5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
b'EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
molecule tags Oxidoreductase
source organism Brucella abortus biovar 1 (strain 9-941)
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
3R3SA 5HS6A 3C7DB 3KETA 1PQWA 1LEHA 1YS4A 3HFSA 3JYLA 4UVGA 4Z9FA 5JCJD 1OOEA 1YL5A 3DZFA 3N74A 2P9EA 3GN2A 2PZJA 3NTQA 4WNIA 3RUIA 1IOLA 4ND5A 3NDRA 1R4MB 1WDLA 2IEDA 2HKIA 4WEQA 4XCVA 2YDXA 1PIWA 1SO8A 2NU9A 4D45A 2GZ2A 4L9RA 3LC2O 3OECA 3STHA 3JQFA 5CEJA 3I6QA 4JIGA 4TZKA 4BNWA 3D5QA 5KKCA 3TF5A 1DIBA 4CQLB 1U28A 4XGNA 4B4UA 2XXJA 4AFNA 3L4SO 3PDUA 3H8VA 1T1RA 1QYDA 1M67A 5ILOA 1NPYA 4R5MA 1BXZA 1DB3A 1RM0A 4P4GA 1MX3A 2C2XA 2FP4A 4L73A 3SC4A 2QW8A 3RVDA 2W90A 2NVBA 3L4BA 3ZNNA 2W2KA 4CQMA 1LTHR 4EJ6A 2E49A 4B3JA 4BMNA 4GGOA 4XZ3A 4IJWA 4E4YA 5AXBA 2QYSA 4F6CA 5ICMA 1T2AA 4ZQBA 3ZWWA 2Q4BA 2WYUA 1H93A 2NU8A 1XCBA 3VTFA 2CNBA 4J0FA 3DBLB 3PXXA 1XHLA 1R16A 4CLDA 4IMPA 4TKLA 4DLAA 4WCFA 1WMBA 2UYYA 5THKA 4IXWA 2XF8A 1YDEA 2YV3A 3D64A 2ZCVA 1O9BA 3NTOA 3TZCA 1HXHA 4FFNA 3DBVO 2WDZA 2OUIA 2R2GA 4AJOA 3GPIA 5CDGA 1RJWA 1YONA 1JVSA 1XLTA 4DQUA 4B79A 4NR0A 4HV4A 1BDMA 1C1XB 1KIFA 3PWZA 4OAQA 4GX5A 3NJ4A 2HK9A 4LMPA 3KUXA 1Y1PA 1O89A 3DFUA 4FOSA 1HYGA 4LISA 4R9SA 4UREA 4G5HA 4J7XA 2O48X 1VL8A 2CFCA 1PGOA 2O3JA 4GX0A 1ISMA 1UDBA 2Y0CA 4JJGA 2AHRA 5DN9A 1XDWA 3RQSA 4R1UA 1E0DA 4E0BA 2PGLA 3WICA 3GK3A 5I9LA 2BH9A 1PZHA 2CZCA 2BKAA 2JD2A 1HDXA 4WPGA 1FDTA 4PVDA 4XDYA 2Y68A 1K2WA 1B8UA 2XOXA 5T8KA 1HE2A 3ZNOA 3WLEA 1UR5A 2HUNA 3V2HA 3LK7A 2IZ0A 1UP7A 2BI8A 3LU1A 4IDBA 4OXNA 4XIYA 3UHAA 4UEJA 1FDSA 3TOZA 4A03A 3BMNB 4F46A 5JBIA 3U09A 3G1UA 3DL2A 4N18A 3OF2A 3W4JA 1Q0QA 3QP9A 2WMDA 3AI3A 3AWDA 2Q1WA 2V6MA 5DNAA 1Z7EA 4E21A 1EK5A 2VOEA 3KV3O 2W2LD 2B4TO 3Q6IA 1RYEA 3GG9A 1HE3A 2VRCD 4KOAA 5FI5A 4BKPA 3GNTA 2GASA 4GX1A 2Z1NA 4BMSA 1PJ4A 4OJNA 3DZGA 5IDYA 3ZV3A 3AFMA 4GQAA 3GA0A 3D4NA 3DZIA 3KYDB 5K0ZA 2P4QA 2RHCA 2Z5LA 1E1MA 4RVUA 2Q3EA 2D0IA 3B6ZA 3PHGA 4Q39A 5EL0A 3WGQA 5DP2A 1WZIA 1DFGA 2EEZA 1Y8QB 4FN4A 4ZRNA 2P5UA 1B16A 1HYHA 2E4AA 2DUWA 3V2GA 5B1YA 5F1KA 3L6EA 5TNXA 3H3FA 1RM5A 3NGLA 5G0SA 1RM4A 3DOCA 1R6DA 3I9JA 3D7LA 1NWCA 1R66A 1C14A 3H5NA 4MIEA 4J9VA 3GGOA 3FD8A 1V3UA 1U2DA 3VDQA 3ZHBA 4GKBA 3TZ6A 1GY8A 2FWMX 3INTA 2AG8A 2IXAA 3L07A 3WG9A 4YRAA 4TMFA 5GZ1A 1WDKA 4M89A 4G81A 1X0VA 2V65A 3D4OA 2OP1A 1ENPA 1PL7A 5KJFA 3PIIA 3Q3CA 5EERA 2GF2A 4P4NA 3B1KA 4RVFA 3GMDA 1PTJA 5MGBA 4P22A 1CEQA 3K2EA 4D3SA 2A35A 4YJDA 1E7QA 1OAAA 1NVMB 3LLSA 1ORRA 1LQTA 3RSHA 1MLDA 1GAEO 3RBVA 3ST7A 4R9RA 4NFHA 4R5HA 1DBVO 1LA2A 3VHRA 5L4NA 4K9DA 4BMVA 4XYEA 4EBFA 4XA8A 4OXYA 1ZEMA 2P5YA 1GUZA 2FN7A 1FDVA 2NM0A 3BMQB 2H1SA 5IAAA 4CQMD 1ZZEA 3RJ9A 3VVBA 1QORA 3ZWMA 4W4TA 3GY0A 1P0FA 3FNGA 4MVJA 4WOKA 5A5EA 1PWZA 2X9GA 3VZRA 2C7GA 4XB1A 1FXSA 2O7QA 2E48A 1VJ0A 1P0CA 3JYQA 4RDHA 1VRWA 3CUKA 4OKNA 2D2IA 1BWSA 5GZ6A 1N9GB 3DZKA 3TNLA 4DVJA 4Z9YA 1I33A 4BIIA 1N5DA 4NJMB 3ABIA 2Q50A 4CR6A 3WGYA 2W4QA 1ZJZA 3P2OA 4CLOB 1I2ZA 1QV6A 4XYLA 1PL6A 3HJAA 1CRWG 4II3A 3FF4A 3O9ZA 3VC7A 4E12A 3EYWA 2W8ZA 1XU9A 3JQ7B 1SEVA 1HDZA 1TB4A 2Q1UA 2A4KA 1LXCA 3S55A 1JKJA 3VZQA 4BV8A 4U0KA 4BO9A 3UKOA 2Y1EA 4NIMA 5C37A 3NRCA 4EGFA 4J4HA 2GRAA 4M54A 5I7SA 5I7EA 3LSYA 1CERA 4HFJA 3IUPA 1X13A 5JYDA 2X1HA 4KTTE 3W6UA 1KVRA 1ZK4A 3EC7A 2JJYA 2VCYA 2VTDA 4W7IA 4CUJA 5L3ZA 2AXQA 3AFNA 1P74A 3H9EO 3JYNA 4CM9A 1MXHA 3GNQA 3JQ9C 2HMUA 3ROMA 1E6WA 3WJ7A 2YFHA 2ET6A 4K26A 3P19A 5I9MA 3ANMA 4LK3A 1QV7A 1U8FO 4MJLA 5K9ZA 3AK4A 4BO6A 1HDYA 4UUNA 3ZN2A 3G49A 5A06A 1NTOA 3JQBC 1R12A 4KP7A 1QP8A 3AM3A 4UUMA 1ZK1A 4BKOA 1Q0LA 2YY7A 1ZK2A 3LZ6A 2NQTA 3RIHA 4Y9DA 5L4SA 4BO7A 5LDGA 3S2EA 4R69A 4H3VA 5T64A 2CY0A 2YFQA 5F3RA 1XG5A 2ZKLA 4WASA 3FI9A 5L40A 3VPXA 4DLBA 1H9AA 1YB1A 4GVXA 4XQCA 3TPCA 2VHVA 5ADHA 5COQA 3QQPA 4ID9A 4CM7A 2Q49A 1YWGO 2P68A 3INRA 3GDFA 1NM5A 3QJ5A 5LCXA 1W4ZA 4J1NA 4CM8A 1HE5A 1IL0A 2QRJA 3HUDA 4YT5A 1I01A 2AW5A 1UAYA 2FSSA 5JDCC 2FSVA 2ZQZA 3ROPA 3JQAB 1LJ8A 4ZQEA 3V1TC 1S6YA 4BL5A 4D3FA 2X22A 3MJTA 4ZQFA 1EK6A 1LI4A 2GN8A 1VI2A 3O8QA 1D1TA 1T26A 3HZZA 4GMFA 3X2FA 3QE3A 3CZMA 4Y67A 1BXGA 1CDOA 2WTBA 5TIIA 2HU2A 1XGKA 4MDHA 3FR8A 3IDSA 3PDJA 1E7RA 4TSKA 1JTVA 2ZYAA 4CMIB 3TDKA 3AU8A 2RBEA 3OJEA 3U62A 4I5GA 3AUAA 2Q2QA 3SJ7A 3WXBA 5I7VA 3F1KA 2FHSA 3WGTA 1ENZA 2UVDA 3KOUA 4FC6A 4WUVA 3DBHA 4A0SA 4D43A 4FFLA 3IKTA 4CM5A 4OGWA 1W0CA 4CM4B 2JFHA 5H81A 4WE3A 5C7LO 1HKUA 2X0JA 4BNGA 3ADPA 3ANNA 1KY4A 3PJDA 3E9QA 4MO2A 4BKUA 3ZWAA 3HHPA 4E2ZA 3JQFC 3ZW8A 4O1MA 4RF5A 3NTRA 3GDOA 1LQUA 4TRNA 2WE8A 3NKLA 3MTGA 1DRUA 1U8XX 1V6AA 2I6TA 1UXGA 4BNTA 1B3RA 3M2PA 4TWRA 4BUCA 1X1EA 5JDIA 2ZQYA 4TRJA 2VUTA 4I08A 2SCUA 3HB5X 4LSMA 4GAEA 1ONPA 4GKVA 5LDHA 3IOYA 1YO6A 3H2ZA 2AMFA 4AJ2A 1A72A 1U4SA 3IP1A 5IZCC 1ADCA 4J7CA 1AE1A 4D41A 4Q3BA 3ENNA 1E1LA 4I5DA 1O94A 2NVUA 4Q3DA 4CM6A 1KEWA 3E48A 3QRWA 3WMXA 2D8AA 3GRPA 3GMSA 5G4LA 4IM7A 4EDFA 5A1TA 3KHUA 2J8ZA 2WE7A 1HZJA 4R51A 3DEYX 3OSUA 2BF7A 1GPDG 4PLZA 4YAGA 4IXTA 1CQJA 4L4XA 3DO5A 5L4LA 1TLTA 5F5LA 4EJ0A 5TGDA 1V8BA 1G0NA 1K3TA 3DAGA 4Q3CA 1H9BA 5KNLA 8ADHA 3DMTA 4J2HA 4L4RA 1K89A 2ILTA 3QV1A 3RC9A 3GAZA 4OQZA 5AQ1A 2H9IA 3OQ6A 2NQ8A 1I8TA 3GUCA 1JN0A 3VPFA 2OMEA 4RORA 1IUKA 3TN7A 4B7UA 2J3HA 2O3SA 4LGVA 1EUZA 2Y1FA 1PL8A 1E7WA 2DUUA 3AOEC 1BW9B 1PS8A 3D0OA 1YKFA 1F0YA 4GI2A 3RBXA 1X1TA 5IFLA 1QRRA 1E3JA 4MVJM 2GSDA 3WX0A 4GBJA 4BO4A 2Q99A 2UUPA 4KUHA 1LRKA 2ZATA 1ZFNA 1DLJA 2RH4A 2B4QA 4U8GA 3ASVA 2DQ4A 2VWGA 3ZHYA 2O2SA 4I1IA 4ND4A 3JCZA 3KXDA 2JD1A 1DEHA 2GDZA 3GZNA 4OKIA 4Z6KA 4CODB 5G4KA 5IJZA 5C7IO 5EN4A 5C5IA 3WOHA 1PS9A 3AY6A 3HWRA 2PFGA 1A71A 2JCXA 4N5NA 4KQXA 3TL3A 4LRSB 5TX7A 4HFNA 4DA9A 1SNYA 1YOVA 4PLGA 2HAEA 1TT5B 4MINA 3WQRA 3OH8A 1F14A 4PG5A 4BQPA 3RUHA 4EUHA 3DAFA 3F6YA 4CLXA 3PJEA 1QLHA 2AA3A 3QWFA 3RKRA 3WSWA 3E18A 3ZI0A 3GH3A 5IXSA 2LDXA 1NQ5A 2VN8A 4PRLA 5T57A 1WXDA 4E5KA 3CEAA 1ISIA 1DJQA 4KUEA 3KYCB 5KWEA 1XQ6A 4D42A 4DPKA 4HX5A 2JD0A 5EQDA 2F00A 3OJ0A 2G82A 1JAXA 1Z82A 2DTEA 1P44A 3RWBA 4NBWA 1GUFA 3LT0A 3VZSA 4A7PA 4MKXA 1T24A 4I5FA 4TROA 3GZ4A 3H3JA 1NAIA 1SEPA 3DC2A 1YQXA 4KTVE 2C0CA 1W8DA 2C07A 1GR0A 2O23A 1PS0A 2X5OA 1NQAO 4OSOA 5DCYA 4BB5A 2DAPA 4YJGA 5BR7A 4BGIA 2UDPA 3WYEA 3TFOA 1DHRA 4PLWA 1FDUA 4QXMA 4DBVO 4K6FA 1NVTA 2PNFA 4FFPA 3PP8A 3C7AA 3HN7A 3S8MA 3W4IA 3NYWA 4EW6A 3WGZA 3GRKA 3RUEA 1IPEA 2EGHA 1ENYA 4W9NA 4W82A 4FC7A 1MUUA 2DC1A 1LNQA 1YJQA 2DVMA 3I1JA 3NUGA 4LVUA 5H82A 1Y9AA 3TSCA 3U4IA 4RGBA 7ADHA 4B8WA 1I3LA 3OJOA 1VPDA 1X15A 4IINA 4K6CA 5HBRA 1EMDA 3MJVA 2GZ3A 5L7YA 3KRTA 3EAGA 4QSMA 1HLDA 1I2BA 3G17A 5CPFA 1E3LA 4NG5A 1VKOA 4I9UA 2PH5A 4IJKA 4YXFA 4OMUA 1DXYA 3AY7A 4JXKA 5U9CA 2O3UA 4O5OA 1DC3A 2A9FA 1ZSNA 3HDJA 1Q7CA 3CXRA 4KDEA 1QXSA 1OC4A 3ETGA 4CL3A 3SEFA 2Q2VA 1DIAA 4L74A 4B4OA 4R54A 3JQEA 2VZ9A 3FNHA 1E5LA 1CQIA 3R3JA 3JQ8A 1V0JA 2OL4A 2YUTA 3F9IA 1SPXA 3WGGA 4BO1A 4E33A 4PN3A 2NTJA 4IGEA 4BB6A 1Q2XA 5A5FA 3W8DA 4JLWA 1UDAA 1ZSVA 4TVBA 4DIFA 5KOIA 1PJSA 1R4MA 3RD5A 3I9NA 1DFHA 2ZB3A 3JYPA 2VT2A 4N5LA 5TLSA 4EJMA 1KEVA 4YJHB 4QO7A 5L51A 2BFMA 4ZA2A 3EMKA 3A4VA 4XJSA 4AJ4A 3TFQA 4FFRA 3L6OO 1I10A 1IHYA 1NWHA 1O6ZA 3OQBA 3Q2KA 2NTVA 3ETEA 4TRRA 1HETA 3BMOB 3JQGB 5HRUA 4Y6SA 5EJ2A 2AQIA 4XR9A 4HUJA 3UXYA 1U7HA 1P1KA 3TOXA 2F1KA 2RHRA 1P77A 4CV2A 3K6JA 2J3JA 4J1SA 2C20A 2VYND 2BFAA 5DF1A 5A3VA 3GDGA 1VLLA 1EVIA 2G5CA 3QIVA 1Y6JA 3ROQA 2PKQP 4WCFC 3L0DA 4W6ZA 1QLJA 1SMKA 4NK4A 4ZHSA 4EZBA 2PWZA 1WVGA 2VNAA 4PLFA 1P1RA 1NX6A 1AUPA 3PFFA 1TEHA 4IY1A 4Y8VA 2W2LA 1LSOA 3O4RA 4M1QA 1GL3A 3KSZO 3F4LA 2X5KO 1D7OA 1E1NA 1BSVA 5HTOA 1A27A 3HNPA 3T4XA 3LQFA 3ZZNA 2HLPA 2ZIZA 4QQRA 1CWUA 3NDIA 1K6XA 5CDSA 4L0QA 4E5PA 1FF9A 4R4JA 5B4TA 3CSDA 3ON5A 2I9PA 2B37A 3CE6A 4LW8A 4P8RA 4WLOA 4YRDA 1PQPA 3SX2A 5TJHA 1ENOA 4EUEA 3JD2A 3OHSX 1GZ6A 4JBIA 5ITWA 1E7MA 2BGKA 1IZ9A 3IKVA 4NU5A 3WQSB 2CDBA 2Q1SA 1HL3A 4DLLA 2JFGA 2DTXA 3MJSA 2O4CA 4ND1A 4QFDA 4Q3EA 3BTOA 1JDJA 1OI7A 1LLUA 2ZK7A 1M6WA 3GHHA 4XJTA 5F21A 4DPLA 3PK0A 4DQVA 1UZMA 4BNKA 1HT0A 3RKUA 4MVJF 5JS6A 3AW9A 1OFGA 3E1KA 4Z0HO 1MV8A 5JY6A 2C5EA 3RC2A 1KYQA 2B83A 2PH3A 4DUPA 3ZH2A 1ZMOA 3LF2A 4M87A 1I30A 4RQUA 1KVQA 2O3RA 5BNFA 3KTDA 5CDYA 1MG0A 1UXKA 1F8GA 4FDAA 4QEDA 5CEFA 4MIYA 2HMTA 1CJCA 2J5RA 1M75A 2RH8A 1H94A 3E5RA 4GVLA 2Q45A 3F3SA 5T67A 3VPHA 3ZHZA 3KYDA 4M49A 5KVCA 4LN1A 4ND3A 4N54A 4JK3A 2HQ1A 2FPIA 3B1JA 4CM8B 4CLEA 4E5YA 1D1SA 2GGSA 5ICSA 2FY8A 3JQAD 3ONFA 4UVIA 1MC5A 1PJQA 1B15A 4XRGA 1R0SA 1YQGA 3I9OA 3MWEB 3PEFA 4F3YA 4XR4A 3PWSA 3PZRA 3CMMA 1IY8A 3M1AA 4A2CA 3FR7A 4LVCA 3VVCA 1T2EA 3Q1LA 3AOEA 4YJFA 4FBGA 5G0UA 4AJNA 1DOHA 1YBMA 1P1FA 4CLRB 1MXFA 1U5AA 2VRBA 3ZWVA 2Y0EA 1B8VA 3ZWYA 1NASA 1EFLA 1NR1A 1PZGA 3OETA 1DRWA 4OSPA 5JDIC 3IUSA 1H6AA 3DZBA 4AJ1A 3K31A 4CMGA 1ISJA 4YT4A 4U5QA 2C59A 3R1IA 2E37A 4IS2A 2Q46A 3EUWA 4YACA 4FQ8A 2ZYGA 1U3UA 1YVEI 4BKRA 3WB9A 2DFDA 5IXYA 4XGIA 1WLYA 5JO9A 5BNTA 5TT1A 4IDAA 2IYPA 2ZB4A 2A92A 1GYPA 3RUAA 4J6FA 1A4UA 2EWMA 3Q9UA 1O95A 2QZZA 1E7YA 2J3KA 3TJRA 2OBYA 4O0LA 3DBRA 3V2UA 1NFRA 1HE4A 4YYZA 1PGNA 4DMLA 4NJOA 2VHYA 1GYQA 2JAHA 2FZWA 3N58A 4J90A 4ALNA 3K30A 1LU9A 2YZ7A 4I9NA 4IIUA 5G0VA 2DBRA 1H5QA 1UXHA 1K6JA 4E30A 4HNGA 1C0KA 1A5ZA 1DIGA 3ZWCA 2TMGA 4B7CA 1IYZA 1UZNA 1ZK3A 3FN4A 1EVJA 1H6DA 4P38A 5FI3A 2H6EA 4YAEA 1XEAA 3P5SA 4BNVA 3H7AA 1Z7BA 2OO5A 3NT4A 1U2GA 2VYVA 1N9GA 3UGKA 4DBZA 3E5MA 4OO3A 4OXKA 3OICA 3PIDA 3EZYA 3QVTA 2Z1MA 4KQWA 3I52A 1U3TA 3I9LA 1NXQA 1P9LA 3CIFA 2GZ1A 3AUTA 4Y6RA 5CDUA 2VHZA 5TC4A 3KEOA 2AE1A 3U4HA 3QW2A 5TT0A 1H0KA 3Q0EA 1J5PA 1DSSG 1YQDA 3GHYA 3FHLA 4JJIA 4YTEA 2X7HA 4MOWA 4J9UE 3ZCXA 5I8WA 1GU7A 4IQGA 1HDGO 3SLGA 3GC6A 1WW8A 3WBFA 1HYEA 1P1JA 3KSDO 1GDHA 1DPGA 3I23A 5AXDA 3KEQA 1P33A 4CMAA 1DC5A 1DO8A 3TQHA 1U9JA 2V6BA 3PFWO 3ZWNA 2P4HX 4BNIA 1X0XA 3IMFA 1DC6A 1LBEA 3EK2A 4KWHA 3ENKA 4CUZA 5B4UA 4L4SA 2O3TA 5KIAA 4AVYA 3AOGA 4ND2A 2EIHA 1JWAB 3H5AA 4R3NA 2I3GA 1FJHA 4IZIA 4PZEA 2OXIA 2WWRA 1I2CA 2NLOA 4QTZA 5CP8A 3NEPX 3OM9A 4CMJA 3AM4A 4IDFA 4PGFA 1SOVA 1AHHA 1NQOA 3C85A 2HMWA 1M6HA 3TZKA 4BO2A 1X14A 4I5EA 3BMCA 1ZJYA 5GY7A 3RU7A 3DONA 1T4BA 1DHTA 2HSDA 4FW8A 1R4NA 4IQ8A 5CEEA 1NP3A 3Q2IA 1WP4A 1MP0A 1JU9A 3WSVA 1VJ1A 3PYLA 2YHIA 1GV1A 1R0KA 1CYDA 4XYGA 1EDZA 3PHLA 5A05A 4BNYA 3U0BA 3UF0A 1TVEA 3H9QA 4YAIA 3UVEA 3W8FA 4RPKA 4BO8A 2C7VA 4WCFB 1E3WA 1B7GO 1ISHA 1T4DA 1RWBA 2VOJA 4UEKA 4U6QA 1GV0A 2B36A 2ZTMA 3U5TA 3ZW9A 2DPGA 2EKQA 4DMMA 2WM3A 3F5QA 4ALIA 3GGPA 4NK5A 3UUWA 1V3VA 4DTIA 1LC3A 1ZSYA 4KMSA 4UULA 3BAZA 4DC1A 1DDOA 3JYOA 4AJLA 2A94A 2DTDA 1I32A 3DQPA 4OOEA 2J5QA 2R00C 3ONDA 3ICCA 2DM6A 1NFQA 3IIEA 3AY3A 1L7EA 1JVBA 2YJZA 1F8FA 2B69A 4YPOA 3OFSA 1OMOA 2ZYDA 4A10A 5EQFA 1EE9A 4D3DA 1ISFA 3ULKA 3OIGA 2J6IA 3DBLA 5JMWA 2FMUA 3GVCA 3TWOA 3RU9A 3VPSA 4YJGB 4E32A 3T4EA 3LYLA 4J4TA 2J5KA 2WD7A 2CVQA 5CHEA 2X9NA 3T7CA 1GPJA 5I9NA 4ALKA 1PGJA 5L45A 1CF2O 4BVAA 1IPFA 2EG9A 2D3TA 2V7PA 3KBOA 3OBBA 5KJ6A 4GL4A 2NU6A 7MDHA 4BS9A 4HADA 3OEYA 1X7HA 2YW9A 4BNMA 4C4OA 1KOLA 3TL2A 2O4UX 2I5PO 4H15A 4AJIA 3K92A 1LLQA 2PGDA 3IAHA 2Y05A 4TVOA 4WOJA 2B35A 2DU8A 3VH1A 3ASUA 5DBFA 3E9NA 4MVJG 3ICPA 1LDMA 2GD1O 5B4VA 2JL1A 4UAGA 1OZAA 4HWKA 5A9TA 2IE0A 1HDOA 2B5WA 5JXWA 2HCTA 2GN6A 4IDDA 3W6ZA 1ZXBA 2HK7A 1U3VA 3RC7A 4D46A 4W99A 3WDSA 1BGVA 1YB4A 4BNZA 4ZQGA 1Y8QA 4MP8A 1ZUD1 2XPCA 4HFMA 1ARZA 1UXIA 2D5AA 1BMDA 4GWKA 4KUGA 5COBA 3U49A 1PEDA 1EE2A 1XU7A 4XDZA 3BTUA 3QSGA 5JSFA 3CINA 3NDJA 2V6FA 4J1TA 3H65A 4OIMA 5KKAA 1Z75A 4XGKA 2EW8A 4DPMA 3FNFA 4YQZA 3V1UA 2X6TA 1Q7BA 1P45A 5G0TA 4IJUA 1WZEA 3LT1A 4J91A 2IYOA 2DBQA 3QWAA 4XYBA 3WGIA 4CPDA 3C1TA 4NHEA 2HJRA 4BNFA 1QMGA 4CLHA 1V9LA 1V3TA 4BQRA 1U3WA 2VZ8A 3S2IA 3H5RA 3E03A 2I3AA 4XRRA 5ENVA 5KVVA 3QVXA 2GN9A 4X54A 3VH2A 2AG5A 1GEGA 2Y1GA 4PLPA 3ZU5A 5A04A 1EDOA 2AEJA 2BFOA 2OFPA 3DOJA 4JNKA 4PCVA 3EGOA 3RUCA 4CQLA 4BNHA 2I99A 1LDNA 5IG2A 4UVHA 4BO5A 1YGYA 3DB2A 3PWKA 2OORA 3I9MA 4JQCA 5T8KC 1PJTA 4INAA 3KZVA 1MGOA 1SOWA 3CMCO 2RIRA 3MOGA 3UCFA 2Y66A 5JYEA 1UXJA 1OBFO 3HQ4O 5BSFA 5JCJA 3KM0A 5IZCA 2CMDA 3V8BA 4BO0A 4GPD1 5G4KB 3DZHA 1LRJA 3UW3A 1P31A 3QVSA 1GCOA 2X9VA 4YEDA 4C7KA 3L9WA 1YXMA 3ZHXA 4FOOA 3VZPA 1BRMA 2P9GA 5A02A 1KERA 2EXXA 4NFSA 2Q4EA 4NNJA 3WJAA 5KJEA 2PZMA 1ADGA 1RM3A 2ZJ1A 3SC6A 2OP0A 4IDGA 3GVIA 3H2SA 4GSKA 4IS3A 5L9AA 5FEUA 2HRBA 3IS3A 2ZB8A 4NPCA 4JROA 1TT7A 3IQDB 4UUOA 3LC1O 4MP3A 1YDWA 1YH3A 2O3QA 2W2KB 1I24A 4LCEA 1P1IA 4LMRA 3RBZA 4GMGA 2QYTA 3ZU2A 1V35A 1PZFA 4HKTA 3PVZA 3EZLA 1NVGA 1BTOA 1WPQA 2VWHA 3I3OA 4B4WA 1I5RA 5KJ1A 1IB6A 5T6BA 1VC2A 2DBZA 1T2CA 3L6DA 2QRLA 6ADHA 4GGPA 1W6UA 3HSKA 1YE3A 4RPLA 1EZ4A 5K6AA 3SJUA 4JBHA 3HN2A 1SCUA 2GUGA 2OGUA 3GGGA 1P1HA 1NNUA 1ZBQA 2H5LA 3K2BA 3BHIA 1TI7A 4O6VA 4XQGA 5ES3A 3RCBA 2Y67A 3FWZA 3BMNA 2GPTA 4RV9A 4CLOA 2AQ8A 4UVDA 5BNIA 3WNVA 5BT9A 4F45A 4J1QA 4LRTB 4GX2A 5B37A 3UH1A 3UN1A 2G0TA 1D4FA 3DHYA 3PYXA 3H9JA 3OJFA 4IJVA 4DQXA 1E77A 4FR5A 4ZD6A 1XQ1A 3ZWXA 2ZB7A 1ZVMA 2YV1A 3JV7A 3KSUA 2HK8A 3LT4A 1GADO 1Q7GA 4ALMA 4R68A 2J3IA 4BNXA 1DJNA 2C2YA 2NUAA 4B7XA 2VRCA 4E13A 1U1IA 2D59A 1JKIA 4A5OA 4GSLA 1Y9EA 4PIVA 1C0IA 1Y7TA 3JQ6A 2C82A 5HWSA 1RYDA 3JD4A 3EW7A 3E8XA 2BRUA 3GQVA 3M2TA 5IF3A 4FFMA 5AXAA 4NBVA 2NNLD 3AI1A 3CH6A 3CZRA 3GEGA 4WLNA 4AG3A 3WGOA 1PJCA 5IN5A 4CMEC 2YYYA 2G1UA 2D5CA 4MKRA 1MA0A 3GF4A 3HDHA 2CSUA 4ZGWA 3HFGA 3MJCA 5TSDA 3DHEA 2BGLA 5EMHA 1LRLA 1KS9A 1NYTA 4Y98A 2VWPA 3N7UA 1MFPA 3DBHB 3F4BA 3DFZA 4Q3NA 4YT2A 1A7KA 1VSUA 1NPTO 4AJHA 4CM1A 3A1NA 2RAFA 4K1LA 5BSEA 2ZJ0A 2EKPA 3FBTA 1KEUA 1MG5A 3UAGA 4O63O 3E6AA 3OIDA 3RC1A 5L95A 3RI3A 2CVOA 4J2OA 4HNHA 5FWNA 1KVUA 2GCGA 3ANLA 4Z0TA 3HE3A 3NT5A 1IZ0A 4RF4A 4EEZA 5JPIA 4RJTA 3PQDA 1KC3A 4BOYA 5L53A 3JD0A 1UP6A 4XD2A 2QX7A 5JNLA 1PGPA 4CMIA 1LC0A 2X23A 4S3MA 4NBRA 4MVJD 4YB8A 3U4CA 4FJ2A 4JBGA 3GFGA 2CDAA 4MPDA 3A28A 3TRIA 3PJGA 1DIHA 1B3BA 4EUFA 1U4OA 1A9ZA 2X5JO 4B4VA 1GD1O 1PWXA 1EUDA 1ZMTA 1NQTA 1Y81A 2WEKA 1GFSA 3ETDA 4RZHA 1UZLA 2OZPA 4R1TA 4G2NA 2VUUA 1HSZA 3ITDA 1J4AA 3SXPA 4TKMA 1B0AA 1JQBA 1EVZA 4RPHA 1QYCA 1DRVA 2PR2A 5A9SB 4ZU3A 3R6DA 3WS7A 3PHHA 3VOSA 2OOSA 4II2A 1WWKA 2WYWA 5JDCA 3QVOA 3BYZA 4Q3AA 1YL6A 4KWIA 3MEQA 1NAHA 2EF1A 5DCUA 3WFJA 3WIDA 4PG8A 4FGWA 4JP2A 3BMCB 1LDBA 1C1DB 3LC7O 2GLXA 2JHFA 4IDEA 5DULA 1N7HA 5EIOA 2CDCA 1SB8A 2PA3A 2UV8A 4GLLA 4NQZA 3VPGA 3H9UA 1J0XO 5DZSA 1AXGA 2ZCUA 4ITUA 2JAPA 2XXBA 5EINA 4G65A 4PLYA 3UCXA 3FTNA 3IL2A 1BG6A 1Z73A 2AQKA 1NHWA 3Q9NA 2ZTUA 3ZV4A 4JGBA 5IDQA 1PZEA 3AUSA 3ITKA 3ZV5A 1H2BA 4KZPA 1EQ2A 2X0IA 1A9YA 2WSBA 2Y1CA 3G3EA 3EHEA 3FWNA 4ONEA 4PG4A 5COAA 4W9NC 3JQ7A 5T5QA 4QUKA 1WDMA 3OA2A 4DIOA 4Q9NA 1GYRA 1QYWA 2P2SA 3KLMX 2JCYA 3AM5A 3COSA 3F47A 1YOVB 2NVWA 3GT0A 1AGNA 3OMLA 2OBNA 1ULUA 1UUFA 2PY6A 4U0JA 1WAMA 4XX0A 1K0UA 4YJFB 4J49A 5F1OA 5A9RA 1T25A 1I3MA 4PLHA 4D79A 3VAZA 3WIEA 4CUKA 3ZV6A 5DBGA 1BW9A 3S1LA 5ER9A 4A27A 1ZCJA 2QRKA 4NBUA 4PG7A 4XB2A 5CPBA 1XR3A 2BGMA 3PTZA 1DAPA 4B3HA 1N92A 4FS3A 4J4BA 5GMOA 3RFXA 3S2FA 3VKUA 1EUCA 1IULA 1Y8RA 2WD7B 4RLSA 4L76A 3GG2A 3O8QB 5BSHA 4HBGA 3JD3A 5G2OA 3JQCA 4E2WA 3GZNB 2FR1A 3WTCA 3OEWA 4GH5A 2AEFA 1T2DA 1VL6A 2AQHA 2WJPA 2C29D 3FBGA 1Z74A 3PJFA 4J3FA 5JO0A 1E3SA 1Z45A 4JP3A 9LDTA 2YDYA 3E82A 4L8VA 3WFIA 2CUKA 5BQFA 2PKRA 3BA1A 5ILGA 5CDTA 3P7MA 2ZTVA 2FR8A 1PJBA 4PLTA 8LDHA 3C7CB 3RUDA 3PHIA 2BFPA 4BGVA 4ZICA 5KJCA 1PJ3A 4ZVVA 1SZJG 3W1VA 3H6KA 3C1AA 4DL9A 4DYVA 2DBVO 3DHNA 3CKYA 4N5MA 3HDYA 2IEBA 4RVGA 1FDWA 2PLAA 3PQFA 5JCXA 3GUYA 1MFZA 4NDNE 1GUYA 4BO3A 1BHSA 2JFFA 4TRMA 1LSSA 4OM8A 4DWVA 3EY4A 4AICA 3W8EA 1YJ8A 1NPDA 1VM6A 3QY9A 4PRKA 5ENDA 5IDXA 4XIJA 3ZWBA 3GEMA 1F06A 1RPNA 4BKQA 1OC2A 2DLDA 3X2EA 3GNSA 5AYVA 3U4DA 3UOGA 4IZHA 3ADOA 1ZO8A 4JX8A 3FRJA 4EEXA 4D0SA 3BZUA 3I6IA 4I8XA 1PX0A 2HJSA 2FRDA 4CM4A 5CAEA 1E7SA 4D44A 1HF3A 4A26A 3PRJA 5JAMA 1LDYA 1G1AA 3GLQA 3JQBA 5L7TA 2OHXA 4XEHA 3MTJA 5MDHA 3PZBA 1O0SA 1ZNQO 3VKVA 5JMPA 4Z3KA 3WMWA 3C1OA 3D1LA 5AOVA 4FB5A 4K28A 3QWBA 1VSVA 2EHDA 2HDHA 1XSEA 2V6GA 3NAQA 4J43A 4M55A 3S2GA 5C7OO 2IDZA 2VUSA 4DC0A 1X7GA 3DAPA 4PG6A 3ZWOA 1EVYA 5DBIA 3QWHA 5DCWA 3PLNA 5HA5A 4L75A 1U7TA 2EJVA 1HSOA 2QQ5A 1CIVA 1L1FA 3CPSA 4FIZA 3ROKA 2G76A 3CTMA 3NV9A 3D3WB 2FPGA 3F5SA 3DXFA 4E2XA 1YB5A 5JAQA 3WR5A 4BNNA 4PLCA 5FFFA 4E2YA 1SB9A 3RJ5A 2UUOA 4XWYA 3G0OA 4XQ9A 4P4LA 1B14A 1DFIA 3KO8A 2NSDA 4YCAA 4D7AA 3IP3A 4IMRA 1JW9B 3A06A 2WD8A 3ZWPA 3I4FA 4CM9D 5THQA 1GQQA 1SAYA 4R01A 3ONEA 5JFOA 3GFBA 3QLJA 5I8ZA 4WLUA 5K6AC 1JLLA 1K5HA 3G1TA 1PR9A 1Q1NA 3WTBA 3P2YA 4AJKA 4YAKA 3OJLA 4NBTA 4CMBA 4UVEA 5KVSA 4Z3DA 3GPDG 1W73A 1VJTA 2VHXA 5IDWA 3QWIA 4RZIA 1R0LA 3PQEA 4NFYA 5JAZA 1FK8A 1F12A 3PGJA 2Y93A 2GO1A 2EP7A 1T2FA 2JKVA 1TA4A 3WGHA 3IC5A 5HM8A 4TQGA 5TQVA 3E9MA 1HEUA 3I83A 4CR8A 1O5IA 1TT5A 4WCDA 1J49A 1QSGA 1JA9A 1LLDA 1QYVA 3TZHA 5A3JA 4MIOA 3KB6A 4UUPA 3AUUA 2Y99A 5TJ9A 1Y5RA 5GZ3A 2HMSA 1A4IA 3INGA 3G79A 3FSRA 1E92A 2VYNA 4IDCA 1YRLA 3W4KA 4FGSA 5A03A 2YQ4A 4IPTA 3GAFA 1B26A 1ADBA 4CQMB 1P3DA 4ZN6A 4RO0A 2O7SA 4RLHA 3MCVA 5JLAA 2VTEA 3B20A 3VH3A 1EEHA 4FPXA 3EVTA 4RVDA 5HS4A 5ITVA 2BLLA 4YBZA 3AJRA 2NACA 3Q11A 4F6LA 2IRWA 3O26A 3DDNA 4WLEA 3LT2A 2RCYA 3VH4A 4CL8A 3MWDB 5BSGA 3UFXA 2P9CA 2Y1OA 1HWYA 3GOHA 4DGSA 1DC4A 2BELA 1O8CA 1E3EA 1Y5MA 1M66A 4YA6A 2HMVA 4HXYA 1ONOA 3V5NA 5F1PA 3ZDFA 4UEOA 2PV7A 2X0NA 3DMYA 4E5MA 3DTYA 4MVJI 2PTGA 5EESA 2VQ3A 4NJMA 2DFVA 4GWGA 4JN6B 5FYDA 5I7FA 2GR9A 1BDBA 5AVOA 3M6IA 1DAOA 4HP8A 5G0WA 3BXXA 3PGXA 1C1XA 4OQYA 2Y0DA 4URFA 2X86A 4CMHA 4JJFA 4OH1A 4PZCA 3D5TA 1I0ZA 2BMAA 1EFKA 3L4BC 3KYCA 1EQUA 3D3EA 2R00A 3KVOA 4AJPA 3NGXA 2IZ1A 3L77A 4RF3A 5A4DA 1I3NA 5H83A 1B2LA 1S7CA 3OQ1A 5IZ4A 5JAIA 2CF5A 2Z95A 3JSAA 2VT3A 1NFFA 2CVZA 2Q2WA 1LX6A 3JTMA 1ULSA 3LVFO 4Z0PA 1GQYA 1HLPA 3PI7A 1CETA 1QKIA 4HY3A 2VHWA 3QVWA 4NH4A 3EDMA 1T1SA 2EKLA 2BD0A 3EVNA 3OA0A 2PKQO 2G17A 1IHXA 4E31A 3JQ8B 1ZXLA 1HTBA 4EI2A 2JHGA 5J23A 2B5VA 3JD1A 4NU6A 3K8ZA 4YWJA 4OYRA 4FD3A 4HFRA 2AEMA 2GYYA 3RUFA 5JY1A 4QT0A 1E6UA 1Q0HA 1N1GA 3VTZA 2X0RA 3I4CA 1PSDA 4Y6PA 2LDBA 1AXEA 4DYDA 1E1KA 4ILKA 3ZNPA 4C7JA 1N7GA 1XIVA 3O03A 1D3AA 4YR9A 3D4PA 4B8ZA 2X58A 4FCCA 4LCJA 4BNUA 2C54A 1J6UA 3K9QO 2EW2A 1X7DA 3C8MA 1ID1A 1VL0A 2D1YA 4ZRMA 4O59O 4FSHA 4MP6A 4U7WA 3MJEA 4MVJP 3WBBA 3GVPA 3JQGA 3BMOA 3RROA 2PD6A 2YHUA 4CLRA 2PK3A 1MC4A 4GLOA 3VDRA 3AI2A 3DOOA 3A9WA 1KY5A 4BGUA 1ZKMA 3WWYA 1NR7A 1ZW1A 2DKNA 1ZH8A 4ROSA 1WNTA 1AN9A 5ER6A 4DXHA 1GZ3A 1ML3A 4ZJUA 1R15A 4CM3A 1UDCA 2DPHA 3RFVA 5JW6A 2QZ9A 1XA0A 1LDEA 2ZTLA 4YVFA 5AXCA 1BXGB 1E6EA 1UP4A 3PYMA 4AJEA 1F17A 4CMEA 3GEDA 4FJ1A 1BVUA 4YJHA 4A73A 4RL6A 3O38A 3NX4A 2TMDA 3DTTA 3IJPA 3UCEA 1PJ2A 1I36A 3PLRA 3DBRB 4WNCA 3QA9A 4WLVA 4FFOA 2FOIA 2YV2A 2IXBA 2PD4A 3K73O 1N8KA 4CMCA 2D4AA 5LC1A 4DIBA 1YL7A 5A9SA 2B4RO 4RVSA 2UAGA 2P91A 4D0RA 1L7DA 1SC6A 3T7EA 2FR0A 2IODA 4E3ZA 4OHUA 1LUAA 2QHXA 4PFJA 2CF6A 2WYVA 1JWBB 2Q1TA 3I5MA 1C1DA 4XQEA 3MZ0A 4B3IA 3RFTA 5TF4A 4QECA 2BHLA 3LF1A 1GQ2A 2EERA 3SVTA 1AHIA 1XKQA 1HDRA 1ONNA 3JQ9A 9LDBA 2FZEA 1XELA 1KVSA 4R1NA 3BHJA 3BMQA 1YBVA 5JC1A 1Z6ZA 1IE3A 4N7RA 3V1YA 4MVJE 1QR6A 1UAGA 4J16A 5F5NA 3BHMA 1WMAA 1N1EA 2CD9A 1EBUA 3OP4A 3ZNQA 2C5AA 4DREA 1G6KA 4XKJA 1QYXA 4YAJA 4CMKA 3RAJA 1PR3A 5DT9A 4RVHA 2NVUB 1ADFA 3BIOA 1LDGA 4NZ9A 1GEEA 4CR7A 2EJWA 4KDFA 1VE9A 2VZ0A 5L7WA 4AL4A 3WQQA 1DIRA 1E5QA 2PD3A 4IUYA 2FPPA 1HZZA 3KYBA 5KTKA 3A14A 2O50A 2W98A 2PZKA 3SBOA 1KBZA 5FF9A 1VKNA 5IN4A 4BV9A 3GN1A 5KVQA 5CG2A 3QHAA 2NADA 1UH5A 1M2WA 4JCOA 1KC1A 5U1PA 2HRZA 3FCOA 4S1VA 1LSJA 4J0EA 2E6UX 4NMHA 3DZJA 3C3XA 4MVJH 2QIOA 3RASA 4CV0A 3HB4X 4BNLA 4EITA 3WNQA 2QG4A 1XYGA 2EP5A 1B8PA 1KEPA 4IQ0A 1KVTA 1Y8RB 4YT8A 1M76A 4WGGA 1SBYA 4U6SA 5DDIP 3B1FA 1R4NB 2VWQA 1A7AA 3DWFA 4H7PA 1LLCA 1PGQA 4RCVA 4WECA 2YQ5A 2YHIB 3HDQA 4ALJA 1C3VA 2PZLA 3MJ4A 4IBOA 4BGEA 2POQX 1LSUA 3JQDA 1C0PA 2X4GA 4PLVA 4CV1A 3M1LA 4NI5A 3NJ8A 1JAYA 1E3WB 2X8LA 5JC8A 4YRBA 3HADA 1TXGA 4YDRA 5TS3A 1I3KA 1PJLA 3MOIA 4BHTA 3R0IA 1NBOA 4YQYA 1C0LA 1H2HA 4QO8A 4WEOA 4WKGA 2E82A 3ZGYA 4I9HA 3GVHA 4R1SA 4DRYA 5B12A 3FPCA 2DT5A 4IGFA 2IZZA 1HDCA 4QX6A 1K6IA 1BVRA 3NT2A 4WK6A 3TZQA 4RPGA 1EBFA 5EPOA 1ZEJA 2XAAA 1PQUA 2GN4A 2NWQA 1GTMA 2I67A 4E6PA 4WLFA 3HG7A 4PVCA 2I76A 4WJZA 1ISGA 6LDHA 3U9LA 3L9XA 5CG1A 3K96A 5CFZA 4ALLA 3JQAA 2I65A 3FPLA 4IIVA 1N2SA 1D8AA 2Y1DA 2VNSA 3WYBA 4J7UA 2NTNA 4CJXA 3ZU4A 2PGJA 3ORFA 4FJ0A 3WYCA 2JCVA 1FMCA 2R6JA 1NHGA 4H16A 3LLVA 4R3WA 3I9KA 3F1LA 4OL9A 3KLPX 1KETA 3LDHA 4EYEA 3C24A 3BTVA 3F46A 4M8SA 1GZ4A 2I66A 1GCUA 2VYVD 4CV3A 2EV9A 1G0OA 3SLKA 3UICA 5DP1A 2O2YA 3U3XA 1YBAA 1BXKA 2B0JA 3DMTC 3WWZA 3IJRA 2HO5A 1XWFA 4W7HA 4TZTA 2AE2A 3D3WA 3WLFA 5C3MA 4RDIA 4QFCA 4RF2A 3B70A 3K5PA 3DR3A 4PZDA 2NU7A 4R41A 4Z9XA 5KCZA 4MKZA 4XYMA 4BNJA 2BI7A 2GERA 3AU9A 3H9GA 5DOVA 4ZQHA 3GVXA 5JE8A 4LSWA 4AJJA 5U4QA 4RPJA 1RKXA 3BTSA 4RQTA 3ZU3A 3PHJA 4OOFA 1ZIDA 1MB4A 2EGGA 3OIFA 3H4VA 2H63A 4M86A 4E5NA 4R16A 1DLIA 1JKFA 3GR6A 1H6CA 3PPIA 5DOZA 1R37A 1UJMA 1ZK0A 3FTPA 2GNAA 5TRTA 1E3IA 1HRDA 4ESOA 1H6BA 1U5CA 2NV6A 3FNEA 1PU2A 1QG6A
chains in the Genus database with same CATH superfamily
3IBCA 1SCIA 3R6TA 2JBAA 4PAGA 5HS6A 3C7DB 3W90A 3V33A 3A6HA 3KPYA 1Z4MA 4PYIA 5KTNA 3IEVA 4NBNA 4E3WA 3MQ2A 4D8XA 1S2IA 2BGJA 5BPFA 4WNIA 3PF8A 1FL9A 4ND5A 4NF2A 5EKSA 3UMYA 1WDLA 4Q1AA 1Z6XA 2HKIA 4KYTA 3RF7A 3O4FA 3AVXA 1CE8B 4JJZA 3LC2O 5FWXA 2WZDA 4BB0A 5CEJA 1OASA 2ZJ3A 1MRZA 3PEUA 1N1DA 1CSEE 1U6KA 2G8LA 1HZZC 4OHZA 5KKCA 4BZZA 1WDWB 1DQSA 3WQBA 4CQLB 4UPVA 4FTWA 1NXXA 3TAXA 4ZV4A 5IJ0B 1T1RA 3H1FA 4FUQA 2C92A 1H2EA 2FNAA 5JSZA 4ZAWA 4P4GA 5CK5A 2FPOA 1BMTA 2FP4A 4L73A 3JVDA 1ES9A 2BR4A 1SU8A 4MI3A 3RVDA 5CT8A 1T3LA 1MRNA 2NVBA 3VC3A 1MX1A 2W2KA 5EIBD 2REBA 2LGJA 3FVRA 5H68A 4X71A 3ZW7A 5DE3A 4EJ6A 4B3JA 1YUBA 4XZ3A 2PFSA 1H1LB 4L0MA 2AD1A 4MVCA 1YFKA 4C4XA 1KO8A 3C4JA 5HUQA 2XWPA 4R0VA 3NM4A 5J59A 2A7QA 5ICMA 2ADOA 5AVJA 4QLBA 4OXXA 4P0TA 1H93A 2NU8A 1YB7A 4HCJA 3ROTA 3N76A 4J0FA 2FGJA 3CNBA 3QJYA 1NT4A 1Z12A 4GMHA 5FCDA 1OU4A 3USZA 1EIWA 2QL7A 3TXYA 2FEOA 3IBYA 4IMPA 5D85A 3SMVA 4XI9A 3MTQA 4JELA 3T0IA 4LHYA 4ZI3A 4V1CB 3IIKA 5THKA 4U6NA 2P3LA 1YDEA 2PRZA 1ZUHA 1QMPA 2MSDB 4HEHA 5ICGA 5L3VA 3NS7A 4FFNA 3SCZA 2WVJA 3BZWA 1VBKA 3RO7A 3NC0C 3ES9A 1O9HA 4AJOA 3GPIA 4LZOA 1XLTC 3JRNA 4D1YA 2Y4NA 1XD2A 1S3IA 1A97A 4PAOA 1XLTA 4UU0A 4EB3A 4O2RA 5IPFA 2YJ3A 3CRVA 4HV4A 3A2LA 5KEIA 1RAFA 2M6SA 5FYQA 4OAQA 5B57C 1TMGE 1VIDA 2P41A 3NJ4A 1T4MA 4GX5A 2ZJYA 4LMPA 5KKNB 1J99A 1Y1PA 3KB1A 3KUXA 4N7MA 3ZE1B 7AT1A 5ECWA 1WDTA 4X64B 4AKGA 5KYTA 2C88A 3RS4A 1YZGA 1GTSA 4GXTA 2Z4TA 1J8QA 3RUAA 2ZBUA 3BKXA 2E1RA 4IIJB 1ISMA 3LPLA 4MS1A 3VVMA 2Y0CA 5KAMA 5KDDA 4KXUA 3IEXA 4K9LA 4E11A 4MITA 2GEVA 4XAQA 2QGZA 3CFYA 2NP6A 2BH9A 4D9CA 1FFSA 3ESQA 4C4ZA 1GPAA 3ZCSA 2O0JA 2JD2A 3V7WA 3O74A 5CGQB 5B3JA 1G66A 1K2WA 1EK0A 1GPBA 1NVAA 2XOXA 3OUZA 3QXSA 5T8KA 4HG2A 3ZNOA 3N39C 1UR5A 2CZQA 3UJCA 4EPVA 3PNMA 3UH0A 4Q4HA 1EGHA 4YALA 4RZUA 2G09A 3CLKA 1RQNA 3UHAA 4EHDA 1A7UA 5EIBC 3V8PA 1KMCA 3G1UA 4KKXB 1GP2A 3DL2A 2ORVA 4H4CA 4ZAFA 1DOAA 3OF2A 4BTVA 5KQLA 4BXOA 2WMDA 1ZX1A 1M7GA 4I50F 2ONZA 1JYEA 4QTXA 5DNAA 1ZCBA 3W79A 4G07A 1EK5A 1JB1A 1IXKA 3TLAA 4G1EB 3LOQA 2NO9A 4D82A 4E21A 5LUAA 3SMQA 4C2UA 1RLUA 2BH2A 3HCPA 2VPIA 4YAWA 4BKPA 4MPRA 1ECFA 5C8YB 1XCOA 3GNTA 3OO0A 5LYJF 4PS1A 4OJNA 4UU7A 3R7SA 3CVYA 4QDKA 1PR0A 3HMKA 3JAWB 1PSZA 2C0QA 2WLTA 3WBJA 4DJAA 4TMZA 1M8FA 4LRQA 5BWLA 1FZTA 2FFBA 3AFMA 3CNEA 1ZN2A 4GQAA 5FR1A 4S05A 1SVOA 2QYOA 3D4NA 2QUZA 4JLJA 2RGEA 3KYDB 4NLLA 2RGGA 2Z04A 5K0CA 1PUXA 4XOIA 4TS4A 2FPGB 1F2VA 5EL0A 4OHFA 2BHRA 5DP2A 4ZZIA 4G4SO 4OSEA 4FN4A 1D1PA 2WB4A 3VHQA 2FE4A 2ZIGA 4IXMA 4D80A 2AD5A 4YR9A 1JA1A 1VYUA 2OBFA 3HEAA 2UZIR 1R6XA 1F1BA 1RYNA 2A84A 5JBNA 4Z7QB 1FVFA 1GSIA 3CH4B 2CCGA 2B61A 1AKUA 3CG0A 3CXUA 3ZIDA 1W85B 5CDFE 3ZC3A 2R8YA 3DOCA 5C8DA 3I9JA 3D7LA 4IV8A 3MT0A 4ZQCB 1C14A 4IMIB 4MIEA 4J9VA 4OHPA 2JAWA 3FD8A 1V3UA 4HNRA 4JBYA 2PKYX 3H83A 3RVNA 3PXGA 3TIGA 4CKWB 3A6PC 4RSMA 3RANA 3MINA 4GKBA 2E1PA 4L4ZA 1GPWB 3Q0TA 2JG3A 2YXNA 2E18A 4F96A 2PBFA 2QSZA 1EP2B 4UE3S 2FWMX 1Y4UA 1Z07A 3AIKA 3L07A 4NCBA 3WG9A 2FLWA 1DL5A 3ED1A 3DYVA 2G71A 4M89A 4LY9A 5ECDA 5GZ1A 3E9CA 4MB0A 1KZ7B 3TX2A 2JCSA 4KC0A 3H0EA 2VDQB 2HQSA 3KZMA 4MJXA 4MWZA 5EERA 4P4NA 2R3SA 3I04M 5MGBA 4P22A 3T3HA 2C4KA 2HF2A 3EIXA 1S3FA 5HZMA 1NVMB 3O82A 1ORRA 2CVHA 2YVQA 3C15C 5HF8A 4RDXA 5JQGB 3MMZA 2XB6A 1SRRA 1RCUA 4R9RA 4LOAA 4NFHA 3OLVA 4AMYA 3VHRA 4QQKA 4HDCA 4WBNB 2FA9A 3ODGA 1D04A 2WFAA 5CA0F 3ESXA 5ALXA 2Q0SA 3OZIA 1CUZA 3GZJA 4OXYA 4XA8A 3AILA 3O31A 1IWPB 1N9ZA 2IU4A 2IITA 2YZGA 4FEGA 4IUCS 5CJ2A 3ZLVA 4IDQA 1G3QA 2DQSA 3AB3A 4K9NA 1FDVA 4MJ7A 4UMEA 2DFNA 3HLKA 2AGVA 1JEQB 3HUTA 3W6NA 4CQMD 5THXA 3VVBA 1QORA 2XLBA 4IWXA 4PONA 4W4TA 3GY0A 5L3SB 1M74A 1HEYA 1VJRA 1YACA 1QTNA 2M9MA 1PWZA 4IWNA 5AJXA 1V43A 1AKNA 4R05A 3VZRA 3THWB 2XA9A 2O7QA 5C1BA 5FV4A 2GAOA 1W36C 2IEAA 4B6OA 3P97A 1RHUA 2I33A 4OKNA 4OK5A 2D2IA 4B33A 1N9GB 1OUMA 2ZXFA 3QKRB 1Y8CA 3EXG2 3IA2A 3MPUA 5DTJA 1IMOA 2Q5HA 5EIAA 2P6RA 1N5DA 4RHTA 1M8PA 5EP3A 4Q18A 1DCTA 1YMVA 2R5NA 4NBLA 4BWGA 5K0EA 4MRAA 4QYIB 5ERYA 1C7QA 1Z7WA 3VR0A 1I2ZA 4GZ3A 4XYLA 4FHDA 3RG2A 2F8SA 1IPHA 3H11B 4F2DA 3GLGE 4II3A 3BVPA 4GQBA 1V5GA 4WBXC 4EGJA 5ELMA 3JQ7B 3QX7A 5D00A 1HDZA 4FFDA 5I4KA 2A4KA 1LXCA 2J0VA 1NF2A 1PFWA 1VIYA 1H3EA 1AK2A 2JASA 2WKQA 3CNOA 1E3QA 2QN9A 3GFFA 4LNUB 2A0WA 3NRCA 4M54A 1I80A 2QAGC 3NNSA 3LSYA 4Q4JA 3JATA 4TUYF 3BGWA 1X13A 5FOUA 5JAPA 2ZJOA 3P45A 5J4YA 1KFJB 3EC7A 1ZPDA 5BRNA 3W5HA 2WSIA 1H0RA 3L46A 2VTDA 2Z2JA 4PANA 4QODA 3RC3A 3RVOA 3W7AA 1J23A 1JG7A 3JYNA 3GJTA 2IYRA 1YAHA 4FS8A 2YZNA 3PXAA 2BCEA 3WI7A 3T12A 1B8NA 4RJIA 4A6DA 1V8FA 1GNLA 2DJIA 1ZLYA 4UJ5A 5JQGF 1DBWA 1TW3A 2YFHA 2ET6A 3JASB 4UU8A 2IPMA 3KNZA 5BWMA 4LK3A 3EGVA 3N2ZB 5IH3A 4BTEA 2JFVA 2BHTA 3TL6A 2IHKA 5K9ZA 3OJXA 4BO6A 3ZN2A 2A5DA 3K72B 1H2ZA 2IWRA 4GF5A 5I7RA 4KP7A 2GAIA 2HWYA 4RKFA 4UUMA 4UHHA 2DFLA 3FCCA 2PE5A 5FO0A 2RC6A 3WK8A 4BKOA 4G1UC 5A1JA 3GJYA 5BVHB 1VDMA 4EFMA 5J5AA 3LZ6A 4TV9A 4DA7A 4C7XA 2PX5A 5BUSA 2NQ2C 1QQAA 2YFQA 4DLXA 4TX1A 2ZKLA 3HR8A 3FI9A 3FMIA 1Y4ZA 5L40A 4DLBA 1KK1A 2HHLA 3OMWA 3SX0A 3TPCA 4EYOA 4ID9A 4MW0A 1NSFA 4WKOA 4ZEOA 2Q49A 5JS2A 5I3CA 2MSWA 5F4BA 2P68A 3INRA 3GDFA 1JEYA 3EDYA 3TLGB 5AICA 5LCXA 4RW0A 1QHNA 1A5TA 5BT8A 1A8IA 1CZHA 3HUDA 3B5EA 4YUYA 3RVMA 1P7VA 3ZS9A 1HNNA 1V1RB 1LJ8A 3V1TC 3I0NA 1CVRA 4D3FA 2X22A 4ZFNA 1AQYA 3FUCA 3GIDA 3I92A 5ILQA 3F8WA 2HPAA 1NG9A 1JZTA 2Y8EA 1A9XA 2JFYA 3HZZA 3X2FA 4HYYA 4BFZA 1C3OA 4Y67A 2VDUE 4NE7A 3IXLA 3WKEA 1NC1A 4D5GA 1OFUX 1L5GB 2QUHA 5GVRA 4BBPA 2RHGB 3PDJA 1E7RA 3U5ZB 4NNOA 4TSKA 1O2DA 3RE1A 1JTVA 2ZYAA 3VO1A 5IX8A 2AOTA 2WD9A 1KI8A 2WB2A 1GAJA 5LA6B 2CFIA 4AZVA 1RT9A 1JTEA 1R5BA 4LF9B 1DBRA 3WXBA 2HZBA 3F1KA 3ZDYB 4A0RA 5HIJA 2V8OA 4AO7A 5EJEA 4I3HA 1ENZA 2CSXA 3IH5A 3DBHA 1FW6A 2QLTA 1Q0PA 4FFLA 5GINE 1ZHOA 1CS0A 1J0DA 2H2GA 3KDAA 1G1MA 3AETA 3GI1A 4OGWA 2J0UB 1O96A 3N53A 4QDUA 4A8PA 3ILXA 5H81A 1DG1G 2BL4A 4C7MA 1HYBA 1L7AA 4IV0A 4JCCA 2ONCA 3DYBA 2I03A 4BRWA 4EA7A 2EP8A 1R6VA 2WK1A 1J0EA 3WKCA 2Z2YA 4K81B 5KTMA 4RKYA 3TZLA 5B58C 4E2ZA 1I4LD 1QIEA 2IOQA 3VR6D 2I1QA 1XZGA 5EMMA 2YBDA 3EMVA 3KZXA 3HKCA 3KVVA 2EBUA 1BA2A 2CT8A 1E5XA 5EP2A 2W2XA 1DRUA 2IYEA 1U8XX 1DE0A 1Y7HA 4O29A 5LP6F 1YJXA 1EP3B 2OCIA 3D7NA 3I01M 1A4RA 4W8OA 5EHIA 4DCOA 2ZVDA 3M7IA 4BUCA 4R3UC 2O1SA 4L51A 1N57A 1U8EA 2B7CA 2OUKA 1N0VC 2V58A 4FI3F 4IHQA 4IOMA 4L6AA 4LSMA 5DI3A 2ZBFA 2VG8A 5LVAA 4RTJA 1ULHA 2JH3A 4BLWA 2PWYA 1D1QA 2CCJA 1OX5A 1A72A 1ETHA 3IP1A 1HMPA 2Y9PB 2YXPX 3FWHA 4IH1A 5IHXA 4S12A 4HQ0A 1XZIA 4G5SA 1P29A 4D41A 1VA5A 5CA1B 1QCZA 1E1LA 1X92A 3AEKB 2NVUA 1TM7E 3Q3GE 1KEWA 2OHGA 3NO4A 2CEAA 1GL7A 1XVUA 3W9SA 4JLUA 3GRPA 1EDEA 4KYUA 4RTMA 2OXCA 3GMSA 1Z4IA 3ELWA 3GLRA 5G4LA 3E7PA 4XCXA 5FH9A 5GIPE 3EEBA 1DKUA 3GEHA 1YTLA 2AEEA 4L9WA 4F91B 5KOYA 4QYWA 1EZ1A 2SKDA 5H3LA 1M2OA 1A8PA 3SQNA 4BRZA 5ISMA 1CQJA 3T4UA 4L4XA 3EXFB 5J5CA 3DO5A 3W34A 1RTTA 2GEJA 5F5LA 1N6PA 3RIEA 4DQDA 3SZGA 1G0NA 3FW1A 1U7UA 5FHRA 1JXMA 2CN1A 2AOXA 2G77B 4LHWA 4LXTA 5CCDA 5CCEA 3QU2A 3ORYA 3HM9A 1RMQA 4MKIA 2GN0A 3QV1A 3U56A 3C6ZA 5JJKA 5DGHA 2YX1A 3BBLA 1CZUA 3KLBA 3TOCA 4J3JA 5DYTA 3H0CA 3OQ6A 1CNEA 1JDNA 3SDBA 5C2JB 3RIYA 2XUIA 3OIVA 1JIVA 4RORA 1X7WA 1HQDA 1IUKA 3TN7A 4MPJA 2Q0XA 4AF8A 1PQ4A 1U2GC 1GKLA 2PL1A 2Y1FA 4D9KA 5K8TA 5BOVA 4OHKA 3TLEA 1WQ3A 2OORC 1CQPA 1XLUA 2QXUA 4OU5A 1F6DA 5J1TB 1F0YA 2OQRA 1X1TA 5JISA 1CK4A 1E3JA 3BF7A 4X6XA 3ZXUB 3BT7A 3QXXA 4I8DA 3GLGB 1ZJ4A 1LRKA 2ZATA 3HCBA 4FQ7A 4XARA 4EAQA 2XTAA 3M5PA 4U8GA 3B3GA 5AW3A 5EIXA 4ZYZA 1EJ6A 3MHPA 5FO1A 1OX4B 2FUG1 3DO8A 5EIFA 4Z6KA 5CYGA 4F4DA 3EZFA 3GRFA 5EWLA 5IJZA 1UDWA 1N2IA 2ZGVA 3WOHA 3AY6A 2QD3A 5T6MA 4AT1A 4HNTA 4UBMA 1A71A 2I8LA 3A9CA 2CVFA 4KQXA 2H0RA 2MYNA 4DA9A 3KP1A 3E4DA 1JHMA 1I3CA 1YOVA 1NBME 1OA0A 2HAEA 2R79A 3JZFA 1K2VN 4PG5A 3WQRA 3N8HA 4B48A 3TRHA 2VJQA 3G0GA 4L50A 1VDZA 4PAWA 4EUHA 8GPBA 2CMHA 3IUBA 2ZI9A 3EUAA 4N40A 5KHOC 1ISRA 4H0NA 1Z5UA 1U7PA 3RKRA 4OLAA 1LF5A 3IOBA 4F06A 3GH3A 1D09A 4V3CA 4LI3X 1EJ2A 1XNHA 2JHCA 2ZSUA 5DTRA 1B76A 1T2UA 1UZAA 2F8MA 1C41A 4GYJA 4PRLA 2OWEA 4U1RA 4UZSA 3C70A 1AHPA 2BFEB 3GT7A 4A4DA 1Z3IX 2HCRA 4ZVPA 1NNSA 3R9KA 3CEPB 2DWCA 3RIMA 3VDXA 4ZEMA 5ITSA 2JGNA 1OX6A 3G5LA 5KWEA 1TK2A 2VP0A 1WVMA 3OZ7A 3VU1A 1VHJA 5IVDA 4DPKA 3DA8A 3AUYA 4AZSA 1NULA 1UC4B 2JD0A 3OJ0A 3T06B 1NN3A 4S1WA 5DM4A 4AY5A 3LXRA 2OECA 1DJPA 1N2GA 2HEIA 4CKEB 2C04A 2FPSA 3KR0A 3W2TA 4NBWA 1QHFA 4LJ9A 1SUIA 1E2UA 1U2SA 1A0OA 1NAIA 3EG9B 4L5JA 1FMJA 4R1LA 4UTXA 3TE7A 1SEPA 4MHTA 1OA1A 1F8UA 2R25B 2FEAA 2O23A 3AF2A 3OZFA 1X39A 4JLAA 5EJ6A 1CNFA 1UFRA 2WAOA 5DCYA 5KQRA 4N82A 5CCXA 4RZQA 3WYEA 3DFKA 1L8QA 2W6IA 1D6MA 5K4GA 1YZKA 1IBCA 2AV6A 4JUIA 2WHPA 1BAPA 2YV5A 4QXMA 4DBVO 5BP7A 4CIYA 3QVGB 4OHMA 4ZEWA 3JQQA 4CU5A 3WGZA 2I29A 1I2DA 2I80A 1ZN9A 1WF3A 2EGHA 4W9NA 1T4CA 2PSSA 2CE2X 2WVAA 3TNDA 3NUGA 4DCSA 4PBRA 3L0ZA 4RGBA 3KS9A 1G5IA 2H1FA 1Y48E 1ZGCA 4BVHA 4PAQA 3OJOA 1V8ZA 1VPDA 4K6CA 5M7EA 2GZ3A 5L7YA 3UAOA 1DCFA 3TW8B 5KYXB 2G1JA 4L8GA 2VC2B 2MINB 3LCUA 1E3LA 2SNIE 3ZIUA 1KO5A 3ZK7A 1PNOA 3V97A 3DG9A 1QQBA 4MCAA 4K87A 3I73A 4YXFA 3SI7A 2OAEA 2AUTA 2Y77A 3C5WP 1DXYA 1UOOA 2P4UA 2PT6A 4JXKA 4LEIA 2O3UA 4O5OA 1DC3A 4O02B 4RPCA 1QX3A 1Y3HA 1ZSNA 2G4LA 1Q7CA 1CG6A 2V7UA 3HBFA 4NZZA 4O3FA 3N87A 2AFIE 4V0ME 3S2SA 4WN3A 3TDMA 3K0AA 2C8LA 4HRXA 1D4OA 2H4ZA 4OP1A 4L74A 2FK7A 1VMKA 2J85A 4Y1FA 1HT3A 2VZ9A 3R6GA 3GJ4A 5EZ6B 1ELOA 1SIUA 1E5LA 1JDZA 2QSYA 4H6PA 3R3JA 4KGDA 1V0JA 3A0RB 2XDYA 1GQOA 1UC5B 1E4OA 1SPXA 1RIIA 2VP6A 2GZAA 3JY6A 3NBFA 2GPBA 5EJ9A 1CZRA 1K8QA 4IGEA 2QU7A 5DW0A 5EMLA 4BB6A 1VG1A 1U0FA 1UM9B 2YKGA 3C39A 3HFJA 1N2ZA 4YECA 4TMYA 4TVBA 1RE1A 4DIFA 4OP3A 1ZD5A 1PSWA 1PJSA 1GNSA 2GPWA 2QUKA 2YOHA 5FWDA 4D3YA 5T4EA 4CKBB 4F1WA 5ARBA 4AN4A 3E0QA 3RD5A 4FIDA 1DFHA 3GFQA 3KHKA 3TQFA 2EWWA 4YJHB 1G63A 4QO7A 1C3EA 1TPYA 2GTIA 4V3BA 2Q6TA 4AJ4A 4YO7A 1NJ6A 1YB6A 1C9KA 1EHCA 1TLLA 4JYCA 1AJEA 4XEUA 1TCBA 4GLBA 3WRYC 3AR2A 3I4LA 4IDPA 4M7PA 3CVUA 1A9OA 1I10A 1IHYA 2B0CA 4CG1A 3EGDA 3GJ5A 3WLIA 2RI6A 3Q2KA 4HTFA 4A6EA 4ECEA 2QTMA 1ISPA 2J7PD 2PX3A 2Y0BA 4KACA 1HETA 3BMOB 3RARA 3NPAA 5TMEA 4ZK6A 4LDZA 4MYDA 5CGZA 4Y6SA 1E9DA 4FMBB 1K8ZB 2FPLA 3BXHA 3TW0A 5EP4A 1ORDA 2AQIA 4QAJA 4F11A 4C4YA 2DBYA 2AXNA 3BE5A 3HABA 1GN9A 3A4NA 3UHPA 4Y1RB 3SKVA 5IRCD 5CBKA 1TRHA 2RHDA 5H59A 2QA5A 2FU5C 3G2QA 2WHEA 2F1KA 3G85A 2RHRA 5D86A 3JZDA 2OGTA 1FPMA 4CV2A 1OVGA 2J3JA 2XRFA 4J1SA 3KJGA 3H19A 3RRBA 3RYCB 4J1TC 2H9AA 2RGNC 3DFMA 3FTEA 2H4XA 2OZEA 3GDGA 3HA2A 2V7WA 5ALRA 3BWCA 1EVIA 2G5CA 2W5UA 1Y6JA 4U2FA 3PD1A 4WCFC 3QPUA 2ERCA 5JAOA 1ZA1A 3RG8A 4C0QC 5JT1A 2IEIA 1QLJA 3QV2A 1SMKA 1DQRA 4NK4A 5EXPA 4M36A 4U2EA 4ZHSA 1QU2A 1N6NA 1Q1ZA 2VNAA 3IURA 3SXUB 3AF0A 4DCGA 4IY1A 1TO1E 3IPCA 2W2LA 3O4RA 3IP8A 4YAFA 5HW0A 2X5KO 1PYOA 1JIJA 4Q6BA 5ELXA 2QM8A 4EHBA 4FSXA 3HNPA 3T4XA 4HWGA 2R6AA 1S4MA 4LXIA 5GADl 1NU8A 3ZZNA 3CLVA 1IWOA 3NDIA 3U16A 1K6XA 3EARA 2DCMA 1B42A 4QXRA 1WA5A 2C84A 1M8JA 2IX3A 4HJXA 4YRDA 5DWVA 5C3UA 4JLPA 2ZRPA 4E5VA 3ESRA 5KNCD 2WKWA 3PUZA 3RNOA 4ARZA 1O58A 2IXEA 1BFKA 2G9UA 4GEKA 2PSFA 5TJHA 2ECPA 3SX2A 1GZ6A 2FZKA 4OGGA 5A5GA 5HK9A 3OM1A 5IBQA 2CHGA 2VP2A 3A32A 3KAQA 3PSHA 2CDBA 1YR3A 1MC1A 3EFOA 4EAAA 1GSHA 2JFGA 2X9QA 3A6KA 3DCIA 1QS0A 3OZUA 4QFDA 3GLFB 1C7JA 2AYZA 3G5AA 1QHHB 4LGCA 5CX1A 5BWNA 1LLUA 2H52A 1M6WA 2ZK7A 3BSYA 2B6NA 4DVGA 4EQZA 2GM4A 4DQVA 2ZE7A 5IJXA 2B99A 1QC5A 1SCJA 1Y4AE 3T9BA 4B6FA 3OM8A 1UZMA 2E5WA 3PA8A 2H11A 1HT0A 2FMKA 3RKUA 1T9GS 1VE3A 2YL2A 3QKIA 2AOUA 1NMXA 2XH8A 4KXWA 1NLUA 1NXVA 2BRUC 1W8IA 1KDVA 1G3UA 4W1SA 6AT1A 1T9HA 3E1KA 4FXOA 2PX4A 1IOZA 4JZKA 2VL7A 3W06A 1U6IA 1FFEA 4B40A 2BUAA 4QYXA 4C14A 2Q7DA 1KYQA 4LZJA 4X6YA 1MN6A 2B83A 5JWRA 4DUPA 4WKBA 2H1WA 4NONA 5DI9A 2OO5C 3TZBA 5PGMA 4M87A 5PNTA 4EB8A 4LYJA 4XW2A 2XBMA 2AR7A 3NC1C 4ARSA 3L7JA 5M3BA 2IF2A 4H4EA 3O3NB 4X91A 6YASA 1J2EA 1F8GA 1N2CE 2FYTA 3GEEA 2LV8A 3UG7A 5CEFA 1SVLA 2D1TA 3A1DA 4J07A 4KGXA 1JILA 1Y33E 1EYZA 4RK4A 4X44A 1YQQA 2MMGA 2I78A 2RH8A 1H94A 4GVLA 2ZR7A 3KYDA 1N0UA 2ZJ8A 3N75A 4M49A 3V8QA 1PZXA 1TM4E 3ZGXA 5KVCA 4ND3A 5HQ3A 2HQ1A 1TFUA 2QAIA 1PYGA 1T5BA 1ANKA 1EBBA 4FYYA 3CCFA 4ZOBA 4HWTA 4BAGA 4C4TA 1D1SA 2GGSA 3DE0X 5DSZA 3MQ4A 3OT4A 1NUPA 1B15A 3HY6A 3D7MA 4Y2SA 3ZTTA 2XMGA 1UBSB 2ECOA 2IF0A 4Y0AA 2Q21A 3G9UA 4DJTA 2ZSJA 2WJGA 2XECA 1RMTA 2TRSB 2FVXA 1SA0A 3PWSA 3ZS8A 3FOEC 3PZRA 3FIUA 2FWPA 1ZXXA 1QGAA 3VVCA 1T2EA 2CLOB 5CTAA 3Q1LA 4BFCA 4JYPA 4E1BA 1XPJA 3KQPA 4ZOLB 4YJFA 4FBGA 3GARA 1BHO1 4ASUA 3KUUA 2QT9A 4G8BA 3TO5A 3MJDA 3CF4A 1P1FA 1XAJA 3JR3A 1YCGA 3STWA 2Y0EA 2J0QA 1NASA 7REQA 4IVPA 1O0BA 1L5WA 1CEYA 3NEYA 3JSXA 3NQ41 3C3EA 4HB0A 4DA0A 2I71A 1OIXA 3DZBA 2UZ0A 1QFZA 2RONA 1G7SA 1T5OA 3ND5A 2JLCA 1RFGE 4ETMA 2P62A 3R1IA 3A7EA 2E37A 4PQFA 5J9FA 1CVLA 1MO4A 4FQ8A 4JYMA 4O1IA 1WD5A 5E4YA 4BLOA 4JHLA 3RVKA 5DNYB 3KZKA 1Y3CE 1YVEI 1BEUB 2LBPA 4QDOA 4X24A 3WB9A 4NOJA 4KITB 3Q5DA 4XGIA 3S29A 4HAVA 2KM1A 4I36A 1XPUA 1SUEA 1B1AA 1GYPA 4Z49A 2RAVA 5DN6A 4C30A 1J42A 2J3KA 3TJRA 2JLVA 3O3MB 3RDPA 3V2UA 4JLNA 1OXTA 5AJWA 3VYTB 1LVGA 3N58A 1P2UA 2FZWA 4ALNA 2OHVA 3ZLJA 3K30A 1BE8A 2NSYA 1T15A 1RXEA 2DBRA 2GA8A 5G0VA 3T3IA 4HB3A 4LGYA 5CT4A 1UWLA 1H5QA 5K3CA 3WLRA 1L4KA 1K6JA 1SC4A 3LDFA 4PHCA 2R96A 3SFVA 1V1JA 3NC4A 6PFKA 3ZEIA 4D4JA 4ZVKA 3OQOA 4HNGA 1MHPA 3N70A 4KU4A 4WESB 2AG1A 3TLXA 1NI4B 2FQXA 4PEVA 2WJWA 1UZNA 4BX3A 1ZR2A 2XMCA 3CC8A 3NFYA 5AQEA 1GT91 3MCZA 5DFAA 3ORSA 3J80A 3F9CA 1N2XA 3O8NA 1XD8A 3A05A 4JWKA 1YQEA 4GKJB 4BNVA 4RTQA 3OLXA 3S81A 1U2GA 2XEXA 3CS3A 4QU5A 2GVZC 1ZCAA 3AC0A 3R5KA 4DBZA 4JR0A 4MQEB 4JI1B 4OO3A 1GPNA 3FOCA 2D0PB 4AMBA 2YMQA 2A67A 1U3TA 1PZNA 5LKAA 3RAFC 3CIFA 4NE9A 4URHA 3AUTA 5CDUA 3GO4A 1BD3A 1RPTA 3VRHA 4KO4S 4N5HX 1J5PA 3EWAA 1XZQA 1Z28A 2GJSA 5B6IA 1HH4A 5BPHA 3K6SB 3TG2A 1YQDA 1PF7E 3FHLA 3GHYA 1E63A 3OEEA 4JJIA 5KWJA 4YTEA 2X7HA 4DCVA 4J9UE 4P5PA 2H9YA 5I51A 1GU7A 2Z5VA 4ZOAA 2O8FB 2V3WA 4WFKA 5F77A 1HDGO 5FTWA 4E5YA 1GRNA 1TJ4A 5KSPA 3TIFA 2FJ0A 4M60A 3UV6A 3KSDO 2ZRAA 1OQAA 3HEBA 3IMCA 4HPJB 1PT8A 3I23A 4P4SA 3KEQA 1P33A 3UA4A 1Z38A 4E07A 1UBUS 4RULA 1T0HB 2GCOB 1DRKA 3CRZA 4LHSA 5I7WA 2NU7B 5E4FA 5F2EA 2PXCA 5LJIA 4PINA 3W9YA 2J9GA 3EK2A 1JHQA 1QRAA 3QUSA 4DOMA 1DKPA 5B4UA 2WG0A 4Z0NA 2FW6A 3LGXA 5ARCA 5B3JC 4QRDA 3WLAA 3UMJA 5AJVB 4R3NA 4IZIA 1FJHA 1NZDA 1GNTA 4QTZA 1X38A 1HUQA 1KI2A 5K3FA 3SHQA 4CMJA 1X7ZA 4IDFA 4PGFA 1HA3A 3HVRA 5KTYA 1NQOA 1U0NA 1NRIA 4IIGA 4LRUA 1HI9A 3C85A 5HF9A 3L7OA 5IC6A 5AVWA 1M6HA 1ZESA 5TQ2A 4C0KA 2A3RA 1X14A 5GY7A 3DONA 4CFSA 1DHTA 3BSSA 4FW8A 5K99A 5CEEA 2QLFA 3TLCA 3GLTA 2IY9A 2XHEA 5HCIA 1BKSB 1XK7A 2W00A 4RWEA 3SC2A 1VJ1A 3DP9A 5A3RA 3COYA 5FDFA 3PSAA 3VU9A 2YHIA 5FPSA 2IP1A 1R0KA 2R6ZA 1QO0D 5HUHA 3RHSA 3GH1A 3L7LA 2FLVA 3IR6A 3QFRA 1U2RA 4MRSA 5GTDA 2JF0A 3EW9A 3H9QA 1U65A 3W3AD 1Y3BE 3H0KA 4KJZA 1N5LA 2PT5A 3W7BA 3T3EA 3ZIAD 3OAAA 1II8A 5F7ZA 5FWXB 4OU4A 1RWBA 4RA6B 4U6QA 2B20A 1F2TA 3PDCA 1WXGA 3C2QA 4HOYA 4IXNA 1Z3CA 1O5TA 1OVMA 1TOAA 1E0SA 4QLOA 1AZLA 4AZTA 3IVAA 2JGFA 1AC5A 3P9RA 2XUQA 3WAGA 1JIKA 2RKWA 1IOWA 1AK1A 1KY3A 1LC3A 2IIQA 2R47A 2V5VA 4KMSA 1IY9A 4UULA 1ZVVA 2QW0X 2WHQA 2A5YB 3FSGD 3G8YA 2A94A 3H2BA 3HPQA 3LX6A 4HXEB 4HN2A 4D4LA 2FSVC 2JW5A 2GBIA 3QLVA 2R00C 1PD0A 4ZDJA 2I1LA 2NUPB 5D3MB 3WL8A 3IIEA 5KTSA 1YK0A 4WZAA 2ZBVA 1IBMB 1U7DA 3AFGA 4QGGA 1H1LA 1F8FA 3LBAA 2B69A 3B9PA 1GGEA 1W52X 1K5DA 1U8CB 1OMOA 2ICAA 2JLAA 2IUYA 3U26A 3MJFA 1PP4A 1D7AA 2KWIA 1ESCA 1VMDA 1EE9A 3FRIA 1E0AA 2FPMA 3OIGA 4LPKA 3DBLA 3LBYA 1QF6A 3D6NB 5LA6A 2Q6KA 3OFJA 1BQ3A 3T4EA 3BGOS 3LYLA 4WK2B 1VE7A 1JBKA 2Y9MB 1EUCB 2CVQA 5E9QA 1TA9A 3NR2A 4R8VA 4HNVA 3GELA 1ESEA 1BU5A 2QV0A 3N8KA 4ZYLA 5L45A 4N41A 2O8DB 5CW1A 1JHYA 2ZAMA 5CVJA 3K4PA 3VNUA 2GYWA 2I3BA 5HKBA 1E3MA 5A0VA 5BV0A 2X6RA 4EHAA 3CCBA 7MDHA 4LJ7A 3W2HA 3KOWA 1MO3A 1GZVA 1ZVJA 1G6OA 2YW9A 3VDNB 4BAUA 1THGA 4CEHA 2XNDA 2JLWA 5FOVA 1IC6A 2PV0A 1YRBA 1LLQA 4L6IA 2PGDA 2B1JA 2Y05A 3IAHA 4AAYA 1WHSB 3W2GA 1YUNA 5KYUA 3O2NA 2JL1A 4QARA 3S1SA 2B7BA 2IEGA 2IHJA 1OZAA 3C74A 1N3IA 3FFWA 4IH4A 4JC0A 4JIMA 4XTRA 1USGA 4JAVC 5ALWA 1NV8A 5FUVA 2NW6A 3FGPA 1RWOA 2A9KA 4N3GA 5IULC 2WUGA 3WDSA 3WO1A 3WMGA 1H0HA 3RWMB 1J2UA 1DTSA 3T9FA 3D8RA 4M1SA 1P4SA 1L0BA 1ZUD1 2XPCA 3RAGA 4F56A 2JGAA 1FDOA 4Q21A 2G7ZA 5H16A 1ZVQA 5LPNA 3PDHA 1JX6A 1P0PA 3L8DA 1PEDA 1NMZA 2POCA 1Y63A 3T5CA 3U49A 3PUHA 1XU7A 4QVKA 2ST1A 3WKDA 1MEEA 2F8TA 4HSGA 1MVLA 3OLZA 4OP2A 3LPDA 2FPRA 4U3JB 4NS4A 1W85A 3TTWA 1KY2A 3X0DA 2FMFA 5INTA 4UTZA 5TXGA 3AEKA 5BURA 2L18A 1FRQA 2SKCA 4KE8A 3SHFA 2XF2A 2NO0A 3SGLA 4I4TB 3U9TA 4DPMA 2PS9A 3KQYA 2QUAA 5DYNA 3V1UA 2G6BA 2OG1A 2VXYA 2EKBA 4HDKA 1V8PA 3LLUA 4EJSC 3BWVA 3E84A 4EHJA 2R6CA 1E98A 3WGIA 1FSSA 2FDXA 2RBGA 3JAWA 3ANTA 1HFEL 4J76A 5LQSA 3WGVA 5I6DA 3NDBB 4KH1A 1KFCB 5KQMA 2WHXA 1YHYA 3B1ZA 1CRLA 2NZ8A 1JQDA 3L1UA 1G98A 1VQ1A 3P0HA 4P86A 2QX9A 3JVUA 7MHTA 3CT6A 2IH5A 3GUHA 2EZUA 2I3AA 3HH8A 4XRRA 3GOQA 1RW4A 5ENVA 3RV4A 5K8VA 2IS4A 1KHHA 3ZJYA 2ZDGA 3QVXA 3E0XA 3O92A 4FX2A 2MYPA 3RFCA 3LQKA 5C18A 2AJCA 3G7SA 4AIRA 4PLPA 2VJYA 3QHQA 3SR4A 1O08A 1EDOA 4IIYA 4U7TB 5FWAA 2OFPA 5JSHA 4PCVA 4JNKA 3BL5A 3B2QA 3EGOA 3I58A 3KKEA 2I99A 5CMLA 1HDEA 1ULZA 1LVHA 5GONA 1IK4A 4BNHA 1EM8B 1HLGA 1YB2A 4UVHA 5IG2A 2QE6A 2A1UA 3VNSA 3IULA 2WU4A 3JWPA 4UU1A 3PWKA 2QP4A 4PBTA 1RJFA 1UBKS 3WHIA 3IB3A 3TAUA 3RVQA 3OCXA 2IIBA 4E14A 3PQ2A 2E85A 4P7BA 3I2IA 4E15A 4INAA 3JR7A 1SC1A 2I6GA 4HAXA 3D6MA 4CKWA 2X77A 1SHKA 2ORWA 2WTXA 3UCFA 1LS6A 1WETA 1EFRD 3V4LA 5JYEA 2YXDA 3AKZA 3HQ4O 2R8OA 3UM9A 5B36A 1TVKB 3CA8A 3PKJA 4TYQA 5JCJA 4CF3A 3C4QA 5IZCA 4MSUA 3NHBA 4ARCA 3NHSA 4R2IA 5FLEX 3RT9A 2XCSB 1VPVA 2PCLA 1W36B 1P31A 2GVDC 1GCOA 4M2LA 1FVOA 4U2BA 4PX9A 1RRCA 2CCKA 2AWOA 4JVMA 1CZNA 5CITA 3EH1A 3C5HA 2Q4TA 2OLJA 1YXMA 2VSQA 4MW6A 4QDJA 3ZHXA 5H02A 3QKRA 1E9SA 1G9SA 4BWFB 2XX3A 2KQUA 4NFSA 2Q4EA 1O95C 3OFND 4B4DA 1JYFA 1SULA 2BBTA 2PZMA 2XUOA 4BLVA 1IFXA 2N3ZA 2PMFA 3CUTA 4IDGA 2WWTA 3F2IA 4M0LA 2VA9A 4JJKA 4PZLA 4C4PA 2A3NA 2Q5CA 3GVIA 5D01A 5EXEA 4FM9A 4CG0A 2WJVA 2QLLA 4IS3A 4MUIA 5E7QA 5L9AA 3GBPA 3K70C 2IU6A 3OQMA 2P35A 4YDSA 1GDTA 4Z8XA 1Z4JA 4IWYA 5IKOA 2ABWA 4HZUB 4JJ6A 5JFGA 4RMGA 1WF6A 1W4CA 2HJWA 3F6SA 3LC1O 1YDWA 1I24A 4KK4A 1P1IA 5EZ5A 4RENA 3BCRA 5J2TF 2QYTA 1WSWA 4V39A 2FN8A 4HN9A 2EL9A 1GPKA 3IDZA 4KIWA 2VWHA 3LWDA 3OURA 1I5RA 2O8BA 4QUEA 2YRWA 3DOHA 5J2TA 4FEYA 1NE7A 4R2KA 4A36A 4ACBA 1FX0A 3L6DA 5K3SA 1KR2A 6ADHA 2ZYIA 4JHXA 3D9QX 1E8DA 3AZOA 4RPLA 4YREA 3UHFA 4Z4CA 4YFYA 3SJUA 4U5XA 2W83A 4JBHA 4WNAA 4JR1A 1NYQA 2FLKA 2GUGA 3LWZA 4ZEVA 1NP6A 1NNUA 1P62B 2H5LA 4EY8A 1Y1RA 2VH1A 2ODAA 4QTYA 1M1ZA 1TI7A 2R8PA 2HFJA 1JQAA 1THZA 2AIRA 2Y67A 3FWZA 4N7BA 3CUEF 2GPTA 2I6UA 4FCVA 1LW6E 3L7DA 4KCGA 4S1OA 2XUPA 1II9A 3WNVA 3E4CA 5BT9A 1JNYA 4LRTB 2HSWA 3AF4A 3ND6A 2X41A 5U4XA 3HCCA 4BLRA 4MR9B 3DMGA 3G2OA 3CX6A 1FMLA 2G0TA 1D4FA 3HZOA 3MMXA 2EFJA 2PYDA 3CN7A 3H9JA 1XZFA 4KHZA 1ZGAA 2Z6VA 4PYRA 4FR5A 4XTCS 5FA8A 4DQXA 2HCBA 3FZEA 1TD9A 3KHTA 1F6BA 3KL4A 4YC7A 3HU3A 4EO9A 4Z53A 3SBXA 3OX3A 1DO0A 1VCIA 2FSFA 4F4UA 2C3PA 1XXLA 2J3IA 1KIAA 2O2EA 2Q3CA 2QN1A 4R1PA 1L7VC 4TMKA 4BNXA 1KO1A 2NUAA 5JH7F 4NCAA 4EVSA 1WZNA 2CJYA 2G5TA 3FDFA 4Z1MA 2VRCA 3TPZA 5CFPA 2DHEA 1W5TA