5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
source organism Brucella abortus biovar 1 (strain 9-941)
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
1I8TA 3DR3A 3DO5A 3C1AA 4J43A 4WUVA 3WGIA 3ZU2A 2VWHA 1HT0A 4Y6SA 1ZSVA 1ZNQO 2EKPA 1ID1A 5F21A 3EHEA 4DPMA 3WBBA 1JLLA 4J4BA 4R1NA 1ADGA 3PDUA 2WE8A 2BI7A 3JQ7B 2VT3A 4P4NA 4C4OA 1I24A 2O3QA 3U49A 1W8DA 3HADA 1HYGA 4BKPA 4FFMA 5JO9A 1C0KA 4K26A 4IY1A 4RGBA 4L76A 1XGKA 3OEYA 3ZNNA 1K6JA 3ROQA 2AE1A 1JN0A 2YJZA 3HNPA 1DPGA 2NVBA 1GPDG 3OQ6A 3HSKA 4J6FA 3GFGA 4I9NA 4MPDA 2ZTLA 1I32A 5G0WA 4IIUA 2OUIA 4CM6A 2VRCA 2JCYA 1JKFA 4TZKA 4Q3AA 4R9SA 3ZNPA 1B8VA 4KQWA 3G79A 5FI3A 5TJ9A 3NTRA 1PGNA 3VH3A 4MVJG 4BQRA 3D3EA 3L9XA 1N7GA 3DOJA 4M89A 1NM5A 1WMBA 2NWQA 4H3VA 3ZNQA 1SAYA 3NEPX 4CMHA 2UDPA 4M86A 4DMMA 4HFJA 2IXBA 4UAGA 3AUSA 3LK7A 3E9MA 4HXYA 1A72A 4DLBA 3AI1A 2E37A 2GYYA 4DA9A 2ZCVA 1R12A 1QLHA 1MX3A 1A4UA 2JFHA 3K96A 4R1SA 4JQCA 1GU7A 4ZN6A 3TRIA 4AJOA 2C0CA 2GASA 3K6JA 1P33A 1P31A 3D4OA 2DTEA 1DRUA 2V6FA 4QO8A 2C07A 2ZQZA 4WLNA 4BNTA 4RF2A 1I30A 5DCYA 4Q3CA 3FNGA 4WNCA 1P77A 1NVTA 2VUTA 1I3NA 2WE7A 3PLRA 3Q0EA 1ZK0A 1V9LA 2CDAA 3ADPA 1CEQA 3CEAA 2UV8A 4RLSA 3EZLA 3WNVA 4BNVA 2V65A 1OC4A 2GN9A 2QYTA 3GC6A 3L0DA 3OMLA 3WR5A 1R0LA 4R41A 1P1JA 4QX6A 4D7AA 1WW8A 4UUNA 3AUUA 4XKJA 4BGUA 1U4OA 1VL8A 3GEMA 4CQLA 4N5NA 3E48A 3E6AA 4LCEA 2JFFA 3S2GA 3IIEA 3K73O 2ZQYA 3E18A 3TQHA 2JHFA 2X7HA 3WG9A 4YCAA 5JSFA 4BNJA 2H9IA 3JSAA 5DULA 2W4QA 4GSLA 1RKXA 3HDHA 3KYCA 4NK5A 2P68A 3HHPA 3QY9A 2JAHA 3GUCA 3ZWWA 4HY3A 1C0PA 3RC2A 3KYCB 1HDCA 3RASA 4XGIA 4DXHA 2Y05A 3ZWYA 4GQAA 2F00A 1HTBA 3KB6A 3R1IA 3ROMA 2OMEA 4CODB 1S6YA 5BSFA 3UCFA 3IC5A 3RIHA 1ADFA 1GFSA 5DF1A 3DZJA 2RHCA 1F0YA 1SC6A 1A7AA 5TRTA 1PJ2A 4PRKA 3WS7A 1DEHA 4IDCA 4L75A 3GFBA 1UXIA 4UUPA 1BDMA 3PFWO 3ZU5A 5JCXA 2X5OA 3NJ4A 1PWXA 2EKLA 3DBHA 1ISJA 4U8GA 4FD3A 3ICCA 2Y1FA 3DBHB 2I6TA 3DL2A 5JDIC 3G1UA 5L3ZA 1Q2XA 3KEQA 3RCBA 4RF5A 3OIFA 4DREA 5KJ6A 2ZB4A 1IL0A 1PZFA 3A9WA 4ND2A 5C7IO 3KYBA 2EEZA 4CM9D 3F4BA 3DZFA 3Q2KA 1NASA 3MZ0A 4MO2A 1GY8A 3QVWA 2E4AA 1VKOA 1DLIA 5T64A 1IZ9A 1E1LA 1RM0A 2HK7A 2VQ3A 3I9MA 2J3JA 2JD2A 1RM5A 1DIAA 1MP0A 3OIGA 4R51A 3UAGA 4EEXA 3EAGA 1K89A 2UUOA 5J23A 3G17A 1W4ZA 3PJDA 5F1OA 2VWPA 5T8KA 2OXIA 2VWQA 5IXYA 2NSDA 3VHRA 2FN7A 1H6DA 1F17A 2X0RA 3JQCA 4MIEA 4OMUA 2UYYA 4ZHSA 3QWIA 3GMDA 3QJ5A 1RWBA 3LZ6A 2V6MA 3I4CA 2FRDA 2Q1TA 4GX0A 4XJTA 4O63O 3RC9A 1NQOA 4O6VA 4W99A 3F5QA 4JBHA 3I9JA 4Z9FA 3I5MA 1JKIA 1O5IA 4E13A 4B4UA 2RBEA 2QW8A 1NHWA 1P74A 2RHRA 4UEOA 4E2XA 1H2HA 2CZCA 1D4FA 2O4CA 4OQZA 4L4SA 1MA0A 2A4KA 3PDJA 4PZDA 4TRRA 5LCXA 4IDFA 3WNQA 3W6ZA 4I5FA 4XQGA 3OA0A 2NTNA 2R6JA 2OBNA 1E7WA 3SLKA 2PA3A 4YXFA 3E1KA 2A92A 3WICA 2Y67A 4IUYA 1VC2A 5ITWA 3PHLA 3F46A 2OFPA 4XQ9A 1VM6A 4OOEA 3M1LA 2DLDA 1WDKA 1C0LA 1BGVA 3V5NA 3GK3A 2AG5A 2AG8A 3K31A 3VPFA 5AXAA 4XX0A 4XYEA 7ADHA 1MLDA 2EG9A 1XU7A 3DZHA 4CM1A 1CYDA 4KOAA 4HWKA 2Y1EA 4U6QA 4I1IA 4RDIA 2GERA 5KOIA 4IINA 4EYEA 4OAQA 2FPIA 4YQZA 5H81A 4BO3A 1M2WA 4PLPA 2QRKA 2GN8A 2PY6A 3OA2A 3AOEA 4XDYA 1U9JA 3K30A 2NTJA 4UREA 1P0CA 1ZEJA 2GLXA 1QP8A 5DZSA 1B7GO 3GVHA 5B37A 3DMYA 4YAJA 2Y1GA 3ZCXA 1U28A 2VHYA 5IFLA 1ZXLA 3KSDO 3WQSB 4FFNA 5B4TA 1LDGA 2A35A 4KDEA 3DC2A 2PH3A 5BNFA 1IPFA 5COQA 1HWYA 1NR1A 3VVCA 4CLHA 4CM5A 3A4VA 2VZ9A 4JNKA 4BO0A 4RLHA 1JTVA 4YJHA 4D42A 3MEQA 1T2FA 1IPEA 2EV9A 3KYDA 2JD0A 2ZYDA 3P2YA 2YQ5A 4GKBA 3O9ZA 4YJHB 1A7KA 3RD5A 4A73A 2RCYA 5ER6A 2H63A 4CM7A 5I9NA 2CVOA 3PIIA 1LLCA 2VCYA 1P44A 4RVFA 2VYVA 3PFFA 1LU9A 3IQDB 3QVTA 4Y6RA 1P45A 2OL4A 4GH5A 1I3MA 4I5EA 2GNAA 4BO9A 1VI2A 1DHTA 2WDZA 1GR0A 2I99A 3OJFA 4LGVA 5I8ZA 1YBAA 3V1YA 1KC1A 1NFRA 2A9FA 2PKRA 3BAZA 2J5RA 3L6DA 3OQBA 1H9BA 3O38A 4RVDA 6LDHA 1C1XB 1UZLA 4XQCA 3RJ5A 4B4WA 1ZCJA 4D79A 5KIAA 2D5CA 3L07A 3QHAA 4DYVA 2Q4EA 2HJSA 3F1LA 1YDWA 3D0OA 1CF2O 3GGOA 1LDEA 5GMOA 1BWSA 2BKAA 2C5AA 2FWMX 3PLNA 2IEBA 5JPIA 1MC5A 4BO4A 4K9DA 3C3XA 1MG0A 1NQAO 4CLOA 4F46A 1ONNA 4XQEA 4W7IA 2V6GA 1X0VA 4DMLA 1U4SA 4RZIA 3MJSA 2AE2A 1LXCA 4B8ZA 1Z82A 2W90A 1NTOA 1NBOA 2GGSA 3WTCA 1ZFNA 1R0SA 2D0IA 1PGQA 1W73A 4PLHA 1O0SA 4R1UA 3C1OA 2QIOA 4XB1A 4ND4A 3F3SA 3DHEA 4D43A 1TXGA 4QEDA 2VYND 9LDBA 2A94A 3OHSX 4YEDA 1B15A 1ML3A 2NVWA 2H1SA 4DGSA 3WMWA 1PL8A 3DONA 4XYMA 3WLEA 1BXKA 3O4RA 3KEOA 4YT8A 4XYLA 4QUKA 4Y67A 1N1GA 3QRWA 4MIOA 4NK4A 1NPYA 3FI9A 3F47A 3WGHA 1HSOA 1UZMA 3DAPA 4CMCA 3IMFA 4L4RA 5I7EA 1D3AA 1V8BA 3KV3O 4CMEA 5L7TA 2PK3A 2PH5A 2X22A 4J1NA 4TKLA 4WOKA 3WTBA 3W4KA 4OXNA 1I0ZA 2AEMA 4BS9A 1DAOA 1H5QA 1LSSA 4FPXA 3VPXA 4E2ZA 3JQAA 3QWHA 1XEAA 1OZAA 3L9WA 4AG3A 5ENDA 3W8FA 2HRZA 3CKYA 3EZYA 4FQ8A 3X2FA 5A02A 3ONDA 2WTBA 3JQAB 1W0CA 2Q49A 3MJ4A 4K6FA 1XU9A 1NQTA 4MJLA 4HV4A 2HCTA 5I9MA 5AQ1A 4W7HA 1UZNA 2X4GA 5GZ1A 3OFSA 1M6HA 3GDGA 3Q11A 4EZBA 3SJUA 1B16A 2Z1MA 1M66A 5G2OA 5KVCA 4EI2A 3NDIA 3AUTA 3P19A 4NNJA 2YW9A 1V3VA 1B26A 1ENPA 3AM3A 3WQQA 4WLFA 4GMFA 1N2SA 1XIVA 3OJ0A 4N5LA 4YDRA 1WLYA 1IULA 3UOGA 1WWKA 4IDDA 4B7UA 2PKQP 2QQ5A 4CQMA 3U4HA 1DO8A 1HRDA 4GI2A 1ZKMA 4FC6A 2R2GA 3K8ZA 7MDHA 2HMUA 3DBLA 2J5QA 3CINA 4W4TA 1GEEA 4YAEA 2CF6A 4WCDA 5AXBA 4LRTB 3WGZA 3DBLB 3O8QA 4NJMB 3VPGA 2B5WA 4CV2A 3ONFA 3I9KA 3O8QB 4KTTE 1ORRA 1KEPA 4W6ZA 2ZB7A 1E7RA 5EQDA 4B7CA 2VN8A 3D7LA 1I2BA 1RYDA 4C7JA 2RIRA 4JBGA 1HDYA 3CMCO 3NGLA 3BMCA 3KETA 1E92A 2VHVA 3LF2A 5DP2A 1ONPA 5A3JA 1QSGA 5HBRA 4B79A 1MGOA 1J0XO 4OJNA 4P4GA 2Q45A 3BMCB 3MJVA 1CETA 1YH3A 2JAPA 5T6BA 3I1JA 4J1SA 1E3LA 4Y6PA 4CMGA 2IODA 3PIDA 2YV1A 4BNKA 4L74A 1A9ZA 3C7CB 2EF1A 3P7MA 5EERA 1Z6ZA 1IOLA 4YPOA 1XKQA 3T4EA 1E5LA 5IDWA 3V1TC 1I2ZA 2XF8A 4B3IA 3MWDB 1IUKA 4RPKA 1LEHA 4HADA 3K2BA 3HDJA 4E2YA 4YR9A 3DZGA 1E3SA 1P1IA 4DTIA 4CUKA 1GZ6A 3DAGA 2WD7A 1Y1PA 1K6XA 3PEFA 5AOVA 1ZK4A 5K6AA 5CEEA 5CAEA 2O7SA 4M8SA 1P1KA 1Z73A 1DXYA 5DT9A 2RH8A 4XR9A 2B35A 4FOOA 4II2A 4ZVVA 4DIBA 2VTEA 3QWAA 1SOVA 5EJ2A 4AJEA 2X0IA 2HMSA 2P9CA 1HE4A 1V3TA 3ZZNA 4PN3A 3ITKA 2I3AA 1OC2A 1YOVA 3DMTC 5JC8A 3F1KA 5F3RA 1HKUA 1NQ5A 2DU8A 1H6CA 1B8PA 3TOZA 4GVLA 4CLXA 1DC3A 4Q3NA 1YOVB 3ZWVA 2WJPA 1HLDA 1F14A 3HE3A 2DVMA 5L40A 1QYXA 1GYPA 5DNAA 5TGDA 4U6SA 4BNWA 3JCZA 1KY5A 1PR9A 1VRWA 3PQDA 4P4LA 1ISFA 1C1DA 1J49A 2DTDA 1KY4A 4ONEA 1SOWA 2O3RA 3LYLA 2HDHA 1YQXA 1C14A 3GDFA 4L0QA 2Q99A 2BFMA 3UFXA 1EE2A 1XG5A 4YJDA 4DPKA 1WNTA 3CE6A 5JXWA 2LDBA 1BW9A 2ZTVA 1FK8A 4KQXA 3VAZA 1Y5RA 3FTPA 4GGPA 5FWNA 1FDWA 2BFAA 5LDHA 2POQX 1X0XA 3RWBA 5JDIA 3GPDG 4AL4A 3OEWA 4G2NA 4RVUA 2CFCA 4UUOA 4CMJA 3WGQA 3NT5A 2O7QA 1BXZA 1WZIA 3ZV5A 5U1PA 3FF4A 5IDYA 4ZQBA 3TZKA 2BGLA 3IP3A 5LDGA 2LDXA 2O2SA 3TFQA 4CM3A 4TKMA 1LRKA 2Q2VA 2YZ7A 5CP8A 3GVPA 4NBRA 4PLTA 4XIYA 1NFQA 1U2GA 3VOSA 5CEJA 5A3VA 3S1LA 4GX1A 4J7UA 4CV0A 2OBYA 3MWEB 1HL3A 4KDFA 1EQUA 1L7EA 1X14A 3IDSA 5ER9A 5A9RA 1ARZA 1C0IA 3ULKA 2GO1A 1MB4A 4CMEC 1NX6A 3JD1A 3X2EA 2C20A 4CLRA 5I9LA 1NPDA 1HDOA 4C7KA 2X1HA 3C85A 2X8LA 3DB2A 4J3FA 4XJSA 4CMBA 1T2DA 4Z0HO 1F06A 1YO6A 3ABIA 5CDTA 1EMDA 1NVGA 2P5YA 5EQFA 3LC2O 1EK6A 2BMAA 1Q7BA 2GDZA 2FMUA 5TS3A 4IQGA 4CM9A 3B70A 4IDGA 4OH1A 4N18A 3W1VA 4IIVA 3D64A 4IGFA 3FBGA 5JE8A 3TFOA 2Y99A 1GZ4A 5CPFA 3EUWA 1EBFA 3EK2A 4Z9XA 4DPLA 3JYOA 4IZIA 2C2XA 3RFTA 3UVEA 2G0TA 3ZGYA 3H9UA 3VVBA 4TRJA 3ZV6A 1PX0A 2D5AA 4PZCA 1ZEMA 5IN5A 2DTXA 4ROSA 1B8UA 4BNXA 1GL3A 1D1TA 3JQDA 3ZWXA 5A05A 4JN6B 3K5PA 4BNGA 2HJRA 1UP7A 3QV1A 4BGIA 2C7VA 3EYWA 1CJCA 2W8ZA 1CQJA 5THKA 1T24A 5MGBA 4BNHA 2YY7A 4BV9A 1T1SA 1FXSA 3WGGA 3U4CA 3AK4A 3Q9NA 2I5PO 2VWGA 1UH5A 3ON5A 4EJ6A 2O3TA 2YQ4A 4N5MA 1P0FA 1EDZA 1KOLA 5GZ3A 3F9IA 3W8DA 4FJ0A 4DL9A 3EDMA 4JCOA 4PLWA 2PLAA 5HRUA 5A9TA 5HM8A 1ZMOA 3H5NA 4UVIA 2HK8A 1IYZA 2OORA 4BO1A 2DFVA 3ITDA 4LSMA 3RSHA 4PLVA 1V35A 1JW9B 2OP1A 1TLTA 3CPSA 4XCVA 3GAFA 5TNXA 3AI3A 1YB5A 2GZ2A 3JV7A 3GZ4A 1U5AA 1YXMA 3OJOA 2C29D 5THQA 3E8XA 3DEYX 4G65A 3AWDA 1PJQA 6ADHA 5DCUA 1DC4A 2PFGA 4UEKA 3WX0A 3DHYA 1IE3A 3G3EA 5JBIA 3RUDA 3CZMA 1U1IA 2RAFA 1X7DA 2Y68A 3R6DA 1X1EA 3H5RA 3HG7A 2AMFA 2X9NA 1DRVA 4FIZA 4RQTA 4GWKA 1BTOA 5T5QA 2AQ8A 2XXBA 4ND1A 2C59A 1I10A 2DAPA 2G5CA 3GY0A 4NFYA 4URFA 4HX5A 2HSDA 5K6AC 5U9CA 3SX2A 1EUCA 1M67A 5CDYA 3HN2A 2TMDA 3RU9A 4Z9YA 1SNYA 4DC0A 1I01A 2VOEA 3ETGA 4F6LA 3RJ9A 4CQLB 3FTNA 2NQTA 4XEHA 4JP3A 4BMVA 2PGJA 2X86A 3E5RA 3S55A 4MINA 4BKOA 3IKTA 1NWHA 3KHUA 4E5YA 4E30A 3PGXA 1BHSA 4O59O 3RUHA 3BHJA 8LDHA 2HMVA 4GL4A 4EITA 3VH2A 3H5AA 1UXHA 4JX8A 3OIDA 3I6IA 3P5SA 3UH1A 3ZWAA 4RVSA 2GD1O 2YHIA 3D1LA 1F8FA 4QO7A 1PS0A 2Q1UA 4WE3A 5EN4A 4CLDA 1PQUA 1KVQA 1ZUD1 5JY6A 3FPCA 2FPGA 4MP8A 4OKNA 3NX4A 2XPCA 4JJGA 1YL7A 5A1TA 4NMHA 4P22A 3G0OA 3Q9UA 3FHLA 3H6KA 4WCFC 2B37A 5JMPA 1VJ0A 1E3WA 5B12A 1HDXA 1KS9A 1K0UA 1N5DA 4NBWA 1E3WB 4CM4A 1HETA 1EZ4A 1DJQA 1PJ4A 5TT0A 3U4DA 3PVZA 4Y98A 3R3JA 3ETEA 5ICSA 1LX6A 1WDMA 2E82A 4WEOA 4J7CA 2W2LA 4CM4B 1ZH8A 1R66A 3LDHA 2Y1CA 1A5ZA 1FJHA 1QYDA 1XYGA 1SEPA 4BO5A 2ZK7A 2HKIA 3QP9A 2AQIA 3BYZA 1Z45A 4XD2A 3LT2A 1NWCA 4JJFA 4QFDA 4BB5A 2O4UX 2VHZA 4PLGA 5KVQA 1DIGA 5FFFA 5JCJD 3ZDFA 3ZH2A 4EUFA 2Q4BA 3ASUA 5U4QA 3R0IA 1B2LA 1DB3A 1GCOA 3TOXA 1QV7A 4RJTA 4AJPA 1E7SA 3BZUA 1OI7A 4RZHA 3M6IA 1AXEA 2QRJA 3OBBA 2VYNA 4OGWA 4KUGA 2BFOA 4M54A 1M75A 4GX5A 4U5QA 1BG6A 4DBZA 2V6BA 3A14A 2C82A 3VZRA 2CDBA 4BGVA 4ZRNA 1EDOA 3BTUA 4E32A 3PZRA 4DVJA 3KVOA 4DBVO 3VDRA 3UF0A 4CV3A 1I3KA 4NH4A 4IQ8A 2WYWA 4J2HA 3BMNA 2P9EA 1H2BA 1PQWA 4BIIA 3ROKA 4NBVA 3QE3A 1GCUA 4AJNA 4CLEA 2GZ3A 4GLOA 2NQ8A 3BMNB 4R68A 4OO3A 5C7LO 1SB9A 3KO8A 3BHMA 3FBTA 4UUMA 1L7DA 1P9LA 1LLQA 3FR7A 4FW8A 2VRCD 3W4IA 4B3HA 5L53A 1R0KA 4B7XA 3FNEA 4FGWA 3GA0A 3RFXA 5JLAA 2FR0A 1DDOA 3KRTA 1X7GA 4M1QA 3ZHYA 1H93A 3WWYA 4NR0A 2D3TA 1T2CA 3V2HA 5F1PA 4CR6A 3ENNA 4HFRA 3CXRA 4RO0A 2PZMA 1YBMA 3MOGA 4EGFA 1I2CA 5JDCC 2QX7A 4BOYA 1U3WA 2NU6A 1AHHA 1QYCA 3ETDA 4IS2A 1BVRA 5BSGA 1AGNA 4ALKA 3DWFA 3N74A 4INAA 4S3MA 4TWRA 1DJNA 1B3BA 2WM3A 5HTOA 4AJHA 4A5OA 3EC7A 5TQVA 1LI4A 1TT5A 4OXKA 2X0JA 3ZWOA 1GZ3A 4D45A 3ADOA 5FF9A 3ZN2A 5MDHA 1LC0A 5CG1A 2WWRA 1TT5B 3D4PA 1N9GA 4FFPA 1PJ3A 4TRNA 2W98A 4X54A 3FWNA 5I7SA 5DOVA 2J5KA 4A27A 4ZJUA 2Z5LA 2EGGA 3UCXA 3DAFA 5AYVA 2D4AA 1HE5A 3FNFA 1P1FA 2P4QA 3HWRA 2NVUA 2CVQA 1X15A 3RUCA 2RH4A 3H65A 5ENVA 2BI8A 1LDNA 1YRLA 3DMTA 3KYDB 4A7PA 2I65A 3VTFA 2HLPA 4Q3EA 2E6UX 4EUEA 1VKNA 2IYPA 5FI5A 2XAAA 1RM3A 1YL5A 3AM4A 1KYQA 3GEDA 1HF3A 2O3UA 4RDHA 2BGKA 4R9RA 3HB5X 1ZJYA 2ZYAA 1Y6JA 3PXXA 3GVIA 3LU1A 3F6YA 4ALNA 3V8BA 3PWKA 1UUFA 3AW9A 3ZHXA 1IHXA 3JD2A 3AM5A 1J4AA 1NR7A 3PHIA 4M55A 5KTKA 1CIVA 2IYOA 1PGPA 3PHJA 2IXAA 1A27A 5HA5A 1VLLA 1S7CA 2NU8A 5A06A 3D4NA 2P5UA 3MCVA 4A10A 2PD3A 3JQ8A 1LSJA 1WVGA 1E3EA 1GQQA 4S1VA 3PP8A 4DQXA 3I4FA 3JQ8B 2I66A 1Y9AA 4D46A 5DN9A 3IKVA 1JWAB 4GLLA 1XDWA 1LRLA 2AEFA 1I3LA 2UVDA 4KUHA 4MP3A 1LDYA 1KERA 2IZZA 3QA9A 4JXKA 4MKZA 4Q3BA 4TVBA 4WOJA 4CLOB 2JFGA 4F45A 1PL7A 2FPPA 3FWZA 4RL6A 3RFVA 5A03A 5C5IA 1PS9A 3O26A 1KEVA 3GMSA 1B14A 3GH3A 3H4VA 1DIBA 4PCVA 4WEQA 1QV6A 3LLSA 3T4XA 3S2EA 2D2IA 1DFIA 1E6WA 4N7RA 3JQGA 4U0KA 5HS4A 3L6OO 4NQZA 2PD4A 2CSUA 3VH4A 3JQGB 1E7YA 3PJGA 1PGOA 4D3SA 4BQPA 4O5OA 3AY3A 3OM9A 4BO2A 3A06A 1R6DA 3FCOA 3PK0A 4I5DA 8ADHA 4ZU3A 4Z6KA 2YUTA 1DAPA 3GN2A 3GQVA 4YJGA 1GADO 4J49A 1WXDA 4K28A 5KNLA 4DQUA 3C24A 2GN4A 1E1KA 2C2YA 3PZBA 4YJGB 1EUZA 4KMSA 4DWVA 1XLTA 1E6UA 1OBFO 1GDHA 3DBRA 4E21A 4LK3A 3HDYA 4Q39A 3ZWBA 1XELA 3W6UA 3DBRB 4CMKA 5G4KA 3CUKA 1TEHA 3HFSA 2IDZA 4U7WA 4WPGA 2Y66A 5BNTA 1PTJA 2O48X 3AUAA 3T7EA 1MV8A 4IGEA 5G4KB 4PG8A 3H9EO 3OJLA 3WFIA 3WWZA 4BL5A 5L45A 1LQTA 2BGMA 3GAZA 1ZO8A 3ZWMA 1XHLA 3EGOA 3E9QA 1R4MA 3SXPA 4RQUA 1LBEA 2HO5A 2EWMA 1PU2A 5L4LA 1R4MB 3PWSA 2NM0A 5A5FA 1YQDA 2B4RO 1RJWA 1Q7GA 3HFGA 1YWGO 2BHLA 4KP7A 4PGFA 3BTVA 3W8EA 1EE9A 5TC4A 2GPTA 4BV8A 1YJQA 3DTYA 3H2ZA 5C7OO 2WMDA 4CQMB 1PJSA 5K9ZA 1SCUA 3WYCA 1CDOA 3VZQA 1E7QA 3ANNA 1BRMA 2EXXA 2P9GA 2XOXA 3DZKA 5FYDA 2VZ8A 5TF4A 1PJBA 2ILTA 1G6KA 3GNSA 3W4JA 3JD3A 4ND5A 4XYBA 1H6AA 3ST7A 3UICA 1Q0QA 3CSDA 2D1YA 4BNLA 1MXHA 3LT0A 5FEUA 1OOEA 1MUUA 1VPDA 2Q50A 3TPCA 4BNIA 4D0RA 1ZMTA 2DM6A 3L4BC 3H9JA 4Z0TA 5TSDA 4CMIA 2I9PA 1NVMB 1JVBA 4NFSA 1UXGA 1A4IA 3RI3A 2GZ1A 3GEGA 3KOUA 1CWUA 5KKAA 4MKRA 5IXSA 1TVEA 3DBVO 1ULUA 1NHGA 1LSUA 4YAGA 1NAIA 1U2DA 1DC5A 3ENKA 4AICA 2X5KO 3D5QA 1KVRA 5KVVA 5GZ6A 3H3FA 3KUXA 1AN9A 5IAAA 3BHIA 5DBIA 5JC1A 1LUAA 4LCJA 1ZIDA 5F5LA 3U5TA 3FSRA 1Y5MA 4J16A 3JD4A 5JY1A 2IE0A 4NHEA 2DT5A 2OZPA 2IEDA 4HFNA 1QORA 1LDBA 1DSSG 4GKVA 4BO6A 1SBYA 4RF4A 4O1MA 1D7OA 4B3JA 1ISMA 1GUZA 3B6ZA 3PHHA 4EBFA 4YJFA 4DIFA 1Q0HA 5BT9A 4XA8A 1DRWA 4YB8A 4XGKA 2Q1WA 1ENYA 1VJTA 3I52A 2AEJA 4CL3A 3QQPA 3ONEA 3A28A 4N54A 1TT7A 3DOCA 3EMKA 4HNGA 1XCBA 3GG9A 4PRLA 1EQ2A 3ORFA 2WD7B 1HYHA 2Y1DA 3FD8A 4XRRA 1ZBQA 4MVJM 2G76A 2YV3A 1G0OA 3GN1A 1Q7CA 3ZV4A 2B4TO 1Q0LA 3QWFA 4Z3KA 1UP4A 3RQSA 1UR5A 2WD8A 4PLCA 4R3NA 4Z0PA 3PYXA 2B5VA 3SEFA 3WSVA 1W6UA 2NADA 3NYWA 3DFUA 3GPIA 3WLFA 4J0EA 3KTDA 2UUPA 1LLDA 2JCVA 1IZ0A 4YAKA 2Y0CA 4U0JA 3RU7A 3PYMA 4CJXA 1VJ1A 5BR7A 3QSGA 1ENOA 4WLEA 3WGOA 4CV1A 4MKXA 3NAQA 1K3TA 3I23A 3LSYA 4AVYA 2NTVA 5CHEA 4GVXA 1C1DB 1UP6A 1PZEA 1EEHA 3SVTA 1G0NA 3BTSA 5CDUA 1M6WA 4MVJE 4BNUA 3JQBC 3PTZA 1K2WA 3M2PA 5BSHA 2PZLA 2DUUA 4JLWA 4XYGA 1E77A 1GQ2A 1P1RA 2G82A 3C7DB 4J9VA 4ALLA 1PWZA 5IZCC 4BVAA 2DPHA 4RV9A 4WCFA 4PVCA 3H9QA 4I9UA 2X5JO 4YRDA 1BW9B 3ICPA 1KC3A 3S8MA 4H16A 4A03A 3NJ8A 4WCFB 5JYEA 4PZEA 4MVJD 4QECA 3KSUA 4E2WA 2YV2A 3JQ6A 1T4BA 2FZWA 4E3ZA 3H2SA 3K9QO 2FZEA 3JYPA 2O3SA 3VPHA 5CPBA 4BMSA 4YQYA 4GSKA 4WJZA 1BXGA 1O8CA 5KVSA 4MVJH 4Y9DA 4B4VA 4FS3A 4I9HA 3B1FA 3SJ7A 5TIIA 1BXGB 2NU7A 1GAEO 4FFRA 2GF2A 4OSOA 1XWFA 4B4OA 1XR3A 4ALJA 4J90A 1BVUA 4XIJA 3PI7A 1PGJA 4EJMA 1UDBA 2BFPA 2Q3EA 5G0VA 3IOYA 4OSPA 4NDNE 3MOIA 5K0ZA 3RROA 1O89A 3KXDA 4D3FA 3WYBA 5LC1A 2FR8A 4NU6A 5ILOA 3U09A 4IJUA 3WDSA 4E0BA 4NFHA 3TZQA 1WMAA 4CLRB 1HEUA 4CR7A 2PGDA 4Y8VA 1YB1A 3VH1A 5H83A 4PG7A 5TLSA 2GCGA 1LQUA 4GWGA 3K2EA 4OIMA 4AFNA 2G1UA 5KKCA 4FGSA 3WYEA 5IJZA 1MC4A 3EVNA 4NBTA 5AVOA 4MP6A 1QRRA 4ALMA 3OECA 2BELA 3PQEA 4R5HA 4M49A 4OHUA 4DLAA 3WJ7A 3E9NA 3G1TA 5JCJA 1GEGA 2X6TA 1XSEA 3E82A 4DLLA 3INTA 4A0SA 1YB4A 3WOHA 4BB6A 1YKFA 2R00C 3DHNA 1NFFA 4RVGA 1V6AA 3JQ7A 1PJLA 1HXHA 1E3JA 4WLUA 2CVZA 4FFLA 3ANLA 3GNQA 5T67A 4EEZA 4AJ2A 4E5MA 2H6EA 2YFQA 1Z7EA 2C7GA 3CMMA 3GR6A 1NYTA 4E12A 4ZQEA 1HZJA 1ZSYA 3F5SA 1N7HA 3M1AA 5JDCA 4F6CA 3HUDA 1EUDA 4P8RA 4TRMA 3GGPA 3VZPA 2YDYA 4I8XA 1LJ8A 3DOOA 4FJ2A 2OGUA 3JYQA 3UCEA 4L73A 5F1KA 1QKIA 3TZCA 1P3DA 5EESA 1EVIA 1AE1A 5COBA 4E33A 1WP4A 2PD6A 3ZW8A 3DDNA 3LT1A 1FF9A 3U3XA 1EFLA 3KSZO 1LDMA 4GMGA 1AHIA 1ISHA 3I83A 1A71A 2PTGA 2DUWA 2HU2A 2X0NA 1Z7BA 3L4SO 4RPGA 4FJ1A 3RUEA 5I7VA 4KTVE 4WECA 1GYRA 2ZCUA 3GRKA 4IZHA 5KJ1A 1VL0A 1FDTA 1D8AA 1GTMA 2EW8A 3B1JA 3BMOA 2P2SA 1QXSA 2CDCA 5JAZA 3T7CA 1EBUA 3BMOB 4O0LA 3UGKA 3A1NA 4L9RA 3RBVA 2O23A 3VDQA 3OICA 3GLQA 4KWHA 1XQ1A 1GV0A 5A04A 1B0AA 1NPTO 4WASA 4IMPA 4BNFA 3INGA 4WGGA 3AI2A 4WNIA 1U7HA 1C3VA 3NTOA 4AJKA 4E5KA 1KETA 3TSCA 4YT4A 1IHYA 2GR9A 4XR4A 5L9AA 2G17A 4YBZA 2X9VA 3ZU4A 4IJWA 3Q1LA 2HAEA 5JNLA 3PPIA 1ONOA 5A9SA 4CR8A 4TVOA 5A5EA 2VTDA 1U7TA 1SEVA 5KJEA 1MFPA 4OXYA 3U62A 3RUIA 5A9SB 1H94A 3NT2A 3QLJA 3QVSA 2B69A 3PJEA 3NT4A 3WGTA 3WSWA 3QW2A 1PQPA 1E5QA 5JAMA 3I6QA 1FDVA 4A2CA 4J1QA 4PLZA 3R3SA 1SPXA 5DBGA 5GY7A 2QYSA 3ZNOA 4J1TA 2B83A 3KBOA 4RPJA 4ZD6A 4ZRMA 4LMPA 4II3A 5T57A 1EK5A 4RF3A 1I36A 1PEDA 1H0KA 1O94A 1Y9EA 1K5HA 5G4LA 1ZZEA 3TNLA 2ZB3A 2YHIB 5DCWA 2NACA 4MVJF 2DQ4A 1U3TA 3V2GA 4FR5A 4RCVA 3TJRA 4BNNA 4AJIA 3NKLA 4MIYA 5EPOA 2YYYA 3HJAA 2ZTUA 3SLGA 5IZ4A 2VRBA 1J5PA 4BKRA 3BA1A 3RC7A 3RVDA 3WFJA 2NUAA 4HUJA 4IDAA 2OHXA 4M87A 1KBZA 1DFHA 3CTMA 3L6EA 5G0UA 5L4NA 5JAQA 3OJEA 4IM7A 4WKGA 5AXCA 4CMAA 1KEUA 2YHUA 5B1YA 5JAIA 3PGJA 4W9NA 3NUGA 4BKQA 3TL2A 5L51A 4E5NA 4R69A 3RBXA 1ADCA 1D1SA 1WDLA 2NU9A 3GRPA 3IJRA 5COAA 1HDZA 2PZKA 1OAAA 4ZQGA 2JL1A 2C54A 3MJCA 4R01A 3TZHA 3JQ9C 4WLOA 2FSVA 3K92A 3TDKA 3WBFA 4E5PA 2J8ZA 2VT2A 3GGGA 1JA9A 2X9GA 1A9YA 1SZJG 2AQKA 3MTGA 3VKVA 1E0DA 3BXXA 4QXMA 3WIDA 4YYZA 1CQIA 3PWZA 1B3RA 1LRJA 3AY6A 1EVZA 1U8XX 3LT4A 1GYQA 4PIVA 2Q1SA 3C7AA 5ADHA 3JQEA 3JQFC 5G0TA 4K6CA 4L8VA 3CIFA 4RPLA 3M2TA 1KIFA 1ULSA 5B4UA 4OYRA 4FDAA 1DHRA 4NG5A 1VE9A 1GUFA 3VPSA 4J7XA 4ALIA 4LVUA 2JJYA 1JKJA 3UKOA 3BIOA 5IG2A 2BLLA 1E1NA 3FNHA 3PYLA 3PRJA 5JO0A 2EP7A 4NIMA 3IJPA 2DFDA 1NXQA 1HLPA 3I3OA 4LSWA 3DZBA 1T26A 2C5EA 2FHSA 3V1UA 3ZV3A 2ZB8A 1UDAA 3NDRA 4ND3A 3WXBA 4QTZA 3QVXA 3LF1A 1PL6A 5ITVA 2UAGA 2GN6A 3L4BA 4L4XA 3TN7A 1AXGA 3RKUA 1PIWA 1PZGA 3FPLA 2E48A 4AJ4A 3RUAA 3UW3A 4UVGA 2J6IA 4NI5A 9LDTA 4IS3A 4LRSB 1LNQA 4A26A 4I08A 3VKUA 5JW6A 4TQGA 3WB9A 2TMGA 2FR1A 2CNBA 3N58A 2B0JA 2Q2WA 3RAJA 2CD9A 4E6PA 1SMKA 3MJTA 1RM4A 3PJFA 4FOSA 1JAXA 2PGLA 1LC3A 1T2EA 2BF7A 1TI7A 2JHGA 2CY0A 1YL6A 4UEJA 4DUPA 4YACA 2EERA 3UXYA 1MFZA 4ZGWA 2CMDA 1FDSA 4PVDA 3GG2A 4IJKA 4BNZA 5L7WA 1UDCA 4OL9A 2F1KA 4GAEA 5TT1A 4OQYA 3OH8A 1N9GB 3AU9A 2VUSA 5IDXA 3CZRA 2EHDA 1N8KA 4R3WA 3COSA 4HKTA 4NZ9A 2Z1NA 5CDGA 4ESOA 3Q6IA 1TA4A 1XA0A 5DDIP 3VZSA 4CPDA 3EY4A 4YAIA 4ID9A 5HS6A 2PV7A 1DIHA 2NVUB 2J3HA 4GPD1 3FRJA 1YE3A 2NV6A 4CM8A 3SBOA 3WGYA 2CUKA 1U8FO 3NV9A 3SC4A 4BO7A 1HZZA 4CM8B 3RC1A 2HRBA 4CUZA 4OM8A 4ITUA 1Y8RA 3OSUA 4FC7A 1V3UA 1NNUA 1PS8A 2DPGA 2H5LA 1Y8RB 3NGXA 2IRWA 1U3UA 1DIRA 4QT0A 5DOZA 2QG4A 3CH6A 1DFGA 3IUSA 1HE2A 1ENZA 1I33A 2VHXA 4G5HA 3H3JA 1YS4A 5JMWA 1GD1O 4JJIA 3C1TA 4YVFA 1ZVMA 3HDQA 1PJTA 4J91A 1QYWA 3JQBA 4LVCA 1Z74A 2O50A 4G81A 4B8WA 5KCZA 5JS6A 3S2IA 5IZCA 5CDSA 1OFGA 3D3WA 2O3JA 1E7MA 3IP1A 3UUWA 1T4DA 3IS3A 3WIEA 1JWBB 3UHAA 3IUPA 1C1XA 2B4QA 1E6EA 1F12A 3D3WB 5L4SA 3H7AA 5AXDA 2FSSA 3WMXA 1RYEA 3ROPA 4YWJA 2W2KA 4XDZA 4E4YA 4GX2A 1GPJA 3LVFO 4DIOA 1HSZA 1DBVO 2J3IA 2AQHA 4HFMA 1QG6A 4NPCA 2W2KB 3FR8A 1VL6A 2W2LD 3DTTA 2HQ1A 4IXWA 3BMQA 4H15A 4I5GA 4DC1A 5JYDA 2AA3A 1PJCA 2XXJA 3INRA 1LTHR 2B36A 3BMQB 4OOFA 3ZI0A 3MTJA 2P4HX 5A4DA 4KZPA 4NU5A 3GOHA 1YGYA 2PKQO 3QIVA 3GZNA 1RPNA 4FBGA 4WK6A 4D0SA 5KJCA 4TZTA 5I8WA 5ICMA 4HP8A 3GZNB 2GUGA 4LW8A 2YFHA 4MVJP 4YRBA 4WLVA 1T2AA 2WEKA 4BNMA 3C8MA 2VZ0A 1BSVA 2Z95A 3WQRA 4PLYA 1JQBA 4FCCA 5L95A 2ZTMA 1M76A 1MG5A 5IN4A 4IJVA 4W9NC 4UVHA 1HDGO 2VOJA 2SCUA 4R5MA 2AXQA 2V7PA 3AFMA 1QYVA 3AFNA 4K1LA 3JTMA 3ASVA 1R15A 2AW5A 3E03A 4MVJA 3NTQA 4BMNA 3B1KA 4AJ1A 1N1EA 5H82A 2JCXA 4XGNA 1R4NA 3UN1A 5CFZA 3ZU3A 2EKQA 2ZIZA 1JU9A 1X1TA 2J3KA 3G49A 3PHGA 1Z75A 3GNTA 3TL3A 2QZ9A 4R16A 1Q1NA 1R4NB 2Y0EA 3Q2IA 4IBOA 1KVTA 3ZWNA 4BHTA 3QVOA 4DQVA 3O03A 3HQ4O 4QFCA 2DBQA 4PG4A 1ZK2A 3AU8A 2EIHA 5I7FA 2VHWA 3U4IA 4IPTA 1WPQA 1TB4A 3HB4X 4AJLA 2QRLA 1DC6A 4Q3DA 3U9LA 3ZHZA 4TMFA 3GT0A 2R00A 1BDBA 5T8KC 5BQFA 1KVSA 4J4TA 3DZIA 2Q2QA 4KUEA 2EW2A 5C37A 2VUUA 4PG5A 4YA6A 3ZWCA 1O6ZA 3N7UA 1JDJA 4EUHA 3WJAA 3TZ6A 2HUNA 2QHXA 3AJRA 1ZK1A 3FN4A 4RORA 4ILKA 3KM0A 1ADBA 1YONA 3Q3CA 3JYLA 4UVDA 4BNYA 1YDEA 4EDFA 1VSVA 3IAHA 2HK9A 5B4VA 5EIOA 4XZ3A 5BSEA 3LC1O 4RVHA 4BUCA 2X23A 3GDOA 1EFKA 1E1MA 4QSMA 2ZJ1A 1GV1A 3GF4A 3VC7A 1N92A 4YRAA 4YT5A 2OO5A 4J9UE 1EVYA 4FN4A 4LISA 4NJMA 3I9LA 3JYNA 3STHA 4J4HA 5HWSA 2O2YA 4IXTA 4TROA 4CMIB 1ZK3A 5CG2A 1U5CA 3RKRA 2EGHA 1YBVA 4AJJA 1J6UA 3I9NA 3LC7O 3H9GA 1YJ8A 2FP4A 1SO8A 2DC1A 2E49A 1G1AA 3PQFA 4GBJA 4JGBA 3SC6A 3H8VA 1ZJZA 2DBZA 2PWZA 2OP0A 2WSBA 4R4JA 3E5MA 1UAGA 1JAYA 1IY8A 4R54A 1Y8QA 4PLFA 4EW6A 2ZKLA 4UVEA 1XQ6A 1ZSNA 1CERA 5DP1A 1Y8QB 2I67A 4MVJI 4BO8A 3LQFA 4MOWA 1IB6A 4JK3A 2WYUA 3F4LA 4FFOA 1ZXBA 4ZQFA 2VYVD 2EJVA 1QMGA 2CF5A 4BGEA 1DOHA 1JVSA 2FY8A 4YJFB 3RUFA 4ZICA 4RPHA 2GSDA 1Y81A 4OKIA 3IL2A 5KWEA 1H6BA 1NAHA 1SB8A 3AOEC 3AY7A 3OF2A 1F8GA 3NDJA 2ET6A 2VNAA 4Q9NA 4XRGA 3I9OA 3ANMA 3ZHBA 1EVJA 2D59A 1YVEI 4NBUA 3GUYA 4NJOA 4D44A 3B20A 3HN7A 4IQ0A 4BKUA 4FSHA 4Z3DA 3BTOA 1E3IA 1WAMA 1YQGA 1I5RA 5JFOA 2ZATA 1KEWA 3LLVA 3HZZA 3EVTA 3RBZA 5F5NA 1BMDA 1DLJA 3OETA 4YT2A 1HYEA 3AOGA 5G0SA 2NNLD 1UXKA 4W82A 3GVXA 1HDRA 3GHHA 1VSUA 2X58A 4JP2A 1L1FA 2DBVO 5KJFA 1V0JA 3S2FA 1O95A 5L7YA 1LA2A 1QR6A 1X7HA 3GHYA 4PFJA 1R16A 2JKVA 5EL0A 3DFZA 1O9BA 1PR3A 3DXFA 4D41A 1UXJA 2QZZA 4QQRA 3KZVA 2EP5A 2JD1A 3QWBA 4HBGA 1H9AA 4HNHA 1T25A 2HMWA 1R37A 1GUYA 3JD0A 1MXFA 4IMRA 1T1RA 2NLOA 4PG6A 4XB2A 2ZYGA 4EJ0A 3OQ1A 4JBIA 5TX7A 3NRCA 2I76A 4XWYA 2BD0A 2D8AA 3U0BA 2PNFA 1HE3A 4H7PA 4J2OA 2EJWA 4E31A 5IDQA 1FDUA 2Y1OA 1PZHA 5CEFA 1ISGA 4F3YA 4YTEA 4UULA 4JROA 5TJHA 1P1HA 2IZ0A 3ZWPA 3EW7A 1K6IA 1PSDA 1GQYA 4DYDA 3JQAD 1KVUA 1U3VA 4DRYA 4FB5A 3JQ9A 5IF3A 3OP4A 1ISIA 2ZJ0A 1ZW1A 1FMCA 3L77A 1LLUA 1UJMA 1X13A 4KWIA 4J0FA 4P38A 5BNIA 2AHRA 2DKNA 1NP3A 3TF5A 2DBRA 2HMTA 1Y7TA 4TSKA 4CUJA 1LSOA 4LN1A 3KLPX 1WZEA 3KLMX 1QLJA 4MDHA 3JQFA 2WYVA 4ZA2A 3VTZA 4ZQHA 2PZJA 2OOSA 2Q46A 4CQMD 5ES3A 5ILGA 5EMHA 2P91A 4R1TA 4JIGA 4D3DA 1CRWG 2GRAA 3MJEA 5EINA 4LMRA 4IDEA 4IDBA 1UAYA 2YDXA 3P2OA 2VNSA 3ZW9A 2FOIA 2I3GA 3V2UA 3GVCA 4GGOA 2BRUA 1AUPA 2IZ1A 4CL8A 3TWOA 1OMOA 2Y93A 3DQPA 5C3MA 2Y0DA 3D5TA 5DBFA 2PR2A 2BH9A
chains in the Genus database with same CATH superfamily
1RS0A 3DR3A 2F4NA 3C1AA 3OQVA 3QMWA 1UC4B 4LXYA 4Q3KA 5LB2A 3SEQA 2AI1A 4I5IA 5AKYA 4YCLA 1XTKA 3T41A 1G6Q1 3O2JA 1JEOA 4RYDA 3D9QX 2VH1A 5HR5A 3D8TA 1QG0A 4ZI7F 1KH2A 4HLQB 4IR7A 4I4CA 1XQ9A 5AI8A 3EHEA 1O2DA 3D3JA 3G8AA 3ZCVA 2WHXA 3G8YA 4D57A 3FPFA 2BUAA 3CW8X 3PDUA 1Q16A 1H4QA 3JQ7B 1Z83A 3IUNA 4TUYA 5AQEA 1TQDA 1WF3A 5B1EA 5LXTB 4HWPA 2IXDA 4MVWA 1RXWA 1NA5A 2OCKA 1V41E 2JLXA 1UOQA 3CKMA 2GFQA 5AHXA 3I45A 3IV6A 1NJ1A 5H70A 2KW5A 1PQYA 3HRIA 3PF9A 5JO9A 1C0KA 2PLNA 4PANA 2DERA 1GPKA 1MJNA 3MUNA 1XGKA 1KAHA 3T9AA 1USWA 4INPA 4RTJA 2AE1A 4EKEA 3HNPA 1DPGA 4BNGA 1GPDG 3QMPA 4G5XA 4UHBA 5FA5A 3OQ6A 3A05A 3PUYA 5K8TA 5JARA 2YVQA 1A5SB 2QORA 1UK9A 2K7ZA 1N3BA 4G6ZA 3SZOA 1VKRA 1SC9A 2FSPA 1YQQA 1KZ6A 3M6WA 2JCYA 4QAJA 2HQOA 3JALB 4K46A 3TB6A 4UTZA 3B1YA 3WZMA 4TZKA 4HQLA 4IXDA 4HYTA 5IVPA 4MGYR 1UFQA 1B8VA 5TJ9A 3VH3A 4PSCA 1D2CA 5A7GA 5CCXA 1A9RA 4IWXA 5E6SA 1YVUA 3DOJA 3I64A 3MBOA 4XD7D 4M89A 1WMBA 1W49A 3ZNQA 3MB8A 4BFSA 2WVGA 4CMHA 4V2IA 2N0SA 2UDPA 2E89A 1NZJA 2JLCA 1Q7RA 3EIOA 3KXIA 1XTSA 2ZBEA 4L6CA 4IIFA 1T9GS 4HNSA 3H99A 5WRFA 4IRMA 3F6PA 2ENUA 1A72A 2GEKA 1NDQA 5K0BA 4ZTUB 1QGDA 4TLBA 2FN9A 4DJAA 4MQLA 2X19A 5FKJA 2ZCVA 1JFSA 4O2AA 3ZZ1A 4FW9A 5DGHA 1KDVA 5HBGA 1KYXA 3A1EA 1TNDA 3O94A 1DARA 1KH1A 3RT9A 4R2IA 4A82A 4Y9UA 3TRIA 4D6XA 2GASA 3CV3A 2D54A 3IOEA 4X0EA 4EUNA 3FJ1A 4YXWA 1IBCA 4LHVA 1C4OA 3D4OA 2HSEA 2V6FA 4QO8A 5FBVB 1JEEA 4UOZA 4RF2A 5TMBA 1I30A 3D3QA 1KFBB 1GGVA 3FNGA 2GTPA 1P77A 4RHFA 3F67A 5CBPA 4AUNA 4A3SA 1Z68A 3HL4A 4RLSA 3OQMA 3VR6H 6GPBA 4BNVA 3CZ9A 3QKTA 1QNLA 4LXXA 2IVZA 5HE9A 5BOSB 5GJBA 4MQUA 4CKBA 4UBJA 1KJ8A 5E9JA 1GPMA 2X8BA 3CT6A 3RRJA 4JLPA 4PAWA 3DWIA 1FFHA 1JPUA 4KMRA 4UUNA 4E88A 3G85A 4IZ6A 1PK7A 2J30A 1VL8A 4QLOA 4N0PA 1PDOA 2E4ZA 1GGNA 2ZS8A 1XLUA 3ZI7A 3J81A 1M8FA 1F6BA 2OCAA 1T9AA 2QROA 3PUXA 3QEJA 4EFLA 2LUOA 5A4KA 1UL1X 2FZGA 4Y30A 1VFPA 4BNJA 2H9IA 1RLIA 2LCIA 2PXXA 2R6DA 3LGSA 2AC7A 2BKLA 3LXMA 1L4EA 2JK0A 3BFJA 3FRIA 5EE5B 3W5VA 3HHPA 3K1AB 3QY9A 4ZREA 5E4JA 4EPYA 2JAHA 3ZWWA 3ANYB 4HG2A 3RC2A 2H52A 1Y33E 4OQNA 3RASA 3ZCUA 4YCSA 1V7QA 2Y05A 3ZWYA 2WK1A 2F00A 1P4SA 4NC9A 3FZYA 3JZFA 2OG1A 3THSA 2H4JA 1F5NA 3FGOA 1JU4A 1NXWA 2BBOA 5KNBH 4KFSA 1SVOA 2F2TA 4V2UA 5HP4A 5I7HA 2OMEA 1FSSA 1S6YA 5LJIA 4MLCA 4RVNA 3TJZA 3R3WA 5FADA 4HGNA 3CO0S 2FE4A 5F33A 2G70A 1PJ2A 3GEEA 4PRKA 4GR5A 4BVLA 1W581 1QCDA 1WUKS 1V4VA 3KHSA 4HLUA 2BKXA 1A8HA 2PQ6A 3C8HA 4IDCA 4YI3A 4KN8A 3ZGLA 5IBRA 3T94A 2EKZA 3PFWO 4BKMA 3ZU5A 2X5OA 3ORHA 3AZPA 1TRKA 4HEHA 4ZTZB 5IVDA 3NKVA 1BQEA 1SURA 3ICCA 2W6IA 4MV6A 3MJRA 1JDNA 2Y1FA 5IH3A 5TEWA 3KEGA 1G17A 4LXQA 2JJQA 3RYFB 1YHYA 3NIGB 4RF5A 5KJ6A 3EXHC 1XE3A 1W59A 1PZFA 2QTVB 4Q02A 2ZI3A 5C7IO 3UJ3X 1JEYA 1ETUA 2EEZA 2C8JA 3F4BA 3CRVA 3KYBA 1KO1A 3PGVA 3Q2KA 3STUA 2DKFA 1M5RA 2ZSHA 4UMDA 3KXLA 2IYSA 3QVWA 2FOXA 4QLBA 4JXZA 2E4AA 2EX1A 5HJ5A 5K6RA 1DLIA 1L8OA 5CYFA 4GEKA 1HEYA 5EJ7A 3HMKA 2VQ3A 2FN8A 3DVLA 1CJUC 1XMVA 1PYGA 2QD1A 4OJYA 2CN1A 4B81A 1KO4A 1UMBA 2F9MA 4XE5A 4X7MA 3EAGA 1T0JB 4DLRA 1Q20A 4RK5A 3PQ7A 1XAHA 4XM2A 3PJDA 1GILA 1I5EA 3PGMA 4BEVA 5T8KA 5IXYA 2XQVA 3NGMA 2VQEB 2FN7A 3AFGA 3I3SR 3ZD9A 3QQ5A 1PDVA 5FTKA 5JVDB 1H05A 2J31A 1PNVA 3JQCA 1BHO1 2Z43A 2J3EA 1LPMA 1GKYA 4JMPA 3GMDA 3UT6A 4ZHSA 4LBWA 1UM9B 4UXJA 4WT7A 2V6MA 3I4CA 2GAFA 2FRDA 2LKCA 2ZJYA 3P27A 2QM0A 5IABA 1NURA 1TKAA 2PUAA 3RC9A 5FHQA 1Q1AA 4UDNA 1SUDA 4W99A 1ZW6A 4MRSA 4H4CA 1JJFA 5TY0A 5FUQA 3U6KA 4Z9FA 4Q9AA 1FCJA 1HBJA 1MIOA 3NFYA 5GIPE 4OQDA 2QW8A 3FGNA 2RE8A 2IYWA 1KYVA 1P74A 4UEOA 2DCMA 4E14A 5EJ8A 4E2XA 1H2HA 1EB9A 1B6GA 5EYPB 1N2CB 3GWZA 1AKYA 4EB6B 1GRCA 2GAOA 2Z6AA 2ZBFA 4TRRA 4D0LB 4HZIA 1BE6A 2WU8A 4HDNB 1C9DB 2JIDA 1NXTA 2X9QA 1VJ5A 1NKSA 1TJYA 1Y1LA 1CTQA 2A5GA 2OBNA 2QPAA 2ZWAA 2PA3A 3UZUA 4ARAA 5A9SB 3KZXA 5EXDA 3MF4A 4BC0A 1JWLA 2Z4SA 1CR1A 1ZMBA 4A6EA 2JGJA 1VC2A 3CEPB 3JZDA 3PHLA 4UNQA 4XVRA 3R7FA 1QUEA 1VM6A 1FFGA 1S0UA 4PWZA 5CT6A 3M1LA 3L0PA 2DLDA 1JSCA 1H2XA 1G5IA 3V55A 1MQ8B 3V5NA 3IHWA 1OCEA 3EFOA 2AG8A 4KQCA 4QHYA 1V43A 5AXAA 5LU8A 2O14A 4XYEA 4OYHA 2PRIA 2EG9A 2I6XA 4CM1A 1XZ8A 1CYDA 1FEZA 2Y27A 1TLLA 3BH6A 4FYMA 5FNVF 3QW4B 1V7PC 3QUBA 1OBCA 1THZA 3EOBI 1U7UA 4BPRA 2GERA 2IU0A 2A5JA 4YQZA 5C32A 4WQMA 1IZ8A 2NZ2A 4PBSA 3UWOA 2V7QA 1TPYA 3TTSA 1JX6A 1TYAE 3SF0A 2P2LA 4BB9A 1U9JA 1PE0A 1R9NA 2FPIB 2NTJA 2X7XA 1QZXA 3K30A 3LPCA 3A1FA 3OD5A 3VR4A 1ECBA 1QTNA 4N8EA 4PFKA 4QWMA 5KNDD 5DZSA 3GVHA 3VYWA 5BVHB 3A11A 2ZUSA 4FZVA 2FWRA 3GUUA 2WQ6A 4DV3B 4JYAB 5FWAA 1UZUA 2Y1GA 3VVLA 1I4OA 3ZCXA 2ZAGA 1IWBB 5IFLA 3KSDO 4PF1A 4B6GA 3DNPA 2VNHA 4I6JA 5SY9A 5G1PA 3DC2A 2PH3A 2GEFA 2V59A 3O2NA 3F3MA 3X1WA 2ALJA 4JC8A 4LXIA 1NR1A 2RARA 4EQ6A 1SCAA 2EGUA 2QS9A 2JJ2A 4JB8A 4JNKA 4O8ZA 5DVZA 3IQEA 3TSOA 5BW4A 2C9BA 3H1FA 4AQ7A 1U99A 3MEQA 1IPEA 4BZZA 1O0BA 3IP5A 3P2YA 3P0FA 1W4BA 2C1XA 2GBLA 3O9ZA 4YAOA 1Z4QA 1A7KA 2IXFA 1QHXA 2VS1A 2RCYA 3NVDA 4YJHB 4CM7A 1U3CA 2CVOA 2EHJA 4GP6A 4POAA 1U0FA 4UC0A 2PUWA 1POWA 1MB0A 2HLNA 2J5XA 1FS4A 2FKAA 2QPTA 4B3TB 3VISA 5CLLA 1P44A 2HRQA 3OZSA 3TTXA 2BZ1A 2VYVA 1LU9A 4NKRA 1V8DA 4NS1A 3QVTA 3NHJA 4ZODA 8AT1A 4I5EA 3JWIA 4BO9A 1MO3A 3NIDB 4C78A 4EHKA 3OJFA 1GR0A 2I99A 5I8ZA 4Z9AA 1YBAA 3V1YA 1NFRA 1PYOA 1NSTA 3BAZA 1RFGE 4N3CA 4XFDA 4LJ9A 2VXCA 4Y2HA 2VP5A 2R6GA 3IUEA 1UZLA 5LBUA 3NDPA 2AJ8A 3ZK9A 2FW7A 3PEYA 2JFQA 3SDZA 2YOFA 4ZAZA 3ZU6A 1ZKDA 2P35A 4DYVA 3JW8A 3TECE 5C34B 4QBIA 5IT0A 4BMXA 2ORIA 2HPVA 4YRRA 4YAWA 1O6BA 4DNOA 3E15A 1G3UA 2BKAA 4LSGA 2FWMX 3Q8KA 1N2BA 3N0XA 4DLTA 3RTAA 1WXGA 2HPHA 1U2PA 4CLOA 4F46A 4OH7A 3ECAA 3GFTA 3L4EA 3OTHA 4DMLA 3MK31 3VAYA 1GP2A 4RZIA 1BQ3A 2AE2A 3EN0A 4NEGA 3B7PA 3N1UA 4PBRA 3QLVC 1WDWB 2D8MA 4ZGBA 1NTOA 1NBOA 2GGSA 5JAUA 2C78A 4QOEA 5BV0A 2HPAA 4XB1A 3L06A 3B3FA 4ND4A 3F3SA 1XOIA 2ZYVX 3H0EA 3CZ4A 2JH8A 3FUWA 2GWRA 4ZEOA 2OFWA 3S44A 3TL6A 9LDBA 2IOQA 2B2CA 4H2DA 3KV1A 3VKWA 4YPVA 5JALA 1CHDA 3DFFA 2EZTA 4KV7A 5JQWA 3Q4GA 3N5KA 3DD5A 2OK8A 2C8VA 4RK7A 3KEOA 1RLTA 4B2IA 1IHDA 4R8MA 1KEKA 5IS2A 4MCJA 5A4AA 2JFVA 3AEXA 1JIJA 1OGIA 5GPBA 2BGIA 1UBHS 2DRIA 4Y67A 4GOLD 2HWWA 3A1WA 1YF3A 3WGHA 1Y3DE 7MHTA 3AM1A 3MB5A 1JR6A 5E6UA 1DKUA 1WNFA 1JVNA 2RGUA 3IMFA 1VJRA 1GPLA 4WFQA 4CMCA 1A8IA 1D3AA 2D4HA 5JQGB 4CEIA 5I7UA 4J1NA 3V00A 1IXSB 1M10A 3E7DA 4JP1A 3R7NA 3W4KA 1W88A 2H51A 1TIPA 2DUJA 2JAQA 2PX0A 2QVBA 1V37A 1H5QA 3MT8A 4FEYA 5DX1A 4YHHB 3VPXA 2NUBA 1ECPA 3ETNA 3FKSD 5B64A 3U16A 2PFKA 1XEAA 2C03A 2QRNA 4BQIA 4J0IA 2HRZA 2ODNA 1E2FA 2AD1A 4JMLA 3X2FA 5DN6D 2ACKA 1F0PA 4RLQA 5KB3A 3RYHB 3MJ4A 1L5RA 4D6PA 4DNXA 2HCTA 5AQ1A 4W7HA 1D09A 1M6HA 1B16A 4UU0A 1R6XA 3N2LA 2W11A 2RH9B 2V45A 3RHZA 4EYQA 4NNJA 2VJLA 3ECCA 5M04A 3ORQA 4PC1A 4XDGA 4I6EA 1ENPA 3ETJA 3BG5A 4YRCA 1XRQA 2YS7A 4QICA 1PG2A 1KDYA 1XTZA 3T3GA 3AIKA 3IKJA 1FRZA 2JGDA 3E7XA 4J0KA 4N5LA 3IJ5A 1N2EA 2FJUA 5GQSA 4ZCQA 3UOGA 3OM8A 4CKZA 1GLVA 2HA2A 4YCCA 4EA9A 2W2XA 4UFNA 1E6KA 4FC6A 3EPLA 3SZLA 2WVHA 2YINC 3R4VA 4FDUA 3K8ZA 5CD1A 1GTRA 1OTXA 1ZCFA 2HMUA 3DL0A 5AI5A 3WK8A 1B74A 2XQKA 4DA0A 1VE1A 1SRRA 5LUAA 4AC9A 3NHUA 2IYXA 4LRTB 2R8BA 4FONA 3TR0A 3TAHA 621PA 4NJMB 3CVWA 2XQJA 1IBRA 2OCDA 4KBFA 1U0JA 4OB6A 3VO1A 4JWKA 4TV8F 2IW3A 1KEPA 3ER9A 4UBIA 5EQDA 3X1DA 3HS3A 1NVDA 1Q21A 1UWLA 2O52A 2QXTA 3D7LA 1ESCA 1RYDA 2IOYA 3I0ZA 3F5DA 3ZKWB 1FVXA 2I62A 5HKBA 3TOSA 3LPDA 3AP2A 1HDYA 5E7IA 3O47A 1DRJA 1OYYA 2EJBA 1M0SA 1WM1A 3Q5GA 3M82A 3CRNA 5CVVA 1G3QA 1MGOA 3R3VA 1E2IA 1BFKA 4P4GA 3ABZA 1RRPA 4NVRA 3BIJA 4JT9A 4O4JF 5T6BA 1XN4A 2FQXA 3I1JA 3GXOA 1E3LA 2PWPA 2QN3A 1FP6A 1H69A 2IODA 3PIDA 4X8OA 5DYYA 3SR4A 1A9OA 4Q1DA 2EF1A 4W8GA 3QYJA 4KITB 1IOLA 3MWDA 2P4UA 1XKQA 3T4EA 2N3ZA 1NNEA 2XBMA 3FSJX 1RXVA 4K87A 5KYNA 2SICE 2PRSA 2P67A 2W00A 1G6HA 3DMNA 1Q77A 1V7CA 2VHEA 2XF8A 3BQ9A 1NUQA 4IMIB 4L27A 4LZLA 4B3IA 3UIEA 4C9BA 1KJZA 3PIRA 4WK2B 2F1HA 1FU4A 4LEIA 1O9GA 1PBNA 1M1ZA 3C8UA 5ALTA 3WLRA 2R2AA 2ZYUX 4ZVKA 3SF8B 1Y1PA 3ZXYA 5LPNA 1BCRB 1YS2X 3DE5X 1RTTA 1ZK4A 1KQOA 3MVEA 4OHXA 5AOVA 5CEEA 6AT1A 5JRZA 3JATB 3VVMA 2BGNA 1Z73A 2H92A 3KD2A 2AYXA 4ARIA 2B35A 2GM9A 2IP2A 4DIBA 3QWAA 1SOVA 1TKBA 3H17A 4JITA 3ZXXA 1ZUNA 5CFQA 2X0IA 5FOUA 2R7NA 3OI7A 2P9CA 4RXUA 1KE1A 1IHPA 1QFZA 1T6YA 2VHQA 1G2QA 4FHFA 3ZZNA 1O97D 4QGBA 5JC8A 3F1KA 3H2GA 3JRWA 4WXEA 1HNZB 1NQ5A 3QEMB 4ADSG 2DU8A 5AOCA 4BNUA 5C8VA 4CLXA 4K9PA 4ZV7A 3GQBB 2OAQ1 1DJOA 1F14A 4XGRA 5FUYA 2DVMA 1J5EB 2WV7A 1QVRA 1KMQA 2IYRA 4ZALA 1Z16A 3HBNA 1RIIA 5CIWA 5TGDA 5TGTA 4BNWA 4E2FA 4C89A 2VA9A 4Y1EA 1II8B 3ZHQA 1VRWA 1UBNA 1DQSA 1ISFA 3HPQA 1J49A 1RQXA 2MIIA 1KY4A 4OMCA 4CKEA 3M9LA 2P27A 2ZSIA 3TGPA 1HNXB 1REQA 2BFDA 1RHQA 1VL5A 4UM9B 1C7IA 3UFXA 1EE2A 1Z63A 5EKSA 4P5EA 1HDEA 1X1QA 1WNTA 3CE6A 3KUCA 4MK4A 4RADA 2QWXA 4DTCA 3GUHA 4XQ0A 5DM0A 2LDBA 1R9MA 4Q4AB 1BW9A 3COJA 4KQXA 5CITA 1R7RA 4NULA 1Y5RA 1M2HA 5AVWA 3BPSA 5CH3A 2DPMA 3C16C 3AHJA 3IB3A 3BA6A 3GV0A 1EX1A 3T3IA 4ZEWA 5K3EA 1POXA 4Z51A 4HDMB 3RYIA 1GU1A 1YR7A 2GPSA 4AG6A 3RWBA 5DM4A 2DLCX 3AR9A 2FEOA 1ILWA 2CFCA 4Q4HB 4RVUA 2A2ZA 4UUOA 1GZSA 4PSKA 2XF2A 3NT5A 3D7RA 2CNLA 2XDQA 5IHPA 1WZIA 2HFJA 1RI3A 3EQ7A 3EXG2 4WNAB 1PI3A 2R60A 2ZVJA 5IDYA 5CT5A 4N5DA 2FHPA 2JRLA 3EXHB 3HP7A 2EQAA 3ZG6A 4DLVA 4EY8A 5CA1B 1ZP6A 1Z6QA 2GS9A 1OAOA 4MX8A 4RQAA 2XMZA 2ZJFA 3CE9A 4H7EA 2C4KA 4NBRA 1II0A 5CP8A 3SOZA 3ZVMA 1JQDA 1YIOA 3M4YA 2QUAA 4W5JA 1Y6GA 1X8XA 4MKFA 2H54A 1U2GA 3UWPA 3ZIUA 1FX0B 421PA 5CNMA 2R8EA 3R23A 3LDGA 5CEJA 5A3VA 4UXHA 3S1LA 4BJHB 2R87A 2OBYA 1E32A 1TU3A 4BUZA 2F3TA 5JAOA 2GM5A 1HL3A 4RHYA 5E4TA 3V6LA 2OBMA 2ZIVB 2EWVA 2QDXA 3IDSA 1VPLA 3K20A 3DCIA 2LPMA 4HGRA 4Q66C 3WKEA 5JZVA 1I1NA 2FFJA 3RT1A 5A9RA 4QBTA 3N8IA 1C0IA 4TKVA 4N0MA 3KKZA 1MB4A 2ZULA 3CF4A 2DY0A 3JD1A 4P3KA 4QD3A 2C20A 5I9LA 1VP9A 1XAIA 2F1JA 2GPBA 4FFBA 4Q12A 4C7KA 4M7RA 1EHCA 5LA6F 2X1HA 1JG1A 1XLTC 3C85A 3DB2A 3RSQA 4EX7A 5AK0A 4CMBA 4PFSA 1JAZA 3IXLA 2NAPA 2WJIA 3WRXA 3FFTA 1EMDA 4PM4A 3AUFA 5EQFA 3RTGA 1PEYA 2ZYTX 3ZUGA 4IRUB 4DIMA 4MS4A 1Q7BA 2GDZA 3AETA 2P75A 2FB9A 1EP9A 1QO7A 3MOSA 4YREA 4GG1A 4CM9A 1WMEA 4AY2A 1PTJC 4IDGA 5FPQA 5LN1A 2Y3IA 4RETA 4IGFA 4TMWA 3FBGA 2P2CA 3K4PA 4DJEC 2Q5QA 2R11A 4FHZA 2EF0A 5FV7A 4C0LA 1G21B 2V5UA 4Z9XA 2P9FA 3Q7RA 2C2XA 4Y6QA 4QU9A 2VBCA 3ZV6A 4UTVA 4TVKA 1PX0A 4PZCA 1ZEMA 3AL0C 1ODSA 3CB4A 3HPRA 4E7OA 4OX9Y 4ROSA 1CUJA 3ZHCA 5KYVA 1V6CA 3DEAA 1X9IA 5CXXA 3ZWXA 3IAS6 5A05A 1QAOA 2HJRA 5AVJA 1T5LA 5FTNA 3E3LA 2YWBA 3QV1A 4XGQA 2C2OA 1CY2A 1L4KA 3UJ6A 5KYUB 3C6YA 3T9CA 4XUCA 1Y1SA 1GTG1 2PLWA 4IIXA 5K99A 2Y2UA 2W8ZA 2ZIUB 3DULA 4IHAA 3QM1A 5B55A 4Q47A 2LKDA 2P9YA 3G0CA 4IUBS 2CC2A 2IPOA 2JIBA 3CG0A 1NMXA 3HVIA 4OBBA 4ZZ3A 4CXMA 3WGGA 3AK4A 3Q9NA 4CWAA 1P4RA 1XCLA 3U61B 2XNDA 1UH5A 3HNRA 4FHEA 5CFNA 2O3TA 3NIBA 4N5MA 4KPEC 1KOLA 2EDCA 1TC2A 1SGWA 3DP7A 4FJ0A 4B3FX 5ILQA 3T1OA 4ZEMA 2PLAA 1A4RA 5JSHA 2GF0A 2Y1LA 4TQAA 4EY6A 1MB2A 5JJ5A 1WCIA 5FUWA 4LJYA 1U1DA 3RSHA 3R4CA 1K7FB 5KTPA 4FGJA 4UPEA 1S8NA 1HURA 2QTBA 1G4AE 4PSDA 5TNXA 4JHXA 2P1DA 4B6OA 3COPA 2J0UB 5IANA 1WO8A 4RD2A 4U1RA 2B1JA 3OG9A 3WYDA 1IJFA 2AG0A 5DCUA 4TQ9A 3WX0A 4MV1A 3TO5A 4PBTA 2X8WA 1D7AA 3NU1A 4X94A 1IWOA 1G20A 3B2EA 3R41A 4QQNA 4KQ1A 5HFAA 3R6DA 2ECQA 1TQHA 1O6GA 1X1EA 2FTKE 3RRBA 1KAOA 2AMFA 3OOEA 3I61A 3FNBA 1YA8A 2V8BA 1BDHA 1YQTA 3GGDA 3HRHA 4NCJA 4DIUA 4DRXB 3WGIA 4RQTA 1A4XA 5T5QA 4GKKB 2GZMA 1YAHA 1MNAA 5J1SB 4M8NE 3SBDA 4RMGA 2HSDA 4HWOA 5DMHA 1G5PA 2V7TA 3A0UA 3AJDA 1OPRA 2VAPA 3HN2A 1DQYA 2TMDA 4NZYA 3MWGA 1QTQA 2WFAA 4HQNA 4ZKEA 1W1WA 4KRYA 4M9XA 2R48A 2UVPA 2YN4A 3HKBB 4JI4B 3IRUA 2F64A 2UZIR 5KNBD 3DF7A 2DSNA 3EZFA 4XEHA 2AFIB 4LOAA 3JAKA 1GKLA 3U7HB 4I4TA 2B1GA 4RENA 3S55A 4QJBA 4MINA 4A2PA 1SKAA 2MHCA 3T5MA 4E5YA 3URMA 4JC0A 1EEXB 2AHOA 3PGXA 2PUEA 1ZCAA 3BHJA 5BNZA 1RCTE 3PICA 1EDBA 4Q18A 5G1NA 3OIDA 3GL9A 3I6IA 4PICA 4PPFA 5K03A 4DV4B 3NC4A 1QIKA 4TTJA 5ENZA 1SXIA 2EYQA 1RKQA 5EN4A 3OIVA 3UK7A 4WE3A 4CBVA 2F3UA 3NBQA 2JLVA 1TJ4A 1ZUD1 2QSZA 3ABQB 2FPKA 3QVLA 5HE8A 2CXTA 3IEUA 5JY6A 4NP6A 3BF8A 5KSOA 4MP8A 1G60A 4OKNA 3GPLA 1Y8CA 2XPCA 4JJGA 4F3NA 3J80A 1OTYA 2QRVA 1DEXA 1E79A 1ZPDA 3EC1A 3OURA 2CHVA 3BILA 1DTWA 1YJ5A 2A57A 3BE4A 4O1HA 4JI0B 2LNDA 2WJHA 3C6XA 5AW9A 2QUJA 3ICVA 4KMMA 4DMGA 3N2KB 2PAAA 1JHMA 1UFVA 4WCFC 5JMPA 3EVEA 4IJ6A 3DM5A 3V2IA 2FN3A 5B12A 4LZZA 3O7MA 3ADCA 3LOQA 4FKZA 3HB0A 5BV8A 1HDXA 2R1VA 1R2QA 1OV6A 1K0UA 1YZ3A 1SWWA 3QLUC 4G01B 4URVR 2HADA 1SG6A 1SG9A 1EG2A 1JMVA 5TT0A 2H59A 1JHYA 1ZJ5A 4UHHA 5ICSA 3OHMA 4FYWA 1L5NA 4WEOA 1XZKA 1FFDA 3DMPA 221PA 3G2HA 1D6NA 1C7ZA 5HFNA 3FAKA 1FJHA 1WV0A 5I51A 4DSOA 2AOTA 1YA4A 3FGPA 3QHPA 3IKLA 3T7KA 3QP9A 1CZHA 2Y1KA 2V1XA 5HZMA 1X7XA 4QATA 4UPVA 4GM4A 3BB1A 1YTUA 4RW0A 4JJFA 1TDJA 3ICOA 1DIGA 3K1TA 1TVKA 1EWKA 5FFFA 1A1SA 5DHRA 4E4TA 3CRMA 2ZSFA 2Q4BA 4EW1A 2WD9A 1JR4A 3ASUA 3BJZA 4PYOA 5IWCA 5LWQA 5IW8A 1KMIY 2P0AA 2CV2A 1OI7A 3FLAA 3M6IA 4I50F 3KU1A 1P3Y1 2QRJA 4WKBA 3VRHA 3OBBA 1EKXA 1OHHA 4FR2A 4OGWA 1DEOA 4WZ6A 4PHCA 1A50B 4KUGA 1E98A 2XIJA 3C5EA 1QNFA 3K0AA 3DXXA 4MLPA 3P2KA 4U5QA 1VA4A 2A0WA 3QNWA 2C82A 3HJCA 2RGXA 1F3OA 4ZTBA 4BGVA 4ZRNA 2VNKA 3ZUPA 1V1JA 1QFMA 3BXHA 3EGDA 3EF1A 1T4CB 4CV3A 1I3KA 1UMDB 4NH4A 2PGNA 5BWMA 2BCGY 1VFNA 2WQZA 3JAMA 4EHDA 2WYWA 3BMNA 1OLSB 4U6NA 1CE8B 2P9EA 1H2BA 2FP3A 1PQWA 3ESXA 1KJ9A 1QJ4A 2DHCA 4NBVA 1ZGCA 3QXXA 3C97A 1VE5A 2MYPA 3P8ZA 2JLWA 3ZTYA 1S3SA 4TQUS 3KO8A 3JRXA 4KPFC 3F4KA 2FQWA 3BHMA 4KSBA 3TMAA 4UUMA 3EQ9A 1X7WB 3M8KA 1LLQA 5G3YA 5DYTA 2VRCD 1WXHA 4TS4A 3W9BA 4XJVA 4GL2A 1U7PA 3ENVA 2ZM6B 1MC8A 5HF8A 3VUEA 3ZE0B 5L6LB 3ELYA 2Z9BA 2EKBA 2PMWB 3GA0A 5H1YA 1PD0A 2P3SA 4X20B 1FFEA 4P36A 4XVUA 1X7GA 4DT1A 1SCKA 3ZHYA 5LLDA 2COKA 3G7UA 2WI8A 2B94A 2CLCX 2OBLA 1BS1A 2LZ0A 2O2ZA 2Z56A 2TYSB 3AHGA 1JR3A 1B4DA 3T3PB 3ENNA 4HFRA 2WJAA 1VA5A 5J58A 1QWSA 1E0JA 2QM8A 3D8HA 1J39A 3TLMA 5FBWB 1D2MA 4EGFA 4XX0B 1I2CA 4XPZA 4ASUD 3E2PA 4G25A 5FBKA 4ZI7A 3G02A 1U3WA 1AHHA 1QYCA 3MCUA 3QKSB 4MAMA 3RYTC 2DOKA 2N42A 2O2CA 3OIYA 4KFRA 3UMYA 1U1GA 2G4VA 4INAA 1OQAA 5K0SA 2JZNA 3AUKA 3WNBA 1CF4A 4U63A 1WTCA 4AYXA 4XPIB 1LW6E 1OV4A 3EC7A 5FL7D 1NGSA 2JZCA 3QI2A 5JSQA 1ULTA 4DCPA 2ZXUA 1FJXA 3ADOA 4TGLA 2QQ0A 3ZN2A 5MDHA 1LC0A 5CG1A 2WWRA 1QRAA 1F2VA 2C94A 5ALLA 2AWOA 2V7UA 2XECA 1OFUA 1UKVY 3TW4A 4EVRA 5D87A 3CF4G 1N9GA 4FFPA 4C0KA 1PJ3A 4HMOA 2FDRA 3FRHA 4AD8A 5KSZA 3FWNA 5DOVA 4X90A 5AICA 1W30A 2VXYA 4BAUA 2FMTA 4FGZA 4CGYA 5AM3A 1JPNA 5AYVA 1B73A 1P7YA 4A2QA 1J56A 3N53A 2G1AA 2P4QA 4NZZA 3HWRA 4AAYA 4L3WA 4WIAA 3GLIE 3DLPX 2Y1XA 2REXB 3O84A 5KX5A 2J0SA 1WL8A 4AY5A 2PSJA 2ONJA 4AMYA 3LV8A 1IC6A 2P90A 2HO4A 4AX8A 1C4WA 3FA2A 3OPQA 4OA8A 1P9WA 3KYDB 2I65A 3DYBA 1OU4A 1VPTA 2I8AA 2V8OA 3FETA 4O2BF 3VTFA 3ZGOA 2E6UX 4EUEA 3PC3A 4XIFA 4YRJA 4H7DA 4UJ3A 3AM4A 3BD6A 1VJGA 1WXXA 2B4YA 5KVAA 2GPWA 1OSNA 4RDHA 3LQ1A 3ZDXB 1ZC4A 1ZJYA 3PPWA 4IVQA 4YRIA 1YR2A 1J06A 3PWKA 3U3DA 1UUFA 4G37A 1IHXA 4XOIA 3JD2A 4QOGA 3VZCA 2IZ6A 1IEVA 3KG2A 2OCGA 1NR7A 1OT3A 4HT3B 1YUBA 1LPNA 3MN1A 3AR8A 2QJTA 3PHIA 1JMKC 1L4FA 3UKDA 3LK6A 4OUDA 5HX7A 4LMAA 3N0WA 2IXAA 3GLTA 3PHJA 1XZNA 5T6MA 5A06A 5LQNA 1OZHA 2A9JA 1YACA 3EEIA 3MCVA 4KZKA 4HQ0A 5GOTA 5CFLA 1V5EA 1KZGB 1WCV1 1ZNYA 3JQ8A 2WZDA 4B6PA 1NW5A 5MFPA 4RSRA 2OGTA 5JISA 2NU8B 4DQXA 3I05A 2A30A 3I4FA 3H2YA 4D4GA 3R8FA 3A9SA 5TS2A 1J25A 2CNKA 4FQ7A 3EG9A 3IR5A 2BKVA 3AUJB 1WUYA 2AEFA 4XLTA 1I3LA 4KUHA 3DLCA 1LDYA 1J0CA 3PEUA 1KERA 4Q3BA 4PRYA 5G40A 1BKSB 4IOJA 4QNNA 3N07A 4D25A 4RL6A 5A03A 1TPZA 4M53A 4L2IA 4CI0B 1JI3A 3O26A 3ZY2A 4PC3A 4B73A 3GH3A 2DUNA 2HQRA 4KX5A 4BLUA 3DWEX 4Y6LA 3RVKA 3T4XA 2P6RA 1E5TA 5IAGA 4AP9A 5CB4A 1SWVA 3JQGA 2Y6UA 2Z58A 1PX2A 3MC1A 4ITVA 4KLAA 4M9RA 1GQRA 1RI4A 1B2RA 2OENG 3B3AA 4UMVA 2JBAA 1Z5OA 3S8YA 4QARA 8MHTA 3UUFA 3SQXA 1NOIA 2BFCA 2IV2X 4D3SA 5LOVF 2J0QA 3DS8A 1MH1A 1N6KA 3OM9A 3UENA 4ER3A 5J4KA 1JHVA 2VDPB 4KE9A 2NO1A 2QNBA 1QPZA 1T91A 1ECJA 2G9ZA 5EHIA 1RQRA 3EYAA 4ZU3A 1P81A 2BTQA 4AZTA 3GN2A 1SVNA 4YJGA 1GADO 4JEHA 4M22A 4Z2YA 4N8DA 1WHTA 4F4DA 1ZOOA 1OLXA 3PBKA 3G0GA 3PZBA 1Y1QA 1C3OA 1H5NA 3QLEA 4KXUA 4NBKA 4O1IA 4WD3A 5CW1A 5DLPA 5LXTF 3SC2B 3TM5A 1T5TA 4C4XA 1CDZA 3CRZA 4IEFB 3DEFA 3HDYA 3JPWA 4Q39A 4JT8A 3O3NB 4H08A 1XELA 4DMUB 4B43A 3DBRB 4CMKA 1Z38A 4UMFA 4R2LA 3GCZA 3EFHA 5IPFA 1H65A 2Y66A 5KQLA 1TTTA 2F62A 4BVHA 3KJGA 3AUAA 2PNJA 3SG0A 2PGIA 3QKRB 4C1BA 4DEVA 2RGAA 4Q37A 2PZGA 3H9EO 4ZZ2A 4PG8A 2AOWA 4HDCA 4Q7QA 5JBQA 4U7DA 1LQTA 1H2AS 1Z0ZA 5EXEA 1JEQB 4NAUA 1WTAA 2BDUA 3PC7A 1YCFA 4IXNA 4RV5A 1NY6A 1QH8A 1F2UB 2PMDA 4Y7DA 4RQUA 3WDLA 1K9SA 2E9SA 4LCBA 2O07A 3L02A 1NIPA 4QU0A 1JF8A 2QE7D 5AJYA 4EPTA 1R4MB 3HB9A 4GUDA 4PSVA 2YXLA 4G67A 1F4LA 5EE0A 1Z34A 1KJNA 1Q7GA 3QKWA 1RRFA 3DOUA 5FLEX 1EE9A 4B3GA 4IQ4A 3SHOA 4BFYA 3DTYA 2ZXFA 1USIA 1QWOA 4C07A 4CQMB 1SCUA 5H9WA 2OCBA 4EI8A 4AULA 3I76A 2ZSUA 1L3BA 4G0OA 3BGOS 3CLTD 2P9GA 5FYDA 2CLFB 2VZ8A 2GVNA 4N3AA 5CA0F 4OYLA 2DSTA 1NE7A 2R751 3BM5A 4A16A 4CF6A 4ILEA 4XYBA 1CV2A 1QRSA 3TQFA 1MABA 1Q0QA 1J20A 1E89A 1MXHA 1MUUA 1Y3CE 3JWGA 2Q50A 4HPWA 4X45A 4Y2UA 4YRTA 3PEWA 1NJ2A 3T8YA 3RAFC 4B3BA 1GTJ1 2ZRDA 2DM6A 2KPOA 3D59A 3KZCA 3L4BC 3PQ2A 3QX8A 4D0RA 4X84A 4EFKA 5BMVB 1JDZA 1UMKA 3DXYA 3W79A 5MGNA 1J1ZA 2FFRA 3A27A 3L7BA 4FX5A 1HFWA 1JVBA 3OEED 5CVCA 1CZNA 3H0CA 4KSCA 1PKEA 1ZH2A 3GEGA 3A1SA 1CWUA 4HWTA 4MKRA 5IXSA 2HWXA 5AJWA 4LRUA 1T6BY 1IN8A 1NHGA 1ZWKA 4M60A 1YE8A 1NYRA 3P52A 1NN3A 1U2DA 3ENKA 3MILA 4RLFA 1UBEA 1Y9ZA 3D5QA 3BJIC 3I4LA 3ZTWA 1JI0A 2RJOA 3H3FA 3TCKA 2VSOA 3AIMA 4O4IB 5KTMA 2QDKA 2ZETA 3GLKA 5DBIA 2CLHB 2JIQA 1LUAA 3QVUA 4N0DA 3U5TA 4WVLA 1JDPA 2BSXA 3AFHA 2PQ2A 3CUUA 1Y5MA 3OSZA 3FPEA 4J16A 2RFLA 1AKEA 4N0EA 2FSIA 5FLKA 4NHEA 3ND9A 3P9QA 2Y0BA 3PWTA 5HUJA 4Z4EA 3PLAE 2OLEA 4GPZA 4URXR 1AJEA 2XRYA 1N3IA 2PUJA 4W1SA 1DSSG 1EA5A 3W5UA 4D4KA 1K63A 1L8LA 4X93A 1D7OA 3CUEF 3SVZA 2P6PA 3LI2A 3UXHA 4DG9A 1NMEA 4N40A 4GF5A 2WC1A 4QJ5A 4RANA 1DQRA 1M2OB 3N70A 5KYWA 1N7IA 1TZJA 1HO3A 3L7AA 1UK6A 2GYUA 3A28A 2IYLD 4N54A 2WWIA 5GV7A 4HNGA 4QM6A 2O8FA 2JHPA 2OXFA 4PRLA 3NCHA 4BVEA 1M1NB 2VCEA 3FSGD 4XD7A 5DEOA 4AG5A 4EUSA 5LDDC 4JOCA 4CG0A 2WD7B 4RS3A 1C29B 4HTFA 2JLBA 5ECWA 1HYHA 5E3IA 5FNVA 2Q29A 2Y9MB 4TLMB 5E3HA 4LY9A 5CVTA 5JMTA 4WN9A 3CEJA 1HTTA 3GN1A 2OCPA 2YMMA 2QT1A 4N48A 1KI1A 2QP3A 3ZV4A 4C14A 1I4DD 4RCZA 3VNUA 4C7BA 3GCDA 4KEAA 4PLCA 3P97A 4Z0PA 4KNVA 1W34A 1KI9A 3AZOA 3LFUA 3TVTA 4KQ2A 3SEFA 2ZYSA 4XTCS 1W6UA 4CIAA 3HJHA 4OGLA 4D9EA 1FMTA 2FFQA 4HVTA 1QB8A 2OFOA 4TXNA 3AEZA 4X60A 3OTOB 2D5BA 1TK3A 2UUPA 4MHTA 4M4SA 2JCVA 1IZ0A 1HY3A 2ORWA 3IE0A 1P4AA 2OOKA 5FH9A 1L3IA 3VR0A 2EARA 3Q9LA 3O8DA 3QSGA 4X6LA 1ENOA 1RYBA 2CJYA 4B47A 2CCJA 3ZJ5A 1TUGA 2OR3A 4MITA 3WGOA 4CV1A 3NAQA 5A71A 1K3TA 1MVOA 3LSYA 1DG1G 5CHEA 1UP6A 1XP5A 3BJEA 1EEHA 3COYA 5IJ9A 3SVTA 1L7MA 4GRIA 4KRXA 2XBLA 4DKJA 3JQBC 3WK6A 1TGYA 5EP3A 4RA6A 5BSHA 3LBIA 4A8JC 3FPGA 2A14A 2DUUA 4XYGA 2C3OA 3CPHA 1V3QE 3C7DB 3I58A 5H3CA 1QLWA 5J2UB 2Z0MA 5K3CA 4AKSA 3IMEA 1FSZA 3AEYA 4EZIA 2CD7A 3DPUA 5CJPA 5CM8B 1W75A 1JDSA 3H9QA 3VPCA 2QBYA 3BX1A 3MT0A 2VDNB 3WGLA 3PNQA 2PKXA 1P7ZA 2A0KA 3UJNA 2ZBVA 3NJ8A 4WCFB 3VSCA 4JJKA 1GR1A 5BWBA 1ATZA 1K4MA 3KSUA 3TLBA 1WF6A 2PBRA 4QXRA 4RIEA 5TPZD 3THYA 4JP5A 3K9HA 3E81A 1CEYA 1SUCA 3QXSA 5DI3B 4ZYXA 4MR9A