5CM9C

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
146
Chain Sequence
ALHKVIMVGSGGVGKSALTLQFMYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 146
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm9C00
3UWOA 3WNBA 4FMDF 4WZBE 4NONA 1E9AA 1KJYA 1XD2B 1T0HB 4KVGA 4KFSA 2R9VA 3GD7A 4AG6A 1FTSA 1ZNYA 1D9ZA 2GESA 2CJWA 4P4SB 3GJ0A 3AUXA 3HPQA 4AWXA 1Q1QA 2ZEJA 3ASZA 1AA9A 1JR3D 1XEFA 3SQWA 3NDPA 5A4JA 3AGQA 1VG0B 4Q7JB 5DI3A 2HYIC 1SVWA 3SNHA 4B32A 1X8LA 3ZS8A 1E2GA 1MR3F 2VHTA 2CCKA 1UJ2A 2RGNC 3DPUA 2JDIA 3CX7A 4LV8B 3TUJC 3ASYA 1TEXA 1ZUNB 4JL6A 2C98A 4PFSA 3FKQA 1N5LA 5CJ2A 3PIRA 4YDHB 4A36A 3P26A 1Z07A 2JATA 2RGXA 3QPWA 4AG5A 5KSOA 3IIJA 2MSEB 2CEAA 1CR2A 4HDQB 5A0FA 1XRJA 1YZGA 1FZQA 1ZNWA 3QENA 1TQ6A 2GEUA 4HDCA 1R7RA 3FTQA 1TPZA 2C99A 2EWWA 2IYRA 2P5TB 4MRPA 2QP9X 2YJTD 3B85A 3QEJA 5KSPA 3SZRA 2JGNA 4QKQA 5FOVA 1NN0A 4MQBA 5EE3A 2J7PD 2GJAA 2ZI3A 3CF6R 3PXGA 1W4RA 5L3VA 2J0SA 4X8LA 2NIPA 3IQWA 3SBEA 5DHAA 2JCSA 2FWRA 1IHUA 1W48A 4NP6A 3W5IA 4Q9JA 3VTKA 4E5UA 3EWSA 4Q7KA 2Z4SA 4K46A 5J4KA 1EWQA 3FMIA 1UDXA 3B9PA 3U44B 4FCTA 1FNNA 3SJBA 5IRCD 2JLYA 2QMUA 4D0GA 1J8YF 4KBGA 1DG3A 4V02A 1FQJA 2GAOA 5GVRA 2GZDA 4HI0E 4TL7A 5AWFC 1NSFA 1DBSA 4U00A 5AUNB 3PITA 3SE0A 3KQLA 4JJKA 3IHLA 2CNWA 2JJ1A 1B0UA 1GTVA 1GUAA 4B6FA 4MDFA 3BD9A 2BVNA 3H2YA 1RKBA 2A5YB 1E1RD 1YZUA 2V54A 4H1VA 1M74A 2YC2C 2A5DA 4KFUA 5EZ6B 4KLZA 4ACAA 5KDLA 3Q85A 1IY1A 4OKSA 2KBEA 4OK5A 4V0LA 5C46F 2VP9A 3EZ2A 4M4SA 1Z22A 1P9RA 2Z4RA 3B6EA 4UXHA 5FTKA 4DKXA 4N1AA 4OI4A 3O8CA 3RVBA 2ZE5A 3LBIA 4V03A 3CF2A 2BBSA 4BLRA 4DJTA 2O5VA 1WXQA 1X1RA 2A7QA 4FMBB 1DS6A 4LOAA 5JJLA 2ZSBA 1W46A 3O8BA 2GCPA 1KI9A 4RZ3A 2UZIR 1E79A 2QE7D 2VIIA 3QJYA 2GEDA 1SVIA 5KO2A 5CITA 2NZ8A 2VP2A 1MT0A 2R6AA 2WSSD 3OAAA 4LBVA 4OI1A 1OIVA 5TV2A 1SVMA 1JAIA 3MMPA 1AZSC 1AGRA 4ASUD 3T34A 5CM8B 4OHVA 1GOTA 2J0QA 3A1TA 2R2AA 3G5UA 1XWIA 3B1VA 3EG5A 3GLFE 4ZIRB 2H1LA 2DB3A 2IS4A 1L4UA 3GLGE 4TMZA 2PCJA 3K0EA 4RD1A 4S35A 2R6FA 2IUSA 2QMOA 4UQOA 4HDOB 1QG2A 1UKEA 1JXMA 1T5LA 2W6ID 3CPEA 4QHSA 4D80A 4F4JA 3ADKA 1C4OA 2AK2A 1LVGA 4DCNA 4OBEA 3U3RA 1DAFA 1YZNA 2ZROA 4NCIA 4JYBA 4UJ5A 3IQXA 1QHSA 3AF4A 3ZS9A 3JVUA 3L82B 3NKVA 1S3SA 4ZI3A 4C0JA 1E0JA 4TWZA 3U7HB 2PLRA 1E2NA 3HYTA 1PZNA 2QG6A 4Q9HA 1OXTA 1V43A 2V4ZA 2YWEA 3KTAA 1VMAA 2YV5A 4BUJA 5JWHA 1A5TA 1O87A 3BRWD 4CEIA 5AUPB 3LBHA 4NPHA 2ZSFA 4QBHA 1VCMA 1WB9A 1PJRA 3P32A 1VCIA 2EYUA 2Q0HA 2ZTSA 1XTIA 3UPUA 3C41J 4TSFA 5BN3A 3OFND 4ABYA 4TL9A 4E07A 3A4MA 1NRJB 1YKSA 4QNRA 3VAAA 1CEEA 4PR0A 1LF5A 4A8JB 1HE1C 3NBXX 2WKRA 1EFUA 2F3TA 4UJ3A 5EP3A 2NO1A 3GJ4A 4GI7A 4QM7A 4R71A 2EW1A 1ZM4A 2NPIA 2ODEA 5DN6A 3EPJA 2REBA 2FPLA 3LQRA 4O2LA 5IK2D 2XSZD 2IYVA 1A4RA 1W2GA 1QDEA 2HJGA 4Q9KA 1NVUQ 4QL3A 4NDZA 5JZVA 2EVWX 1S4QA 3EIQA 4ZDKA 1IM2A 5CB8A 1HV8A 1P9WA 4IXMA 4LDJA 4GT1A 2KI5A 3ZVMA 4K8OA 2P65A 1KDRA 2PH1A 3IGFA 1QHHA 1W44A 2HF8A 3U4QB 5EJEA 4PTLA 1ODFA 2FSGA 4HLQB 4PSKA 1MV5A 5JRJA 3FMPB 4PAMA 2ZI7A 4TMTA 1QHIA 3FB4A 5C4GB 4L5BA 4UNSA 1AN0A 4PC1A 1U98A 1XCPA 2C78A 2R44A 2V6JA 2GTPA 4JSYA 4OJQA 1U2RA 3B82A 3GFTA 1VYTA 2GXSA 2R6CA 2GWHA 4LYAA 3ZIAA 4B76A 5H70A 4KSBA 2RGDA 4Q66C 1OJLA 2X2EA 3QXHA 5BXQC 3ICEA 1OLOA 2ZRIA 2L0XA 1XMVA 2VTKA 3THWB 1ZUHA 5CDFE 2C77A 3R20A 4KCGA 4LHXA 5B57C 2QBYB 1VHTA 3ADCA 1OXSC 3W3AA 3ZH9B 4C7OA 2CVFA 3DM5A 5EE5B 1BS1A 1JI0A 1EG7A 1P73A 2FGKA 4Q1CA 2GK7A 1KI7A 1WDTA 3O8RA 4XVRA 1XCMA 1TQDA 4Q1EA 1OFHA 2FFAA 1Z0DA 5CYOA 3K0FA 3PVSA 1KI6A 1JAHA 1EFCA 1NL3A 3AKEA 3RS0A 4BFUA 1Z29A 2QRNA 3GCGA 3KJGA 1U99A 3DKVA 1ZAKA 2J7KA 4Z8YA 4OHYA 1N2CE 2WMOB 4WVFA 4A9AA 4MDEA 4GL2A 3PEYA 4URWR 2GZHA 2FNAA 4XOIA 5B2ZA 1M6NA 4XWKA 3BS4A 2YZ2A 4DSNA 3K1JA 4LJ7A 1KMQA 4B34A 4IDHA 4GOKA 2C5LA 4P3YA 4M1MA 2GEVA 4RY2A 221PA 1RW4A 1TADA 3GJXC 1Z28A 2V8OA 1Z0AA 2GVZC 1JPJA 4LJAA 3I8SA 3TGPA 2ZAMA 4XSHA 1VG1A 5K8TA 3SQXA 3K0AA 4M1YA 3LRPA 2WPDD 4AKGA 1XEXA 1GAJA 2WJHA 3EXAA 4QG7A 3WHLA 2JLSA 4LJ6A 2QAJA 1CRPA 5B58C 2BMJA 1S9DA 3IPXA 2HT6A 1RRGA 2FPMA 3PUXA 1XXHE 4NYIR 5F9HA 4LZZA 4US1R 3WRYC 1XTQA 3RDPA 1P6XA 2KB0A 3X1XA 2FOLA 1ZP6A 2IXGA 3TRFA 4Z1MA 3VU9B 3KQKA 2JLXA 2P67A 1F2UA 2BMEA 4II7A 4TT3A 4I99A 1G1MA 1OF1A 2QT1A 3BB1A 3T5GA 1A1VA 3C15C 4JZKA 2ZYWX 4RKFA 1T4GA 4Q4HA 2GNOA 3I4LA 3ZD6A 1HT2E 1QG4A 1LNZA 4BFYA 4IOMA 1Q1ZA 4YXWD 1G19A 3GJ8A 2H92A 1GL7A 3EC1A 3K9NA 4ACBA 2HT1A 1CXZA 2IYYA 2WKQA 2CE7A 3PEWA 2W83A 2O8CB 3D7MA 4W9MC 1CJKC 3UG7A 3AP2A 3OEEA 3R7WA 1YZKA 2OE2A 4S2EA 4CEHA 1G8HA 1GRRA 3AEZA 4FWTA 4Q02A 4A4DA 2ZJZA 2HLDD 2XTNA 2C9CA 2ZRKA 1ESNA 3EW9A 2IYZA 1G18A 1ZM9A 2QPAA 1KMHB 2W0MA 2WWHA 2WZQA 3M0EA 1SHZA 5GJVC 5AK0A 5C4MA 1J99A 4HZUB 3TSZA 1DELA 2ZE7A 1WE2A 3K9LA 4ZDIA 3QG1A 3AKCA 5K8LA 1BIFA 3AF3A 2BEKA 5FH9A 2YOHA 3GQBA 2OXRA 1GKIA 4TQ9A 5GJWC 4MUBA 4N3NA 1E69A 5GVSA 2R65A 5KSYA 1D5CA 4DBLC 3EZ6A 4H9GA 1ZMXA 4J0QA 1L8QA 1TF7A 4ZCLA 4D4KA 3KKOA 3B7GA 4PO9A 3GLFB 1U0LA 1II0A 2IK8A 2H8KA 4B2LA 2IHYA 3GLGB 3ADDA 1N5JA 4KVAA 2OEPA 1IONA 4PO1A 2WBLC 3O47A 5KOYA 1G3MA 4L8GA 3PCRB 3KQHA 4IEIA 1AQYA 3SHFA 1N0WA 4PO8A 1HE8B 3NTUA 3WYFA 2ZRFA 4O0MA 2ZU0C 4LCBA 2RH5A 1SXJE 3RC3A 1F60A 2D74A 4Q7MB 2GCOA 3VHLB 3SBDA 2BEJA 1DPFA 3U3JA 1MO3A 3I62A 5HZKA 2J0VA 5FPTA 1M2OB 4M9ZA 3CRQA 2ASEA 2D06A 1HURA 4KYUA 2IYSA 5FTNA 4EQ6A 4F7WA 3IUYA 1JPNA 4QHYA 4PSVA 3SC3A 2G0TA 4ZV4A 5CJPA 4Q5IA 1GG2A 3A1VA 5H1YA 4G01B 4LUCA 1IJFA 4X8HA 2GDJA 3RS4A 5JI3E 4M53A 1NBMD 3UG6A 2AK3A 2IF0A 4P4SA 2XJ4A 3DVLA 2AKAB 3QF4B 3RSOA 3SFVA 1UKVY 2QPTA 4EJSB 1VYVA 1W0KD 2HEIA 1NBME 4AYXA 4UXJA 1JXOA 4DUGA 1PLLA 1ZC3A 5G3ZA 3IHWA 3QPUA 1PLJA 3OE7A 4NHOA 1E2IA 2RGBA 3EPHA 1P75A 3H4MA 1GP2A 1XF9A 5HCNA 5EUMA 2IS2A 1FPMA 1NJGA 1AZTA 2F43B 2P0EA 4MGIR 3VNVA 3CPHA 4JLNA 1KSGA 2OCBA 3ZJYA 1E32A 1GILA 2O0JA 4RFVA 4JLOA 4DCSA 3ZVRA 2YC4C 1U0HC 4ZPXA 4G0NA 2XZOA 1G5RA 4FINA 1CS4C 4AKEA 1P2VA 2HV8A 3VKWA 2BCJQ 4ZCMA 1E1QA 3W6PA 3L43A 2JJ2D 4Y0VA 1GNRA 1VG8A 2EQBA 2ZYTX 3CONA 1AS0A 1IN8A 1GL6A 2ZS8A 4PZZA 4M21A 5E7MA 3A37A 2ZI9A 5HTKA 4V0KA 1DAGA 1E9FA 1Q44A 5EP1A 2C8VA 1QHXA 4BLOA 3NBYC 3NC0C 4HAUA 3H86A 1H65A 5JHGB 1BKDR 1CU1A 1GITA 2ERXA 4WBSA 4DLWA 3KQNA 3B78A 3P1JA 3GLHE 1F5NA 3MWYW 5LB4A 3ZVLA 3MGCA 1TNDA 3AH8A 1US8B 4WAUA 1X8KA 3V9PA 3U61B 2JLUA 1E2LA 2CK3D 5FUVA 4ZO4A 3GJ5A 1MO4A 4UXIA 4TYQA 1EFRA 4M2LA 1NMYA 4DLXA 4PQFA 1GSIA 2QGNA 1GNQA 4QGAA 2QUZA 1UEJA 4XH9B 5BN5A 3LDAA 4HUQA 1ZM2A 2ZQ5A 4YMUA 2DFKB 1Z6YA 3E5HA 4QXAA 5SZIA 5E4FA 4TMXA 5FTLA 1OIWA 4XSGA 1JALA 4HB3A 3HR8A 2XTZA 4NTZA 1ZRHA 1JJ7A 4JS0A 3X2SA 3DDCA 4IFBA 1ZD9A 4CRWB 1SQ5A 2ODWA 3HWSA 1NN1A 2OFXA 1W2HA 4GOJA 2REOA 5FOUA 5JBQA 3THOA 4Q4LA 1N5KA 2V55B 3A36A 5FPHA 2OUKA 4KBFA 1R6BX 4ZKDA 5CK4A 3KZ1E 4BLQA 2CDNA 3BE4A 4LJ5A 5HZHA 1G3UA 4AI6A 2O0HA 5B64A 4MYHA 2QAGB 1Z6GA 5BYJA 2EU8A 4GSYA 1UF9A 2VA8A 3F8TA 4CT4B 1P3JA 3KFVA 4LV6A 4WOPA 2JEOA 3QKTA 3RRMA 5BW8A 3NHBA 1Q20A 2F1IA 4W5HA 2WM9B 2EFGA 4IHQA 4PPGA 2ZUCA 4Z54A 1OH5A 4ZIRA 2ZRGA 1FOEB 1KKLA 1S8FA 1XCGB 2BHRA 1S9HA 4Q01A 2GZAA 4A6XA 3REFA 3WXMA 3FFBA 3SYNA 4TMVA 5GJBA 4H1UA 4U5XA 4LJ8A 4U7DA 4TTPA 3AKYA 2RHMA 4C3ZA 3A1UA 1J90A 2FJUA 1AGPA 2JDID 3KKMA 2C04A 2CL0X 3EARA 2GJ8A 1MABB 1ZD8A 4PHFA 1KAOA 3FKSA 2YNMA 5FR2A 4P31A 1TU3A 3R9XA 2GBLC 5EXPA 2XNDA 4M0LA 4DLRA 2OLKA 1J7KA 2W6JA 1Z0KA 5AJWA 4TYWA 2ATVA 2KBFA 4DRZA 2PZFA 1TAGA 2I1VB 2WWWA 3HJNA 4QHTA 5FUYA 4B3BA 2HF9A 1ZW6A 1R0ZA 5BQ5A 3THXB 1LY1A 2AR7A 2BDTA 2QA5A 2Q3FA 5EZ5A 3L8YA 2WIAA 2ZJ5A 5J4HA 1G64A 4KO8A 5E95A 5CM9C 1R0WA 2NO6A 2ZYVX 1AS3A 2AKYA 4NMMA 4EFLA 1Q1BA 2IT1A 2XXAB 3L8ZA 1SZPA 3I5YA 2JJ8A 4O25A 4A8JA 4DDUA 4A2WA 5EP4A 1MO6A 4YDSA 1LB1B 4DLSA 4DLVA 2VH5R 3LBNA 4IW3B 3QKUA 1MO5A 5L3RA 3AQ4A 1E3MA 1J8MF 1K5GA 1UAAA 2CNWD 2JJ1D 5LPNA 3PFIA 1KO8A 4F91B 3CB4A 2PX0A 3C4JA 1N5IA 3VR4A 1JR3E 4M1KA 1KDPA 4IDNA 4UNNA 2V9PA 1E2KA 3LVQE 1Z6AA 2C96A 4NYJR 3U2QA 3U7FB 3AVVA 4A8JC 4W5WA 1KNQA 1IY0A 1A2BA 4KV9A 1W36D 4RFSB 5JSZB 3PENA 1IXSB 3RS3A 1AQUA 2ZRDA 1CKEA 1GIAA 3U4QA 1OHHA 1KK1A 3KJEA 4HB0A 1R5NA 5D3QA 1SXJB 2IYLD 3UMFA 1G291 2AD1A 3NBZC 1E79D 3T1TA 1LF0A 4JT2A 3R8CA 4HATA 3MWKA 3CLVA 1VG9B 4B74A 4ZDJA 1Q3TA 3AVXA 1G8FA 2GJSA 4LYHA 4NCNA 4LYJA 3ZZUA 3OAAD 3GFOA 2UKDA 5AJVB 1DAMA 2VEDA 3PUWA 5KTYA 1UBGA 2GK6A 1G3RA 3THWA 3SOPA 1R2QA 2Q9AA 2QBYA 3T1VA 3EIEA 3ZGXA 5A5GA 1EGAA 2QORA 1RRCA 1COWA 3I1FA 5FBVB 3S1AB 1FFHA 3A1SA 4E03A 1GZSA 3CUEF 2ONKA 5KDDA 3VX4A 4ESVA 1Z08A 2WWGA 3NXSA 2W2VA 2OHFA 8OHMA 1NF3A 4HUQB 1XP8A 4IDPA 1OKKA 2QZ4A 4BGDA 2QSZA 1HQYE 1T3HA 4EPRA 1IY2A 5KDOA 2OCYC 3GJ6A 5JCZA 1BOFA 1IXZA 1WA5A 2AN9A 1YQTA 1KI2A 3O8DA 5TY0A 2PEYA 4LJYA 4E22A 4AYWA 4QJ3A 4A0RA 2VO1A 1XMIA 121PA 3BH6A 4QNMA 1MOZA 3TMKA 2GXUA 3B9QA 3EPLA 3MUFA 1IOZA 4CT5A 3J81k 2ZS7A 1DG1G 4NZYA 4TTQA 4EKDA 4L9WA 5TB5A 3LXXA 2VSOA 3TVDA 3WNDA 2Q21A 3IO3A 2OO7A 2XGJA 3T15A 4HAYA 4IKEA 2D62A 2VPPA 4FW9A 1FP7A 1G4AE 4AKHA 1GL9B 1CTQA 2O8FB 3PG5A 4GP6A 2GXAA 4RCZA 3IDQA 2G1JA 4TSFD 3NEYA 3CKLA 1D2EA 2EFDB 4B47A 2OG2A 3F0TA 3I72A 1DAKA 2RGGA 4DSOA 2FEMA 4B3CA 1UKYA 4MGZR 5DSZA 2ZRHA 1SVSA 3VU9A 4BQSA 3TIFA 1TX4B 1Q12A 4A0FA 4LGMA 3GLHB 2F1HA 4DVGA 1T5IA 2A3RA 3BK7A 1KO4A 1AM4D 1QF9A 2XOKA 4TL8A 1YJ5A 1VIYA 2J5XA 2OT3B 2ZJAA 2ZJYA 3P27A 2ONJA 4MYUA 4RZXA 4EIWA 4DLYA 5DN6D 5J4VA 3QSYA 4JSTA 4A2PA 2IYTA 2PBRA 5HKKA 2R8RA 4MRRA 4XWAA 4UNRA 2FSIA 2ZITA 4LI0A 4M9XA 721PA 5JHHB 4EPXA 2DCUA 1XZQA 3HPRA 4JLAA 4TYNA 4R7ZA 1W4CA 1QZXA 4A92A 1Z06A 3B13B 2BKEA 3AVWA 1OT3A 2WOJA 1YE8A 2O8CA 4WA7A 4XJXA 1E1RA 3WRXC 2E1RA 2WKPA 4D0NA 5UKDA 3EPKA 2Z83A 4C0HA 4LJ4A 1G8GA 4BEJA 3T1QA 4D82A 3R9WA 2GVDC 3QXJA 5SZKB 4F4CA 2P6RA 4FI3C 2GAAA 3NH9A 1G7RA 4MH0R 1NY5A 4BWYA 5FL7A 1RJ9B 3I3SR 3K8YA 4D6PA 1VCOA 2QNRA 1A2KC 4C2TA 1U8YA 2XX3A 3VMFA 1HH4A 1KMHA 4ITRC 4B48A 1DEKA 2WOOA 1BH2A 4TLAA 4BPBA 3GFPA 4HZUA 2PLFA 4Q1AA 2VP6A 2ZS9A 2AFIE 3FE2A 3OIWA 4I1UA 4JMPA 5FTMA 4EUNA 1ZNZA 3KKNA 3KKQA 1XB2A 2YWFA 3M6AA 3TBKA 4UNPA 3KX2A 1ELOA 1XZPA 4JVMA 1G8PA 2X19A 2ZRAA 1CJVC 3ZZTA 4F92B 3L0OA 5G40A 1OFUX 3EC2A 2PJZA 1D2MA 4FMCF 4P0TA 3GLFA 1QRAA 2Q3MA 2WSSA 1AS2A 4L9SA 5CB6A 1OE0A 2X2FA 3B1WA 3ADBA 3GLGA 1GKYA 1NVXQ 3W8NA 1W4AA 3DMDA 5KNBA 4F93B 3U60B 2I4IA 3AB3A 2KJQA 2ZRCA 2CCJA 1EFHA 1KY2A 2BJWA 2JIZA 1AK2A 4TZ6A 4V0ME 4JBWA 2CL6X 4MKHA 1XEWY 2VBCA 2ZRBA 3MWLA 5JECA 4C2UA 2ORWA 1RYHA 4JJZA 3Q72A 4RKEA 3T1OA 1OFTA 1G41A 2J9RA 1E0AA 5FBWB 1LS6A 5K8UA 2CXXA 3SYKA 4NH0A 3ZVNA 3I92A 4POAA 3NWJA 4P4UA 1SKYB 4YONB 5DO9A 3QOFA 1IN7A 1WMSA 3JZMA 2V1UA 1XPOA 2DY1A 2ZSDA 4HSEA 2QENA 4PAOA 5TARA 4JL5A 4RD6A 2WWYA 1U81A 2ZXUA 5J5CA 4D25A 5FR1A 4LBYA 1ZM3A 1VHLA 1E2DA 2BKUA 3W6NA 2O8DB 2VHQA 2GF9A 3VR5A 1HUQA 4OK3A 5C1BA 4B33A 2G0NA 3VR6A 1WBBA 3QF4A 4JLJA 1UBFA 2QROA 4QBFA 4QBIA 2EFHB 1Z83A 4B3FX 4URVR 4Z1MD 4EJSA 1G6OA 2WICA 4B73A 4C9BA 3WMGA 2WSMA 4TT3D 2DWPA 3DL0A 4BZQA 1T3SA 1U9IA 1F6BA 2YOGA 2A5FA 3WY9A 2ZRLA 1OB2A 2FDCA 3FPAA 4AK9A 3IEVA 2B7BA 2FN4A 3M1IA 2ZANA 4WXPA 2N42A 5HE8A 2F43A 4CEJB 3IBGA 5IF9A 2BM1A 2P3SA 4Q21A 5DLQC 3ND8A 4HLUC 4I4LA 5JRZA 4O3MA 1T3LA 4TL6A 4C0BA 2CHGA 3CRRA 4EJSC 1ESMA 1T0JB 2V6IA 1P4SA 1KJZA 3K09A 4NCKA 1N0VC 3T5DA 3HU3A 1YZQA 1NG1A 2NTYC 1NI3A 3LW7A 5JEEA 1Z63A 5H68A 4GZLA 1U9IC 3OEED 4QRHA 4AURA 2Q9CA 4DEXA 4FXPA 3DMNA 3CNOA 4CGZA 4OHXA 1G7SA 4P4TA 1IAQA 3IEUA 1H8EA 4TQAA 3BH0A 4YMSA 2LCFA 3I61A 2BWJA 5CYPA 5JJKA 1MRNA 1N6RA 2ZE6A 4L15A 3AV0B 1G5TA 2PL3A 2FE4A 2C9YA 4C30A 1US8A 3K09C 2ERYA 2AXNA 3QIAA 3U3MA 3K70D 5LD2C 2CCGA 1BMFA 4O2RA 5EP2A 1G21E 2D7DA 2QQ0A 3NG1A 4LPSA 1Q21A 5HE9A 1E9EA 4IJMA 3RSLA 3TAHA 1DE0A 2W2TA 2KWIA 1VECA 5CDFA 1XMSA 1TEVA 5JFGA 3ONWA 4JLKA 1E9SA 2IWRA 1ZCBA 1XJQA 4BASA 2F9MA 3WYGA 3EASA 5EE9A 2UVQA 2BM0A 1E2JA 3CZPA 3LW8A 1TUIA 2ZU6A 2ZRNA 2FMXA 3BWDD 3HDTA 1OW3B 4TLBA 4TYPA 4DDTA 1P2TA 4KYIB 4NCHA 3PUYA 5JJIA 2ZRPA 3L0SA 1PUIA 1CR4A 1E0KA 1DAIA 1II9A 1NY6A 2G83A 2D2EA 2IC5A 2IWHA 5IDVA 4MYCA 4NKRA 2WWFA 4FMDB 1CR0A 2Z5FA 3AVUA 1TU4A 3ZZ0A 4DXAA 2OBMA 3AVYA 3ZD7A 1KSJA 1XX6A 1MH1A 2ZRMA 2QAGA 4LHWA 3NBFA 1GKUB 1RRFA 4FWIB 4BRUA 4Z51A 3QNUA 1P60A 2XB4A 4KI0A 5KSZA 1WP9A 1R5OA 2ZE8A 4PX9A 1TF5A 5DI9A 2O8EB 1RVDA 4WW0A 3NIBA 3FMOB 4Q03A 2PX3A 1XPUA 1U8AA 5FFMA 2H7VA 1KY3A 1N6IA 1M34E 1DOAA 1T6NA 1VPLA 2YVUA 2V7QA 1KK3A 1MKYA 1Q1EA 3EAQA 4PQYA 3TJZA 4DC9A 1TQ2A 1JB1A 3RWMB 4OQNA 3UMRA 4JLMA 2HCBA 1SULA 4XIGS 4B43A 2QAGC 3C5HA 5G41A 4DUGD 2QQEA 2Z6VA 4QGHA 1HQCA 3OE7D 1KAGA 3CIOA 4MGYR 5IHPA 2I3BA 5JLJA 1R10A 1N6OA 1OH6A 2ZJ8A 3BOSA 4US2R 1D6JA 2FFQA 1MABA 3T06B 5D3MB 4Q9IA 3CRMA 1F3OA 2KSQA 1KO7A 2JLWA 3ICQB 4KHZA 3GLIE 2ORVA 4BRWA 4TTRA 2Q9BA 2O8BB 2W2XA 2ZAOA 5FBLB 3CNLA 3SDZA 3I8XA 4D0LB 2FPKA 1O3YA 3IBYA 4M8NE 3RLFA 1W47A 3RRYA 1E1QD 1J70A 2DWQA 2WVJA 4OK6A 3THXA 4ZDWA 3OEHA 4NYIQ 1R8QA 4MKFA 1G20E 2QRZA 2QEQA 2B8TA 2WJYA 3AP3A 1KI4A 1HTWA 4G5OA 4R2IA 2GXQA 2GJKA 1JNYA 1I4TD 1NP6A 4M1WA 3SI7A 3WP0A 2HXSA 2AD5A 4KFRA 3BB4A 3TKLA 2XXAA 1XD9A 1CJMA 3PUZA 4UNQA 5LDDC 2AXPA 3U3OA 2BMDA 3NDBB 2FH5B 4RJLA 2NO9A 3ZYCA 3KUCA 4YLGA 3ND9A 1SVKA 4LV5B 4M9QA 1W0JD 2C95A 4DLTA 1E99A 4BZXA 1EFRD 3CR7A 1ZIOA 3TE6A 2ZR7A 5EUQB 2YWGA 5F3WB 2DYKA 4FCVA 2ANCA 1Z47A 4DCVA 1G7TA 2RKOA 1R0XA 2B8WA 3AKDA 2FF7A 3DO6A 3LLUA 5KNCA 1D8TA 2P6NA 1YU9A 2G77B 3KB1A 2HYDA 2FSFA 2UZ3A 3PR1A 3QQ5A 3W3ZB 2ZREA 2RAPA 3CX6A 4XD7A 3W90A 1NKTA 2AFHE 4AKIA 1R4AA 1LFDB 3F5FA 2H16A 5GJCA 4HAWA 4DCUA 2YKGA 4DT1B 3KUDA 3U44A 4RFSA 5JSZA 2BV3A 5LD2B 1Z5ZA 2FSHA 4PHTA 1V5WA 3CPJB 2XEXA 3KXLA 3K53A 1SXJA 4DDVA 1CF4A 1GVNB 1FP6A 4I1OA 1JQJC 2BBTA 1DAEA 2XZPA 3WNCA 2Z43A 1FNMA 4Q7LA 4HEJA 2G88A 2Y8EA 3U7EB 4MITA 1FW6A 1JBKA 2FFBA 1L7VC 2JLVA 2PMKA 3HR7A 1Z0JA 3EZFA 3ZLJA 4IOJA 1KKMA 3FHTA 1M1YE 3LX8A 3A4LA 1CBUA 1R0YA 3CRVA 3BJIC 4M1OA 3VR3A 4B3GA 1LS1A 5E7JA 3SU8A 4B3DA 4PHHA 2A5JA 4PPNA 2IS1A 1E94E 2VL7A 1HEIA 1VCNA 3KL4A 1SHKA 4AY2A 3S1AA 4PSAA 1SXJC 4G5RA 2DBYA 3X1DA 1E9BA 4Q4JB 2IBMA 2IEYA 2VRWA 3IIKA 5LB2A 2JLZA 3G0HA 4OYHA 1KO1A 4JBYA 4BFSA 5FI1B 4A1FA 3D6TB 2G1KA 4PXAA 1NBMA 4TMKA 1VTKA 1ZYUA 2J0UB 3TVTA 1RFLA 821PA 3TAUA 1FX0B 4Q47A 3CM0A 1S3GA 4LSGA 4DDWA 1OXVA 3FKSD 3AF2A 3GJ3A 3AF0A 1RIFA 4Q4AB 1PUJA 2OCAA 1GM5A 4AD8A 2XNDD 2G3YA 2XITA 1E6CA 5J47A 4LC0A 2W6JD 2IYWA 1NIPA 1L2TA 1T91A 4IEEA 1P62B 1W1WA 1Z2AA 4I81A 4Q19A 2O8FA 1KO5A 3D31A 1XDBA 1XTRA 3RNLA 2QM8A 3BFVA 1XD8A 2WTUA 1NSTA 3K0CA 4FMCB 2OLJA 4BLTA 3C8UA 4W7SA 2B6HA 1X6VA 5DH9A 5DYIA 4JLDA 5FUXA 3A8TA 3JZAA 1F2TB 1X1SA 1N3BA 2GBLA 1E9DA 2QL6A 1UEIA 3L2OB 4IDQA 1XXHB 5L3SA 3EA5A 521PA 4DEYA 4JLVA 3DOFA 3GLHA 1E2HA 4XVQA 4ARZB 3DHWC 4CYMA 1E0SA 1OH7A 4KFTA 3UMSA 3FVQA 5GADl 4HAZA 1N6PA 2A2ZA 2X8AA 2LKDA 2ORIA 4I1SA 1Z0IA 4Q1FA 2BC9A 3TLXA 3K0CC 1K5DA 2VHUA 3KJHA 4LWZA 2F9LA 4BFZA 4ZCIA 1GFIA 3MJRA 3QXXA 5F9FA 5CLQA 1D9XA 3QKRB 4BZPA 1DO2A 2CK3A 1WBDA 4URUR 1KI1A 1EX6A 2JLRA 3MD0A 4GDFA 4QM6A 3VKGA 5JS7A 3NHAA 4LK2A 4P33A 4F38A 1ZM7A 1OIXA 5JEDA 2CHVA 2ZIAA 4JLBA 3VQTA 1NLFA 2EYQA 1OHHD 2PEZA 1II8B 2WJJA 1WCV1 4PHGA 3SHWA 2DPXA 3OESA 3EIHA 2A5GA 1E4YA 1CULC 1AKEA 3AVOA 3LFUA 1RJ9A 421PA 5BN4A 1ZC4A 4OQLA 3DM9B 5KUTA 2QTHA 1QHNA 3FDIA 3B1YA 1IJEA 4QBGB 4C0KA 3E2IA 3EZ9A 5DE3A 1ZNXA 3FWYA 1W5TA 3K9HA 1CLUA 2VSFA 1RRPA 2ECKA 2ZJ2A 1B23P 4A15A 1AJEA 3H84A 1PV4A 4JVSB 2PJRA 3KKPA 4M1SA 1U8ZA 3TH5A 1COWD 1EXMA 4N0DA 4URZR 3MSXA 2GETA 1T8TA 1OXUA 2ZI4A 2V3CC 1BYIA 2O52A 3TR5A 1KI3A 4M22A 3QBTA 4G5GA 5M04A 3JVVA 2JA1A 2ZI5A 1OKKD 4WIAA 3AVPA 1TQ4A 5AUQA 1F48A 4BE7B 4Q9LA 2YINC 2RHDA 5DYGA 4IVPA 3QKSB 3FMFA 3OZXA 3UWKA 3NEJA 4KJZA 3CBQA 4A82A 2QTVB 4QOSA 1XNJA 4QFMA 1EX7A 1QHGA 3PJRA 2J59A 4LHZA 1G5PA 1NVWQ 5TXGA 3GPLA 3GLIB 2BIFA 1TL7C 5FL3A 3Q7QA 3V4RA 3VNUA 3KDSE 1JR6A 2ZPTX 1CRQA 1YVDA 2IL1A 4MRVA 1ANKA 1EWRA 1S1CA 3V00A 3T35A 1M7BA 4A0HA 2PZGA 1RYFA 3U6BA 3IIMA 2BBWA 5F2EA 5G53C 1UM8A 2EFCB 4KSCA 3V4FA 3RAPR 2O8DA 4QGFA 1E98A 1H8HA 4OQMA 3K0SA 2OAP1 3LNCA 3PEUA 4HZIA 3QE0A 1YZTA 1Q0UA 4C4PA 2HCJB 3CWZA 2VP5A 2NG1A 3PUVA 3P4YA 2X1VA 5FOSA 4IOKA 1KZGB 2A78A 5DIFA 2F55A 3QBVA 4YMVA 2IYUA 1KK0A 2XOKD 2BBOA 2CLCX 2HUPA 2WAXA 5L8VA 5F98A 5SZJA 4D4LA 3UATA 2J87A 2ZJOA 1GWNA 4MRSA 4CEJA 4GNKA 4XTCS 5HKKD 4NYMR 5KYKA 1Z8FA 3GEEA 1ZD1A 4ON9A 1LW7A 1W5SA 1JR3A 3GJ7A 3HU2A 5L3QB 3NH6A 3TSOA 1NNEA 1NN5A 2DFTA 3OF5A 5FBRB 2G9NA 2J46A 3LA6A 3QXCA 4MKGA 2G6BA 2BJVA 4TLCA 3RRZA 1U94A 2C2HA 2D4HA 2XZLA 2Z0MA 4ILEA 3SJZA 1ONBA 3HYRA 2J41A 1P2SA 4OQFA 5CIWA 3G82C 4LY6A 4QJ5A 3RABA 2Q6TA 2E87A 3MFYA 2EFEB 5FL7D 3BFXA 1SKQA 3ETLA 3LXRA 4F4IA 5EXXA 1QVAA 4D2IA 5ELXA 1UBCA 1OH8A 2VHJA 3U6KA 2XJ9A 1I4LD 2VQSA 2F6RA 4DSTA 4LYFA 5FPSA 3ZQJA 2FX3A 3W6OA 2J7PA 5KNDA 5L3SB 1A7JA 3VHXA 3D8BA 2DFLA 4MKIA 1IN4A 4NYJQ 3THYB 2ZUBA 4R98A 3MRSA 1XEWX 4OHWA 4P32A 1T9HA 1NLYA 1W4BA 3SN6A 2N1BA 4KAXA 1QBKC 1G9XA 4B35A 3RYTC 3IKJA 2JIZD 1RPZA 1W36C 2O0KA 2BCGY 3T61A 2WAYA 3KQUA 1KDTA 4PQRA 4DWJA 1KOFA 1Q57A 2OESA 4TN1A 4JT4A 3TSWA 3C16C 4D81A 1G4UR 2IF2A 4RZ2A 5AJZA 3Q9LA 3WHKA 2XNSA 2IX3A 4BECA 1L4YA 3LY5A 2QSYA 3P20A 1JJVA 1N6KA 1WF3A 1VYUA 4KODA 5FOWA 1NMZA 2BMFA 4KLNA 2QPOA 1S0UA 4ZI2A 4RD3A 3A1WA 1Z2CA 4OJKA 4NE2A 3SYLA 2QGZA 2RGCA 4LRWA 2O8EA 3KB2A 1GRQA 1Q3HA 3ZIAD 1P5ZB 1C1YA 4RVCA 4DZZA 2PT7A 5AR1A 2CE2X 3R9IA 5JWOA 4CVNA 4LHVA 3U3KA 2FZLA 4CDGA 1HT1E 1P61B 2J1LA 2QE7A 3I5XA 3UK6A 5FPKA 2DFNA 1IBRA 1XU4A 4BLSA 1YR9A 1BO6A 3TNFA 4NYMQ 4YC7A 1HYQA 4IVRA 4A2QA 2VYFA 4CZ2A 5JI2E 4G3XA 1DVRA 1TMKA 2R6GA 4ASUA 2OAQ1 1N0UA 3B8HA 2CBZA 4KU4A 2W58A 5D3MA 2CJWB 3CF0A 1D2NA 4PC2A 3TQCA 2ZVQX 3WYAA 4WXRA 4YQFA 1KYIA 621PA 1A82A 3C14C 1SGWA 1KJWA 3CO5A 5P21A 4XWOA 2CLDX 3BIFA 5J4LA 2FZ4A 2VP0A 2YWHA 2O8BA 5DI3B 2CMKA 4MRNA 1M7GA 2F1RA 3FYHA 4X8OA 4PZYA 2W6IA 4LBZA 4B2IA 3LX5A 4EFMA 1HY3A 2CHQA 2H17A 4RD2A 5HCIA 4CIDA 1E2PA 1R5BA 3N70A 4RZUA 2DWOA 1I4DD 4GZMA 4U02A 3Q5EA 3X1YA 3X1WA 3B2EA 1XPRA 3FGNA 3N5CA 3AUYA 3KXKA 3TUIC 2F3RA 2CL7X 1DAHA 1Z6XA 2OCPA 1KK2A 5FPYA 1KSHA 1H8ED 3CX8A 4RCYA 1E9CA 3Q3JB 2B92A 4HAVA 2ODNA 4Q00A 2FFHA 5C2JB 1UPTA 2XB2A 3AVTA 4MUAA 2MSCB 4GPTA 3FHCB 1G6HA 4FIDA 1OYWA 2QTFA 4HLUA 1DO0A 4FN5A 4HLDA 2K5UA 3GP8A 2NPFA 3B1XA 3BH7A 4ERNA 1BMFD 1ZBDA 3VR2A 1NLZA 3OIVA 4OL0A 4B3XA 3SEAA 2RMKA 1FMJA 5CLLA 1DADA 2ZR0A 5DHFA 5E3HA 1KSFX 3OFNA 3OHMA 3BGWA 4N0EA 2QU8A 2ZI6A 3C5CA 1OFIA 3WMEA 1NG9A 3DZ8A 3Q7PA 5EXSA 3IO5A 3QY0A 3LH5A 1N6LA 3VX3A 2F7SA 4V0OA 3BXZA 2P6UA 3X1ZA 4LHYA 1NIJA 1KGDA 2OXCA 1W7AA 1ZJ6A 2R6DA 5ANRB 1N6NA 4V0MA 1LTQA 1X3SA 1N6HA 2J3EA 4DT1A 2C9OA 1GRNA 2GILA 4URXR 2VP4A 4G5QA 3EX7C 3H0KA 4EDHA 4Q1DA 2DHRA 1ZU4A 1P2UA 5K8IA 5IK2A 2XAUA 2XSZA 4M9SA 1WQ1R 1E2MA 1CR1A 1TF2A 5J4YA 1W49A 3AM1A 4AC9A 1ZCAA 4HB4A 1DTSA 4EPTA 1Y63A 3U7GA 3QG5A 3VFDA 1E4VA 1RE0A 1E2EA 4B6EA 3QI2A 1W36B 2AL7A 4JKIA 1K6MA 2MMGA 4BEBA 5TVKA 1TUEA 5DGXA 5SZHB 3BERA 2NO7A 1FUKA 2V7QD 3IPYA 1NKSA 1Y3AA 3LAWA 4JBXA 4CF7A 4Q4JA 3AVQA 4C0QC 1VKJA 3L0PA 3TQFA 3CH4B 1NVVR 4D26A 1VIAA 2I1QA 1QVRA 4JKYA 3MAAC 3TK1A 1XTJA 6Q21A 2WWIA 1X86B 2R62A 4LC1A 3NC1C 2J0UA 5HPYB 4LX0A 3H1TA 2OILA 2IUUA 3UANA 2J45A 1FX0A 1SVLA 2FA9A 1YRBA 4MGKR 4A0GA 1YRAA 3I32A 4YMTA 5KPDA 1ZVQA 3E70C 4Q4AA 3PV0A 4DIEA 2LKCA 2B21A 2GHIA 1UDWA 1IXRC 5KU1A 1U90A 2B7CA 2PZEA 5FTJA 1DARA 3TW8B 2WV9A 3W8RA 3SJAA 5JCPA 2WWXA 3IILA 3NVAA 4GBMA 4GMXA 1YR6A 2PMDA 2GF0A 2FV8A 3PQCA 4CW7A 1JEDA 3OEHD 1G17A 1R8SA 1SVOA 2AHOA 3CW2A 1RZ3A 3I73A 3T12A 3UKDA 3HU1A 1BYUA 1OYYA 1WRBA 2VF7A 4Q1BA 1J2JA 3GMTA 3SFZA 2WMNB 4DLUA 4L4UA 2MMCA 2LWIA 2PCLA 4AYTA 4D4MA 2OZEA 3KTAB 2QY9A 3CWQA 1IN5A 1F2TA 3QXSA 4PC3A 1NJFA 1OPXA 3KFXA 2NGRA 2JASA 3LO5A 3LV8A 1CP2A 1S2MA 1XXHA 2AX4A 4CEIB 3TW4A 2FG5A 5FI0B 4Z8XA 4ARZA 5JS8A 3W9YA 2QM7A 2YOFA 3OIYA 3QVVA 2WPDA 4WZ6A 2QI9C 2GA8A 3QEOA 2OBNA 1AKYA 4JLPA 4RSGA 1X8JA 3R8FA 2N46A 2OSBA 4HLCA 3CH5A 3F3YA 5EE0A 1PVOA 2YYZA 3QKRA 4L16A 4OHZA 2FEOA 4XD7D 3QF7A 1YZLA 2RCNA 3L0IB 2ZR9A 5JWRA 2OV2A 3ZQ6A 5KPJA 4B71A 3CR8A 1YR7A 2A30A 4QGGA 1OSNA 2HXYA 3B60A 4DB4A 4BFTA 1II8A 2ZYUX 1SXJD 1MRSA 1P7CA 3REGA 5AJXA 1E9RA 2ZJBA 3BFKA 4YXWA 3LQQA 2GKSA 4K81B 1C9KA 4UKDA 2PT5A 4JL8A 4LPKA 4Y0AA 4TQUS 1XTKA 1K8RA 1KNXA 1PLKA 2GJ9A 2GRJA 2H18A 1I2MA 3K70C 4WZAE 2DR3A 4HAXA 4MYTA 3RS7A 3CNNA 1NN3A 4KXFB 4QC2A 1KDOA 5AJYA 3DKPA 4HYYA 1QHHB 2W0SA 4DLZA 2WIBA 4DHEA 3FOZA 1NVVQ 1RC8A 2H5EA 3OIUA 3UIEA 2P2LA 2OFWA 4G5SA 4DB2A 2IYQA 4BFWA 3HP1A 1IN6A 1YR8A 4US0R 5FOTA 2IW3A 2HLDA 1G3IA 4C0SA 2C03A 2VF8A 2X77A 4XVUA 5AUOB 4OI0A 2W00A 1EFTA 3A58B 1CJTC 2RGEA 2EWVA 1XD2A 4B44A 3SJCA 4A6PA 2WJIA 2ZM5A 4JVLA 4ZKEA 3QVUA 3QKSA 1EESA 4C7OB 1XJCA 3RHFA 3KXIA 5J40A 1KIMA 4OQXA 2JAQA 1GNPA 3AP1A 4AIIA 4PC7A 2KE5A 2V1XA 3K0FB 2ODBA 3M4YA 1G7CA 4FD2A 1KI6B 4G1UC 4HUTA 2IXFA 3GLIA 1E2QA 2TMKA 4PZLA 2NO0A 4EPYA 4EFNA 2A9KA 2IA5A 1OXXK 1LV7A 3WMFA 2OFOA 4RD0A 2F1JA 4R9UC 5DNYB 3MLEA 3UXMA 3SS8A 4JYCA 3EZ7A 1VDZA 3GEIA 4IVQA 4JIMA 3W5JA 1EK0A 4E09A 2D3WA 2D7CA 2YHSA 2AWOA 1KZ7B 4PPQA 3WBKA 2BOVA 4B2PA 3DEFA 1FL9A 4PANA 1UBEA 3D3QA 3W34A 5CK5A 2HDNB 3BORA 1Z3IX 2REXB 4BFXA 2VSXA 4BLPA 2P5SA 4MA4A 1CIPA 1ETUA 1ZIPA 1S96A 1JQLB 4LJ9A 4NL4H 3LWNA 5BYKA 5EE1A 3K0AB 3KJIA 1TTTA 5DISB 1XEXB 5B30A 5E7IA 1S1MA 1YHNA 1M7HA 3AGPA 3CZQA 2WJVA 3E1SA 3QUSA 4NBSA 1ZUIA 5IT5A 4PC6A 1ZINA 1GDDA 2NQ2C 4IOLA 5BWMA 4PPFA 4C0LA 1QHYA 2HJVA 3WBJA 2ZVPX 1E96A 3RWOA 1KHTA 4W5JA 3VR1A 3CRW1 4Q48A 5L3QA 1W0JA 1W0KA 1F2UB 3RANA 5EXTA 5HR5A 3TUZC 1N25A 4TZ0A 4M1TA 1AIPA 2XTMA 3PEVA 2IUTA 5JMTA 4Q18A 3MWJA 3N2IA 5H8WA 4Q4HB 2QP4A 4NCJA 2IS6A 3RRNA 3EWAA 1UKZA 2E9SA 1G8YA 2WJGA 4XTRA 3BAFA 2NMVA 3MJHA 1OB5A 4X8MA 1M8PA 4ESHA 4NU0A 2CVHA 3EA0A 4EPWA 2ZRJA 3MCAA 5FBQB 1KI8A 3GEHA 1Z0FA 1Z6TA 1FQKA 2D2FA 5FUWA 1NMXA 1FTNA 4I1VA 4BFVA 3RS2A 1G16A 1CJUC 2JJ2A 3DOEA 2ZSEA 2QT0A 4YMWA 2SHKA 2ZSAA 3ECCA 4GOXA 3R7WB 4TLEA 3LVRE 1Q22A 2RGAA 3B1ZA 2FGJA 5EQTA 4CEHB 1FMLA 1XTSA 3MG9A 4GRAA 4IXNA 3DZDA 3RS5A 1FUUA 4DSUA 3B5JA 3THYA 4DIDA 4TYYA 4GFDA 2NOAA 3ZDQA 3BBPA 5KHOC 4GMDA 1UADA 5CIQA 2VHCA 2FU5C 2ZUDA 1HA3A 2VLIA 4TMWA 4R2HA 3K70B 3BC1A 2WHXA 4DCTA 1XBTA 2QMHA 2H57A 1XJ0A 3A6PC 3FFAA 4IRUB 5TMPA 2QN6A 3N2EA 5C18A 1P72A 5G3YA 1G3QA 3FHOA 4EAQA 1E2FA 5TDHA 2RB4A 1I2DA 1P9NA 2AWNA 2QP3A 2NZJA 3U5ZB 4OI2A 2GCNA 3A4NA 2IHBA 1UFQA 2OBLA 4EPVA 3LLMA 3SR0A 2IEZA 2ATXA 4IDOA 3VKHA 3P4XA 2OM2A 5FOXA 4D4JA 3LD9A 4FCWA 4C0AC 2IXEA 1U0JA 1T8UA 1KTVA 1IQPA 2IYXA 3AF1A 4TLDA 3WP1B 2GCOB 2Q3HA 1SKYE 4JVNA 1H8HD 4QJ4A 4HB2A 4LBWA 3TR0A 3QPVA 4PAQA 5LBIA 4V0NA 1XFAA 3K9GA 2JLQA 1JEEA 3C7KA 3RC8A 4B75A 2QMEA 3BB3A 1JECA 2ANBA 4URYR 4GP7A 1ZU5A 1XMJA 3Q5DA 4IFEA 4EQ6B 1OV4A 2MSDB 4KITB 4RD4A 2ZETA 3Q8XB 2RGNA 2CLSA
chains in the Genus database with same CATH superfamily
1H0SA 4BWFB 3UWOA 1JG7A 5DM70 3JQFC 4XE5A 4FMDF 6PFKA 2BMAA 4KVGA 1T0HB 2R9VA 5HIKA 2FPRA 2ZPAA 3ACCA 1FTSA 1ZNYA 4RM2A 2H0AA 2CJWA 2QYHA 4NDNE 1FRVA 1XL0A 3GJ0A 4AWXA 3WVNA 1Q1QA 2DF8A 3JQ7A 1IN1A 4IIBA 5CFOA 5L4LA 1L7DA 2YV1A 3KLPX 3OQJA 1SWWA 5A4JA 4BAUA 4Y2SA 3F2IA 4Q7JB 5A7GA 1TLLA 4UHDA 1WJGA 3JZIA 4B32A 3ZS8A 2AI1A 4DMRA 4EYOA 5HG0A 4C6HA 2J6BA 2X5KO 2VHTA 3DMPA 2PUDA 1UJ2A 1MIOB 2JDIA 1X1EA 2UAGA 3ZNOA 3TUJC 3ASYA 3K9BA 1TEXA 5LA6B 1Z7EA 2HSWA 4OSOA 5F51A 3C5VA 4PFSA 4A91A 4E2XA 3PIRA 1DX4A 4QEKA 2FPXA 3P26A 4P6VF 4BCDA 1K89A 2JATA 3QPWA 4NFYA 5KSOA 4EG8A 3HXPA 2CEAA 1IUPA 2R86A 4FGWA 2PKWA 3GEPA 5A0FA 4HPWA 3S2SA 4CV3A 2WAAA 5I8ZA 1U0GA 1X7WA 2GEUA 3MCVA 4HDCA 2OZLB 3FTQA 1KFKB 3Q7EA 4NBKA 4KREA 1P45A 1JU3A 1AB6A 2PY6A 2FVXA 3RADC 2XCOA 4DV2B 3JD1A 2QP9X 4QU9A 4YK7A 3QEJA 5LJLA 3AYZB 4IY1A 2XRMA 3MRVA 3MJEA 4DXHA 2XMPA 3BIXA 1I5RA 2PUHA 4CMIA 2A14A 2GJAA 1HI9A 3PXGA 3PQEA 4L5IA 1ECCA 1NQXA 1PR1A 1LLFA 4N5DA 4KR9A 2J0SA 5DHAA 2XUZA 3L8FA 4HQRA 5G1PA 3CVUA 2HDOA 3UAGA 3K2EA 1QGED 2VDKB 4MDYA 4RXTA 2Z4SA 1DUVG 3EE6A 1E3WB 1E2UA 4K46A 5J4KA 1PEDA 3HKDB 4BO1A 4RS3A 4II2A 1UDXA 3B9PA 2QQ5A 2W6ZA 3F5QA 4G67A 2IQIA 1NGSA 4O6VA 3KJZA 4WNIA 5DT9A 3G5MA 5YASA 2CNNA 1FNNA 2NYRA 5IRCD 3E7DA 3HB4X 1H4TA 3IQIX 4A10A 4D0GA 4G56A 4NPCA 1TIBA 5I7WA 4V0QA 2GSWA 5AWFC 5JAUA 3QPCA 3LS2A 2IXTA 4U00A 2B1IA 5AUNB 3J81A 3SE0A 3Q40A 4N47A 4JJKA 3MYYA 3MTDA 5E2AA 5BSWA 2BJHA 1KERA 2PMEA 4B6FA 1IUKA 3W78A 4QU0A 4BYGA 2BVNA 3LM8A 1OBFO 3PGA1 4G85A 3TEFA 3G2QA 2C31A 2V54A 3OD5A 2JVIA 1MORA 3O9ZA 1DNPA 2A5DA 3PE4A 4QQNA 3ZWNA 4AB1A 4L76A 4KLZA 2PM8A 2XMGA 3QKWA 5KDLA 1RAGA 2UYCA 4OKSA 4OK5A 4A3SA 4LF4B 2XDQB 4IQGA 3C5EA 3JQ8B 3Q11A 4R41A 1S01A 1Z22A 2PH7A 3BWXA 3FCXA 3PHGA 3IAM6 2BT4A 4H17A 4P3XA 5J58A 3E84A 4DKXA 4N1AA 4G25A 2IUEA 4IDFA 3RVBA 3KEOA 1EDDA 4NBNA 1TC1A 1KWGA 3GUHA 1DDIA 2LV8A 3ED5A 5TJ9A 4NX2A 4RF5A 4AX8A 4BVKA 5KNLA 5ARDA 4U2KA 1B2LA 5B1IA 1X1RA 4XZ3A 2HXGA 1VSQA 1O97D 2A7QA 1SUFA 4P81A 4XCVA 3KPVA 3EGOA 1SKUA 2OO3A 1GGJA 1Z18A 4RZ3A 2IIBA 1MIHA 2UZIR 2AG0A 2QE7D 4FX2A 2NZUG 4TSRA 3QJYA 5CXUA 1J2TA 5HF5A 4ZHQB 4WGFA 3EQ9A 1NI4A 4L8WB 5CITA 1HETA 2RGUA 4BNKA 2Z8YA 1TT5A 1DP4A 4CT0A 2PMBA 4M1ZA 5FPQA 2JEZA 4YAJA 4L78A 3HB1A 4UBLA 1JGTA 4Z99A 1VRCA 2AG1A 1AGRA 1K06A 2V8BA 4JHLA 2XF8A 3ZOKA 2C2BA 4JP3A 4ASUD 5C1OA 1GOTA 1ZSVA 3MJ4A 5AW4A 1ZGGA 2BFWA 1Q11A 3PD0A 3BL6A 5HGJA 4RULA 2PMWB 4YUAA 5A4MS 5LP6F 3NJ8A 2DB3A 2HU7A 4NOKA 5IWAB 5JATA 2C7GA 2HWKA 4TMZA 1IVSA 3BHIA 2H5IA 5AI5A 4CF5A 5E3JA 1AOXA 3MJCA 4HG2A 3H1GA 1BG6A 2PFSA 3OETA 4UQOA 1DC6A 1DFHA 1JXMA 2JGEA 4HEHA 1R0RE 4MVJA 4QHSA 1GQQA 3VC7A 3D7NA 3W4IA 2WYOA 4D80A 4K0KB 5C37A 1U65A 3OO0A 3DXFA 3V1NA 4B6JA 2J3DA 5HIJA 1LVGA 4OYLA 4QUJA 1Z6PA 2ZBQA 3DV9A 4UCXA 5BT9A 2NM0A 5G1OA 1YZNA 4KGZA 2D6FA 3BIWA 4O4LB 3RIGA 3K8QA 4NCIA 3ZTTA 3WWPA 1QHSA 2QN1A 3L82B 1B41A 3NKVA 4I5GA 1VIMA 1XTVA 4ZI3A 1E0JA 1F0YA 1SUBA 3QNMA 1EUCB 1Q19A 5FUMA 1PZNA 3HKCB 4Q9HA 4DQUA 2Y1OA 3U4MA 1AB5A 1JTFA 2V4ZA 3KTAA 1GPWB 4ND7A 4GEKA 4G9BA 3LZCA 1VMAA 3QV1A 4FLEA 4N8EA 5EERA 5JWHA 3H3FA 3VSAA 5E9AA 5CVUA 3P7MA 5AUPB 5KOJB 3K2BA 4DILA 5CAEA 1AF4A 2ZSFA 3WDSA 3KYDA 3P32A 4HJRA 1BSVA 2EYUA 4GUAA 3W2IA 2Q0HA 4LSZA 2ZTSA 1BZYA 1JXAA 4TSFA 4ABYA 4CM3A 5DCLA 2YWBA 4E07A 2EGHA 3AUKA 2NU9B 3NRJA 4G1VA 4EH1A 1HOTA 4LVNA 4ENRA 3BJRA 4ZQFA 5ER9A 3OX4A 1XDGA 3VAAA 4FDTA 1J1IA 1JDVA 2DQSA 2Q3DA 3UJ8A 3ZHSA 3O3NB 2WKRA 3ANYB 4LY3A 4UJ3A 5EP3A 1R6DA 3IT2A 4P5EA 1BRTA 3DKRA 3AKZA 2CMHA 4UTXA 4N18A 2PLWA 1DTWB 1K3FA 3R5HA 1KJNA 3KB6A 3WB1A 1TUBB 4ZVVA 5LQMA 1J0DA 1G5FA 2XKAA 2Z9CA 4R3UC 4D74A 1U7DA 1UAGA 2EW1A 2Q7DA 1MU0A 4H31A 2JIQA 4G4SP 1X7XA 3DOHA 4PS1A 5DEIA 1D6SA 3KU4A 4K6OA 4CM4B 1DRJA 1O95C 2NV6A 2XYPA 3FTCA 3C3WA 2FPLA 1ZA1A 3WGOA 5DTJA 3ZDDA 3G13A 2IYVA 3ZWDA 1A4RA 1L5OA 3LCUA 3Q3IA 5LC1A 3HRIA 4F4JA 1UBMS 5JZVA 5C3UA 1L5HB 4ZMSA 3CEPB 1O54A 1YVEI 2CLHB 4UTZA 4W8HA 5JNSA 1O2DA 3NANA 4IIUA 4I1PA 3ZVMA 2YTZA 2FUEA 5K0JA 2PH1A 2VI5A 3R7FA 4BBAA 3RGGA 1BXGB 4P2GA 4D98A 4OLBA 4CLOA 1Q83A 5EJEA 1R0SA 5BYAA 1BXZA 1VCHA 1ODFA 3S1LA 4I55A 4R84A 2HADA 2EDCA 2QRMA 3QHPA 4L0MA 2QL9A 3NZEA 5EJGA 1Z45A 2E6KA 3SC2A 4NABA 5M7EA 3PUJA 5C4GB 3U80A 4BJ1A 2JNWA 1ZH2A 1XCPA 3WL7A 3GR6A 5SYAA 4OJQA 4PINA 4EGFA 2G5CA 2GXSA 3AY0A 2R6CA 4XIIA 4AUNA 1F7VA 5H70A 1X7ZB 3NHSA 4IJKA 1Y37A 3LGXA 2AHRA 4Q66C 4D6YA 3LUCA 5BXQC 2ZYGA 3KLMX 4A8PA 4N41A 2VZLA 2XMZA 3HN7A 3THWB 2QBYB 2C77A 1JU4A 3CRNA 3OA0A 4LHXA 5F12A 3IP6A 1USWA 5J2TB 3DXXA 5HCUA 4W5TA 1WAMA 1BS1A 1EG7A 1PGNA 4ZQEA 4Q1CA 3IURA 1CDDA 2WFAA 3ZV6A 1KI7A 3KL2A 1U9JA 4XVRA 4GKKB 1QYWA 4EYQA 3PPXA 2VAMA 1OFHA 2FFAA 1Z0DA 1GHTA 2QL5A 2PZLA 2Z2XA 1X92A 3LUDA 4J07A 1NL3A 1P1IA 3AKEA 5M2QA 4ZEOA 1K8ZB 1VXRA 2J48A 1JZQA 4UTRA 1I5EA 2XDWA 3DKVA 4L5AA 3WLAA 1JQDA 4MWGA 4KO4S 4Z8YA 4DMUB 3R7NA 3MQ4A 4MP3A 2O7QA 2K2WA 4BQPA 4XX1A 2Y1GA 4A9AA 5AVOA 4IXWA 2AMJA 4GL2A 1PT7A 1QKJA 3CIFA 3D64A 2GZHA 5CB4A 2PUFA 2XYGA 4CUJA 5TVGA 3ACBA 4ZZ2A 4LSWA 2YZ2A 1YVUA 1P19A 1UAYA 3DR5A 4D0RA 3K1JA 4DSNA 1VL6A 2BMWA 1WY5A 1YL6A 4W9RA 1DT3A 1JLKA 1K3UB 1U5AA 4IDHA 4H4CA 4UCQA 3EVNA 4TVOA 3K1AA 3LNTA 3UJPA 1CF2O 2DH5A 5LQRA 1XAIA 3WDMA 2V8OA 1Y1LA 2AXQA 1C9MA 3E23A 4FGLA 4J4HA 1DBPA 1EVKA 4WA8A 2WU8A 1JPJA 1NX6A 5BO5A 4YCAA 1C0KA 2IE0A 1N2ZA 1H1TA 1VG1A 3K0AA 4AKGA 1BX3A 2WJHA 1GAJA 2YZKA 2PE5A 2P9QA 3F7OA 4KMRA 2JLSA 1GQYA 2QAJA 3MWFA 4R8LA 2OPHA 3IPXA 1H2YA 4MQ6A 4KO3S 3DTYA 4YMIA 2O9JA 3PUXA 1XXHE 2HU8A 1GXSA 2PQ0A 2VPQA 4LZZA 3WRYC 1HE3A 1XTQA 3H2KA 1P18A 2FWNA 5F73A 5IJ0B 1WXFA 3STTA 3X1XA 2FOLA 2IXGA 1IBMB 3VU9B 4NVRA 5JSUA 3H9BA 2JLXA 5A9TA 4R6WA 5I4CA 1D0SA 4HL6A 5K01A 4BNNA 4NZ9A 2CUTA 4TT3A 3ZGZA 4MJ7A 1G1MA 3HKBA 2IIPA 1JG3A 2FP4B 2H06A 5EYPA 3VGJA 4JZKA 2PBFA 3IEMA 4N48A 3ODPA 1USKA 1ISHA 3MIIA 4RKFA 4C03A 2CUZA 3BEDA 3EF1A 3ZD6A 3KVYA 3E3LA 4XPIA 1VJ1A 3EY9A 4KPFC 1DSSG 4FNOA 3MM4A 5JSQA 1LNZA 1S8NA 4OMFG 1Y89A 2YV4A 4HEA1 4DSAA 2H1VA 4NSNA 3F8WA 1IDN1 3OZEA 2Z3WA 5IKPA 1GL7A 1RXSA 5IG2A 1WBJB 4LZLA 3DLBA 4J1SA 4Y3UA 1CUGA 1CXZA 2IYYA 2DOKA 2YIJA 2HHAA 4MUYA 3G1UA 1D7AA 4IS2A 2H08A 2ZIVB 4AVYA 1CJBA 1D1SA 3OTIA 3K5WA 1E6MA 4MPPA 3FI9A 4JZYA 4KQFA 3OZWA 4YWHA 4R9RA 2Y3IA 4CEHA 3OC0A 1GRRA 1C8LA 2D5CA 1BN7A 4EELA 4U5QA 1BFKA 3PNYA 1E18A 4J49A 5B6IA 1YAJA 2HBYA 1T8WA 1RXUA 2WU4A 3NCHA 1YA6A 1FS4A 4YPFA 3EDCA 1OWOA 1V8OA 3EN0A 4WCFB 3L93A 4R5HA 5AK0A 3SCZA 4M38A 1IEXA 3H17A 4HF7A 4LOKA 2ZE7A 1WE2A 4RA6B 1WD5A 5CHYA 3OICA 4ZDIA 4MS4A 1BIFA 3COWA 4ZZIA 1OAOA 4JB0A 5KVAA 3AR9A 3IPLA 4TQ9A 1C0EA 4N3NA 1E69A 3GAMA 3KOMA 1JIKA 3NALA 5GJWC 3TL6A 4KW7A 1LH0A 3EZ6A 1A9XB 3KZVA 4DBLC 4J0QA 4X93A 5BSKA 2IH5A 1E3SA 1NXSA 5CBPB 3WAJA 3OBIA 3OKAA 5AM3A 4MR9A 5ERYA 5C53B 5CW2A 4QA9A 3LE8A 2Y99A 3S5UA 2QN7A 1P33A 2ZP1A 3UQZA 3N2GA 5KTKA 2OEPA 1IONA 4PO1A 4FFOA 3IAXA 5KOYA 4CKEA 1RWNA 3P2JA 2AOVA 3KQHA 4IEIA 1C7IA 3SHFA 1ADBA 3U09A 1PGQA 1N0WA 3WLLA 5FEMA 2HSDA 1DBWA 3NTUA 1EHIA 2H1FA 1OAOC 3NBAA 3OZGA 2IZ1A 4KWCA 4LCBA 3WIOA 5I9NA 1HFKA 3II6X 1LKZA 4YHHB 2CVPA 1YNSA 4PWYA 2D74A 4Q7MB 4UM8B 2GCOA 1NI5A 2I3ZA 2X7HA 3SBDA 3VHLB 1ZR4A 2FW0A 1MO3A 3AR6A 1H1LB 1RWPA 3HM9A 1CZRA 4YYZA 4F6RA 5KCMA 5AVYA 1JTVA 2OP0A 4WECA 5AK5A 3D6FA 3UW1A 2VATA 4M9ZA 3CRQA 2H4XA 4NV1A 1N92A 3OPYI 4KYUA 5FTNA 2FPPA 1TLFA 2IYSA 4R3NA 5IVKA 4EZEA 3NHFA 2P7HA 4QHYA 1PFVA 2FPWA 3SC3A 2E4VA 2G0TA 3OZSA 4K9OA 1ADJA 3KZNA 4ZV4A 1R9MA 3P9QA 3WK8A 1W4ZA 2VS1A 1Z5NA 5KNCA 1RPAA 1K27A 3EBOA 3Q12A 4YCBA 4EUNA 2BZ1A 4J0IA 2P9EA 4M89A 3UG6A 5ICSA 1X7GA 4FGKA 3ROPA 5JZMA 1Z63A 2IF0A 5IBQA 2G25A 2WQZA 3DVLA 5IAAA 3RC1A 6YASA 4QARA 3VDNB 2P78A 2YY6A 3LKVA 4BNUA 4CE6A 4EJSB 1AGYA 4HMPA 3VO9A 1W0KD 4XX0B 1Q0SA 4TRMA 1JXOA 1N7IA 1P77A 4DUGA 1PLLA 4B5LA 2VUUA 4EY8A 3IHWA 5IXJA 5GM1A 5F5NA 1O0SA 3UV7A 1MIOA 3D8RA 3R6TA 3H2BA 5LA6A 2IS2A 1A9PA 3LPNA 1CDZA 4QYWA 1GPH1 4U2FA 3DZJA 1ZD5A 3HSSA 4MUGA 2ZJ0A 3QMPA 4K9KA 2IHVA 2CMGA 3U13A 3OT4A 4GLJA 4F3YA 1RMYA 3ZJYA 1GILA 3U56A 3SDSA 1ZGBA 3ZVRA 1U0HC 5B2FA 1XQ6A 2YZNA 2OZLA 4NICA 4X85A 2BGLA 3PQ8A 2XZOA 3JALB 1XJWA 3QOYA 3P94A 4ZHSA 3N0RA 1CS4C 2DFVA 2Y1LA 2AW5A 2EJUA 2JFGA 3KR2A 2VSQA 3PDWA 5DHQA 3UHPA 4D5GA 4EEKA 1LRLA 1WZCA 3L43A 3M1AA 4Y0VA 1S3FA 3DC2A 5K0FA 3TM4A 4X65B 1EIZA 2EARA 2HQSA 2B82A 3NBQA 4LFBB 4QFDA 5B3JA 1XELA 3R0VA 3EVAA 2ZI9A 4N7JA 5HTKA 2VDUE 2G7ZA 1EM6A 4WJKB 1RWBA 1QHXA 2HWYA 3KYCB 4BLOA 3NBYC 1E3WA 2AGVA 3SX0A 3HKDA 3U44A 1GITA 3IQFA 4B6SA 2O07A 3B78A 4NY1A 3GLHE 2JZCA 4H7DA 4L57A 1TNDA 2P40A 3AH8A 2YN2A 4C0XA 4CR6A 3H8WA 4ID3A 2W2LD 2EJBA 3L8HA 1SBHA 4EMUA 3MUNA 1UDAA 4RESA 5CH5A 5A03A 3I53A 4YQEA 1N77A 1EFRA 2P2CA 5EIAA 3UBMA 3CR3C 3HEAA 3CNBA 1GSIA 3PR2B 5JY1A 4KH1A 4BFLA 4G86A 3QUQA 2BGJA 2DQYA 2KS6A 2QZSA 4ZQBA 1BE0A 4E12A 4HUQA 4HS9A 1ZM2A 2ZQ5A 4TTTS 3HHPA 3LUKA 1N2HA 4G0YA 1LGYA 2WFMA 4HWKA 5LQUA 4L9RA 4QXAA 5SZIA 4BXOB 5E4FA 1RYMA 3PKIA 5FTLA 2XDQA 4P3PA 3JQ8A 2HZ7A 3FAKA 4HB3A 4YRRA 3AUTA 3CZRA 4FFPA 3EAGA 3DNPA 5LXTF 1D4AA 2W4MA 3RG2A 4C4OA 4CRWB 4EW1A 4YMLA 4FK8A 4G6ZA 3HWSA 4Z7QB 2OFXA 1W2HA 1NW3A 2J5KA 2REOA 5JBQA 3PTLA 3DO5A 3THOA 5A1TA 4DA4A 2V55B 4WCDA 2RKWA 3A0UA 3FGPA 4N0QA 4KQHA 4OB7A 5CW1A 4F2PA 1EUQA 3ZX5A 4AI6A 3LX4A 5A05A 1V5EA 2OWEA 2VBIA 4JSRA 3FNBA 4ZHQA 4D9GA 2QAGB 3G0DA 3FNRA 4G1FA 1YS7A 3P2EA 2WWTA 1WR8A 1GZVA 3JARB 4ZOCA 4CIVA 4R40A 1KR2A 3NGLA 2EU8A 5SY6A 3UC5A 3VNSA 1LFAA 2OMEA 2VA8A 3BCHA 3A6HA 5JYEA 4PV7A 1IPFA 4WOPA 3EH2A 1A1SA 1DG9A 3Q8WA 3QKTA 4KXVA 1A5ZA 1E20A 3RRMA 3ZWVA 5JNLA 3OWXA 2GOYA 5JYDA 2F1IA 3EGCA 4WFIA 2EFGA 1H4SA 5LQCA 4W8GA 1WB6A 1S8FA 2Q99A 1XCGB 2A67A 3GXOA 1S9HA 3OZRA 2B0JA 3W5HA 2JKZA 3WXMA 4TTAA 3FFBA 3SYNA 1YVPA 2ZZMA 1PR0A 2P4SA 2GYUA 1AQNA 4HVLA 5IVPA 4TXMA 1SY7A 3VUFA 4U7DA 1GKLA 1C1HA 4TTPA 2GRAA 4DV1B 2ILVA 1NLUA 1XNGA 1UPCA 1J90A 1UZUA 3KKMA 1AGPA 3PXCX 4UC0A 3KEFA 3OZDA 3WL8A 4PHFA 1LI7A 3DMTA 4CIXA 2VR1A 1M6EX 1XROA 2V6FA 3FKSA 4O4LA 4OHUA 4QU5A 1W76A 4Q7EA 3TDMA 4RQUA 1KP9A 5FR2A 3VKFA 4P31A 4E5NA 3DW3X 3KQTA 5ITWA 1TU3A 3HYNA 4HX2A 2GBLC 1O5IA 2GX6A 4O0LA 5C32A 1UUFA 3BPSA 2FUKA 4DLRA 1JZTA 1EUCA 4K1LA 4WK6A 3HKCA 5IT0A 4I3HA 1HKHA 1W2WB 3OMWA 1HG1A 5LWQA 5KKAA 1ZH0A 1NXWA 2QD1A 1TAGA 2PV7A 1GU1A 1VKHA 5BQ5A 3THXB 4DADA 2ARKA 3R0ZA 2AR7A 4F1WA 3KYBA 2H4JA 4D96A 5JAHA 2ZJ5A 1SCNE 1E3LA 2O1EA 4R6XA 2NU9A 2XGGA 4W1SA 1Z8NA 5A7HA 4E5KA 1AS3A 4EFLA 1A3CA 3TOZA 1EJ0A 3DEIA 3L8ZA 3UUFA 1A5SB 1SBQA 1SZPA 4AZ0B 3HVRA 2O6LA 1OI7A 2C1EA 4DDUA 1YRHA 1SCBA 2XE7A 5EP4A 4A0SA 1LB1B 4MWZA 4MV6A 4DLVA 2YIMA 5EQFA 2XVYA 5CFLA 1MO5A 2I3AA 1DTWA 1QV9A 2IPOA 4YRMA 1K5GA 2CVOA 1TUBA 3NRBA 4TS1A 3NAMA 5DGIA 2CKDA 3PFIA 3WKCA 1VC2A 4KLAA 4HHEA 5LPNA 1KO8A 1D4FA 1R88A 3DNFA 4KQMA 3UJNA 2CB9A 3CB4A 4IGIA 4RH1A 4DYVA 3SFTA 1SUDA 1PGPA 4A8HA 1JR3E 1M5UA 4M1KA 2QUBA 3ZE9A 4NLLA 1IJKA 1AMOA 3WGJA 1RBYA 4PG5A 3JS5A 3STHA 5KREA 1L5HA 3ZIUA 4ZMRA 3BM5A 5AI0A 4Q3LA 3AVVA 1T5HX 1PR5A 3I0NA 2V7EA 2GYVA 1FNSA 3NDJA 1KNQA 5EYPB 4I0WB 4JBLA 2FWBA 4QUAA 4LFCB 4KV9A 1FU7A 2ZIXB 4BQIA 1W36D 4RFSB 1BXGA 3PENA 4FOTA 4F2HA 1CKEA 2N75A 4YXWD 1HDEA 1FVHA 1JWBB 2P75A 1XG5A 2XECA 3GNQA 3KJEA 3F3MA 3KDAA 2Q50A 4WZAB 5CX1B 1FFYA 3UMFA 1G291 3DOOA 3T1TA 4J6EA 5ECDA 1IATA 3MWKA 4WVLA 1WCIB 4B74A 4DUYB 1X80B 2XVZA 2PZKA 5DK4A 4Z2AA 3AVXA 1G8FA 4U6NA 3G59A 1ODKA 2M1ZA 3RU9A 1GPUA 3F1KA 3W7VA 1SKMA 2WHPB 3WSWA 5C1PA 3D6NB 3GFOA 2UKDA 4UHJA 2ZKIA 2I33A 3LC0A 2DULA 4CMEA 2OCGA 2NP6A 5EMHA 1NAHA 2GERA 3PUWA 1C9DB 4LGVA 1UBGA 2ZGVA 4ZV9A 4RX1A 3SOPA 3THWA 2QBYA 1ST3A 2Y4OA 1L4LA 2B83A 2JCBA 4BKRA 4DLZA 1RRCA 2VWPA 3HKEB 1HE2A 1FFXB 1BCRB 1HL7A 1NVGA 3JR3A 4XW2A 5DMHA 4DA7A 4N65A 2BDUA 2FN7A 2RFLA 3V7NA 3LBAA 2EFJA 2WWGA 2DJIA 2W2VA 5I7SA 2FLVA 8OHMA 5BN5B 1NF3A 1XP8A 1QE3A 4RBNA 4IDPA 2ENUA 3ND6A 4DR4B 4A27A 3MB8A 3E18A 1T3HA 4ZQHA 5K0ZA 3H04A 3A28A 3NP9A 2R48A 2XMSA 4BAGA 1BOFA 1IXZA 2R00C 3M6UA 1U1EA 3L77A 3GAFA 5ALDA 4PZCA 3WYDA 5JADA 4AYWA 4LISA 1L4NA 1MC8A 2ROQA 4UHFA 5JBNA 2EKQA 3KVOA 1X3LA 1KYVA 1ZSNA 2AZ4A 3GD5A 2YMPA 3N87A 4CI0B 3MUFA 3KQYA 3WSVA 1YKFA 3N8DA 3J81k 1FMFA 3X1KA 4EKDA 3O95A 3PNKA 4QOFA 5AH0A 2ZWAA 5TB5A 4B8YA 2XWQA 2WYWA 1GLVA 5DULA 4Z0HO 4ZI5A 8ABPA 4YCLA 2R8PA 5F77A 3CLUD 3ABIA 4HAYA 2PWZA 4IKEA 2D62A 2VPPA 4TV9B 1JYSA 5EHIA 2X0KA 2P30A 4L3VA 4WH0A 5CTAA 2XWPA 3WL5A 1P5JA 5I9IA 1G4AE 2FMUA 2XD9A 2JLBA 1H3EA 4OO3A 3LCMA 1HOXA 5DZSA 1VHDA 2O8FB 1XRPA 3WBBA 1QGZA 3VPGA 1DMSA 1ENYA 2GXAA 1J33A 1BD4A 4L6CA 4N40A 4OG2A 3FOWA 1V25A 5CBKA 3G2NA 4EJ6A 1HYEA 2ABWA 1YB4A 2OBXA 4F11A 1VBFA 3FIJA 3O2NA 3F0TA 2YJNA 1Q7EA 3D6AA 4YRFA 3E7FA 2K6GA 2ZT6A 1X39A 2MCFA 5IJ0A 4ED9A 2EG5A 2B25A 2PMCA 2ZRHA 1SVSA 4J9UE 3VU9A 5JO0A 2BRUA 3OPNA 2R4TA 4L9AA 2FKNA 3FDJA 4ZT5A 2B2CA 4AP5A 1HDZA 1RLTA 2F1HA 4M9RA 4KGDA 4OQEA 1NBWB 2FP4A 1L5LA 2K7FA 1EQUA 1N78A 3SMVA 1ILWA 1YJ5A 1XSEA 4MV8A 2ZJAA 2ZKLA 3T3GA 4CIWA 4QGSA 1VL5A 2OORA 4MYUA 4DLYA 5J4VA 3L6UA 1JB9A 4NCAA 5I5GA 1ZGHA 4JQCA 3GVPA 1LLQA 1H2BA 4BV9A 3TKYA 2ZITA 4UNRA 5ICCA 2GGSA 4RA9B 2OQVA 4EPXA 1JEAA 1XZQA 4R7ZA 5DHTA 1QZXA 4A92A 1Z06A 2BRUC 2BKEA 1ZLYA 1OFGA 5EWJB 4QUHA 1TYAE 3Q8MA 2GB4A 1XWWA 2XTJA 1U0SY 3OY2A 3OLVA 5H0IA 4QRDA 1LTHR 4BEJA 4QX6A 4F0JA 1V9LA 2GVDC 1RCUA 3QXJA 1W6RA 2OORC 1JHPA 3UWPA 3ILXA 4C6RA 4F4CA 4MH0R 5FT9A 1XO1A 1RJ9B 3I3SR 3K8YA 4XJVA 1AV6A 4LQ4A 3V9AA 4EI9A 3KOYA 1WXHA 1A27A 2XX3A 1PJQA 3SMQA 5FNZA 2ZWIA 4ITRC 3RASA 1M1XB 2WOOA 4WCFA 3JV7A 3JVIA 2GR9A 2I6FA 1HBJA 1Z4JA 3ONEA 3VRHA 2PLFA 1W30A 4Q1AA 5CEEA 3Q3CA 5KQRA 4NBRA 2VP6A 2ZS9A 3FE2A 3L6EA 3OIWA 2B4YA 4MS1B 2VQ6A 4RA6A 5FTMA 2OYCA 2AOUB 4ECAA 4PIPA 1I36A 2YZ7A 2YWFA 4PLCA 3TBKA 5INTA 1C7EA 1VPEA 1CY6A 4BQNA 3W3AD 2CF5A 2A9QA 2ZRAA 4QD3A 1E1NA 2NXWA 1B3RA 1A9XA 3GPDG 2POQX 2VPXA 3MBOA 4E5SA 5CBPA 3E1KA 1XGKA 5IN4A 4P0TA 1QRAA 3GB9A 4PYQA 2Q3CA 4RUKA 1OE0A 4JKOA 1DINA 3KSUA 4H08A 3GPBA 3DJYA 4JODA 3DMDA 3FDZB 2Z58A 1EE2A 1LBSA 4GI1A 4V39A 2KJQA 4RLSA 1OMOA 1QK5A 2CCJA 2BJWA 2H4ZA 2JIZA 4DPMA 2PU7A 4OLFA 5IKOA 3GWZA 1RJWA 4JBWA 1RZRD 1O97C 4W6ZA 1XEWY 2JZOA 2VBCA 3DAGA 2EV9A 4JX9A 2V5VA 5A3JA 3GHYA 2NXCA 2ZRBA 4DCOA 4XYBA 4C2UA 4R05A 3FZNA 4JJZA 3SIRA 1Z8HA 3T1OA 4UTOA 1H5QA 3EJ6A 3FAZA 1ORWA 1H1LA 1XVLA 4FHGA 3ZK8A 3LL4A 1ISGA 1RQLA 3CKMA 4GI3A 1ZISA 2XYQA 4JCOA 3VOAA 2PSJA 2RHHA 1BE1A 4HLNA 4LZJA 4OXYA 2ASVA 5HA5A 3FNGA 2PVSA 1SU4A 1TRKA 2VZ0A 1IN7A 3C43A 2A0YA 1WMSA 4IPTA 3Q2IA 4JJGA 4JJ6A 4EYKA 1RYDA 3WIUA 1XPOA 3E2MA 3HNRA 1ORVA 4HSEA 4UZFA 3V4LA 5PNTA 5KYNA 2X5NA 1GT91 4KQEA 4M7PA 1TCUA 1Y8QB 3KQWA 4JL5A 4F71A 1KEEA 3ZCTA 1E5XA 1T24A 1ZM3A 2O8DB 3GXBA 3VR5A 4B82A 3E03A 4CGYA 3FN4A 4CKZA 3FPBA 1IY8A 4D41A 4H7HA 2I7VA 1ZJYA 1SBZA 1NPYA 1EFPB 1MB9A 2P4EA 3O3CA 3N8GA 3LZ6A 4RHEA 4XUDA 1VLLA 2EFHB 1Z83A 2XKJE 5CNIA 4DY6A 4Z1MD 4Q9NA 3UCXA 4QPCA 4EJSA 5JXJA 3PHLA 4PZEA 2AQHA 3NNNA 5B64A 2WSMA 3GGGA 5LYJF 3JZFA 4RXMA 2XA2A 2DWPA 3DQQA 3NVMB 1F0PA 2XQIA 4P2BA 2EJWA 2FZWA 3P2OA 1PDWA 2Q3JA 4RQAA 5LXTB 1FVOA 3WYBA 2YOGA 1B1AA 2A5FA 2FDCA 1E1CB 3JQRA 3QLUA 3VH1A 3IUJA 4AK9A 3IEVA 1YR2A 4DPKA 5KZMB 2FN4A 4CEJB 5HE8A 4DABA 1OFUA 2N0SA 2A4MA 2KQUA 1U80A 1XALA 3H5OA 3R1IA 2PZMA 1X74A 5DLQC 4LCEA 5FB3A 4I4LA 1SZCA 4X94A 3NHZA 1WETA 3GNLA 4D92A 3GRFA 4TVBA 3CRRA 3OPXA 2RH9B 1XKLA 1ESMA 1T0JB 3C2QA 2V6IA 4U9UA 1WMDA 3JALA 1WKCA 1ETHA 1N2XA 3KOXA 5A4FS 2BY4A 1G2QA 2Z08A 4BMNA 1TC2A 2C4WA 1NG1A 1AZWA 1UKAA 2NTYC 2X5XA 1RRKA 4EVIA 4F96A 5K9ZA 2A58A 3PEEA 4E1VA 2R6R1 3Q3EA 3WS7A 4AURA 3KWJA 4GR5A 2W9XA 3QLUC 4ZP1A 4TOIA 4DEXA 4FXPA 4DQ0A 3FVTA 1JKJB 1G7SA 3VXKA 4CLHA 5GZ3A 1IAQA 2QN2A 3HCPA 2VNSA 3KYCA 2O2HA 4KB5A 5EJIA 2ZDGA 5JYBA 1Q14A 3EZLA 2YYAA 4TN5A 1MRNA 2R96A 2X23A 2ZE6A 3ITNA 4KNWA 2I66A 4TZTA 1PW5A 2GM4A 1NJSA 1M76A 5JT1A 2PS0A 2AXNA 1LD3A 4NR0A 2AYZA 3VKUA 3K70D 2CCGA 4LZNA 4ND4A 4OOEA 5EP2A 3NG1A 1Q21A 4IJMA 4NJMB 4UPDA 1DE0A 2AUTA 3BGVA 3QUCA 4BE9A 1HFEL 1FLAA 5C5IA 3GJTA 3H65A 4HXYA 1E9SA 1A71A 2EBWA 5LP6C 5HSGA 3FVRA 3N1UA 1AY0A 4BASA 4BMCA 4OA5A 2A33A 4LK3A 5LKRA 2G0AA 1QFXA 5EE9A 1DKMA 1E2JA 2QR2A 5HMLA 5IJ9B 4Q34A 1PF7E 4BXOA 4QOGA 5JUWA 2FMXA 1U02A 1FE8A 3H5WA 4K9MA 4EHNA 4KYIB 1ZH8A 4NCHA 4EJ0A 2SKDA 3THYB 1VGRA 2PWPA 3L0SA 3OTHA 4GMFA 3E9NA 1KPHA 2WE8A 1E0KA 2NZVG 2G83A 1G98A 4UUBA 3VAYA 2D2EA 3T3IA 2IWHA 3T0FA 5IDVA 4F4UA 3WK4A 4NKRA 2ZTLA 4ZVRA 2WWFA 2Z5FA 3SBOA 3ZGLA 4ROTA 4PX5A 1NC1A 4UDYX 1SURA 3UWDA 1M8JA 1W5AA 5F1PA 1MH1A 2QAGA 2QD5A 3NBFA 5KQGA 4FWIB 4ZO8A 3JARA 2ZB2A 4AY6A 3UB3A 2ILTA 4KI0A 5FEUA 5KSZA 3I9LA 4HN2A 1CQPA 2F3UA 2ZE8A 3CLSD 4JNKA 5K51A 3TMYA 1TF5A 1BE6A 3FPKA 4YXFA 5FOQA 1RVDA 4RETA 2W6OA 2PRKA 3FMOB 2PX3A 4K6HA 4CMGA 2G82A 2GD6A 5FFMA 1L5RA 3KRTA 3AY3A 3WMRA 1N6IA 1M34E 4JGGA 5FBLB 3VA7A 2V7QA 1KK3A 1LLUA 1MKYA 3GLSA 3TJZA 5GIPE 2GPYA 3IAEA 3ESRA 3RUFA 3RWMB 2GN2A 2HCTA 1E7SA 4W82A 3H7AA 4OMDA 1SXPA 4XIJA 1PGJA 3IULA 5EESA 4DLKA 2QMYA 5H4HA 2QAGC 1I4WA 1RXCA 2GCEA 3CH6A 3RUEA 1XMPA 1TDJA 3D4BA 4Z4FA 5LLDA 4IYJA 2HA0A 4OJYA 2PT9A 4MEBA 5ENVA 1HQCA 4JXJA 7MHTA 2I3BA 1N32B 4Y1RB 2ZJ8A 3I01A 5JROA 1D6JA 2FFQA 3CJRA 3CJQA 1QS0B 2A9PA 1F2VA 4B79A 5HUQA 1MPTA 4XM2A 5EJFA 4WKOA 3CRMA 1JG6A 2OCKA 3VYRB 2J08A 5JAOA 2CDBA 3ICQB 1RQXA 1YT5A 3NUQA 5JC8A 1DKRA 4CUKA 2ORVA 2Q6IA 1A98A 2XCRB 2J4CA 7ADHA 2NW6A 2IS4A 2O8BB 1R37A 2ZAOA 3FNQA 3X0DA 3NHLA 5AVRA 4QQRA 3CVVA 3I8XA 1RRMA 2ZG6A 1EB9A 1O3YA 1T9GS 5DRTA 3DV0B 5L6MB 3RRYA 3IJ5A 3WGQA 1JF8A 5AKGA 4BB9A 3IE0A 4UFOA 4OK6A 3RR2A 4DF3A 5FDFA 3NHJA 4EJSC 3JVEA 2O50A 4RZHA 5EJ4A 3THXA 1SB9A 2CBXA 1OBOA 4X20B 5CM2Z 2J31A 1RIIA 3L4EA 3V1MA 1NULA 2WJYA 2QEQA 3CCFA 2FZVA 4FFLA 4M8LA 1APBA 4OEHA 5JAMA 5JJCA 1I4TD 5FX2A 4M1WA 5BSMA 4BTLA 4BY9E 4QDOA 1GQ2A 3OJEA 4PWZA 3TKLA 4P92A 3TPCA 3DDNA 5CVJA 1D4OA 1CJMA 3PUZA 4AZ0A 1XVIA 5LDDC 2AXPA 3NDBB 3T35A 2NO9A 4YMGA 4V3BA 2QSUA 1U0EA 1VGVA 3K15A