1SOUA

Nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
MLKSELRKKVLHKRINLSEEERRRLSEKVISNLKSLPEFKKSKKVALYCPIKGEVDLTPLFPEVLKEKELILPKVEGNEISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRVKGLKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRRLRDGRSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methenyltetrahydrofolate synthetase
publication title NMR structure of Aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: Northeast Structural Genomics Consortium Target QR46
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 50
structure length 194
sequence length 194
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1souA00
1WKCA 2G40A 1SBQA 1SOUA 3HY6A 2JCBA 1YDMA 3HY3A 1U3FA 3HXTA 3HY4A 1U3GA
chains in the Genus database with same CATH superfamily
3NHFA 4JZYA 3JY6A 3L1UA 2Y1KA 4D25A 2CLKB 4BVEA 1W36C 3PQ7A 4QUEA 4CCYA 4WX2B 3MWJA 1YAHA 4I4CA 2VCEA 3I5XA 3DYVA 1R0CA 2JGFA 4G37A 3GJQA 2YY7A 3NIDB 2P9JA 1CY0A 4KAFA 2PRKA 3MT0A 3TZQA 1R6AA 2XNCA 3QYPA 3N7UA 3SOZA 5C2JB 3Q3HA 1T2UA 3ZNNA 1BGVA 3GUCA 4IJVA 1N6RA 1UKEA 1ZCZA 1YCHA 2NUAA 2P75A 3C8HA 2I9KA 4KRGA 4MJ7A 2QPTA 4RD6A 4I1UA 2Q5OA 4KL8S 3VYWA 1T1SA 2A9PA 1EUQA 4XM1A 2BEUA 3E0QA 4CM5A 2BRUC 2MYNA 1THZA 2FR8A 1E6CA 2Q3DA 3K6JA 2BISA 1YA8A 3IP5A 1KY2A 1O6CA 4U8GA 2PFKA 1I0LA 5AW5A 2IEIA 5FO1A 3VR4D 5EWLA 4C07A 1RMQA 1ZITA 4IH1A 1HEIA 3FYCA 3LCVB 3FF4A 3O73A 4G89A 4QPPA 3FA2A 3VQTA 5FTLA 3HO1A 4R9NA 1PDWA 1YMUA 1UK9A 2YZKA 4G0UA 4LHVA 8GPBA 2ZWIA 1JKJA 1P7PA 2O2GA 3N87A 5EP1A 2HBRA 2PKQO 3D3EA 3D7KA 4KTTE 2ACKA 2JD2A 3KJZA 2ECFA 3G0DA 3JYNA 3DOIA 1XK7A 3GLHB 3NOOA 4CMAA 2R9VA 2GD0A 2MMGA 2EQ5A 3MUOA 4IJ5A 3AWDA 4J8PA 1ULUA 5AM4A 5AXDA 3WMRA 1EFVB 3ND8A 3UJDA 4DLKA 4EKEA 5CGQB 4L3OA 1BDMA 1T1GA 5LN1A 4J07A 2OLEA 1HORA 1NA5A 1J1UA 5KTPA 3NB0A 4Q7KA 1EFAA 3IMKA 2VH5R 3G2MA 1ETUA 1W8DA 1EP9A 4GFDA 1R88A 2FFQA 1PW7A 2ZPUA 2WVJA 3OHSX 3ZV5A 4RV9A 3HUEA 3MLAA 1MCZA 2ISQA 1BOOA 2ZJFA 3G2KA 3WVNA 5IDVA 3RO7A 2WWVD 1HK7A 1KF0A 1XZ8A 3G8CA 3MBKA 3GOQA 3E4DA 3P9SA 4DV6B 2ZI4A 4TWIA 3E23A 5KYTA 2JJYA 3M8KA 1NWCA 4C22A 3ZHTA 1PUXA 3U3OA 3B1FA 1UAGA 4I0WB 3GPBA 1EVZA 1UMKA 4QUHA 4KEAA 4XAQA 4FHFA 2IWHA 2RKWA 3N7TA 2L17A 4LTMA 2ZYUX 4V0KA 5ALEA 1OFUX 4DSUA 4QJ4A 4CODB 5BQOA 1KI1A 5E7MA 4KUGA 3U2QA 4ESHA 3TMKA 2NV6A 5B4UA 2UYOA 2A5YB 3LQFA 3D5QA 1UKCA 1UEIA 1AG9A 2QJTA 5EPUA 1JEEA 1RLMA 4MSUA 4MYHA 1FX1A 1VJDA 2AR9A 2O7RA 2Z2IA 1PP4A 3BT7A 2CZGA 3WTCA 1Z6GA 4IDDA 2XE7A 3EG9B 3MTEA 5JDIA 2H11A 3TL3A 2PL3A 1O6FA 5EJ2A 3OIGA 3WK4A 1ZOIA 3W04A 3HGQA 1Y0BA 1XQVA 4N5IX 2ZT6A 1HRKA 3UXEA 5JMOA 4GKKB 1OXSC 2GPBA 2ZJ2A 1W73A 3A9VA 1CUFA 1I2BA 3GUZA 5FLXA 1XKXA 4Z0PA 2QLJA 2D4AA 4HGRA 3FB1A 2AOVA 1T3LA 4GLBA 4JS0A 5ILOA 1FX0B 4QHYA 4UFPA 1PJLA 1P9LA 1WOYA 4J4BA 2RGBA 4JB8A 4NEHB 5DCYA 1P45A 1I6KA 1BMFA 1P81A 2R1VB 4U9UA 3SGLA 3KWLA 1FTWA 2ZYVX 3KB1A 2FOIA 1DKPA 4JI3B 5C1BA 3A1VA 1FU4A 1FJGB 1E2BA 5E2IA 1E1NA 1JPVA 2WV7A 2JS7A 3ZE7A 3P2EA 2UUAB 4LJYA 4ZDIA 3IYLW 4YAFA 1EIZA 1Q1ZA 4LSGA 4EF5A 3GAAA 3GRUA 4TT3A 4K03A 3KQKA 2R7LA 1X1EA 2IPAB 4G1UC 4D26A 4LMBA 3WDMA 2BGMA 2CF5A 3ONEA 4C3OB 3GXBA 5ITZB 1GUYA 1WXFA 2VQDA 1CHDA 2OV8A 2EKZA 3E7XA 4B7ZA 4JLKA 1WWKA 3OMWA 4LJ4A 5IJAA 2XE4A 4IIFA 3OQPA 1NNLA 3AEUB 1K8XB 1Z4OA 3BH0A 5ALYA 3B6JA 3QHQA 1UBMS 1UC5B 3QF7A 3RUCA 3TE6A 1OA1A 4U8HA 3MJVA 4DSTA 4XSHA 4DZTA 5FUQA 3AHCA 3N6XA 2ZRJA 3C74A 1XELA 2AN9A 2PWZA 1C9NA 4NXNB 3P19A 1WMDA 1V2GA 1IJBA 4MR7B 3ZQ4A 3F0TA 1H5UA 3OIDA 1ZUHA 3WDKA 3Q8XB 1K0UA 1TK3A 3SAJA 1JG2A 5H82A 1RXSA 4RYDA 3EB9A 4ZCQA 1NFRA 3CQ9A 5JO0A 3KZVA 2RGYA 3I8XA 4PR3A 2QXYA 1R10A 4OTZA 3C8MA 2QAGC 1ZNZA 3E2PA 3BTSA 3HJTA 2IEBA 1VDZA 1KK3A 1M0WA 3T9BA 2N47A 3HWSA 2WILA 4X44A 1QQ6A 2B25A 4U0KA 3T0FA 4EPYA 1DJMA 1KBQA 2RHHA 1UZAA 3VPSA 1ZN9A 4FE4A 2E5WA 2J0UB 1UEJA 2VP3A 3NORA 1XCOA 3BILA 4NNPA 3KZOA 3S81A 3PFWO 1VHJA 4DCMA 1OX5A 4ZODA 2ZSKA 2PR2A 4PU0A 2C4UA 3GK3A 4KWCA 3GDFA 1OZGA 1L4KA 4ED9A 1VJRA 3NG1A 4LOHA 1L5VA 2WNHA 3EFHA 4ZMBA 3HFSA 5LFAA 4WNIA 3ESQA 4FBLA 2Y0EA 1OI3A 4BO8A 5AKIA 3ZDEA 1NVFA 4PRZA 5DK4A 1NSFA 1J22A 3NP9A 5IC4A 1GNRA 2FW9A 3NHAA 3GA7A 3PI6A 1GU7A 4XQ9A 7ADHA 1PAUA 3T0IA 4GU5A 1ECLA 1GCAA 3CZ4A 3KKLA 3OQNA 4QASA 3E1KA 1CVLA 2Y1OA 3C5CA 2QDKA 2XUKA 2XMSA 3THYA 3TSAA 2V5UA 3F78A 3GF4A 4BFCA 4MUYA 3H97A 2GK7A 4K5QA 1A76A 2OWEA 3ZVMA 4HLUC 1TYEB 3SIXA 3WJ2A 4E5NA 2JJ1A 3HDJA 2O8EA 3GQBB 3K1JA 5ICCA 1RLIA 3EIEA 3DEYX 3FRHA 1MXHA 1R6VA 1JNXX 1WHTA 1K98A 2LV8A 1ZD1A 3H4TA 3IOEA 3MWLA 3G5AA 5TSDA 4EYOA 2ZITA 4N6OA 5LMNB 5K4HA 4UBIA 2O8CB 3L2OB 3FUWA 4TKMA 1W87A 3U3MA 1LPPA 5JW6A 3MT8A 5IS2A 1FUKA 2GBCA 1U80A 1ACLA 3VU3A 1NNUA 2BSAA 3W2GA 2VPXA 3R6TA 3TSZA 3KSUA 1QG0A 1L3IA 2YZ2A 3QIAA 4KZKA 2VZEA 4KU4A 5J4KA 1AHNA 1AQ6A 1MABA 1N6NA 2DSTA 2OGZA 4KXMA 4CV2A 3HVRA 4BNZA 2CXOA 5EWMB 2PAFA 1U4SA 3L02A 5B3JC 1D5WA 1K8RA 2PGXA 3L8EA 5JS6A 1VJGA 2ZQYA 2G0AA 5AKHA 3T7EA 2FPUA 3OAAA 4A0GA 1VCHA 4QFMA 1XNGA 1YTLA 5C4GB 2C7OA 1HNXB 4OGLA 4ES6A 2ZDHA 2O7VA 3NDJA 4GPD1 5CCDA 2EHDA 1BJRE 1QAMA 1ODCA 2WFLB 2MSKA 4PO1A 1DIGA 1WABA 4BO4A 3RAEC 1JNYA 1RJ9B 3IO5A 3QE4A 4PIVA 5C34B 2JLVA 1A5ZA 4HNGA 2LKDA 2VJLA 2ZJ6A 3QKRB 1G3QA 5I4IA 2IEZA 3EQ2A 1KFCB 1KZGB 2NO0A 2B61A 3QGMA 1KPHA 1OX6A 3DOUA 1IMOA 4GI3A 1R3UA 3LU1A 4OHUA 2REOA 4QARA 4XGNA 4DMRA 1OT5A 1LA2A 1LI4A 3AW8A 1ISMA 4W9RA 3RNOA 4M9XA 1QLJA 4O63O 1ZN7A 2YMLA 3RS4A 4H77A 4TVSA 2I7CA 4CMEA 1G1AA 3ITKA 4Z0TA 2DOKA 5IARA 1HDXA 2Y1XA 1YQDA 13PKA 5ALUA 3S2GA 1E0JA 2HM7A 1VKNA 5AKLA 1DC7A 4NPHA 4RQTA 2OOSA 5IVIA 2YVUA 3PD0A 2MYPA 4MMZB 2DLNA 3DV0B 3I12A 2G1AA 4YRZA 2ZIGA 3ZCVA 4AF7A 1DP4A 1OU4A 3W4IA 4RXMA 4JT4A 3WE7A 4HGQA 2R44A 4GYKA 3R3ZA 3A9RA 3DE7X 3NWJA 1PNVA 3BIJA 3PJRA 3MB8A 5BQ5A 4MUJA 4OJNA 2W42A 1RHJA 1ECBA 3I4FA 3M83A 3MFQA 4L08A 2H54A 2IJGX 3TSOA 5SYMA 3DDSA 4ND4A 3PVSA 4C0QC 3VR0A 3FNGA 3Q15C 1T43A 1G7TA 3MQ4A 2BBWA 2QTWB 2JJ2D 5FTJA 2Y92A 1L5NA 5JXGA 1JR3A 1VPDA 2ZTLA 1AKMA 4QVKA 5EINA 3L8YA 1HSOA 3ZGYA 4EY3A 3GLKA 3C3AA 3GDGA 4JUFA 4D80A 4LYEA 3KG2A 1ZESA 2GILA 3GP8A 1N33B 1CBUA 2W37A 1B42A 1Z35A 3ICVA 3QWBA 1WD5A 3V46A 5U4QA 1CNMA 2VUIB 1IN6A 5DM60 1JN0A 3JQPA 2JLXA 2CY0A 2HA5A 2GF9A 1QF7A 1KXZA 2QNIA 3GROA 3OX3A 4UBMA 5GTDA 4H0NA 3FLBA 4BU1A 3QLUA 1CETA 3FLEA 1X74A 3RVNA 4DLRA 3C5EA 2N1BA 2OZEA 1QGZA 4BUJA 1M2FA 1GV0A 2GHRA 2XOXA 2RJ3A 2AJ8A 2F9MA 4XGRA 5LBIA 4D9KA 1KR5A 5AIAA 1NUTA 1XTRA 5FBLB 2WHPB 1N6IA 3I6BA 3VZPA 4DPLA 3UW1A 1E7RA 1I3KA 1WW2A 1YS7A 4GZ6A 1QQAA 1Y7TA 3M81A 1A8UA 3KKMA 4AY6A 2HIAA 1QE3A 1SQ5A 2W4QA 1BX3A 3EG9A 4BLVA 3QYFA 3EDCA 4D74A 4CLRA 3ZWYA 5TQ2A 3OCXA 4PQYA 2WJJA 3B13B 1R0KA 5CFZA 3FPAA 3EA0A 4LDAA 4GBMA 4IVNA 5LQNA 2ODTX 5A4JA 2F7SA 3UATA 3V1YA 4N8DA 3ZJTA 4XD7A 6NULA 1U8YA 2AG1A 4ND7A 1D1PA 3RVLA 1FX0A 1NZDA 3RTDA 1XYVA 4FNOA 1ZXLA 2Q5QA 2ZWVA 4F38A 1WPGA 3KJQA 1JDBC 2DRIA 1EBUA 2R1VA 4TTRA 4DDHA 1NLMA 4I6JA 1KDZA 4GC5A 4BAZA 4NCBA 1P2SA 1HT3A 1DV2A 3RKUA 3VH2A 3WLTA 4MWGA 4B75A 4NK4A 5FOSA 4TXMA 3BRWD 4JP8A 3LYHA 1RYEA 2IS1A 2HV8A 2QJFA 4RORA 5BWCA 4YP0A 2BF7A 1IQ0A 1YDGA 4Q3KA 4N7JA 3DLTA 1IHDA 4IOLA 3DTNA 4IIEA 2YV5A 3PHGA 2FXIA 2O1SA 3QX7A 4XOUA 5ITZA 1EVIA 4QOEA 5CNMA 1E5QA 4Z9YA 1VKZA 4DL9A 5IKXA 1E3EA 4YV0A 1IOLA 2IP4A 1NVTA 1BOFA 3MPUA 1LDMA 2IYPA 1RLUA 5AJVB 1JEQB 3T7AA 1MV5A 4FW8A 3B6EA 1E8NA 3C43A 3L0PA 4MIOA 3U31A 5JD4A 4LXUA 3WLPA 2BJWA 1EFKA 3G23A 2R3SA 3GJXC 3N2ZB 3R6LA 4LJ7A 4A2PA 3FPEA 4NULA 3WK9A 3D0RA 5HOQA 4JEHA 4L0QA 4I50F 3TTUA 1RPNA 4MR7A 1GCGA 2GR9A 4Z86A 3NH6A 5D7NA 4CI9A 3P0JA 4KN8A 2DLCX 3GJ6A 5DHFA 4PC7A 3B1JA 2ZZKA 4BCCA 2IPLA 1Y8QA 2QY6A 3DW1X 4I50B 3AQ4A 3RFCA 1QKJA 3UVEA 4DLSA 4F86A 5T6BA 1KQFA 4BKOA 1M9NA 2AEMA 4P6VF 1FDWA 1K88A 1SEVA 4CXMA 3BSYA 3UJ3X 2H8KA 1EWTA 3ILVA 3NWEA 2FMXA 3A7EA 4YRIA 2OHXA 5HP4A 1R9JA 1XZFA 4I5EA 3IQFA 1MW9X 4RQUA 4RMHA 1YQQA 2IUEA 2CNLA 2J0UA 3BWVA 4KHZA 2ZFUA 1HNWB 7MDHA 2W70A 4I4IA 3E9EA 2QXTA 3PNKA 4FYIA 2FSPA 1XRQA 1CV2A 3WWDA 8LDHA 2C3PA 3RH0A 3VYTB 2B36A 3PUVA 1NT4A 3FF1A 2I1QA 4QGGA 621PA 4GPAA 2DMRA 1XD2A 5IZCA 4HH3C 1SHUX 2CXNA 2QMUA 1EI9A 4IMJB 4MPPA 3VU0A 2IS6A 1P1KA 3V8NA 3R4CA 4V38A 4BGVA 4Q12A 2X41A 4TQUS 5HFAA 1YI8A 1OFTA 4GP9A 5CA1F 1W9HA 4YHBA 3GLIE 5LL6P 4BIMA 1PQ4A 2NLOA 3LUJA 5JAZA 1SZDA 3AR7A 4UNRA 4UHKA 2J8ZA 2B6NA 3WGQA 3M6IA 5GIPE 4WNCA 5CA1B 1VPEA 1A3CA 1FOEB 2GM4A 2VZ8A 4P7GA 1Z5VA 1ISRA 5IKEA 2PAAA 4HLDA 4BQOA 2TSYB 1DFGA 2FFHA 3FW1A 4CYMA 1TVKB 1A04A 1RSZA 2ZI6A 3IBTA 4B43A 4JI0B 5FHRA 1NHWA 1HLPA 2GETA 2WIBA 4RPKA 2CVPA 2CK3D 2OORC 3IDFA 2I6FA 2H29A 4YQEA 3RRXA 1Y8ZA 5EERA 1PBTA 4D9FA 3QLVC 3UK2A 3LQKA 5JE8A 1PJBA 3C85A 5EMHA 1NUPA 2FN8A 2OFWA 3A3NA 1XLTC 2P9YA 2PBLA 1DBQA 2O8CA 2VBIA 1W5TA 5BW5A 4YMUA 5FPPA 4A7PA 4TMTA 2QN7A 5EFOA 3H04A 4XQ0A 4A91A 2FK8A 1F8XA 3OZUA 2HCRA 3VR1A 3FMOB 3UHJA 2C9BA 4WKBA 3MK31 3IO3A 5GAJA 3WL7A 4HNVA 1P19A 4A0HA 4FGSA 3EA5A 2FN7A 3UKDA 4ZQCB 2XCOA 3PRYA 5MFPA 4L73A 2JF0A 2ZWPA 1X7GA 2QUIA 5HTKA 2C88A 2X1VA 4DNQA 3AI7A 4OLAA 2BGIA 3M89A 1HTBA 4GPTA 5HILA 2NZ2A 2XITA 4D7AA 4CNQA 2PZLA 3AR9A 2GEJA 2VTBB 3ZDYB 2AWNA 4LA4A 2HFJA 3FMGA 1MEOA 2DVMA 1RJ9A 1VP9A 2NP6A 1BH6A 1IXSB 1I7PA 2QB5A 3QKRA 4B3CA 4CV0A 1JWBB 2IIQA 1EDOA 3C70A 3BC1A 4IDPA 5HKKA 1NGSA 3GMTA 4L27A 3R5JA 4BLRA 5IEJA 2WOOA 1EK1A 3GCXA 2XMCA 1WETA 1XZIA 2XJ4A 3FN4A 3VVMA 3CU5A 4RKEA 3GRAA 1NTOA 1DRVA 1ML4A 1LI7A 1RCFA 1NYTA 2DF8A 1EUCA 2W6JD 3EASA 4MEAA 3VTFA 4EI9A 1KOJA 3CB2A 3SHVA 5A4FS 2EWWA 3SF0A 3U1TA 4UMFA 3PGMA 4C9BA 1OYOA 4FP9A 4JROA 1N9GB 3DVAB 3IR6A 3N8DA 5LYJF 5ERXA 3DV0A 2H07A 2ONZA 3FDFA 2L19A 1MO2A 3NETA 4LYYA 4DUYB 1TADA 5C8DA 1M1UA 5LYJB 5KUTA 2PKXA 2JIBA 1J7JA 2ORWA 4YXFA 1RJEA 4F21A 5I9MA 1L5FA 2ZT8A 2BGKA 1W0KD 5B7GA 3N2LA 5LDDC 3K70B 1GFIA 2QXUA 3I3OA 4ETIA 3KHUA 4IG9A 3CNBA 2FPRA 3C3BA 4HD8A 3HEBA 3AKEA 4EO4A 4EATA 4RTPA 2NU7B 3L7AA 1W36B 1RLJA 1A9OA 1WUHS 2Z5FA 4J1NA 5F7OA 4UEKA 2H8GA 3L8HA 5DBGA 1PJSA 4Z7OB 1LLQA 1YU9A 1SBQA 1R6XA 2BY4A 3MIZA 5AW2A 1CDDA 4UDXX 4R2IA 5C1OA 2RGRA 1SB8A 2GO7A 1W59A 1MEJA 1KYTA 3OZDA 3LCMA 1B6RA 3Q87B 3WJ1A 3IQZA 1XVIA 2X4IA 3IAUA 3QH4A 3JSXA 3VR3A 4E4YA 1X13A 1XL0A 2JFGA 4MA4A 1B00A 5KOIA 3ETDA 5AVVA 1GILA 1BDBA 5KSOA 2QV0A 2WV9A 2X1LA 4R5MA 1KMQA 4UHDA 2Q6KA 5LDGA 5SZJA 3UG6A 5KB3A 1KMHB 1XDSA 3VKGA 3K0BA 5CURA 4AK9A 2PGDA 1KO1A 2D00A 2YWCA 1WW3A 1PZFA 4FEAA 3GT0A 3TM4A 1BCSB 4PWYA 2CVHA 4IRMA 2H2DA 2FUCA 3L0IB 2QU7A 3IMGA 3LFHA 2ZE6A 1X2BA 4UNPA 5J47A 4G25A 1TL7C 3NEYA 4Y67A 3V34A 4G0YA 5AOCA 5KKAA 1GTSA 4H7DA 4B8WA 2LNDA 1USWA 2WHPA 4GECA 4MUAA 3JQAA 3T54A 4DLTA 4DDMA 1OWMA 3I5YA 3UNXA 4FSXA 4EUHA 2PMEA 4AJ1A 1PL0A 2YL2A 3HY3A 1NKTA 3IDZA 3Q7QA 3KCNA 4R3WA 1KJZA 1LDEA 2FLWA 3UAGA 3V1LA 1G5FA 5BSFA 2POCA 5C5DA 1I2DA 2BOVA 3OLWA 4OM7A 4MIEA 3RPEA 2AG8A 2WM2A 5AT1A 5GONF 5EP2A 3TPFA 1ND6A 2Z8YA 3FYSA 4X41A 1FP4B 1YQTA 3FZYA 4BZQA 2V3WA 2NSHA 5GONB 4B6FA 1T3HA 3Q10A 3W2IA 4GMXA 4ZQHA 5F9HA 1FRNA 4LS3A 3TR6A 1KEWA 4AXBA 5KWJA 5LMUB 2VF8A 2VP6A 3KL2A 1FLVA 2RAUA 1EX9A 2BFAA 3CGWA 4GKVA 4IKOA 1GPWB 2D1FA 3ZX4A 1SU4A 3UGJA 4HDMB 4JOCA 4GZLA 3IV7A 1VPWA 2IEGA 1Z5ZA 3NR2A 4Q00A 3TD9A 5CCXA 4QPCA 1GGNA 1NXOA 1C0KA 4INPA 2IXGA 2L42A 1Q6YA 4BU0A 3IQHX 1YR9A 4YJDA 3D2LA 4MI3A 5KJ6A 3I62A 3PGVA 4N0EA 5EYPA 4ENUA 2PV7A 3RRFA 2C9MA 2BZGA 4NV3A 5I9BA 3AOEC 2QTRA 1I30A 1VMAA 3D7LA 4LXHA 3NMUF 4LFCB 3TQOA 3M7IA 1UP4A 3HHPA 2ZZMA 1M54A 3ZC3A 1JEQA 4BFZA 4L6AA 1OX4B 3LHSA 1GL6A 3U4HA 3ODGA 2G36A 4DCOA 3U4GA 4IW3B 2I76A 1G3UA 1MORA 2B8NA 2RGWA 3I72A 3RIHA 2FOLA 3TZ6A 3FTFA 2CMFA 2BKUA 4KQGA 4Q24A 1BX1A 3IPYA 5TS3A 1NSTA 1B7GO 2VI5A 4MV6A 3TB6A 2XQGA 1ZMTA 5DX8A 3T7IA 3QLTA 1YH3A 3ZGOA 2JFOA 3G0GA 1A4IA 3RG2A 2P9HA 2FW7A 1R8YA 2IOFA 2OAGA 2PLNA 3REGA 4KB5A 5G0UA 3P71T 4N82A 3HP1A 3N2IA 3WAJA 4WWHA 1L3CA 4YALA 5ETJA 3VDMA 3GJ7A 4LYDA 4F1WA 1E3JA 2UU9B 3K94A 2QAIA 2D1QA 3EW9A 3HZHA 4ZHSA 5F3DA 3K71B 1LVUA 1VLHA 2HB6A 4C03A 2LUOA 3T3HA 1P8AA 1PYDA 1YZUA 4N3BA 4ARVA 1HE4A 4GW3A 4IDAA 5I48A 1A8SA 2AX3A 1P9WA 2DWPA 3LI2A 2VZ0A 4FHDA 4OSPA 2JFWA 4CMHA 3B3JA 2B1GA 3DMHA 1E1DA 2ZJBA 3K1YA 4IQ0A 4B09A 4PLHA 2ZWOA 5EIFA 5AXAA 4B34A 2WSBA 3H5IA 3MELA 4WK6A 3FNQA 5FAXA 2CLLB 4UQOA 4YPOA 2PUFA 1L4NA 3QE3A 1X9HA 4RVCA 6REQB 2WLSA 4NOLA 3OLQA 1BMFD 1X38A 2XH8A 4YPFA 1MIHA 5J4HA 3LA6A 5CX4A 3E1SA 3JWEA 1KSHA 2PSEA 4FDUA 4ZYUA 1KK2A 1MV8A 3JTMA 2EU8A 3H11A 1GZVA 1VBMA 3SS7X 4BFSA 3IUPA 4ZQGA 5TY0A 4TKLA 1R6TA 4L8VA 4TWJA 1OU0A 2DEUA 1NRIA 4B84A 3DMGA 1F1BA 4B4OA 5F1KA 3INYA 2C4TA 3JZDA 4EW1A 1Q95A 4LF7B 2V6IA 4G2TA 4RBNA 2X0JA 3N9IA 2E4WA 2VIIA 4LWOA 1JDNA 1IN8A 2CUTA 1TZ2A 1I36A 1GQRA 4JJGA 5AM3A 3ZYZA 2PUAA 1RBMA 3RUEA 2W7TA 1IM5A 4MP3A 1KY4A 3S7ZA 1JDTA 1ZUWA 4GUAA 4V1CI 1JB1A 3MWYW 3CC8A 3GRVA 2YYYA 1RWBA 4RZXA 2ZUWA 3M34A 4IXMA 1ZM4A 5DGHA 2C04A 1EWKA 3DAFA 2VK2A 1GGVA 1ZBDA 3RVJA 3WMXA 2GK3A 4WD3A 1H0KA 2MR6A 1O5IA 2X6QA 1WXHA 1CZHA 2AK3A 2IYNA 3A9CA 3WB1A 4EGQA 4UE3S 2AN1A 1TZCA 2FF5A 4P4NA 4DQ0A 5FTWA 4E1AA 4KN6A 2BLNA 2ANBA 2YJZA 3WB0A 3BH7A 2BWJA 2QLBA 2L0XA 3Q6MA 2HIMA 1VFNA 1PS9A 3TOZA 4UOEA 4AKIA 3NBFA 3BERA 4D5GA 4HJRA 3L0DA 2XWBF 1DPGA 1QCCA 5J2TA 1O87A 4XUGB 5CXQA 1QGUB 4ZAZA 4D3YA 5I5GA 1AT1A 2JA2A 3X1DA 1G6OA 2O14A 1ZFNA 3A32A 4L6IA 2YN4A 1ZD2P 3HVIA 4Q9IA 1SUEA 1NV9A 4PG5A 5D01A 2FPKA 2HD4A 3UG7A 1M5UA 4YJ3F 1M1XB 4WFJA 3QFFA 3VPAA 1GKUB 2D8MA 3P9KA 2AXEA 3QJGA 1M34E 2AOXA 3QUCA 1G8MA 1ODLA 5AKGA 4YJ3B 4JI2B 3OUTA 2IZ5A 2H17A 4AWXA 5BR8B 4ND6A 4BNUA 1V7QA 3DVAA 1MFPA 3HN6A 2YJTD 3ND5A 4KLZA 1PT7A 5F4BA 4EJ2A 2O54A 1NP6A 2OAQ1 4PYKA 2HMWA 5J1SB 2YUTA 1Q1BA 4IGKA 3II6X 1UFOA 3ZHYA 2J3KA 4IBOA 4XPZA 1MHTA 1PG2A 1C8KA 1TJYA 3O2JA 4C0JA 5HZKA 1Y9EA 2D2XA 4TMVA 3EUFA 4BMCA 2EBWA 1W85B 2JJ1D 2QTGA 3PDHA 4TL7A 5B7QA 4E5VA 3KQNA 4GXQA 4MS4B 5DM2A 2W22A 1G59A 1I14A 2QORA 4M0CA 2Y2UA 1L6RA 2CLMB 3PKIA 4KNWA 2NU7A 3UK6A 1B3RA 2V7QA 3VHXA 3ASVA 3BSSA 1E1MA 1R5NA 2C58A 3GO4A 5CHYA 3M9WA 3ZZUA 1BFDA 1BXRA 4HQFA 4AUNA 4ETWA 3BCUA 4OMCA 5B36A 2QYTA 3HCDA 4N4AA 3DKRA 1BW9A 5EWJA 2ZU6A 3VR5H 4BGUA 4C3VA 4ITUA 3JQFC 4M0UA 1N5IA 2V0CA 4UZSA 4RGYA 4X6LA 1EK0A 3W5UA 3SOPA 3M5PA 3OAAD 5TJHA 1RLOA 4JLPA 3T7TA 1M2WA 2QZZA 4MTCA 5L40A 1J39A 2C82A 3GEPA 1JUDA 4XCVA 2V45A 3GZ4A 4EPTA 1BCSA 3LC0A 4II2A 5LZ5A 2ZE8A 1OAAA 3Q5EA 1S8FA 2IW3A 3AHIA 2HT1A 1Q7RA 2BRUA 4MKRA 1TD9A 2CL7X 5FULA 2V6MA 1A77A 4BKQA 2X5NA 4MA5A 4IGFA 2P9BA 5AUPB 1U0JA 4D3SA 1ZJYA 3TL6A 2C9OA 5BV2P 1CUUA 1V1JA 4MIYA 2ZBQA 1CFZA 4IHQA 4KKVA 4D82A 4IUBS 3WWPA 5AJHA 3UAXA 1WB4A 2Z56A 5DOVA 3OQBA 3GNLA 1M0TA 1P77A 3CEAA 4UPVA 2DU8A 4DYVA 4ZDKA 2ZAMA 2RHTA 4AMVA 2WJ6A 2HO5A 2ZYIA 1JILA 3DZBA 3EQZA 4ZN6A 3K0HA 4PBTA 2R62A 3IQWA 3WL3A 5KDDA 1SK9A 1FP4A 4CM8B 1NRJB 4CLOA 4J9VA 2G4CA 1XU4A 5CW1A 3TQTA 1AMUA 3ROQA 5AKXA 2BSQA 1DKNA 1NVKA 1T8WA 2A30A 2CBZA 2VSNA 1F4PA 3AB7A 3MILA 4Q1AA 1RE1A 4D42A 3Q9NA 2Z2JA 5GP1A 4IO1A 2PVCA 3N3BC 1SFRA 1SHJA 4HDMA 4OI2A 3B6IA 3LNCA 5CH5A 5GGXA 4V1CB 2HQOA 3D9QX 5JXHA 2HADA 4AI6A 1Q0QA 2XRFA 5KYWB 2JVKA 2X4LA 2Z8XA 2AG0A 3QUQA 1BWQA 4HT3B 2B2NA 2HZBA 1FYFA 2PS0A 1OWOA 1TE2A 2PT5A 3PNOA 4HNAB 4DMGA 3HJAA 3ZHRA 1JR3D 2ATIA 3EVZA 2BKEA 2X8BA 3DMFA 4WOBA 3G2OA 2ZRIA 1Y1KE 4L5YA 3SDSA 4RZQA 2QTZA 5EPOA 4DXDA 2VDPB 4URUR 3SQLA 4UM9B 4C1BA 4D98A 1G5PA 4YJHA 3GHYA 4M9CA 5H0IA 1KSFX 1OAOC 2C3MA 3HYSA 4X91A 2XGSA 1OX4A 2F43B 1XAHA 3HU1A 3C87A 3O0DA 1IN4A 3WK7A 3RBAA 1JFFB 1XDGA 2ZBFA 4YAOA 4U2CA 1FPQA 2JLCA 2Q1XA 4MICA 3DE4X 1DQNA 5FL7A 4N0MA 2F3RA 3HBNA 1BXKA 4TQGA 4ZJZA 1CUVA 1J06A 3P27A 1NF9A 4KN9S 1S1MA 3RS7A 3ZR4B 5ALMA 3VH4A 4WBXC 1YUMA 1TO2E 2GAOA 5J5VA 1Z2NX 5BSTA 3R3UA 1VL1A 5FUMA 1DBPA 1HT0A 4R8KA 3P0EA 2O7QA 1N7GA 2FPIA 4RTOA 3MB5A 2VTDA 2VF7A 3C3XA 4NENB 4CETA 2VF5X 1XAIA 4FT4A 5TIIA 4H6XA 1JT9A 2HWXA 1UP7A 2EP8A 2ZRAA 3S2FA 4XH9B 1WDLA 2GKSA 5BT8A 5L6LB 2ZIUB 1NLYA 5CR9A 1T2CA 4MQEB 4I4LA 4RVHA 3OQIB 1LPNA 5G40A 1YZYA 4A16A 1F3OA 2QD4A 3NHRA 1F2TA 2YMQA 3QFSA 4QJBA 3DWFA 4EX7A 3KTDA 5F7JA 2DUNA 2OQRA 4DE5A 1G3MA 4EX6A 1XDBA 3UK1A 3ZCXA 3L4BC 5JRDS 3GYGA 4CT0A 4J0CA 4XD7D 3W8FA 3GLTA 4GO1A 3FDIA 2CN1A 5BMOA 2P79A 3NUQA 6REQA 5KOJA 1BE6A 2WSSA 3KXPA 2AK2A 5FFFA 1P3Y1 4YRSA 2PA3A 2WVGA 3A4YA 4QSHA 2CJWA 1UXKA 1G60A 4S24A 4YP6A 1TRHA 4E03A 2QZPA 4C3UA 1DAEA 1UPUA 1RKBA 2CVFA 2R1ZA 3LOPA 3OZIA 4OBBA 4YRDA 1HFEL 1UCFA 3UT5B 4LRUA 1QWOA 4YK7A 1JEJA 4ZREA 3KSBC 3F2IA 1XZBA 2DXIA 4MHSA 5DBHX 3T61A 3IAS6 1CW2B 1RR6A 3AZOA 4BP3A 4DA9A 3VBEA 3PNMA 1IM8A 3CVJA 3NGXA 3SBEA 2C3UA 3T1VA 1CQJB 1U0FA 2IHTA 4ISBA 2EFGA 4D46A 2XCTB 1OHHA 5SZKB 2WF8A 2XNDA 3DA8A 1JWAB 3DAPA 1SHZA 1QFMA 5GVRA 2WUDA 3ZNQA 3U6BA 1J1ZA 2BR5A 1X3SA 2P2SA 4K6HA 4MRMB 2BMWA 2G1KA 4EKIA 4MWTA 3WMGA 1JR4A 3KFVA 5T4FA 2YZGA 1BU5A 4IMIB 2BMDA 2BLLA 2UVQA 1WDTA 2WIDA 3WGOA 5EJ9A 1EFRD 4H16A 3GBPA 3JAKA 1NM5A 3PFIA 5DDIP 4R3UC 3TMAA 2RGCA 1QYXA 2HDWA 2HXYA 3R74A 3VNBA 4AZTA 2ORYA 1HEYA 5FWAA 3ETEA 3GU3A 1G21E 3FPHA 5DISB 5HKOA 4HDNA 4GLJA 4OLFA 1Y63A 3CSDA 3FVQA 2OGWA 4KC0A 2EVWX 4DNOA 4GOLD 1NBWB 1T35A 1GNVA 2HU7A 3IQIX 1U4OA 4IQGA 4B3MB 3OM1A 3YASA 1RAEA 4TQ9A 5I7OA 3HXOA 4WGFA 1KQGA 3TCKA 1FRFS 5E4JA 3FWZA 1PJCA 3FFXA 1K6JA 3ML1A 1TECE 2BEVB 3C6MA 3ZH9B 4O25A 1TT7A 2FZVA 4EAQA 3KEFA 2PZMA 4BRUA 3C24A 2H0QA 1KY3A 2GFHA 3ITDA 3LUBA 4HY3A 4PIMA 4QAJA 4CLDA 4F72A 4LCEA 4UJ5A 1L4MA 3H1GA 1QYIA 4KPYA 2DX7A 2VH2A 3NHBA 3NT4A 1QGUA 4J0HA 2OV4A 1E4VA 4QL3A 5LQMA 1ODSA 2AI1A 2XYHA 4D8YA 1GZUA 3C14C 4M55A 1YL7A 1JE0A 3WSWA 1VLZA 4N3AA 3FUCA 2BPOA 4YWHA 5JAUA 1SXJC 3I1JA 4HLUA 4CR7A 2QQEA 3O8NA 1CLEA 3IAEA 5EXSA 3KSAC 1VKHA 4I99A 3RFXA 2C2XA 2EJWA 1BZYA 5JASA 2F67A 1FYVA 3ZQUA 3T9DA 3MMXA 1HZZC 1V4BA 1G1MA 3N07A 1Q7GA 1VHTA 1HG0A 2IHYA 4GOND 4UE6A 4EHDA 3ETCA 4WL0A 4OJKA 1KMCA 2P8SA 3DPSA 3EGCA 2YVAA 2V5VA 3HKDA 2HRRA 3AP1A 1QX4A 1GQYA 4JJ8A 4D96A 5JZBA 4NBNA 4FTWA 2C92A 3KEQA 5T64A 3IP1A 4V0MA 3B5EA 3HRKA 2CCGA 4MNTA 2VAVA 3F6EX 4ERXA 3U9SA 2M6SA 3GUYA 4A0FA 1M1YA 3OBIA 1TJ5A 3SNKA 3TO5A 4BNMA 2DAPA 4UCQA 3EVTA 4QKQA 4FFVA 4NHOA 1JF8A 3WGIA 4O2AF 1ZNXA 5CLGA 2F64A 1UOPA 1Z17A 1XNJA 3KUCA 1HMYA 3LHKA 3OCZA 5B3JA 4FB5A 4BS9A 1GUAA 4X00A 4KV7A 5JAOA 4O2AB 1TNDA 1GAJA 3PP8A 4PN7A 4AUKA 3VZSA 4EBFA 3LY9A 1DO8A 4J16C 2FPPB 3NHSA 5JBNA 4MHTA 1SOAA 5DN6A 1EZZA 2H1OA 4ZGBA 1UMDB 2G8LA 4Q03A 2A1UB 3IIIA 5BP7A 4LG1A 1BHQ1 1HT2E 2B2CA 4Y6OA 5NULA 5CD9A 1Y3HA 4P86A 2QRGA 3T4XA 3OTHA 2ZKIA 1UFVA 5BY2A 3ESZA 2IOFK 2B7LA 3MTDA 3RR2A 1YS1X 1S9HA 3C3MA 3CCCA 3FXAA 4QHTA 3K92A 2H59A 4W8GA 2C42A 1KGSA 4MVJE 1RQLA 1HYHA 3MMSA 1I7DA 2GEUA 4GSKA 1TQ8A 5HKKD 3DWGA 4HDCA 4KQEA 4JLBA 2KYRA 1ENZA 3O8QB 5AW6A 4AC9A 3HUFA 4ENQA 4WVLA 1E32A 5EKSA 4YDQA 1VLQA 1OZ0A 3BE5A 4OVKA 3HMQA 4E5MA 3ZUGA 3WKBA 3RCBA 3MXTA 4ABYA 1UPXA 4RKQA 1SC4A 2DECA 4S1PA 4D0LB 3SJCA 1O94C 2AMFA 1GYRA 4BTVA 3TOXA 1PJZA 1QR2A 2DULA 4YAEA 5L3SB 3OTQA 3C3JA 4GWLA 4K46A 4BMVA 5A7HA 1KFKB 3NGLA 4RAQA 4F5DA 3ZWXA 3LRTA 3OE4A 1T9HA 4EMTA 4WUVA 2DQKA 3ZI7A 3VYRB 4CM8A 4K9SA 3OZ7A 4DFDA 3PKZA 4LWPA 4MYCA 4NQRA 4RM2A 2WBLC 4N5LA 3TJRA 2V98A 3DEIA 1SULA 3EDMA 4KK4A 4IVPA 4LVOA 1KYXA 4LOLA 4MUGA 5HE8A 5KJEA 4AXXA 4C06A 3ZIUA 4DLYA 3TIGA 9LDTA 4JQSA 5LZ2A 4WCFB 3JQGB 5LIPA 3G0CA 1MA0A 1R0XA 5H4GA 5GV7A 1LC3A 1A27A 2NUPB 3H3JA 4XB6B 4DC0A 3MJRA 5KYWA 1AMNA 3A05A 4I46A 5FOTA 2GLTA 2C3YA 1XJ0A 4QULA 4G9EA 4QXPA 4DADA 1UWCA 1DKRA 2ZPAA 5JROA 2FW8A 4OHWA 2Y0BA 2J59A 3SYKA 3WDSA 4BP8A 2ZCJA 4TSFA 1USGA 3V1UA 2E4AA 1KZ6A 1QH1A 2B20A 4AJOA 3S2IA 5AJWA 3W8NA 3VR3D 2C1ZA 3ZE8A 4KXLA 3KAQA 3BREA 3HPRA 1V96A 3STHA 1DQPA 1DCTA 4J4TA 2PMFA 1HV8A 2X4DA 3VPCA 1MLDA 3DP7A 1MJGM 4L51A 4O29A 1PQYA 1RI2A 1MB4A 3H2KA 3RK1A 2Z58A 3D4BA 4EG7A 2NTYC 4UJ3A 4EB6B 4M9SA 1XLVA 2BN4A 4I4TF 1GM5A 4XI9A 2AI2A 2IUSA 3NX4A 2AMJA 4GBGA 3RQIA 2C9DA 4MI6A 4I4TB 2XMZA 4OU5A 4PLGA 4UHHA 5E3JA 3V5NA 1OPRA 5J58A 1HDEA 3ENQA 5FNVF 3X0DA 3RS2A 2RSLA 2QKYA 2W58A 5I4CA 4EGSA 3JQAD 4Z4QA 1EIWA 4NENA 1ENPA 3DAHA 3LIPA 2ZBVA 4Q3EA 5FNVB 1YB5A 1DIOB 1EQAA 1I5OA 1XEXB 2HT6A 3ABIA 2A9KA 1Q3HA 1SWVA 2B37A 4JLUA 4LOAA 3S2EA 4D4KA 1JU4A 3FR8A 4B6QA 4MI1A 1DWUA 4N47A 5A5VA 2V4ZA 5AKEA 1LF0A 4P4UA 1M7BA 2D2VA 3FVRA 4RLQA 3T3DA 5BSWA 4S1WA 2GEBA 4D3FA 3FCCA 2P9FA 2RK3A 4GX0A 4E2YA 1KJIA 2RHCA 3AB8A 4JOQA 1J4AA 1CDOA 1MOQA 3HA3A 4PTZA 4DQKA 1CLUA 3QFHA 3CRVA 3KQOA 5B4VA 3AJRA 1NMEA 5DBFA 3VH1A 4BV2A 2FE1A 2QG9A 3FAZA 5D86A 3UM9A 1PV4A 1A8PA 3SBXA 3WWZA 1VG1A 4Y2HA 2VP0A 2V7UA 1XVUA 2GCEA 1C9DB 4M8IA 2PY6A 3SXJA 1SXIA 3CRRA 3IHKA 4R7GA 3W5VA 4AROA 1OTXA 3AUFA 4RLSA 4YAUA 4R31A 3SEZA 2KBEA 2APJA 3HM9A 1AJEA 1M2KA 1OBFO 3IFSA 3O8OB 1XTVA 3OZEA 3O92A 1FPMA 4KW7A 1SZJG 1SKQA 1RABA 4DLZA 1CQJA 1UWKA 2C2YA 3I39X 4WZAE 3UHFA 3UY4A 3W06A 4NU6A 4X63A 2R4UA 1VLJA 5A6SB 5KWIA 1UKZA 3NNSA 1Z38A 2YICA 4Z4IA 4AICA 1E1CA 4B83A 2IH2A 1LV8A 4FNMA 1FLDA 1K5PA 3L9WA 1DKMA 4WNYA 5FPSA 3GZNB 3PFCA 4YRGA 1BNCA 3IOMA 2VYNA 4CIBA 1ZN2A 1M75A 3V8MA 1KAMA 4CLEA 3QPCA 4DJTA 2WPDA 3E2IA 1GOTA 5KWSA 4BE4A 4B6EA 2H2WA 3ETLA 3KOUA 4ITVA 1KI9A 3GB9A 1URPA 4HEA6 5K03A 2MYUA 1KI7A 1U7DA 1KJQA 1USVA 2FLVA 1LDNA 1P6XA 2JCBA 2NU6B 3AILA 3D6UA 2CLIB 1GSIA 2D59A 1FNDA 3FPLA 5DHUA 1APBA 3CZCA 4XSVA 3BTOA 3KEGA 3WHKA 1EJ2A 2YRFA 4TKUB 1Z29A 1BE8A 2R8PA 3LLSA 2PUEA 3CLRD 5BQFA 3JD3A 4TLAA 1QOPB 2HMVA 2ZYWX 1PWEA 5DNDA 4DMCA 3BHIA 2OCYC 2OK8A 1TZMA 1X15A 1NW4A 3MN1A 2C4NA 3KYDA 2PCJA 2H2HA 3PC8C 4HBGA 4GX1A 4M9ZA 1OB2A 1N5DA 5JJBA 3DZKA 4BCBA 4RDXA 1J9EA 1E2UA 3FDXA 3M6AA 2EJCA 3WYCA 1UP6A 1N2XA 3I45A 3TMYA 4E3WA 2NTNA 3WOHA 1ZHFA 1E3TA 4HUTA 1NOJA 4IWNA 2CCJA 3R7FA 3DV2A 2HV9A 3UCEA 1QP4A 1T13A 1U31A 3COJA 1QH8A 4DILA 2AFRA 2HHCA 4NZMA 2AIRA 1G6KA 5K0GA 2XOKD 4KVFA 1UXOA 2R7MA 2WJGA 4MULA 4OAPA 2OORA 1EHCA 2QL9A 3A28A 3K31A 4UULA 2BVNA 2JD0A 1QFJA 1XTPA 3CPHA 4XM2A 5CDFA 3QLVA 1C3LA 1GG5A 1AU9A 4IZHA 3SJAA 4FOLA 2ZU0C 1P31A 1GNSA 4ZDWA 1C1XA 1XLTA 1E1QA 1T25A 4KDFA 2VCHA 4G5RA 2RARA 5GOZA 3LLCA 3F73A 2C20A 3FD8A 4Q6BA 1FTSA 1I4TD 2VNAA 1ZW6A 1EZ1A 3KXDA 1D4ZA 4A0RA 4AAYA 3PNLA 4ZYLA 3F90A 5DGXA 1TZBA 4U1RA 3MPOA 3TZCA 5AVSA 2R96A 1WMFA 2D1SA 2GLUA 2OCDA 2P6UA 3CG0A 1ADJA 4DCJA 3AY3A 3L40A 3QXCA 4JX9A 2IE0A 3SI7A 1SUAA 2QP9X 3AF6A 3PD1A 1HTTA 1WU7A 2IHBA 1XK6A 4X1YA 1BN6A 2O3TA 1HM5A 2ZIFA 2XGJA 4DDUA 1Y6QA 4DM3A 4MVJM 4Z54A 2W6ID 4O2AA 1QR6A 3KUXA 2J31A 5KKNB 5CFOA 3HU3A 5F1YA 1PFYA 3IQXA 1YSCA 4X95A 2AUNA 2FPPA 2HBYA 1AURA 2RBGA 3CLUC 3LK7A 1E4EB 2HK9A 1JH8A 4LYFA 4MUIA 3TOCA 3TQQA 1M74A 1OLUA 3WGJA 3U1BA 3NHLA 1J7KA 1WQ1R 3VV2A 5JSUA 4QBHA 4IGIA 4PRYA 4OL9A 4MWBA 3OPQA 4R0NA 4YUYA 2O7SA 1HT1E 2F3TA 2ZYTX 4UZEA 1RCUA 4KYUA 3TUIC 2D3WA 2IZ7A 4DMKA 3PRKE 2PJRA 3A1DA 4TTAA 2IUFA 3OTGA 3G8YA 4RPCA 3PCXA 4Y2GA 3BXZA 4WN9A 4NY1A 4FWTA 4LUCA 1SGWA 2HMUA 2IC5A 2K2WA 2RHJA 4RE5A 5CDYA 3O8QA 2PKEA 1DQYA 1J0EA 1XT6A 3GNQA 4BOYA 2A5GA 1T5IA 1DS6A 1KI8A 3AKZA 4TTJA 5JCOA 3QVJA 2EJUA 2Z9CA 4OH7A 4AN0A 4F3NA 3R5KA 5MHTA 5J5CA 3KZ1E 3Q88A 2W2XA 3M3DA 3ABZA 4ZRNA 1G2IA 4HDSB 4NJEA 1NQVA 1K5GA 1AB6A 1W0JD 1ULZA 1V3VA 2O3QA 1XLWA 1L3BA 1YRWA 1Z36A 3R7WB 4D3DA 2QVGA 4BB5A 1FQKA 2H1FA 2HK8A 1I0IA 2X8JB 4BJ6A 1QUEA 4NFHA 2QN1A 2AFVA 3RU7A 1QF6A 4UBOA 4H0CA 1M8GA 5D1HA 2AD1A 5EKUA 5CB4F 1T9CA 4EB3A 4IUCS 2AYYA 3U4AA 1I80A 1JU9A 3Q9UA 2FI1A 4BMSA 4LZAA 2P0YA 1NHGA 2Y1LA 5CB4B 4K9DA 1P74A 3C3CA 4ZT7A 1YOBA 1P0CA 4PVCA 1D7OA 3FUTA 3PF8A 4KXQA 2G06A 4MQ4A 3I53A 3O2SB 3DL0A 2BDUA 4IDCA 2V7QD 2H4JA 1W36D 3K0FB 1N32B 3A4VA 2R8OA 2BF4A 2H2FA 1GJRA 2II6A 2K5UA 2PJZA 3E81A 2EYUA 1JQAA 3OLZA 5AJYA 5TX7A 4EPWA 3JYQA 3OSZA 4OJQA 3DM9B 1FVFA 2G67A 3NV9A 4FX2A 1C80A 2IHJA 4B85A 3FH0A 4IS3A 3U60B 1E60A 1MA3A 3HCEA 4BY9E 2O2DA 2P9TA 4U3JA 2ZUCA 4WJKB 2QZJA 4M60A 3U7HB 3LA8A 4GMHA 1ZIYA 5AKZA 3NNNA 2JLBA 5JZSA 4NEGA 1NXXA 3RSOA 2QIPA 3PIDA 4JQOA 2R8BA 3P4UA 1X86B 2W48A 1QZUA 1SO8A 2PT6A 5JSQA 1JFSA 3H5TA 2IHVA 3RS5A 2ZETA 1E18A 4GUDA 5YASA 1T6BY 4EB6A 3ADCA 1RM4A 2A9QA 1X1DA 1MX3A 2HPHA 2Q29A 1U2RA 1L4LA 1K92A 2F1KA 2BMAA 3UWOA 4ND1A 3F7MA 1KNXA 4JR0A 3IAS1 5LB4A 1HQCA 3M4NA 1COWD 1KEPA 5L53A 4AIIA 1M66A 2L2QA 1C7RA 4OKSA 2ZRMA 1FXWF 2WJHA 3UF0A 3VTAA 5E2BA 4V0QA 3WYAA 1UJBA 2J3HA 4V0OA 5HFJA 4EITA 2DERA 1W5BA 1BEZA 4IS2A 1Y1TA 4H6PA 2AZ4A 1S7GA 2NQTA 1R4AA 3IB6A 1BS1A 2B98A 1MKYA 5AXBA 4UXIA 3EG5A 1G98A 4B6GA 3L43A 1CEXA 1GSAA 2ZYHA 4JL5A 2JBAB 4P08A 4F7WA 4K81B 5BOSB 1SOMA 2C2WA 1VIDA 5L4SA 1JVSA 4GF5A 4RF3A 2DFVA 2UYYA 3PENA 1NR1A 1OT3A 4FFDA 4LRXA 4QNNA 4H3HB 3UMGA 3OA2A 1YIAA 3Q7TA 1NYRA 5EGSA 4MVJI 2EIXA 3WYGA 5HR5A 1E2HA 2OD2A 5IASA 2P78A 3AINA 2ZI7A 2YXBA 4G5YA 5IF9A 1GPH1 2CWDA 1WBDA 2B8JA 3W05A 2EG5A 3TEFA 3TW0A 1U8ZA 1XHEA 1UC9A 3CRZA 2BH2A 2O1XA 4NU0A 3AYZB 2HXSA 4FXOA 4LC9A 4X7PA 1YVPA 4LDQA 4X61A 3GC6A 1RT9A 1UT6A 4MPDA 1MGOA 5JJKA 4NAHA 3X44A 4AKEA 4NCIA 3O8OA 4P81A 5EKTA 1A0OA 3QLJA 3S1AB 4B3TB 3EEQA 1QANA 1V11B 1FLAA 1XZKA 4FNAA 4MQMA 3VDNB 3QXHA 5KOHA 1M2GA 3K5WA 5HDBB 4X7BA 3VTZA 4W5TA 2P35A 5JYEA 3L8CA 4H4EA 1O96A 4A23A 1NLZA 2ERCA 4U7PB 4AB1A 3D6VA 3MUFA 1PL6A 5LC1A 3TBKA 1QU3A 2C03A 1PWXA 1ULAA 1W47A 4KR6A 1H69A 4FMDF 1ZJ5A 4RXTA 1PR5A 3GDHA 3IKJA 3RE1A 2IYOA 3KTAB 1AC5A 2OV6A 3G2PA 3JWIA 3OZGA 3Q2OA 4WNAA 3TW6A 2NZVG 4DLNA 3D3WA 4FMDB 2NO4A 4YMSA 1NASA 5FL7D 4ZWNA 5ILQA 2DFKB 4FFOA 2Q5LA 1E5DA 2ENUA 4MB2A 1CQPA 1HE3A 2AN4A 3QX3A 1Y6JA 1Q7TA 5BR1A 2QQGA 1KTIA 3L4KA 5CT9A 2NU6A 2PTGA 4Z7JA 5KQSA 2E21A 1KOGA 1HDYA 5GPBA 4Q34A 1D2NA 1L7OA 4XFKA 3VO9A 1BWPA 3AVVA 2NVUA 1JMYA 4EKYA 4URXR 3WYNA 4GD3Q 3H75A 3RJZA 3OZVA 1MIOB 3I6MA 4TKUA 1UDAA 5BQXA 5LBTA 4XIYA 2DKNA 4P0QB 3PQFA 5IMBA 3E9RA 4MS3B 2RAVA 4YRJA 2XI4A 3DYBA 4WIAA 3QMPA 1X9IA 4L0CA 5IVDA 3W4JA 2F2TA 3DAGA 1C0PA 4X6XA 3VMMA 1E58A 1YB1A 3R0JA 4LJ6A 4WADA 2O5EA 1FYDA 1GR1A 2IELA 2Q3FA 1CJVC 3P9IA 1D7AA 3GLVA 3QPWA 4UTOA 1SC3A 1OLXB 4L07A 1G9TA 4RWEA 1JPJA 4MINA 5FT9A 4RHCA 2YHIB 2OHHA 2FDCA 4ISCA 5EZQA 3RUIA 3R24A 3R77A 3I6ZA 5ADHA 4DUPA 1S3IA 1BHSA 2GVNA 2WSSD 3F6BX 2Q8QA 5EC8A 3WKAA 3NH9A 1PYGA 1AZTA 3ZZ1A 2ADMA 3N6RA 2HA4A 4X6YA 1TCAA 1XAJA 4TZKA 4XB2A 5FOVA 5FOQA 4KO3S 2Q7OE 1JFLA 5EIWA 5U4XA 3KSZO 4UEWA 4C2TA 2QVXX 1XCGB 2E0IA 5EJEA 1F4LA 1ZOSA 1SA0B 3HH8A 4N7RA 2ONJA 2NZ8A 4IFBA 3ED1A 1AQUA 3PQ3A 4JGIA 4TLEA 3ZWBA 1YKSA 4MKIA 2PFGA 3IEVA 3ZOKA 4Q1EA 3AY7A 2YR0A 2ZCVA 1OHHD 3ISTA 1N2IA 4HUJA 1A9XA 2XNDD 2MSNA 4PQRA 3VI3B 5JSZA 1KQ3A 2QR2A 2D54A 4NCJA 3ICCA 3HVUA 4QYWA 1UODA 1XF1A 1MC5A 4LXYA 4BFTA 3H6KA 2XUAA 2AZTA 4MXDA 1SKUA 1CUDA 3K5IA 2X40A 3VC2A 2QN6A 3ZD6A 4L2IB 2DUMA 3AI1A 4GRDA 5EAIA 5JJIA 2XLCA 1WD7A 2Q3CA 1H6AA 1US8B 2OFOA 2QR5A 3J7TA 3RWOA 1NF2A 3OO1A 3S44A 3WWCA 1SKMA 3NUZA 5IBRA 3BDAA 2YOGA 2Z4TA 4Y6PA 3H2JA 1Q77A 1UT8A 3IDOA 1EP3B 1RI3A 1EVQA 1CERA 1TYZA 2BV3A 2OY0A 3BEOA 3EGOA 3G0BA 1UBJS 3K2EA 5E9QA 4DTIA 2OXIA 3DCJA 4KPFC 4PSVA 2ORED 4LGYA 2OZVA 2PGOA 1PFQA 1V1MA 3NS7A 4BQNA 3MWEB 3MWKA 5TLSA 3E35A 1CNEA 2W71A 5ICEA 1VHWA 3CNLA 3HSSA 3UJPA 4BNHA 3R0XA 4EHFA 2H1IA 4BX8A 4YRBA 2QRMA 1NATA 1Q0RA 3LY7A 5TQ0A 3V1TC 1NBMD 3AEQB 3FNIA 1VXOA 1VECA 5A03A 3QWAA 5DP1A 3GN2A 2ADOA 5BUQA 1ZSVA 4RVDA 1DEXA 5CK4A 5EA2A 4HWSA 3PNBA 4ER3A 4WZBE 4ZXPA 3CBGA 4F9FA 4INAA 3COVA 4L9SA 4KDEA 5AVWA 5MGBA 3KQLA 3R09A 4QO7A 1B76A 4CL3A 2JLWA 4V0NA 4Q3BA 4AKTA 1V8ZA 4CV3A 3LCRA 3L7OA 3DVLA 1UBNA 4GSLA 4MV5A 4HDSA 2OO5C 4B80A 3VSCA 3DGEC 5LR6A 3PA8A 3NLLA 4R1NA 4RTLA 2FTKE 1CG6A 3ZBTA 1OYYA 4ZCLA 3R7WA 1GYPA 1OLSB 1ORIA 4MOWA 2RGUA 1TQ4A 2KB0A 1VMKA 2X8JA 2CMDA 5CVJA 4TRRA 4Y3UA 3U4DA 4CTKA 4DWJA 6AT1A 4XASA 2JHAA 1MO4A 1N2OA 2O9JA 4IDFA 3AWIA 4FZJA 1X8KA 2AE2A 4YR7A 4AQYB 5JNVA 1K3TA 4JU8A 3EXG1 1E62A 1DQZA 3O38A 1CR0A 4U4AA 1I94B 1Z7YA 1F2VA 4CF6A 3S8MA 1PFUA 5AW7A 1YRQA 3FHCB 4XXHA 1THTA 3PUWA 3K0FA 3OIUA 4LI0A 1DMSA 1UOOA 1T2EA 1E7YA 1X7DA 1D9ZA 3LWDA 4NK5A 5G3YA 3AF3A 1E2EA 1HYGA 2Y3IA 3IRVA 1U7PA 4WI1A 3K9NA 2D5BA 3DHYA 1CD5A 3OICA 3CTMA 5B2ZA 3D8HA 3W1VA 2FU5C 4JMPA 5DN6D 4I5DA 3HBMA 4NABA 3L6UA 2HPAA 3VTKA 3LLUA 5C32A 2ZJZA 3IURA 5KVCA 1MR3F 1A1SA 1UT5A 2I71A 3ITNA 1WCWA 4WERA 2DQYA 1UMCB 1Z16A 3FIJA 5EE9A 1RM5A 4UATA 2ZTMA 3COWA 3KKPA 4S0ZA 2Y68A 1P5JA 5REQB 3H84A 1N6LA 2CB0A 4N6NA 4PEVA 4B3XA 4BB9A 3K1AA 3VH3A 1Y8RB 1RQ7A 3CPJB 3MQ2A 3K2QA 2FPOA 1G20E 3PEFA 4G1BA 4IDNA 1YVEI 2ZBPA 1XPRA 3P32A 3A6JA 2BFDB 2VN8A 4WOPA 2W0SA 1VSVA 2WG2A 2ZWMA 3GRRA 1PTKA 2A88A 4RQBA 4GT1A 4DQLA 5JY1A 1UK8A 4ENTA 2F1HA 2X77A 4DJJA 3RB8A 1N6OA 2ZRBA 1E5TA 3FM9A 3I58A 3PS9A 4QFDA 4RY0A 4R51A 4Y6SA 1SQSA 3RHZA 2JBAA 4LV6A 4GGPA 4TS9A 1G2QA 5BOSA 2DYKA 4I5IA 4J0FA 5B64A 2G3YA 4B4DA 2GNPA 1I6LA 4OXYA 4P53A 5D5PA 5IUJC 2BMVA 4HEA1 3GG9A 3ZGXA 2QNBA 1VBFA 1YZVA 3S2ZA 3CSUA 3DE5X 4DR2B 3GT3A 1MQSA 2XIJA 4NQZA 2NZJA 3X1ZA 1VLMA 1Y5RA 3BEDA 1UDRA 3D6HA 4H1WA 1F9AA 2HFKA 2FKAA 2I6QA 2NYRA 3VVLA 5AQEA 3H13A 121PA 5DJ5A 2CLSA 4P36A 1AKNA 1FFWA 3CT4A 4LJ9A 1XTKA 3U62A 4GPBA 1JJ7A 3R76A 1K9SA 4RTJA 4M0KA 3KOZA 5DIZA 2FEWB 1ZKMA 4P54A 3OWXA 3S1AA 1RACA 2DQZA 3HJHA 7REQB 5KTKA 2VAMA 4YJFA 1PR4A 4TSFD 1WPQA 4B76A 4EMUA 4KXYA 1E9CA 3FDZA 1ZEMA 4QTZA 3IOCA 4J6EA 2NO5A 2C31A 5HGJA 1XLUA 2GARA 2IW1A 2YIMA 3ICOA 3D7MA 3ZTYA 1YS6A 4MQFA 3JS5A 4P3XA 2WT9A 3EIHA 4HPWA 4NWIA 1E64A 1SD1A 1SIWA 4HH4A 3ZEAA 2ZUVA 3AGQA 3PQ2A 1UJMA 1P17A 1DBVO 1LLCA 5AK4A 3AIMA 1C3XA 4Y1GA 4BMZA 1CR2A 2YZ7A 1WX1A 3BF7A 2LGJA 4F2PA 5JHGB 1YB7A 5IC5A 5JHHB 1T24A 3Q8WA 2FSIA 1FDVA 1VJCA 4WA7A 4DQUA 4PYOA 4U6SA 4K0RA 4MYTA 3I73A 1OBCA 2R4QA 3JWHA 3UK7A 3VR4H 3GLGA 3D4LA 1XMQB 1DC5A 3OZTA 1WZCA 5EHXA 3DUWA 2MMCA 3O03A 3VSDA 3KQMA 5B58T 1MIOA 1XVAA 3G59A 2VJBA 2O06A 3SQNA 4JUCA 2Q2NA 3FBTA 1C1YA 4HS9A 3T7DA 2C59A 2AQHA 4IL5A 4N1AA 1MH1A 2G9ZA 1Z06A 3E7FA 4FHZA 3BMNB 3TEJA 2FJUA 4BX9A 4CM4A 3NJ4A 3PXBA 5BPFA 3UV3A 3GEGA 1X1CA 2WU8A 2VZLA 1PQPA 4MTLA 5ANRB 2VATA 1OLXA 1PJ3A 4JBGA 2ZLBA 2DTXA 3R9IA 1P7WA 1YDMA 1NW7A 1FE8A 2B7BA 3FJOA 3JD2A 1R8SA 4JH0A 4MCIA 4OXRA 4XYEA 4N65A 5B5SA 3CYFA 1P9RA 1WL8A 2YHAA 4ZPXA 5DSZA 1TRKA 1WTCA 1MRSA 2WWIA 1E2KA 3UTCA 1ISSA 1JBKA 3WP1B 3H9UA 3OF3A 1GQQA 4MS1B 5I7EA 2DCMA 4RENA 4AUMA 1IJFA 3H5VA 2MSDB 2XUOA 3Q41A 1QGYA 2YWXA 5DOZA 2VOEA 1VC2A 4J1TA 4KQKA 5AVRA 4ZMRA 4DR5B 4LE1A 1T1RA 1UBEA 3A6LA 3K1TA 1RYFA 3EK2A 1JHDA 3P2JA 4G8BA 3P52A 4A8HA 1NXWA 1EFCA 3MJSA 3M1IA 2VJCA 3OZFA 1CP3A 2YVKA 4L4SA 2YQ4A 4DSZA 1QO0A 5EJAA 1GZHB 1K7EB 4IILA 3SFTA 2G5CA 2P41A 3F96A 3DZJA 1GNLA 3P4XA 3GR6A 1HC7A 3BN3A 3H4MA 3EMKA 3NM4A 2ZSAA 1I4DD 3NYWA 3NJRA 3FVVA 3W3ZB 1B3BA 1WMAA 2EFHB 1T1JA 1OROA 3IKLA 3OSUA 1FP1D 1EMDA 1O4WA 4M76B 2RB5A 3BB1A 4XGKA 2FGKA 1E3MA 2FZCA 1AF4A 4G84A 1L7DA 5AW4A 4OJYA 1Z4LA 4AYTA 1OVMA 3KFLA 3DFFA 1WULS 4B0OA 4LF9B 3GFOA 1Z28A 1ZVQA 1LBEA 3A4MA 5ITWA 1TAHA 1WXXA 2BKVA 2GD6A 5JBIA 2Z5LA 4NHEA 3H9QA 1SMKA 4BVAA 1FDSA 4D4MA 4OD0A 3JATB 5EI5A 2RD2A 3OX2A 4O4HA 4EKNB 4LISA 3V8VA 1SCKA 1QE5A 2CFCA 1UBSB 4KFUA 3TSCA 5DCLA 2FAXA 1BGXT 4D4LA 2LCQA 1QV6A 3CJRA 4IHAA 1TZKA 4JYPA 2PUDA 4B3BA 2O52A 2OCIA 2QI9C 4PC2A 2AZXA 2WDZA 1GUBA 1QK3A 1L2TA 1SUFA 1TIBA 2AF4C 4MGEA 4P82A 4CGYA 2WZCA 1GD1O 1XHLA 4UQLA 4GX2A 3DR3A 4Y2PA 4HPXB 3WGTA 2WHEA 4CT4B 3ZJUA 1GVNB 4JP5A 1ISGA 1SXJA 2DH5A 4ZAFA 1R0SA 4B6PA 2BI8A 3Q85A 1U9IC 3AG6A 1GKLA 3BD6A 2H9AA 3U44A 1H3FA 1E3IA 1GCUA 3HU2A 2VZ9A 3B70A 4QOGA 3RYFA 4FFRA 3KJFA 5SYAA 3I61A 1XX6A 1ZK0A 3T5BA 1ZD9A 2ZYRA 2EQBA 4F3YA 5THKA 1LBSA 4F92B 1KO4A 5K8VA 4DWVA 1NL3A 3G9UA 4AG6A 1E3DA 4O2BF 1Y9DA 3QG1A 4K6GA 2V1XA 5AW8A 1PJ4A 2GPSA 3LVBA 4P0TA 4R84A 2EGUA 1NQAO 4EVSA 5JS7A 2BZ0A 5HFNA 4O2BB 5ARBA 1GLNA 1E1QD 4PAGA 4C6TA 3ORQA 2FEMA 4C4OA 1AKUA 3U7JA 4AZ3B 4RULA 2C2HA 1A2KC 2HLPA 3A6FA 4PYNA 1YRAA 2ODEA 1JLKA 4E14A 4XUDA 3X43A 3ZNPA 1ULSA 1Y89A 4N54A 1Q44A 2GD2A 2Q5HA 4J16A 2VJOA 4XYGA 1TM5E 1SZCA 2EC5A 3C7TA 3JU3A 2R00C 4JN6B 3PXDA 1M2OA 4YP5A 3FOZA 1K6EA 4KYTA 4EG8A 5JLJA 3QP9A 1FZTA 3CB4A 5BRAA 2OZKA 1P4AA 1BD4A 3NBMA 1YQEA 3MAJA 4G0NA 4Y1FA 3ZCRA 3MZ0A 1GCIA 5BT9A 2ALJA 4EQ6A 2R68A 5A71A 1LPSA 5DFAA 4KHPB 4BATA 4GRAA 4K28A 2VHTA 4OQPA 4RS4A 3SWWA 4B3RB 4EYSA 3L6BA 1XJWA 2OFPA 3DB2A 3NBZC 5CXSA 3OIWA 4AX4A 1HR0B 4S0XA 4HAWA 4IIGA 4POOA 5AM2A 4OHVA 4B35A 4LSMA 1UMCA 1W8IA 1GYQA 1KEEB 1UMBB 1LX7A 1W4ZA 3OESA 3KHKA 3O74A 4MB6A 3OEHD 2LR0A 4TMFA 3Q6NA 1ZK3A 3LFTA 3NCHA 1MPXA 1YBHA 2H1RA 1H4QA 4JLOA 2MT9A 3A4LA 4PICA 5DF1A 3WSTA 1N2CB 1O94A 3L1HA 2DP4E 4H1HA 2ID9A 1JKIA 1T8SA 2XB9A 4QEKA 4ZC8A 3NAGA 1G41A 4R1LA 5IXYA 4EUEA 4G6ZA 3ZIAD 5I7UA 2BFDA 2QROA 2WTBA 3GLFB 4ER5A 3MINA 4Q9HA 5A06A 5IT5A 4GICA 1EVKA 3N2YA 2EFYA 4L8FA 4M3NA 3LCCA 1XN1A 4QDTA 3RVPA 1NU6A 1T5TA 4CQNA 2DGDA 3QWIA 1EH5A 3EPHA 2PPLA 2PMWB 4QUGA 1BKDR 2P2ZA 4GI7A 3M1LA 1F06A 4E2WA 2IUYA 1OXTA 2WAMA 4Q01A 4NG5A 4BVLA 1UDWA 3B2QA 1FS5A 3J81A 4UREA 4YBZA 1K86A 2VO1A 1GZDA 4QA9A 5AVYA 2PSJA 1GO2A 3RIXA 1AKVA 4EOGA 1VIVA 1OVGA 5KYNA 2EKLA 4FGZA 3ZV6A 4BQIA 2X6TA 2W11A 4PZPA 5DNVA 1Q16A 3B85A 4C4YA 4ZOAA 1JBQA 1LJUA 4EFKA 1TPZA 3QI2A 1FDTA 3U49A 2FKNA 2PKQP 1KJWA 2Q1UA 4C5AA 3WRXC 3IL2A 4L5CA 4EHJA 3VDRA 1I3CA 1ZCAA 5FWDA 1SRRA 1VG9B 4PBSA 3OOJA 4Q4HB 1N1EA 1LBIA 2PRZA 2F1JA 3PU6A 4GWGA 1R4NB 4NPCA 4BNJA 3QEJA 1TM7E 1L5OA 1LTQA 1TQ2A 4TTQA 4UQPA 4JGGA 4RK4A 3V4LA 2B30A 4FMPA 4QAQA 5AKKA 1GXSB 1D4OA 1YDWA 4HZUA 4TXNA 4N49A 3SZMA 1ZA1A 4ZVNA 4EK9A 5BN3B 2OWDA 1VSTA 1BROA 1HXHA 3HFRA 3AR6A 1TUEA 1E92A 4IUDS 4YO7A 3H18A 4EW3A 1D2RA 1ISFA 1LDGA 1ZI9A 2I0FA 2X0EA 5JNRA 1KIFA 4IFTA 3G9ZA 4P4SA 2NNWB 4J7AA 2A14A 2VYVD 3KQYA 4LPKA 1TLFA 1J24A 1A71A 1PSZA 1A50B 2WHYA 4JENA 4A0QA 4R01A 2HTEA 2I7DA 2H06A 3IV9A 4FDMA 2EKDA 3OZXA 3EPLA 2DJ5A 4FYKA 3EF3A 3L6DA 3RRZA 4EHLA 3AVPA 1VCNA 5J40A 4J7XA 2QGNA 2ETXA 1OI7A 1CQZA 1OBVA 4Y0AA 4A8JC 1RWKA 4IZ6A 1E9RA 4U39A 1Q20A 3WDLA 1HUQA 2C29D 4GI5A 3BE6A 4IZOA 5LQJA 3LPMA 1IN7A 1CY4A 3D6FA 4JJEA 2IPXA 4L7QA 3MS7A 4W5NA 1T3TA 3C98A 4EBBA 1OF1A 3N5KA 3AC0A 1KDRA 2VYQA 3BGWA 2GSDA 2PLRA 3O1LA 1NE2A 4H18A 3CKKA 4Z1MA 3IDQA 3ESYA 4OXKA 1T4DA 5CLJA 3DTTA 1CJBA 10MHA 4ND2A 3V4PB 1RRFA 2P91A 3CGGA 2XPCA 4J0EA 4DARA 1IZ8A 3A31A 1QHXA 2XNSA 4IOKA 1K5DA 3Q98A 5FAKA 4F2DA 2D0DA 1BMQA 2FQQA 4HEQA 4HUQB 1BYUA 1QQ5A 3LHDA 1HQDA 4R1TA 2W2VA 4OGGA 3UQZA 4AJ2A 4NG4A 4RVNA 1O95C 3L6OO 1H2YA 3PJEA 3P9ZA 5EP3A 3G13A 2CFSA 3GJSA 1TYBE 3D8NA 2WTXA 1YJBA 5B1IA 4I8XA 1BCRB 3SX2A 4B6OA 2GM3A 3TLXA 3PJGA 1G55A 1OFGA 2PLAA 3EWNA 4V2IA 2OQVA 3FRJA 3PC4A 1V9LA 2BDTA 1SKBA 3HDQA 1T8RA 2Z57A 3OPXA 4IIDA 1ZAKA 3UJ6A 2YNMC 3GCZA 2YWGA 4I19A 4RD4A 3C3YA 4IGEA 5KIAA 4PANA 3KLPX 3TTWA 1TYDE 3NHJA 2HN9A 4BNFA 5BVGB 5KYKA 1C8LA 4UD2A 3Q3JB 4RFSA 1HDCA 3S28A 4FUTA 4B33A 5TPZD 3ITEA 1EAMA 1LDBA 1R8QA 1ZXXA 2V7TA 4IPTA 1NY6A 5AESA 3RTEA 3N05A 1UJ2A 3STXA 3SC6A 2M6LA 5FEUA 4P83A 1P7YA 3LQRA 4IP0A 2XADA 2XODA 3UJNA 2RH9B 4Y2RA 1J0XO 2G6TA 2XSZA 3UMRA 3W2HA 5THXA 3CMCO 2BAGA 2BJHA 2BM0A 3PDCA 5ES3A 2RGDA 3O31A 2HA7A 521PA 2PUCA 4OI0A 2XBUA 3P7MA 4X6UA 2X3FA 3RUFA 4YP9A 3ZUPA 4B74A 3JATA 4ZI5A 4X3OA 3WRWA 4FMBB 2GPJA 4PPFA 2MTBA 4LJSA 1I1NA 3A11A 4GM4A 5D87A 2N0SA 1UK7A 3SCZA 4FUQA 2ZG6A 4FBGA 4OPMA 4WDRA 4HB2A 3N53A 2HY7A 4F91B 4Q19A 3G49A 1RAFA 2G0NA 3FSGD 5F73A 2CUKA 3RGWS 1T8PA 3MCWA 3NC1C 2NO1A 4LZWA 2G5TA 1WP4A 5D84A 2IX3A 1UJNA 1LWOA 2CHQA 2GNAA 4G0PA 4R1PA 1E9SA 1W52X 1ACMA 2WVHA 3U4CA 5I47A 1ZI8A 5ICGA 1N2SA 2XB4A 5IT4A 1D4AA 5ECGC 5JSYA 3UAWA 3CUSA 3QVOA 1E9AA 1A9SA 2NO6A 3IAAA 1DIHA 4N40A 4RW0A 4QQNA 3LLMA 3P9CA 1P33A 1IY8A 1D2CA 1UFRA 3B6ZA 4J49A 2VA9A 4LBVA 1E9FA 3E05A 2XZPA 4KSYA 1P5HA 1JTFA 4ASUA 3DNPA 5LQCA 4NX2A 5FI0B 3RGGA 4NR0A 4IIJA 2GN9A 4AS3A 3JVIA 1JDJA 1F51E 1RADA 4BEJA 2M6RA 4EGFA 6YASA 2HPZA 4RMJA 2CXXA 5E6RB 1GQ2A 3RJTA 4MDFA 1FY2A 1OV4A 2EKBA 1IDN1 4EECA 2YFKA 4O2BA 3JPWA 2XCSB 4KNVA 1P2VA 4RY8A 2YIVX 4E32A 3AEZA 1T8TA 3H7IA 3H83A 4DCNA 2H1VA 2CDCA 4JC5A 1XCJA 3BAZA 2VBGA 1LLFA 1C9MA 2OB2A 4NDAA 3T5CA 1UBLS 4OSEA 4CL8A 2XX3A 5KHOC 2ZIXA 4RIFA 1BQEA 2PSSA 4NTZA 4D9EA 5I7SA 3MOGA 3DCYA 1Y1PA 2PQ2A 4RCVA 4BO7A 1TDJA 2VTVA 4JASB 4C43A 3RJ9A 4FJ0A 5KQLA 3LDUA 1W1WA 3CN7A 3JYLA 4RIIA 4YRPA 1G17A 2G76A 4YRNA 5JCZA 3SZRA 4YRKA 1DG9A 1GP2A 5K3CA 3UMJA 3F5DA 4CW7A 1EHIA 1TI7A 3TLGB 1XO1A 4BJ1A 1THGA 1MC4A 3DDCA 4ESOA 1CIVA 3FPSA 4RSRA 5EMMA 3TG2A 3I2YX 2E2WA 3UC5A 1F0NA 1ONSA 2Z1DA 3A6ZA 3TTYA 3P5BA 5COQA 3R7BA 2JAWA 4KRFA 3QKWA 2V7BA 3MWDB 5FA6A 2Y6UA 2B8WA 3V8PA 5AYVA 1CUZA 3DMRA 1YRHA 4ILKA 1KEEA 1LBQA 4JYMA 2CDAA 1H65A 2PH5A 3EZXA 4HLNA 2DBRA 4AF6A 1C4WA 3B1YA 1GLVA 2C4MA 2RH8A 4Q3AA 3VKUA 1I1QB 1S2LA 4IRUB 3AF1A 4G0WA 1I8TA 4JD5A 2UZ1B 4KMSA 4R9UC 3TLYA 2BBTA 3BUSA 5JUWA 6GPBA 3H9CA 1C3OA 2C0CA 3A14A 3T4PA 4HXYA 2VDMB 3ZE2B 4UFNA 2JZCA 4LJLA 2QF7A 3OEYA 1K8QA 1I7SB 1M1NB 1SUSA 1TW2A 2ZIZA 4MPJA 2WJ4A 5JCPA 1UFKA 1EJ6A 1YU6A 2FRDC 1P5FA 3C5VA 4GR9A 5FLYA 1RWWA 1LVHA 4G0OA 4URYR 3T9CA 5B1SA 3HQ4O 3X1YA 1U63A 5DM4A 4MUMA 4Q3OA 3WFJA 4MZXA 4JQYA 2ANCA 3BULA 3ESXA 5EZ5A 3SD7A 3T1TA 3DZDA 3GLIB 1SXPA 1DB3A 1WMBA 4GVXA 4CMIB 2R25B 3UMSA 2YXLA 4IDBA 3VDQA 4UUBA 3PQ6A 4OBWA 5BSRA 3VVBA 3VU8A 1T6XA 1XTQA 4DJFC 2PRYA 1AA6A 4GGOA 1IBRA 4NECA 1UBCA 2AG5A 5TMPA 4YXWD 5LUAA 2CUZA 2QD1A 2RAPA 4HTFA 1KJJA 1KI2A 2ZBEA 3AI2A 3GEEA 3OJLA 2QG6A 1QMGA 4E88A 1I13A 4TTPA 4EUSA 1N6HA 1JRLA 1EDZA 4FDLA 4DBVO 1QZTA 1RRMA 5JXIA 1JPUA 1ZINA 1E3WB 3KBBA 1TJNA 2O0MA 3PI7A 3OWOA 4LXIA 3AUXA 2QT1A 2ECKA 3L7MA 2IEDA 1O77A 2GPNA 5F78A 3NPMA 4JIMA 5DWQA 2WJZB 2OCPA 3CUYA 4FK8A 2B0JA 2VAXA 4BO5A 1PLKA 4X94A 2RKBA 2WQZA 1WBJB 3G3EA 5K0FA 3HR4A 2CL6X 4YDRA 4ZKDA 4ZVRA 4Q1VA 1ESZA 3CHYA 2D0OB 2CEAA 3LPDA 4INZA 1JTVA 2ZUDA 1XUOA 2GBFA 1SOVA 3G8AA 4Z2AA 1OWLA 1GDHA 2JA1A 4M1MA 1DZIA 5EQFA 3K15A 4FYYA 3TQFA 3UXMA 3ROGA 5CFNA 1ZD4A 2C5FA 3H0CA 5HK9A 1YNSA 3UBTA 4RPGA 2ZSUA 2V8BA 3PD7A 1AGXA 1TGVA 2AEEA 3FLAA 2KS6A 3LPCA 3N70A 2D7DA 1FSZA 5JR3A 3ZX5A 5JZOA 4XWKA 4ZVQA 3CVXA 2V6FA 5HWSA 4FGUA 1KBOA 1O6BA 4JVNA 4ZOEA 1II0A 1NQ5A 2Q4RA 5T8KA 3ZVKA 1QMPA 1PDOA 1O58A 2A9VA 1G8SA 4LOIA 1AHPA 2Z2KA 3HNPA 4RD2A 1SCJA 3MT7A 4LHZA 4BPBA 3HBFA 4Z7QB 3F9RA 1N3IA 1E2NA 5L3RA 5SZIA 2G5PA 1S1CA 2HUNA 3HBJA 5JD3A 4XX1A 1H2BA 3D4PA 3WLIA 3QX8A 3ZGVA 4CM9A 3B51X 3M70A 3MTBA 4UDNA 4EY6A 3MD9A 3G17A 4ZAWA 4EEXA 5LDHA 3GMSA 4V0LA 1R0ZA 5AW0A 2WHRA 5HW0A 4PO8A 3KYCB 4MWDA 3GGJA 4NH4A 3F5QA 4Y2VA 3SC4A 4CR8A 5CFPA 5MN6A 1NVAA 1YJAA 4FWIB 4HUQA 3TSWA 1M2VB 1O08A 3D64A 2K6GA 3NTRA 3P9RA 4C2AA 1DI0A 3BL6A 3CXUA 4ER6A 4D44A 5BSKA 4GZ5A 1KBZA 4ZIRA 4IJQA 1WCV1 5ESDA 3RM3A 2HU2A 5FX2A 5AOAA 3F4BA 2FZLA 3KDSE 3G9TA 4OMUA 1XQXA 2ABWA 5B58C 4UU8A 1WM1A 3BIXA 5K3BA 5LXTA 4JJZA 1K5HA 5BSMA 4EZEA 2E4ZA 3MG9A 4RF5A 3O4VA 1L1FA 3AO0B 1E2FA 2AN3A 1Z0AA 2ORVA 3JYPA 1E6EA 2A3RA 2HC9A 3HWWA 3DDOA 3JWPA 3Q7EA 3VKWA 3VX4A 2KX7A 3W5AA 4MV8A 1LBTA 2D7CA 4Z3DA 4A6DA 5JV5A 1PK7A 5E4FA 3A2LA 5BVGA 4CL2A 5K6AC 2A0XA 1YMVA 1WXQA 2XRMA 3T9AA 2C7RA 1A9TA 5AHKA 4DGSA 4YH1A 2BH9A 4FLMA 4RGBA 1JGTA 4JEMA 3ZBQA 2XKBA 2JASA 3KKEA 2YBEA 1WB6A 3BXFA 4HQ6A 4KO4S 2PDAA 5IPFA 1J99A 5DZSA 3SF8A 1DKUA 1AKRA 1XNQB 4BO3A 1UPFA 2J7KA 5HQTA 5E1OA 4PLZA 4CTMA 5MN4A 2HK7A 5EJIA 3I32A 2VJPA 1GQSA 3P26A 2HSJA 4BO0A 2YS7A 1NC3A 1JQDA 1YS9A 2E6UX 1PT8A 1C3JA 4FLFA 4OB7A 5IBPA 3H1PA 2HJRA 4C7OA 4GEKA 5BNTA 3TCNA 1Q1GA 2A1IA 4FFBB 2NUBA 1RZ3A 1GTRA 2NADA 1G8FA 2AJDA 5JTTA 1XIVA 3G6WA 3ZEIA 4KQ6A 2B21A 1YL5A 3CUTA 3QVXA 1DRJA 1Z6PA 3A1UA 3KHTA 1W5FA 2OE2A 3KR9A 3EEIA 1H93A 1SUPA 2VDOB 4JU9A 4XEHA 1CUCA 3I05A 1EQ2A 1NOIA 4ND8B 4RV5A 3GRPA 4NMLA 4P80A 3UOGA 4IRXA 4PSKA 1LF5A 5BOVA 4R5HA 3ZWQA 2Z6QA 3QMMA 2OUIA 4KI7A 4AU1A 4PZ9A 3AJAA 3AONB 3IPRA 4FZ5A 4BKRA 1VGRA 1YJ5A 3JQRA 4FFSA 4K0KB 1EGAA 2RGNC 5CX1B 5F2OA 1K2VN 2HSWA 3LXUX 1VE3A 1CRQA 5K5EA 3IV6A 4R05A 5FTKA 4CDGA 4XUEA 5FO0A 1N57A 1RKVA 3AMVA 1CUBA 4ZVUA 1USIA 4C76A 5FOWA 1IB6A 4W63A 1XXHE 3NHMA 4LMAA 2YUIA 2ZBUA 2DR0A 3RVMA 4A10A 2JJ8A 3T41A 2FUNB 1CDEA 4IR7A 3RSQA 4DNPA 5ITVA 1U1FA 2P1DA 4BFLA 5I6DA 4Q7MB 1T6NA 2J6CA 2QZ4A 4GC9A 3WKCA 3RVOA 1WS6A 5JS2A 2VOJA 4QYMA 3LX6A 2CNKA 2FA9A 4LOKA 3CVVA 1MOSA 2H08A 1HI9A 5IHXA 1GTVA 1T4GA 4NC9A 5FOXA 4DQVA 1LGYA 3LY5A 4OMDA 1OQAA 4Z1OA 1QCDA 2ZANA 4X8MA 4MR8B 1D0IA 4NH0A 4NOMA 4EHIA 4YCJA 1JHOA 2ILVA 3CR7A 4YJ2A 3O84A 4YMIA 3CINA 2B83A 5T4EA 4DV1B 2GCIA 1N9KA 3LRXA 2VDKB 3JVVA 2FUEA 3TZLA 1XKLA 3IOBA 5LIRA 2PWAA 5LP1A 4TYNA 1M8JA 1IRXA 4M0EA 4P31A 4UM8B 2HI0A 4PX9A 2AG6A 2BFFB 1EB8A 3RT1A 1VMEA 5JAPA 5C51B 2GXQA 3TI9A 2IS4A 5B57C 3FOFC 4DRXA 1LQUA 4EG1A 3GLQA 5EEHA 4ZV9A 1RXWA 3A4IA 1OCEA 1JLRA 1FMFA 2TYSB 4EGAA 1Z68A 5AK3A 3N8NA 4JNCA 5E6UA 3UHAA 1YBMA 1AKWA 1AXGA 1I51A 1SXJD 2OO5A 1QFZA 5LCXA 3KB8A 3A1TA 2DWOA 3T99A 1ZJZA 5LLDA 1IUKA 3HFGA 1QTNA 1UM8A 1QHSA 2ZE5A 8ADHA 4RGQA 4MW2A 2BE9A 1XRPA 4DDVA 3RHFA 1G5QA 6PFKA 2WUVA 1R8JA 3C8ZA 1R9GA 3F97A 3F3YA 1JDPA 1VRWA 3X1MA 4DR1B 1ODFA 3SZ3A 1KHHA 2I6GA 3HKBB 4Y2JA 4UAGA 2O4UX 1FW6A 2VP9A 3OQMA 3ZK9A 1XEFA 2SKDA 4M9QA 3GLIA 4Y2QA 2ZBGA 3UFXA 3WL6A 1WDMA 1D1SA 2WABA 5F52A 4DV0B 4CMIA 1C81A 3EDOA 2WKSA 1TF2A 2Y0CA 1IBSA 3ETJA 3BWEA 2ODAA 3GFPA 3P9YA 4KH0A 4L85A 2DFPA 4C3ZA 2H4YA 2RI6A 3OJXA 4CRWB 2HZ7A 2CZCA 3K0KA 3PQDA 2OHJA 2X4GA 4EGCB 1HETA 1N1MA 2CKMA 3OVMA 2IOYA