1SOUA

Nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
MLKSELRKKVLHKRINLSEEERRRLSEKVISNLKSLPEFKKSKKVALYCPIKGEVDLTPLFPEVLKEKELILPKVEGNEISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRVKGLKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRRLRDGRSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 5,10-methenyltetrahydrofolate synthetase
publication title NMR structure of Aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: Northeast Structural Genomics Consortium Target QR46
rcsb
source organism Aquifex aeolicus
total genus 50
structure length 194
sequence length 194
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1souA00
3HY4A 2JCBA 3HXTA 1U3FA 1SBQA 1YDMA 3HY6A 1WKCA 2G40A 3HY3A 1SOUA 1U3GA
chains in the Genus database with same CATH superfamily
4F4UA 3AVVA 1MCZA 3FRJA 4GM4A 2CXUA 3ROTA 3UEOA 4BO3A 2FX5A 4B7AA 4CM9A 4L51A 4CZ2A 3BHMA 5BV7A 3MTAA 4HPWA 3OOEA 4HRVA 4HX5A 2R6GA 1T6YA 2G28A 4MS4A 2P9JA 2YFKA 3MS4A 1JE0A 1NUAA 1ZKMA 3Q8MA 2JI4A 3U1VA 3GRPA 3FHJA 3FUVA 4O02B 2QJTA 4F2GA 8AT1A 5EHIA 3WRXC 3OO1A 1KDTA 1NJ2A 4L3WA 3RVPA 3V5NA 1ICIA 3B1YA 1L7NA 1MNAA 3CCBA 4IG4A 4ITVA 3SHQA 3F5SA 1SIWA 3UAGA 1XPOA 1AE1A 3ZPXA 3G02A 4BYMA 3K92A 4PINA 4LISA 3TMKA 1RI3A 3BB3A 2A84A 2XQVA 3K8QA 4ZU1X 3U7RA 4DUGA 2CT8A 1UKZA 3N7AA 3HTXA 1Q57A 2B5OA 2L17A 1GA1A 4J03A 4R0NA 5CJJA 2Q4EA 3NWBA 3P96A 5DTRA 3SS9X 4CU2A 5A1TA 3I5YA 1QQBA 1WEHA 3IJ5A 4JR1A 3LHIA 4ZD6A 1WUHS 1XQ1A 2AVDA 2QUAA 5CEFA 2HQ1A 4W5TA 2A1TR 3DULA 1HY3A 2QRNA 4IEEA 3UC9A 2QRPA 1XO1A 2B6NA 2GEDA 2OA0A 4WT7A 1K6EA 1JB9A 2XNHA 3TFWA 4LK3A 1EDEA 3ABZA 3SVTA 5ALSA 2OFFA 1UQTA 2ZUSA 3AEYA 5I7AA 1JR3D 5CH8A 4PAWA 2DFLA 3PTZA 1I1OA 1JT9A 5CHYA 3IQDB 4YB8A 3SWWA 4JZKA 2YJ5A 2F3SA 3LFHA 2QVBA 3HYTA 4TT3D 1U9ZA 2C2GA 2IEAA 3L8GA 2VYQA 4HDSB 1GPNA 1TO2E 3VO2A 2YOFA 2AZXA 2C83A 2FDCA 2DETA 1REQA 2ZZMA 3VR6H 1MO2A 2JCGA 4ZZ2A 1KXJA 5A5GA 2YVAA 1J0XO 2QOEA 4MKFA 4K88A 5L4SA 2KPOA 4F45A 4B45A 4ITRC 1N6KA 5JCJA 4ND2A 2NV2B 1I24A 4XSGA 1ZIOA 2D1RA 3NKLA 1DX4A 3SICE 2CXQA 1JS1X 4CKBB 4KQ2A 2UDPA 5JMTA 2E5WA 1RXVA 4L4UA 3A32A 1WG8A 3K8YA 1LNQA 3LDFA 4D2IA 5AXCA 4ERNA 3K6JA 4R7ZA 1EFPB 3NGLA 4MAMA 1LB1B 3K0AA 2P0YA 3QP9A 4AJOA 4NYIQ 4QULA 5TV2A 3ROEA 3C41J 4YJ2F 4B1FA 1CV2A 1GGVA 2HXYA 2GN0A 2HV9A 2J67A 3OAAA 3VO9A 1TM5E 2DUUA 3T1TA 2TMYA 4E4YA 4JENA 1O5OA 1MBZA 4D6YA 3Q7SA 3RSCA 1BU8A 1H2HA 1X1AA 4KR7A 4IVRA 4G41A 4P3PA 3KQOA 2ORYA 1KO1A 1LC3A 4FYWA 1XMOB 3TEMA 4RX1A 5ALWA 3CRVA 3PGJA 3PQ2A 3HDQA 3LPMA 4IHJA 5BNZA 2YN2A 2QAGA 2QS9A 3BE4A 4AKSA 3FUCA 4BX8A 4FM9A 1GVNB 5AJUA 5H9WA 2JPDA 3BSSA 1FTWA 1VFPA 1QQ7A 2QMQA 4AXBA 3MIIA 3TTTA 1OB2A 2C07A 4R1PA 3JQ7B 1IRXA 4B6JA 2G9RA 2VXYA 5AK3A 2CSXA 4HAWA 3WQHA 1JT2A 3WJ7A 4CRWB 2RH5A 2CLIB 3CTPA 5GJWC 4MEAA 3WB1A 4BWVA 4LSZA 1OPXA 3T7SA 1O95D 3DLAA 3OQOA 1E2LA 2PGAA 1XZGA 1Y0BA 3RVRA 2DY1A 2FZ5A 2VTKA 4GX2A 4MWDA 5CXSA 4DMCA 3MNFA 2QR5A 3WYEA 1KDPA 2ADFA 4J9UE 1ZHHA 1Y9JA 2SCUB 3EXFA 5DN9A 3G79A 3WWYA 5C4MA 1OXSC 4I3HA 5JYDA 2G5TA 1THGA 2CXSA 4XCXA 5B58T 4A0SA 1KJQA 4R7GA 1W59A 3E1SA 2DFNA 3KT0A 2OOKA 4I5GA 4ND8B 4Z6KA 3BYZA 4JOCA 1C7FA 2FGJA 1MIOB 3ZGOA 1JBEA 3P45A 4WFQA 3PJDA 5C4GB 1UWKA 2JAPA 1NMEA 4HUQA 4PE5B 2UYCA 4BP8A 3DZ8A 2WPNA 3AGQA 1IJKA 3F2VA 1JDPA 1KY2A 4GF5A 4NZNA 2WABA 2BMAA 3KOZA 5IJXA 5JFOA 2QZJA 3DM5A 1RHMA 4LIPD 1J2RA 2NQ8A 1XTSA 2MSDB 3DE3X 4CNQA 5E1BA 1XD2B 1GKIA 4MV9A 2A2ZA 2BF7A 2X2EA 3PQEA 4OQYA 3VZQA 1I1HA 3ZDYB 2QVZX 4EHBA 2XDYA 1J99A 3H3FA 4JBWA 5IC5A 5HFNA 3AZOA 3K15A 3WYBA 3D81A 3T7TA 4V1CI 2I4RA 1TRHA 1D6JA 5C0OE 4FFBB 1LPAB 1N2HA 5KNDA 1DWUA 4PAMA 5FLEX 4JI7B 3PP8A 1JPNA 2FEAA 5TMDA 4CWAA 3K2IA 5MF6A 1GFWA 1VJTA 4PW0A 3NBFA 2C2YA 4URZR 3ZDDA 4ZDKA 2TS1A 4WNIA 5D8DA 1XJWA 1SWVA 3WFIA 3DZDA 4EMUA 2B92A 1EGMB 1SVOA 1UEXC 1ZC4A 3IDQA 4U9IS 4BTVA 3BJIC 4AUNA 5FLYA 1HT1E 2JFPA 2VPIA 3DZJA 1PZEA 2X6RA 3PKJA 1I2CA 4HZUA 2ZVJA 3GR6A 13PKA 1GZ6A 2GZ1A 1IUOA 3MOGA 1IWBB 2W0MA 1LRLA 3G2OA 3LQRA 3KQNA 4RMNA 3AONB 3E3AA 3KSBC 4RKQA 4ESHA 4J9VA 4RIGA 1WZUA 1UFOA 4RLSA 3RASA 4A91A 4NDAA 3R7AA 3CLRD 3K09C 4OIFA 1MJNA 1W85A 4DLBA 5JXIA 1DBIA 4IAOA 2ODNA 2TMGA 1TEZA 3ZLJA 4OB6A 4C0KA 3JQDA 2J7PA 5T5QA 1DFGA 1PFGA 5DULA 1UC9A 2KSQA 4FFRA 2Q1TA 4QD3A 3DXXA 2BBOA 4LWQA 3UF0A 3GDOA 1R6UA 3VHXB 4EQ6A 2ZJOA 3RROA 1W75A 4YROA 1S01A 1ENOA 2B69A 1VXOA 1WM1A 4MQFB 1XB2A 2XODA 2ILTA 3I9FA 3RK0A 1YE8A 5LPNA 1IXYA 3WGQA 4YO8A 1K0FA 1YDFA 2FW1A 4W99A 2AN4A 2XYQA 4W7SA 5J3JA 5FX2A 4Y67A 1AB5A 3HZHA 5B3JA 3E5HA 3USCS 1W48A 2J0UB 1VBKA 5EHGA 2CWDA 3V1TC 3FROA 2YVKA 1KOGA 2BT4A 2O52A 2IOQA 1WHTB 5G1NA 3U3OA 5GVSA 3RREA 2HBZA 2ON6A 4QJ4A 1LBTA 1YFZA 3II6X 2OUIA 4YXWD 1CZLA 4GLBA 5IWCA 5K6RA 3FNRA 3D54D 4GI1A 1ZN9A 4D8TA 3HJGA 1E1MA 5IC6A 3SM3A 2PUTA 2Y6VA 4O6VA 4JDUA 1KQFA 1TDJA 4RY0A 5K3CA 3UCFA 1K66A 3DT6A 4MVJF 4WACA 4WTOA 1T8SA 4QYMA 2ZJAA 3ZUGA 2WHPB 2QN2A 3MWDB 2OD2A 4ND5A 4A27A 3GG2A 4XTRA 4AUEA 2C58A 3Q12A 4YIKA 4LX0A 3GT4A 3RTAA 4EL0A 2Y3IA 3F3KA 3WAKA 3MQ2A 4XYLA 1SK9A 1I13A 1NHWA 1JU4A 2ZR7A 1U3DA 3HC7A 1SG9A 3JD2A 1DMSA 4A0QA 1OILA 5LMZA 1DC5A 2BFBA 4MTCA 3FWNA 3QKTA 5T8KA 4JLOA 1JKJB 3ISJA 1R6AA 3FTPA 3OLVA 4K6HA 4LNUA 5E4YA 5I7RA 3K1JA 2ZM5A 3PNVA 1JYFA 2JJMA 3HA5A 1NT2A 1TT5A 3TIFA 4QKQA 4UBMA 3TZHA 2JARA 5MN5A 1KTVA 2FJUA 2XIJA 4II2A 4NATA 2NUPB 2P0AA 5FWDA 1XL0A 4F4CA 5L95A 4LFBB 2FRXA 3AINA 2CLHB 4WADA 3VV2A 5CT4A 1RBYA 3DV0A 3HDTA 3KHKA 1PTKA 3ZHTA 1AV6A 3FF1A 1BROA 1GSAA 1KI8A 1ZXXA 4IMPA 4R5MA 2F1KA 5CD9A 3JX9A 3EB9A 2AFIA 2AQKA 1D7AA 4CLOA 4YA6A 3ICWA 4YDHB 4LF8B 1QPGA 1FPMA 2W2VA 2XA1A 3I1YA 1N1GA 4YRKA 3GBPA 2G71A 1YF3A 3VX3A 4YUAA 1G0OA 1XXHB 4OJMX 3GJ0A 4EIWA 5BURA 1YONA 4JMLA 1IIRA 1NRIA 4W63A 1L8XA 2FWPA 4Q4CA 2V0GA 4OXKA 4EJMA 2VNSA 3WGYA 1H0SA 2QD3A 5HQ3B 2BF4A 4NNPA 4D3XA 2V0NA 5JRJA 4P0TA 3M3DA 2C7QA 2P3LA 2F90A 2ZGVA 2PE5A 1XPUA 2HU2A 3D0KA 1NZFA 2Z1DA 3D5TA 4WLVA 4P80A 4C22A 4C7MA 5JZMA 1PJTA 3KOMA 4NMWA 3EZ7A 1MNQA 3P9ZA 4PHFA 5HIIA 4I4NA 1WD5A 1IQ0A 2HSEA 4AAYA 3AETB 4NZYA 4WN9B 1XU9A 1Z6YA 1CZUA 2JB9A 4FMCB 2VN8A 3AUSA 2CDRA 4PO1A 4Q9AA 1Y8CA 2Z2YA 1S9DA 4ZVVA 5K6AA 5D1HA 2XT6A 3GRYA 2NSLA 2C5GA 2OHFA 5IJ0B 4FDUA 2OCLA 2FWJA 2P2SA 3IAM6 4AJ4A 1XV5A 2JFXA 3GPLA 3ET5A 1Z4QA 2Y67A 4OV6B 3MCZA 2VRNA 2VJYA 3MRSA 4Z4IA 1I4TD 3JQBA 4GG1A 4YGXB 4EMTA 5ABPA 4MMXB 1TM7E 3KJHA 5I9LA 4TZ0A 2IIPA 3NBUA 2B7LA 3OPNA 4GX5A 5DWVA 1TZCA 3QM1A 3Q3GE 3MWEA 4OGKA 4R8SA 4BNKA 5IUJC 1EE1A 1KO8A 4DV0B 2BW0A 1NRWA 2IH2A 2GD0A 3L0OA 2NLOA 1S02A 2GQ0A 3L93A 4YAJA 4BGEA 4E11A 2KW5A 3KZOA 3COYA 4P4SA 1DRKA 1K06A 3SMVA 1THZA 4JOSA 1XU4A 3F49S 4ARCA 5F9HA 1FX0A 3AV3A 4YR7A 4HLDA 1BVHA 2HN9A 3U4QB 4Z51A 1XZMA 1OLXA 1AMUA 5ALLA 4ABYA 4CUKA 2GFHA 3K96A 1UXKA 3BREA 1N5LA 3VI3B 1X77A 2J3QA 5DV9A 1L7PA 1OYVA 3WGLA 1C2TA 3OCJA 1E7RA 2PMKA 1NVXQ 4OLFA 3WDKA 2ZTUA 3NJRA 3HXKA 3G0DA 1N8TA 2WAAA 2ZTHA 1G20B 4N6NA 3LCUA 3U37A 3I9LA 4DCVA 2EIXA 5LNK6 1QXSA 4I36A 2H0QA 4HQFA 1NUQA 5FYQA 3IEVA 4OXQA 3PGA1 2I65A 2JD2A 3MCWA 4TT8A 2G25A 4BNLA 2O8CA 3JTMA 4M8NE 3L6OO 4IFIA 3GFFA 3K1AA 4IIUA 1Q0QA 1P2DA 2JZOA 4K9RA 4OHMA 4F72A 1PQ4A 2VJPA 5EUQB 5H4GA 4ZI7A 1V7PC 3GUUA 3IGFA 4IH9A 3UWPA 3A9VA 3A10A 1TUGA 4G1VA 4KE9A 3LKVA 3DTVB 3STWA 2JAOA 1HTTA 1SKYE 3BEDA 1FUKA 3SQMA 1CDDA 3RTDA 3K3PA 1X8KA 2I0FA 2JIDA 3IP5A 3ZXIA 2B8JA 3CS3A 1F8XA 2DF8A 2EL7A 3DF7A 2BGLA 2J3JA 4PF1A 3D3KA 1AB6A 4EHJA 1OZHA 5JEEA 1YHYA 2F43B 2FRDC 3N70A 4WAUA 5B7QA 1ML4A 1AURA 1IXKA 2QYTA 1UBSB 3L7OA 2V6IA 4IJKA 5CT6A 4RTMA 4QQNA 1X9HA 3BD9A 2QLNA 3D3WB 4WIAA 3UJ9A 2EKDA 1J8MF 2KI5A 2RGXA 3KXPA 4K6OA 3LT5A 2W98A 3H5NA 3P20A 2IY9A 1A9SA 4E4TA 3SR4A 4QGHA 2DB3A 1ZMRA 1BHO1 4G67A 4Q1FA 4QXOA 4YRFA 3H9GA 1KO4A 4UUAA 4S0XA 4ZYYA 2QRJA 3E7FA 4KLAA 1VI5A 3KEOA 1RLJA 3L06A 4KITB 1G64A 1PGPA 1U2PA 2CKDA 2E18A 2Q6KA 4LJ7A 1C3XA 3EGDB 4POOA 1Q7CA 4ZYZA 3HE3A 2NVUA 2NO7A 1ZOSA 2B37A 3MT7A 1SUDA 2HY7A 3DEHA 3QOYA 2DHEA 4FSDA 5A5FA 3PWSA 4P8RA 1H9AA 3DA8A 3QX7A 1IK6A 4G0OA 2POCA 4M60A 2QD4A 1SCUB 2AG8A 4YJGB 5BR8B 3JV7A 4BVHA 4QDXA 3SC3A 2X9VA 3EMBA 2B9EA 4P3KA 4BVKA 4D02A 5KSOA 4JITA 4ZA2A 3B89A 5DNDA 3I52A 1XLTC 5ETJA 3UFXA 1IXSB 3CZ4A 1AKEA 3Q98A 3M34A 4LCBA 1GYRA 3ZE2B 2KWIA 2RHRA 4X85A 3PXGA 5KJ1A 4PQRA 3W3AD 4MROA 4LA4A 5JH7A 1ZJ6A 1MORA 1Z4IA 4KPUB 3WWPA 2NIPA 1AXGA 3D6FA 1C1DA 1PR4A 1XZLA 5DXFA 3ONEA 4KWHA 5AHRA 2N1MA 1E60A 2AUMA 3EIQA 3F7TA 1XZBA 4A6EA 1F7VA 2DQ4A 3H6HA 3LZDA 1JX6A 4FFVA 4UASA 1MOPA 3H6GA 1K88A 1KY4A 3D7LA 1WSWA 3PHHA 1UH5A 1UXGA 1ZY2A 4ISBA 1EESA 1F1JA 4MTLA 2QX6A 3KB8A 1P91A 3PWTA 1E2EA 4KWIA 3N8IA 3U31A 1ZEJA 3FFBA 4BNTA 2ZKLA 1XLUA 5HYVA 4MUIA 1SJ9A 4QVIA 5KREA 1MVLA 4O1IA 4RUKA 4W9MC 2JHAA 1DAFA 2PUVA 2ZRQA 3WOVA 3AERA 2I66A 4FBMA 4W7IA 1W52X 1WXWA 4YAFA 5DLYA 5A4AA 4IJMA 3A9SA 4HNRA 5E7IA 3FUUA 4FI3F 2ZYUX 2GZAA 4GWGA 4ILKA 3HV2A 1BS2A 2EWWA 3NV7A 4OQ4A 4Y6LA 1Q1QA 4INJA 1L0BA 4D9EA 5JDCA 3RS9A 5KKNB 5HGXA 4PLHA 1RPZA 1HRKA 1KI6B 1GKUB 4MR9B 4PX2A 2J32A 4EB8A 1SC3A 3H42B 3M3HA 3OZIA 4JBHA 1TMOA 2G0TA 3LHDA 1DAIA 1T4GA 3DTVD 3NDJA 3NLLA 4HYEA 4NBRA 1ZG3A 2XBMA 1I3MA 3ETDA 1ST2A 1NI4A 3EAGA 1KEZA 1XCGB 2EP5A 2JJ2D 3FPGA 3TRIA 2L42A 1E6KA 1JIUA 2P8JA 4XD2A 3VYRB 3AHDA 4R4JA 3NEJA 4MYSA 3W79A 5JTTA 3DE4X 5KWIA 2FQYA 1IUKA 3ILXA 3IRUA 1LXCA 1DBRA 3B7WA 3WB0A 1N36B 2SNIE 4DQKA 3HFRA 4MQ6A 1XDGA 1H2ZA 3K16A 4U2GA 4KODA 1V6SA 3AHCA 4WDQA 3ROFA 3K2QA 3SJCA 4F86A 1PJ8A 1SRRA 1IDN1 4C7BA 3O8LA 4IH1A 4KFCA 1ZK0A 2APJA 3FWPA 4MO2A 4WVLA 3SS8A 3RU9A 4HQKA 1AHPA 1G8SA 4ND6A 5KYXA 3WKEA 1ZZEA 1XFAA 2I2XB 2V3WA 2GPWA 3UJPA 3ZK9A 2BFAA 4HAYA 4D4GA 3S8YA 3KWFA 2HK6A 1BXGA 2WT8A 2GAAA 3IHKA 3D8TA 3BQ9A 2O6LA 4FHGA 2CDNA 1E66A 2A9RA 3ETNA 5DNAA 3TG8A 2I67A 4BB0A 3EEFA 4ENTA 1CHDA 1TCAA 2QD2A 3PKZA 1MC8A 1SU7A 3H87A 4ZT7A 4OUKX 1ETHA 2HDOA 1MJGA 4FQ5A 4KBYA 3LXXA 3NT2A 6PFKA 2EQAA 2AS0A 2M9MA 2VPYA 4O0MA 3VU0A 4Z7NB 1CRPA 4ZI7F 3SZLA 3GZNB 4DVGA 3BWEA 2ILVA 1UDRA 3QZUA 4PLCA 4X71A 2WNSA 5EP3A 3TF5A 2X15A 3RF7A 3NM5A 3PR1A 1DX9A 2ESRA 3AV0B 3ORSA 3GEPA 3PZBA 4PXAA 1RWVA 3OZXA 1P7VA 2D62A 1AD2A 3PFGA 5BQ3A 2DE0X 3KKEA 1VJRA 3WK4A 3IVAA 1Y6ZA 4YJKA 4MR8A 2VDMB 5JAZA 2YMLA 3EEIA 1L4YA 2IY7A 3IVCA 3WYDA 4BKMA 1QIDA 4ER0A 1V48A 3BIWA 2JLVA 5JT1A 4EA6A 4Q3BA 4IQGA 3F3MA 3EUFA 3DR3A 1IN5A 1KI2A 1E79D 4UFOA 4LV6A 2HU7A 4E1BA 4ZVPA 4DCUA 1RKUA 1W87A 1EMDA 1P1IA 2Y0EA 2NZXA 4S2EA 4MGHA 5D51S 2FH5B 1ZH2A 1JPVA 3DJYA 1P17A 2Q5HA 3RUPA 4YFVA 5BQFA 1IEQA 3PF9A 2J09A 1D04A 4ZGGA 3HP4A 2WP8J 4UQOA 1B4DA 3K73O 1VDMA 1KOJA 2AQHA 3AVYA 5EQTA 1WV0A 5DH9A 3AIMA 1L7RA 2A67A 3AJRA 1ORTA 3NC0C 5F33A 4DBVO 2OYRA 5BUCA 1G2QA 2HGSA 2GKSA 1VL5A 3F7NA 4UMDA 3ICCA 3WBJA 5B6JA 3DE2X 2XQFA 5J2UB 4HD8A 1GRRA 2VATA 4JNCA 3NVKI 1DKPA 3EGIA 4PLPA 4EM6A 3P1JA 2O2JA 5TGDA 3L7KA 5MFPA 4H18A 3GOQA 3K5IA 4LGYA 3AUUA 1UPAA 1WXFA 1X0XA 1G21B 3DFZA 4CLDA 4G09A 3WQSB 5K0CA 2OWDA 1C41A 4B43A 1E58A 2IYRA 4U7TB 2CCKA 1Z0FA 3CM0A 4TKVA 3C5EA 1DRWA 3HVKA 3DDSA 3ENVA 3IAXA 3OHMA 1Z34A 3GDHA 2BHTA 1G8KA 3C8MA 3D7SA 1E8DA 5CYOA 1JNXX 3LVRE 3N05A 1OIWA 3GNQA 4MV1A 3AFHA 1B76A 1DQZA 4ZEWA 5C53B 2AEEA 1IAVA 3KQSA 3LM8A 4MKIA 3C3DA 1PYGA 3OX4A 1NVEA 2OTCA 5AH0A 1IEXA 4EGQA 3ZKWB 1NQOA 5HKOA 2D1TA 4G63A 4IP0A 4LXTA 4HQOA 4A82A 1TF7A 1CIVA 1LSOA 1E2KA 1P3DA 3DZGA 3FKQA 4BUJA 3QELB 1M8JA 1SKAA 1X1BA 1AG9A 4MUXA 2PO7A 2R9VA 4X97A 1IHPA 3HJTA 3K6SA 3U7IA 1Y7TA 2ACWA 2D2XA 2R8RA 3A9TA 3KV1A 2ZRFA 5DWQA 3VMFA 3D8HA 5JCXA 10MHA 4R8RA 4Y2GA 2WQ6A 3W0LB 1WSDA 3AJ9A 1YD7A 3DLCA 3KQQA 3PNQA 4LHZA 4NOJA 5CT8A 4C7JA 1ZLYA 1W6UA 2JHFA 1GG9A 2CHVA 3CZMA 2FW8A 1SU8A 4M8IA 4MIEA 5K4HA 1NVDA 2AV6A 2RAFA 3EQZA 4N5NA 3AX6A 3ZI0A 3MQ4A 4ETMA 2JLSA 1DIOB 1GZHB 2FEPA 3TQSA 5JJCA 1EFRA 1ZMBA 2IJGX 5AW3A 1FTNA 5E1MA 3UIEA 5LJIA 3L92A 4IF6A 5F7OA 4PAGA 4TUYA 2OK8A 2FPIA 4KLZA 2ZS8A 3G9QA 3N2GA 2JDID 2AFHB 3QFSA 3R0VA 4EBBA 4LCJA 3EPKA 3KKPA 1T4CA 1KORA 1W2WB 5DWDA 5EMJA 4RK0A 3FOEC 1TKRA 3AYXB 1IY8A 4QFMA 2YR0A 4H7DA 3S0JA 1RSZA 2QX7A 5A4JA 4XYBA 2ZBDA 4AO8A 3EPRA 1N6RA 3FVQA 3HA7A 3QU7A 3RRNA 4GLJA 1OBFO 3C3WA 1XKQA 3L8FA 4ZC1A 5KIAA 3C3KA 4XGKA 3GLIA 4ZWNA 1WV1A 1J8YF 1X2EA 3DB1A 1XMSA 3C1OA 1YVUA 2OPBA 1MC1A 1E59A 4IBOA 3GU3A 1ZI8A 2R8EA 4WEQA 1AV7A 4M9ZA 5FOTA 4HUTA 3KVYA 3OICA 1N7GA 2O2SA 4KE8A 3SXUA 3I42A 2QIOA 3SLGA 5AJXA 3ZDBA 5E3IA 3UV7A 2XUZA 3DFIA 4N39A 3PLRA 3L41A 3UATA 3X44A 1KYVA 4DWVA 4BEBA 4OSPA 1KYTA 3EGEA 4K2AA 1Z22A 5GV7A 4EAQA 4D9BA 1NIJA 3O4RA 3W3ZB 3WB2A 3P52A 5C1PA 1ZD5A 2HZ7A 4B6GA 3NNSA 4FU0A 1FYFA 3DM9B 1P2GA 3P8ZA 3P9IA 3PPYA 1SKQA 1DEHA 1UBJS 3E0XA 5CTJA 4U3JB 1OX4A 3FPAA 4PSVA 5LP6C 1ADGA 1UPXA 4KHZA 3G9XA 4ILEA 3ND6A 4PZEA 2B99A 3R3ZA 1GZSA 1PT8A 4JASB 4FNMA 2BJHA 3MVEA 5KTRA 1YFLA 1LPMA 5HNKA 3QX3A 1JI0A 1PJ3A 3FMGA 4HDQB 3IV6A 3L0PA 4A5OA 2RCNA 1ZRHA 4I8XA 5ECYA 3GFBA 3PDJA 5G4LA 4O4IA 2FSFA 3FYSA 4UDYX 4XGIA 5TQ0B 3LXMA 4B3BA 1L7MA 5CFPA 9MHTA 3PI7A 1SQGA 1CY4A 3VAAA 2QRUA 1QGOA 4HDKA 3QVMA 1MRZA 4KIJA 4LYYA 4AJ1A 3NU1A 4B33A 4B3XA 4AUMA 4US2R 3IAFA 3OMLA 1NYRA 3V8EA 4LGVA 4P7FA 1X1QA 4JHLA 4R31A 1DX6A 4JFAA 5K1ZA 1R0XA 2Q3MA 4GBMA 2A5YB 3RIHA 2X9QA 3O83A 4RESA 5L3SB 1XEFA 1XTKA 2WWTA 2WIDA 4EBFA 1GQQA 3I1JA 4NCNA 3RC1A 3O4HA 5ICEA 2QN7A 4MRRA 4YACA 2ZRDA 4L50A 5TGTA 5FEUA 1BTOA 3AP3A 5GJBA 2QG6A 1JL3A 2E87A 4WECA 4DLPA 2G80A 3O0TA 4QHSA 3R0XA 2P1ZA 4N7BA 4S1VA 3Q0TA 5JCOC 1TI7A 1Z6PA 1U9JA 2FUG6 2GNPA 4X93A 4XUEA 3D64A 3UANA 1U7PA 4EKEA 4IRMA 3OFVA 4XQGA 1E99A 1P2BA 2YL2A 3BF8A 2AW3A 3EH1A 3TX6A 3QXJA 3JWGA 2QSYA 2W6PA 4DA7A 3V8BA 3QKRA 4HNSA 4JJ4A 4D9FA 4RA6A 4RAOA 3CT6A 3UM9A 4ENUA 1OZ0A 4F4HA 3LC0A 2B0JA 3THXB 2QYHA 4REOA 2AJCA 3G2JA 1E5TA 2PV7A 3BB1A 3X0DA 4H6WA 1EX1A 5TT0A 1O87A 4JLNA 2QY9A 3G2HA 3OT1B 5HF8A 3DG9A 3DHVA 4QU0A 3EGOA 3RTCA 3W5BA 2FF7A 3KLMX 3C8ZA 2V4ZA 3BWYA 4TXJA 2WU1A 4JMPA 4PG8A 2DR2A 2JVKA 2MR6A 4OREX 4TSFA 4EW3A 1H4QA 1SQSA 3EDRA 3IQXA 2BP7A 1KAHA 2JLBA 4V0ME 2EGHA 3GO4A 2AR0A 2BLLA 5E6UB 1Q11A 3WL6A 2NAFA 3AR5A 2CDAA 1CUAA 2PUDA 4DJEC 1BG6A 4HUQB 4M0EA 4V02A 3V55A 2IL1A 1SC6A 1P4RA 2RGDA 3N2ZB 3PC8A 4QNMA 2NQTA 2WU0A 1L5KA 3RVSA 3UMCA 2XCRB 4EB6A 3IBFA 4JLVA 3G85A 1XZFA 2JGIA 4ALLA 2PRZA 1JIQA 1U2RA 2HAEA 4LJ9A 4RHXA 4PGGA 4EZBA 4IIFA 1YU9A 4GKAA 1YBFA 4BGUA 4DDWA 3WMEA 3A4VA 3ANYB 3F8WA 1NF9A 5IKEA 1Q22A 4L85A 4UD6A 3KPJA 4DJAA 1UFQA 1UJ5A 4BJ6A 2GZ3A 2RIRA 5EN4A 4LGCA 2Q2QA 5JSUA 1FRZA 5AT1A 3STVA 1E89A 4Y6RA 4ZAFA 5SY4A 4YMHA 1DIRA 3ITNA 4MYCA 2WYVA 1EU1A 1FVOA 5K3OA 3UJDA 1LBIA 2Z5VA 5I5GA 2OKCA 3F9IA 3AZPA 4S1WA 2VF7A 4JJZA 3D7KA 1GGJA 3FVWA 3KSMA 3IIEA 1GTJ1 3QWHA 4OB8A 1RRGA 2XMPA 3HJUA 1T9AA 1WW3A 2OE2A 3GUYA 4TUYF 3DHNA 3KOYA 2UZ0A 5C7IO 2I6QA 1PAUA 4UNQA 2AZDA 2OV4A 4C0LA 1JA9A 1X7XA 2HRBA 1T35A 4HZUB 1RE0A 3ROQA 1NYQA 2WYOA 3AIOA 4JB2A 1GO2A 2JLZA 4MVJD 5ESWA 1QG6A 3I23A 2QLFA 3ZU6A 1KP2A 1C1XA 1T2EA 3U48A 3ABRB 3PBKA 1Y5MA 1L7XA 3FI0A 2RHTA 3LL7A 2WV9A 3OJXA 4JFRA 4R1OA 1HZZA 1H0HA 4ZRNA 3T3GA 4A1OA 4B3TB 5GV8A 4AYXA 3GOHA 4ZODA 3RIMA 4KIUA 3OTGA 3GWGA 4J6FA 1O58A 1K5PA 2OESA 2DC1A 5DTEA 1W85B 2CSUA 3A14A 4HAZA 4I1OA 5KJFA 2I6TA 2FOLA 3B5EA 4K8RB 5ITWA 1J1IA 3LFUA 3SJAA 3UAOA 2V4MA 1P1BA 1QNLA 5CA1B 2A86A 2CNBA 2UZIR 3DFKA 3E9MA 3WHLA 4ETWA 4EUHA 1SC4A 3G89A 3RVLA 3TBKA 2WJPA 1ORVA 2PMDA 3HXPA 5CK5A 5FUVA 2BEUA 2AI3A 2VQSA 1B0UA 3D0QA 3DOIA 3ILYA 3M6XA 3DCYA 5FNVF 3GMTA 3O94A 3JZMA 4DKJA 1U28C 3ZNPA 3C6BA 3U4HA 3PQ5A 4GOOD 4WINA 3DMPA 3QVUA 1WZNA 4URUR 3BXXA 1MAVA 1RABA 1RMQA 1QRAA 1RRPA 2P4SA 3N5KA 4Q16A 4Q9HA 4R2MA 3PC7A 4UM9B 3R5SA 1U6IA 2BR5A 2OLEA 2QTWB 5L3ZA 4UNSA 5KYUA 3FPJA 3L7LA 5ES4B 5JD3A 3U2QA 3I34X 1CBUA 3B5JA 1X87A 2XDAA 5IXJA 5KB3A 2R1VA 3E9CA 1FXWA 5LQUA 3MIZA 1IC6A 2QN9A 4O4IF 2Q6TA 3KT8A 3PIRA 4N3CA 3TVDA 1YBHA 5K3DA 4BKOA 1CRQA 3B3QA 3CLSC 4G5GA 1EFTA 2W6JA 4NF2A 1P9OA 4FKMA 3TIVA 4D96A 1V5FA 1PSZA 2HIGA 3HVUA 4NZPA 3O1LA 1C9JA 4E14A 2MYNA 3NIFB 1AM4D 4B0OA 2VA9A 1HTWA 1NA5A 3MS7A 4DLRA 5K8LA 2O0LA 1XQWA 5AD1A 2FP4A 4OATA 4OUDB 2GBGA 1E69A 1Y1TA 3IHLA 4MW2A 1V4VA 2OCIA 3OVMA 3TZ6A 3U4DA 5CLJA 1AKVA 1N2EA 2NTNA 4RJTA 2LDXA 4XIFA 1YZYA 4BFUA 1KJNA 5LP1A 3IPXA 5KNDD 3IQEA 3P2JA 4PPFA 3DDWA 3PTAA 4P93A 3IPRA 5JECA 1R6DA 1SUBA 4R2IA 4V0KA 2LIPA 1KEPA 3IEKA 4JC4A 1XAHA 4L95C 3WADA 1XNQB 1MAWA 1YQUA 5EQFA 5AHWA 1K68A 1KMCA 1DL5A 4XD7A 1G55A 1FDTA 4PZDA 1P8AA 2Z5GA 5G4KA 5EIFA 1I3NA 3ESYA 4G5RA 3TSOA 4NCAA 1F2TB 2ZIVB 1SBHA 1BKYA 3FKSA 4L57A 5BRNA 3G68A 1JQJC 3WKAA 1W0KD 3CCCA 1RWNA 4FZ5A 3IDAA 1SD5A 3RRMA 4LYGA 3SIWA 4F2PA 2H3HA 5A2GA 5ALVA 1JDJA 4J91A 4RYDA 3MD9A 3PD7A 3V1LA 2B7BA 3CLTD 1RI4A 3OTHA 3SHTA 2B5VA 2JAQA 3R0JA 3BRCA 5KYNA 1MEEA 5AW2A 2OXCA 4WERA 3W3AH 4WXYB 1BKDR 2YHSA 3DWFA 3L1JA 5THXA 5B30A 3ZWNA 1YR6A 4KJXA 2OV3A 3T5CA 1GPDG 3PR3A 1IBKB 2HSWA 4YT2A 4AF6A 1IONA 1W46A 2O0MA 2X8WA 3HN2A 2CLFB 2ENUA 3I01A 3GPIA 1JHZA 3KYCA 4R41A 5TLSA 2XWPA 3CTMA 5MN4A 4R1SA 3FTNA 1GYQA 1E1RD 2C7VA 1U0SY 3H2BA 2ZR0A 4XRRA 3BK7A 5ENZA 1T36A 2ETVA 3HU2A 1NXOA 1R9GA 3SQOA 4HEJA 4E12A 4BVGA 4QDJA 3NHFA 3SAJA 4TMYA 2ET6A 3DTTA 3PUZA 1YC5A 3KVRA 1HFWA 4UM9D 2P2LA 1PUXA 1F6BA 3GJ7A 3RRJA 4AWBA 3J81A 4MW1A 4LK2A 1L1FA 4CEHA 3W8DA 1FW8A 3WHPA 4Z1OA 5IJ0A 1NX6A 3LDUA 2C3YA 1U0NA 3T95A 3COJA 2ZBGA 5DM2A 1NFFA 2AMFA 5F3DA 4DBLE 3PNYA 2HPHA 2IZ1A 1FSGA 4LJSA 1Y1RA 3NPMA 3MWEB 2WD7A 4F9FA 4NXNB 1YMUA 3P26A 4F6CA 1JLSA 2F3QA 5EWMA 1JHDA 4PONA 5EJAA 5HF5A 5ERXA 1RYFA 2WJYA 5E2AA 1IB0A 4M89A 2EP8A 2JVIA 3STHA 3BXGA 2ZUUA 3IUNA 3JD3A 4GW3A 4DBLC 5KTOA 3H8WA 1P7YA 1E9SA 1VHLA 1SB9A 2EFHB 3DDZX 4FEEA 5I8WA 1B3RA 1NQVA 3TVTA 1FVHA 4XJSA 1K63A 1R16A 3IAEA 3OCWA 3SYLA 5HHTA 3ZJUA 3W77A 2NO6A 4NYMR 3EXHA 4X1KA 3WLRA 2O1XA 1Z63A 3D7NA 5ILOA 3C3MA 4I4TA 4P4TA 9ABPA 2CXNA 3T9BA 1TA4A 4DDMA 4KQIA 2H4XA 1GSHA 2OBNA 3VTFA 3GLIE 1O6GA 2GESA 2RH9B 3IP7A 4JL6A 3SJUA 4DSUA 4AY6A 4AYTA 4TWRA 2J8ZA 3WGTA 2AH5A 4EVSA 4N41A 1E2UA 4CW7A 3WA6A 2ZJ4A 4XI9A 5H1YA 3WQRA 3P32A 2B4QA 2Q21A 4RYLA 4YMGA 4DE5A 4WH0A 2DGDA 2OORC 3PJFA 2ZUBA 1N32B 2G7ZA 2Q5EA 2XKAA 2IPOA 1H3FA 1U8TA 2CHGA 4CIXA 3FGOA 3D6HA 4X6UA 3IEPA 5K51A 4C2UA 2JATA 5U9CA 5IAGA 1KSHA 5KTSA 1RAEA 2CFIA 2NN3C 3ILSA 4W8OA 3GV0A 5F7ZA 4JKOA 5KAMA 2G7MC 2AJDA 3PXEA 2O8CB 1U5AA 2ZEJA 2I3BA 4ES6A 4ER3A 2XRZA 5L7TA 1E6MA 1T5DX 3ICVA 3L8YA 2CMGA 1FXWF 3OEEA 5KSPA 3OETA 3NVDA 2WIAA 4LCEA 4BY9E 4EJSC 3V8RA 2ZJZA 4MUKA 3KETA 3RTGA 2CLDX 2RC6A 3LSTA 3ORFA 1JQ5A 2ORIA 2WTAA 2D3WA 4C4OA 4Q1CA 5JAUA 1Q16A 2CLCX 4B4OA 4KGDA 4BL5A 5I4CA 1BA2A 2OHJA 3SVZA 2FZGA 5BOSA 4DR3B 3R7SA 1QDLB 3RT1A 3BG5A 3PKIA 2J3EA 4YJHA 1H8HD 1JAHA 1NOJA 3AKDA 3P94A 5CD1A 4C5BA 2BE9A 2C4VA 2CUTA 1Q7RA 4P4NA 1A9TA 1W34A 2DBQA 2HBRA 1SZJG 4DR2B 3OKCA 2R5WA 3F6RA 3QVVA 1E9AA 1YUNA 2NSYA 5DHUA 3R8XA 4UUMA 2PUAA 2B7CA 2V7PA 4HI0E 4PO9A 1YS2X 4BO4A 3BMQA 3HUEA 2WZBA 1SHZA 1NVVR 1NW3A 3AEUA 2YHUA 4Y2UA 4C4SA 4WCFA 5CLGA 1W73A 4HEHA 2DUWA 5ICGA 1VJ1A 5ALGA 1EVLA 1OFUX 1C0IA 2R6HA 3IXQA 1IQRA 4XB1A 1JIIA 2PD4A 2I7DA 4HADA 2BFCB 4YMWA 5IKOA 2ZJ3A 4RWEA 4CMIA 1E94E 4TVOA 5CYFA 5J9FA 1U2GA 1XFDA 1E2QA 3HLKA 5JDIC 4P0PB 1E7MA 1HTBA 2C31A 2WKPA 4XJVA 2WWYA 2N3ZA 3EULA 4WBNA 2OP0A 3H9UA 4E5PA 2ONKA 2LD4A 3CZAA 5FTKA 4KRGA 1C0KA 1M2VA 1WDTA 4U6QA 2ZYDA 4BEVA 1HYBA 1Q7BA 2NW6A 1D9ZA 3HM9A 3HVIA 4MWOA 2JK1A 3AR9A 4BV9A 2C77A 3VO8A 4D1YA 1M10A 2RAUA 3CNNA 4MRMA 2EWVA 1MH1A 2B9VA 2FZ4A 1X1CA 4F3CA 2IS4A 2Q9AA 2B1QA 1GN8A 1F2UA 3DZBA 3AVUA 1XTBA 1XEXB 2PKQO 4H15A 5IJ9A 4BLPA 4YPVA 1WNTA 1UADA 1NMZA 1NLMA 1NYLA 1O94C 2AG0A 4FIDA 3IIKA 1W581 1Z06A 2HBYA 4EFMA 3JYQA 1CR4A 1GCUA 5E4FA 3NJ4A 2WVJA 1YO6A 3CRNA 4W4TA 1CKEA 2Y0DA 4N5LA 1TQ2A 3IVGA 1U8AA 5TEVA 1AS2A 2VJBA 1FSFA 1B42A 2YWBA 3NH6A 4HLNA 4QBIA 1E2GA 3VU8A 3VA7A 1JPUA 3OU7A 1P7PA 2YWHA 2RHMA 3KPUA 1J56A 1KNXA 3MLBA 1ZLXA 2EVWX 2J3KA 3PC8C 1RADA 1P0QA 3I0NA 3KE8A 2BBWA 5AQ1A 3DOFA 2RKBA 1XWWA 3RSGA 3OWHA 4RKFA 5BYJA 1BRTA 3Q5EA 1QVVA 3OZGA 3TFQA 1I32A 1WDWB 3PRJA 1MKYA 3ZD6A 4WOKA 3TM5A 4JODA 5KKAA 2EZ8A 1SG0A 4DG5A 3V3KA 3HCFA 5BNIA 1FYXA 3LF2A 3JVIA 1YH3A 3OUTA 4HFNA 3VMMA 3KTDA 3MZ0A 2BDEA 3WYAA 5H9VA 3H1GA 3ORHA 5BYAA 2HWXA 4JJIA 4YMTA 1OU4A 3AR3A 2C03A 5K3BA 4A8HA 4GIBA 3ADKA 3AOEA 4E2WA 1GUDA 3AL2A 2FK7A 3G2NA 3Q0EA 4I4TF 2GPJA 5IYZB 4FMDB 3SVLA 4ZK2A 3GLHA 1NJ5A 2BMWA 4IEIA 4YGYA 3V4OA 3ZHOA 3EQ7A 3U09A 1VPWA 1RQGA 3MLAA 3CO0S 3U26A 5DCUA 1YRBA 4OGWA 5FA5A 1ZSVA 1NM5C 2QUIA 2V5AA 3G0HA 1PLLA 2PQ2A 4AP6A 4Y2TA 2G4CA 4QZVA 1A9PA 2OV8A 1VPTA 2X8BA 5AK4A 2XJ9A 1BXGB 4K28A 1K3FA 1QIJA 1KI9A 2E4ZA 2IXEA 2IXBA 3ASUA 2JK0A 3DAPA 4IJ5A 5DCYA 1PLJA 3F9CA 4CQNA 2Z6AA 1GUBA 1Y3AA 1Z6GA 4P4GA 1N3LA 4ATNA 3JU3A 1YR9A 1XRNA 3PEVA 5B36A 4C7VA 4CV1A 2HX1A 3NHLA 1BGXT 4QPZA 1P80A 3DMGA 3NBYC 3R8CA 4AZWA 3JYHA 3ZZMA 4H1WA 3LBIA 4CIAA 1RPAA 1J0BA 1LQTA 3OBIA 5ESDA 3RU7A 4D0GA 1CZKA 3DD5A 4KAJA 3RYFB 5L3QB 1JG7A 4B8YA 3KHSA 4RMIA 1I3LA 4LYAA 4OO3A 1NVUQ 4EG1A 4YR9A 4JI2B 2OP1A 3PA6A 2YNMA 1D2MA 2YV2A 4QC2A 5EUBA 3OIGA 2VJLA 3VC2A 2A1TS 3BWMA 1RRKA 4MR8B 3O92A 4IXWA 4ZHQA 1OIXA 1SIUA 3I3OA 2QVXX 4E46A 2D00A 4BIMA 1QV6A 4F1WA 1BWSA 2GOYA 1DEOA 1KJIA 4F8JA 1T3ZA 3BTUA 3FGPA 1ZGCA 1W5EA 2G77B 1E6LA 5F35A 4AKTA 5JMWA 5CA0A 4ZT4A 3FWYA 3GJSA 3P9YA 4U5XA 1Z29A 2ZWVA 4JOQA 1Y63A 2Y77A 1W4RA 4UUPA 2WU4A 4WY5A 3QMWA 2WUEA 1QRRA 3GUZA 2B36A 3TPFA 3TLBA 3Q41A 1W88A 2YOGA 1DQRA 1Y7IA 1Y1QA 2YC4C 4WESB 1RQLA 5KVVA 1M9NA 1EFAA 3L49A 3R0QA 2B4AA 3IKJA 5JBIA 4GBGA 4M1KA 4AY4A 1N3YA 1G2OA 5FLKA 1M74A 2FZKA 2OGZA 2WFLA 3WMFA 3ZCVA 5A6SA 4Z53A 3FOBA 4L8WB 2RHJA 2ZJ1A 4ID3A 4DIBA 4WBNF 2YYYA 3CUTA 4NV0A 3T5PA 3CFYA 3DFMA 5IW8A 5FPQA 5JYCA 1NSTA 3DQQA 1EK2A 4YI3A 2PUGA 3CH6A 1P4HA 3LG2A 2RHHA 2OO3A 3LWBA 1V8ZA 1SUAA 7GPBA 5SYMA 1RWPA 2PWAA 2RJ3A 2ZK7A 1UPFA 4HB0A 5T3UA 4UJ3A 4A0FA 2D3TA 4YYZA 4LMAA 1XTUA 3C6ZA 3JQFC 2LV8A 2IDKA 2NU9A 4RA9A 5I3CA 5FBRB 3B2NA 5CK4A 4RNDB 5DNUA 2EKLA 3P0RA 5BWLA 2J46A 4TKVB 1MZPA 3N8KA 3QVOA 4KI7A 5H4HA 2CFTA 3HCNA 1BW9A 4Q39A 2HRQA 4RD6A 3WAJA 1KGSA 4PYMA 3UTCA 3RU3A 1K9VF 2P27A 1Q77A 1R9JA 1YASA 2O2HA 3I9OA 4D74A 2AB0A 2R48A 2IHNA 1XA0A 5EAIA 3S4YA 3OKPA 4IICA 3CG0A 1LNSA 5JUWA 3Q11A 1DKOA 4KCGA 2TYSB 1PJBA 1SZCA 3L1KA 2RGCA 4HWPA 3VUEA 3ZLTA 2O4UX 3F73A 4HS4A 1QKJA 3QEBZ 3VKHA 1RKVA 1PX0A 2EP7A 1RU3A 1O08A 4CF6A 4GVXA 3ER9A 1T4BA 2B25A 1L7AA 3LZ6A 4MS1A 1JAZA 4KDEA 1U4SA 4OX9Y 1PJLA 1SQ6A 2H6EA 3EGXA 3JYOA 4FYKA 4YRCA 5DP2A 5FBHA 3SYNA 1HG1A 4RULA 4AK9A 5JRZA 2ZVQX 2FEKA 4D26A 4GVLA 3L04A 1Q2UA 3C4VA 3TUZC 2Q2VA 4RPJA 4R9RA 3TN7A 3PXCX 2G70A 1H4SA 1LX6A 5JSFA 4G0WA 5EJ2A 2FHPA 4BNUA 4DJFC 1M1NB 1UMKA 2Y9MB 2OV1A 1JFVA 5AVJA 5ELMA 3T6KA 1QHHB 4TL8A 2FPPA 1X7WA 4X24A 3TAUA 1NTOA 4TUYB 2B2CA 4YCCA 3RUHA 3WKDA 3KEFA 4BCDA 4G0MA 2Z04A 1PJCA 3N2GB 2AT1A 4CM3A 1UFVA 2W83A 2TECE 1WVGA 5GZ6A 1CS0A 3HU5A 3TXXA 1T9BA 1JJFA 4CJXA 3BWVA 1R8YA 3A4IA 4FQ8A 4KUEA 1WTAA 3O4IA 4MVJH 4LHYA 3WGKA 1KEWA 1T2DA 4UC0A 5A5EA 4Z3DA 1QAMA 3WJAA 1YBMA 4PTYA 2PK3A 3O2NA 3RJ5A 1MO3A 3RNLA 5HIAA 1TQDA 2GJAA 1HQCA 1Q3HA 4R1LA 1JGTA 2ORVA 3I1IA 4QJ5A 3LXUX 1Z2AA 4UZFA 2HMVA 1M6VB 2BY4A 2ZVDA 5HIKA 2WE8A 3IP9A 4LYJA 2PH7A 4EG5A 3DMFA 1UQUA 3G0CA 3Q9UA 2DWUA 4RK4A 3HFGA 1CUZA 2GHRA 2HWWA 4JVLA 5E38A 1RCUA 1IG0A 1FDUA 1W96A 2EFGA 1X7ZB 2CNWD 4G86A 5FNVB 3CX3A 1PBTA 2XCIA 5JNLA 1YZKA 3EH2A 4AM8A 1OGYA 3QVKA 3OPVA 1T8WA 1E61A 2EW2A 3JVDA 3ROMA 1OX4B 1ORRA 3GFOA 4KWEA 2PZBA 4QFCA 1WY7A 1PFUA 2VDOB 3WDSA 3PGXA 2PEYA 3H6KA 5DI3A 3NHRA 4HLUA 3UJ8A 4QTTB 3ZZ1A 4F4FA 3OQMA 1C81A 4I5DA 5M2QA 3LBHA 3GJQA 4IX9A 2QTVA 3ZVNA 1RXCA 2BKVA 4KN8A 2YV4A 3P7MA 3L9XA 3OM9A 3PPXA 4ZVTA 4BDSA 3WL4A 3GD7A 3O21A 4E94A 2ZI9A 5DLPA 4YWHA 2LBPA 4BFXA 1EK6A 1IVNA 1W25A 1BE0A 3FZYA 3ISTA 5FBKA 4HDKB 2IUUA 1L8QA 1RD4A 3E2PA 2FWBA 1CUGA 3B6MA 4GOJA 1GL6A 4GPTA 4XM2A 1VRCA 2ZJYA 3KDPA 2C2KA 4BS9A 2ZYWX 5CA0F 1M0TA 4G5XA 3QMPA 3OQNA 5HMLA 2QUBA 2XCLA 2ZTSA 4H1UA 3E03A 3N2EA 1PF7E 4QDZA 4GE3A 2QRLA 3FJ1A 2HLNA 1Q7TA 3CUVA 4WKNA 4X94A 3BKWA 3HEAA 3S8EA 1B93A 4F93B 3C3EA 2R6CA 3A04A 3K6RA 4GLOA 4AJ2A 1FMJA 3I6QA 1Z2CA 1U9IA 4NCHA 4UEOA 3AVWA 3BFJA 3FCYA 3NETA 3TOSA 2W37A 2DH5A 4MV0A 4MSUA 4O2AA 5EMKA 2NUTA 5EJ7A 5KNDH 1FTSA 1C7RA 3HEMA 4TMFA 4GL4A 5CP8A 3I9JA 3RYCB 3V8QA 1GGFA 3A6KA 5EIXA 4F92B 1V43A 2GHQA 4PR0A 1BWRA 2H92A 2BD0A 3WGUA 5EP4A 2Z98A 3CNEA 1NVAA 4OHWA 3R74A 4KZPA 1WA5A 1EFLA 1A5TA 4JSTA 1OOEA 2WJ4A 4HXEB 3ZJ5A 1F3LA 2GPYA 2Q0HA 1MUUA 1ND6A 2Y1KA 4IHJB 2ECPA 4KTTE 4MLPA 1GGNA 5ER9A 4H6VA 5IBPA 3RKSA 2G07A 3RG8A 3PGKA 3I09A 2HW8A 1JFFA 1NBME 3G9TA 4ENVA 5EVCA 2OILA 3DDNA 3OLWA 3T4PA 1XRPA 4R40A 1T5IA 3LNTA 2P77A 4N0MA 5KPJA 1XCOA 1WD7A 3H75A 4XEUA 5CW2A 1XP8A 5LB4A 1TLFA 4AULA 3HCOA 3HGQA 2ZULA 4CG2A 1UXIA 3DAGA 1UDXA 2ZBRA 1OUMA 1GPBA 3CRRA 3JXEA 4X44A 1IBLB 1PNOA 1TVKA 2GRUA 1RJ9B 2DYKA 2IHTA 4U4AA 2HDHA 4GGOA 2A4KA 4MCJA 1Y9DA 3QV2A 3VJRA 1OCEA 2DHQA 4EB6B 4BCCA 2PZAA 2VH5R 1G66A 1G5PA 3NTUA 4I66A 4V03A 5JZ9A 1TO1E 2H9AA 2GFIA 4QO8A 3WRYC 3FCXA 3LP6A 2L2QA 1ZGBA 2WU3A 3ZZNA 3C7TA 3PE3A 2Z2KA 3VC3A 2H2HA 3UV3A 4YP1A 3NAQA 1YAHA 4B8WA 5CG1A 2ZBUA 1R10A 2D8MA 5A9TA 1EAYA 1P9WA 5CVJA 5F1PA 1YI0A 4N9QA 3M49A 3SSAA 3QPVA 4ZCLA 1DKLA 2KHZA 5FT9A 1QJCA 2WZQA 3BCRA 3BMOA 1FX1A 1A8HA 1HDRA 1YDGA 2RAPA 2WVAA 1W94A 3JD4A 4FWIB 3I2JA 4WNYA 3K0BA 2X2OA 1Z2OX 1BMFA 3HDGA 1KZ4A 4IOLA 4ND7A 1T1JA 1I4EB 3LGXA 1QIFA 1VL1A 2YOHA 2H2GA 4ETIA 1GL9B 1Q1ZA 3DKIA 3F5QA 5REQA 5DGIA 1U7TA 5GM2A 2O07A 5ITZA 4I19A 1LV8A 2AL7A 3D4IA 2OC9A 3DUFA 3AJAA 3B1WA 4L9AA 3WQQA 5B1EA 2NGRA 4Z7OB 3QJYA 2PNFA 1FSPA 3ASYA 3BDAA 1AGXA 4JELA 2CCJA 2I34A 5BYKA 1H5UA 2PQ0A 4OFBA 3SBXA 1N6OA 5ICCA 1L4MA 2J6CA 1C9YA 2YWXA 2M6LA 1ZM9A 1H0RA 5E7QA 5L3VA 2ODTX 3GLKA 3Q8KA 1MA0A 2VHWA 5AJHA 3CNHA 1U0OC 3E5NA 4JL8A 1YMVA 4Z7JA 3HU3A 4MQUA 4KO4S 5FTLA 3GMSA 4ZAYA 3A06A 4XAQA 1D5WA 3WO1A 2B34A 4LZWA 4YMSA 1Z35A 2VK2A 5KVQA 3P9QA 1JXMA 1JH8A 1HG0A 1PW7A 2H8GA 2YX1A 3WE7A 1QHNA 2J9FB 4QREA 4DA6A 2BEUB 1ZO8A 2XXBA 3UPDA 3OF3A 5DGCA 3IP6A 1DQYA 4BKPA 3D6MA 1R4NA 4R9NA 2ZLBA 1X13A 2I29A 4PY2A 4N7MA 4OHUA 2A59A 2VHUA 1E9EA 1NW7A 3S3TA 4EY7A 5FNZA 4RIHA 1N6LA 2ATEA 5EIBD 3O84A 1U2DC 3TOVA 1H2AS 5EYPB 1UIMA 1ZNZA 2FFBA 2HQSA 2XQGA 4JBIA 5KYUB 4EMSA 3S1SA 1UINA 2CLSA 4BWGA 4IIGA 4EHDA 1WP9A 5KJ6A 3ZGZA 2J4FA 2NACA 3FMIA 2PGOA 4FHDA 3UT5A 1ADJA 2R1VB 4B46A 2MU1A 3KQVA 1FQKA 3BGOS 2GK3A 5KQSA 1SBZA 1MTOA 1RE1A 3TKYA 5CFZA 1CZNA 1P0PA 4TRJA 4URFA 3X2SA 3AU9A 4OQNA 1MT0A 4AZ0A 5IFLA 1XN4A 3PNPA 4CODB 1EGQA 4Y2SA 1EQUA 5DGHA 4FFPA 2JGDB 1QV9A 2G4LA 1G6HA 3GN1A 3P2MA 2GAFA 3ZJVA 5E1OA 3QPAA 4LC9A 5HCUA 3Q3HA 3B1VA 2IHBA 1ESMA 1D9XA 1H5QA 3N7UA 1KPHA 3QF4A 3TR0A 3DLTA 4RU1A 1GA4A 1GL7A 5H82A 2YWGA 5E2IA 3MWYW 2FP4B 1NXPA 5CYGA 2VSQA 1KYIA 2J4DA 3AB3A 3BF7A 6GPBA 5B55A 1NF2A 1PSWA 3RGGA 5BXYA 3L1UA 3NHJA 4KYUA 5EC8A 1KH3A 2ZB8A 4N7RA 4YJ3A 1TO6A 3M9LA 5LLSA 3WC4A 1CY7A 3VR3A 4TYYA 3K0KA 4M49A 2GXAA 1UODA 4BBZA 1ML3A 3KE9A 3H1EA 4MVYA 5DIZA 2O3JA 4QUAA 1UC4B 4O2AF 1T8YA 2ZYAA 3NBKA 1G98A 1T3GA 1J97A 4F5YA 2NO0A 4UXJA 5JBNA 1QFJA 1XDUA 4YAUA 2WF6A 2CLLB 2GHTA 3C6XA 1EP9A 4LBZA 4FBGA 3WL7A 2C0QA 4GEKA 1F3OA 2FTKE 3NONA 3R0IA 3DDUA 6Q21A 1HETA 4MQLA 3JAMA 1QDEA 3ONFA 4BTEA 1VE3A 1AKMA 1H8ED 3B52X 4DIKA 1G8HA 3OZWA 4ZCIA 4LTNA 3L07A 3RAPR 4QU5A 4W82A 4OU5A 5GAJA 2WAYA 3TIGA 3WMGA 1V5WA 4XTCS 1X1EA 4ZTBA 2HHCA 5H83A 3AUJB 4M0FA 3DNPA 3V34A 1HDIA 3PS9A 3NHZA 1C0PA 4J0FA 1SXIA 5K0TA 4WVFA 3D4LA 5BSVA 4F3NA 3NIBA 6ABPA 5KTMA 2AG1A 1ZH6A 2O9JA 1QRTA 4PNPA 4GYYA 3UMBA 4YO7A 5TS3A 5AW4A 3NYRA 3E9ZA 3NUQA 4TTTS 5LKRA 3RFTA 2PYIA 3BHIA 3VOTA 3ZR4B 1G42A 3HM2A 2AOTB 2ZR9A 3F6BX 3VKGA 1FYVA 2IP1A 4N01A 3FNHA 1Q0HA 3KYCB 4U0KA 3V4FA 3LT2A 4M0KA 2JLYA 1YWGO 1VCOA 1W36C 4A0HA 1ULZA 3ECCA 4LOLA 1EUCA 1R1DA 4E2YA 4B80A 1XYYA 1AY0A 2AMYA 2XNCA 1XTTA 3I64A 4IFBA 4DA0A 1BKSB 1T36B 2IKQA 4PLZA 1B1AA 2TRSB 3Q5DA 5LQAA 4KFTA 4F7DA 2VVTA 3O1IC 3A1SA 3PD0A 3UHFA 4CG1A 5IT4A 2WNHA 1EPUA 1GP2A 1LDBA 4P83A 1ZJYA 1I14A 2HWYA 3AY7A 3OPYB 4WZBA 4LF6B 1WXEA 1GTSA 2OFOA 1Q21A 4FCTA 5D1NA 4CEHB 4BAUA 1VI6A 5FFMA 4NS1A 3NS7A 1JDNA 4NPHA 1RYYA 2HTFA 5GP1A 4K81B 2XA2A 3DPUA 4PIPA 2AHRA 1L1EA 2ZB7A 4G5YA 2UVDA 3ESRA 4PRZA 4M1MA 2P4UA 4AWAA 1I9CA 4YN3A 5F98A 1FDOA 3T7RA 3C7DB 4AZVA 1NP3A 3OC0A 4OL0A 1WF6A 3KQMA 4QPDA 3R5XA 1JDZA 2G0AA 3WOHA 5BWMA 4TRNA 3ZNQA 4F1KA 2B98A 1UBHS 3ADBA 4DPLA 1F60A 3QJGA 1SVWA 4D41A 3PC6A 3DMTA 3KUKA 3UMVA 1B7GO 3G2QA 1SU6A 4LXGA 2ZSAA 1X3LA 1VMKA 2XQKA 2PS1A 4LDNA 1NW4A 2QNRA 3EXHB 2GPSA 4GM0A 2A35A 2CYCA 2PHZA 4X1KB 1BFUA 1Z08A 2EATA 1WABA 4JEUA 4JDPA 1GQOA 2NO5A 3ABQB 4KYIB 4O25A 1I6WA 3QNUA 3QUQA 1N9ZA 2JHGA 4KWCA 4WXPA 1V47A 3GEBA 3BGDA 3C14C 3ETGA 3OT5A 2GPAA 3HFJA 5A9SB 4ZYVA 1Q50A 3GJZA 2P6OA 3L2OB 4HMQA 4HPXB 2WAOA 4K8OA 2DJ5A 1RWMA 1SMKA 1PW5A 3ZS8A 4JNKA 3IH5A 3DHWC 3MGCA 3QHPA 3ZU2A 3ICEA 4ZEVA 3BKXA 4AY5A 5AVTA 4XD7D 1SUSA 4V1CA 1V37A 3DWIA 1ESZA 1QIIA 5B64A 4MUHA 4PWYA 2IUFA 3H05A 3V42A 3BH7A 2C5BA 3IT2A 1UK9A 4Q0MA 5KYWB 2C9YA 1H69A 5LOVA 4BZXA 2D2IA 4PQEA 2KLBA 2ZI3A 3B51X 4N18A 3CGWA 3DKRA 4MVCA 1TA0A 4WV3A 5E7MA 5CB4A 1PWZA 2H51A 3PLNA 1T3LA 2JASA 3D2AA 1M2OA 4C4TA 1XTQA 1EBFA 1EFCA 3R7NA 3INGA 2G1KA 3BFKA 3BD7A 3H2JA 3M70A 4FJ2A 1E6UA 2V7QA 2R8XA 2EGUA 2ZE6A 1LI4A 4B74A 4PAOA 1Z16A 4ZMRA 3NW9A 2OFXA 4HHEA 1U9YA 3GLFA 3HUUA 4R98A 5HF9A 3BK1A 1VPVA 4QGBA 4RC9A 1SKMA 3I76A 3IODA 3AYZB 3EWAA 4IMIB 4M55A 3RIYA 3FB4A 4OK5A 2JIMA 1I4DD 4UCFA 2Z4SA 4YJ3F 4Z9FA 5FWXA 3X2FA 3JZIA 4DRXB 1THMA 2JI6A 2QX4A 3OHPA 3K0FB 1LVGA 1ZGAA 1D2RA 2RG7A 1IBRA 2OLKA 5CIWA 1CJUC 4FE7A 1JIJA 3SYKA 1KDOA 4MV4A 4YI5A 3DOUA 4NAUA 5GZ3A 1KH2A 4RO0A 2GUWA 3MEQA 3ZY6A 3U4MA 4N48A 2XUAA 4Y1RB 4MV6A 2AKAB 1XYGA 2PBFA 4H0FA 3H9QA 4KUHA 1NXTA 4CEJB 3CF4A 3HO1A 5M34A 2FN9A 1L4EA 1MTZA 4RAQA 3I5UA 1P1HA 5U4QA 3VBCA 3G0OA 4DCGA 4US0R 1MG0A 1OLOA 3GP5A 4WBNB 1RFLA 4WLEA 2Q99A 2FZLA 3H84A 1EZ4A 1T5OA 1M2VB 3UXHA 4OB7A 3UJCA 3IE0A 4H3KB 4TLEA 2QG9A 1AKUA 1D2AA 5BSWA 1UBLS 1BDJA 3LHFA 2AXQA 4Q4HA 4RPLA 4ZARA 5E2BA 4MRMB 4BMOB 4F21A 5BUQA 4DV4B 1HR0B 5FPPA 4LVCA 4UUBA 4YP5A 1BN6A 4RVSA 3U7JA 1W49A 1RXIA 2VPTA 1YBAA 5AVSA 2WINI 1J7JA 2OPHA 4A4DA 4B6RA 5HW0A 1K9SA 1HE4A 1IBCA 2QMEA 1K92A 2ZR8A 3D3JA 3GFQA 4RSMA 4C1BA 3W9BA 2J3DA 4QOSA 4BMYA 1GUFA 4Z4EA 3CLKA 4MW5A 1AS0A 3I6IA 3IO3A 1EWYA 1OKKD 4PSCA 4FGLA 2CN1A 5A4MS 2AKYA 3EISA 1TIBA 1W8IA 2BHSA 1PJZA 1I5EA 1UKYA 2V9PA 1A9YA 1IM2A 3I5MA 1GV1A 4RCZA 4QECA 3MB8A 3QUBA 4FWBA 4UARA 4X5OA 1ADFA 3HUDA 5D5PA 1IY0A 1TD1A 4ER6A 1XXLA 1OH6A 4IUYA 5FORA 3WBBA 3U6BA 1JG4A 2YVQA 1A9RA 1CQIB 4KU4A 4P3YA 4CL0A 4CDGA 3GFPA 5M04A 4Y2VA 2O2XA 2HIAA 3K72B 5I7EA 2MMCA 3GY0A 3NIDB 3ZD9A 2RK6A 4LY3A 1OASA 3G13A 3ONDA 3BDIA 3I0MA 2C96A 5L4NA 4D98A 5GVRA 5HUQA 1KMIY 5TF4A 3FCSB 3QKIA 4GFDA 4X0EA 3D1JA 3HYLA 4NYJQ 2CXHA 1YHNA 3MCTA 4ZZ1A 5C5IA 5JROA 5CPFA 4R3NA 2VP9A 4CM4B 4E15A 5KSYA 2C2WA 2P2GA 4BYGA 1OVMA 4NOMA 3LX8A 4RFSA 7REQB 3MGKA 1FLVA 5IK2A 4UPVA 1RRCA 3UK0A 3FFWA 3IMCA 4KQFA 2BHRA 1WSAA 3D1LA 3OZBA 4NI5A 4PU0A 5K0LA 1G3QA 3TMAA 4DC1A 1FUUA 1GQRA 2AE1A 1KI4A 3AK4A 1TJ3A 5FWYA 2PMFA 3L43A 1NU8A 2CWWA 2XOEA 1QP8A 4HATA 1HDXA 3JQGB 4OHPA 1CEXA 5D5HA 4ALKA 1XTZA 3ZXSA 4HAIA 3RYHA 3TM4A 3MTBA 4FKBA 3VZCA 4UKDA 5K0ZA 1A7JA 1XQVA 3LO5A 2E4XA 4OHYA 2XF8A 3ESAA 3MGBA 4RVUA 3FPCA 2NU6A 3ZGLA 2C2BA 4IXNA 3TRJA 1GGKA 2G9VA 2J3LA 3ONNA 1PZNA 2EGGA 5JAQA 4BLWA 2P3SA 4KRYA 1I0LA 4B75A 5DNYB 2BSAA 4IQFA 1G8AA 1RTKA 5EJIA 1QPBA 4ZJUA 2MIIA 1RVDA 1ANKA 1CUBA 4NBVA 4DMMA 3EE6A 2D7DA 1RXSA 3GA5A 2PDAA 3UA4A 1AUQA 1UQRA 3HO6A 4HAXA 1Y5LA 2R44A 4JC5A 5LOVF 3P9SA 4PHHA 4PC1A 1PV2A 2Z8YA 4JJKA 3M83A 3QLTA 3WLAA 1RMTA 4YRLA 2WIGA 1YIAA 5CB4F 3IKTA 1KYZA 3PFCA 3G0BA 2GO7A 3PVZA 4FW9A 4HH3C 1OLSA 2VH1A 4QGAA 4R2HA 5TGZA 3U4CA 2V45A 3H17A 3S1AA 3SBOA 3LT4A 2VG8A 3B9RA 4OQQA 4NFLA 3RCBA 4TKMA 1ZIDA 4C9BA 5FUQA 4K40A 4ENRA 2O7VA 4ML3A 5LYJA 3LUJA 5HF6A 3KL4A 1ISPA 4HUJA 2JS7A 1KDZA 5HBGA 1IZZA 4AZSA 2DRIA 5IPFA 3PEYA 3FSEA 2JKVA 3M33A 1SELA 2P5YA 2XBUA 1OHHD 1TYEB 5TSDA 3UOGA 3GJ8A 3TGWA 2XMZA 3AOGA 3TZEA 1T1GA 1IG3A 2FG6C 3W2GA 4BU1A 5CDYA 1B00A 2JNWA 4R2LA 1FRNA 1BJTA 2VDVE 3PR2B 5ER6A 3O8BA 3TSCA 4CQLB 1VMIA 5G0TA 3GJXC 2AC7A 1ZH0A 1ITZA 1Q1AA 1MIHA 2RH8A 3B60A 1DCFA 1DWPA 2C54A 2QM3A 3WGMA 2QU8A 3O8RA 4N82A 3QITA 4Y9DA 5CA0B 1C4OA 1HEUA 3VR6A 3TLZA 3G5UA 4DPKA 2OENG 3D4NA 1LSJA 1JSRA 3EFOA 1T13A 3MTQA 3MMZA 1FS5A 1IHXA 1W88B 3NR2A 2D2VA 4BAZA 5CM8B 2UAGA 4C2BA 4Z1MD 2G72A 1OZFA 3WWZA 3AF4A 4AMUA 1ZD9A 1DFIA 3FVRA 2I78A 1E3LA 4CN8A 2WFLB 5FHRA 5IX8A 3ZHZA 2GBLC 3FDFA 4NONA 2A30A 3C6KA 3H1AA 1AA9A 1KZ9A 4YV1A 1ZBQA 1IEWA 1TMGE 2C5LA 1QDUA 3QVGB 1DAGA 4RE5A 3UN1A 3IL2A 4XJTA 1IL0A 2VHYA 1U11A 5JG7A 4GS5A 4G1BA 4J1TC 2JIOA 1SUIA 2QI9C 5EWLB 1CR2A 2INGX 5K3AA 2VPXA 4AMGA 2MOKA 3LKZA 4R01A 4B73A 5K20A 4RLFA 4DLXA 1JA1A 1LZLA 2VC2B 3RODA 2O8FA 5ED0A 3IJPA 2NU9B 1EGAA 1SQ5A 2GETA 3NWPA 5IF9A 3GJYA 4QO7A 2WHEA 5EE9A 2V96A 1ST3A 3AKYA 3AUTA 1VG0B 4IXMA 1XTJA 4DHWA 1XGKA 3PTLA 1NQTA 3B70A 3K9GA 4JYCA 2LVBA 3BJMA 3DP9A 3UH0A 3KLNA 3Q6MA 1BW9B 1QUFA 2P4EA 1IUPA 3MJTA 3CKKA 5I9BA 4DV3B 2RARA 1K8ZB 4MYHA 4TYWA 1YZ3A 1BFDA 2FMIA 2IXTA 4WZZA 4XSVA 4ZO9A 2WYHA 3VPCA 1G5IA 3ZBQA 2BIFA 3EXEA 1M73E 4P7JA 3ZU3A 2IEDA 3GEGA 1G2PA 2Q9BA 2HL6A 3NHKA 4KIGA 1CUFA 3ICQB 2K4MA 3OZSA 2C1EA 5AUQA 3TKAA 2XMSA 5AOCA 3ANNA 1EBUA 3B3AA 3OWXA 2CXRA 3PXAA 3IRVA 4N1AA 4C5CA 4MS1B 2JEOA 5EEHA 4Y18A 5LDGA 4FYPA 2JIQA 1YDMA 3ZOZA 4EI7A 2IE0A 4ZZIA 3BIOA 4Y2YA 1BVYF 3ZWQA 4UBJA 5EIHA 2F3PA 4MWTA 3VTAA 3W6NA 1II8A 2EYQA 2B82A 2X9GA 1DCTA 1U7DA 2VBFA 1NUHA 4YRDA 3AM3A 1DXYA 5AI4A 3AESB 4P54A 5A9RA 1QPZA 1KFEB 2EHJA 3V33A 2PLRA 1SEVA 1UDWA 4GR4A 1U1CA 3S27A 3E3NA 4N54A 1D2HA 2BC9A 2EKZA 2FPPB 4IIDA 4L73A 2JI7A 3E82A 4MB0A 1SXJA 3KWLA 4X1IA 3TDNA 3JCZA 1E9DA 4GSYA 3SZGA 1A2QA 2YNMD 3SDZA 1AGRA 1UC8A 2C8LA 2H1LA 4KK4A 2ZWPA 1MV8A 1T4MA 4OAOA 2HJRA 3K0EA 4PHGA 1CS0B 2P2CA 4R05A 3U4IA 1FEZA 2NP7A 1M1UA 3C97A 3KFLA 4HEA1 4YTEA 3GRFA 4XVHA 1RPNA 3VV3A 1MF7A 4KQ9A 1OZGA 2WT4A 4JB3A 2Q28A 4BVFA 2XVMA 3QLUA 2QQEA 4GNKA 1J2EA 1HMPA 1ZK3A 2VCYA 1TVCA 1QYDA 2X4LA 1VIDA 3E58A 3JATA 4L0DA 4ZV4A 1EJ6A 1A72A 5DOVA 4FWTA 3NOQA 2OZLB 2EU8A 2Q5JA 3H5WA 1H4TA 2GUGA 3I04M 3QUSA 2HLHA 4AN4A 4BB9A 2OT3B 4C3UA 2C57A 2K87A 5EJEA 4FYXA 4QDTA 5IN4A 4CTNA 2YHIA 3RJTA 3A6LA 3CA8A 2ZROA 3V7YA 5KNLA 1XZKA 3ZCUA 1ODFA 1G19A 4BLOA 1R0LA 2BSQA 4V0QA 3H5VA 1F17A 5HKAA 3FETA 3U60B 3KD3A 4CF4A 1E9VA 1I3KA 5DXAA 3W6OA 2PJZA 1Z6QA 1FC0A 3EDQA 5LLTA 4PZAA 5TMBA 1WB4A 3LECA 2ZREA 4IV8A 3ZDEA 3GVIA 1HKUA 3CO5A 4G4JA 7ADHA 5LYJF 2J9XB 4G23A 2ZB2A 1OJLA 4QUEA 3TSAA 4XA8A 2CHQA 1HDEA 1CNFA 4KUGA 1WU8A 3RBXA 2JAWA 4DEXA 2FVYA 5IHPA 1OAAA 2DWOA 1N3BA 3PVSA 5TMEA 1U3TA 5A7HA 2LPMA 2EKBA 3TLJA 2DECA 4FJ0A 1OF1A 1XNJA 2ZI7A 4J4HA 1YJXA 1B2LA 4ONEA 5F21A 4C08A 3V4RA 1JMYA 1OIVA 3N53A 3RFXA 2IIVA 5G3YA 1E1CA 2HJVA 3GPCA 3QHQA 1RZRD 3U3DA 3BA6A 3SJ7A 1D3AA 3OX1A 5C8XA 3G9ZA 3PDIA 1M0SA 3K94A 3PNOA 1T2NA 1XJCA 1ZRMA 4E0BA 4KPYA 3GUVA 4IIHA 4OHRA 1K6MA 2EFEB 2IYVA 2IXAA 3QU4A 4G8DA 5TPWB 2CJWA 2YZ2A 5J5VA 5DHPA 3LYUA 1MX5A 1S3IA 1WMDA 3NBQA 3QBEA 4HK4A 4CKCA 4E6EA 5I4IA 4UUNA 1Z37A 3DE5X 3AXSA 2WAXA 3FYUA 1XHEA 2NUTB 3SEFA 1N75A 4O2AB 3HKBB 9GPBA 2GB4A 3NNNA 3T3MB 4EA9A 5BN3A 1VKNA 4R6WA 5AKXA 4PZLA 5AXBA 3J7TA 3C7KA 3KAJA 2JAXA 4GSKA 1E5DA 1PVDA 4C0QC 3RS2A 4KQKA 2QD1A 4MIYA 4G9EA 4E5UA 2UZ3A 1EX6A 3BIFA 4WI1A 2XE7A 4TS9A 5KSZA 5EQJB 2G88A 4CL3A 2VYNA 4KR2A 5KOJA 4L2IB 4Z4FA 4P5EA 4FP9A 3CMCO 1V71A 5LZ2A 1AMNA 3C4JA 1FL9A 4D82A 4WUTA 3AVXA 4NFHA 4JBGA 1Y3BE 1YS9A 4MYRA 3BGIA 1I1QB 2O7RA 4UQPA 1E5VA 4KR0A 5JSQA 5IVKA 5JJBA 2FSVA 1TJ5A 2AW5A 2HTEA 2ISSD 4OTZA 1C30B 3JQRA 4X95A 2V55B 3JASA 1XPJA 2AXNA 3DBLB 2PQMA 4JX9A 1M75A 4NAVA 5AI5A 4DYVA 5JANA 2VKTA 1YVDA 3CWZA 4L5BA 4RMHA 1KVRA 2ZRPA 5KDLA 1N2CE 3CH5A 3F47A 3OIDA 1LJ8A 3QU9A 3L40A 3R7WB 3AR2A 3ZVLA 5JU6A 1Y8QA 1NATA 2VWQA 3TZBA 3M0EA 2IHUA 2D4AA 3AF0A 1F0KA 1P7CA 4Q7LA 3OZ7A 4PCUA 3MMXA 1GILA 3L8ZA 4H77A 2L0XA 3STXA 2XOKD 4QLOA 2Z43A 5HQTA 2D0IA 2OGTA 1JXQA 1RLOA 4CLHA 4K6KA 1M2JA 3WK6A 4C2TA 3W9SA 4NU0A 2CVPA 3ASVA 2HYDA 2F59A 4NK4A 1GPAA 1SVNA 1VXRA 3SYRA 1XZPA 1Y98A 2VSYA 3PUVA 4OMCA 1IXRC 4HGQA 5E3JA 1DKQA 4PRKA 4V0NA 3UAWA 4C6RA 2XITA 5DHTA 4ZOQI 4MA4A 2RSLA 3GCDA 4NZOA 4DUZB 4PN3A 4ZN6A 5HP4A 4LQLA 1GZVA 3DUFB 5CDHA 4UBKA 2NWQA 1RZVA 2D0DA 3C3XA 1QS0B 1KYQA 1TM3E 1S3SA 1E96A 4D8VA 1TC2A 3UGKA 1CUYA 1DWOA 5JZOA 3R24A 2PUJA 3O91A 1E3SA 3D8SA 2R8YA 5DU2A 2WFAA 3VI4B 4ARZA 2QYOA 3I4LA 3F6CA 5T6MA 3PU6A 1J4AA 1WWKA 2F3RA 2ZIWB 4B4VA 1G3MA 1R2QA 1DWQA 1MQAA 3GNLA 2FN7A 4OSOA 2Q1YA 3W1EA 3PPVA 3WS7A 1G5FA 4NTZA 4M0CA 4RHFA 1TPYA 3N2NA 1Z26A 2QN3A 2ZRGA 1DELA 3GNTA 4UVHA 3WK7A 2UKDA 1D4ZA 5K6TA 1FDWA 1N8NA 1CF4A 5A02A 3VR4D 2I4NA 5JWHA 4IDOA 1KVSA 5K8IA 3N3AC 4F7WA 2XKBA 1I8TA 1XI2A 2VHZA 2DTDA 1LW7A 3GT0A 1EVKA 3A4NA 3VNAA 1ARZA 1CX9B 2EDAA 3RQSA 5TIIA 1P1JA 4UAJA 1GR0A 5M5BA 1KJ8A 1NVMB 2ZUDA 1BN7A 3H4IA 3FOCA 5ALYA 3EGVA 1B73A 2G06A 1MRNA 3RBZA 4RETA 4D99A 2VDWA 4HJRA 1OV4A 3HLTA 3O8CA 1D0SA 1B6GA 1R9NA 1RXYA 2XHEA 2ZYTX 4DCCA 5I48A 2GLXA 1VHJA 5E7JA 3KLBA 4CKYA 5TXGA 4P92A 3TEJA 4F8YA 1F20A 2HRDA 1PR1A 4KN6A 1FK8A 4EVQA 5HE8A 1S6YA 1H23A 1XTIA 1YB5A 3BJEA 4WXRA 2LUOA 5JXWA 1WUKS 4H59A 1S2NA 1SPXA 1VDZA 1KKMA 4A6PA 3QF4B 4RZIA 3HBFA 4C14A 5FLXA 3PCTA 1CPYA 4L8LA 4ZDIA 1ZVVA 5KYKA 3BZUA 4LTDA 3C3YA 2X5JO 4URXR 3TXAA 4O8ZA 5I7OA 1JQ3A 2NO4A 1Q2XA 2GZSA 3GA7A 4MPPA 4EPRA 1UAGA 4TTJA 4M8LA 5L7YA 3BMNA 1EP3B 4OU4A 5CVCA 5HUHA 2BVNA 2NVOA 4YJ3B 1H94A 5LQJA 3SI7A 3EC1A 1YRWA 2DG2A 3OQ6A 2IVFA 3ZD8A 3ZWXA 3PLAE 2Y4NA 2NXEA 3FYDA 5CNJA 2XYGA 2I3ZA 2R6R1 1KVQA 3VGPA 2C5HA 4D46A 2H0RA 4G0YA 2XB8A 4WZAB 2NU8A 4D4IA 4FC7A 4OLJA 3EVNA 2UVPA 4HN2A 4J1SA 1VLLA 3D7MA 3OA0A 4PSUA 2IYZA 4TWAA 3KYIB 1IB6A 4EO9A 3C7CB 3UXMA 2ODAA 1A50B 2GJ8A 4LV5B 5FL7A 4HFJA 1MX3A 3RR2A 5K8UA 4EMBA 1NWHA 2KYRA 4IDGA 1I33A 1JVNA 4ALJA 4M1SA 4TXNA 3HVRA 3WRVA 5IAOA 1TJYA 1H65A 1OI2A 1ZIYA 2ZRLA 4EB3A 5TB5A 3L77A 2ZBQA 4FE3A 1LPOA 1P4JA 3EXIB 3VRHA 3CGGA 3REGA 3EVFA 4D8YA 1TVEA 1XJ5A 1Y4ZA 4E51A 4TROA 1A04A 2PJUA 3L02A 4JLUA 1YJ8A 2I1QA 1Z25A 1A5BB 3DNMA 4DSOA 1NY5A 2DFDA 3BXZA 2F62A 4G89A 4I2NA 5LKAA 1DRJA 1MX9A 2IQIA 2MSCB 1RBQA 2BGNA 3K35A 3MFYA 4FMPA 4Y7DA 5SZHB 3DMHA 4DA4A 3KZVA 1Y89A 1GAWA 1N0UA 2OKGA 4EARA 1SN7A 4BO9A 1HNNA 1H4VB 3VH2A 5A4DA 2R66A 3OWOA 2C97A 2QQFA 4OHFA 4KXNA 3GGSA 3L9WA 3DWGA 4U8GA 4XDZA 3KJFA 1Q5PA 2AF3C 1PN3A 1R7RA 1RRFA 1PYDA 3AHIA 4RL6A 3VAZA 1X2BA 3H5RA 3CZPA 3SNHA 3HJFA 3QE4A 4JXKA 1H93A 1VLHA 2Z57A 2M32A 4JQOA 1T6XA 2YQZA 4WZBB 1SCDA 5B4TA 1NFQA 1NR7A 3E22A 4UXIA 4ZOCA 1T2AA 3D5EA 5DYTA 1DFHA 2ZT8A 1AMOA 2YIMA 3K9NA 3FPBA 3SY8A 1NMQA 2DAPA 1U98A 4DR5B 5C7OO 1EG2A 3KKMA 5AM2A 5EJ6A 1EVJA 4B6SA 3X2EA 2DULA 4OJNA 1FDSA 1RBZA 2H11A 3LDGA 4GO1A 3W6UA 2JLQA 3DEZA 1N6IA 5CM2Z 5BNFA 5DGDA 5MFZA 4JA0A 4KXFB 2W2PA 2W8BB 3EQ6A 4OJYA 4JVNA 2GAIA 4LSGA 1Z6TA 2BTQA 1NNI1 5EA2A 1Y9EA 4LXXA 1QTRA 5CBPA 1D1TA 1U6KA 1S2LA 1GDDA 3QKWA 3TFOA 2PSEA 1R8SA 1K6IA 5ADVA 3V80A 5CFOA 5JE8A 4P84A 1GU1A 5DKFA 1UAYA 4CI9A 5BQ5A 1WZIA 3TSWA 1ZVQA 4EVRA 4TLDA 1C3OB 2IH5A 2FLKA 4M2LA 4ZI5A 1EP1B 2OZPA 5GJVC 1VMDA 1XIVA 4UCQA 1YOVB 5AMXA 1YZUA 4TV9B 3GPBA 2GSWA 2VYCA 3PRYA 2LZ0A 3LJKA 4XGQA 5AM4A 4BRUA 4OHOA 4RGVA 4KH0A 1SO8A 2P6NA 2GZDA 2HUPA 1WBJB 3FRIA 3K30A 3QUAA 1F0PA 2QN1A 3TOXA 4C6TB 3LC7O 1J25A 3FTEA 3BK2A 4PVDA 4OLAA 3WSTA 4UVEA 4ESVA 2FDXA 3IOBA 4OFWA 4FZ3A 5F7XA 3O1HB 1BGWA 5A4FS 4DG9A 1FYWA 4KMRA 1TQ8A 4K05A 4CMEC 4TQGA 3FLAA 2YRWA 2CCGA 2Q7DA 4XX0A 5JISA 4BE7B 2P41A 4LDRA 1B0PA 1LSSA 4H4EA 3I9NA 1VLVA 2BFMA 3ZNNA 3MJEA 5J58A 1VIAA 1A8UA 4EHIA 1ODTC 3ZTYA 1J24A 5A3SA 1EWTA 3ZZ0A 5LWHA 1SUWA 4N76A 2W4MA 5JXHA 1SNYA 3W7VA 3U81A 4FEAA 3VDNB 2Y6UA 3KUDA 3KQKA 4WHMA 4Z2AA 4C88A 2X6QA 1TPZA 1P72A 2H54A 1V8OA 4DWJA 4EKIA 1UK8A 4JYZA 1JR3A 1Q3TA 1RYEA 2C7GA 4J0CA 2WC1A 4AWXA 1KWGA 4HGOA 3JYNA 5GQSA 1MB0A 2JFHA 4GECA 1Y4UA 5ERYA 3KCQA 3EPLA 2V5UA 5BQOA 4LQCA 3PJEA 2Z3ZA 4CGZA 1NBIA 1Z4LA 4MUYA 1A9XA 1NDQA 1PGOA 4JT2A 3I05A 2IOYA 4XYEA 1GSOA 1SRQA 2Z4RA 3BEOA 3TK1A 1V1JA 4G0XA 4EYEA 1LA2A 4UJ5A 2RGGA 4U2KA 1HE5A 2F8LA 3QTBA 4GMKA 2XCTB 4KQMA 1Y1KE 2BFOA 4RCVA 3A70A 2H5EA 5CCBA 5COQA 5CLHA 1UL1X 4MRSA 1UKAA 3OZEA 4XZ3A 2SKEA 1N3IA 2VTDA 3CY6A 3GFVA 4IPTA 3VH3A 2A5JA 1JU3A 2QRVA 1A98A 1F4PA 3QXGA 3ODGA 1WTCA 3KFXA 1PFWA 3WLKX 1DOZA 3Q15C 3LLUA 3MCAA 3PK0A 2IZ0A 1KY3A 4NESA 3EAFA 4KAXA 5CFLA 2P1DA 1ABBA 4UUQA 4AJIA 4YPOA 3TG2A 1F8YA 2JBAB 2Y05A 1D4OA 2Y99A 2OXIA 4BO2A 4KSCA 3MTJA 2PM8A 1QTQA 2DR3A 2HMAA 2YBDA 1BFKA 1W9MA 2XV1A 4O2BA 4YV2A 2GRAA 3W4KA 3M4JA 1GD1O 1WHSA 3GFGA 3OE5A 2HCTA 1U7UA 4U7HA 3CX6A 2PMBA 4QSMA 2D0OB 1QQ6A 4R8KA 4WL0A 3ZD7A 3COPA 3DW1X 3PEFA 2Q3BA 1ZJ4A 2O0JA 5JS8A 2R751 3N5CA 3NX4A 2QORA 4G4SO 1MGPA 2NQ2C 4NDZA 4OIMA 5D3QA 2IBTA 1V1MA 1SIBE 1HYHA 5L40A 3KOWA 2DBRA 1F1BA 2NG1A 3FFXA 4C20A 2VUHB 3VNUA 1FRQA 1X7YB 4O08A 4OVKA 1JAXA 3EY4A 3V97A 1FU7A 1GQ2A 4K9KA 1YVPA 3B6JA 4L7QA 1LWOA 2C20A 1FA9A