 4OQZA 2FR1A 2Q49A 4Q39A 5DZSA 2FR8A 3O9ZA 4ZHSA 1ADFA 4AJKA 3PWSA 1W0CA 4RZIA 4W9NA 4RJTA 4IBOA 2PH5A 4GX0A 1Q7GA 2X8LA 2EEZA 4HFJA 4RVDA 1NQAO 4HP8A 3H9QA 4ZQHA 4BGIA 2WE8A 1B14A 4TRMA 4F6LA 1DIRA 3DBRB 3DDNA 3E48A 2AE2A 2C5EA 4PCVA 2GD1O 3ZW9A 5ILOA 2GZ1A 4Y98A 3TL2A 2EV9A 3PPIA 5ER9A 3HADA 1ISMA 1DIAA 3PJDA 5IDYA 1ZXLA 5T6BA 4R5MA 4CM4A 4CR7A 3RCBA 4CMEC 4GX1A 1QP8A 3O4RA 1HRDA 3HJAA 3PVZA 4GL4A 3L4BC 4E5KA 1XHLA 4BNFA 2PD6A 1ML3A 4ALLA 1CQIA 4YJHB 1LDYA 4CQMB 2ZYDA 3L0DA 1H9BA 2Z1MA 3KZVA 1LX6A 4Y6RA 3E9NA 4L73A 3SLGA 5TS3A 2VWHA 3BA1A 1LDBA 4ND5A 3ZV4A 1D7OA 1E7RA 2NTJA 2HMSA 3RU7A 4CLOA 1HKUA 2PKQO 4EUFA 3JQFC 4DPKA 1TVEA 3KXDA
chains in the Genus database with same CATH superfamily
4IZHA 2OG1A 1K7EB 4UHHA 1DXHA 2OPBA 4RDHA 3LVQE 1ZLYA 4V0RA 5ITWA 2AOTA 2Z57A 3JQ7A 5J4HA 2E4XA 1G20E 4P4TA 4AS3A 2O9JA 4KHPB 2X5JO 4NIMA 1R4NA 4MOWA 3K5IA 2H51A 1RQNA 1AS0A 1CDDA 1QGYA 2W22A 3GD7A 1OB5A 3EN0A 3WJ7A 2EIXA 4EUHA 2V6BA 1K2VN 1VKHA 3NYIA 4DQUA 4E1BA 5K7SA 2CLCX 1PTJA 1CQXA 1NRXA 3MT9A 1ODIA 1W34A 1ZUNB 4HNSA 5ECDA 5BN4A 4M1EA 4P98A 4BV9A 1RFGE 5ES3A 5KOYA 2XA1A 4GICA 2ECQA 1WCYA 4F8JA 1J5EB 2RDMA 5FR1A 4K86A 2RAUA 4EFNA 3I9FA 2QYTA 5TPZA 3L4SO 1A1SA 1OF1A 4L4YA 4MV4A 3QUQA 3PJGA 3FYSA 1A27A 1UQTA 4AT1A 5IABA 2LKCA 2JLCA 4UD6A 3HCCA 2IV7A 4HLNA 3EZ2A 3ZDQA 1VKZA 4B4UA 2EKQA 2BJWA 2C77A 3IAS1 2Q3JA 3ZE9A 4DC0A 5A4IS 3B7GA 1K4KA 1X1QA 1TO6A 3K0EA 2H31A 3RVPA 1GDDA 4CEJB 5K6AC 1S02A 1WMEA 1Y3DE 4IOLA 4MVJD 2P90A 4MCHA 5ALGA 1T2FA 3JYOA 1X19A 2XYPA 5I51A 4A0SA 3RSZA 1YDEA 1GPH1 1J20A 1MAHA 3VO1A 4ALNA 2CXQA 4YP5A 2X5KO 4PLPA 2WQ7A 2PTHA 1PTKA 3K9HA 3PFIA 1ACLA 2HJ9A 4P4NA 4Z4CA 5EXTA 2EVWX 2VNSA 5AM1A 1ESEA 1SUBA 4C7JA 3DFFA 1N5IA 5D84A 3E2IA 1VKRA 3NYQA 1YIOA 4ZQGA 4ZU3A 3L1UA 4NEHB 3S2ZA 4DARA 3NHJA 3ORFA 4HAWA 1KEVA 2I8CA 4WXYB 4FGSA 1Q14A 4D25A 1QRAA 4MQFB 4NH0A 4TMFA 5E1OA 4RPGA 2C4HA 2IXFA 2EC5A 3WYFA 3C3WA 4MQ4A 4CV2A 2VSQA 3FNFA 3K05A 1QYIA 2GI4A 1HDXA 1H8HD 4FZ3A 4HFMA 1UBMS 1V5EA 5E2IA 2HF7A 4BNHA 3UBTA 2VZLA 2D2IA 3RSSA 3AIOA 4BLOA 1CUWA 4WLFA 1E61A 1JS1X 4ZO9A 4YRCA 1H85A 2ZGVA 2X8WA 3HL0A 4R1TA 4YR7A 1E5XA 1JJVA 2DUWA 1ZK4A 3H6HA 4LZZA 4Q6WA 4KWHA 2WB2A 2G88A 3TGWA 2GCNA 3A6HA 5B3JA 3S1LA 3REGA 4R81A 1T26A 2H5LA 2VQ6A 4L4RA 4DL9A 1TD1A 4U5XA 1ML4A 4O3FA 4ENQA 5LUAA 5TF4A 2O8FB 1Z06A 2OWEA 1WVGA 3LQYA 4D9BA 3E5HA 5A3RA 3ULKA 3G2OA 1C50A 1DXQA 3GHHA 3IP5A 4UHCA 5KNBA 5L6MB 2GXAA 1KH2A 4FCCA 2VXCA 4GZ5A 2UDPA 4LQ4A 2EJWA 1ATZA 2P8JA 1M2JA 4H08A 1N6NA 4ARAA 4URXR 2CFTA 4GMDA 4PU0A 4ETWA 1T36B 4IHAA 2O3JA 3UMCA 2HCTA 3KOWA 2V7QA 4WY5A 2DQ4A 4BVEA 2DY0A 4BO7A 3HDQA 3ESDA 3UG6A 1VB5A 2I9KA 2GZ3A 2IYOA 5HDQA 1E3TA 4J91A 4QQ8A 3RARA 4F9EA 1W9HA 1YI1A 4HH0A 2GO1A 1Z6TA 1M2NA 2E18A 3GEMA 1U31A 4PYMA 1GQOA 2RI0A 3OOWA 5BOSB 1Y8QA 1WY5A 3UY4A 5LLSA 3MTIA 3VPHA 3KNZA 3ZDCA 1KK2A 4LSMA 5GIOE 3MGKA 4RVFA 5H0IA 2GCIA 4PG4A 2WE7A 2H11A 1Q2XA 4YRQA 3F2VA 2VATA 3X1XA 4ZDWA 3EQ8A 1KJJA 3A8TA 4HQKA 4AWXA 3K4HA 4YUZA 5IUJC 3U61B 3FNQA 5CHYA 4A0QA 1VKNA 1SAYA 4EF6A 1XPOA 5AJZA 3SCZA 3ZS8A 4TS3A 1WUHS 3ZI7A 1WP9A 2P65A 3O91A 3PF8A 4JVLA 3UFXA 5HKOA 1KVSA 3I12A 3MCZA 4MW5A 2C61A 1RHJA 4MJLA 3VSAA 2WWXA 4Y6LA 5M5BA 3GCDA 2FZKA 5JY6A 1AJEA 1TYCA 5CHEA 3FWZA 4HX2A 4E07A 3CHYA 5JRJA 4YAFA 2FX3A 4CMCA 4TLDA 3UF0A 3JVIA 3BB4A 2Q5FA 4HQ6A 1T5SA 3AHFA 4L8GA 3A4LA 3LA6A 1V6CA 1AGNA 2CVZA 5COBA 1KQNA 2GXSA 1VMDA 3AF0A 4EPYA 5E2BA 3WGLA 4RH0A 5DLPA 1IC6A 2VNAA 1OXXK 1A9QA 4OP1A 4H3KB 1BOFA 1R9JA 1J22A 1FUEA 1QONA 3U31A 1CPYA 1KTIA 1GDTA 2RE8A 1O1YA 1XNQB 3GAMA 1AXGA 5AJWA 1MVLA 4AIRA 4B8ZA 2P6RA 4KW7A 3BMNB 3QVGB 3PXDA 1UBTS 3FDZB 3OQHA 1G5IA 4UNIA 4ZCQA 4C7KA 3WNCA 3PEYA 3GUUA 2V3WA 3RW9A 4BC1A 2JIMA 4I3GA 4Q1EA 4XX1A 2W4QA 1L7DA 2D4HA 1GP2A 4ZO6A 3PRKE 5LBUA 3L6BA 5P21A 2WMOB 2XB4A 3SSOA 4EX7A 1YVUA 5F12A 3HY6A 1LY1A 2POQX 5DBFA 3TE7A 3UT5A 3NGMA 3SX0A 1NXTA 1EQ2A 5CH8A 2DFDA 3RRYA 5CDTA 2HAEA 3DV2A 4ZOQI 1GYPA 2HXYA 4OLBA 4XTCS 5JOQA 1QH8B 2C3YA 1DNPA 1L4HA 1LDNA 3V2IA 2JASA 4AF6A 5G3ZA 4XE5A 4C88A 3BTVA 1Q7RA 1WIWA 2H07A 3H2IA 3TOSA 3ZZNA 1YR2A 3ZHXA 1OTYA 2RGCA 1NFRA 2V7WA 2R1UA 3LC0A 3M3HA 1RI5A 2NX2A 1HUQA 3KVYA 5HZMA 1E92A 2HDHA 4O2AA 1I7QB 3M9LA 1RM5A 1NVDA 3R6GA 2AXQA 2KS6A 4XGQA 1QVZA 3MD9A 4YASA 3RVKA 2Y2UA 4E21A 5B2EA 2F9MA 1B0UA 3UXEA 3OQMA 3IDAA 4M98A 4DG9A 1ZBDA 1IWOA 1LRJA 2BSXA 3C3YA 3I04A 3QMWA 3G5TA 3RLFA 4KO4S 2VDVE 2V6MA 1GAXA 2ZAGA 1AKWA 5IAKA 1OYOA 2WUFA 2YOFA 4ZQCB 3D1VA 2D7JA 3R7FA 3H7AA 3GFRA 1G9XA 1U0TA 2X0RA 4NOKA 2EGUA 1ZD8A 4EL0A 1BGXT 1JE1A 1QVAA 1R0WA 1CLUA 2HK9A 3CMCO 2AFRA 3S2FA 3VTZA 3Q8XB 4GLBA 3RK4A 3ZUGA 4DRZA 4E14A 4EPWA 4PYJA 1J2EA 2R7LA 1T3ZA 1QO0A 3D0KA 4IFIA 5HYVA 5EIXA 3DBRA 4IDGA 1P7YA 1GV1A 3V1TC 3U09A 3DL0A 2VTBB 4TKMA 2R00A 3NEYA 4ID3A 4HNVA 2QSJA 2ZIZA 3QW2A 4HDCA 2A0XA 2AOUB 4DJ5X 1C1YA 3DG9A 4V1CB 5KQSA 3TUZC 1A4UA 1KEZA 3CRZA 4W1RA 2X1LA 1E1MA 3FVRA 4FHCA 1U2DC 2WYVA 1KO7A 3B9QA 3G2LA 3QG1A 5IJ9A 1VGQA 2XMCA 3FDIA 4NHOA 1OI3A 3K09A 3KZMA 4CTMA 3IVXA 1XRSB 4LE2A 2JCGA 1SA0A 1U2EA 2MYUA 2ZSUA 4Q3KA 1E99A 4KQ6A 1E9CA 1BFDA 1ONOA 2EIHA 2XIJA 5KTMA 1XJ5A 1B8OA 1K98A 2H1WA 1L9XA 1T6YA 2HSWA 3FTNA 4EUSA 4JBIA 1AD2A 3HXQA 2QRHA 3FSEA 1CR4A 2G7ZA 3UUGA 4XFJA 3WZLA 1E98A 4QAQA 4KPUB 4ECAA 4XXHA 4CFZA 2H2AA 3IUPA 4ROSA 1FP4A 3OZDA 1UJCA 2N42A 2OB2A 2H57A 1T8UA 1BA2A 4KG7A 4BNGA 1VRCA 4W7IA 3SYTA 2OV6A 4QFBA 3P52A 4INAA 4AJ4A 4YJGA 2WFMA 4QXPA 3PXGA 1DRUA 4B3XA 1R6BX 1UBUS 5G1PA 1HXHA 1Z62A 4ROTA 3ESYA 1Z15A 3U3JA 4RD3A 3DMDA 3PQ3A 1XVAA 4FJ2A 4MP6A 4NYMQ 1A95A 1XYYA 1GRVA 1ZQ9A 1GQQA 4EOGA 3NM5A 3NH9A 2PBFA 1M1XB 1ONBA 2GPWA 4LXTA 5F2OA 4KO3S 1VYUA 1G7TA 4OK3A 1OU0A 3MLEA 4TWBA 5K51A 3DAYA 3AIKA 1KA9H 4P82A 3BRCA 4S2UA 3FPEA 3FSJX 3QIVA 4P86A 1SOUA 1XRNA 1Z2CA 1NXPA 1GCIA 2P9BA 2HZ7A 1PO7A 2YRWA 3HNRA 4II7A 4PC1A 1FSFA 5IBQA 4KC0A 2EBFX 1TF7A 2OHIA 5DEIA 4EZIA 2DTDA 3OBBA 4MV7A 1HE8B 1QYCA 4I9HA 4Q01A 4WFKA 1TCBA 1XF9A 5B2FA 3W3AA 1NR7A 4GOKA 1FUIA 3NOVA 5C81A 3Q3HA 1IUKA 2DPYA 2VEOA 2YW9A 4AYWA 1GAEO 2QY9A 2CUKA 2OAGA 4RVCA 5EJ7A 4H4EA 4UNPA 2NAPA 4EJSB 3BBPA 4YJDA 3A7EA 4DDTA 2NU7A 2LGJA 3MUNA 2Q3DA 3EH2A 1OSNA 2GEKA 3N39C 2QVLA 3KR0A 3QBTA 3ZCXA 4D6XA 5CA0B 4KR7A 1T8SA 2AQIA 1UXKA 2N75A 4K9PA 1AQIA 1I8TA 1N7JA 1XOIA 4ZZ2A 4D6YA 3IXMA 2ZB2A 2W70A 2XMBA 1MRZA 5L7YA 3ANSA 1U9JA 3DWIA 1Q12A 4EG1A 2J9RA 2AWOA 4EO4A 1TIPA 1M8JA 1U3GA 4A5OA 1GZ5A 4DOMA 4PC3A 1KKUA 2OD9A 5K8TA 1U2QA 3O3MB 2N9UA 2P69A 4C0KA 3OQ6A 1G6Q1 5EESA 4TMYA 4I46A 2RB4A 3LUDA 1HEUA 1LV8A 1G8MA 4E2XA 2RGDA 5LP6F 1W1IA 1EXDA 2C0CA 3BIJA 5AXCA 4B48A 3K8YA 3MTDA 1GL7A 3N86A 2FPPB 2E5LB 5LQJA 4F2PA 2H54A 5DYIA 1NGSA 3ZWOA 7ADHA 3VAAA 1GL9B 1XAIA 3Q15C 5JXHA 5DM70 2DHCA 1VE1A 2BM0A 2UUOA 2DQYA 5ESWA 3HJRA 2ZYGA 3WADA 4UTNA 4MDYA 3HZZA 3KHTA 2QTRA 4MCIA 5F51A 4F3RA 3HR4A 4AECA 1SKYB 3WLLA 3U7IA 3EW9A 5B37A 2QQFA 4BBZA 4PZZA 5CB0A 2NZ2A 2ID4A 4C43A 3UMMA 1W4AA 2XBUA 1YZYA 2GZSA 1F38A 3D02A 4K2HA 4QODA 1XRRA 2IT1A 3PFHA 4PO3X 3FFAA 5LBTA 2QQGA 1JLLB 3S4YA 3V46A 1XDGA 2ZPAA 3KOXA 2VHEA 2WTNA 1UWCA 1BU8A 2BJHA 2Z2JA 3KOYA 3HCNA 1BA3A 2NSDA 3FHJA 2IOFA 4YT5A 1KVUA 5FWXB 1MV8A 1XYGA 4HLUA 1RTTA 4RA9A 1OYWA 4CVNA 2BMWA 4AS1A 3GGSA 1QDEA 2PT5A 1JVNA 2ZT7A 3KP1A 2ESRA 1IPFA 1HFEL 3DSRA 4I1RA 5C34B 4YIKA 3TMAA 1DBQA 2JJ1A 1FS4A 3QH4A 3AM3A 4FXOA 4WZAA 4I4TB 4QGFA 4DLBA 4LC9A 3KZOA 3K9CA 4BKUA 3AR9A 4TLBA 5IAAA 2R6CA 3AT1A 1KFBB 4WQMA 5LXTF 3Q98A 4GXTA 1S5PA 5JMPA 1VC2A 3NTOA 1RQ7A 4V24A 4OB7A 3PJRA 1YUNA 2H3HA 5LZ7A 1EZ1A 3MELA 2JFOA 4P2BA 3VR6H 3VJKA 4F38A 4V02A 1SG0A 4GSKA 1NHGA 1E9RA 3MWEA 5GIPE 3OQJA 3T7RA 4WESB 3OJLA 4FOSA 2GESA 4D96A 3A26A 4UEJA 2CHUA 2FK8A 4TVKA 3U7QA 1JLSA 1Y37A 1R0SA 2R7NA 2O3QA 1NTRA 1TECE 3PGMA 4FHDA 4GVLA 4MDHA 1N2JA 4MVJM 4IG9A 4C01A 1J25A 1M2OA 2OGZA 4G5HA 2HB6A 4L08A 4O4IA 5DYYA 5IASA 1KSFX 2XYHA 3FWHA 3J7TA 3NASA 3VR5H 2ZWIA 4F4UA 1L8OA 3LK7A 1N4DA 1UDAA 4DMHA 1GN9A 5JFGA 3B36A 4YMIA 2GZDA 5DO9A 3GT0A 5IX8A 4ZT7A 1T25A 1UBGA 3HSKA 5F77A 4U0KA 3EQ7A 1GUBA 5F3WB 1XQ1A 4TM8A 2RFLA 4QGAA 2DMRA 5CDHA 2I7XA 1NP3A 4UUQA 2XCQA 5B64A 3JYHA 3MK31 3M4JA 3SIWA 3QY9A 3ILXA 3UHPA 2AFHA 5CCEA 1DP4A 4TL9A 4I1YA 3GPCA 2ERCA 4KV9A 4QG3A 2WJ6A 4LTDA 1ZH8A 3M4NA 1LJLA 2WJIA 3MBKA 1LSUA 4H4CA 5IM5A 1SBHA 5DB4A 1R0YA 1NQTA 1JG3A 3DVLA 4B40A 1BMDA 2MCFA 1K89A 5KYYB 1ILWA 1CHNA 4JR0A 1RKVA 2WFZA 2RHRA 4BVFA 5J2UA 2HWUA 4LMPA 3H11A 4D9GA 2YV2A 3C6BA 3C45A 3EWNA 4BJHB 1SPBS 1V11B 1RWMA 2QG9A 4MS3B 1SKBA 3C8ZA 4TTSA 4BQSA 4LGVA 1EMDA 2WNHA 4EW3A 5K0ZA 3EEBA 1UZAA 2NNLD 3LTEA 5CA1A 3LUJA 1XXHE 1BXKA 2ODWA 5THKA 3WLRA 5ITVA 4D8UA 3QWIA 1PLJA 1I7DA 1USWA 4CM8B 1E5QA 2BI4A 2VP9A 3N1UA 4FD3A 4Q21A 3LHDA 2DECA 1BXGB 2FRDC 3BVPA 4EG6A 3LY9A 4DMRA 5C51B 3VMMA 2LD4A 1SULA 3D4LA 3TQQA 1RJGA 1X86B 3B51X 3S8MA 3SE0A 4TKLA 4D56A 5GONF 4MVCA 5HQJA 3UMYA 1X0VA 4S2EA 4C4TA 2AC7A 5D3MA 3HHPA 5IEJA 2OM6A 1Z45A 3L6EA 3AX6A 2PBRA 2FMXA 3UENA 4GKBA 4A8PA 4URZR 5HZKA 2QROA 4JEMA 3R9XB 4Q7JB 3EVBA 1NSTA 4B6QA 2NV0A 3O1IC 4BFLA 1DXOA 1IXSB 1XTRA 1KBOA 2OLKA 1IHDA 2Y9MB 3FNBA 4F2HA 5CFRA 2MSDB 2GM3A 4CUKA 2A3RA 4ZOCA 1YB6A 3OFND 2C96A 1XK6A 4IDDA 3P5SA 4QICA 2VPIA 1AQYA 5CB4F 5BUZA 4HMQA 3M5PA 3L41A 5CBPB 3ITDA 3O3OB 4R2WA 3RBAA 3H16A 1BRMA 1TKBA 4IHKA 3IP9A 5LZ5A 2P4QA 5L7WA 1QF7A 1L4YA 2PT7A 4FE3A 3MWGA 3LJKA 1KOGA 1IPEA 1NBHA 4ZZ0A 4E11A 1FMTA 1QK4A 1QOPB 2NYUA 4MVYA 5KYWB 3WG9A 3DQPA 4A4DA 1XZDA 3DZFA 4P0PB 2OV3A 5FBWB 3T3OA 1FVOA 5ECGC 3MWEB 2PS1A 4M87A 3LO5A 2NO7A 4KE6A 5IK2A 4FQ8A 3Q4GA 4J0CA 4OHYA 3TOZA 1CJKC 1MT3A 2CXOA 1L5VA 1RPNA 2IUEA 5ALDA 2YJTD 4A8JC 4KAXA 1HOXA 2QTFA 3NC0C 2OWDA 1EFRA 1X7ZA 2WHPA 3AHHA 3MQFA 3GGJA 2I76A 1N7IA 3RADC 1YUBA 3OZCA 1CUCA 3HCOA 5I9SA 4B4DA 1KZYC 2ZJZA 1CEYA 3PIIA 1J8MF 1QORA 3GP5A 4C06A 4ZMBA 2JBAA 1JBQA 2ZAIA 1CUVA 3W90A 2SNIE 3ON5A 4HRYA 1BDIA 1GUYA 3ENWA 3L7IA 2FW6A 1UOEA 5F1KA 2WAXA 2RH9B 2M2IA 2PA0A 1ZM4A 3ITKA 4I0WB 3TLGA 3TO5A 4AY2A 1KXZA 2QLBA 1NN1A 4P0TA 2AXPA 2H7VA 3F9IA 5LOVF 1MHPA 5A2GA 4LFAB 1DPGA 1YZVA 4KVZA 3K2EA 3D1JA 5LQDA 3RAEC 2D0DA 4JI8B 4P38A 4RNDB 3ASVA 4RYLA 4EVSA 4EGFA 5TR9A 5KWEA 4Z1MD 1OW3B 3PTAA 3K92A 1X2BA 1AQLA 1VIMA 2B5WA 2YHBA 3BCUA 3IT3A 4HDSA 1NLZA 2BEVA 1MB3A 1WXDA 3GJ6A 4OLJA 4O08A 3OQBA 2JJQA 3RRJA 4QSHA 1QIHA 1FVFA 2ODTX 3OBIA 4BP9A 5IXJA 1FLAA 4M8SA 2BGMA 1E7YA 1TVKB 2EERA 4KIWA 5LKAA 1JT2A 1ULTA 1CXZA 5FIUA 3ILVA 3HEMA 5U4QA 4HNHA 2ZJ3A 1FTNA 1W5EA 1XP5A 1SCKA 1P1RA 1XCMA 3ZY4A 4ILEA 2O05A 1EFVB 3U7RA 3TLAA 3I9MA 1Y6ZA 4RH1A 5EE0A 5LA6F 3AY0A 4KLRA 5K0BA 2JFYA 3MXOA 4OLAA 4NV1A 4ZAXA 4AY3A 3JWJA 1TTTA 1V3VA 3HYTA 2H1RA 1G21A 3CVYA 2H3EA 5FWNA 4ZN6A 3KTOA 2RK3A 3NX4A 4Q9NA 3S0JA 3OP1A 4P36A 1BFKA 4NTZA 1BX1A 4HEJA 4AP6A 4EHIA 3AWIA 1J0CA 4UCXA 4RTQA 1RTKA 2BF4A 2NWQA 3FVWA 5I45A 5I4IA 1X3LA 4ASUD 2OXTA 5HP4A 4NBSA 1IHXA 1X70A 2IS4A 3OTGA 1PT5A 1JG6A 2ZJ5A 1NMSA 1PSZA 1VG8A 3DZBA 3OZRA 3ORYA 3DQZA 4O4JB 5E4FA 1M34E 4JGGA 1H1LA 2GGSA 2OILA 3U7JA 3RM3A 5KYNA 2YWJA 4JWKA 4EVRA 3HXOA 4BRWA 5HRCA 3AI3A 2XEXA 1AKQA 4UE3S 2ZYVX 2PUJA 3O83A 4YHHB 2G4CA 3BB3A 2EBHX 4YAOA 2I33A 2B7BA 2EGGA 3I42A 3U16A 2P3OA 4A6DA 1L8AA 3CN7A 1SZCA 4YBZA 4G0WA 4M7RA 5T7BA 4CT0A 2CVFA 5IJAA 4IIJA 3ZWCA 2FSHA 4R8KA 5EGNA 1W49A 4RV4A 1YZUA 1W59A 3PD7A 4BUCA 3T7EA 3LYHA 4G4SO 4KFRA 3E9CA 3H13A 4H17A 2FPLA 2I6FA 2G28A 1VPTA 2WV9A 3VRHA 5CH3A 2QL7A 3LC2O 1U2TA 2QY6A 1KJ9A 3OJWA 3P2IA 3EJ6A 4WCFC 1WKBA 2Z9BA 4A0HA 2R6AA 2Q0SA 2ACVA 3KQYA 1MQAA 3EGWA 3LCCA 4KLNA 4G97A 4MW7A 5AW4A 1Z2PX 4X94A 5HUQA 3PKIA 1EFCA 4HN2A 4NICA 2KYRA 3U44B 5FTWA 3HO1A 2R00C 4ATNA 1WZNA 2HRCA 4ZHQA 3OLXA 2YASA 2IX9A 1XLUA 3ZWDA 4XWKA 4CIAA 4DR5B 1KJZA 4CV0A 1XXLA 3H19A 2R6R1 4QL3A 2XE6A 1L3CA 1TVKA 2A0WA 4P6VF 2HRZA 1PV2A 3RPEA 4XGNA 4YRSA 4B3MB 4QIHA 3C16C 1DXYA 4PVDA 2PFKA 4BNXA 1J1IA 1QYDA 1F1BA 4P7JA 4YJ3B 2VSFA 2Q2NA 1GN8A 1TVMA 1YA4A 3QVXA 4JQSA 1N0UA 3EZ9A 5HF8A 5DF1A 3K09C 4LNHA 3RSQA 1RAGA 5T41A 1VHWA 5BVGB 1ZNWA 4RUKA 4PRYA 4GP6A 4HJXA 4BMOB 5CNMA 1XZKA 1DTEA 5FBKA 1M1YA 5JCJD 2JD0A 2WRZA 1Y3HA 2B20A 3PHGA 5IG2A 5EFZA 2XIQA 2VYCA 1DCTA 4W1PA 2O06A 4BDSA 3OQPA 2C3UA 5JD6A 3I6QA 4DBVO 5JU6A 3CBGA 5EJIA 3UWSA 2NU6B 1PCXA 3AJDA 1E3SA 3IUJA 4V1CA 1C1DA 3I6MA 4FS8A 1AK9A 1QTIA 2A86A 3QK7A 4HYEA 1LVUA 5DP1A 3SR3A 4AY5A 4C7OA 5HEKA 1W9MA 4R7GA 1AHIA 3HR8A 4ZKEA 2ODPA 2DSNA 3GB9A 4UZSA 3QX3A 2W2QA 2Z5FA 5HCIA 2JJ2D 3GP8A 2D5LA 1SB8A 3MTBA 3BWMA 4UW9A 3IAXA 3AEQA 3WNBA 3PPXA 2II6A 1RLOA 1MG5A 2QUBA 4S1NA 4ZEXA 1I6KA 1OA1A 2QIOA 3RS3A 1K9SA 3MMXA 1J4AA 5JR3A 1N2CE 3Q10A 4OHFA 4ANFA 3H9JA 2ETXA 4EW1A 1Q0UA 2ERXA 5FD8A 1OI4A 5CYOA 3HM9A 1TQHA 3A1TA 2JIPA 1RI2A 1PR9A 3GVHA 4G6ZA 1U3TA 3VPFA 3E23A 1J42A 4FSHA 4I08A 2VOEA 4B09A 3PYMA 3IEUA 4H7DA 4HEQA 4NYMR 5KHAA 1EIWA 3OC6A 1SCUA 4RFSA 3OESA 5E7QA 1SC1A 4CQJA 1JIVA 2PT9A 2ZRGA 4DUPA 3ZQUA 2XNDA 1A4IA 2GJ4A 4YK7A 4BMYA 3RIMA 3KEFA 3HCWA 1KQPA 4RIFA 5ALTA 2R6DA 3V4OA 5JBNA 5AOAA 4Q9DA 2XGOA 2ATEA 5CYGA 2YHIB 4F4JA 3ZGZA 2QZPA 3KB2A 4GYJA 2WWHA 3RYCB 1FVHA 2GPYA 1ZICA 4JJKA 4J07A 4M76B 3HO6A 4CL0A 2RGUA 1DKOA 2PU5A 1DS6A 2OFOA 2QKYA 4YCNA 2VT6A 2Q7DA 4KR0A 5CT9A 3WZMA 3ZV7A 2EHJA 3CRRA 3BMQA 5LXTA 1E18A 2BL4A 4INJA 5D3MB 4UVDA 1NPDA 5HKKA 2Q41A 4JV5B 3A4VA 4PQFA 3LUHA 2D59A 2FWRA 4FYMA 3UXYA 3PX7A 1RPAA 1R18A 4MXDA 3DUFA 2J5XA 3BCSA 3P9CA 4CMHA 5GQSA 1RM4A 4DUGA 2A7XA 4GLJA 1Y8AA 4G0XA 1K7CA 4IVPA 1H2WA 3DCJA 4TXJA 1CNEA 3IAS6 3RHSA 1CKEA 3HV0A 1G8YA 4RHTA 3VR5D 3DVRX 1C80A 3KDAA 2TECE 3ZHBA 3ZIUA 1FP4B 1WOMA 4CLOB 5LDDC 3I9JA 1DO8A 1EQAA 4UUOA 2C5GA 1BN7A 1DKPA 2OBYA 4UMFA 2WA2A 3LDHA 4B32A 3GLIE 2OCYC 3DTVD 4Y7CA 4Y2SA 2AA3A 2ISSD 3OKAA 1GPDG 3KU4A 5L9AA 3I01A 1MA3A 3G8BA 1E4EB 3KZ1E 2RKBA 4O6VA 5FWDA 5K3BA 1CIJA 1JIQA 1XCBA 3JS5A 3NDRA 2VP5A 1B2LA 3GUZA 3A1WA 4KDFA 5DNWA 5HZGA 3RG2A 2X1HA 1RYZA 4HO1X 1MNQA 1U5BB 3T06B 3U4DA 1YZNA 3QBEA 1DV2A 3DMRA 3K6SB 10MHA 2O1WA 2IPNA 2ZU6A 3EPRA 3GYBA 1Y6GA 1KS2A 1D8TA 4E2ZA 5FV4A 3HBLA 4XQGA 2P9GA 1EUCB 1OAOC 2BI8A 2V6FA 4C3ZA 2X15A 3V4FA 3G0BA 1K8ZB 3FWPA 1VHLA 1KEEB 2ZRCA 3BXFA 3N2GB 3PFWO 4WKOA 4BQOA 3IBFA 9GPBA 3ADDA 1VP9A 3LWBA 2R7AA 2VHQA 2FPKA 1E9EA 5DE3A 3ASUA 5IUNC 3KOZA 1YJAA 5KZMB 4XD7A 3O1LA 4YDHB 3FETA 4YACA 5IMSA 2HI0A 3Q0EA 3GLUA 4ZI2A 2ZROA 4QVGA 1CDEA 1UDWA 4QT4A 3ROXA 3T5AA 3AEYA 4KQXA 3IJPA 1UEIA 1N9KA 3KSZO 3RKSA 1A9SA 3F5MA 2CW5A 4N8SA 4JP2A 4WI1A 3I0ZA 1PWEA 3NM4A 2C2OA 1XLVA 4TL8A 2KI5A 1ZUHA 3Q7PA 4CKZA 1X8LA 3HKEB 2E9SA 1UZLA 2IVFA 2BTQB 3HKCA 1PGJA 2H0RA 1DMSA 3AUSA 1NF9A 4J1NA 3LBAA 4ADSG 1REQB 2GJAA 4L9AA 4LHEA 5JYDA 4BJ3A 4MUYA 1RVDA 2Z43A 4QULA 5KOHB 2EJUA 2PRSA 3GEDA 4KODA 5EE1A 5KNBD 1QS0B 2P9QA 1YK1A 4MUMA 1Q77A 3FZNA 2WM8A 1L9KA 4PW0A 4QYIB 1NUHA 4GRIA 2BY4A 4YWJA 3ZVRA 4QQNA 4RVSA 2CKDA 5KX5A 4L8YA 4EYSA 1I1OA 3IOEA 5DCWA 4ZVSA 2I2CA 1LH0A 2ZCVA 4IDEA 2YHIA 5DM0A 2IIVA 2FPUA 2QMZA 3LDUA 3EUEA 2B7CA 1ULBA 5ECYA 1Y8ZA 3QYFA 3JAKB 4UCFA 2GKSA 3GGGA 2J4FA 3QU2A 5AHWA 3UXMA 3ZNQA 3WAJA 1I4TD 2HYDA 3L8MA 1DO2A 2QEQA 4NKRA 4ZDJA 5EVJA 2LZ0A 2XCSB 4S35A 5E4YA 3PHHA 3ZGLA 4AY6A 1H9CA 2G1JA 2AMFA 4FLFA 4LAFA 4YH1A 4H7PA 2ZBVA 5CU7A 2LIPA 2OB1A 2VUSA 3JARB 2IKQA 4H18A 4L22A 3TW8A 4JITA 121PA 4EHNA 3G2QA 4NHEA 2NSLA 2XUIA 3CF2A 4RWEA 2SKCA 3QKSA 1C29B 1ZLXA 5DTEA 5JTTA 1FUUA 1ZO8A 1LEHA 2OG2A 3HWWA 3VMFA 5U9CA 1V41E 4N4AA 2GBPA 3ZCQA 4K3VA 3QVLA 5K2MA 2D2FA 2ZVJA 3DHEA 4G5SA 2OOKA 3QQPA 1H69A 3CZ4A 2AHRA 4R40A 4RGYA 4WJKB 4HDOB 2Q5HA 3EOBI 3I8OA 3SOZA 3JQ9C 5JZ9A 2FMHA 1LX7A 3LAWA 2V1XA 4HGRA 4L57A 1QZXA 1BE1A 3EZ6A 1SBNE 2VPTA 4KYTA 4OAPA 5E6SB 4FLEA 5EEHA 2VDJA 4M1TA 2YQZA 3LRPA 1NQVA 4BVKA 1SOWA 2YUTA 1YJBA 5CEEA 4FILA 1Z47A 2XITA 1O58A 1W0JA 3W5BA 1Y48E 4BFSA 5JQGF 1RAHA 1L5HA 2O20A 2G76A 4RZ2A 3FCOA 3RFVA 5LMUB 5DULA 5TMEA 4PIMA 3NBAA 1T2AA 1UJ6A 4NAVA 4DUGD 3EZYA 1OXMA 1SHLA 2JVKA 1IVSA 1ZAYA 1PL0A 4YO8A 3ZGXA 1LSSA 3IIJA 4IKOA 5D3QA 3HC7A 4KNWA 4NNJA 4QTUB 2C1XA 1TEXA 1W44A 1Y8QB 4UU8A 1Y4ZA 4MZXA 3U4CA 2NG1A 1DKUA 4HLCA 4I4LA 3MQ2A 1I4EB 4HZGA 4DKJA 3DTVA 1MEEA 3EULA 3R3UA 4ALIA 5K45A 2A9RA 5BN4B 1JN0A 7ABPA 4O2RA 7MDHA 5IP5A 2ADMA 2J9GA 1RHQA 2HHJA 4Q24A 3W6ZA 2OBFA 2Y1DA 3QLUC 3W8EA 3WB1A 4KQKA 3ZHUA 3CLUD 5JASA 4HCJA 1KI3A 4EEZA 5JS8A 2ILVA 3OSUA 2IKSA 2MWMA 3VU0A 5DT2A 2AKYA 1GCOA 3QVVA 4RS4A 5DSTA 4YPOA 5CEJA 1E1QD 3FVVA 4BB0A 3GO4A 1BC5A 1JDVA 4OHKA 3T3EA 4ZVOA 5I4KA 1DDOA 1R8XA 2PMKA 1W19A 4G0MA 3NHUA 4X90A 1UJMA 4DNXA 1UPAA 5DHRA 4M9RA 2X76A 3R9KA 1JQKA 2G67A 1DG9A 2QMUA 2R25B 3KJNA 3R5HA 5A3VA 1FDRA 3ZJ5A 3LPMA 4HDQB 1ZRSA 5L3VA 2QP3A 3N3BC 3DE0X 4IYRA 2H2HA 4ZCIA 2I7TA 4JBGA 2PQ0A 5KYWA 4GRAA 5AKZA 4MRMA 4RV9A 1THGA 2XKAA 1L3IA 2WJHA 2IXAA 3FVTA 1VQ1A 4XCQA 2XXAB 4XR4A 3HO8A 1UJ5A 4XD7D 4W8GA 2OFPA 4ITUA 2VQDA 2PJDA 3AG5A 3FJYA 3GZ4A 4KIUA 5DN9A 5JMTA 2FR8C 3QFSA 4GYKA 2BFEB 5LU8A 4NCXA 3VJMA 2FUKA 4OGGA 2QSZA 4OFZA 3SDZA 3UYKA 1QE3A 3AERB 4RO0A 5AYVA 4EUEA 3MD0A 4X1YA 1HLDA 4HWKA 1RVV1 3RGGA 3SC2B 3U9LA 3RE1A 1IUNA 1LB1B 1QO0D 3TW0A 3ZDDA 4O2BF 5FPHA 1Z12A 3IJRA 4ZCMA 2R0QC 2X5OA 4QTXA 1P45A 5E6RA 2NUTA 3ZWXA 1GY8A 1GYRA 4KSBA 5CVJA 3ANLA 4CMAA 3TZKA 5E6RB 5BQXA 1ZD1A 1UIMA 1RYFA 4KIJA 3TZ6A 3FHTA 4QU0A 2PUTA 2VDLB 1I32A 4G5FA 1F8FA 1AHNA 5CFMA 1N2IA 5LP6C 4MQ5A 2CFCA 4J76A 3WGYA 3ZCPA 3DFMA 4JD5A 4F92B 3NFYA 1PWXA 1JEQA 2QG4A 2BFCA 4OJYA 1D2GA 4L28A 3EDQA 4WCFB 2XUQA 5HJ2A 5BSTA 3WZ2A 1RCFA 4CIVA 1T4DA 4AU1A 3CX6A 5JQGB 2R9VA 5BYJA 1XO1A 3GJTA 3ZWAA 5MGBA 3QF7A 7GPBA 1L7EA 3BH7A 2REQA 3ONVA 3ZY5A 2P7HA 3ER9A 3TLEA 2FSFA 3VO8A 5CEFA 2GPSA 1Y9JA 4LTMA 5EJFA 2ZXUA 1P7ZA 5JPIA 3M81A 4LWOA 3NV7A 4LI3X 1JJBA 3RHZA 2X1VA 2ZJYA 1Q7CA 1VB3A 2I54A 3MJSA 3R0QA 4L1KA 4L5IA 4PFJA 1FZTA 4B2IA 3RR2A 4H9GA 5DHFA 3PE6A 4DIBA 2YVAA 1PUIA 4BLRA 2IBTA 1JIJA 2ZQ5A 1L1RA 2AEMA 3LKZA 4J7AA 3ZWPA 1A7JA 5A4MS 2CHVA 1V5IA 1G2IA 1DC6A 1VJ5A 4TSKA 3VZRA 1EB8A 5IS2A 1L5FA 4OTZA 5JISA 1Y5RA 5JZOA 2DR2A 1U1FA 2J31A 2K2WA 2Z2IA 4JC4A 3LGAA 1BX0A 1V1RB 4KYVA 5BV0A 4KYUA 1UFQA 5AHXA 5F21A 3VYTB 1DBRA 3UKOA 1ZW1A 3LQQA 2ZSDA 3RTGA 1FJXA 2XB2A 4QFDA 3A4NA 4ZOBA 3TM5A 1NY5A 1C8KA 4LF4B 3DM9B 3LX4A 1C30A 3NJ4A 4FQ5A 2J3DA 3WGNA 5J47A 1T0IA 3RAPR 4IIEA 2IC5A 4J2HA 2ZSEA 3KAJA 1OZHA 4ZYUA 4CF5A 3QE0A 1QIMA 2VA9A 3W9UA 4KWIA 4LXIA 1QIGA 4DJAA 2QHXA 1V9CA 2P62A 1ES9A 2J48A 2OD2A 3AVXA 4DR6B 2D1QA 2P6OA 1TX4B 2A1UB 3PJEA 4WESA 2LKDA 4ZOLA 4U7TB 3ZCUA 2WDPA 5T67A 2EX4A 1P0PA 1GNRA 3A58B 1DAOA 2XUOA 5JLAA 1N7GA 4EM6A 1PL6A 1COWA 1AURA 3CR8A 3ABSB 3FLMA 4U2FA 4YUXA 4GUDA 3RJ5A 4HX5A 3QPUA 2OV2A 1YQQA 1KKMA 2GBCA 4B7ZA 1YONA 1RM0A 1ZUD1 3D54D 2WHXA 3GCGA 3GROA 1VG9B 3GZNA 4GZ6A 4PONA 3I62A 3RIYA 3DEFA 1G2PA 1SUDA 3JD2A 4O2AB 1DLIA 2PKYX 3EYAA 5K6AA 3PB3A 4A92A 1EDZA 1SK8A 4H35A 4MWBA 3PDIA 5CLLA 2ZRLA 5D6NA 3ZLJA 1H3EA 2C03A 4WZAB 1L5QA 1WMSA 4PGGA 4OUDA 5T6MA 3P2OA 4QLOA 4R2JA 4RU1A 5DBIA 2OXEA 5GP1A 1QGUA 3M83A 1ZH0A 1GUDA 4IZIA 4B43A 5JAMA 2AW3A 4DWJA 5BY2A 4F7WA 5LVAA 4Q4CA 2BTQA 1KO4A 3E4DA 3F2IA 3W5IA 4L5AA 4D9MA 2BHSA 4UE6A 4F1WA 2PUHA 1SIBE 3GGPA 5BN1A 2PKWA 3AHIA 4OI4A 3TNYA 4HZUA 1KVTA 2XA9A 3MMPA 4DDKA 1D6SA 3BTSA 4YALA 1D2AA 1WTCA 1P61B 3D31A 3ZLUA 2RCNA 1BXGA 2F55A 1UMKA 4Y6OA 3V3TA 4ABYA 4XD2A 1ABEA 1Q1BA 2PGAA 3F6SA 5FP0A 4F84A 1VYTA 3V2HA 4R7ZA 4AMGA 4P4SB 3GIDA 1UDBA 5TJ9A 2OO5A 4KRGA 5BQ5A 3HMQA 1W6RA 3A6ZA 4N82A 1J00A 3AW9A 1M73E 4GRDA 1CJCA 3GMDA 1VL0A 1Q22A 4XDGA 2XB8A 1B42A 4X85A 1C7IA 3NUGA 4OQFA 5KUTA 1BMFD 3ADBA 2IDJA 4OU4A 5TMDA 2HDNB 1WEKA 3EY9A 3NLLA 2B21A 2ZETA 5KKCA 2QPLA 1UP4A 2QJWA 2XV1A 3RRZA 1M83A 4ZVNA 1MTZA 1OI2A 3I45A 3ZJ4A 5JIBA 5AKXA 4TWZA 1A9RA 3THSA 3SIPA 2CLDX 4O0MA 3CF6R 1OQAA 2AOXA 2RHBA 3B38A 3EC1A 2ZB7A 2EP7A 3OUZA 3VZBA 3B9PA 2P9EA 1UZMA 5K05A 1IY8A 3NVMB 5E9AA 1T3LA 1X15A 4IWNA 4AVYA 2CGEA 1Y9DA 2A14A 2CF6A 4LJ6A 2PSEA 4N47A 3CEMA 4EHLA 2PANA 4Q9HA 3UK1A 3GLVA 4HJRA 4JI3B 5BR4A 1JL3A 1M6VB 1UFVA 1FX0B 2B37A 2GUWA 3VU3A 2B25A 1ZINA 3P2YA 1KDZA 1GRQA 1RIFA 1Z34A 2C92A 3GQVA 3RFTA 2BN4A 3DKPA 2Y1XA 2FH5B 2PX6A 4LJKA 2HYIC 1JR6A 3L8HA 1AGRA 1M74A 3SM3A 1F4VA 2GZRA 4TLMB 4OJNA 2X5XA 1WA5A