5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
b'EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
source organism Brucella abortus biovar 1 (strain 9-941)
molecule tags Oxidoreductase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
3DHYA 3VH2A 4P4GA 4KQWA 4RVHA 1E3EA 3ZU4A 5A9RA 1PJ3A 5GZ1A 2AQHA 1NPTO 4YTEA 1IY8A 1PS9A 4XIYA 1AGNA 3ONEA 5JCXA 2ZQYA 5KIAA 1HRDA 4MIOA 4O59O 4WK6A 3N7UA 3TRIA 4RF2A 4RPHA 1ZK4A 4BHTA 2J5KA 5C37A 3U62A 3WG9A 5A3JA 4OXNA 5BNFA 2O2YA 2Q4EA 2W90A 4QUKA 2Y67A 1IB6A 3JQDA 4PG7A 3AOEA 1E5LA 3DB2A 4S3MA 4F46A 3RJ5A 3ASVA 2OO5A 3ZU5A 5KJEA 4WNCA 2X6TA 1A9ZA 4OH1A 4PZCA 4O63O 4CMGA 3ZV6A 1YQDA 3K6JA 1GFSA 4EI2A 1LRJA 1E3WA 3KVOA 3JQBA 2P4HX 2JAHA 1X1TA 5G0TA 2NACA 3OF2A 1B16A 1LJ8A 3GR6A 4H3VA 3ST7A 2DU8A 3RKUA 4IJWA 3MTGA 4JJIA 3QLJA 4LISA 4NBTA 4RCVA 4MPDA 1VRWA 4FCCA 1H9AA 4MVJM 1P1JA 2NU7A 1GUZA 1PR3A 2C59A 2CFCA 3RSHA 4QEDA 2BHLA 3IC5A 2C5EA 4YJFA 3LF2A 3WYEA 4KDFA 4GSLA 1HYGA 1NR1A 3O4RA 2C20A 1EFKA 4XB2A 3VC7A 1M66A 4FR5A 4E4YA 5TRTA 1NFRA 5A06A 3KOUA 4NHEA 4J7UA 4JBGA 7ADHA 4Y67A 3HSKA 1E7RA 3ZNOA 4YJGB 2VT3A 1NTOA 1ZEMA 3K92A 2R6JA 3L9XA 1NQ5A 3PHIA 2IYPA 4QX6A 5TJ9A 1T24A 2DKNA 3U0BA 5IDXA 1Y8QA 3I5MA 4XGIA 3QV1A 3EDMA 3BHJA 2BELA 2ZTMA 3DMTC 4YT4A 1X7HA 1A7KA 2JKVA 4IINA 3JQEA 3AFMA 4B7XA 2C7GA 4D3SA 1PSDA 2JJYA 3DBVO 4TVOA 1Q7BA 1N7GA 4R1UA 2BFAA 1TVEA 3NT4A 1YDEA 3P2YA 2HK7A 2ZTUA 4PIVA 3AI3A 1YRLA 3OJFA 3H5AA 1UP6A 3NUGA 4AJEA 2GD1O 2Y99A 1C1XB 1H6DA 1JQBA 4CM9D 4N5MA 1CYDA 2EERA 4MP3A 1NPYA 2P68A 2QRJA 4DIFA 3OFSA 1FXSA 3S2GA 3VPHA 2YHIB 5FEUA 3B1JA 2HDHA 1I24A 3DTTA 3GVCA 4BMVA 3BTVA 2B4RO 2HSDA 1D3AA 2D5CA 3WB9A 5JY6A 2JCXA 4ND3A 3GC6A 4O6VA 2DBVO 1YXMA 1PWXA 4UVDA 2WYWA 1L7EA 2ZIZA 2EP7A 2VUSA 3FSRA 1WZEA 4WCFA 3GZ4A 2CD9A 2PD4A 4J9VA 4BNNA 5IAAA 1VLLA 4W99A 2CVOA 2DBQA 2Z1MA 3VDRA 1PQUA 2ZB7A 3F3SA 2ZQZA 1KVSA 4AL4A 4XYLA 4JK3A 2VWQA 2UYYA 4P38A 4GKBA 1FDSA 4IXWA 4R3NA 4CM5A 4JBIA 1JKFA 2H5LA 4MVJI 1RWBA 4OOFA 3MEQA 2YUTA 4RGBA 2HMWA 1GPJA 4BO2A 1QSGA 1ZEJA 2DFDA 4CM4A 3C7AA 3PWZA 1W0CA 1RJWA 4LCEA 4LSWA 2RHCA 4K26A 3VZPA 1KERA 1T2EA 2O3SA 2C07A 4N54A 4EW6A 3JQAA 4CLDA 2X86A 3PVZA 3FNGA 2DTXA 4J0FA 4LRTB 1N2SA 3CZMA 4B4WA 3DZJA 3KLPX 3GZNA 2BFPA 4Z3KA 2DQ4A 1Z74A 1J4AA 5EQFA 1A7AA 1HE2A 4DVJA 4BNVA 3FBGA 4GI2A 1D1TA 3OQ1A 4CR8A 3FBTA 3H2SA 4FQ8A 2AG5A 4K9DA 1PR9A 1YDWA 2XPCA 3NKLA 4FW8A 3PEFA 1ZXLA 3WLFA 1Y1PA 2W2LD 4E5NA 2PWZA 1I0ZA 1NAHA 4BGUA 1MA0A 3WDSA 4JN6B 5TLSA 4XJTA 2UV8A 3AM5A 1Q0HA 2E48A 4KDEA 5TJHA 3QIVA 1N5DA 1X0VA 1A27A 1TT5B 2I9PA 1JVSA 1E6UA 4BO3A 1X13A 3G79A 2QYSA 3WOHA 3P7MA 4B4OA 1ZCJA 1HF3A 3PHLA 2HJRA 4PLWA 4F6LA 2FR8A 1HDGO 1ZMTA 2VUTA 1P74A 1VL0A 3JD4A 4ALMA 4BKOA 3VVCA 4RJTA 5EIOA 4CM3A 1GY8A 2POQX 3KRTA 1ZKMA 3NX4A 3MOGA 1RM0A 4ESOA 4CLOB 1YJ8A 1YH3A 2ZB3A 4BNFA 3C3XA 3PPIA 4HX5A 4PLHA 2C7VA 2YW9A 4FSHA 4NNJA 4NJOA 4CMIB 1ZH8A 2B5VA 3QWBA 1YQGA 4GX2A 4J91A 1C1DB 1VKNA 2C2XA 1X14A 2BH9A 3ANNA 3JQ9A 1PWZA 3Q11A 4NPCA 1BDMA 1MX3A 4ND5A 4AICA 3COSA 2B0JA 3HUDA 3M6IA 2DVMA 3BMOA 3I6IA 4L4XA 4K1LA 4A2CA 2VN8A 4BO5A 3PLNA 2OL4A 4LSMA 4FC7A 3VAZA 3KV3O 3E1KA 3RD5A 1FK8A 4WKGA 3SC6A 3WGOA 2HMSA 2PH5A 2J3KA 4JX8A 4YA6A 3RUHA 3GVIA 5C3MA 3GLQA 4HFJA 1ML3A 1H2BA 1P31A 4OQZA 3DBRA 3GMDA 4YQYA 2Y0DA 3ZV5A 3C24A 2JFFA 3D7LA 3ICPA 1P1RA 2NV6A 3DZFA 4L75A 1MC4A 4BV9A 3IP3A 3H3FA 4UVHA 1GUFA 3QHAA 5F1PA 4AG3A 1VL6A 2ZYDA 3DBHA 2CVQA 4AJ4A 5I7FA 3D5QA 1U8XX 1GEEA 3PYXA 4ID9A 1E3WB 4HFRA 4XZ3A 4GX0A 1GYRA 4L4RA 4D79A 2DAPA 3T7CA 1SNYA 3TWOA 2OP1A 4JLWA 4TZKA 4FIZA 4ITUA 5DP2A 1B3BA 3PQFA 1E3IA 2FY8A 5JAMA 1D1SA 4KUHA 2TMGA 1K6IA 3KYBA 3VZSA 3V1TC 4BNIA 1DIAA 2JD0A 4NBUA 4PVDA 5JMWA 3P19A 4BNMA 4YT2A 2QIOA 4BS9A 2P9GA 1JA9A 2O4CA 5CDGA 2RCYA 4JP2A 5H82A 2PR2A 4C4OA 3F5QA 4J6FA 3V5NA 3S8MA 4OGWA 4R01A 4ZRNA 1O9BA 2X0IA 3JYLA 5EN4A 1LEHA 5JC8A 4MJLA 4PVCA 3UW3A 2P5YA 5DCWA 2R00A 3FR8A 4AVYA 1IZ9A 2ILTA 4BB5A 3C1OA 2VOEA 2J6IA 3A14A 4KWHA 3KETA 2IDZA 1Y8QB 2VYNA 3TF5A 3BIOA 1BVRA 2FHSA 1PQPA 3RI3A 5ENVA 1SO8A 4D3DA 3WBBA 2IYOA 3WQSB 1FDWA 1EVZA 3IL2A 3SLGA 1ENPA 2EG9A 1TLTA 2HUNA 4M89A 4BMSA 4EJMA 3AW9A 1BW9A 3I3OA 5DT9A 5AXAA 5KVQA 2X9GA 5KTKA 1CF2O 2VRCD 4KWIA 2X9NA 3LC1O 3A4VA 2Q4BA 3GVXA 3FWNA 5IXSA 1YOVA 1P33A 4K6FA 3RASA 3W8FA 4URFA 5EMHA 5K6AA 3OEYA 1PEDA 1ZK0A 3OJ0A 3AUUA 1GAEO 4RPLA 3MJ4A 1LU9A 1BXGA 1C3VA 1QYWA 2OGUA 4QSMA 2AHRA 1PS8A 3WGTA 4WCFB 1PZGA 3IUPA 1Z75A 4E32A 2Y1FA 4P22A 1YB5A 4A0SA 1XG5A 4B79A 4FJ0A 4YT8A 3GOHA 3U9LA 3PFWO 3PYMA 4EGFA 3EZLA 2VOJA 2UUPA 1TT7A 3C7CB 1DEHA 3AUTA 3PZBA 4CM1A 5T8KC 4YQZA 5ICMA 3E03A 5BT9A 3VH3A 3I4CA 2A35A 1GQYA 4ZQGA 1V6AA 1R0LA 4F6CA 2YY7A 3DEYX 1EUCA 4MIYA 5FFFA 3I83A 5IDWA 1H6CA 2EXXA 2CF5A 1Z73A 3DMYA 3PJFA 3VPSA 1QV7A 2A94A 3IP1A 4N18A 2GPTA 4YJHB 4JBHA 1NQOA 1ZIDA 3FR7A 1XA0A 1HE3A 4Z0TA 4OYRA 4CM4B 2W2KB 2BGLA 4E2XA 4RZIA 1EBUA 3NGXA 1UP7A 3FNFA 1L1FA 1J49A 1KIFA 3PLRA 5A9SB 1WDKA 1TB4A 3JQAB 5ILOA 3ZWCA 3WBFA 2X58A 4KUGA 3PYLA 1XYGA 1I5RA 1PJ4A 3CEAA 5AXDA 4IJUA 4ALKA 3TL2A 3GZNB 4HP8A 3I9MA 4OSOA 3S1LA 1X7DA 2PH3A 1PZEA 2NM0A 1DFHA 1E92A 2V65A 3AM3A 1LLUA 4DYDA 2Z95A 1MXFA 2O4UX 5IZCC 4GSKA 1I01A 3NTOA 1T1RA 4L73A 4ZJUA 2QZZA 1VSVA 1DRUA 3M2PA 2RBEA 4IGFA 1CEQA 4XD2A 3BHIA 3FNEA 1KVRA 4P4LA 4XX0A 4Y8VA 4YDRA 1Y5MA 4RPGA 3HJAA 5JW6A 5JFOA 3WJAA 1HLDA 2JD2A 3IQDB 4IGEA 4XA8A 3U09A 3KBOA 3GG9A 4KZPA 2C2YA 2JCVA 2EW8A 3P5SA 5BSFA 2GO1A 3HB4X 3LZ6A 3BHMA 4ALLA 3IKVA 4MVJA 2Y0EA 3OICA 5JCJA 2BKAA 4L9RA 1B15A 3X2FA 2X0JA 1N9GA 4DBVO 3ZHXA 4IDGA 2OP0A 4U6QA 4I9NA 3K2BA 1LXCA 4NK4A 3L77A 1B2LA 5L95A 2CZCA 5IDQA 1M2WA 4FBGA 4CMEA 4Y6SA 3BMOB 5MDHA 1M67A 4BNLA 1T1SA 1LRKA 3MWEB 1LQTA 1U1IA 4WOKA 1GL3A 1Z6ZA 1YONA 4BQPA 5A4DA 3UFXA 3ZV3A 1WMAA 3Q9NA 1NP3A 2GSDA 3DBRB 5IXYA 2NVWA 1MV8A 2NLOA 4M86A 2VZ8A 3OM9A 5JDCA 5BNTA 3VTZA 3HFGA 4GH5A 3WMXA 1JW9B 1I3MA 1FDVA 3L4SO 2FSSA 4XQCA 4YAEA 3GAZA 2VWHA 3PXXA 2X23A 3DBHB 2LDBA 4JQCA 1UH5A 3M1LA 4TZTA 4XGNA 2E4AA 4LVCA 1EDOA 4Q39A 4Z6KA 1UUFA 1IPEA 2ZYAA 4OQYA 4DQVA 2BMAA 4IIVA 4WUVA 3JQFA 4J4HA 3G1UA 5THKA 1DB3A 1JKIA 1GD1O 2UDPA 2GYYA 2NADA 4M87A 3GEMA 2JCYA 4AJ1A 4DIBA 1LC3A 2A9FA 4W82A 5L53A 3QA9A 3RWBA 1PGQA 1VKOA 1WNTA 4UUOA 3FF4A 2C82A 3EGOA 3KM0A 3UCXA 1DBVO 1HYEA 1NR7A 4U0KA 3SXPA 4NU6A 4QTZA 3D1LA 4CLHA 1J5PA 4TVBA 5CG1A 3CPSA 3WNQA 4Z9FA 1HEUA 4KOAA 1QP8A 4YJDA 2YFQA 3CUKA 1Y6JA 1NX6A 3SEFA 4CLRA 5DBGA 2GR9A 4RVGA 2I3AA 3LVFO 4NJMA 4OHUA 1LBEA 4GX1A 3ZWPA 3ZZNA 3JYOA 2D59A 3BTSA 2FOIA 3ITKA 2ZB8A 4BNYA 2GZ2A 5CG2A 3WWYA 1UXIA 1E7YA 4GQAA 2AG8A 4J49A 2VNAA 5BR7A 5DBIA 3F46A 1CRWG 3FHLA 5EQDA 4BO7A 5JS6A 1KYQA 1EK6A 3HFSA 3STHA 4QXMA 4S1VA 3VVBA 4E13A 2YDXA 3O9ZA 1O6ZA 1JAXA 2E6UX 3JQAD 1ISGA 4PG4A 1YS4A 5KOIA 4IDEA 3OMLA 1F17A 2Q3EA 3DZHA 2OFPA 1SPXA 4WLNA 3SC4A 4NBWA 4Z3DA 1BW9B 2NTNA 1LSUA 4QO8A 3U4HA 1IULA 3BXXA 5TS3A 4CMBA 4J9UE 2Y93A 4XQGA 1K5HA 3BTUA 3RCBA 4CM8A 2YHUA 4AJJA 5KCZA 3VPFA 5JDIA 1YOVB 3GDFA 4OL9A 2NVUA 4X54A 2CVZA 3EMKA 2YDYA 2IRWA 3I9NA 3ORFA 1C1DA 1CDOA 3GHHA 3GN1A 4FDAA 4TRMA 4GMGA 4FC6A 3D3EA 1ENZA 4GGOA 3AU9A 4TKLA 1WP4A 1ZVMA 3WGZA 1GQQA 3QQPA 1SC6A 2PGJA 5DN9A 1E7MA 3C8MA 1HDZA 3D4OA 1K6XA 3OJEA 3QVXA 4IDFA 4I9UA 4JIGA 1EZ4A 3P2OA 3I9OA 3DBLA 3DWFA 2V6BA 3DZBA 1BVUA 4YRBA 1D4FA 1H5QA 2WD8A 3PI7A 4R16A 3WYBA 4LW8A 4ONEA 1MG0A 3JQ8A 2QYTA 1U4OA 2PTGA 4CV1A 1ZSVA 2BD0A 1AE1A 3TPCA 1AXGA 4RO0A 1XGKA 3EW7A 5IF3A 3OSUA 4U0JA 2DPGA 1FDTA 1GV1A 3BA1A 3NEPX 4PLZA 2DLDA 2VYVA 4E5KA 4B8WA 4D43A 4IM7A 5FYDA 3PWKA 1P1HA 4WCDA 1LNQA 2NUAA 3UHAA 3JSAA 4RPJA 3PGJA 2NU9A 4JJFA 3WTBA 4EUFA 1IZ0A 4E0BA 1MUUA 3CSDA 4Y6RA 3WQQA 4R9RA 5JAZA 3JYNA 2WE7A 4IDAA 1W4ZA 3L4BC 4IDBA 1LSJA 1UAGA 4GAEA 3SJUA 2GCGA 3F1KA 1FMCA 1VPDA 1E3SA 3IIEA 3KTDA 3NT5A 4GWKA 1EVJA 4E2ZA 1XCBA 3U5TA 1T25A 4RV9A 1R6DA 2Q46A 5DOZA 2VT2A 3GGOA 1KC3A 2CDAA 3CKYA 3L6DA 3PJDA 2SCUA 1W8DA 2AEMA 2PV7A 4UREA 2VTEA 2B36A 1LDGA 2EW2A 3O38A 4BGVA 4E31A 3INRA 3Q3CA 2FR0A 3ANLA 4DLBA 3GHYA 4RDIA 1OC4A 1HDYA 2O7SA 3EC7A 5CEEA 4UUNA 1ARZA 4ALJA 1OI7A 4BO9A 4KTVE 4XDYA 2CY0A 2F00A 3PP8A 5DZSA 4BNTA 1I32A 2O3JA 9LDTA 5L45A 4NG5A 1ENOA 1T4DA 4G81A 3LLSA 1NFQA 1WDMA 1XHLA 1N9GB 1FF9A 3H65A 1OFGA 4I5EA 4F45A 2E37A 1R0KA 1IHYA 2FPPA 2H63A 3A06A 1GEGA 5JLAA 4CQLA 5CHEA 2FZEA 1P1KA 2HKIA 2PZKA 3EUWA 5F1OA 1EK5A 3TJRA 2X8LA 3ZDFA 9LDBA 3Q9UA 4FJ2A 1D7OA 4OO3A 5B37A 3E9NA 4BKPA 5HA5A 2PD6A 2Y05A 3MTJA 4FFOA 3U4IA 3OECA 1QRRA 2QG4A 1QXSA 2CSUA 2RIRA 1KS9A 3H5NA 3VTFA 2RHRA 3IAHA 3KSDO 4RZHA 1XEAA 4IQ0A 1OOEA 2C29D 4PG8A 2YV2A 2BGMA 2V6FA 4XCVA 1N92A 2VYND 4R69A 2CF6A 4BNWA 1H6AA 2AE2A 1I10A 2BFMA 3CMCO 3QY9A 4RL6A 4W9NC 2NU8A 1QLJA 2EGGA 1JLLA 3NTRA 5CP8A 3EYWA 4IQGA 4W4TA 1SOVA 1KVUA 1PGPA 2P91A 3ONDA 4DIOA 2OXIA 3AM4A 3GNSA 1D8AA 4EZBA 4KTTE 5U4QA 3M1AA 3NJ8A 1I2BA 4YJHA 3QVOA 5DCUA 4K28A 4IBOA 4HFNA 5ER9A 3HE3A 3PIIA 2OOSA 3EVTA 3H8VA 2W98A 2DTEA 4O0LA 2W2KA 4PLVA 4XQ9A 3ZHZA 4BNKA 1DFGA 1YE3A 4Y9DA 1NHGA 1ULSA 4AJNA 4EJ6A 3GEDA 5A9SA 1G0OA 3LLVA 4J1SA 1U5AA 5T6BA 2YQ4A 2I67A 3CXRA 1I2ZA 2C54A 1DHTA 4UVGA 3DOOA 2GN4A 3LC7O 1HL3A 2HMUA 2Q2QA 1DIGA 3VH4A 4E21A 4EYEA 3RC2A 3MJSA 4LMRA 3ROKA 4EITA 1KVTA 4CLRB 3ZNNA 2X5KO 2FMUA 4NJMB 4J4BA 4J2HA 5DULA 3W4IA 3TZHA 8LDHA 4O1MA 1DAOA 1U7HA 2Y1DA 1MFZA 2UAGA 4XYMA 3DMTA 1E7SA 4YBZA 3RC9A 2P9EA 3TNLA 4A03A 3MZ0A 5HS4A 1JKJA 2A4KA 2X22A 3OQBA 4R51A 2Q2WA 5JC1A 2DBRA 3AFNA 3KHUA 3G17A 1UAYA 2GZ1A 1JAYA 4XIJA 1E77A 4ZQBA 3WQRA 4UUPA 2QRKA 4YEDA 2EJWA 1K2WA 1U8FO 3ZW8A 3DR3A 1CWUA 1PJCA 3DTYA 4NQZA 4H15A 3V2HA 2CUKA 3QJ5A 4E2WA 5I8WA 2DTDA 3MJEA 3UUWA 2O50A 1SZJG 1LDYA 4B7UA 1BWSA 5C7IO 1V3UA 4CM8B 4XDZA 4B4VA 1M76A 1ULUA 2FWMX 2IZ0A 4C7KA 1ZUD1 2NVUB 1SEVA 3WTCA 1F12A 3F1LA 3G0OA 1LLDA 3VKUA 3DQPA 4O5OA 4BVAA 3JD2A 5U1PA 1KC1A 1NASA 5FF9A 5JO9A 3TZKA 3GFBA 1IYZA 1UXGA 1DRVA 3NV9A 3TL3A 3Q6IA 2ZKLA 4ZN6A 3UKOA 5JBIA 1DHRA 1NWHA 1EFLA 2HLPA 2WDZA 3FRJA 2AEFA 3R6DA 3W8EA 2XXJA 4B8ZA 3HWRA 3K30A 1NPDA 3DBLB 3TFQA 2V6MA 2IZZA 1V3TA 4J4TA 2O3QA 4D0SA 4AFNA 4HBGA 3RFVA 1ZSYA 5L4SA 1WXDA 1SCUA 3JQ8B 3FPLA 3H9QA 4C7JA 4MVJD 5JCJD 1XWFA 3AWDA 3QE3A 5JMPA 3I1JA 4U7WA 1DXYA 2V6GA 2FPIA 2GLXA 3UCFA 4E6PA 3HDQA 2ZB4A 1EVYA 2B4TO 4LVUA 3O03A 5EJ2A 5K9ZA 3WS7A 1ONNA 2OBNA 3IJRA 2TMDA 4YRDA 5AXCA 3W8DA 1JTVA 2VZ0A 2UVDA 4G5HA 4PLGA 3WIEA 4UVEA 3GPDG 3H5RA 3WMWA 2WYUA 4IDCA 3U4CA 4JP3A 5F5LA 2J3HA 5HTOA 4CJXA 2AE1A 4PRKA 3E9QA 1B0AA 3B70A 3JD1A 2D8AA 4YPOA 4GL4A 4UEKA 1E3LA 1IOLA 4PLTA 4EUEA 1HE5A 2GERA 5G0UA 4MOWA 1R15A 1AHIA 2Z1NA 4ZICA 4II2A 1PU2A 4I1IA 2C5AA 1Q7GA 4I5DA 3F6YA 3AUAA 1NHWA 3LYLA 2G5CA 5I9NA 4FD3A 2ET6A 2HU2A 1EMDA 1NVMB 3INTA 2Y68A 3TQHA 3AY3A 4HWKA 4JXKA 2RH8A 3LT0A 3ULKA 3RU9A 4IJVA 5GZ3A 4DYVA 3L9WA 1Q2XA 5BSEA 3MJVA 3OP4A 5COAA 1E0DA 1OC2A 2VUUA 4WOJA 1DO8A 2DM6A 4F3YA 1HSZA 3SVTA 1RM4A 4Q3EA 3T7EA 1HYHA 4YAKA 1CERA 1P45A 5IZ4A 4J7XA 3RUDA 1NQTA 4PLYA 3ZHBA 2GZ3A 4CQLB 3BMNB 1LX6A 3C1AA 4DWVA 1MG5A 3RFXA 5EERA 1F8GA 1UXHA 2E49A 5KJ6A 3ANMA 1XELA 1PJTA 1EDZA 3SBOA 3E8XA 4I5FA 5HRUA 3H6KA 2ZJ1A 3AK4A 4FFRA 4J3FA 3ADOA 3BMQB 2PGDA 1YO6A 4R68A 1B8UA 2F1KA 3V2UA 4HNGA 3VOSA 5B4TA 5F5NA 1GPDG 1MFPA 2WMDA 1Z45A 4W6ZA 1ZFNA 5AYVA 1XLTA 5CDUA 1LA2A 2VZ9A 2VHVA 1H2HA 4CL8A 5TIIA 4OIMA 1ZNQO 1LRLA 4JCOA 4CMCA 3FN4A 1O94A 2B83A 1R4NA 2ZTLA 1DC3A 1Y81A 2Y0CA 3W4JA 1W6UA 1F0YA 3RKRA 1UR5A 3LT2A 4I8XA 2WTBA 4WNIA 2WD7A 2QHXA 5GY7A 3ASUA 2HRZA 4N7RA 2OORA 4GBJA 5DBFA 5TT1A 2XOXA 3I9JA 4TQGA 3IKTA 1JDJA 1NM5A 4DQUA 5J23A 2CMDA 1PX0A 4PRLA 3GVHA 1CETA 1I36A 3ETDA 3IMFA 4IXTA 4J0EA 3E5RA 3KYCA 2HO5A 5ICSA 3VZQA 5KJCA 1I30A 2PZLA 3OIGA 2B35A 4WLVA 1B8VA 1DJNA 5AXBA 6ADHA 1T2DA 1FJHA 4Q9NA 5GMOA 3KB6A 1ZK2A 3TZCA 3DZGA 2Q50A 2W2LA 3HN7A 3LSYA 1U2DA 1YWGO 4IMRA 1U3TA 2I76A 4CPDA 2AQKA 2Z5LA 4GPD1 5I9LA 1IE3A 1ZJYA 4CM6A 2YV3A 3V8BA 3BMCA 4WECA 3K73O 3ZCXA 2PLAA 1LLQA 3KYDA 5JAQA 5KKCA 2ZYGA 3LT1A 4WLFA 1KVQA 1ZMOA 3JQ7A 3OIFA 4BNHA 1ISJA 1SMKA 2DT5A 1EQUA 1B26A 5CFZA 3DL2A 1DLJA 3LQFA 4ZA2A 1ZO8A 2VYVD 4OJNA 4RORA 4CQMA 2BFOA 4M1QA 4BGIA 2I3GA 5I7VA 3LT4A 5I7EA 3PK0A 3GMSA 1A71A 4WEQA 2J5RA 3NDIA 1VI2A 2JHGA 3T4XA 5CDSA 1XKQA 3DHNA 5CPBA 3M2TA 2X9VA 3PHHA 4HY3A 3GUYA 4DA9A 3V2GA 4J90A 5CEFA 3EHEA 1HLPA 2D5AA 2A92A 1BHSA 4OKNA 1XR3A 3I6QA 3ZI0A 2YYYA 3RJ9A 5KJFA 1H0KA 1BG6A 1WW8A 1GU7A 1RYDA 4Y98A 1DIBA 1KEWA 3RBXA 4MP6A 5C7OO 5T8KA 5I9MA 1TA4A 4L74A 3AY7A 2GASA 4MP8A 3RUCA 1GCUA 1ISMA 2CDBA 4UUMA 4WGGA 3K5PA 4J2OA 2EHDA 1AUPA 4R5MA 3B20A 3OA2A 4WE3A 1ADFA 3VH1A 3X2EA 1NXQA 1VM6A 3W6ZA 3TFOA 3I9KA 1QYVA 1Z7EA 4J16A 4Z9XA 4QT0A 2O48X 4TRNA 5TX7A 5L3ZA 2OZPA 3DFZA 3KZVA 5KVVA 2AXQA 2W8ZA 4XRRA 1UP4A 5TC4A 2ZJ0A 1DC6A 2NQ8A 1K89A 4LCJA 3RIHA 1UZNA 5A5EA 2JAPA 1P1IA 2AQ8A 4CL3A 5A3VA 4JROA 3S55A 3WGYA 2H9IA 2G82A 3NDJA 4TRJA 2GRAA 1QYDA 1E1LA 1SOWA 1KEVA 1M6HA 2D4AA 4IZHA 4JNKA 4MVJE 3TN7A 1KY5A 3RUEA 3TOZA 4CMJA 4WEOA 1BMDA 5B1YA 4K6CA 3OJLA 4DPLA 4BNGA 3FNHA 4YVFA 2X7HA 4R1TA 3G3EA 5IZCA 1X7GA 3LU1A 2CNBA 3SX2A 3EAGA 3WR5A 1MLDA 3GFGA 1V9LA 3DOJA 4WLUA 1F14A 1TXGA 2EWMA 4RLSA 1EE9A 1NQAO 2YJZA 1AN9A 3D4NA 5TSDA 3ZWBA 1PZFA 4D3FA 3E5MA 2R2GA 1U4SA 4OAQA 1XQ1A 3WXBA 4PLPA 2XAAA 4IMPA 4TROA 4XR4A 4ZQHA 1G1AA 1YKFA 2ZK7A 3E48A 3KEQA 4XYGA 5TGDA 1Y9EA 1B14A 1X15A 1QR6A 4UAGA 4YT5A 4KMSA 3GH3A 5B4UA 4FN4A 5G0WA 4R1SA 2RH4A 1HWYA 2PFGA 4ZQFA 3R1IA 3KO8A 2GUGA 5JYDA 3OEWA 5C5IA 4BO4A 1T2FA 3NYWA 4YB8A 3AOEC 1GZ3A 4G65A 5A04A 4BGEA 4AJOA 1E1KA 1YB1A 1PL8A 3N74A 1PTJA 4GVLA 1U5CA 4R54A 5A05A 1RM5A 5H83A 2E82A 4RVSA 1VJ1A 4FJ1A 1XDWA 1IHXA 3VHRA 3E82A 3JQBC 5HM8A 3E6AA 3EVNA 3GA0A 3ZN2A 1N7HA 1S7CA 3NRCA 2Q1WA 3FTPA 4MINA 2NVBA 1YL7A 4CMKA 5I7SA 2X5OA 1W73A 1V8BA 4RVDA 4D45A 2VWGA 5KJ1A 3QWAA 1DOHA 3CMMA 3PIDA 1I2CA 1VJ0A 2QZ9A 3CIFA 3ZWVA 2O3RA 4R41A 4J43A 3ZGYA 3K8ZA 4RLHA 4IZIA 2D2IA 1YBMA 3HDJA 3NT2A 4NMHA 4DUPA 1DAPA 5CPFA 2DFVA 1QMGA 3R3SA 4FB5A 4UULA 3K2EA 3UVEA 1QG6A 2VCYA 1DC5A 1Q0QA 1DFIA 2ZATA 3C7DB 4W7IA 3ROPA 3UH1A 2PZMA 4MIEA 3KUXA 1HDOA 5L7YA 1R4NB 5FWNA 3A28A 1X1EA 2PY6A 4DC1A 3HB5X 1PIWA 3E9MA 3B1FA 4L0QA 2Q1TA 3GEGA 3CZRA 2WD7B 2OBYA 4DC0A 3K31A 4YAIA 5B12A 1IUKA 3DFUA 2B5WA 1LSSA 1ZK3A 1P44A 1QYCA 5T57A 3HG7A 3WGQA 2JHFA 1DIHA 1I3KA 1PJQA 4GKVA 5EL0A 7MDHA 1T2AA 1HSOA 4DLAA 4ZU3A 5MGBA 3KYCB 1Q7CA 4ROSA 3WIDA 3BAZA 5G4KA 3KEOA 1C0LA 1UZLA 3ONFA 4EDFA 4I5GA 3GRKA 4RF3A 3QRWA 3DONA 1RYEA 2P4QA 3INGA 3PWSA 3QP9A 4I08A 1C14A 1HTBA 3JYPA 4Z9YA 2P9CA 4NFYA 4LGVA 3VZRA 1VJTA 1ZXBA 5IDYA 3JYQA 3WGHA 5ENDA 4IJKA 1PQWA 4KUEA 4M8SA 2Y1OA 4AJIA 3RUIA 3BMCB 4WCFC 2H6EA 3KYDB 1V0JA 1GADO 4RQTA 1ZZEA 4CR7A 1LSOA 3JQ7B 4LRSB 1ONOA 3MJTA 3QWFA 4E5PA 4B7CA 4BKUA 1GZ6A 2DPHA 2IEBA 3AJRA 1DC4A 4H7PA 2WEKA 3V1YA 4DREA 5IG2A 4CQMB 3KXDA 3H4VA 4XB1A 1A4UA 4HADA 2PA3A 1HKUA 4JJGA 4ZD6A 4ZRMA 3W4KA 5A03A 4BV8A 3GGPA 1UZMA 2J3IA 5AVOA 1I8TA 3UGKA 4EEXA 3I52A 3FWZA 3FD8A 1JWBB 3HDYA 3O26A 3O8QA 3H9UA 5G0VA 5L9AA 3UF0A 1AXEA 3TSCA 2Y1EA 3C1TA 3Q0EA 1SB9A 4ILKA 4XGKA 1V3VA 4DQXA 2WWRA 4WLEA 4NU5A 3PHGA 4LN1A 1NNUA 3JQGA 4E30A 1U9JA 1WZIA 1LTHR 4IS2A 1BTOA 1F8FA 1R12A 2UUOA 1ISHA 4Z0HO 2I5PO 5JO0A 2DUUA 1OAAA 3OBBA 3H3JA 3FPCA 4R1NA 4Z0PA 3WYCA 4XQEA 2QQ5A 2VTDA 3RBVA 3BMNA 4R4JA 3TZQA 1BRMA 5KNLA 3ROMA 2IODA 2P5UA 3DXFA 3LF1A 4J7CA 3ZU3A 4R9SA 2QX7A 5JY1A 3F4LA 3OJOA 4M55A 1YB4A 1K6JA 4IUYA 3ZHYA 2X0NA 4QO7A 1OMOA 3BMQA 3W1VA 4D7AA 3U4DA 1X0XA 3NGLA 3RU7A 3MOIA 2IEDA 4BQRA 1ID1A 4IIUA 3DAPA 2O23A 2C0CA 3ZWAA 4PG5A 4II3A 4D44A 3GY0A 1ADBA 1ZBQA 1DIRA 1DPGA 1EQ2A 3NJ4A 4CUKA 1C0IA 2PGLA 1OZAA 1RPNA 3IOYA 4AJPA 1H6BA 2AMFA 1R4MA 3PRJA 3E18A 4CMAA 3ABIA 1MB4A 2VWPA 3ITDA 5F3RA 1O8CA 3L4BA 3RROA 3DO5A 4RF4A 2G1UA 3TOXA 2J5QA 4A5OA 4M49A 4PGFA 1YQXA 5A1TA 4DGSA 3CE6A 4GLLA 1IPFA 1N8KA 3PGXA 4HXYA 3IDSA 4LK3A 4ZQEA 3FCOA 2HK8A 4NZ9A 3JQ9C 3BYZA 1I3NA 1PS0A 4L76A 4XKJA 4DRYA 4UVIA 2ZTVA 3HZZA 4BNJA 3TDKA 1MP0A 1ZK1A 5TNXA 4MO2A 5EINA 4YYZA 4NIMA 3B1KA 1DRWA 3L0DA 1LUAA 1B3RA 3AI1A 4P4NA 4E12A 4YRAA 1ZSNA 1KEPA 1MXHA 3Q2IA 5L4NA 1UDCA 1LI4A 2NNLD 2NSDA 1YVEI 2B4QA 2D3TA 3DDNA 3KSUA 1YGYA 3QVSA 1A4IA 3WLEA 3NAQA 4E3ZA 2JD1A 3UN1A 1O0SA 2JFGA 3R0IA 3DC2A 5DCYA 2IXBA 5KWEA 1NVGA 1JU9A 1O5IA 1WMBA 1E6EA 1GQ2A 4HUJA 4ND1A 4XJSA 4D41A 1PGNA 2D1YA 3D0OA 1B8PA 4MDHA 1N1EA 4D46A 4JGBA 4WJZA 2FPGA 3QW2A 4R3WA 3PZRA 4RF5A 3VDQA 1G0NA 1JWAB 3ZNPA 4OMUA 1WLYA 3I9LA 5HS6A 1QORA 3KLMX 3HNPA 1HDXA 3PHJA 4WPGA 4NH4A 1LLCA 5ADHA 1VSUA 2VHYA 3AU8A 3OIDA 1P0FA 3SJ7A 5DP1A 2PKQO 1WDLA 1CQIA 4NBVA 2DUWA 2AA3A 2Q49A 1P77A 2AQIA 2XXBA 3ZV4A 3GRPA 2Q1SA 1I33A 1S6YA 3D3WB 1K3TA 1PJBA 3MCVA 4BB6A 3D64A 2FP4A 3WFIA 3AY6A 5L7TA 4AJLA 2NU6A 2O3TA 4GX5A 5JXWA 4CV3A 2Q1UA 4XR9A 4E5YA 5A9TA 3WSWA 3F9IA 4DPKA 5JNLA 3OA0A 1T26A 1YJQA 2WYVA 3PQDA 4FOSA 2EKLA 4U5QA 4W7HA 4W9NA 2B69A 2HRBA 2R00C 4YCAA 4I9HA 1EUZA 4CQMD 3ADPA 5BNIA 2IZ1A 1P3DA 4L4SA 3VPXA 4QECA 1U7TA 1E7WA 1C0PA 2Y1GA 5IN5A 1HZZA 2BI8A 1KY4A 3WGIA 4J1QA 1F06A 3WSVA 2VHZA 4MKRA 4TRRA 5T64A 3R3JA 4RVFA 3ZWOA 1DJQA 5THQA 5G0SA 4E2YA 4BIIA 4OM8A 3DAFA 4PG6A 2H1SA 4DTIA 1CIVA 5L51A 1L7DA 2Q99A 1T4BA 2WE8A 1Y9AA 2JL1A 5G4KB 2FSVA 3WNVA 4Q3DA 1E1MA 3I4FA 2VHXA 1ISIA 4EJ0A 5AQ1A 4CR6A 2VRBA 4HFMA 2Y1CA 4YR9A 4BOYA 2O2SA 3BTOA 5G4LA 4BO8A 2GNAA 5K6AC 2PD3A 4U6SA 3JD0A 4FFNA 4TSKA 3ZWWA 2P2SA 3WJ7A 3WICA 1WAMA 3GPIA 4PZEA 4Q3NA 3PTZA 3UOGA 1Y8RA 1E3JA 1FDUA 2BLLA 2VQ3A 1EUDA 1O89A 2PNFA 4XRGA 1HZJA 1WVGA 5T67A 4BMNA 1EE2A 4RVUA 4A27A 4PLCA 5LC1A 2HJSA 3GDOA 1QKIA 2LDXA 4OXKA 1IL0A 1PGJA 4AJHA 3A1NA 3HHPA 4MVJG 4NFSA 1NYTA 3H2ZA 5KVCA 4DL9A 1GYPA 3GVPA 4FGSA 2PKRA 3PJEA 4ZVVA 3Q1LA 4N5NA 3UXYA 4EBFA 3JQ6A 3UAGA 3ZWXA 4ALIA 2O7QA 2YZ7A 4YJFB 3A9WA 4OSPA 1A72A 2X5JO 1ZW1A 2QRLA 3O8QB 5FI3A 1HDCA 2HCTA 5EPOA 2G17A 3N58A 5FI5A 3EK2A 4OKIA 3ZWMA 3JQGB 1LDMA 3L6OO 5T5QA 5LDHA 3EY4A 4CM9A 1GTMA 1T2CA 1WPQA 2ZCVA 1M75A 4BO0A 3KSZO 5H81A 4GMFA 3QVWA 3CINA 5L4LA 2OMEA 2V7PA 1SEPA 5COQA 4J1NA 3MWDB 5F1KA 5IN4A 2O3UA 4YAJA 4GWGA 3HN2A 2HAEA 4FGWA 4BNUA 3OETA 3QSGA 4TKMA 5ITVA 2FRDA 5BQFA 4BNXA 2EEZA 2B37A 4RDHA 4CLXA 1PL6A 1LDBA 2AW5A 3G49A 4B3IA 2W4QA 5B4VA 2BGKA 4GLOA 4BO1A 1H93A 1EBFA 2OHXA 4NR0A 3DZIA 3G1TA 5GZ6A 4WLOA 4B4UA 2RAFA 1PZHA 2EKPA 3PFFA 4CMHA 4DMLA 4FFPA 4PN3A 1R4MB 2VHWA 1MGOA 1R0SA 4NBRA 5BSGA 3AI2A 2X4GA 1P9LA 2EJVA 4L8VA 3LC2O 5ILGA 1UDAA 3GGGA 4QFDA 5ITWA 5L7WA 1NWCA 2CDCA 3JTMA 4LMPA 2NTVA 4XEHA 1H94A 2BI7A 1U3UA 1HT0A 3PDUA 4YWJA 4CMEC 2XF8A 5C7LO 1BGVA 1K0UA 2OUIA 4HV4A 5CDYA 2D0IA 2NWQA 1NAIA 1BXKA 1J0XO 1QLHA 5F21A 1PJ2A 2GN8A 2FR1A 3BZUA 4MKZA 1WWKA 4BO6A 4DBZA 4ND2A 1E6WA 4R5HA 2WM3A 4HKTA 4Q3BA 5DNAA 3ETEA 3K96A 1UXJA 1PL7A 4AJKA 4EEZA 5JDCC 1GYQA 3S2EA 1KOLA 3HADA 1E7QA 5ER6A 1U2GA 1NVTA 2YQ5A 1UJMA 1TEHA 2QW8A 4PLFA 2FZWA 3DAGA 1GDHA 2HK9A 1CQJA 1EEHA 3HQ4O 4MKXA 1GZ4A 5EESA 4UEOA 3OQ6A 3GQVA 3IJPA 1AHHA 1XIVA 4PFJA 1O95A 1P0CA 2Q45A 3UCEA 3RC1A 5TQVA 4CODB 4IQ8A 3LK7A 3ROQA 3ZU2A 3RBZA 3JQFC 1VC2A 2PKQP 3GNQA 2HMTA 4B3JA 3QWIA 2FN7A 3TZ6A 3QVTA 4D0RA 1OBFO 3RQSA 3LDHA 1SBYA 4NDNE 4EUHA 2NQTA 5ES3A 6LDHA 2NTJA 4FFMA 1MC5A 1E1NA 4FFLA 1VL8A 4FS3A 4GGPA 2X1HA 2BF7A 4CUZA 2GF2A 2HMVA 1YBAA 3B6ZA 1E5QA 1GCOA 1U3VA 1VE9A 3AOGA 2J8ZA 1J6UA 1GUYA 2WSBA 4A73A 3EZYA 3H9JA 4MVJF 4RQUA 3GT0A 3ON5A 1R16A 4DLLA 3ENKA 1HE4A 4YAGA 2EIHA 4ALNA 2JFHA 5K0ZA 1XU7A 5A02A 1BSVA 4TMFA 1Z82A 3S2FA 3ETGA 2EV9A 2GN9A 3OHSX 3NDRA 1LQUA 3CH6A 1LC0A 1KBZA 4Q3CA 5L40A 3D4PA 4IDDA 3DHEA 4YJGA 4CLEA 4NFHA 4BNZA 1CJCA 3Q2KA 1LDEA 1A9YA 3JD3A 1UDBA 2GN6A 4J1TA 4M54A 4FPXA 4QQRA 1HETA 1ORRA 3GK3A 3IS3A 3ZNQA 1GV0A 1XQ6A 2EF1A 1NFFA 3DZKA 3AUSA 1P1FA 3QWHA 2I99A 3T4EA 3U49A 5G2OA 1PJLA 4RPKA 4G2NA 4XWYA 1I3LA 1QV6A 5JAIA 3WX0A 2G76A 3VKVA 3RFTA 5A5FA 4BUCA 3CTMA 3WWZA 3L07A 1ISFA 4XYEA 5TF4A 2AEJA 5JSFA 1C1XA 1ENYA 1KETA 2I66A 5DOVA 3F5SA 1JVBA 1U28A 4OOEA 2IXAA 3JQCA 1DLIA 2YHIA 4MVJH 2G0TA 4KP7A 2IE0A 4PZDA 1Y7TA 1G6KA 3RAJA 1HDRA 5JDIC 1EVIA 5DDIP 3H9EO 1TI7A 3GUCA 3GN2A 3PDJA 5I8ZA 2BRUA 4N5LA 3F4BA 4IY1A 3C85A 5BSHA 3GG2A 4OXYA 3RUFA 1Y8RB 1LDNA 3FI9A 8ADHA 2EKQA 3GDGA 4B3HA 3PQEA 5IJZA 1Y5RA 3ENNA 2X0RA 1A5ZA 5CAEA 4NI5A 5U9CA 1ONPA 2EP5A 2EGHA 4YACA 4CV2A 1XU9A 3D5TA 4HNHA 4AJ2A 2ZCUA 5HBRA 5AOVA 3OH8A 1ADCA 1XSEA 4ZGWA 1U3WA 1V35A 4QFCA 2HQ1A 3W6UA 1M6WA 4A26A 3WGGA 2DBZA 3DOCA 3JV7A 1Z7BA 1HXHA 3S2IA 1R66A 5IFLA 3IUSA 3U3XA 1UXKA 4BKQA 1BXZA 2GGSA 5TT0A 2I65A 5JYEA 4DXHA 1DDOA 1PJSA 5JPIA 4D42A 4PCVA 1ZJZA 3JCZA 4P8RA 2VRCA 3I23A 2Q2VA 5DF1A 4XYBA 4U8GA 1BDBA 3L6EA 3GF4A 4CM7A 4FOOA 3RC7A 3RUAA 3V1UA 1N1GA 4Y6PA 4ND4A 4WASA 5KKAA 5HWSA 3ZH2A 1SB8A 4KQXA 4MVJP 3H7AA 4ZHSA 4E5MA 3RVDA 3ZW9A 1ADGA 5CDTA 1NBOA 4A7PA 1R37A 3D3WA 2DC1A 1TT5A 3K9QO 3HDHA 3ICCA 2I6TA 2WJPA 3VPGA 4BKRA 3GNTA 1H9BA 1YL6A 4H16A 1Q0LA 4A10A 1RM3A 3F47A 5JE8A 2J3JA 4NK5A 4CUJA 2VNSA 4BL5A 5LDGA 4IPTA 1B7GO 2Y66A 1PGOA 4INAA 1C0KA 1DSSG 5COBA 1RKXA 1QYXA 4E33A 5CEJA 2YFHA 4TWRA 4CLOA 3FTNA 2GDZA 3SLKA 1GR0A 4Q3AA 1SAYA 3PJGA 3ZWNA 4UEJA 5KVSA 2YV1A 5LCXA 3ZWYA 3GAFA 3MJCA 3H9GA 4CMIA 1JN0A 2PZJA 4CV0A 1BXGB 2PK3A 4DMMA 1KEUA 4GVXA 4DPMA 1YBVA 3WFJA 3UICA 4YXFA 4IS3A 1Q1NA 3NTQA 1YL5A
chains in the Genus database with same CATH superfamily
3DHYA 4RVHA 2X41A 4CL2A 3DM5A 2V6JA 5A9RA 4IH1A 1RBYA 1NPTO 2EX1A 4HD8A 4HEQA 4YTEA 2WQ7A 1UAAA 1FFYA 2J46A 1UL1X 5HFJA 5JCXA 2ZQYA 4FOTA 1HRDA 4G8JA 2ZSAA 3C3KA 3VDMA 4C05A 4AJ9A 4RF2A 3HXMA 1ZK4A 3DHWC 2QGFA 3NIFB 2J5KA 4RMJA 4XASA 5IULC 3AFIA 1VPTA 4OXNA 3OLWA 1OV4A 4XLTA 3F6SA 4ZEXA 3I8XA 4NEHB 4CWAA 4LOIA 4K86A 4MLDA 2G06A 1TL7C 1WB6A 4K2HA 4GOLD 3AOEA 1E5LA 1Y33E 1WUKS 2PS1A 3CIOA 3M34A 1M8PA 4PSUA 4S3MA 3S3TA 1POXA 5ANRB 4D6YA 3ASVA 2OO5A 4OH1A 4AN1A 4BECA 4TLMB 2C4VA 5E6SB 1RC8A 1GFSA 3CLRC 3GRAA 2A9KA 3HBMA 2RG7A 2ZE5A 4OYHA 4NWIA 4NXMB 1U7OA 1TW2A 2NACA 4RTMA 1BOOA 1S96A 1JF8A 4EY7A 1MRZA 1XZMA 5CIWA 4H3VA 1CULC 2IV3A 2C42A 3S7TA 3WRWA 4EHJA 3PGMA 3QLJA 1KZGB 4QPJC 2PT7A 3LLCA 4PYKA 3JVDA 4JYCA 1GUZA 2XQGA 4MWSA 1D1PA 1WXXA 4LDZA 5EZSA 3V8VA 1E6KA 4K9MA 2VQSA 5LXTF 3RREA 1GNSA 3KWFA 3FVRA 1X39A 3UMMA 1N8SA 3CC8A 5D1HA 3ZIDA 5JJCA 5EKDA 1M66A 2QL7A 1TGVA 1KA9H 5DWQA 4DCSA 3AIMA 4ZYXA 1VLVA 1EDDA 3O1IC 5A06A 3FHOA 3QBDA 1XCOA 5KWJA 3JS5A 4DABA 4KXVA 3VOBA 5KNDH 1NQUA 1Q5PA 4C01A 2JJ8A 4F4HA 4MGIR 2LVBA 2OAQ1 5HFNA 1KOFA 3A6DA 3UT5A 4YJGB 1XROA 2R7LA 1NTOA 2DJ5A 2R6JA 1NQ5A 3IEMA 1GSHA 4PGHA 1LFAA 2IYPA 2P6UA 2DKNA 2C04A 1II9A 2ZBPA 3R8FA 1YRHA 4R8VA 3BHJA 5K0LA 1BX0A 4H0NA 1QH0A 5CR9A 2YS6A 4EM6A 3HI4A 4NEGA 3E35A 1MW9X 2G4CA 1OU4A 2G67A 3JQEA 2JGJA 2VDVE 4D3SA 1BD3A 1JA1A 1L7XA 1PSDA 2C7GA 3DDUA 4DBLC 5I9IA 1M5RA 2BZSA 3RSZA 5A62A 1VL1A 4URXR 1T4GA 2BFAA 1TVEA 5B2ZA 3PCTA 5T7BA 3PUXA 3ILVA 1JU4A 3R3HA 2MIIA 2WA2A 3H5AA 4WV3A 4AJEA 5C4MA 3CZ4A 1GLGA 1C1XB 3GJZA 2XWSA 3HU3A 3HXKA 4HRXA 1CYDA 1U9CA 3O8CA 3S5UA 1SQ6A 3QKIA 5FBZA 4G4GA 1IK4A 3S2GA 3VPHA 5FEUA 3FYHA 1GGKA 2YRXA 1P9OA 5FNZA 3T54A 3BTVA 2B4RO 5JQWA 1J5XA 3PF8A 1M1UA 3NWJA 2QAJA 1XNRB 4UPEA 3LZDA 4RD2A 1W52X 4ZU1X 3WB9A 2JCXA 3S2SA 5HQTA 4O6VA 2DBVO 1A9PA 4MMYB 1G98A 2DWQA 2WYWA 4RM3A 4CE6A 2EP7A 4OK5A 4Q02A 4UTRA 4J9VA 1VSQA 2ZJYA 4MH0R 4E14A 3C5HA 5IAAA 4PR3A 1YJCA 4MLPA 4W99A 2Z1MA 1QQBA 1QTQA 4M7PA 3PBKA 1R10A 5ESDA 1W5AA 3OTOB 3T3OA 2WTAA 1VHWA 2H2GA 4AL4A 2ZI4A 1ZI8A 5EXDA 3W7AA 1GG9A 2ONKA 2UYYA 4AQYB 4P38A 2Z3ZA 4IXWA 1BN7A 4YMWA 2A9PA 3H13A 3PX3A 1PG2A 2NIPA 1JKFA 5AW5A 2YICA 5K45A 4NBNA 1O94D 4RKQA 4BCDA 2V7VA 2VH5R 2VK4A 2HA2A 4LXQA 1N7JA 3HO6A 1AZLA 2H1HA 2JFPA 3IQXA 2PRYA 3AYZB 3N6XA 4MS1B 4RGBA 5GM2A 4B2IA 4TL8A 2HMWA 4TV8F 3SR3A 4BLUA 4ZZIA 4Y2PA 1QSGA 3VR3A 1WNFA 1DGQA 3C7AA 3II6X 5J58A 2IS2A 1W0CA 3RVNA 3I64A 3Q6MA 5KSYA 5IWAB 4HJRA 3Q8KA 5I7UA 2X77A 1UJ6A 2XYVA 2C07A 2C9ZA 3I0ZA 5C8ZA 3IOEA 5E1DA 3A2NA 4EW6A 4RZXA 3PVZA 3MF4A 3RBAA 4X93A 2DTXA 4J0FA 5IHXA 1GZUA 3CZMA 4A6DA 4DJFC 1AVTA 4EF6A 1S0UA 1K92A 2B92A 5K7SA 4Z3KA 4MROA 1RXEA 3OJXA 1J4AA 1ZM9A 3IBGA 1MCZA 2YWFA 1A1SA 1XTVA 1FUYB 1RQXA 2C4HA 2QXTA 3MGGA 1IY9A 2OVBA 4RELA 4XUDA 5A0FA 3E05A 4GI2A 2QS9A 3OQ1A 4MV1A 2JLRA 4NQRA 1CVIA 4FQ8A 3QIAA 4O33A 5FD8A 2AG5A 4K9DA 1VPWA 1YJBA 1YDWA 3NUQA 3PC4A 1K4KA 4JH0A 4PIMA 3PEFA 1FNNA 2ZIEA 4RDCA 3KJNA 3V8NA 4EPTA 2W2LD 5EXSA 3VSDA 3BD9A 2LTAA 1FNBA 1MA0A 3CVOA 2ALJA 4NYIQ 4JN6B 4C29A 4MJXA 5TLSA 2IEZA 4EG5A 2W42A 3OLVA 1Q0HA 1OXBB 1EM6A 1QHHB 2D2EA 2JDIA 3OPMA 3QIVA 1RLTA 4WGFA 1A27A 4XXHA 4B3GA 1K63A 1JVSA 1NVBA 1TZMA 2HLNA 3HB7A 1ABEA 3G79A 1AKEA 4YLEA 1XRJA 4Y2HA 2K2QB 4GM1A 1QVWA 1JZQA 3P7MA 2AFIE 1OXVA 4LQCA 2OZKA 4PLWA 4F6LA 2X3FA 5LQJA 1O95D 3SYLA 1VL0A 2FMFA 4NCBA 2IX3A 1GY8A 1FFWA 2J3DA 1JFVA 3NX4A 4N3AA 4OTZA 2IWHA 3T0IA 5JCPA 1N0WA 4EYKA 2CLHB 1WCV1 1D0VA 3C8UA 3PPIA 4HX5A 3T95A 4JYAB 4RZUA 2FFJA 2YW9A 4YN3A 4NNJA 1PYDA 1HFKA 3KJGA 4DBLE 5B36A 4P0TA 1IQRA 5KTRA 5F73A 1ZH8A 3P2KA 4JIMA 4MS3A 2B8EA 1N9KA 1VPLA 3N39C 4GX2A 3SHOA 5BUCA 1VKNA 2C2XA 3ANNA 3JQ9A 3NJRA 4NPCA 5CX1B 1FMFA 1T0BA 1Z5VA 3V8RA 3CLHA 4IDHA 2C98A 3HUDA 1SBTA 1RYMA 1TQ8A 3GIDA 1OBCA 2HXGA 5DBOA 4A2CA 3I58A 1QDLB 5CFQA 4LSMA 3WK8A 2DUNA 3VAZA 1E2QA 4WKGA 3WGOA 5HP4A 3RQIA 3FUTA 2J3KA 2LKCA 2ZU6A 4BCBA 4S2EA 2IT1A 4G4JA 3LX6A 4HRVA 3KD2A 4AY3A 4CF7A 4W1QA 1CRQA 4DA7A 4HSEA 2OCDA 3THXA 1Y3AA 2XBLA 1H2BA 4JFRA 1PJZA 1P31A 4IEEA 3Q3VA 4OFWA 4TYQA 1JQLB 5CLHA 3DBRA 4L22A 2QRPA 2QTTA 4MUYA 3C24A 1L8AA 3EGWA 3DAOA 3D7LA 5EWMB 4J03A 1ZD2P 3DZFA 2IGTA 3UKJA 3ROZA 1XLTC 4PC7A 3W7BA 4D8WA 2WUEA 3C5VA 3OMWA 2ZYDA 1SVUA 1V11B 3DBHA 3KT6A 3MBOA 5KTSA 3A3PA 5L3SB 1HA3A 2R7MA 5I47A 4YRIA 2QVYX 4X60A 2NUAB 2INGX 1E3WB 2WWFA 4G41A 3VZCA 3WZLA 4CG0A 3EQ9A 1E8MA 4M0CA 2PO7A 1YGPA 4L4RA 4NS1A 4RMIA 5EGNA 1DBWA 4RQBA 4D79A 1ODJA 3CRMA 1HM5A 1KWGA 1VTKA 3I1FA 2Y77A 1YKGA 4TZKA 3BIJA 3PGVA 4WKBA 3Q6NA 3G8YA 5LP6C 4MHTA 2HR1A 4ZO8A 3PRJA 2HM7A 4RC9A 2FY8A 3UV6A 2NU7B 2JBAB 3CT6A 3T9FA 5AW4A 2I6GA 4L5IA 4RMHA 3K6SB 3FKJA 2JD0A 1I9GA 4NBUA 3QE4A 2D1FA 2I8LA 4PVDA 1E8DA 2BJWA 1NBMA 2LPMA 5JNWA 4N0MA 2QIOA 3PRKE 2P9GA 4WY2A 3ZE1B 1A7UA 1QC5B 4BS9A 4DJDC 3R5XA 2OHVA 4L0MA 4LX0A 5K0NA 1O77A 1RQPA 3VQTA 1WQ3A 1KO8A 4RSRA 4CTNA 4EW2A 5CDGA 5JV5A 4H35A 4JP2A 3DKPA 2AI2A 1U8YA 3EXFA 3RIGA 3EXHA 3CUWA 5H82A 2A5YB 3FZGA 1KBQA 2GHRA 4FI3F 1Y6GA 1T5LA 4DSZA 1UKEA 5BWOA 4RACA 2ZWPA 3WL3A 4AROA 1ORTA 2AD1A 2PYZA 2H4XA 1W34A 3BE5A 5DX0A 1U1GA 4BASA 2ASEA 4I55A 4BV2A 4BBJA 2VAWA 3KQMA 1PK9A 3L8DA 4KQ6A 2QRQA 4RLFA 4AVYA 4BB5A 2F3SA 4IFBA 3C1OA 4OUDA 2J6IA 2OFOA 3KETA 2GCNA 3VR6H 5BOSA 1H0HA 5FUQA 2Q8NA 3SG0A 2VDRB 2VYNA 3PPYA 4C4TA 3IA7A 3EZNA 3T3NA 3TAXA 1H1LA 5IAEA 4OGFA 2FHSA 4N8SA 3RI3A 1BKYA 1F2UA 1I3CA 2W4IA 5ENVA 5B2EA 5L8VA 5DXAA 1V47A 1Z47A 3G0BA 4Y6OA 1G6HA 2NAPA 3RF6A 1EVZA 2ZUBA 2HBRA 1D6SA 1TLTA 4M89A 5B6IA 2VYCA 3TK1A 2XIQA 3X44A 4BLWA 1M1YA 4FOPA 1Z25A 4KVGA 2K4MA 2X9GA 5FL7A 3WY9A 3WL7A 1TF2A 3ZJYA 1YU6A 2VRCD 3EEBA 5KTKA 1JE1A 5K05A 3IPLA 3ASZA 5ALXA 2Q4BA 1MVNA 2A0WA 3D02A 4RNDB 4LGYA 3ZOZA 5L40A 4HDMA 2IP1A 3KTAA 4JAVC 1ZK0A 5LP1A 1C3XA 2XWPA 3AUUA 4DLUA 4KFTA 4EPXA 3T5PA 2HRQA 4DCOA 3PNOA 2B30A 3H8JA 2GPWA 1QYWA 3R6LA 2AHRA 3WGTA 2XDYA 1Z75A 4NZPA 2UZIR 5AM4A 1KH1A 2R7KA 4FJ0A 1M2GA 2EU8A 2QMHA 3PFWO 3PYMA 2BISA 1TTPB 2F9FA 2YJ3A 1ZD5A 3I2HA 5EMJA 2O2JA 5AIBA 1WX1A 3HV2A 3QX9A 1BFUA 3K9LA 3PXCX 4R8MA 2RBGA 4GLJA 4YQZA 1G59A 1YR2A 1PFUA 1POWA 2KI5A 3F7OA 1KYWA 2A35A 1J97A 2R2AA 2YXDA 3A25A 4J0IA 4RHEA 1V6AA 1R0LA 2P75A 2YY7A 1N6RA 1EUCA 2ZYUX 3DEYX 2HGZA 3QPBA 4MJ3A 4MIYA 4F8YA 2EXXA 2RIPA 5IDWA 1QO0D 1ISRA 3LQ4A 5F2NA 3D7MA 5GADl 1IHUA 2ZJAA 3IUMA 2F2TA 2RB5A 3EFBA 4TGLA 1Y5NA 1NQOA 2R97A 4JBHA 4ZAYA 4A8HA 5INTA 4Z0TA 2GJSA 2OWDA 4DLXA 4CM4B 2PYIA 3FCXA 3QMPA 3LL7A 3QBJA 4FHZA 1QKKA 4Q82A 3V32A 2EZ4A 3B12A 4GF5A 5IM5A 3H86A 2IIVA 2XVZA 3RSFA 5A9SB 3D8TA 5JWOA 4GXNA 2H5JA 2VH2A 4JVSB 5E6SA 2QQFA 3JQAB 3EIHA 2P40A 1WXWA 4DIEA 1R8YA 3IOBA 1PJ4A 2VZLA 3OIWA 3P9PA 4M7WA 421PA 1SUFA 5SYMA 1FP1D 3B6KA 3Q87B 3WL8A 3RRJA 2QV7A 1D2CA 1G3IA 5EZYF 1Z39A 3NTXA 1PZEA 1BNCA 4JSRA 1V1RA 5CCBA 1E92A 1QIHA 2V65A 1VBFA 2WJZB 4MQBA 3W5UA 5JBQA 1LLUA 1COWD 3NTOA 4ES6A 2C03A 2XUAA 1T1RA 1GA1A 4L73A 5CA0B 1SKYB 2B2NA 5K0JA 2LIPA 1G5PA 2QZZA 5AW3A 1ESCA 3U2QA 1HT2E 3OZSA 5F7OA 1UMCA 1BC5A 4QUBA 2WUWE 5EZYA 3J7TA 2ZZNA 3FNEA 2HCBA 5IK2D 1JXQA 2I71A 2IOHA 3CO5A 1PE0A 4O4IB 2YZKA 3Q9SA 1FTQA 1PD1A 1WPGA 3KBOA 1X87A 4ZP1A 2P4UA 4JD5A 3RUPA 4LHWA 4KXLA 4ZPXA 2QQGA 1EX9A 2V3VA 2OUKA 3H16A 3HGMA 2DERA 2EW8A 2W6ZA 4W1RA 3HB4X 4ALLA 3K8OE 1HDEA 2W9XA 2Y0EA 3OICA 4MV4A 3LCJA 5TMEA 4HNTA 3ZE6A 4DBVO 3AKCA 3D4IA 3O31A 1T2UA 1PTJC 4UXHA 4WX2B 2OP0A 4U6QA 3E27A 4I9NA 1FFGA 2KLHA 2XMCA 3K2BA 1LXCA 3DL7A 3PPWA 5SZJA 1QGED 5L6MB 3L77A 2DT8A 4IFIA 5L95A 2CZCA 5IDQA 5D5HA 3ED1A 4Y6SA 3HJFA 1U80A 1W5SA 3WRYC 1TJNA 1YQUA 2LD4A 4U63A 2ZUFA 1HV8A 4C43A 4JYZA 3CG0A 4I4LA 4O4JF 3HZRA 1C7QA 1T1SA 3FZYA 2IJGX 3L8CA 3MWEB 3EW9A 1U1IA 4CU2A 1Z6ZA 2XOEA 1UOQA 1XZQA 1N0UA 2H2IA 3LX8A 3LI2A 2E7ZA 2H92A 4C88A 1DEAA 1N3YA 2GCOA 2OV1A 1YQWA 3OCXA 4H1HA 5LA6B 3UMCA 1KMQA 3Q9NA 3VBCA 3OLZA 3LSTA 1O0BA 2NVWA 1MV8A 3D81A 3ZE7A 3KE8A 1U0SY 2VZ8A 2PQ6A 4JJZA 1LQ2A 3GCDA 3KUUA 1H4QA 4ZCSA 1RTTA 2RHBA 2VNKA 5BQPA 2AIRA 4UFPA 1JW9B 4PRYA 5JVDF 3L4SO 4ID3A 4XQCA 2QMZA 1RKUA 2VWHA 5HKOA 4L0CA 4WA8A 4C4SA 3ZXUB 4MQFB 4RTQA 4UD2A 1XUOA 3UWSA 1FOEB 1CUAA 2HZ7A 2V55B 4Q39A 2DFLA 4LF5B 2GJ8A 3AF4A 3QUCA 1MTZA 1UCFA 2IHUA 2F3RA 2WU0A 4QGSA 1B74A 1U0JA 1NP7A 1GQRA 1ST2A 1GGHA 1XRNA 2JB9A 3NLLA 4FMPA 4WUVA 4G2TA 2Z4RA 4O2AF 4BLOA 2OHFA 3HO1A 1J0AA 5C32A 4FLFA 4FBLA 2QU8A 4LOAA 2UDPA 5HUHA 5IKXA 1YA4A 2NADA 1JYFA 4X3CA 1IXKA 3Q41A 4H4EA 1EVLA 3PDWA 1Y4UA 2ZUVA 3H3XA 2QM3A 3NIWA 1P9NA 3VU1A 3KZOA 5L53A 4DA6A 4Z1OA 1P7WA 2OXRA 1ZOSA 3WKDA 5BQOA 3I5AA 3W3AD 3CHYA 4UUOA 5ELXA 2C82A 1HYEA 4M4SA 3DOIA 1Q1QA 1VCMA 4U0KA 2E4ZA 2XB8A 3HJRA 4MV7A 4QTZA 1IJKA 5LWHA 3E4CA 2MT9A 5CG1A 3CPSA 3WNQA 4QT4A 1GQOA 1HEUA 2V5AA 2ZE8A 1VSTA 2N1BA 2RGDA 4M9UA 1YVRA 4ZV7A 4RTRA 1A2OA 4XI9A 2HPVA 1VGRA 4RVGA 3ZWPA 1LBEA 3AXSA 3ZZNA 3N0RA 1X7YA 3BTSA 1IZZA 3QH4A 3ITKA 2VTBB 2Z6QA 1K9SA 2IKQA 5EUMA 1J24A 1QIEA 2CL7X 1YQEA 1FTWA 2DYKA 2FDXA 2DQSA 5F2EA 1PN3A 1KGSA 1UWKA 3SYRA 4GQAA 1KHHA 5EJGA 2IYNA 2QUIA 2YN0A 2AVDA 3O3CA 2PJZA 1UBTS 2YUIA 1TAHA 3KEGA 1TVCA 4JDUA 2WKWA 1EX1A 3KAKA 2Y4OA 1QIJA 4QXMA 5DYGA 3VVBA 5I6DA 1G20A 2YDXA 1A04A 1PUXA 1DOZA 1O6ZA 3HMQA 1OY1A 3VKWA 4ASUD 3HKEA 3I3SR 2E6UX 1ZGGA 3MA0A 4HSGA 4NAUA 1USWA 1ISGA 4PG4A 4IDEA 2A0YA 2YNMD 3AR9A 3DZHA 4EO7A 3O75A 3QENA 1NVDA 3KU1A 3SC4A 2R6AA 4Z3DA 4DY6A 2XZLA 4L6IA 4G37A 3SKYA 2PL1A 4KIUA 4TUYB 4NP6A 1KAOA 1XZLA 4F91B 1NN0A 1UXOA 4KLZA 3TG8A 3LYUA 3SYTA 1QE0A 1DKOA 1TOAA 3BXZA 2XUJA 4YUAA 3S8EA 1YOVB 4CZ2A 1HG0A 3CJRA 1XJCA 5EIWA 2B4AA 5ALPA 1ZHFA 4MKFA 3EMKA 5DHFA 1RT9A 4CHGA 4ECAA 3SXUB 2OK7A 5DLEA 4KPYA 3V1NA 4R8RA 2IRWA 3A7DA 3N0XA 3I9NA 3GHHA 3MTIA 3VYTB 4S1PA 2P2GA 2PBRA 4C3ZA 3CVVA 1FRFS 1SCNE 4GMGA 1EP1B 3Q5GA 1ENZA 1XD8A 5AKEA 3KQKA 1WP4A 5BUSA 1GQQA 3QQPA 2HPHA 2PGJA 5DN9A 3BKWA 1BQ3A 1FYFA 1E7MA 2FN9A 3C14C 3C8MA 3M4ZA 3LBFA 3NHWA 3NHAA 1OXKB 5EIBD 3QE9Y 1HDZA 3D4OA 1K6XA 3QVXA 4MR7A 4D25A 1U99A 4JIGA 3CLVA 4TVKA 2I2AA 3DBLA 2PRJA 1R0BA 2FDRA 4G85A 2O6HA 1H0RA 5LYYA 4LW8A 3IRVA 2AMLA 1DX4A 2KLBA 2QYTA 2W6IA 3GIWA 4KNYA 1VG0B 1VZ3A 2BD0A 2DULA 3DZ8A 1ZAKA 4ILEA 2VDKB 4Q16A 5ECGC 5I51A 4X95A 4B43A 4F8EA 4KHPB 1QG2A 2KBFA 3HNOA 3UAXA 1V11A 1FDTA 4PLZA 2W6QA 4HQRA 1X74A 2GAJA 4B8WA 3EISA 2G83A 4D43A 4Z53A 3ZTYA 4WCDA 3I2KA 1U2TA 1QF9A 3ZZMA 1OT3A 2NUAA 2QJTA 3WTBA 4C4YA 2CMFA 3HPQA 3PVSA 2QTAA 4FP9A 3CSDA 3ORYA 4Q9LA 4R9RA 3WQQA 1MX5A 2QDXA 1EFTA 1VHLA 2VDMB 2H4JA 4IDAA 1M1ZA 4US0R 3TTTA 3PFHA 2Z58A 1EVKA 4P9NA 2N3ZA 4EEKA 3SJUA 4L50A 4E5DA 5IMBA 2PL5A 4GNKA 5KOHA 1VE6A 4QYTA 2ZZMA 2GEFA 4GWKA 4ZAGA 3KJIA 1USUA 1XCBA 3RC7A 3QLVC 1JEEA 5EP1A 4RV9A 1R6DA 2VP6A 3GT4A 2Q46A 5DOZA 3EH2A 1SBQA 2VT2A 2CDAA 3O5AA 4FT4A 1I4DD 4KQKA 3WNDA 1BWQA 1QC5A 2SCUA 1JG3A 3BJIC 4I6EA 4OLFA 1LDGA 3PNYA 4MVYA 3O21A 2R6DA 4MYUA 3IMGA 4X7PA 3ZIAA 4C22A 2ZSHA 4E31A 1YZUA 2FR0A 3RF7A 5EFZA 4FTWA 3ESYA 4HBZA 2H7YA 1FX0B 2WMYA 5E9JA 2NO4A 2BW0A 3D8UA 4XSHA 4X5OA 1YCFA 3E15A 3R44A 4C0JA 3I4LA 4BO9A 1F4VA 1KFEB 1YULA 4XDYA 3MINA 1MENA 1Z8NA 2ES4A 5DZSA 4BNTA 3IRUA 5CD1A 5CB0A 2QAIA 3KDPA 2YHSA 1T4DA 2H0RA 3QOFA 2OG1A 4AY5A 1NFQA 1WDMA 4DZRA 4UTNA 3SVLA 4CXMA 4F5EA 1KPHA 4TLBA 4D9CA 2Z57A 2ZKIA 3E7DA 1BDJA 3TDMA 2DWPA 5LIRA 4Y30A 3C1UA 2E37A 2FPPA 2VXOA 2H63A 3TJMA 2VPTA 4WOCA 4RV4A 5REQA 1NJFA 1D0SA 2HKIA 1P1KA 3EUWA 3H9CA 2EDCA 3FTCA 1L5OA 4E94A 1SVKA 1WSWA 3EIFA 2DCUA 3Q9UA 2XMZA 4FJ2A 3VR5H 2AYXA 3SJCA 1ESDA 5KX5F 1H3NA 2E0IA 1SXHA 4NH0A 4FFOA 3QXSA 1XRPA 1WTCA 2HA4A 4NV0A 6ABPA 3W5HA 4B6SA 5AKKA 2R5FA 5B3KA 4LS3A 3K53A 4FYPA 3ADKA 1XWWA 5BR8B 1KS9A 1T5BA 2QX8A 5KC9A 1CUBA 1B42A 2QZSA 3SFVA 4WTOA 1OOEA 1VHJA 1P0IA 4LDRA 4XJVA 4BX2A 4PG8A 5IAOA 1FSFA 3J7AC 2VPXA 4C08A 5I7HA 5KX5A 4XCVA 3HUUA 5A5GA 4JQYA 1CVLA 4IZ6A 2IS1A 3A8TA 5CLQA 2J9XB 4QBIA 4BNWA 3TE6A 1ND6A 1YI0A 1YZ3A 1U6IA 3QTBA 4NBSA 4I4TB 2NUPB 1UBRS 5A4AA 4JC4A 5GJVC 4I7EA 2A9QA 1PNTA 3EY9A 1N8NA 3CZPA 4RL6A 1RP1A 4JYBA 5B58T 4YCCA 2YWJA 5TQ2A 3I0NA 3FLAA 1JLLA 4X62B 4YMHA 4M21A 4P4TA 3EYWA 1SOVA 1L5QA 2P91A 2ZRKA 4FDUA 2ZAMA 1PL0A 4CTMA 1MD9A 1FQJA 2WAMA 3DUFB 3M1AA 1VE7A 4ZT4A 4CMAA 1ICIA 1DAIA 1HOTA 4AIIA 1G7TA 1JQEA 3JR3A 5ER9A 4Q1FA 3UEOA 3WGKA 3H8VA 2DTEA 1ZM7A 1XD9A 4R7GA 2CBGA 5CVDA 1JMYA 1TQ6A 4BNKA 4EG7A 2QTRA 1NHGA 1ULSA 1IB0A 1Z6PA 2D62A 2QUBA 2XX3A 3EUFA 4R0MA 3GEDA 5A9SA 5KTYA 3PEYA 1G0OA 1PO7A 2ZIXA 1U5AA 3LLVA 3I72A 4COOA 2I67A 1UBNA 3V7NA 1GDDA 1RRMA 1EAMA 4UVGA 2GN4A 3LC7O 1V5EA 3A05A 1JH9A 2HMUA 1Q3TA 4PQYA 4X71A 2B21A 3BPSA 4LZNA 1PVDA 1NKVA 5KC8A 3ROKA 2V9ZA 1KVTA 4NV1A 4JVLA 4WFJA 5AJHA 1KARA 3TD2A 2PSDA 2DQKA 1YRBA 2DCMA 3BRWD 5ABPA 3A1EA 5SZIA 4LKRA 1U0GA 4MWDA 1ZQ1A 2OB1A 3H0KA 2PX4A 3B3QA 3KV1A 1CUVA 4UEWA 3I6YA 2R7NA 4Q7KA 1UPBA 3U3RA 5A4IS 4A03A 2A0FA 3G0DA 2P9EA 4LTMA 3MZ0A 3Q3IA 1GQSA 3D3QA 3SOPA 2X22A 2XF2A 1IUPA 2ZR0A 4FS8A 4ZYWA 1ZG3A 5LD2B 4YASA 3SN6A 3V3TA 2YMLA 5B30A 4XIJA 2B2XA 2B5OA 5CA1F 2EFHB 2GX6A 3QMWA 4UUPA 1TUBA 2FQ1A 3R9KA 3RYIA 4GGMX 3ZJVA 2H1WA 4KXUA 4CQNA 4HUQB 4JI4B 2COUA 3SE7A 3WDKA 3CUUA 2JW5A 1CWUA 5E2IA 1G8GA 2NO7A 3BGVA 3L7OA 4DSTA 3GLGE 4O4IA 3OIUA 4X8LA 4H15A 1B6RA 2JCGA 4WFIA 5E7JA 3V2HA 4E2WA 5I8WA 1WMSA 4ATNA 3U7QB 4UKDA 4DDMA 2O50A 1KQPA 1SZJG 1Z5UA 2DR3A 2PQ2A 3GT7A 4JBWA 1OR8A 4O2BF 1HOXA 4BB9A 4YNBA 1ILEA 1NF9A 4CM8B 4WHMA 3BVPA 1UF9A 1RHRA 4XDZA 5AD1A 2D8MA 2FWMX 2J3MA 2IZ0A 4YJ3F 1ZUD1 2IF2A 3D7KA 1SEVA 1DZIA 1VMAA 1G63A 2F1RA 2FPXA 5K5EA 1ULHA 3TNDA 3OCVA 4YDHB 3RHTA 3RTCA 4BFXA 5LYJF 3IPXA 3VXKA 1NASA 5FF9A 3JPYA 1IYZA 1QPBA 1DRVA 1U3GA 2ZYIA 4O2BA 4YDSA 4N0PA 1VIYA 1Z34A 1G4UR 4DR5B 2C9DA 4KU4A 1DP4A 2YJNA 4JLNA 1DHRA 1QGOA 4EHFA 1KYYA 2LZ0A 3I2YX 1KJ8A 2IPNA 3MWEA 2WDZA 3OCJA 4UMFA 1BE6A 1ZH6A 4YP7A 4BMCA 1XKXA 2XDQA 2A1UA 2IYWA 5ICFA 1XDBA 1ZD4A 2FE1A 1V16A 1V3TA 2IZZA 2O3QA 2O5VA 1T9GS 2RKBA 2XE4A 3H84A 3ORSA 5LYJA 1M2NA 4HYYA 3VO8A 4AFNA 5EE9A 1ZSYA 5L4SA 1VJDA 1U2PA 5LIPA 3E4DA 4C7JA 4MVJD 4KXYA 3RYCA 1Q91A 2BCEA 3QE3A 1AN0A 1W1UA 3AEZA 4QDUA 5JMPA 2JLUA 2GN1A 1Y3CE 4F21A 4MKIA 2ZB4A 1G18A 4ZOQI 2KYRA 2XOKD 5EJ2A 1L7PA 2CZQA 5J3JA 1E1YA 3CRNA 4ENRA 4MQFA 1W7AA 4MQLA 2C77A 2TMDA 4FNGA 2X0EA 1O4VA 3D59A 1EWKA 5IAJA 3W8DA 4PYOA 4ARSA 2VZ0A 2UVDA 3CLSD 3DVAB 3BFJA 1RS0A 1GPAA 1Z33A 3CZQA 1N25A 5FI0B 3I76A 1KJQA 1OWLA 1P3JA 1UBMS 1Z06A 2J3HA 2ZRPA 2X40A 5HTOA 3G8CA 1YRYE 3BQNB 3E9QA 3CWZA 1ZI6A 1ZOOA 1QX4A 2JAXA 5CNIA 5EIAA 3AONB 2OVFA 3M0EA 1JFFB 2EP8A 4CFYA 3IFSA 1PR0A 1UINA 5DNUA 1IJFA 2ZJBA 2XLBA 1IOLA 1FS5A 2QXYA 4OV6B 4PLTA 1HE5A 1Z4LA 2PV0A 1MQSA 1TA9A 2Q0QA 2ZWOA 1KZHA 8ABPA 2AMVA 4G23A 1WXEA 4G5QA 1M8GA 3RAGA 4BQNA 1YR6A 3TFWA 4DB4A 1AHIA 1VXRA 1T6ZA 1TADA 2IY8A 1KQOA 4FX2A 2OPHA 4JB0A 4F3CA 4I1IA 4F4IA 1KSHA 2W2VA 2H51A 1HKHA 1ZGJA 1Q7GA 4KN6A 4WY5A 3F6YA 4RIFA 3HBFA 2DE0X 5EG5A 1QWSA 1NHWA 1E2NA 4KODA 4F0JA 2C7RA 5L3QA 1Y1LA 4BZWA 2JA1A 5KTNA 2HSGA 1HC7A 4M8NE 2P9ZA 4WOPA 1KHTA 2E85A 4YBRA 2WB4A 4JI8B 3L79A 4YRRA 3QVLA 4F4CA 5LXTB 1ZBDA 1Y4SA 4V38A 3OWHA 3RU9A 5EWLB 1UDXA 4F2WA 3BH0A 4JT2A 3VC3A 2AF3C 4TOIA 5EZ5A 4OJQA 1DBIA 3DFFA 4E6EA 2V5VA 3HB9A 3H5OA 1HSZA 2HSZA 2NTEA 3PR3A 4RMGA 2WM9B 3SEAA 2RAUA 1W4AA 2P6OA 5HSGA 1P45A 5FUMA 3EGDB 3MS7A 4BIMA 3RS3A 3GJQA 2JFXA 3TLCA 3MQ2A 3UMRA 4CQLB 1RXUA 4MK4A 1T0PA 1IG3A 1Y6ZA 3RFXA 4EZIA 1F8GA 1GR1A 1CUDA 4INZA 2BGNA 3ANMA 2CXSA 4BPRA 4P34A 2MSEB 1RABA 2QP4A 2OQRA 1L7MA 1ORDA 1AKTA 3DAYA 1ZS9A 3H6KA 4TUYA 2ZJ1A 2PHZA 2IPOA 3KALA 1ZAYA 4MGZR 1ID8A 1NVVR 2IZOA 4ER7A 4B44A 3UJAA 1VLZA 3N8IA 3B60A 3IEUA 5AOCA 2FGKA 4MWGA 4IF4A 4KLRA 2ZCJA 3VOSA 4HNGA 5FKJA 5F5NA 5I7AA 2WMDA 4LAFA 4X8OA 1GGFA 5AVJA 3ZEAA 3U3OA 1RJ9A 2ZBUA 5KYWB 4LBZA 4G0NA 2G9ZA 3SXUA 5CDUA 1RCUA 1H23A 4YRFA 2VZ9A 2OHGA 1H2HA 2ZM6B 1I7SB 3P9RA 1TKRA 3BE4A 4Q3KA 2CLKB 1KK1A 4LF6B 1R18A 2Q5CA 3NHJA 3FOEC 1MV5A 3B7GA 3FN4A 1O94A 2VYQA 2CE7A 3T6KA 1R4NA 2ZTLA 1Y81A 1W6UA 3K5HA 1RJEA 1MH1A 4U2EA 4FYXA 3AR2A 1JG7A 1H42A 3ASUA 1NVAA 1RHJA 1FEZA 2HRZA 1E3MA 4J1TC 3PCRB 5C46F 5JI2E 4G5FA 2C2WA 3EOBI 3C3AA 3M6LA 4GRAA 2YWBA 3CCCA 3RIYA 5IVPA 4EGSA 2HBYA 1JDJA 2OESA 1W6RA 5IXJA 4E5SA 5KB3A 2VDJA 5EVCA 4HDSA 2CXOA 4PRLA 2XD9A 3BD7A 4XARA 4IXTA 5HKAA 4Y9RA 3W2EA 2I1LA 4LYGA 5BVGB 3TQQA 2ZUEA 4J0EA 3E5RA 3LOQA 5CJJA 3MM4A 4MVCA 4RTSA 5EVJA 1L4GA 1EWTA 4B5LA 5KJCA 2PZLA 2XQIA 1LPPA 2I2CA 3HDGA 4GUDA 5TVKA 1S1CA 3BXFA 3EF3A 4CKCA 3CVWA 4WN9B 2Q4TA 2R6GA 4M1WA 5JAOA 2D74A 1DAHA 3TQTA 2CHQA 2IF0A 3W2TA 1O9GA 2FFRA 3BDAA 5LLSA 2W6JD 1K88A 5TXGA 2ZAIA 1ZD8A 3DZGA 2BHRA 2RHTA 1LVGA 2W2LA 4FFSA 2H31A 4TV8B 5EJAA 2IV2X 4B48A 3HN7A 4AUEA 3LSYA 1LZLA 5DI3A 5AHOA 1BROA 3ZDDA 1QZ3A 3OIYA 4HI0E 4R1MA 4RKWA 5KINB 3U19A 1LI7A 1A9XB 2R11A 4B8YA 4BAUA 2YHAA 1YK0A 3BMCA 3V8BA 2BSAA 5JATA 1YRWA 2WDPA 4G5OA 5DM4A 2PLAA 3KYDA 4PS0A 3GW8A 4TWZA 1GCAA 2ZYGA 4AC9A 1G3QA 1JKJB 3PENA 4LZJA 4L95C 1RYHA 4YV1A 4UE3S 3SNKA 4P4SB 5CX4A 2AC7A 1T36B 2AWNA 2LWIA 4XQ0A 4BNHA 1XJWA 2LUOA 1KORA 3DEJA 4LRWA 4BCCA 5CFZA 1EQUA 4IXDA 1X3LA 1MIHA 3LQFA 4ZA2A 3Q5DA 2GXAA 1ZO8A 2ZRAA 1C9KA 2ZI3A 2VYVD 4OJNA 2PH7A 1IM8A 2IPAB 4CQMA 1F2TA 2PXAA 3KVNA 3LY7A 2WG0A 4M1QA 2VJYA 1D4ZA 4RA6B 4L85A 5E4FA 2Q3HA 3K0KA 3UPDA 4ENTA 5LM3A 1FX0A 2YXNA 3EQZA 3GPCA 4BFYA 3BQ9A 3GMSA 4LOLA 1A71A 1N33B 5F5XA 2ACEA 2J5RA 1V39A 1VI2A 2JHGA 4L7VA 1PSZA 3K1YA 3TW4A 4MGHA 3ROTA 3DPIA 3QX3A 1T3LA 2J7KA 4WW0A 5C1OA 1EK1A 2C2GA 1WBDA 2VQEB 1UMKA 3P0JA 2I6FA 3V2IA 3A9CA 3UWPA 1Q6YA 2C3MA 4DIMA 4UOEA 1KJIA 1RAAA 2D5AA 2A92A 1BHSA 3NCHA 4ZGGA 1Z18A 3W5BA 3ZI0A 5FUYA 2GKGA 2YYYA 4UFOA 4ENWA 1SCBA 1E0KA 1H0SA 2O1EA 1Z2CA 2YMMA 4GBMA 4E15A 3JRNA 2PLFA 4MP6A 1RCFA 5T8KA 2D1RA 4OHOA 5I9MA 3MERA 2VL7A 3VPDA 1KKLA 1U8EA 1G3RA 3K5PA 4Q3CA 1H2YA 4CKBB 1A2QA 3S40A 4GM0A 3BZBA 3GOQA 1RZVA 4IGKA 2BKLA 3IIMA 2LP4Y 3B20A 1IQUA 3KELA 2OGWA 4HQKA 4R5MA 4YAWA 5EIFA 3VH1A 4F4UA 3PLAE 1U8UA 1NXQA 1TYCA 1AKUA 1QGUB 2JH3A 2PSEA 1QGZA 1IY0A 4GOMD 1KSJA 3EXG2 3OCCA 4J16A 4QT0A 3R6GA 5PGMA 1USKA 2AI3A 1J70A 3IQZA 3T7JA 4DM7A 2O48X 4UTVA 3I12A 2RGUA 4UHFA 1NUSA 4MUNA 1JI3A 1QNLA 3RSGA 2AOUA 1AHPA 2W8ZA 3K15A 2BM0A 1Z2NX 2B98A 1UP4A 5TC4A 2HBZA 4YK7A 2ZJ0A 4I4TA 3L18A 2NQ8A 2D2VA 3RVJA 3RIHA 1UZNA 3TRKA 2G6BA 3GJXC 4M9SA 3RR2A 4OLAA 1L8XA 5A3VA 1FU8A 1XZPA 3S55A 4AO8A 1IC6A 2G82A 3EPRA 3QFFA 5B53A 3O8LA 2BR5A 2GT1A 2D4AA 1KEVA 4S12A 1T9HA 3K1AA 3MIZA 4IZHA 3QUAA 1IOZA 4JNKA 3RUEA 3W05A 4LRUA 4CMJA 1ZIOA 1BMDA 4OG2A 5C0OE 4JHLA 3WLSA 2QVXX 1TTQB 4PU0A 4TYWA 1R0YA 1RBQA 3DE1X 5KHAA 2CHFA 3G2QA 5FX2A 2CV1A 3FNHA 2XJ9A 3OU6A 1U2EA 2X7HA 1PLKA 2RJOA 2A59A 5EP2A 1D9XA 3F7TA 4K87A 4MV0A 3G3EA 3LCVB 4YECA 3RLFA 3UXMA 4TTAA 5IZCA 2W83A 4PE5B 1U1DA 3SX2A 3EEOA 3GFGA 3X2EA 3DOJA 4URWR 1JLRA 1F14A 2EWMA 6REQA 5SYNA 1EE9A 1AN9A 1X8LA 1G41A 1UBHS 2NN3C 1IN4A 3E5MA 1NVXQ 1X70A 2GLTA 4GRDA 4PLPA 1MAVA 1SKBA 1TDJA 4TROA 3VM6A 2CL5A 3MBIA 3W77A 1G1AA 1XCJA 3E3AA 2AUNA 1US8B 3CLRD 4BMOB 1YUMA 4Z86A 2ATEA 3LBNA 3FJ1A 1OASA 3HMKA 4UAGA 5F52A 1PRYA 3GH3A 2GTPA 4C0XA 1EP2B 3IESA 3CF0A 3DFMA 1O3YA 4XOUA 1Y1RA 4G9GA 1TK2A 5FPTA 4A8JB 1O54A 2IP2A 2Z5FA 4US1R 2AR7A 3O7WA 1Y4ZA 2J0UB 5C5IA 2IBMA 4KV9A 4QBGB 1OVMA 4F04A 3QX7A 1C9JA 1Z0ZA 5CXSA 4Q7QA 1G60A 4HZUB 5DU2A 2H54A 3AOEC 5ISMA 1UK9A 2XTNA 2F9MA 2OO5C 3LGAA 2WHYA 1YB1A 3ZY6A 3B1XA 3ZH9B 1MEOA 3CZCA 1P2TA 2B20A 3OLQA 5AW8A 1XDWA 1XNHA 2PJUA 2ZPTX 3O92A