1SOUA

Nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
MLKSELRKKVLHKRINLSEEERRRLSEKVISNLKSLPEFKKSKKVALYCPIKGEVDLTPLFPEVLKEKELILPKVEGNEISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRVKGLKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRRLRDGRSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methenyltetrahydrofolate synthetase
publication title NMR structure of Aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: Northeast Structural Genomics Consortium Target QR46
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 50
structure length 194
sequence length 194
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1souA00
1SBQA 1WKCA 1U3FA 3HY4A 1SOUA 1YDMA 3HY3A 2G40A 3HXTA 3HY6A 2JCBA 1U3GA
chains in the Genus database with same CATH superfamily
4N7MA 1VI6A 3RTAA 3OTQA 1T2EA 4OD0A 4CV0A 3GH3A 4MRSA 5F9HA 1O87A 1ULUA 4KYTA 1U7TA 2V7VA 2XTAA 3H6HA 4AJ2A 4RQUA 4TKUA 3QVSA 1Z7BA 3A8TA 1GKIA 1QV6A 5HGJA 3F73A 1SQ6A 1A7JA 4TKVA 3WNZA 2HSJA 3OMWA 4RV4A 2A92A 3WIVA 2OCXA 2M1XA 3V8RA 5JD5A 2IZ7A 2W2XA 3IIIA 2DPLA 1FJHA 2ILTA 4JLWA 2PR7A 1FP2A 4L8LA 3HZRA 3KK0A 4L1KA 5J63A 2YHSA 3EGDA 3OY7A 4DIOA 4WN9B 5B1YA 1JX6A 2QJFA 3VKUA 2X2OA 3DM9B 1KVSA 3L04A 3HADA 4WERA 2BONA 3CKKA 1X80A 1QVRA 3DD5A 1ODSA 1AQNA 4H3HB 1G1AA 3M34A 4B7ZA 2ZUSA 4QVGA 4UNPA 1G19A 1MV8A 3G2NA 2AE2A 1FP6A 2XUFA 5EIAA 2QI9F 3I39X 3C39A 3QPCA 4W7SA 1V7ZA 2WNSA 1X7ZA 3OZTA 3FZYA 1GLGA 3VA7A 5K0EA 2BGWA 5H02A 3UH0A 4IDCA 3E9EA 5CAEA 5DP1A 5KREA 1ZH6A 4MR9B 3W77A 1YGYA 4ZODA 4A7PA 1FX0A 1F12A 3D8UA 4HWSA 5ESWA 1XXLA 3KT8A 2G83A 1JPNA 2ZBFA 1I3MA 1VLQA 2PEZA 2V6IA 4DQ0A 1M5RA 4DBZA 1HZZA 4MP3A 4EPXA 4KWCA 4CR7A 1NVMB 1TTPB 2N42A 3HCEA 5K0FA 3Q3IA 1Z0FA 5I7AA 4RIEA 1FVOA 1WQ4A 2CKDA 4MRRA 4A8HA 5I6DA 5JZBA 2IPNA 4LVUA 2ZJ3A 1IH8A 4AICA 4YLYA 2LR0A 2Y92A 3AESA 4ZHQF 3JZDA 3VSDA 5EXTA 2ZI5A 1WPQA 1ZQ1A 4NECA 1LQ2A 4FFSA 1ZI8A 4J43A 2WMNB 1A7UA 3T1QA 4XE5A 3E7DA 2Y9MB 3TLAA 4EO7A 4PIMA 2YOGA 3GH1A 4GGPA 3ZTYA 1T9KA 2X9LA 2AF4C 4HDNB 5HIKA 3G5LA 5JCPA 3BGOS 1KC1A 1MDFA 4Q5IA 4XQ0A 2BGLA 4L73A 3U7JA 4DLNA 4AD8A 1ZJ5A 3I2KA 4HHEA 4WXRA 1CUZA 2WU0A 2XGMA 4B33A 3K9HA 1RI3A 1TU4A 1XQ1A 1XFAA 4IDBA 4O4IF 4H0NA 4RJTA 1T0IA 2NXJA 4L0QA 1MXFA 2QS9A 1AIPA 3B6ZA 3GD7A 3MSCA 4ENTA 1H4QA 1OX5A 1C9DB 4KI0A 1DL5A 4JD5A 4GT1A 4CV3A 1Y8RA 3TZBA 2GD0A 4O59O 2VDOB 1V8PA 1FLAA 4XYGA 4N01A 5T8KA 2IW1A 2JIDA 4YRDA 2NAPA 4NOLA 3F4LA 3X1YA 4PZDA 3DE1X 3BIWA 1ZVMA 3EOZA 4CKCA 5ICEA 1FP7A 2O8VA 3D6JA 4B0PA 1Z4IA 4Q21A 2OB2A 3DBRA 2H5JA 3FTEA 4YP5A 2NX2A 4FQ8A 1FRZA 1VL1A 4YACA 4YRCA 1SCBA 5FNZA 2W6CX 5F3DA 2B83A 3TIFA 4Z5XA 5HTOA 5H7XA 4ZEXA 1K88A 1ZBQA 2ZTLA 1WB5A 3WYDA 5FX2A 3G17A 4BLWA 2A59A 2BW0A 4ZZ1A 2Y1LA 4EUHA 1JE0A 2FK7A 3ECCA 3IIJA 5KYKA 1QTQA 3DLBA 5LCXA 5DYYA 1PZXA 2QYOA 1CC1S 3HJAA 4HDKB 4XD7A 3E05A 1SCNE 4QSMA 3VH1A 3HXOA 4DPMA 2NV6A 4G1BA 4KACA 1CEYA 4EQ6B 2R65A 3CN9A 4C89A 4O2BF 5BN3B 2J0UA 1KVUA 4KR0A 4HBZA 4QHSA 4YGXB 3A1EA 4E30A 3HYSA 4NYIQ 4YH1A 2EWWA 1HMYA 1ODCA 2JEOA 4UJ3A 3FDZA 4WK6A 4QGGA 3ROXA 2R7NA 4BGDA 2WYOA 4NJEA 2WJ3A 4IXWA 4JNCA 4YJ3F 4ZVOA 1QGZA 1MJGM 1EAMA 1SULA 1ZITA 2C9YA 2R84A 2EFHB 2VO1A 3EXHA 3LSYA 2M6SA 4QUGA 3KYIB 1RVV1 3PGVA 4URFA 4K46A 2HRQA 3SJBA 1E1CA 2QW1A 3VV3A 1VSTA 3U4QA 4JC5A 4BGVA 5LZ2A 4NPCA 1G21E 1XMVA 4OHOA 1O58A 1Z12A 3KV3O 4HFMA 4H7KA 2E4VA 2VIIA 2G70A 1MOZA 3ELBA 4IMIB 2WW8A 4JB2A 4RMIA 1JIIA 3VPCA 4EIWA 2ZU0C 3C1UA 4DMRA 4N5IX 3PC4A 1LBEA 4CG2A 1G8MA 2W6OA 3O91A 2NSJA 4ARVA 2GK4A 3UT0A 3LFUA 5IDXA 1Q7TA 2VK4A 3QLTA 2WKSA 4AI6A 4MAMA 3NNDA 1JG4A 4RK0A 4O08A 5FHQA 4IIHA 5KNDH 1SQFA 1SCJA 3B13B 1S6YA 3WKEA 3CBGA 2G7ZA 4PAOA 1OAOA 2RHCA 2HPZA 1C9YA 3E5MA 4LHYA 2NP6A 4A2PA 1NQVA 1F17A 2QEQA 3Q11A 2GI4A 2QX7A 4I1UA 2B9EA 3ZI0A 3QU7A 2XA2A 1KYWA 1U8YA 4NL4H 5BN5A 2I6GA 4JLOA 3B6KA 4GVPA 3F71A 4IS2A 4JLBA 3IJ5A 1BGXT 4D57A 1ECCA 4YJ2A 4Y6LA 2AJTA 4LJ5A 2FQYA 1DC6A 2ILVA 1BWRA 3R8XA 1OI7A 2IGTA 3P1JA 4BV2A 5U4XA 2ZM5A 2X3YA 3KUUA 5JV5A 4AJNA 3AO0B 1BHQ1 4K9OA 1KPIA 2XD4A 3H2IA 1BFUA 5C34B 1W25A 1I7DA 4P33A 1U99A 4QFDA 4C01A 5C1IA 3UJBA 2AUMA 4L6AA 3RVNA 4E4RA 3V1MA 5B7QA 2V6GA 3OPYB 5AW2A 5KYWA 3W5UA 3K16A 5AM0A 3K5IA 1P7WA 3QUSA 3JYLA 3KKEA 3D43A 5AJTA 1QJ4A 3HHEA 1QGDA 4N7BA 2LRHA 5HNKA 2GPBA 2X0KA 3I53A 1LU9A 1YZLA 4ZT2A 4DCTA 3O8NA 2IPXA 3NBZC 4TV8B 3KR0A 3HKBB 2GPJA 1HOXA 2C04A 1PFWA 2C5AA 3KR2A 4MR8A 4E32A 3SDSA 4PPFA 4JP3A 3IAUA 5F78A 9LDBA 3GZJA 5EKUA 1KMIY 2A88A 4ZO8A 4X1IB 4FX5A 1PEKE 1C4WA 1Y4SA 2EJWA 4UASA 2JI4A 3VBEA 4RAQA 5DI9A 1ZX1A 3GJ8A 4CHTA 4MVJG 3NBAA 1G21B 1DAHA 2H9IA 3WGQA 2H51A 5IK2A 3COZA 3VHQA 1TTQB 4OAPA 3KTAB 1JXMA 4B8ZA 1B6GA 4LBWA 3SSOA 2OZEA 2JGDA 3TUZC 4GS5A 2POQX 2QM3A 4CF6A 1U3GA 4GSLA 4IIDA 1Y9JA 1VJDA 1T6XA 3DL7A 1HT2E 4L74A 3NALA 2VTKA 4H17A 1JU9A 1PT8A 1VJCA 4NK4A 2FMTA 5CVDA 1H93A 5ITZA 4MW4A 3DZBA 2NTVA 3O95A 2XT9A 4YLEA 5ALHA 1T5OA 5DXJA 3C98A 3I23A 2D00A 5GGXA 3EF3A 4ALLA 1F0PA 2ON6A 2IT1A 1LS1A 3B8HA 1Y9AA 3CYFA 1LPBB 5A3SA 3QEMB 1XN4A 2YWDA 4V0QA 3U16A 1J1IA 1H5NA 5AJVB 2ZBUA 1CJSA 1F7UA 2IIVA 4IPTA 4TV9A 1JKMA 3D59A 3OLCX 5FFMA 3G79A 4UHJA 5FBZA 5KAPA 1T3GA 2X4DA 1CETA 4W9NC 2DY1A 1GA1A 1WV1A 2DFLA 3UGJA 1VL8A 2TS1A 1BN7A 3C3JA 1TJ4A 4PGGA 1SD5A 1QX4A 1W8IA 3PQEA 1K8RA 4LJ6A 2FGKA 1TZ2A 3A3OA 1LF0A 4KSYA 3CA8A 1E69A 2O3JA 1KY3A 3M82A 1SVIA 5IYZA 4P0PB 1CRZA 4LISA 1J33A 5DXFA 4JDPA 1LZKA 4M88A 2OO5A 4E13A 5AH0A 3MCWA 1VGVA 2H2WA 3RD5A 3PHHA 4F5ZA 1MT0A 2DHDA 2OD2A 2VUUA 2BFFB 3UXEA 3R9XA 4LJRA 4L4RA 1VE6A 2HDNB 2JCXA 5IFLA 2H4YA 1ZRMA 2HC9A 3K53A 4ZK2A 4F92B 1Z06A 2YZKA 2O8DB 5JS2A 3IILA 5BNZA 2Q9BA 5IN4A 2DQYA 3W78A 1TAUA 1G3RA 1PGNA 2AVNA 2QRVA 4MPDA 4A0SA 2UZ1A 4KE7A 5EE1A 4TYNA 2EKLA 3KQLA 2HLPA 3KYCA 3PFHA 2I6QA 2HRRA 3OQJA 1EM8B 4G1CA 4RVFA 2ZPUA 4I1IA 4L8YA 5CLIA 3F9IA 1L7BA 3KVYA 1W0KA 1WXEA 1Y9DA 2RJNA 2D1SA 2ZANA 1TTTA 4CIBA 2VUIB 4XIJA 2QT1A 4HR7A 3ZV5A 1SCDA 2VRBA 3C1OA 4H60A 1E92A 5CT4A 2OZKA 3ZI4A 1SXGA 2GO7A 4ZYYA 1QRDA 5EHXA 1SC1A 4L6IA 2AMLA 3EFOB 4NBVA 4LTDA 2NUPA 3GVXA 4LWZA 4V0KA 5JYEA 2MOKA 2NVWA 2P69A 2R60A 4NR0A 4BJ5A 3LY7A 1GTVA 1SM4A 4TXLA 1TUIA 9ABPA 1IVSA 3K5HA 1KP9A 1NJ1A 4H3KB 4UATA 3IL2A 3I42A 4P2BA 2FWAA 4JI8B 4MVWA 4URWR 4D0LB 3ZNQA 3V1UA 1P8JA 4XPIB 3WL8A 4H4DA 4LRTB 3DHVA 4RMGA 4X9XA 3GRVA 2P9GA 2Q41A 4WUTA 1DVRA 3B1YA 1NXTA 3MWJA 4PONA 1Y8ZA 2NN3C 1QCZA 5DK4A 4BLUA 4LQCA 5IH7A 1KJYA 3PEWA 2BCEA 4B6SA 1XRLA 2AQ8A 2Y4OA 4TRRA 2NTYC 3LZCA 4KXVA 4JI5B 1WD5A 1TUGA 2OGUA 1VQ1A 1SIWA 1BWQA 2WJ6A 3RYFA 4TMKA 5FQOA 2O4UX 1EUZA 1E9CA 1G8FA 1DPFA 3FB1A 2WYUA 3FPCA 4DUGD 3SGLA 1U5BA 1X74A 2WF5A 4HC4A 4IDHA 4Q48A 5CFNA 1EBFA 3E7FA 1Z5WA 1OBVA 4AT1A 1T8TA 4QPNA 3IYLW 1KIMA 3AL0C 2C1ZA 3EG9A 4B4OA 1BXRA 2A0WA 3ZWPA 4UM5A 1N2BA 3CVUA 4RNDB 3PDCA 4BKMA 2GTHA 1T3LA 1QRUA 1DBPA 4MR7B 2V1UA 3QTBA 2I91A 4GG1A 3UAVA 2WWFA 4RSMA 4FXOA 5F5NA 4DLYA 3OC6A 1RACA 2W00A 2QRKA 1OZ0A 5G1NA 4OFBA 2YRFA 4BVBA 4EW3A 3W4KA 1WUKS 5JYDA 1R0BA 2FGJA 2RI6A 3BM5A 4U0JA 4Q03A 3OZDA 2HSDA 3TAUA 9ATCA 1O0SA 3DOUA 4QAQA 1K3TA 2VJLA 2W2LD 4C4SA 5B4VA 4O5OA 2FFJA 3LX5A 2A7XA 1L8QA 2BJHA 1FFCA 1E32A 1L5VA 2Q9AA 3OOJA 1XROA 1G7SA 2PPVA 2I1QA 1BS2A 3A3YA 4P3PA 4WFJA 3RYTC 2BLNA 3KQVA 5JS7A 4WKPA 5KJ6A 3Q3GE 1E2DA 3I61A 3W5IA 2AQHA 3LQKA 4Y1RB 3TWOA 2GZDA 3EJWA 3JQRA 4LNUA 3UJ9A 4IIJF 4PNPA 3ZGYA 1NATA 1EJ6A 4JKOA 521PA 1YIOA 3T7KA 2LV8A 4GW3A 3FDXA 2EX0A 4MVJM 3KKZA 5FV4A 2OR3A 2HJWA 4HNAA 5K8UA 3COWA 4JYCA 4IR7A 2M2IA 3J81k 4E21A 1A4IA 1UKAA 3A6JA 4B76A 3GX1A 5AK6A 4EG3A 1AV7A 4UUQA 4ENVA 1HL7A 1ZGAA 4DMMA 2PUVA 1FNBA 1N6KA 2QN7A 3H1EA 1ZW6A 3O31A 1PQ4A 4WPGA 2V3VA 1TVKB 3P9IA 3TAHA 5JECA 1ECFA 2OV1A 4Q4DA 4A15A 3B38A 1H3EA 3C8ZA 1XCOA 1MZVA 3ZHUA 1HT0A 3PPIA 3PLNA 4CVNA 4G81A 3VKGA 4N9WA 4K2AA 5LIRA 4TLDA 1L5QA 1SBTA 3KZ1E 2WSBA 3EW9A 3OM1A 5GZ3A 2CXOA 2XDAA 3UHPA 3TPZA 3OA0A 1KP3A 4OQNA 4C76A 5FTMA 5CCEA 2CHFA 3CX3A 1WVIA 4Y2HA 5T3YA 1OWNA 4NYJQ 3VPBA 5KTYA 1ZD8A 2H2IA 3HXPA 2YXEA 2G40A 4TQUS 1BDIA 1ZK2A 1HFJA 4AJPA 1UWLA 4RCYA 3GUCA 3O8QA 4O4LA 1RABA 1QKIA 3DEAA 1Z2OX 1IHUA 3DMNA 4L0DA 3A7EA 4XVQA 4XUDA 4BXOB 1YFLA 2IIQA 1ODTC 2XA9A 2IPLA 5CA1F 4K3UA 2HCTA 3REGA 2XVZA 4DV6B 3CN7A 3BZUA 3QOXA 4HQ0A 3KFVA 1YC2A 4WFKA 4X7BA 5HIAA 2ZE7A 2P3QA 1NT2A 5A9SA 1LCIA 1JKFA 2NU9B 1QHFA 1ULTA 2WIFA 1ADYA 1HYQA 1WW8A 3EA4A 4U1RA 4PXAA 2XODA 1SVUA 4BC0A 3ZIDA 1V16A 4A0QA 1I0IA 1RM3A 3GXBA 4RVNA 2MR5A 3B1ZA 4BNHA 1UAYA 4PZPA 4DV0B 4G0VA 2JD2A 2J6IA 5BW6B 2XWQA 1WBJB 5B37A 4N3NA 2LW7A 3MTDA 1ZA2A 2ODBA 3NEPX 3R77A 2QT9A 4RLHA 1TRKA 3W8EA 1G60A 4HUJA 1K0UA 2JLUA 1KKUA 3C41J 1VGRA 3NJ4A 1R0ZA 4MYCA 3ZQ6A 4YAWA 1G2OA 4JLAA 3D3EA 1SCUA 2FLWA 2IE8A 4G26A 5KPDA 1II8A 4MJ3A 5DGDA 3OJ0A 3DYIA 1G8KA 1ICIA 2RIRA 1U7XA 1YUBA 4MCIA 4TN1A 4BEBA 4DV2B 2QGFA 4FU0A 2YOFA 2CVQA 1JW9B 2XR1A 4RD3A 4XTCS 3Q1LA 3GC6A 5FNVF 1K4YA 3FNQA 3ET5A 4Q7QA 1QZ3A 1Y34E 3NJ8A 2CCJA 1W4RA 3DNPA 2Z8ZA 2C88A 5DJ5A 3WBJA 2HR1A 2OHJA 2QXTA 3RTBA 1JQDA 3ENWA 1G9TA 1J9GA 3WG9A 3ZWYA 5HGXA 3NBUA 2RG1A 1O7JA 1SVWA 1P2BA 1M2OA 2I03A 2XMRA 4X93A 3TCNA 5JXJA 1NUTA 1LWOA 3H8WA 1L7RA 4L4SA 1QCCA 3HDQA 1FXUA 1XTQA 3N0VA 4MIOA 1Z75A 1BHSA 3K70D 1EX6A 3BZBA 3HEAA 3OTIA 2XD9A 4J90A 3UICA 2WD8A 4TQAA 1OKKD 1VA4A 3P8ZA 1IB6A 2DTEA 5TPZD 4V0LA 4UU1A 4PNEA 5JOQA 4YMGA 3U1BA 2C4MA 1KHHA 3NI2A 1ZJ4A 1O8CA 2KLHA 3MVEA 3FMIA 4GVXA 1IK4A 2ATIA 4ZCSA 1VG8A 5JARA 5FTJA 3DDUA 2WM9B 4LHVA 3JR7A 4OHXA 3K1JA 5DW3A 3V7WA 1E9BA 2H8GA 4C7JA 1Z0DA 2FXIA 1TADA 2XZDA 3T94A 2YJTD 1FTQA 3COJA 1KO1A 2FMIA 2WU8A 2OPHA 2DM6A 4FS3A 1TT5B 1IJBA 1TZMA 1IFXA 3L7JA 2SCUB 4CXMA 3RF7A 2P1RA 4Y6QA 5BUQA 3ZJ4A 4WK2B 4GGMX 3DAHA 3RREA 1R0CA 3IDQA 4CMKA 3REQB 5JIBA 3JWGA 3DF9A 3ICPA 1TA4A 5AKEA 1GPWB 2AYZA 2PS3A 3UM9A 3GY0A 1L5LA 1NQXA 4CM8A 1E4OA 2A30A 2QXYA 4L9RA 4FW9A 2G1JA 1NW5A 1VJ1A 4G0PA 1VHWA 4L9SA 5E7MA 4QJ3A 4ZEVA 1QRAA 4GPBA 1KJZA 1UC4B 3UAOA 4B4UA 1OZAA 5B12A 1VFPA 3QY0A 1ODFA 2V5UA 3E2PA 4RPHA 5CEEA 3N8GA 3AKDA 2BGNA 4EITA 3V4FA 4X3PA 3ZOKA 1QFZA 4EKEA 1DJPA 1IJKA 4J07A 1DKLA 3EZGA 2X4GA 2A8YA 3WKBA 1XLVA 3IDAA 2WAOA 3AG5A 3PLRA 3KEGA 3KQQA 1QB8A 2WV7A 3L92A 3LUDA 4QTTB 4CM4A 5HOEA 1RJGA 4HLUC 3U3RA 4RUKA 3G0BA 3M9WA 4EUKA 3LC0A 4S2UA 4GRAA 1E60A 3R6WA 3H7IA 5FBRB 2B4KA 5DYWA 3UGQA 3ZBTA 3DFUA 2VDLB 2WLTA 4P7BA 2FXVA 3USES 4Q1CA 1T2AA 3DV0A 2C57A 3MAGA 4QXRA 2XYRA 2ZRKA 4MUIA 1S1CA 1E1QD 3B9RA 3GDOA 4LE2A 1AS0A 3ZHTA 4Z9YA 5BPFA 2WTUA 3OAAD 4BLVA 2BF4A 5JE8A 1YBHA 3IEKA 2BRUC 1T9DA 4DA0A 1COZA 1JS1X 2WIKA 4MWCA 4Z54A 2W2MA 4IMRA 4IDPA 4JK3A 4N40A 5SV2A 3WLTA 5L95A 1OU4A 1FRQA 1KDPA 1UBSB 4YO8A 4YJKA 4OK3A 3S2YA 2AH5A 3G13A 3VR6A 1A27A 2XWPA 3L7OA 3O3OB 4WLVA 1OX4A 1EI9A 2O3RA 4R7TA 1J39A 3RBVA 2ZCUA 3PPVA 3FFWA 1EHCA 2HLDA 4TS3A 2NUBA 2VAWA 1QLJA 4H0CA 4YJHB 3AVYA 2EJCA 3CR7A 3FLBA 2VOEA 1M6VA 1PJ2A 1TYAE 2BBWA 2XXAA 4LRWA 2W42A 1P5FA 1XXHE 3QHPA 1VG1A 3VJMA 4JJAA 1Y4AE 5FLEX 3V7UA 1DE0A 3INYA 3U4AA 2HH9A 2OCKA 1OI2A 4RLFA 1MC5A 1QK3A 5EHNA 4M2LA 5TJ9A 2QRLA 5EJ6A 4GC9A 2L17A 1NLYA 2R1TB 3IEVA 2F1RA 3P9PA 3DTVD 4I0WB 1RPZA 4YRPA 3TFOA 3JATA 3ZK7A 3TVDA 3WMXA 1D6JA 5TQ2A 1EFPB 4OSOA 4ZYLA 1TCAA 2PRJA 2JASA 3DZ8A 4PZYA 4D3YA 4FN4A 1BX0A 1CZKA 3LBHA 2OB1A 4A6DA 1MVLA 3THXB 4MYSA 4ZVVA 1ADCA 1PWHA 1G63A 3PNBA 4GOLD 4N03A 1A8SA 1ML4A 3UGTA 4N7JA 1L7NA 3TCXB 1B2LA 5GADl 1R5OA 1CDOA 3EXG2 1KI2A 3NEJA 4BFLA 4B35A 5H3CA 3ZGNA 2A5LA 1FC0A 5D87A 3WGYA 1XMJA 3PD7A 5FRDA 1EYZA 1I2ZA 1R0RE 1PSWA 2C0CA 4JR2A 4KEAA 1DHRA 3P71T 2RGAA 3SSNA 1RMYA 3V1TC 3CVWA 2A0UA 3CLRC 2FVXA 3F5DA 1PP4A 4UM7A 2JAUA 2OV4A 4KGDA 2BR4A 2BEVA 2VI5A 2FSVA 3DAPA 2X0EA 4KAXA 4C3VA 1FFXA 1NQAO 4RH0A 1J2RA 4JA2A 2Q5JA 5IVDA 3C5WP 2ORIA 1XZJA 3IHKA 4WHMA 4KXNA 2KMLA 4HGZA 4F93B 4OX9B 4BB5A 2BFPA 3AUXA 3MTIA 4N5MA 3F6SA 3QWIA 3CWZA 1X1RA 1USKA 2GK7A 4TTRA 4ZP1A 5CFZA 3VYWA 2OCGA 3OQIB 3U3JA 3UANA 4Y2QA 3L1UA 4C6HA 4B17A 1I7QB 3BGIA 3BWXA 3N53A 2I6TA 2I1WA 3DAGA 2HFKA 4G8BA 1E3SA 1CIJA 2CK3D 1XMIA 2YIJA 1QP8A 3K1AA 2VZEA 2XE8A 4L0MA 2BMFA 3N2IA 4ASUD 4EKDA 2FMKA 1F0KA 2D62A 1M6HA 2ZWIA 3ZHBA 2VSYA 4UOZA 1NMEA 3IPYA 3P2KA 4EZIA 1BQ4A 1YCGA 1SFRA 1XMQB 2IFTA 4LCEA 4TOIA 1X7HA 2MSCB 3HY6A 3NLLA 5TVGA 1S96A 1FW6A 1CEXA 3VHRA 2JFBA 1JDSA 4PLWA 5A3JA 2XUKA 2D4HA 4UPVA 3AWIA 5FFFA 3CUYA 3RAFC 4V1CI 1II9A 1L1EA 5HFJA 1PNOA 2BGIA 5JPIA 1UAAA 3D2AA 1SBQA 2QU8A 3GMSA 2D0DA 2XMSA 2W4IA 1AHNA 4RVHA 2C7BA 3H9EO 4XPZA 3UA3A 2Y1KA 5H80A 4B3BA 4LX0A 5C32A 2VJQA 4DCNA 1GZ7A 1KZ1A 1YASA 2VF7A 1FUUA 2JJ8A 3LVRE 4FDUA 1YZYA 2GN6A 4I9NA 4OP2A 2NXWA 3TX6A 1NJ8A 4BLRA 4RHCA 2PH7A 5C52B 2OHOA 3CH6A 5ALIA 1Q22A 3H2BA 3GRAA 3MILA 4YMTA 4RX1A 4GX5A 1FZTA 3IUYA 3N9IA 4WY5A 3IAXA 4X85A 2XZPA 2R6FA 1JHVA 4ZRMA 1NW8A 3CRW1 4OQYA 1GARA 1UBTS 1RYYA 1U9YA 2YVAA 5HF5A 5LXTA 2CC2A 4RCZA 2W2PA 2QRUA 3FF1A 1Z4OA 1WDLA 1MAHA 2TMGA 3JRWA 1R18A 1W5TA 4REQB 1HRKA 1AQUA 1XZIA 4JHLA 3UXHA 3LKBA 3DOEA 1CZRA 3V4SA 3VSCA 3WK6A 2C77A 5KC9A 1LI7A 3G8BA 4IEFB 4IZIA 5EYPB 1CP3A 1PYDA 2A86A 2Q4RA 3QVJA 3CRVA 4L5AA 1AA9A 1QFYA 4IINA 1SUAA 2XHZA 3ADKA 5J4YA 3T1NA 1W0JA 1OBFO 3CE9A 4HMPA 3EGCA 2CLOB 2XYQA 3Q8XB 1NW4A 2P7HA 4TTIA 1Y1PA 3UJDA 2JB9A 4OK6A 1E6LA 1MQ8B 3V1LA 1D5WA 3OX2A 2PX5A 1JIVA 2AQIA 2AUTA 1G38A 2G4VA 3PHIA 2I62A 2VH2A 3NOVA 1Y4UA 5B1HA 1UIRA 3QJYA 3HFGA 1W4ZA 4LJAA 4MUFA 3ZIAD 1SIUA 2BEJA 4TX1A 4CLDA 4PPQA 5HCIA 5ADHA 3A9TA 5L7TA 2IKQA 2PTHA 5GONF 1RRGA 5I9BA 3UWMA 2IZ1A 1FNCA 2VDMB 3OIDA 1KFJB 5CJ2A 3ZJUA 1TF7A 4G24A 1XF1A 5AJUA 5BWNA 3LDAA 3V34A 5M34A 4GMFA 5B7PA 3LCCA 2WBLC 4MQEB 4KHZA 4NMLA 2V6MA 4TMXA 4RTKA 1XTVA 2JGMA 3PKIA 4JJZA 3WGHA 2C61A 1I6MA 3U19A 1RE1A 3NYQA 2X9NA 2XT0A 1JLLB 4J0IA 2JBWA 4CL2A 1RPTA 1DOAA 4B3FX 1C3OA 4X84A 1NYLA 1WAMA 4PZLA 4JLKA 3BZWA 4V0MA 3WA6A 1JE1A 4MUYA 1KF0A 4C0QC 1L4LA 2GBIA 2AG0A 3HKDA 5AM5A 3WHIA 2YUTA 3OJFA 1OB2A 3MMPA 3X0DA 4YCSA 1EGMB 2H11A 4QM6A 3DLTA 3EVGA 3FROA 5EKDA 3PJFA 3RBZA 2EATA 2J3HA 2MMGA 2VL7A 2NV0A 4V3BA 4MRVA 5LLSA 1IEVA 3RUPA 3Q3VA 5CVCA 3DE3X 5GY7A 1X70A 1KQOA 1XQWA 5LUBA 3I83A 3VV2A 2FW8A 3GP8A 4NX2A 1XK7A 2Y2VA 1RPJA 3X44A 1QF7A 2EHJA 2EKPA 1AKRA 4GH5A 1TCBA 3PU6A 5LQDA 1QO0A 4RFLA 1UDCA 3IKTA 1JQAA 3FOWA 4RZ3A 2JGFA 2XE7A 4D7AA 4OM8A 3HV2A 1UPFA 3C14C 2IF2A 3OCJA 3S55A 3JS5A 3HEBA 2DH5A 4IJQA 1DUVG 3WFZA 4RKYA 5LDHA 5L9AA 4QVIA 1V8OA 3WZ2A 1NUPA 2G9VA 3QYFA 4AP6A 4C2BA 2JIOA 1XTBA 4P8RA 4MS3B 4PG4A 5CTJA 1U3UA 4JT9A 2BYTA 4D44A 3GYGA 3TMKA 4WH0A 4Y6OA 1NXSA 2VSOA 2P2GA 4MQMA 3JASA 3OFKA 1I32A 2I5PO 2I8AA 1BMDA 1DX6A 1KBOA 1OGJA 1JWAB 3G6WA 4YCDA 2YYSA 1T3TA 1SBIA 2EWVA 3DYBA 3GG2A 3IP5A 4IWNA 4OYYA 3T4UA 2FWMX 2P5YA 1ZN9A 2H2DA 3COSA 3B89A 5LC1A 1CR2A 2AXNA 2I33A 4IHJF 3MS4A 3EZNA 4RPGA 4ZVMA 4K8OA 1Q0UA 2QVZX 4PLGA 1KYIA 4P7KA 1W88B 1RWVA 1IWBB 4DPLA 1NYTA 2GILA 4YCCA 2YWEA 3GYBA 1UK6A 2WSLA 5EE3A 5HE9A 3R0QA 1CS4C 3TD6A 4EA7A 5JXGA 5DDIP 3KKKA 1HC7A 4BHTA 1MX9A 5JH7B 4G5FA 1E2IA 1S3GA 2QTWB 3I0MA 3Q5EA 4BNLA 4CDNA 5AKYA 1V5IA 2A33A 2OYRA 1TL7C 2FW6A 5FNVA 3UPUA 1P1CA 1AK2A 4XVCA 4S0ZA 1M1XB 3UB2A 4TLMB 5D86A 5IBQA 1IL0A 2CWWA 1AC5A 1CY6A 1KYXA 2GFQA 3H3JA 2WABA 3MUFA 4O4JB 1G7TA 4Q16A 2WU3A 4N65A 4Q4AA 3TLXA 4BO5A 4KITB 3D2BA 1UPUA 3E7PA 3GXOA 4DKJA 1Z38A 4LWPA 1BYIA 5KNDD 1EVYA 4K1XA 2CFSA 1U0JA 4YMIA 1H2HA 4HGYA 5E1DA 3M8KA 1D3AA 1KZ6A 1L4GA 1YCFA 2IIBA 2Y76A 1DJQA 3DT6A 3WLMA 4RORA 2M98A 2OK8A 3TI7A 4J2TA 4Y1GA 4PN3A 4IYJA 5TT0A 2WYHA 2EGUA 3FSGD 1LSSA 4ZYZA 2XMPA 2AOUB 2KHZA 2GN2A 5CRIA 4MKZA 4B7XA 3DWFA 3U7QA 2IY9A 2ZUBA 4ZQHA 4BVAA 5KKCA 4INJA 1SCQA 4NQRA 1M34E 4I19A 3VVCA 2A7QA 3U6KA 3AY3A 2CVHA 3MIZA 2HADA 2A2ZA 4QNRA 3N2EA 4YAOA 2GGSA 5C4IA 2DKFA 3O75A 4RD1A 4B71A 4QEDA 4INPA 4U00A 3RVSA 6REQA 5IUNC 5LQAA 2O8BB 1ULSA 3IS3A 1GTG1 4YPOA 4Q05A 2J3DA 2P9QA 3KQUA 2JHAA 4M0EA 3WRYA 3HJFA 2HYIC 1NNI1 3OC0A 1V1JA 1JIKA 2ODQA 3ICCA 1PL7A 2AYXA 2P35A 3HN6A 4LNAA 2CY0A 1OAAA 2PVPA 1JVBA 2Q8PA 3ND6A 3PEVA 3CUUA 3IQGX 2CYBA 1RQPA 1ENPA 1MIOA 1UR5A 2GF2A 1U0LA 3HL4A 4G4GA 1KQNA 1JDTA 2AG8A 1OD6A 2OUIA 3DKKA 4YMWA 3SQOA 4K6MA 3WLSA 2M9MA 2WTBA 1KSJA 2XVMA 1M10A 4AKTA 5CHYA 5LOVF 4UXIA 5IC5A 1SKUA 4N0PA 2ZJ0A 5AESA 3ZQUA 2R86A 1PS0A 3KBBA 1FTWA 4IX9A 1QK5A 1PI3A 4R68A 1EIWA 3IT3A 4RA9B 5CX1A 1GGJA 3M9XA 4PAGA 3U44A 2X15A 4EENA 2YV2A 2B3DA 2FKAA 2R48A 3W2EA 1L5HB 3MJTA 4QBHA 1ZRNA 1T9BA 4OUDB 4CIWA 4L4ZA 2Q0SA 1I80A 1X2EA 3M6LA 3VHLB 1K68A 2BLLA 1ZCAA 1BXGA 3PHJA 3ZDEA 1GPMA 1ST3A 1F8XA 1MO4A 2I1VB 1U0EA 3E3OA 3LQ2A 3ND5A 3MTAA 1EDZA 5EGNA 2BDUA 2LCIA 4TTPA 3ZK8A 2EW8A 4DNPA 3KFXA 1X7YA 2ECFA 4R1MA 3GLQA 3VPHA 5J3JA 4NMHA 3W1WA 2YV5A 3IEPA 1E2QA 4TYPA 2BSXA 2AGVA 1V25A 4U2KA 1CY1A 2O3TA 3NM4A 3Q87B 1F6DA 1GY8A 2ODAA 3CC8A 3KSZO 1IXZA 2RONA 5JU6A 3CQ9A 2F8MA 1OF1A 4W5JA 2BR3A 1KAQA 3PC3A 4DNFA 4KODA 1Y3DE 2FOLA 3JX9A 2C7QA 2K7FA 3CR8A 1K92A 1VCHA 4GP9A 4EJFA 5A71A 2CFIA 5EN4A 4R40A 3QUBA 1M34B 1EXNA 3TNLA 4AYTA 3U7IA 3C6YA 4MI3A 3G2KA 3JD4A 4LK3A 5THXA 1U7UA 5JS1A 1DEAA 2UVPA 1F20A 4LOAA 1QFXA 3JQDA 1DZ3A 1ZIPA 4M3NA 4TRMA 5FLKA 1DMRA 1P2FA 5K3DA 4RTRA 3A58B 4BLTA 3F7NA 3GUHA 1I2DA 3K4PA 3TQSA 4EG0A 4MVJE 2HRBA 1T0JB 1E2MA 1LQUA 1PQUA 3FFTA 4N6OA 5K3OA 5KTOA 3H84A 1DWPA 1TMOA 3F67A 1O95C 1VRCA 2VJMB 5E6SB 3TLYA 2YMLA 1Z25A 1MRZA 2R47A 1HG1A 4YYEA 5K6AA 4P3XA 2NUTB 3V4OA 3AJEA 3RBAA 1JXQA 3TLZA 4HWKA 1G0NA 5H3HA 1Y8AA 1KBQA 1Z37A 3JVVA 2BHTA 3UW1A 1QQ7A 3M83A 4LC0A 1PZHA 1NSFA 3DKVA 3HM9A 4YRQA 1NE2A 2Y99A 4QICA 4JLSA 1AHIA 3NETA 1XT6A 3H1PA 3GWGA 3C5CA 1EXDA 3QE2A 4HNQA 3X3HA 5B7NA 2EFYA 4KBFA 4G5SA 3R1IA 4DLBA 5IKMA 3A6EA 4EY7A 1BQEA 3UMMA 4LI3X 3WYNA 3AUKA 3GV0A 4WXYB 1DHTA 4FOSA 4L16A 3OCZA 2I7CA 3IVXA 5CGQB 1Z3CA 3R7DA 2C7GA 2B8EA 1J9EA 2WILA 5ALQA 2PX0A 3JQBC 1T5DX 4BJ6A 1J97A 5AJHA 3I6ZA 2WFMA 4WA7A 1QBKC 5DGTA 2IX3A 3OFNA 1NU6A 1UBOS 4E2FA 1X7DA 2NYUA 3L2OB 1RBZA 4NE2A 4P4UA 4CI9A 1DAOA 2Y2UA 3LBFA 4FMDF 1KE1A 5CDSA 5F1PA 2IYXA 4IFTA 1WW2A 5ESXA 3W7VA 2Y1DA 2CJPA 1F6BA 4YCJA 3BDAA 3RADC 2OY0A 4CGYA 4GOJA 3OZGA 3TW0A 1XC7A 3EXG1 2FJ0A 3E61A 4XQ9A 5DTQA 4RHEA 1EJ2A 1RZVA 3EIUA 4UULA 1YUNA 2PRKA 3J81A 1SZCA 3ZW9A 2YN2A 4HNSA 4DXAA 4F2WA 1PSZA 1WL8A 4QPZA 3KUXA 1XMOB 5DHQA 4WXMA 1UINA 5KINB 1VJ0A 5J5CA 1AQ6A 2OVFA 4R2WA 1JFRA 3JQ7B 3KT3A 4ZO7A 4RTLA 2PUDA 2I6SA 4OHVA 3KO8A 1XV5A 2Y66A 3K4HA 4JJ4A 3SEAA 2REQA 4LV5B 5J2UB 2P9CA 3LOPA 4WINA 1Z5UA 4D2IA 2CLCX 1EM6A 1R2QA 1EA5A 1KEPA 2WD7B 1MO6A 5EUQB 3I64A 3SK0A 3HWWA 1ZD5A 1DQPA 3H11A 2C0PA 4FR0A 4BFZA 2M32A 4B2LA 1LPMA 5EZ5A 3ZLBA 2XA1A 1UXJA 2K7ZA 3PI7A 4C2UA 4II3A 4M8IA 2YH2A 4N0EA 3PWZA 2XE4A 3CW2A 1DTEA 1QJCA 2V97A 5LB4A 1YWGO 2XVYA 4E4YA 1KL7A 1GL6A 2ENUA 1RYMA 2Q5LA 3L40A 1NVDA 2LKCA 4BTEA 3W5CA 1T5HX 2B1IA 3QGMA 2FE4A 1RZRA 2X0FA 2GUGA 3QQ5A 4J7CA 4ALJA 1BDJA 4YN3A 3GLGB 2IZZA 5IYZB 2AOTB 3PCTA 3R0ZA 1XLUA 2C5SA 4NXNB 2EDCA 4OFWA 1R0YA 2IDKA 4D5EA 5IT9A 3H5WA 2H92A 1U8EA 1EEHA 2AW3A 2HX1A 1SD1A 5FO0A 4OQDA 4B73A 4BTLA 2EVWX 3AETB 2R62A 4BQOA 3RIYA 2WTEA 4CM6A 2HWYA 2BSAA 1N57A 4B43A 2G7MC 1MA0A 4MYDA 4YXWA 2ZWVA 1OFUX 4PSCA 1XR3A 4ZCIA 5JROA 4CG3A 5I8PA 2Q3LA 3KVOA 4KN9S 1DG3A 3MBIA 4OMCA 2VNHA 4C08A 3BTVA 2ZIUB 2CL5A 4J3JA 3PLAE 3W6NA 4W5WA 4GP7A 2X9QA 4AC9A 3FR7A 4C14A 2A9OA 1ADFA 3OE1A 3V48A 2YV4A 3ABZA 2HK8A 2PR2A 4C0HA 2O20A 4FIZA 2PNJA 1AK1A 3FJOA 3I09A 4HB2A 1O5OA 3L3BA 3MQFA 2JLVA 2BGRA 2UVDA 1FDUA 3QKUA 3BIOA 4JB8A 1NAHA 4TXNA 4UKDA 2X1LA 4D02A 1LTKA 4POOA 4YHHB 1VIYA 1L6IA 1XZQA 3DMGA 4TKUB 4NC9A 4YQFA 2FX3A 3AY7A 2FJPA 4NCXA 1TPYA 1XRJA 4TKVB 3VSBA 2MYPA 2Y67A 4NFHA 1QZZA 1ONSA 3NWBA 5GMOA 2CLMB 2R8BA 4AY2A 2BCJQ 5CXSA 4WTOA 5DEIA 2MSLA 3TO5A 4MV5A 3FDJA 2FWBA 3LUFA 2RK3A 4HUTA 3EGDB 4QUEA 3FZNA 4Z8YA 1WQ3A 5ITWA 1V4VA 3F6YA 3IV6A 1NHGA 1RLOA 1V47A 1NX9A 2WUFA 3T1YB 1K08A 5EMLA 1X80B 4Q1BA 2WJPA 5HMMA 1OFTA 3EGWA 3KP1A 4RWEA 4U0KA 5D7BA 3A10A 2JGAA 5IM4F 4YJFA 4E5DA 4C30A 1JHOA 3CKLA 2EBFX 1JDBB 3WV5A 4KE8A 4CJXA 3T12A 4YRRA 1X7ZB 4U7PB 4URYR 1Z0IA 5JSHA 5KO2A 5KSOA 5M3BA 5CAEB 4MIEA 3RRMA 3VMFA 3IAS1 5JJ5A 3HGMA 1FX0B 1VPWA 1VL2A 1GV0A 1LRLA 1F6WA 3I9LA 1XJCA 3OQBA 1P0IA 4IGEA 1COWA 1QG6A 3X1DA 3EXAA 4EX7A 1CDDA 4RSRA 5IS2A 1TQ6A 4OSEA 3PNMA 2YNMC 2DTXA 4ISCA 4KPGA 4R98A 2MMCA 3NZEA 1DEHA 4ZQEA 4RD2A 1E61A 1YFJA 3FUVA 1IEWA 4P84A 2C07A 1T29A 1RRVA 2B1RA 2IYNA 2ZEJA 1WPGA 4DLKA 1IMJA 2F1IA 1YBMA 4NFLA 1WSDA 2JIRA 2Q6OA 2P3OA 3AESB 3LBYA 3CVJA 4W7IA 4KQFA 4EF4A 3MUOA 3CMCO 3VDRA 2QUAA 5ITVA 3ZVRA 4RTNA 1BH2A 4R1QA 4RK5A 2PZLA 4ZGGA 2X6QA 2W98A 2IYWA 3AL2A 3MK31 4PYIA 1T8RA 4EY6A 3LXUX 4UMFA 3G8CA 4PZZA 4OGFA 3G5UA 1UXIA 3BMQA 4U7GA 3A1FA 3GMDA 4X7MA 5IVIA 1OY1A 2AMYA 3HO6A 3ZWWA 2C84A 3ZHQA 1EP1B 5BOSA 5A03A 3E15A 4QXMA 4M1YA 5KVCA 3C3BA 4J6FA 3E58A 3K8OE 3L49A 1BROA 3DAFA 1JHAA 4IFEA 4EAAA 4EI7A 2I0FA 1WUIS 2WF6A 4G09A 4IHJA 4RK6A 1JMVA 3VR3D 2ZRJA 2HU5A 1X8JA 4RE6A 1Y8RB 2QG6A 1RKBA 2WSYB 1IIRA 3THOA 4E1BA 4M7RA 3ROGA 1XAJA 2G77B 2PKWA 3IT1A 3LPMA 2Q6LA 2P0YA 4D42A 4AWBA 2HU2A 2P67A 3O74A 3HYLA 4RDIA 3I9OA 1YS9A 1H8ED 1Z6AA 1CULC 4TT3D 4V0RA 4CKCB 5IJ0A 3TUJC 1M1YA 2BFCA 2DFNA 4IJ6A 3SEQA 4CN8A 3DBRB 5F1YA 4EWLA 3EVAA 1F0NA 2J59A 2AJLI 3R76A 2WYIA 4FZVA 3VR2A 2Q7XA 2VUTA 4KRYA 5G2OA 2FQQA 2R3SA 3LA8A 4HXFB 3TNFA 3S2ZA 3IA7A 5HM8A 3ZWDA 3D1LA 1ML3A 4UTPA 3LW8A 3OT5A 5D7NA 5DKFA 1C4OA 4FFOA 2WB2A 2EHDA 1XNGA 3BEOA 7ADHA 5DX0A 1UBCA 5C4MA 3E4CA 1JHYA 1RC1A 2BEUA 5GZ1A 4C1BA 1E62A 3MJSA 3RI3A 1Q2XA 1E6UA 1I2AA 2V7TA 3IQZA 3OETA 1QGOA 2IBSA 2WIBA 1IJFA 2YMQA 3U56A 5K8JB 2OESA 2J0UB 3P52A 2JD0A 1V2GA 1HE3A 2B69A 2CD9A 4I46A 4RMJA 3GGDA 3PFNA 3D8SA 3Q8LA 2WF7A 3FDZB 4RTJA 2Q7OE 5IJAA 4NJEB 1WNFA 4RTQA 4QOHA 1UK9A 3ROTA 5J4LA 3EXHB 4MWOA 4FK8A 1I1QB 1THGA 1YVDA 4RXMA 1E1CB 4YP7A 2HF8A 3WSTA 3V7FA 2I6FA 3G2PA 4PSUA 1PLJA 1EE2A 5FYDA 3U4QB 3LGAA 4OOEA 3CINA 3PV0A 3WXBA 4B81A 3JWPA 3TD9A 3OEHA 4QAJA 3QYAA 1TIPA 4WCVA 5DN6A 5H0IA 3T1TA 1EUYA 4TKZA 2CNWD 5JNWA 4KWEA 2P2CA 4M1WA 4ZGWA 3CZMA 3TJMA 3DBLA 3MQ4A 4M87A 5B2EA 4CCSA 1NG9A 1GU0A 3MELA 2VZ0A 3HR8A 1XK6A 1ISMA 4CODB 1ZNWA 3PA6A 1NWCA 1HTWA 1SO8A 4QDKA 5E9JA 4CU5A 4FCCA 5LOVA 1H69A 4MICA 1UBFA 3DEZA 3ICEA 3O1IC 2YQZA 3BJRA 3I9V1 4LDPA 2E1RA 4WKGA 1FDOA 4FCWA 2FUKA 4YYZA 2FH5B 4DV7B 1PTJA 1K6JA 4WXPA 3LWZA 2BI8A 2VWPA 4I1RA 4ZI3A 1QBGA 5HQJA 1EK1A 3OKCA 4GLBA 3F4KA 4DDHA 3SFVA 1KZ7B 2W9XA 2XOEA 3NUGA 1ZEMA 1JQ5A 2E87A 3NC4A 4YECA 5BN5B 4ZO9A 5J47A 1ZGCA 3OOSA 1GDDA 1N5RA 2R5WA 1DRVA 2A9JA 3UFBA 4B6FA 2DQKA 4YJ2B 2A5DA 1WXFA 5HDQA 5ADUS 3I1FA 2F62A 1X6VA 1Z2PX 2QJTA 4LSWA 5JZ9A 5KTRA 1PVOA 4FYHA 3S2UA 5TX7A 2Q2WA 2OLEA 2ZSAA 3QBJA 1CQPA 4OMDA 5AJZA 1GTSA 2FR8C 1VC2A 1XJ0A 4AZWA 2OBXA 2PL1A 3KTFA 4FC7A 5T6MA 3I05A 4EW2A 4PYOA 1OSNA 2GM5A 2XUZA 5KYWB 2QL7A 3BK7A 1VYHA 4QQNA 4UBOA 3R24A 3N3AC 3MS7A 2IPAB 4XOIA 2QTBA 4JLPA 3X1ZA 2CHGA 4W6ZA 1RJDA 4GHWA 4M7OA 3KYDA 5AXCA 4ZGBA 4HB4A 4K88A 4G0ZA 4GI7A 3EYWA 3ESDA 2YJZA 5ALYA 3NHZA 3OH8A 4MR8B 3C24A 4CMEC 2PE5A 2G88A 3K6KA 3ZQJA 2SNIE 3HTXA 1X1DA 2QN3A 5JRZA 3SZLA 3UMFA 4V0SA 3GFFA 2RHMA 4CQMA 2V9PA 2HRZA 4D43A 3OKPA 1PZMA 4WOKA 5FTWA 1YFKA 2XT6A 3E3NA 1C4KA 4JT4A 1VHJA 1ETUA 5L7WA 1UPCA 3AEXA 4LA4A 2MHCA 1T5TA 1ZSYA 2WWHA 5DYNA 4CU2A 1ZN7A 4OX9Y 3A27A 4G1VA 2QWXA 4ZOLF 2JGDB 3MG9A 1ZIDA 3S99A 3TQHA 4AO6A 5JCOC 3UV6A 2VUHB 2N1BA 4H1HA 2Z09A 3ZWKA 2HSZA 2QN6A 5DN9A 3GRPA 2Y0CA 3LHIA 1V43A 4MINA 3TFWA 3VH4A 3CU5A 1R6VA 2VNAA 2P6RA 4X6YA 3F6EX 1PNRA 1UT5A 5E6RA 2RAFA 3KT0A 3FJYA 4QJIA 5ITZB 3BWBA 1VSVA 4C7VA 4UDYX 4CKBA 2WUGA 3PIIA 1P5RA 2UV8A 3QKIA 1VIVA 4KXWA 4PYMA 4BNGA 2ZSEA 4X45A 2C2OA 4TYYA 4A23A 1EZ1A 4EJSA 1JR3D 1G9XA 2DKOA 2OORA 5ES3A 5EJMA 5AW8A 3L6UA 4FEGA 3L1HA 3ZY5A 1EP2B 4RF2A 1PLKA 1RZ3A 3DZKA 4FW8A 1JEYA 2GFIA 4YV2A 5DGCA 1DC4A 1KYQA 3MF4A 4TV9B 2EKQA 4MGIR 3C0KA 2ADFA 4DDVA 1XDDA 3U7GA 4LKOA 1KKLA 4FYJA 1RCUA 2QZSA 2ROQA 2WDPA 2ZRQA 1FFHA 3W5SA 4YAEA 1KI3A 8ATCA 1NR5A 2G8NA 1P91A 2LE0A 3BKWA 3BCSA 3MTJA 2OQ2A 4HGNA 3ANSA 1Q15A 3PSAA 4ZI2A 1TDJA 4HNGA 4EYGA 3L8ZA 4H7IA 5IJWA 3LJKA 4FYIA 2FYTA 2ZYIA 4C0LA 3QF4A 4K2HA 2UYYA 1UBMS 3PL5A 3R9XB 2ZJYA 1WSAA 2NT3A 3BSFA 4PQRA 5I4IA 5F1OA 4AZ3A 3GLIA 2TECE 1GNSA 4E08A 1K2WA 1Z7GA 2XTNA 3FM9A 1RBMA 1U2EA 2AR0A 3VR4A 2QRVB 1KC3A 2XH8A 3EVEA 3LMKA 4G0QA 3GEMA 3ME5A 5AKKA 5G0TA 2UZ1B 3H1AA 2C8LA 3NBYC 5GZ6A 3SZUA 7REQA 3CV3A 3KYCB 4WW0A 4D9MA 3MJFA 2OOKA 1P3JA 4JBGA 1W30A 2CFTA 4K9MA 5E7IA 1R0WA 3VUEA 6CHYA 1Z16A 3NIBA 3ZXIA 5EHGA 1KR2A 4D74A 2IU4A 1ND6A 4KMMA 4X3CA 1QOPB 5JTTA 1SUIA 3WHLA 1QXSA 4NE7A 5IF3A 4AULA 2O3UA 3I62A 3OEWA 4IOLA 4D9CA 1AKWA 1CUEA 3U13A 2JAHA 1L5MA 4N18A 2H1VA 4ENWA 2PK3A 3DDWA 1ZD2P 2CXTA 3BKXA 2XY4A 4BZWA 1YZ3A 3TM4A 1SHJA 2NUPB 1YL6A 4PBTA 1ULHA 3M9LA 2X0RA 1KVRA 2ZRHA 3KB1A 1UC5B 4F2GA 3GUZA 1QE5A 1NZDA 1RAAA 5JQGA 3TL2A 4BRZA 4D8XA 2JEYA 3GF4A 1QQ5A 4O63O 4YCAA 3E1GA 4NS4A 2UDPA 4BPRA 1L6RA 4R3WA 2OV3A 1MEOA 1R9GA 2V9ZA 4PF1A 2VPWA 2PAFA 4IRMA 4U6NA 5F5LA 4RFSA 4HPJB 5THQA 2CNDA 3SHFA 4ENUA 5BNIA 1WLYA 2AC7A 1C50A 1UKZA 2G5CA 3OP1A 2FE1A 2P9BA 1Z56C 1FNNA 2RH4A 3C5VA 4O02B 5JO0A 1C7FA 4BV8A 1SXJD 3MERA 1JSZA 3RYFB 4XWWA 3N59A 3T7AA 2PZKA 1WR8A 1W29A 3SSAA 3KZNA 2H2AA 3QVKA 4KO2S 2IEGA 1LNZA 1U5BB 2RGUA 4PVCA 1E2HA 1U0SY 1UQRA 2JFFA 2JJ1A 3PKJA 2RCYA 4ONEA 3H9GA 4W9NA 1DQRA 4NOJA 1WG8A 2B6NA 2Y0PA 3VU8A 4YMLA 3EG9B 3GGGA 1GNVA 1BXRB 4BMOB 1Y1RA 1NTRA 4LZOA 3CUTA 4M1SA 2BKVA 5B5SA 1TNDA 2FRDC 2GXAA 4KNVA 5DE3A 4UOEA 2I7VA 3L77A 3FAZA 4JLNA 5C8DA 4ND1A 4L75A 2ZJOA 4PPYA 4A82A 2H3EA 2RKOA 3VR1A 4QXQA 4OHKA 4ZPXA 5C2JB 1HE5A 1K06A 3UV3A 3U61B 1OYVA 3A6HA 3T7CA 1Z33A 1KNXA 2DJIA 5I5EA 4R9RA 4MQLA 2I1LA 5KYUA 4CHGA 2IS6A 1E3LA 1TQHA 4I4TF 1PRYA 3VC7A 4FI3C 1USWA 3PGA1 2PT5A 1EX7A 1GD1O 2NQTA 5EXPA 4MXDA 4C2TA 3QG1A 4HOYA 5D6OA 1JT9A 1XNHA 1GYRA 2Z43A 3GLTA 4Q9NA 3SQNA 1W76A 3OTHA 5IVPA 4BEJA 1N75A 3D7NA 5DF1A 3OJCA 1XWIA 3W4IA 2CLSA 1JJBA 2J7PA 1LLQA 1HQYE 3IB6A 2BBTA 3PJEA 4TYMA 5ADVA 3OQOA 3D1JA 1VECA 2B30A 2AG5A 1HH4A 1CDZA 2QF7A 2C9CA 3FUTA 3GMTA 4LNUB 1YRAA 2A1IA 4IM7A 1KPHA 5SY4A 1XZNA 4G9BA 2EERA 5LBIA 4IH1A 3W5AA 1YDMA 3E35A 4HNAB 2GZRA 3R44A 3L07A 5LQMA 2ZULA 4F2DA 3D5QA 2GDZA 3EF0A 4PLZA 4QYWA 4BFYA 4CV1A 2VQSA 5AM2A 2QRHA 1IM5A 5EMJA 1IYZA 2QSYA 4XYMA 1OZHA 2B99A 3BIJA 4BFVA 1V5EA 3L0IB 4Q37A 3HZOA 1V0JA 4AJKA 1O89A 2E89A 2JBHA 1A9OA 1QS0A 2YS6A 2KQUA 1Z0UA 4PFSA 1QYWA 2X0IA 3PB3A 4E4TA 3AYXB 2H4ZA 5DU2A 2HWWA 3OEED 2FUNB 1K63A 3GLSA 2NP7A 1ZK0A 2O7VA 4DNXA 4BBAA 1S2IA 1QPBA 3IAM6 1M2WA 3U7RA 1JECA 2XDQA 3T1OA 5BVHA 2I76A 1KGDA 1P1RA 2LP4Y 4BVLA 4E94A 2RD2A 1UJ5A 1X9HA 2PVCA 5AVQA 3GT0A 3LS2A 1C14A 4F3NA 6ADHA 2XZOA 2A67A 2RHRA 3INRA 3O8QB 4O4LB 3G8AA 3O2NA 3AF4A 1Z8DA 3ZW8A 4GBED 2ZQ5A 4GVLA 1RYEA 3ESQA 4PBSA 4YT8A 2O0LA 3OKFA 5JZSA 3ED5A 3RV3A 3DOHA 5AVUA 1GPJA 4Y8VA 1XTPA 3HCFA 2FEXA 4QOFA 4FB4A 4HEHA 2VDJA 2EYUA 1I7SB 1HM5A 4FZ5A 1ZISA 2C96A 2MYTA 2X8JA 5AK5A 2C4TA 3OD1A 1TFRA 3W3ZB 3K9WA 4F21A 4RTSA 2F17A 3H97A 4HDMA 4XB1A 1J09A 2ZQYA 3HA7A 3Q2OA 4LOHA 3L8FA 5BSTA 3WQQA 5A9SB 4Z4FA 2H7YA 3AGQA 2QTRA 2X5XA 2X1HA 1VCIA 3BD9A 1HDEA 1K7FB 1WE2A 2BAGA 4RY8A 4D9EA 4F45A 5A7HA 4YRIA 3ZJTA 1KJIA 4JR1A 1LF5A 5ALGA 2DETA 1V16B 2WSIA 3FNBA 1WDTA 3P45A 2VWQA 4DLXA 2I66A 3V2IA 3SHTA 4D9GA 1JIJA 3B12A 4C4PA 4D4IA 5B3LA 1KVQA 5KVSA 1W6UA 3VOSA 3G68A 1OPXA 2OXEA 4J0DA 3LAWA 1GEGA 2F3RA 4JBWA 4UM8B 3RS2A 1O54A 4OB7A 1WP4A 3D7RA 4IWYA 4BZZA 4HNTA 2IH2A 4FQ7A 5D5QA 1USGA 1SCUB 4KL8S 5I9IA 3TN7A 1II8B 4BO7A 2WIJA 3KAKA 2LXNA 5G0VA 1HSOA 3CPHA 1O6BA 5BQFA 3P96A 5F35A 4ZV9A 3IQWA 5AOVA 1KZ9A 4RF4A 2A9KA 1SHTX 1U2GC 1RIFA 4TMYA 3A9CA 5TQJA 5ICMA 2JIZA 4MV4A 2FCRA 2DPHA 1LC0A 5I9SA 4JR0A 1SZPA 5CLQA 1NJ5A 2QJOA 3IEXA 3LY5A 5KYXA 3PFIA 3KZCA 1RC8A 2VHYA 5A3QA 2Z6UA 1JHPA 2OYCA 3GNSA 1XRSB 5FUQA 1OBOA 5AYVA 4W99A 4BMXA 3OPYI 5HKOA 1BCRA 5G41A 2H4JA 2Q46A 3UJAA 1XJ5A 3PA8A 1M2OB 1T9HA 4ESEA 3ZGXA 1T0PA 3A6KA 3E1SA 4HPWA 1KAOA 3MJRA 4IQ8A 1ZJ6A 4MPRA 2VSFA 1X1CA 4BQEA 2FP4A 3O94A 2ZCVA 4F7DA 4C0AC 1FEZA 1E0KA 3R5HA 3NGLA 3ORQA 1BMQA 1FQOA 3LFHA 5A05A 3PWSA 3VKVA 3ZU3A 3B9QA 4EHBA 5JXWA 3C7TA 5KVAA 3NIWA 4UNQA 1IM2A 4ZWNA 4CIXA 1TXGA 4QQ8A 4EVIA 3IDFA 1GGFA 2W6QA 3AHHA 2E48A 4XXHA 2OCLA 1SH7A 1Y1QA 3F5SA 4L22A 2VNJA 1HDXA 1I13A 2YDYA 3RUEA 4BPBA 3ZLTA 1AQYA 1M6WA 3NASA 1H1LA 1PG2A 4EPVA 2IHKA 4COOA 3FCCA 2BFEA 2FFAA 5CDUA 3N0TA 4CM1A 4R0VA 4U9IS 3SX0A 1XD2A 2H52A 3OVMA 3ER9A 4ZCRA 5JS6A 1NPTO 4RQBA 3HUUA 2ZROA 3ECAA 4ZVUA 5K3BA 1XZ8A 4S24A 3TINA 2LPMA 4Z3KA 4P31A 5L45A 4INOA 4JU8A 4A0RA 3H1GA 3F6CA 5IWCA 2H2FA 5CPFA 3NBQA 1H6DA 2ZVPX 4CM8B 1JNYA 3QPVA 5J5VA 4V38A 4AX4A 1OXTA 1XVVA 1YQDA 2FA9A 3MS2A 4GOKA 5E1MA 4AY6A 4BX8A 2UUAB 2ZOSA 1U8FO 1LLFA 1ZGGA 3LDHA 2FPWA 1C2YA 3P32A 1XLWA 3ZX5A 5CH5A 5CEFA 4P3NA 3HB1A 2QVXX 4NAVA 4ZAGA 1GCOA 2XKAA 2ODNA 1B74A 2OKCA 4AVYA 4D6YA 3ILXA 3DMFA 4GDFA 2FMXA 4GMGA 1L4EA 2PMKA 4EA8A 4DV1B 1F7VA 5IJXA 4ZTZB 1GAEO 2VYCA 3EA5A 3WO1A 5JDIC 2PRIA 4DRZA 2CXHA 4CM4B 2RBKA 5TEVA 1K7XB 1OLSA 1XZLA 3HZHA 1KH1A 1MKYA 2X1MA 2VZ9A 2QN8A 2WSSA 1O08A 2BMJA 1DXHA 2PBLA 2VLIA 3ZX4A 4DILA 1A76A 3K0FA 1J23A 1ZLXA 3QXGA 3T95A 2K2WA 1TK2A 1W0CA 4PAQA 1Z4LA 2LVBA 2F64A 3DV0B 1TM5E 4PTZA 1MP0A 3EIXA 4QBFA 3ZVLA 1G5QA 2C5LA 1M6NA 4FWBA 3T7SA 5AM4A 1FDVA 2R9VA 3CUVA 2I80A 5COBA 4J0EA 2CCKA 2IYLD 3RTGA 4MI6A 5KDDA 1Z6PA 1VCMA 3HCNA 4YCBA 4LY0A 4AMVA 4BYGA 4EJ6A 3E70C 1JG7A 1QPGA 1TF5A 2Y05A 3OPNA 3P9NA 3I76A 1Q7RA 3WB1A 5IZ4A 5LU8A 3K0SA 4KN6A 3S7ZA 1IY1A 1KARA 1UOPA 2CXPA 1TC2A 1N4AA 3U37A 5EIBC 4W1SA 1AG9A 3S8EA 1WUHS 3ZXXA 1YDFA 1OX4B 2AB0A 1JZTA 5K8VA 3NHKA 4JIGA 3SLKA 2GM9A 3Q6MA 2OG1A 1WKCA 4H16A 4EHFA 3IVMA 1M6VB 4US0R 2XXAB 1YR6A 4I5FA 2F59A 3BXGA 2L69A 1TD1A 2Q0QA 3JQFC 1EP9A 2QZ4A 1WSWA 3IEUA 1QSGA 2YZMA 4WAUA 4ECEA 1I9GA 3KQMA 5C5EA 1S4QA 3WAGA 4Y6RA 4LOLA 2EJUA 4NWIA 3EVNA 2ZI6A 4XIYA 4GOND 1G7CA 1I6WA 3NP7A 1AMUA 2ZGVA 3JATB 1YB7A 3M2PA 4YJDA 1QP4A 5TQ2B 3KDAA 1S3SA 5ERGB 1VMAA 4MW9A 4AMUA 4JJ6A 3DFKA 2R66A 3LQYA 2VH5R 1Q0LA 1JPVA 1Z39A 3DUWA 2IU0A 3OT1A 4PNHA 2FFBA 1DAFA 3CW8X 4XZ3A 3IO3A 5FAKA 1G41A 5AW3A 5ITSA 1NRWA 3H17A 1JXOA 4Q9JA 1WA5A 2Z6VA 3GPIA 4AKEA 1A5BB 4AUKA 5DB4A 2B4TO 2GTPA 2WUVA 4BZQA 1N6RA 2GJ8A 3LBNA 3NV7A 5E4JA 1TZCA 4QHTA 5A6SA 3FMVA 2IEZA 1H4TA 4A92A 4F5YA 2C9DA 5JNVA 4BTVA 2JVJA 1G8GA 3MBKA 1EWVA 1PK7A 2YZGA 4WNCA 1LJUA 1GQOA 2JD1A 2P68A 2PXAA 2Y27A 1DBWA 3CLUC 3MWDA 5DMXA 5F12A 3SNKA 1JJ7A 4ND5A 4HWGA 3D3NA 1AQJA 3Q3HA 1JHMA 3OIGA 4TTAA 1ODJA 2BEVB 2YYYA 3AHCA 2P79A 4B8YA 4CTNA 2VYVA 1J5PA 4DY4A 5C5IA 1FFXB 3D0RA 3LBIA 4QRDA 4UUOA 2FPPA 4X1YA 4HS9A 4RXTA 3V2GA 4ARAA 2C8VA 2UUOA 1RYHA 3WNVA 3PNVA 5EFZA 4PXSA 3H4MA 5DNDA 2N9UA 1QFJA 4LMRA 4OGWA 4OJMX 3OQHA 5HQTA 1ZRHA 4TV8F 4C4XA 1PS9A 3FPEA 5JHHB 3B51X 2O1WA 3P0FA 2VWHA 1JHXA 1CT9A 1Y9EA 1Z0ZA 2UYHA 2QN2A 1HX7A 3CUEF 4IDEA 2C00A 4Q39A 1EG7A 1PV4A 1PZEA 5LPNA 1MB2A 3OZFA 4G84A 1K7SN 3BQNB 3WGJA 3ZEAA 5CEJA 4DB2A 3OI7A 3EMVA 3IP1A 3K1AB 2BRUA 3LL4A 2J6BA 2W6JA 2XSZD 4MV7A 4OGGA 2O2JA 3SHOA 3ZUGA 2JJ2A 4PFQA 4KFCA 3CZQA 3T41A 3Q0IA 2X2PA 4MA0A 1U5CA 7MHTA 1AVTA 3ESYA 4XX1A 3DGFC 2EJTA 3Q7PA 1NZJA 4AN4A 4LJSA 1N5LA 1Z2EA 4BAZA 5IT5A 3TEMA 4E07A 2OL4A 3E8XA 1E66A 2J5XA 3AEYA 3JVDA 4OMUA 3SYLA 3W8FA 2JHCA 4RVCA 4MUMA 5LLTA 1T4BA 1Z5GA 4QDJA 1G5PA 1TAGA 4I7EA 2J7KA 1UFQA 2VJDA 4C4YA 4MEBA 1FFDA 4ZXPA 3AVUA 2PZMA 2FMFA 2ZB8A 3ZY4A 1AK9A 3ACBA 3WR5A 5JAQA 5BW5A 1GT6A 3TXYA 2BY4A 3FTDA 1VJGA 3KPWA 1W4CA 1N2EA 4YBRA 3CISA 1EWRA 1SRRA 5EJEA 1ZN2A 3TDNA 2I67A 2IYRA 4QOJA 4LPSA 4LVNA 2K6GA 4N8DA 4S12A 5FBVB 1PT9A 3BSWA 3DT8A 3PSHA 4FJ0A 4GE0A 4KTTE 3R8FA 4YRBA 4YXFA 1S8NA 1YHZA 5LXTB 4XIFA 1L5WA 1R6UA 1A7KA 2GEJA 2ZKIA 4V03A 1F4VA 1E79A 2AYYA 4ZANA 5K2OA 4OQ4A 2GWRA 1SBZA 1HORA 1KZYC 2VK1A 2X76A 3MTGA 3ITDA 4DRXA 3ANNA 3OF2A 3UJ3X 2QIOA 3M5DA 5ILQA 5LP6C 2G9NA 5LWQA 2ONZA 2WHQA 1UBEA 3EIHA 3TLMA 4ZOBA 1QIKA 4DV5B 4ZARA 3JAWA 3I01A 1EX9A 4O0MA 3ABOB 3GFOA 3A2MA 3IPXA 3GLFA 1CF4A 3DOOA 4QXAA 2DWOA 2ECQA 5AKIA 1B8VA 2R4QA 2H5IA 5H82A 3WGTA 1CLUA 4XUGB 1FJ2A 2DP4E 1B93A 1CG6A 3VO8A 3VR6H 4LNHA 2GX6A 4WBNA 3F3KA 1WBDA 1PGPA 1MGOA 1I14A 3K3PA 4JQSA 4UCFA 3OE5A 1LV7A 4K6CA 1U1FA 4PX5A 3BXEA 1QZTA 2RGGA 3S5UA 1NASA 2OKGA 4ZYVA 5IAOA 3EARA 2P4QA 2C0QA 1WZCA 2G36A 3F8WA 3IRVA 3KAQA 3O4FA 4YNBA 2CXSA 2EKZA 3FUWA 4DGSA 3TF5A 3T0FA 2ZRGA 2WSMA 3KCQA 4M21A 4Q66C 3PK0A 4EFNA 1V39A 4YRZA 4NFSA 1TCCA 2CL6X 3O9ZA 3I0ZA 2ZIXA 3D8BA 3LUHA 1FMTA 3M6AA 2HY7A 2C2ZA 1JDBC 3OQVA 4CNBA 1EK6A 1PJQA 3GU3A 1QHNA 4RTOA 4QOEA 2QLBA 5LZ4A 4BP3A 3TW4A 4F0JA 1SVNA 2J5BA 2VHTA 4H1UA 5KNCA 1THZA 2SHKA 2WYWA 1GQRA 3JD3A 1HOTA 5AUOB 4QHYA 2Y4NA 4NCAA 1C3OB 2DUNA 1RWXA 2CV1A 4B87A 6ABPA 3NDJA 1PF7E 2BELA 3HKDB 4LXTA 4QQFA 3CO5A 3OY2A 5T3UA 5BXQC 1JTFA 3JZIA 2WHXA 4XEHA 3F5QA 1D9XA 2OFOA 4MUNA 4LE0A 3NT5A 1N8SA 3CE6A 5AK4A 5JNLA 4XD2A 5L7YA 1SCKA 4C4AA 1FYXA 1CCWA 2ORWA 3UW3A 1LSUA 2IPMA 2AD5A 3HU2A 4LRQA 4X64B 1UEIA 4EVQA 3SXJA 4M7PA 1C4XA 1U6JA 2Q5EA 4HZUA 2ODEA 3W9UA 2F3UA 2JFZA 3BTUA 1CNEA 3PUZA 5IPFA 3UUEA 3MFQA 4W5TA 3PHBE 1GPBA 3S6JA 1LDEA 4UUAA 2FR1A 1KA9H 1WHTA 3BDIA 2LUOA 1JLSA 3SMVA 2XF8A 3E7WA 3OLQA 5ELLA 1XTTA 5D3MA 2BN4A 3C8DA 4LCJA 5A7FA 4C22A 1Z22A 3RUAA 4XYLA 1WZIA 4BN5A 4CCYA 4F38A 5BN4A 1VCNA 1K6XA 2JFPA 1G3QA 2O2CA 3R0IA 1UUFA 1D8AA 1JU4A 2GN9A 2QL5A 1OBHA 2XOXA 2XUGA 3DFMA 3ETJA 2J5QA 4FCVA 3JASB 2GCNA 3UJHA 3H4TA 4M1QA 2H9YA 1EZZA 3LHKA 3NEAA 3O3CA 4LYDA 1J70A 2ONYA 2EF1A 4OHWA 4RJLA 5G1OA 4EHLA 1E99A 3NHSA 2Q4BA 2HHLA 2YVUA 1Q11A 1FU4A 2ZT7A 2X40A 1BS1A 1L7MA 5A0FA 2I2CA 4DGQA 1PJLA 4LFBB 2VP4A 3AW8A 5HS4A 2YBEA 3IOMA 4TZ6A 3GQVA 1NR7A 4ZVRA 4P32A 4W7HA 2CL0X 1CB7A 2FMHA 2HBZA 5A1TA 2J0SA 1LLUA 4KMRA 4RH3A 5BMVF 4XFJA 1USUA 2GWHA 3OCYA 4FKMA 4WY2A 4QGAA 5FNVB 5HG0A 5K3CA 1N9KA 3FRHA 2AXEA 4EUEA 1H0RA 3L7AA 2ZCJA 5UKDA 5EWMA 1G6OA 4A2QA 3UEOA 1E0JA 1AUPA 4Q4AB 4CQLB 3IJPA 4EA9A 2K87A 3TS1A 2DT5A 4K40A 3JY6A 4UARA 3HDTA 1TQ8A 1W9MA 3S27A 2E21A 3M0EA 2FHPA 3EVDA 5ALVA 1U2TA 4AWAA 3QVMA 1ZL0A 2AWOA 1EFLA 5AVVA 2H7VA 3QOFA 3WO0A 4K1LA 2AOWA 1TM7E 4KXUA 4L8GA 1QVWA 3QTTA 1FMFA 2J30A 1RQGA 2Q6IA 3ORSA 1GTL1 2NW6A 2WKPA 4G41A 3DB1A 5JY1A 5K5EA 4PZEA 2J07A 3U7QB 1UJBA 2AX3A 3FFXA 3IKJA 2P1ZA 5I8WA 1KKMA 3PYXA 5J23A 2I4OA 1XPJA 4XB6B 1L5ZA 2HCBA 3QA9A 1LVHA 4JELA 4WL0A 5FOQA 4ARCA 4CGZA 1XALA 1R5BA 1YDGA 4N0MA 3VAYA 2JA2A 1SG6A 4J6EA 4F8EA 3TXXA 2GK6A 3HABA 2O4CA 4LZZA 3N8KA 4BV3A 6REQB 5C1BA 2QE7A 3UT6A 1YA4A 1CNFA 1WWKA 2B7CA 2QU7A 4JA0A 1E7WA 3GEPA 1TK3A 1OAOC 2O57A 1C3JA 3RS5A 3GFTA 2QM7A 4BUCA 1N2XA 1CIPA 3RB8A 1IXSB 1VMDA 3K8YA 4N5HX 4QDXA 3OZWA 1FFGA 4L7QA 3K5WA 4GAEA 3MUNA 4QO8A 1MIOB 5ENZA 2QLJA 3R4CA 1NLMA 2VP9A 3U0VA 1CS0A 4HAXA 1P1HA 3GI1A 1ORTA 1WNTA 3DWGA 4B85A 1T9CA 5I5GA 3MPOA 4B82A 3OJOA 4M60A 1ZGHA 4EUFA 3A2KA 4QU8A 2GLUA 2PA3A 2AX4A 3DSRA 2IGBA 1QTRA 5I9MA 4EEKA 4KBYA 2OP0A 1AHHA 1CZOA 5CX1B 4K5QA 1R74A 4J76A 3U44B 1M8JA 4K05A 1XRMA 5CU7A 1NLZA 4HDRA 4EYSA 1WM1A 3D6HA 3UG7A 3EVBA 4QOSA 2I87A 1PR9A 4D79A 3K0BA 4OP3A 3K15A 4G4JA 4RV5A 1W1WA 2GFHA 2I4NA 2WQ6A 1CR0A 2BI4A 4MV0A 1BXGB 1SQ5A 4P4LA 5KHAA 2A1TR 4JBNA 2NU7A 2BHNA 3B2QA 4NZMA 1PJAA 4YT5A 1BOFA 4ZPJA 3VPGA 4F1WA 2HJVA 3IVGA 3CSUA 3ZDFA 3LQ4A 4ROTA 1X7YB 5CA0A 1PS8A 2GN4A 1JEOA 2VZLA 4BRUA 4QBIA 4ON9A 1XA3A 4TM7A 3S44A 4TS1A 2GZSA 3NW9A 4MCAA 4MWEA 5AJYA 3U1TA 4EYEA 3C4JA 4JX8A 5TS2A 3ZDQA 4UM9B 1VE9A 2WPDD 3UUWA 3ANMA 3D2CA 4J0QA 3M4NA 2G63A 2WE8A 1F06A 4BLOA 1CEEA 4OQPA 2DG2A 2O5RA 2OFWA 5HIMA 1JQBA 3E5RA 1D1TA 3PGKA 3PQ6A 3DPUA 4DMUB 2C2BA 4CN9A 1BRTA 4KLZA 2Y9PB 5LQSA 1ZK4A 4FFDA 1R0KA 3ZVMA 4GLJA 4MWDA 4DFDA 3IE1A 5BWCA 4G6ZA 4MMYB 1H8HA 4UREA 5DYTA 5BOVA 4G37A 3K9NA 4OYLA 4XGIA 1TMKA 2D7CA 3T7DA 5B6IA 3ELDA 1Z13A 1REQA 2UVPB 2XQIA 1F8YA 5AXAA 3CLTD 4C7BA 2GXQA 2HUPA 4D9IA 4EO4A 4YB8A 3I6MA 1DIHA 2B1JA 4MDYA 4LF8B 1X15A 3UB3A 1GPUA 5FI1B 1RQNA 4DAEA 2G1KA 2GHTA 4M0PA 1E3QA 4NK5A 2B37A 4BMYA 3GRUA 4LKRA 1T1JA 1IVNA 1Z2NX 2A5FA 3GN1A 2VYND 2B4RO 5BQ3A 2ZS9A 1DO8A 2B25A 3QIAA 1QO7A 3OLZA 4FVTA 4RYDA 4WVFA 4XDGA 1DV2A 2RFLA 2CXRA 3SY8A 1IM8A 4BUJA 2YASA 4G0MA 5EMKA 5DGHA 1O03A 3CT4A 3ZXYA 5F7JA 2IOYA 4GPTA 4MITA 5J1TB 3WLNA 4UFOA 4QKQA 1A9ZA 4FE3A 5F5XA 2X2EA 3C6QA 1FJXA 4FSHA 4OJYA 4Z86A 2RHJA 1MEJA 3HO8A 1IATA 3UK6A 4ENQA 1GG8A 2XV1A 1H2RS 2CLDX 3PXBA 5CLHA 3FRJA 3W05A 2UUPA 5KOHA 2Q2VA 4EX6A 2Z5LA 4ZEMA 1OXVA 2ZUDA 1GA6A 2CNNA 5D00A 3WGGA 3MM4A 1BXZA 3CURA 4B79A 4B44A 1MABA 1W73A 2QPOA 3O4IA 2ZVJA 3JVUA 4BP9A 1KMHA 3MOIA 1NMSA 2YJGA 2A3RA 3NYWA 3OHPA 4P92A 4R2JA 3LYAA 1UQUA 3L0YA 2VF4X 3AV0B 3NS7A 1YD7A 4MI9A 5CB8A 2EP8A 2RAUA 4WZZA 4ZVQA 1HFEL 2WP8J 3D0QA 4I66A 3VZQA 1YIAA 1G0OA 1FF9A 1XD8A 3EULA 3WNQA 2XB8A 2AE1A 5DTJA 2ACEA 4LXGA 2JCYA 1YXMA 1D2HA 3MMZA 4JXJA 4KWIA 2D5AA 1QHHA 3SQDA 1N77A 1QAQA 4NBLA 1QGYA 4OL0A 5EL0A 2AW5A 3ZZ0A 2P0EA 2HO4A 2H0QA 1EJBA 4LX8A 1AM4D 4NI5A 1PR0A 3DVRX 4U7FA 5AM1A 1L1FA 5TV2A 3O38A 4H7HA 3WK5A 2UKDA 5CG1A 4YR7A 1BVYF 2V74B 3HP4A 1S89A 3A4NA 5B58T 3DMPA 3OMXA 4HADA 3RFTA 1DOZA 3NJRA 3GZ4A 3JW8A 4JFRA 1KAGA 4BAUA 3JQCA 5KUTA 3O5AA 5BQPA 3GDHA 4G3XA 1UFKA 1YJCA 1L5RA 3KPJA 3EIFA 4GNRA 1RI1A 4AZTA 1Z0JA 2REQB 3LLUA 1L7AA 4BJHB 5K0ZA 5TVKA 3TTVA 2Q9UA 2CDAA 3NONA 3OX3A 1YR3A 2CBZA 1NXPA 3H5AA 2WMOB 1C3VA 4U9UA 1XZAA 1YB6A 1XKQA 3H11B 5KAMA 4B46A 2XZLA 3DQQA 4REMA 4E5MA 2QN1A 3R6DA 5AW6A 1HEYA 4GZ3A 5TF4A 1MJNA 1JVSA 3EWSA 1YR7A 3HWX1 4FBMA 1CRWG 2QP9X 3CNEA 3R3HA 5H3LA 2OHIA 1O95A 1UT6A 4G9EA 3S29A 3K20A 4U2EA 5IF9A 4PLTA 4I8IA 3NTXA 5J1SB 3U3DA 1LH0A 1TPZA 1WPRA 2PS9A 3NXSA 1N2CA 4MDFA 1ENOA 4FFRA 4GNKA 4BS9A 2UZAA 4ZU6X 1HV8A 1M8FA 1OIWA 1VB3A 2HA5A 3H83A 5IK2D 2BHLA 2HL6A 4PO9A 2V7XA 3C6XA 3C16C 3AKCA 4PC1A 5MHTA 4Y2TA 2WEKA 3W2HA 2HV8A 1YH3A 1B3RA 3K8QA 1I33A 1U2ZA 5BSEA 1TM2A 2P0AA 5H70A 1H3FA 4Q4HA 3V4ZA 4I36A 3G23A 1EGQA 2O7QA 5BUZA 5IARA 1UMBA 1LDBA 3HBFA 3ABIA 2EZ4A 1Q5PA 3ROFA 1YTLA 2OXCA 3H4IA 5JMPA 3SVZA 1JBQA 3H19A 1MB3A 1IUPA 3OQ1A 4A03A 3JQBA 1C8VB 1ZUIA 4G8DA 2HBYA 3FNFA 3DDCA 1I7LA 3GGOA 2JLSA 3KXLA 3ODGA 3UPDA 2BT4A 4LJ8A 1NU8A 2M1ZA 5JVDA 4Q7JB 1ZJYA 3EGEA 3RYCA 3ZCQA 1I3KA 2G67A 5BSWA 1BE1A 1G3UA 2DWQA 5L4LA 4RGQA 1DTWA 4ILEA 2YWFA 4IH4A 3H0CA 3A3NA 5BQ5A 1L5SA 3OQ6A 4R84A 1GRRA 1SURA 4TUYF 2YKGA 3SF0A 1G8JA 3QRWA 1WVGA 3DH0A 2WINI 3BB3A 4R2XA 2FPXA 4RIFA 5CR9A 1C3XA 2NG1A 1E5DA 3BK1A 1YKSA 2QD3A 3OUTA 4MVJP 4B80A 3VC2A 4X65B 1NVGA 2VJBA 4IXDA 2GHIA 2HWUA 2RARA 4WKNA 2Q5HA 1JEEA 5J9FA 5KNBA 4J3FA 5CFPA 1B1AA 1NW9B 1JG6A 2AN3A 3HJNA 3DW1X 3O82A 1CJKC 1U4OA 2IVFA 4I3GA 3OLWA 3PRHA 3G88A 1H22A 4RESA 5G53C 2PKQO 4RPJA 2NYVA 1FFSA 3ISVA 4GQIA 2B5OA 2PL3A 3C48A 3HN7A 3U26A 1FJGB 4RABA 2BDTA 2YWGA 2Y0DA 1A50B 3GFVA 4NTZA 5EE0A 1G291 1M0SA 3WVNA 1J8VA 1TQ2A 4C1NA 1RWOA 1K98A 4XYBA 4OHUA 1M0EA 3N7AA 1ZUD1 1TRHA 1OJLA 3PD1A 4YCLA 4H1TA 4YJFB 1XDWA 4C04A 3CEAA 3JRXA 4BWGA 1NW6A 3WQRA 4NHEA 1P62B 2X8LA 3IR6A 1USIA 3ND8A 4PC2A 3S1AA 5IJZA 1QO9A 1GPAA 1LUAA 2PD3A 4J75A 1C7QA 5EEGA 1XEFA 2N3ZA 1UBLS 3DLCA 1AJEA 4PIVA 4G5XA 2WU1A 2ZBPA 2ZSDA 5DSXA 2VQEB 1FLVA 3AQIA 3PIDA 1WABA 3GOQA 4DDTA 5CJJA 2GO1A 1C0KA 3U3MA 1NNUA 1T6BY 1WS6A 3NDRA 2JVIA 3HB0A 1KK2A 2VTVA 3IAEA 1P9NA 2AG1A 3IIEA 3N2KA 1H1TA 3SMQA 3V32A 4IICA 2Y71A 4KSBA 4JSRA 1Z45A 1XIVA 2XMZA 4XQCA 5D5HA 4N54A 4Y7CA 3WAJA 2GJSA 3ETDA 2IYEA 2J4CA 1XEXA 2DBRA 1U0FA 2ECKA 2IHTA 4KOAA 4UBKA 3WGNA 1GPLA 3RS8A 1P4SA 1VHQA 3U7FB 1CVRA 5EC8A 1RXIA 4MX8A 3HO1A 3FFBA 5TE9A 3HDVA 2VVTA 1PT6A 1JEAA 1Q20A 2KLBA 1NP7A 1YS6A 2OG2A 1PL6A 3FTNA 3ITKA 4LZPA 4YHBA 5KU7A 3OP4A 3T1VA 3BMQB 3THYA 2QRPA 3PCRB 4R3UC 1HDOA 1Q14A 4QFMA 5FUMA 1C9NA 2I3ZA 1WHSB 2BMVA 3I01M 5GV7A 4O0LA 4U9HS 2NPIA 1TYCA 3ODPA 2QTLA 2ZJBA 3WYFA 3DZFA 4KO1S 1KTIA 3OLYA 2XCQA 4IHJB 2RHLA 4RIGA 1KJQA 4TSRA 4W1RA 1A1VA 2R5FA 1ZGJA 1GU1A 1RE0A 1NN1A 4M9RA 3NG1A 4N5DA 1I4EB 1VPLA 4ZVPA 3TKLA 1VKRA 4KYIB 2ZJ5A 1EBBA 1NXQA 2FZKA 4AZSA 1YRLA 3UCFA 2QAJA 3OBBA 3Q40A 4RBNA 3QVWA 4ZAFA 5KCZA 4QYXA 1O6GA 1J06A 3MT9A 5IJ0B 3IPCA 2IXTA 1EPUA 2DQZA 1BIFA 4FI3F 1M1YB 1MF7A 2BFCB 5CCXA 4K6GA 5BMVA 5C46F 3LKDA 2DQSA 2ZRFA 4KREA 4NJOA 3EZYA 1UJCA 4KK3A 2P2ZA 4XTRA 5K9ZA 1H3NA 3DE6X 3MGCA 1JA1A 1GFWA 2BMDA 1W46A 5JD6A 1M33A 1ZHOA 3ML1A 2J5RA 3BMNA 3D7SA 3VZRA 4ER3A 5BWBA 4KWTA 3EZ2A 2FV8A 3GPCA 2QG9A 3GP5A 3NTLA 5EQFA 2P40A 2BEUB 3SSMA 2V96A 3C7AA 4B84A 3BT7A 3VJKA 2RHDA 3W79A 4KFRA 5FR1A 4BNJA 3NIFB 3QEOA 3ZE2B 2IEAA 4KAJA 1F2TA 3UN1A 4KVFA 2IYUA 4ETIA 1A5TA 2PZFA 1Z62A 1I9CA 3L06A 1D1QA 5BQOA 4W8GA 2C7RA 1WZUA 1VKJA 3FZGA 4OHFA 2UAGA 3B6IA 3RT7A 2P4HX 2V7QA 3LGXA 2YNMA 4PR0A 2FEOA 3IOYA 3M2TA 2NXCA 3P5SA 1PR5A 1Q19A 1J8FA 2QIPA 2WJZB 4D81A 3T06B 2A78A 3DXFA 1RAIA 3UJNA 1L4KA 1WQ1R 3DDSA 1V71A 1PHRA 3P0EA 3G9ZA 4LDAA 4EY8A 3X43A 3NB0A 5AHKA 5HK9A 3KOYA 5CM2Z 4Z2AA 3H87A 3DE2X 1M2HA 3AF2A 3OOHA 3IEIA 4LY9A 3K30A 1E5LA 3GJXC 4HMQA 2GASA 4DCJA 2OC9A 4QLOA 3L1VA 2WOJA 1F1BA 3MGKA 3QFHA 4O4HA 3RC1A 3MD9A 1JQLB 4QNMA 3DBLB 3LX6A 1ZOIA 2B35A 3FMFA 1T10A 3DZJA 3GPDG 1T36A 3H16A 3QFCA 2QMZA 1RM5A 3ETEA 4WRRA 3Q12A 2XTMA 4OQMA 4UBMA 3PUVA 2GAAA 4AQDA 3DEKA