5CM9C

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
146
Chain Sequence
ALHKVIMVGSGGVGKSALTLQFMYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
total genus 40
structure length 146
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm9C00
2R65A 1JEEA 1SVIA 4P4SB 3GQBA 2OXRA 3AVWA 2YNMA 4NYMQ 1OKKA 5KSZA 4GT1A 2JASA 4HUQB 5FTNA 4MA4A 3CX7A 2PT5A 3P26A 5FR1A 4TYYA 2OESA 2PLFA 1YR7A 3KJEA 1Q12A 2BJWA 4Z54A 2FEOA 3Q5EA 1PV4A 4KSBA 2EFEB 2XZPA 3N2EA 4OYHA 4W5HA 4EFLA 1XMJA 5SZIA 1ODFA 1UDWA 2GEVA 1E9BA 3KQKA 4BRWA 4IDHA 5JJIA 1IXSB 3U3KA 1F2TA 1YKSA 3UPUA 1P5ZB 1QHGA 2CL7X 2QPTA 2YINC 3R20A 4MRNA 3QG1A 3GJ5A 2IHBA 2GHIA 1QHYA 4LYAA 1HA3A 3W3AA 4MUAA 1PUJA 3RRYA 1W36B 3B13B 3THOA 3OIUA 2JEOA 2BM1A 1P9NA 1R5NA 2Z6VA 4IVPA 3REFA 1CULC 2ZI7A 3GFPA 4KHZA 2V3CC 3CRMA 1ZINA 2NO9A 3QF7A 2B6HA 2V1UA 2B7CA 3RYTC 1X6VA 4AURA 4BZQA 4LYJA 4TL7A 2XZLA 1OH8A 2HF8A 4P31A 2ATXA 4FMDB 1R4AA 2QRNA 2YJTD 1ZNWA 2XNDD 2VP4A 3GLGA 3LBNA 4JYBA 1Z47A 2ZRCA 5TB5A 1YRAA 2H92A 4BGDA 4EKDA 2BKEA 2IS2A 1I2MA 5BN5A 5G53C 3ZVLA 5GJWC 2XOKA 3VKWA 1TAGA 1S4QA 3K0AB 4IOKA 4N0EA 3QXCA 2GK7A 4L8GA 3SQXA 1SULA 1E96A 1MT0A 1RJ9A 4PQYA 1QG4A 2CXXA 1UFQA 2E9SA 1DOAA 3B1XA 2ATVA 3LXRA 4BUJA 2JLQA 1XD2A 3LWNA 4QNMA 4RY2A 3WNCA 4JLBA 4TQUS 1E79D 3QKSB 3LQQA 3SFVA 1G3MA 1SXJE 4QKQA 4NL4H 1UPTA 5FUXA 4J0QA 3TW8B 2QMOA 2H7VA 4PZYA 3X1ZA 2AR7A 3H2YA 2J0SA 4RD4A 2NIPA 4YDHB 4LHYA 4YC7A 1UBFA 2H18A 1ZM4A 2JIZD 5EP3A 3B9QA 3C5CA 2ZR7A 1G64A 4EJSB 4Z1MA 4V02A 4PTLA 4TT3D 2WJVA 1CJKC 1E1RA 1JR3E 1OIWA 4BFWA 4B32A 1KO1A 1XD2B 3M6AA 5SZKB 3SJBA 3T12A 4JVSB 3SC3A 3DO6A 3TJZA 4NPHA 2JLWA 4MRPA 2R9VA 4CEHB 2V7QD 3PITA 4YXWA 1SVMA 2V9PA 1VPLA 3TSOA 3HP1A 3VQTA 3ND8A 4FWIB 1TPZA 2FEMA 3AKDA 3SDZA 1G6HA 1GZSA 221PA 3KFVA 4TL6A 2FSFA 2AL7A 4Q4AB 1N6KA 4XD7D 5E95A 4YDSA 3NEYA 4A2PA 4Y0VA 1ZCAA 3A4MA 4X8HA 3HR8A 3W3ZB 2G6BA 4X8LA 1KDTA 1IY2A 2IUTA 2IW3A 5KSPA 5M04A 3T06B 1SQ5A 3KKPA 4PHGA 3GJ7A 4S35A 3IEVA 2OSBA 4KI0A 2FSIA 4UJ5A 1XF9A 1OV4A 4DDWA 2IYSA 1T5IA 5L3SB 1SKYE 3B82A 2BCGY 3B5JA 1NI3A 1FP7A 3LXXA 2FX3A 2ZSAA 1WBDA 1KK3A 2ZI6A 1ETUA 3OEHA 3PUZA 1XMIA 3AQ4A 4TQAA 3UMSA 3VU9A 4WXPA 1A4RA 1NP6A 2CJWA 3LLMA 2ZSBA 1I4DD 1OKKD 2L0XA 1E9FA 4IJMA 4MUBA 2NOAA 2REOA 1A2BA 3RABA 4M4SA 2WKQA 1AS0A 1WRBA 2Z0MA 4MGZR 4ZKEA 4O25A 4UNSA 3PUVA 4QJ5A 4BFZA 4B3GA 1CP2A 1IM2A 3LO5A 5FFMA 3NTUA 1T3HA 5DIFA 3K0FB 1S9HA 4IVRA 4LWZA 4OQXA 3NXSA 1Z6XA 2WWGA 3FDIA 4Q4HA 3FTQA 3TNFA 3LVQE 1M7HA 3U6BA 5B58C 2W2TA 2JJ1A 2J1LA 2VA8A 3LRPA 4M9SA 1GP2A 2AFIE 4KLNA 1W47A 5BW8A 1AS2A 1P2VA 1E9RA 2Q21A 5L3RA 1QVAA 2Z4RA 2VRWA 2HEIA 4C30A 4EPRA 4RCYA 4WXRA 5FTLA 5C4MA 3G82C 1GITA 4OBEA 1JXMA 1TF2A 3BXZA 1W0JD 2ZSEA 4TMZA 3RC8A 3P32A 4BFXA 1KMQA 2A2ZA 1E9CA 2XNDA 1G4UR 1L8QA 2ZJZA 1J7KA 3GFOA 4Q9LA 3HDTA 5JZVA 4Z51A 2DR3A 1P9WA 2ZJYA 2O8FB 2CDNA 3BJIC 3KJHA 4MRRA 1CJTC 1Q1ZA 3AH8A 1ZNXA 4XD7A 3VU9B 3OIYA 2VSOA 5CITA 2SHKA 1KK2A 1TX4B 3BH7A 4G5QA 2NQ2C 2ZRKA 4NYIR 4D0NA 4GDFA 4CRWB 3IKJA 1GWNA 1ZBDA 4DEXA 1T4GA 1KK1A 4FMCF 2OM2A 3PVSA 1U0JA 4WIAA 1S3GA 3VR1A 3P4YA 1NN5A 3U7HB 4DIDA 1RYHA 4LBVA 2DWQA 3A1WA 4AIIA 4BWYA 3DMDA 4JBWA 4URYR 2ZVQX 4DB2A 1HV8A 3CWZA 5EP4A 4U5XA 1CR4A 1LNZA 1OIVA 1UM8A 2WMNB 2HYDA 4ARZB 4F91B 3ZVMA 1IN5A 1GNQA 1U9IA 4LGMA 1RJ9B 2GESA 3CNNA 2C98A 5C1BA 4LDJA 2GAAA 3MWYW 4A6XA 2G77B 1J8YF 2FJUA 2RGDA 1MO6A 3FMIA 2BMFA 1XP8A 5FUYA 4G3XA 1GILA 2DYKA 4MRVA 4JL6A 2IBMA 3QQ5A 3FOZA 1COWD 5AJVB 2GXAA 3EPHA 1JI0A 2KSQA 3Q7PA 3X2SA 3GLIE 3EW9A 1X8KA 4JKYA 4M1YA 1JJVA 2OBNA 1DADA 1AM4D 3FMFA 5L3QB 4RZ3A 2EFGA 4E22A 2KBEA 4RKFA 4FMCB 4ERNA 3N2IA 1CBUA 3U7EB 2GF0A 3AVPA 5AWFC 2X8AA 3LA6A 4JZKA 3L0IB 3KKOA 1Z6GA 4L16A 2DFTA 3QNUA 4B48A 1X86B 2XTNA 4V0KA 5E7IA 4TLAA 5HE9A 1XJ0A 5J47A 1MO3A 3H84A 1NSFA 3GMTA 2YKGA 2GXQA 4UNNA 5EP2A 5J5CA 3I8XA 5KO2A 4FI3C 1GG2A 2IYWA 4P4TA 4BE7B 3W6OA 4TQ9A 1Z08A 2J0QA 2Q9CA 5J4LA 3ZVRA 1NMXA 1NVXQ 5FOXA 3L0PA 2HLDD 4ASUD 2YOGA 1RYFA 3R9IA 3ZD6A 3MJRA 2QA5A 1UBCA 2ZAOA 1GDDA 2ZREA 2WVJA 3WP1B 2G0TA 1HE8B 4L4UA 1GSIA 2ASEA 3PQCA 1R0WA 4PANA 2WIBA 4ZCMA 1MO5A 3WMEA 4C2UA 1GFIA 2XGJA 2RAPA 2XB2A 4MITA 3RS7A 4C0LA 1R8QA 4S2EA 5FPYA 2WSSD 1HT2E 2C03A 1MR3F 1KI3A 3RDPA 3ADDA 1PLLA 4X8OA 2ZJ2A 4DLRA 1GL9B 3LBHA 1ESNA 2EFHB 2YWGA 1FUKA 3VR6A 2A5DA 3BS4A 2OFOA 1R2QA 1RIFA 1UKYA 1DAKA 4PZZA 4PXAA 3GLFB 1NKTA 1XMVA 4OHXA 5DNYB 1IJFA 1A82A 1AGRA 1OIXA 4IDPA 3SJAA 2QPOA 4BLTA 3QXSA 2W83A 2FMXA 2BEKA 2OV2A 4H9GA 5DGXA 4URXR 1N0VC 2A9KA 3HU3A 2PMKA 1UKZA 1P3JA 4GFDA 1LTQA 3ZD7A 4BFSA 2GRJA 1SZPA 4URUR 2FU5C 3WRXC 2HXSA 4LJAA 4DLSA 1HURA 1DAIA 3LFUA 2IYLD 2ZU0C 1KZGB 4A0GA 3K70B 2GKSA 2QGNA 2IXFA 4FW9A 4NYMR 2VHJA 1BOFA 1OXUA 2F1RA 4OK5A 4ZI2A 1JAIA 4FXPA 4C0AC 3U7GA 5D3QA 3IEUA 3I5XA 5F98A 2D2EA 2F1HA 2Q6TA 2RH5A 1VHTA 3VR2A 2EWWA 5JRJA 1GM5A 1ZW6A 3PEUA 1E2JA 1VCNA 3KTAB 4IFEA 3MJHA 3U3JA 3A37A 2ZYVX 4QL3A 4AC9A 1G17A 2OBMA 4TT3A 2ZJOA 4G01B 1ZRHA 1UEIA 1U8AA 3NBYC 4M1SA 4PSAA 4B34A 4B35A 2D06A 2VP6A 3C14C 1PUIA 4BPBA 3IHWA 1HTWA 5KPDA 4OI0A 1XTKA 3KXKA 4IRUB 4FCTA 4YXWD 1X8JA 1XCPA 4JVNA 4K8OA 2IX3A 2IEZA 2FNAA 2O8BB 1D5CA 2MSDB 4HATA 1KI6A 2RGBA 4N3NA 4I1SA 4DLXA 1Y3AA 2Z4SA 4DCSA 2QI9C 4PX9A 2OCYC 5CIWA 2OLKA 4X8MA 1YR8A 3TE6A 2O52A 2OT3B 2D7DA 2XXAA 4WAUA 1M8PA 2F3TA 3FYHA 4PO1A 5C18A 1SVKA 4HLUC 3U3MA 2FFAA 2ZRDA 3CONA 3I72A 2XZOA 3MWKA 2WWXA 4TMWA 4NHOA 3RLFA 3EC1A 2VL7A 1DAHA 4A9AA 2XEXA 3I1FA 4B3DA 2WJIA 1JR6A 5DE3A 4F93B 1E2NA 1J99A 3UIEA 5EUQB 3ETLA 3W34A 2FSGA 3OIWA 1E6CA 2O8DA 1ZUIA 2QT0A 2P6RA 1GL6A 3AVVA 3N5CA 4IXNA 1P9RA 4Q02A 3OFNA 4QBIA 4LJ7A 2EYQA 5HE8A 3U3RA 2XSZD 4NCIA 2YYZA 1G7RA 4G5OA 3JVVA 5TMPA 4B6FA 2ZRIA 2GZAA 1AZTA 3CR8A 3KQHA 4QGFA 5AJYA 2CE2X 2MMGA 2NPIA 3KJGA 3W9YA 2O0HA 3FB4A 3HPRA 4MKIA 1OLOA 2GETA 2ANBA 1P2UA 4GMXA 4DSNA 5CK4A 1EFTA 4D26A 1S96A 4LYFA 3FKSD 5J4KA 1E0JA 1ZD1A 4XVUA 5IDVA 2I3BA 3AKCA 3ASZA 4LJ6A 3K0SA 3SJCA 3K70C 5D3MB 2AXPA 5EE3A 5GVSA 3R7WA 4MQBA 2XXAB 4LHVA 4R2HA 1MRSA 2N1BA 4WBSA 4TMTA 1ZVQA 4OJKA 2P67A 1VKJA 2P0EA 3MG9A 4L9WA 1NL3A 1W48A 2BOVA 5EXXA 4KBFA 5L3SA 4LV5B 1JPJA 2OCPA 1FX0A 4DLTA 3U4QB 1CR2A 4FMBB 4DCNA 1VYVA 2Q0HA 4XTCS 5JCPA 2O8DB 1XZPA 3VX4A 1HEIA 1Z0KA 1YZKA 1SXJB 1TUIA 3EZ6A 1E32A 2F55A 1E99A 2GJ9A 4LJ9A 1Q0UA 2QP3A 3P1JA 4O2RA 4OK3A 3AF4A 3FE2A 4CYMA 4RD6A 3SBDA 3I61A 4UKDA 1E4YA 1I4LD 1VYUA 2WM9B 4GZLA 2HLDA 1CKEA 1VYTA 2Q3MA 4LV6A 1ZCBA 2KE5A 2QNRA 4RVCA 4W5JA 4CT5A 5GADl 4HZUB 5DH9A 3VX3A 4C2TA 2ZETA 2D4HA 4DWJA 5LB2A 3SYKA 2WPDD 4OKSA 2PCJA 2IS1A 3H1TA 2PL3A 1T6NA 3SE0A 5HZHA 2Q9AA 4RD0A 4CEIA 1NMYA 3CNOA 4D2IA 1G3UA 2ZE5A 3GJ3A 3IBYA 2WSSA 1XJQA 4JT4A 1OYYA 2NPFA 4M1KA 1N0WA 4URZR 3IUYA 2RHDA 4HDCA 2ZRBA 3WYAA 4BFYA 5A0FA 1BMFA 1CTQA 3PUYA 4Q9JA 4DB4A 2R6DA 1KYIA 4D81A 4PHFA 3BC1A 1XEWX 2XJ9A 1T8TA 2VYFA 3D7MA 2GCNA 4QHTA 3WHLA 1U90A 2IYUA 4BLOA 5FTJA 1SVLA 1FL9A 4L9SA 4JKIA 4MKFA 3AGQA 3EPLA 3SYNA 4DLUA 2QSZA 2ZI9A 2EVWX 3BERA 1YZUA 4ESHA 1E2GA 3NC0C 1P7CA 2GBLC 4R9UC 2YHSA 3GLGB 2CL6X 1E2HA 1WMSA 1KSHA 2WWHA 2ZIAA 4JLMA 1RRPA 3L8ZA 4XTRA 5FH9A 4WW0A 4JL5A 2XB4A 1XEWY 3FMPB 4O0MA 3EXAA 1JR3A 1C4OA 2IS4A 2C78A 2BIFA 3H86A 1W36D 3MLEA 5FOSA 3WY9A 4B2PA 1G7TA 2YWFA 4PPQA 1W36C 4TYPA 3WNBA 2ZXUA 4NONA 3PEWA 2OCAA 3AV0B 4Q9IA 2B8WA 3X1YA 4EAQA 2AWOA 2P65A 1WF3A 5KYKA 4FINA 3NIBA 1DAFA 1P73A 3K70D 1AS3A 3B1VA 2O8FA 2DCUA 1OFHA 4HAWA 4RKEA 4B47A 5JBQA 4ESVA 3QOFA 3Q9LA 4Q7MB 2CLDX 1FZQA 3TSZA 1C1YA 3OAAD 2ZU6A 4P3YA 4XWOA 2O8CA 4C0QC 3CX8A 2GF9A 3B7GA 2GWHA 3B85A 3QKRB 1IONA 1CXZA 2VH5R 4MKGA 2VBCA 3HPQA 2A5YB 4H1VA 4A0HA 1E9AA 3HU1A 1QHNA 3TAHA 4LHXA 4HI0E 1D9XA 2FFHA 3QJYA 4IHQA 2C99A 1IN4A 1N0UA 4F92B 2WOOA 3DEFA 2J9RA 1G21E 1IJEA 1G5PA 2BCJQ 2C5LA 2O0JA 1G8FA 3AKYA 3IGFA 4KLZA 3DKPA 4OI1A 2F9LA 1US8A 1KI1A 1RRCA 4PC2A 4OQMA 1LB1B 4B76A 4XH9B 5HCIA 3QEOA 2GEUA 2ZUDA 2V7QA 1NLFA 4DCUA 1Z2CA 1FTNA 4GP7A 5ANRB 1Z06A 2XOKD 3THYB 4M22A 2ZEJA 1IN6A 1TQ2A 3UXMA 2IA5A 4BASA 2WJJA 4AKHA 3U6KA 2A3RA 2ZRHA 1UADA 3RRMA 4TLCA 4DJTA 5FBRB 2YC4C 2J41A 4LC1A 2PZEA 1IY1A 2W0SA 2ZE8A 4NZYA 4OJQA 3U3OA 4EQ6B 5EZ5A 4DRZA 5KSYA 2ODWA 2AX4A 3C15C 5CDFA 3VR5A 2G1JA 1RZ3A 4KJZA 4Q9KA 1KDPA 3VFDA 4F4JA 2ZE6A 1TU3A 2YWHA 2JA1A 5LB4A 3ZS9A 1GKUB 1D6JA 1KGDA 1JBKA 5JJLA 3TR0A 1KO5A 2ZE7A 4PPFA 4JLOA 3W8RA 1YZNA 2NTYC 3SFZA 1NN0A 2IYTA 4ABYA 3B9PA 3U61B 3T5GA 4A2QA 4TSFA 5TVKA 2ZRNA 3RHFA 2XX3A 1PLJA 1SXJC 3L0SA 4OL0A 3ZZ0A 1US8B 3TW4A 5FL7D 4CZ2A 3VKHA 3IILA 1KSJA 2V55B 3NEJA 3CX6A 3J81k 2GAOA 2ODNA 1DE0A 3Q72A 1X8LA 3DZ8A 4G5RA 3U2QA 1DPFA 5B2ZA 2D3WA 1FPMA 2JATA 5F3WB 3FGNA 1KI4A 2IYYA 3Q5DA 4LK2A 3U5ZB 3K1JA 4JLAA 3LW7A 2UVQA 3RANA 3QI2A 2VHTA 4TMVA 4O3MA 2I1QA 2LKDA 4PC3A 3D8BA 4M53A 2DBYA 2QT1A 1G5TA 2FWRA 3AF0A 5K8IA 3AM1A 4ZO4A 3PIRA 3B1ZA 2CCGA 3QPVA 3K0FA 3IPXA 1E2IA 4IDQA 4II7A 2X1VA 3K8YA 1Q44A 4JJKA 2H17A 4HUTA 1F6BA 5CJ2A 2F9MA 2VHQA 2BV3A 1XJCA 5C46F 2GVDC 1OXTA 4MYUA 3T1OA 4RFSA 3TVTA 4B44A 3A8TA 2HXYA 1L4UA 4PC6A 1KY3A 4WVFA 2CJWB 1Z0DA 5FI1B 1GVNB 3THYA 4PAMA 4EPXA 2MSEB 1IHUA 4B3XA 3IIKA 1NG1A 4GP6A 2NZ8A 3K53A 2PH1A 4OHWA 3WBJA 4Q4AA 3BAFA 1EG7A 1S2MA 1Z0JA 4NBSA 2XITA 4XWKA 3EG5A 4OQNA 4O2LA 5H1YA 4A4DA 1AQYA 4ARZA 3B78A 4TLBA 1XEXA 2Q9BA 3SI7A 4LOAA 1Q3HA 4RFSB 5EE9A 4QGGA 2ZJ5A 5GVRA 4GZMA 1JECA 3G0HA 2P3SA 3O8CA 4ITRC 3HJNA 4OQLA 1TQ6A 4GPTA 1B23P 2ERXA 2QGZA 2C04A 3F0TA 3IIMA 3W6NA 5KPJA 1V5WA 2CNWD 3I62A 4PZLA 3LD9A 2A5FA 3OESA 4EIWA 2F43B 1KSFX 1CJVC 5SZJA 2GNOA 3P20A 5EXTA 2VP2A 1G6OA 2OO7A 1ELOA 2OZEA 5H70A 3MWLA 2ERYA 2BBSA 4JBXA 5DLQC 2RGCA 2R44A 3CRRA 1ZNYA 2PT7A 2RGXA 1W5TA 2YC2C 2VO1A 3X1DA 2ZITA 4ACBA 1W0JA 1OHHD 1HE1C 4B43A 2VP5A 4DCTA 2WWFA 2REBA 4IDNA 4KODA 2N42A 1K5GA 4TLDA 1NIJA 3PEYA 2GA8A 4FCVA 4QGHA 1YZQA 4HAXA 1NBMA 3TKLA 4UNRA 4CEHA 3SYLA 4GSYA 2KI5A 4DSOA 2QBYA 1F48A 1TU4A 5J4VA 2W2VA 4HAVA 3VKGA 3LY5A 1GRRA 4Q1FA 2ZI5A 5F2EA 4AKGA 1VCMA 3BORA 2WJGA 1MO4A 5C4GB 1XPRA 1ZJ6A 4PQRA 2NGRA 1R0XA 2VF8A 2OAP1 4OI4A 1AK2A 2HJGA 4GOJA 4ZIRA 5J4HA 1S1CA 1DARA 3V9PA 3THWB 2PJZA 4JYCA 5DHFA 2ZM5A 2DB3A 1DG1G 3OIVA 2R6FA 1FX0B 2AN9A 1G18A 3K9LA 4KVAA 4PO8A 2RMKA 2W2XA 3AEZA 1Z6YA 4V0LA 2EU8A 4F7WA 2IYZA 4ILEA 3WHKA 2DWPA 4CDGA 3ICQB 1HH4A 3B60A 4Z8YA 2QUZA 2OEPA 4PPGA 1TTTA 1IN7A 5CM9C 3Q8XB 1B0UA 5B64A 3LQRA 4MGYR 4M1MA 4BLQA 4HAZA 4IKEA 5IK2D 4H1UA 1NLYA 2HJVA 2VP9A 4TL9A 3QPUA 3E5HA 1T91A 3QIAA 4LCBA 1K5DA 4U02A 1D9ZA 4D4JA 1IXRC 1QDEA 1R8SA 3SBEA 4P4UA 4E03A 1U94A 1NMZA 2B92A 4QM6A 1TEVA 3BK7A 3NBFA 1YVDA 4QOSA 3M4YA 2PLRA 2OILA 3TQCA 5LD2B 1CF4A 4DSTA 1NY6A 2GJSA 5JSZB 3V4RA 4QFMA 1S3SA 2QE7A 4Q7KA 1EWRA 1LS6A 1F5NA 1W4CA 1OXXK 3A1TA 4C0BA 1E94E 4ASUA 4B2IA 4NTZA 3EZ7A 3MWJA 2ORIA 3BE4A 4U7DA 4BLRA 4RCZA 1Z63A 1OFTA 1R0ZA 1CJUC 5UKDA 3ASYA 2QAGA 3PG5A 3EIQA 3RS0A 1Q1QA 2O8EA 4HLUA 1XRJA 3DM5A 2QEQA 1HUQA 2WKPA 2AWNA 4MGIR 4BFVA 3BGWA 2ZRJA 2ZJBA 1ANKA 3FHOA 2LCFA 1ZD8A 1KOFA 4DDTA 1JEDA 4XWAA 1S9DA 3DVLA 2NO0A 1NF3A 2V54A 4JL8A 2A5JA 4DEYA 3V00A 1W0KA 2WBLC 5F9FA 3RWOA 4A92A 4C4PA 1W7AA 3GLHB 4ACAA 4NE2A 3IHLA 1ESMA 4FCWA 4WA7A 1A1VA 4PSKA 4IXMA 3WXMA 4QC2A 2J5XA 1XPOA 1T0HB 2QY9A 3LLUA 5K8TA 1WP9A 2CLSA 5TARA 1DAEA 1FQJA 3GLGE 5FBQB 1MRNA 5EXSA 3GFTA 3RS5A 3C5HA 5JS7A 1T3SA 3UKDA 2FE4A 5KNCA 3AF2A 3GP8A 2XTZA 5DI3A 2QM7A 3I8SA 2IHYA 1NN3A 4LI0A 5DN6D 5JHHB 2CMKA 4D4KA 1RPZA 3A1SA 5C2JB 3LX8A 4HYYA 3GLHA 2ORVA 4R2IA 2O8CB 4JLDA 1ZP6A 1GRQA 3QKTA 2ZSDA 1NY5A 2RHMA 2ZJAA 4B75A 3BFKA 4W9MC 2ANCA 2ZAMA 4Q7LA 4URWR 2DY1A 3D6TB 1UAAA 1ZYUA 1II8B 2AHOA 4ZCLA 1J90A 4AWXA 1YQTA 2PEZA 1MABB 2R62A 2W58A 4PSVA 2CCKA 2PEYA 3TR5A 2IYXA 5AUNB 1T3LA 1CRPA 3QF4A 5DYGA 1YE8A 4LRWA 1DO0A 2D74A 5G3YA 2ZUBA 1N5JA 5FR2A 3WMFA 5FUVA 3VNUA 3VHLB 4HZUA 1QBKC 2HYIC 1LVGA 3CF6R 5KSOA 5CB8A 4D25A 1G8YA 3B1WA 3GLFE 1U99A 3K9HA 3IO3A 1SHKA 1YR9A 3CZPA 3SN6A 2Q3HA 1KI8A 4JSYA 3UMRA 1E9DA 5JS8A 2DPXA 3QSYA 3CRW1 1P4SA 3FHTA 1OSNA 1FNMA 4LUCA 5L8VA 5AUOB 2FF7A 4JLJA 1UBEA 5KHOC 2RGNC 4RD3A 4HUQA 5G3ZA 4MYCA 2BBWA 1FQKA 3CZQA 3THXB 4AY2A 4A15A 2F6RA 4AD8A 3TQFA 4KO8A 8OHMA 1XTJA 4CEJA 1MH1A 1E2QA 4LJYA 3ADBA 1W1WA 4KAXA 1NVWQ 4Q00A 2YWEA 3SS8A 2NO1A 2ZANA 1ZIPA 2IF0A 4PO9A 1E9SA 2QAJA 5EE5B 5EP1A 1E69A 2IUSA 1Z3IX 1JAHA 1KI6B 3MMPA 2WWYA 4A6PA 4KXFB 4WZ6A 1LF5A 1NKSA 2QENA 4Q9HA 4FWTA 1EFCA 1OW3B 5JMTA 5BN3A 1DO2A 3RSLA 3EIHA 3ADCA 2BMEA 1Q22A 2GILA 4NCNA 1OB5A 1GOTA 3AP1A 4M0LA 3K09C 1I4TD 1KHTA 3CR7A 2ODEA 5CYOA 4FN5A 4WZAE 4B71A 1NJGA 4B73A 3M1IA 1IOZA 2WJYA 3GJ6A 1CLUA 1JALA 3DKVA 3WNDA 1ZNZA 3H0KA 1OHHA 5KU1A 1WA5A 4Q48A 1NVVQ 1YU9A 3AB3A 5LBIA 3ADKA 4EFNA 3KKQA 4M9XA 1F3OA 1XU4A 5BWMA 2D2FA 3CBQA 3EASA 4EPYA 3SHWA 4C0KA 4MH0R 3EA5A 2YVUA 2ZJ8A 5JWHA 1U8ZA 2R8RA 3CRVA 1E0KA 2F1JA 3K9NA 3AVQA 4XVRA 2GCPA 3JZMA 3NDPA 2BHRA 1EWQA 3EAQA 5KNBA 2IT1A 2IEYA 1Z83A 4KFSA 3NC1C 2NG1A 1E1RD 4QGAA 4GBMA 3SJZA 4CW7A 4TLEA 1QHSA 1Z6AA 5JLJA 1EESA 1GL7A 5HCNA 1AZSC 4A8JC 3HYTA 1BMFD 2YZ2A 4MGKR 1RRFA 2IC5A 1DEKA 4Q01A 3A36A 4ZKDA 4EPVA 3QKSA 4B74A 4TL8A 4HLQB 1DELA 2HF9A 1OPXA 2KB0A 1KAOA 5EZ6B 2W6JA 3NH9A 1R5BA 3KZ1E 3QXJA 2XAUA 2JDIA 3KKNA 4LBZA 2EFCB 5CM8B 3TMKA 2IL1A 2IK8A 1KIMA 2ZSFA 2REXB 5FPTA 3CLVA 3BB4A 1VMAA 1KI9A 4IOLA 3RRNA 2QORA 4UXJA 1FUUA 5LD2C 4N1AA 4JVMA 2UKDA 2IS6A 1IY0A 2JIZA 2FPKA 3RS2A 4ZDJA 2BM0A 3KTAA 4MDFA 1XD9A 1BYUA 2BBTA 2RGGA 3P4XA 1UF9A 2ZS7A 1QHHA 3FPAA 4IEEA 3CF2A 3HWSA 2ZVPX 5KDOA 4Q1CA 3X1XA 2B7BA 1LFDB 2Q3FA 3CPHA 2FN4A 4QNRA 4DBLC 1NN1A 4PHTA 4LJ4A 5FI0B 3W8NA 4PHHA 2ZYWX 1QHIA 2V6JA 3F5FA 3DL0A 1WCV1 1TADA 3AVXA 3U44B 1CR1A 1ZD9A 3K09A 3L0OA 2JJ2D 4LPSA 4RSGA 2YOFA 4HLDA 4Q1BA 4Z8XA 1K6MA 5DO9A 1TQ4A 4D4MA 5JECA 1NRJB 3GEHA 1CS4C 3RNLA 1E0SA 1KK0A 1QHHB 5GJCA 3ICEA 2GCOA 1M74A 1UKEA 2JGNA 3CWQA 4EQ6A 1RC8A 3CH5A 3ND9A 2BVNA 5B30A 1VCIA 2PCLA 621PA 1D2MA 5CYPA 2AK3A 1V43A 3ZDQA 5JCZA 2I4IA 4TYQA 2AFHE 1EFRD 3VHXA 5JFGA 2F7SA 2G1KA 1JPNA 1AJEA 4UJ3A 3TRFA 5IT5A 1W44A 2OG2A 1SHZA 4HB0A 5FBLB 1IQPA 2CVHA 2IUUA 4W5WA 1W4RA 1D2NA 2A5GA 2RGNA 3NH6A 3N70A 421PA 2DWOA 2WPDA 5EXPA 4M1OA 3GLIB 2OAQ1 4GRAA 4I1UA 1TNDA 3U7FB 2V6IA 3CKLA 1G8PA 3GPLA 4TWZA 4KCGA 2WWIA 3EWSA 4M2LA 5TV2A 4BFTA 1OT3A 5FL7A 4JSTA 4CF7A 1AQUA 3MD0A 3C4JA 4NH0A 1JJ7A 2A78A 4DVGA 2HT1A 3A6PC 1QZXA 3EARA 5JHGB 5KTYA 2WIAA 1W46A 4DKXA 4M1TA 2WICA 4JVLA 5CB6A 2V1XA 3R8FA 3CW2A 2P2LA 2B8TA 1SXJD 1TL7C 2GK6A 1QVRA 4ZCIA 1SVWA 2QRZA 4DLYA 1COWA 1N5LA 4A8JA 4D6PA 1T8UA 1P75A 2CBZA 3ZIAD 1KJZA 1KSGA 4UNQA 4JLNA 4LHWA 5KDLA 3GD7A 1Z0FA 4Q1AA 1NIPA 4CIDA 1Z29A 2Z43A 3KQLA 1Z8FA 3ZZTA 2O5VA 1NVVR 1UKVY 3LH5A 1E2PA 3QVVA 1W4BA 4KFTA 3ZLJA 3SHFA 3EWAA 3RAPR 1ZC4A 1ONBA 2K5UA 3K9GA 4WZBE 2C8VA 4WOPA 1FW6A 3ZQJA 3Q7QA 3OEED 4OHVA 3B6EA 3BFXA 1H8ED 5TY0A 4UXIA 1G16A 4IOJA 5JEEA 1SVSA 3KX2A 4DIEA 2J87A 3B1YA 3KUDA 2NMVA 3KKMA 4Q1DA 2G83A 2I1VB 1H8HD 1J70A 4NYIQ 3E70C 2B21A 3EX7C 5BXQC 3NHBA 3BH0A 4NDZA 4E09A 4URVR 3RSOA 121PA 3C7KA 3NBZC 4OK6A 3LNCA 3SR0A 1BO6A 1RRGA 1X1SA 4A8JB 1II0A 1II9A 1OXVA 2EWVA 3MSXA 3ZZUA 4C0JA 1ZC3A 3C16C 4I1VA 6Q21A 3T5DA 3FKSA 4AYXA 2AD1A 4DT1B 3OZXA 1QG2A 3CPEA 1ZUNB 4BLPA 4C7OB 4UXHA 5CIQA 3ECCA 3LBIA 2ZTSA 4XOIA 3ZJYA 2VSXA 3KQUA 4TSFD 1OH7A 3FWYA 1EX7A 3QENA 3R9XA 4US2R 3QBTA 4QJ3A 4P33A 2F43A 4YLGA 2ZRPA 4GOXA 1KKMA 1WE2A 1T0JB 1Q1BA 2HV8A 2GZHA 3VMFA 1FOEB 4OI2A 5IF9A 3HR7A 4W7SA 2A7QA 4XSHA 3KDSE 5JWOA 2JJ2A 3A1UA 1HY3A 2CK3A 4MDEA 2XJ4A 4MYTA 3AVUA 2BMJA 1A5TA 4DC9A 2PMDA 2GZDA 2IYQA 2C9CA 4Q4HB 4RFVA 2PBRA 1X1RA 4IEIA 2C9YA 4LBYA 1UEJA 2AKYA 3CO5A 5CLQA 5AJWA 4FD2A 3SU8A 4POAA 3PEVA 5FOTA 4MRSA 2MMCA 1NLZA 3L43A 4HDQB 4M9QA 5BYJA 521PA 3EIEA 2OXCA 2FPMA 1OFIA 3GLFA 2JLVA 3RWMB 2J7PD 1P2TA 3BH6A 3R8CA 3BWDD 3R7WB 3LAWA 1NNEA 3LV8A 3DHWC 4I1OA 3KFXA 3H4MA 1PZNA 1BIFA 1G7CA 2CHQA 2LKCA 1W4AA 2W6JD 3TUJC 2AK2A 3PUXA 1KZ7B 1UDXA 1MKYA 1NBMD 4PQFA 5KUTA 3DPUA 4IOMA 4Q19A 3X1WA 2PX0A 5E3HA 3AP3A 1XB2A 1W0KD 2W0MA 3KXIA 4OQFA 1PLKA 2JLUA 4U00A 1CEEA 2VLIA 1NG9A 2QP4A 2OFXA 4JLKA 3GJ8A 3K0CA 5CDFE 1NBME 3EZ9A 1Q20A 5DISB 3LVRE 1GIAA 5DSZA 4RD1A 3O8RA 1CU1A 1GRNA 5TDHA 1U98A 4ZIRB 5HPYB 3QBVA 2C96A 3GLHE 1VIYA 1EFUA 1KO7A 2DFLA 4BEBA 2IXEA 3L8YA 1U0LA 2PZFA 1GTVA 3SNHA 2JLSA 3THXA 4P4SA 3OHMA 1TMKA 2P6UA 3AUYA 1XTIA 1E1QA 2X77A 4NYJR 1JR3D 4Q03A 2W6IA 4TZ0A 3RS3A 3WYFA 2G88A 1N3BA 4B33A 1KI2A 1AKEA 1ZUHA 4OHYA 3IQXA 1Y63A 3O47A 1TEXA 3KL4A 4G1UC 2CK3D 2NO7A 2LWIA 3PENA 1S1MA 3LX5A 3SZRA 2UZ3A 1PJRA 3ZVNA 2O8EB 1H65A 1TF5A 1U81A 4ON9A 1W5SA 1Z0AA 3T35A 2XSZA 1YJ5A 2KBFA 3B8HA 4LYHA 4A1FA 3OAAA 1KTVA 2BJVA 3TUIC 1KAGA 3W90A 4L15A 2E87A 1ZU4A 5GJBA 1XNJA 2FPLA 3UG6A 4QM7A 4Y0AA 2FOLA 4P32A 2QAGC 4Q5IA 4DUGD 3SEAA 1X3SA 4LC0A 1ZM3A 3CUEF 1UJ2A 1BS1A 4JLVA 2TMKA 4TN1A 4HAYA 3ZGXA 4AG6A 3CH4B 4TTRA 4AK9A 4CGZA 1VDZA 4C0SA 4FIDA 5KDDA 3MCAA 3RC3A 1EGAA 1G8HA 3PUWA 4JLPA 5E7MA 5HTKA 2OLJA 3K0EA 3IDQA 5J4YA 1HQYE 2F3RA 1E2KA 4EJSA 1K8RA 5G40A 3AKEA 3TH5A 2FDCA 1W49A 2JJ1D 3MRSA 4ZI3A 1D8TA 1ZMXA 1M6NA 2HT6A 2E1RA 1EXMA 4F38A 4DT1A 4N0DA 1E2EA 1M1YE 4D4LA 1P60A 2ODBA 2QN6A 3GEEA 1ZAKA 4QXAA 4YQFA 4Q7JB 1N6PA 3WMGA 1Z22A 2WTUA 3B2EA 3E2IA 2GXUA 2ZRLA 3F8TA 4NP6A 1WBBA 5JEDA 4KBGA 1II8A 1YZTA 1U2RA 1AIPA 1FNNA 2J3EA 3EC2A 4HLCA 1P61B 1SKQA 1Q57A 1XCMA 2QMUA 3D3QA 5D3MA 2IWHA 1E0AA 4ZDKA 1DTSA 1KDOA 3C41J 3U60B 4I4LA 2AXNA 4D0GA 3ZYCA 3V4FA 2VQSA 2PZGA 4NMMA 2HDNB 5DN6A 3CRQA 4RZXA 2Y8EA 1FMLA 4R7ZA 2ZS9A 4HB3A 3S1AA 4HB4A 4DDVA 1GNPA 1XWIA 1HT1E 4AI6A 2N46A 5AK0A 4XIGS 5A5GA 2FV8A 4NKRA 1H8EA 3NVAA 4AYWA 1QHXA 1SXJA 1BKDR 1R5OA 3A58B 2ZPTX 3I3SR 2G9NA 2OE2A 4RD2A 3VR4A 1N6LA 4BZPA 1OB2A 1E2LA 1KNXA 4LJ8A 1NJFA 3QEJA 5H8WA 3IPYA 3BRWD 2VSFA 1U8YA 1R10A 4G5SA 3FKQA 1OYWA 4HB2A 1GNRA 2KWIA 1A7JA 4RZ2A 1G41A 3TVDA 5JJKA 1FP6A 1SGWA 1VIAA 1AA9A 1WDTA 4ZDIA 3ONWA 3BB3A 4F4IA 4B2LA 5EE1A 2QMEA 1L2TA 1KJWA 2RGEA 4B6EA 4HAUA 1F2UB 3UG7A 2NO6A 2ZYUX 4K81B 5G41A 4KVGA 3U44A 5FPSA 4E07A 1Z5ZA 3T1VA 3TK1A 5CJPA 4V0OA 3LDAA 3O8DA 1JQJC 4LX0A 1AGPA 1EK0A 3F3YA 3QVUA 2W6ID 1AN0A 4XSGA 4LV8B 2GJKA 2VHCA 2OBLA 2BWJA 2NZJA 2QTFA 2BDTA 5K8UA 1F60A 5E4FA 2RB4A 3R9WA 2WAYA 4E5UA 4KFUA 1RKBA 1S0UA 1U0HC 3QY0A 3QXXA 4PC1A 721PA 1XBTA 2GEDA 3MGCA 3CPJB 4QBHA 2WOJA 1IAQA 1MOZA 3EA0A 2ONKA 1H8HA 5CLLA 2IF2A 1LV7A 3NWJA 3KB2A 3FVQA 5JSZA 5FUWA 5EE0A 2WWWA 2P5SA 5TXGA 5FL3A 4OHZA 3SQWA 4MKHA 4DZZA 1XPUA 2R6CA 1DAMA 3NKVA 4BRUA 1VTKA 3WBKA 2QL6A 5AR1A 3IQWA 4ZPXA 5FOWA 2OHFA 3ZQ6A 3GJXC 5FBVB 2JLXA 3PXGA 4RJLA 2GXSA 4K46A 5AUQA 2XTMA 1G4AE 4LY6A 5DHAA 2QQEA 5F9HA 2VHUA 2ZYTX 1XZQA 1Z07A 2JLZA 4JS0A 1T9HA 2FZLA 3DM9B 1F2UA 3TAUA 1G3IA 2RCNA 4BEJA 4LHZA 4BECA 4AKIA 5FPHA 4L5BA 4QBGB 4NCKA 2FFBA 4Q4JA 3PJRA 1Z28A 1VG0B 2Z83A 3WYGA 4A0FA 1G291 5IRCD 1XX6A 1AKYA 2C2HA 1YR6A 2QG6A 3UMFA 2HUPA 3FFBA 3PR1A 5HKKA 1TUEA 3VNVA 1KDRA 2W00A 2FZ4A 3D31A 4IVQA 1Z6TA 1Z2AA 5FPKA 3NHAA 1R0YA 2P6NA 1F2TB 4PR0A 3GLIA 4XVQA 2QROA 4RZUA 4M8NE 5FOVA 3NDBB 1OXSC 1N6OA 3REGA 1OFUX 1XEFA 1Z0IA 2EYUA 1E3MA 1YHNA 1E2FA 5L3QA 3K0AA 2OFWA 2IYVA 3A4LA 5LPNA 3W5IA 4GL2A 3AVOA 5EJEA 2ZRAA 2ZROA 2WZQA 2ZI4A 4TTQA 3AF3A 4EDHA 4Q18A 2UZIR 1N25A 3OEHD 4TMXA 1E9EA 1OE0A 3CNLA 3IO5A 5FOUA 3QKRA 4JBYA 1DS6A 1M7BA 3BD9A 3L2OB 1OH5A 3OF5A 1LY1A 2FGJA 3OE7A 1FTSA 3KXLA 2BKUA 4HEJA 2DFNA 1RW4A 4QHYA 5IHPA 3WRYC 3A4NA 2BBOA 2CVFA 3DDCA 3QXHA 4KYIB 2VPPA 1XD8A 3DOFA 3GEIA 3I92A 1LW7A 2DFKB 5E7JA 1CJMA 4Q4LA 3TSWA 3M0EA 1KMHA 2H8KA 2GVZC 3JVUA 2VEDA 3FMOB 1G8GA 1KJYA 2MSCB 3VR3A 1G9XA 2D62A 1LS1A 4FMDF 1WXQA 4IFBA 1E1QD 1ZM2A 4JMPA 4Q4JB 4JT2A 1O3YA 1R6BX 1SKYB 2RGAA 821PA 1R7RA 2QU8A 4DXAA 4I81A 3QPWA 1N5KA 3EZFA 1QF9A 3GJ0A 4NU0A 3BOSA 3C8UA 4DCVA 3UWOA 1WQ1R 3AVYA 5FBWB 4AKEA 1N5IA 5B57C 2QAGB 1GKIA 1TF7A 2PX3A 2VTKA 1TQDA 2ZQ5A 1DAGA 1P62B 3W5JA 4C9BA 5L3VA 2JDID 3JZAA 4UQOA 2JCSA 1LF0A 3MAAC 3S1AB 3VTKA 1KI7A 4CEJB 3PCRB 3UK6A 3AGPA 4NYJQ 4ZDWA 3P27A 4TYWA 4D80A 3AVTA 3T61A 1BYIA 3QE0A 5BQ5A 2G3YA 3OEEA 1XTRA 4DSUA 4HZIA 1E98A 2WHXA 4DUGA 2EFDB 1GUAA 1ZM7A 3I32A 1RFLA 2D7CA 2CHGA 1YZLA 4YMVA 1P72A 2GCOB 2H1LA 1Q3TA 2CHVA 4G0NA 4M21A 2R6AA 4Q1EA 3TLXA 2JLRA 2O0KA 2FFQA 1XXHA 2R2AA 4KU4A 1CR0A 1EFRA 3QF4B 2X2FA 3RS4A 1KMHB 2ZUCA 3RRZA 2WAXA 4NCHA 2EQBA 5JI2E 2JAQA 3I4LA 2DHRA 3NG1A 1ZIOA 4PC7A 1JB1A 3AP2A 5H68A 1GKYA 4YMUA 1NSTA 4M9ZA 3QG5A 2AD5A 5GJVC 1A2KC 4V0ME 1S8FA 2WKRA 5HR5A 4XJXA 2GJ8A 2G0NA 3WP0A 5BN4A 1KNQA 4I99A 2ZI3A 3ZH9B 2CNWA 4D0LB 5ELXA 3TUZC 3FFAA 2XNSA 4BZXA 1I2DA 2OCBA 2V8OA 1G3QA 2FA9A 1RVDA 2WMOB 2AKAB 3O8BA 5J40A 4JIMA 2GBLA 3BFVA 2QZ4A 4CT4B 1G3RA 3DMNA 1JNYA 2QBYB 2BC9A 2J59A 3TBKA 5FTMA 1PVOA 1U9IC 4M1WA 5DYIA 4KV9A 4LPKA 2Z5FA 2J0UB 5DI9A 5HZKA 1OJLA 1ZU5A 5CK5A 3TIFA 1N6HA 1C9KA 2X19A 1M7GA 5AUPB 3KB1A 4JJZA 2WV9A 4KFRA 4DLZA 5EQTA 4Q47A 4BFUA 1P6XA 4R71A 1VG9B 2C9OA 1E2MA 1XTSA 1HYQA 2ORWA 2ZR0A 4V03A 4GI7A 4US0R 4R98A 4TYNA 2IXGA 1CRQA 1UBGA 4QRHA 1DG3A 4KITB 4IDOA 1J8MF 2ZRFA 4B3CA 1VG1A 4CVNA 1XCGB 2R6GA 1T5LA 2VF7A 3T34A 4IW3B 2ZRGA 4US1R 4V0MA 3SOPA 2ZS8A 3T15A 2RKOA 4A36A 1MABA 2CLCX 1IN8A 5KNDA 5K8LA 1KKLA 4QJ4A 1N6NA 1CIPA 1XEXB 4A2WA 2P5TB 3GJ4A 1JQLB 4B3FX 1MV5A 1OF1A 2QTVB 4DDUA 3EPJA 4YONB 3CIOA 2GJAA 3MUFA 1XFAA 3PFIA 5DI3B 5A4JA 3MFYA 3LW8A 5KOYA 4PFSA 3I5YA 1Q1EA 4P0TA 4D82A 1O87A 1XXHE 3U4QA 1FFHA 2OUKA 1N6RA 5EUMA 2GTPA 2F1IA 1E79A 2IWRA 2H57A 4PPNA 3NBXX 2QPAA 4GNKA 1W2GA 3BIFA 1BH2A 3TGPA 2H16A 2CEAA 1G19A 1RE0A 5JWRA 2WJHA 5IK2A 3K0CC 1XDBA 2FGKA 1Q21A 4GOKA 4EFMA 4Z1MD 2X2EA 2QTHA 3KUCA 3UWKA 3EPKA 1G7SA 4LJ5A 3OFND 1W2HA 4AG5A 4LSGA 1VCOA 1IBRA 1M34E 1ZM9A 5SZHB 3IIJA 4BQSA 3W6PA 2QE7D 1DBSA 3IBGA 3DZDA 1G5RA 4CEIB 4C0HA 1KO4A 3CM0A 1VECA 1IXZA 4LZZA 4NCJA 4EPTA 1XTQA 2CCJA 3FHCB 5LDDC 3KJIA 3OE7D 5HKKD 2J7PA 5BYKA 2J7KA 1XXHB 4KSCA 1L4YA 3L82B 1HQCA 4Q66C 2QSYA 2QMHA 4DLWA 3HYRA 4HDOB 2J45A 2J0UA 4PAQA 1JXOA 4LBWA 4UNPA 1L7VC 2FH5B 3Q3JB 3UATA 1OH6A 1EX6A 3RVBA 3T1QA 4EPWA 4HSEA 1FMJA 1NVUQ 1YRBA 3G5UA 2HCBA 2ECKA 1P2SA 4TMKA 5AJZA 1QRAA 2JJ8A 3GCGA 4A82A 2VIIA 5FTKA 2J0VA 2CE7A 2YV5A 3A1VA 1GAJA 2BMDA 2YOHA 3VAAA 1G20E 4YMSA 5P21A 2ZRMA 3Q85A 1KO8A 3ZS8A 3AUXA 1E2DA 2H5EA 4BLSA 2EW1A 4YMWA 2FSHA 4AYTA 1XMSA 2J46A 3CF0A 2PJRA 2QM8A 2CL0X 3DOEA 2WSMA 3BBPA 1DVRA 4MYHA 1YZGA 3AF1A 2C95A 2JLYA 1WB9A 4ZV4A 4KYUA 2VP0A 3I73A 4TZ6A 2A30A 3ZIAA 4C3ZA 1SVOA 4A0RA 3QKUA 4B3BA 3THWA 4F4CA 1N6IA 4GMDA 5AJXA 4DLVA 4C7OA 3UANA 2C77A 3BB1A 1E4VA 2V4ZA 1VHLA 3E1SA 3PV0A 4YMTA 1J2JA 4QHSA 3EZ2A 3QUSA 4DHEA 2O8BA 4PAOA 4G5GA 1M2OB 3HU2A 5JRZA 2HCJB 1EFHA 2QP9X 4V0NA 2FG5A 2ZR9A 1VG8A 2BEJA 4Q21A 4EUNA 2IYRA 2ONJA 1N2CE 2GDJA 2QQ0A 2KJQA 4QBFA 1G1MA 4EJSC 3KQNA 5JI3E 3T1TA 3CB4A 4TTPA 1KY2A 4QG7A 1D2EA
chains in the Genus database with same CATH superfamily
1SHLA 3D4OA 4P4SB 2B7LA 4N5LA 1JHVA 2J3LA 1GUFA 4N8DA 1Z4IA 3W2FA 2C2BA 1BX3A 1SU4A 1T0IA 3G0BA 1XLTA 3I01M 1YB4A 1IAVA 3P26A 4GXQA 3OCYA 5KKCA 1WW3A 2WD9A 2X5XA 1D1SA 2GLUA 3EEIA 2AQKA 2C4HA 1LI5A 3Q5EA 3PFGA 4KSBA 2VUHB 3HUUA 4KQ6A 4LDAA 4PM4A 4W4TA 4EEKA 5EJ2A 2WILA 3QWFA 2LXNA 4W5HA 5I7EA 3MUOA 2Y9PB 1RXUA 3SZOA 4QTUB 2FK7A 5CH3A 1E6KA 3N28A 2RC6A 1BTOA 4H16A 4W7HA 2YV4A 2AYXA 3U3KA 4R1PA 2NSHA 1K7YA 3EODA 2PE5A 3DDNA 2YINC 4C0XA 3EGDA 2IU4A 1YT5A 1QHYA 1HA3A 1HWYA 3O03A 3W3AA 1H22A 4HX5A 3ZWXA 2FPWA 1KS9A 3B13B 1B14A 1E1CB 3OIUA 3DQPA 2X0KA 4OY3A 3U37A 4BAUA 4CE6A 3BD7A 3PDCA 2PRIA 4MULA 1WEKA 1C3JA 1CULC 3G8BA 4UVEA 5L6MB 3JQ8B 3W2TA 1YQXA 1LLQA 2K2QB 3U16A 1S5PA 4PCAA 2B37A 1X7HA 2C9DA 3AB8A 3G85A 1X1QA 2G08A 4P86A 2B20A 4TXNA 3RVJA 2XZLA 4TL7A 1ZN2A 1OH8A 2GVNA 4FMDB 2ZRQA 3LY7A 3BZUA 2WHEA 3H0CA 3SC2A 3B5EA 3FAKA 3OUUA 3QELA 2QX4A 3TSCA 1SIWA 3WDMA 1O94C 5EMNA 3B1KA 4E7OA 1DBWA 3GLGA 2EXXA 3HKDB 3OZBA 4AF6A 2ZRCA 2H92A 4AZVA 5GY7A 4QUAA 4EKDA 3DOCA 3GI1A 2PGDA 1QPBA 2DTDA 2TMGA 3QE3A 4BTEA 1L7AA 3QLTA 4C7KA 1TZMA 4RFLA 2CV2A 3QKWA 1W5EA 5B1DA 5LQRA 3COYA 4R83A 1TAGA 4XW2A 2JAXA 1QNFA 1S4QA 4JFAA 2OC9A 3TYXA 3O3MB 3N2KB 1G66A 2IY9A 3GLQA 5T5QA 4DJFC 2QNBA 2ZYRA 3QXCA 1QAMA 3LS2A 3VV2A 4WLOA 1KE1A 1FRVA 1WUIS 4ZI7F 5HFJA 2P9HA 2FW6A 3PNVA 4HO1X 4KQKA 1BVHA 2L42A 3A3YA 3EJ6A 1TO1E 2XWPA 3LF1A 4J1SA 4XDGA 1GQSA 3IVCA 4WXEA 3GNQA 1L3IA 3C6KA 1E6LA 2ZAIA 1E79D 1G3MA 4EGQA 4QKQA 4NL4H 1UPTA 3S2FA 1RAFA 2Z98A 4J0QA 3X1ZA 2D00A 4BNUA 1JHZA 2QR2A 1WNTA 2NIPA 1EBBA 4NU8X 4YC7A 5IAOA 1FFSA 2JIZD 5EP3A 2DM6A 4X44A 4J0IA 3C5CA 1KYXA 2W2PA 1LA2A 3GG2A 1YR2A 3OE1A 4BKRA 4N82A 5IKPA 4TT3D 1P1JA 2NTEA 1ZRNA 1MNQA 3GX1A 1ZDMA 1N2GA 1E1RA 3O93A 4EHJA 5JS1A 1KU6A 1FP1D 1LJLA 2JB9A 1SIUA 4NV1A 1KO1A 2PJDA 3I30X 1OLXA 3GN2A 3RSGA 4QQNA 2JLWA 5FB3A 2WF5A 4P7GA 2H9IA 4PFKA 3GEGA 4C14A 2UZ4A 2VFAA 2ZTHA 1SVMA 1ZWLA 5HJ5A 3TSOA 3L7KA 3VQTA 3AM3A 1TPZA 2FEMA 4J43A 2RHTA 3DDWA 221PA 3P45A 3FIJA 5K8JB 4XD7D 4MVJF 4J76A 5E95A 4YRFA 3H11B 1D07A 2LZ0A 3NEYA 1SK9A 3U39A 3D81A 2W48A 5FJIA 4E21A 3QVMA 4L57A 3RUCA 3HR8A 4MZXA 1Y3DE 2JZOA 4X8LA 5KSPA 3W5HA 2J8ZA 1UIMA 3T06B 3K9BA 4FLMA 1N8KA 4F12A 1SQ5A 1XNGA 1LVUA 3KKPA 4NOJA 4PHGA 3IEVA 3ZWBA 4HTFB 3DPIA 3O1LA 4KI0A 2FSIA 4DDWA 4YRLA 4F86A 1JBEA 2JLCA 1GPWB 4ALIA 5IJWA 3CB2A 1KK3A 1ETUA 3OEHA 4TQAA 3VU9A 4RGYA 2CNDA 3AF6A 2O2EA 2ZSBA 2RAFA 2L0XA 4MWDA 1E9FA 3TIIA 4CXMA 3GOQA 4FYMA 3ZK8A 3O2JA 1C8KA 3EFBA 2HH9A 1A50B 4G8DA 3ZWKA 1NOIA 2WKQA 3D3JA 5IF3A 1AS0A 4C3VA 5EJIA 2Z0MA 2F3SA 2CUZA 4HMQA 5HJ2A 5FUMA 2AB0A 3ELYA 2G72A 4KQIA 4K9DA 4MQ5A 1UOPA 3L7MA 4DG9A 4B3GA 1CG6A 1RKXA 3NI2A 1PJSA 5LYJF 1T3HA 5IEBA 1UPCA 2JF0A 2PAFA 4CKYA 5TNXA 3LKBA 4IVRA 4B3RB 5IBRA 4OQXA 4F85A 1SC6A 2RSLA 2HK8A 4NAVA 5B1SA 3TNFA 5A5VA 4I55F 4XA8A 1MB3A 1Z2EA 3K1AA 5B58C 2H29A 3A4TA 2J1LA 1JIVA 1RHMA 1VBKA 3CU5A 3LRPA 1RQ2A 3CX3A 4W7IA 1GP2A 2D1TA 2YZ7A 4KLNA 2IVFA 2W8ZA 5I9SA 5ESWA 3FVRA 3SSMA 2FW9A 3WGMA 1ZUD1 3CXUA 3OFVA 3G89A 1AXEA 1MQSA 3OIFA 1KMCA 5AO9A 4KKVA 1SKUA 3WOHA 4EPRA 4N12A 4RCYA 4WXRA 3KWFA 4JUDX 4FX2A 5EFOA 4YTEA 3G2KA 1MJGM 4TTAA 4M0DA 4XEUA 2JGFA 2FCRA 2I7CA 2ZSEA 1OBOA 4ZT3A 3P32A 4BFXA 1PD0A 2P1ZA 2A2ZA 1E9CA 2XNDA 3GFOA 4CCYA 4J0CA 4RVDA 1P9WA 4N0QA 2BHLA 5AKXA 2O8FB 1YNSA 2G0AA 4HQRA 4XD7A 3F5SA 3RVKA 1P39A 1Y6RA 4DY4A 2JAPA 5EIEA 1OAOC 5A3VA 1TX4B 2FOXA 3BH7A 4OJYA 4DSZA 3O91A 2WZCA 1YF3A 3ISJA 1G55A 4IMRA 2OV3A 3ZWYA 1J23A 3WLLA 1GWNA 3DYBA 1BRMA 5BNWA 5CX1A 3BIOA 4I4TA 1A8HA 1E66A 3B6ZA 5TT1A 3BPSA 4DCCA 1TO6A 4ZVUA 1U04A 1BJRE 2EJVA 4ITUA 4M0KA 4QOHA 3B51X 1KZYC 5FNVF 1KQGA 1FSPA 1GA6A 4J6EA 4IZ6A 4LBVA 2YH2A 1XK6A 4EUSA 2Q07A 2Y05A 2Y9MB 4JBHA 4RJJA 4X20A 5F51A 4AS1A 2GBCA 4JBWA 4URYR 1TT5A 3VR3D 1C9NA 3AUTA 1EXNA 4UU0A 2GAFA 3BRWA 3SAJA 4X84A 1K63A 5BOSB 4ZCQA 4BVAA 5CA0B 1CR4A 2A92A 3UTCA 4F91B 2PUTA 1A9OA 1Z4QA 2P2DA 3NIDB 5AVKA 2YJNA 5CCDA 4ZYXA 1U9IA 2GHQA 5AHKA 5C1BA 4C2AA 1M66A 2P7HA 3ABRB 4A6XA 3K05A 4IILA 2G77B 4GXNA 5EUCA 2BGGA 1MO6A 3O4RA 1CUUA 3EVNA 4ZALA 3R9XB 1FFYA 3FA2A 3PC3A 4MRVA 5IS2A 5B6PA 3BZWA 1M54A 3N53A 3K71B 3ZGZA 4C06A 4BX2A 3C4QA 2CJYA 3EPHA 3PHGA 3SBOA 3BULA 3X2SA 4JVOA 3MGBA 4JA2A 4L22A 3PB3A 4JKYA 2DPGA 3DHNA 1WQ4A 3DVQX 1P4RA 4M1YA 5E1DA 5H59A 1DJOA 2D4AA 4RM2A 2EFGA 3GA5A 3B3QA 2KBEA 4ERNA 3IR6A 2OP1A 3O8QB 1OA0A 2GF0A 4JYMA 1NBHA 2HLHA 5JR3A 3JPWA 5HTOA 4FYWA 1JAXA 3A6KA 1WIWA 2DFTA 2Y1GA 3QNUA 3HKEB 3HNOA 3EFOA 2HGSA 3LQ4A 4B48A 1X86B 3KO8A 2XTNA 4HX9A 6NULA 1C41A 1NYTA 3VYTB 4CFZA 3HKBB 3DA8A 1NSFA 3GMTA 2JKVA 2GXQA 3TKYA 5J5CA 5CT5A 5LQAA 1PG0A 2PLWA 2DPHA 2D1QA 3W6OA 4AJHA 4B4OA 1PO7A 1A8QA 3ZZ1A 1JSCA 2IE0A 2Q9CA 1GJRA 4I50A 3ZHQA 2OK7A 1PWZA 2VNSA 3F49S 5IXYA 1M2FA 3SVLA 1GGMA 2ROQA 3L0PA 3B48A 2Q8PA 3DJYA 2BI4A 3IDZA 4L02A 5NULA 4LNUB 4IZIA 2F3PA 3EQ8A 3TXYA 4EB6B 1Q1NA 2VK4A 2XQIA 1UBCA 1QIDA 2ZAOA 2ZREA 3MZ0A 1MFPA 5EHIA 1GSIA 2BH9A 3U19A 3GXBA 4CLEA 4EO4A 1JX6A 3EVCA 3MS7A 4MKXA 4PANA 5KTRA 1MO5A 4C2UA 3B3JA 1LQTA 2IP4A 2RAPA 4L5YA 1QB7A 5DGCA 4DIUA 4C0LA 2XB2A 1PZXA 3R5TA 1MPXA 4S2EA 5FPYA 4F9EA 4UUBA 5ESXA 1NPTO 4OTZA 1HT2E 2K7FA 2FQWA 1WXXA 1U5BA 2F67A 5J43A 3RDPA 5E6SB 2ZULA 4X8OA 1GGKA 2ZJ2A 1NE7A 1GL9B 1DXOA 1WUKS 4EHIA 4PGMA 2WJZB 1AU9A 4JEHA 3Q8WA 4XYBA 5K6RA 3AEKA 3GIWA 2V7TA 1U0TA 3AUAA 5DBGA 3TLBA 3VR6A 1JF8A 1U0RA 1RIFA 3S27A 3EVZA 4PXAA 1I6MA 2VDQB 2P9QA 4N3AA 2E5WA 4Q24A 4ZU3A 2DHQA 1B8NA 3VSEA 1AGRA 3L1IA 2R751 4IDPA 4TUYB 4BLTA 1A3CA 3PD0A 3LYHA 2OKCA 2BEKA 2YQ4A 2OV2A 5DGXA 3G0OA 1XTTA 1B43A 1T15A 1V71A 1N0VC 3O3OB 4ZPJA 4EKGA 1UKZA 3LHDA 2WT9A 2R7NA 1RVV1 1V8OA 2C5SA 5EQJB 1PGNA 1AX9A 4W5RA 1U0BB 4FOPA 4RHCA 3WRYA 1XNQB 2PL5A 2C3YA 3VJMA 1X2EA 2HXSA 4L50A 4LJAA 3WRXC 4YRKA 4U2KA 2C7GA 2H85A 1DAIA 3EHEA 1KZGB 1DMRA 1EPUA 1ODIA 1RPJA 2WY2D 2QGNA 2IXFA 1E5VA 4NYMR 4NZPA 4WTOA 4OQDA 3D8TA 3QBEA 2F1RA 4TV9F 1Y6JA 2GO7A 4LECA 2C1XA 2D2EA 2RH5A 2EWWA 1CUJA 4A16A 5BR1A 2FN7A 1B4DA 1X1DA 3KTAB 3OF2A 4WNAB 5EA2A 3A37A 4E88A 1C1HA 1HPLA 2HMVA 5DX1A 2Q27A 3BA1A 5K3CA 3RASA 3UA3A 3G9QA 1B8PA 1QFXA 3BCRA 3JAKB 4MUMA 3WLEA 4M1SA 2BHTA 3OA0A 4PZ9A 1I2BA 3CVYA 2OO3A 5A3RA 2BDEA 4O2BA 1HTWA 2G9UA 1BVUA 3PXBA 4DIFA 1N7JA 4EKEA 5BWNA 4OI0A 4ZYTA 2D1SA 5IKMA 3JD3A 1XCPA 2VJKA 3CIFA 4D9KA 2C0PA 2YRXA 3AEYA 1RCUA 3D6HA 3NT2A 3PYXA 3BHNA 4K8OA 2MSDB 4XCXA 4HATA 1QIJA 3O8OA 4U2FA 4C5BA 1PT6A 3BYZA 2J4DA 3GK3A 4I1SA 3RTDA 4JLWA 4E1BA 1Y3AA 3R9KA 2Z4SA 2FEKA 1Q2UA 4DCSA 1UMKA 3UHPA 4QFBA 2PANA 2QN8A 3FPFA 1VRWA 2W70A 1GKLA 4PX9A 1YCGA 5CIWA 1GR1A 2IH4A 5K3FB 2JFUA 4C5CA 2HCFA 1KU0A 3KOWA 3RIHA 5KTOA 1QF6A 4MUNA 2QPLA 4F6RB 3GRPA 3A9WA 3OTIA 2F3TA 3FYHA 4M7WA 3T7EA 3N8KA 3BKWA 3LLVA 3F90A 1SVKA 4A0QA 4HLUC 3HDVA 5HS4A 2RIRA 1RQNA 1TXGA 2JGMA 3I72A 4FDVA 2XZOA 1QZUA 3MWKA 4H3KB 5BOVA 2P2YA 2CEKA 4NHOA 4PGHA 1Y5RA 3FSRA 3NYIA 4B3MB 4A9AA 2VL7A 4BCDA 1JR6A 1J33A 2G70A 2XEXA 2SKCA 2WJIA 5T4EA 3ZLVA 3GUUA 1J99A 2Q62A 3HV2A 1WF6A 5EUQB 1BKSB 2FSGA 1E6CA 4JD5A 2VJCA 3DKIA 4LRXA 1T4CA 4PLHA 1U3GA 4IHKA 2P6RA 1GL6A 3E61A 2ZIXB 3N5CA 1Y1QA 3A31A 1P9RA 1WMAA 1V5GA 4QBIA 1AKVA 4P1ZA 4LYYA 1RM4A 1JWLA 4HP8A 3HA7A 5HE8A 3ABOB 3R5HA 3IAUA 2YYZA 1G7RA 2RD2A 2Q0QA 1IPHA 2L17A 2NSYA 1XROA 2ZRIA 3PA8A 4Y2SA 4BGVA 2ENUA 2M2IA 3KR9A 4Z4GA 5ARBA 1PQUA 1T1JA 2O3SA 4OKIA 2BE9A 1Y8ZA 3IBSA 2CE2X 2F9FA 2XGSA 2IHVA 3IV7A 5CEEA 1FNCA 1CQPA 4KE6A 4CG0A 5JLJA 4RPGA 1V5EA 4CKEB 3SICE 1LX7A 4OLFA 4FS8A 3DV0A 2RC5A 4AX8A 4KH0A 1Y37A 4U3JB 1MGOA 1P2UA 3HZHA 4F9TA 1EFTA 1UBUS 1JH9A 2UUAB 1YQDA 1YDMA 4X45A 5D84A 4ZU1X 2Y76A 4NULA 3I05A 2I3BA 4RGQA 4IUDS 5JCOC 1Z6QA 3WJ7A 2YWDA 3IA7A 4G2TA 3DVSX 4LJ6A 1HFKA 3G1WA 1MG5A 1L5GB 4A5SA 4D4GA 5FDFA 5JFOA 3K70C 5KYVA 1YR1A 1JS1X 3P0EA 3KBBA 3QEKA 2AXPA 5EE3A 5GVSA 1IY9A 2I2CA 5LFAA 2XXAB 3K0HA 3RFVA 2D2XA 3AHIA 3Q7IA 4LHVA 5ICGA 2N1BA 3OCWA 4IDCA 5GV7A 4IRXA 1BXRA 1T6XA 3C48A 1QMPA 3AUSA 3AWDA 3DE3X 4G0MA 3NATA 1UC5B 1T5BA 1ZK1A 1CUVA 4LV5B 3RIMA 1V0JA 1QO0D 4GXRA 4X6YA 4DLTA 4ER6A 4CBVA 2V0GA 3G2HA 2HRDA 5ENDA 4DCNA 2O8DB 2QDKA 1FFCA 1XZPA 1MA3A 2XZTA 1T9GR 2YJ3A 2ZGVA 1UZLA 2ZBVA 1YZKA 4MS1A 1SXJB 3JR3A 3AHDA 1E32A 1VZ3A 3HDQA 2PN1A 4QUJA 4KQGA 3UT5A 2GJ9A 2OGZA 5CB4F 1FDVA 3AF4A 3FYUC 4GLFA 4FSHA 5DM4A 4NJMA 4JIGA 1TVCA 4UKDA 1E4YA 5BV7A 4BMPB 2WM9B 1AGNA 1ES9A 1BQ3A 2XADA 3A4YA 4OHFA 2HLDA 2Q3MA 4RAOA 4LV6A 1XKTA 1AQIA 2HHLA 1YAJA 3INGA 4RVCA 1IHYA 4Y6QA 2FDRA 1VHWA 5GADl 3VX3A 2O5EA 2ZETA 5ITZB 3E5NA 4N39A 3FUWA 3SYKA 2Z95A 1W76A 2H1SA 1O8BA 4BCBA 1D4ZA 4AVYA 3JQ7B 2Y1LA 3GFQA 4CEIA 5JADA 3MM4A 4M8IA 3OQHA 3VPHA 4WBNB 5JXIA 4RORA 1G3UA 4I4TB 2WSSA 1ESEA 2J32A 4OMCA 1L7BA 4M1KA 1K7EB 1N0WA 2GDZA 4HVTA 4QUIA 4GQAA 5THQA 2XB6A 3IOCA 3HJFA 2AIRA 4FHEA 2RHDA 2QG4A 3BQ9A 2IU6A 1PG2A 4OXRA 3UVEA 2PSDA 3RK4A 3T7JA 3T4EA 4ZMSA 1P45A 1C7ZA 1RC1A 5A0FA 1W96A 4DIBA 4B85A 3PUYA 3EXFB 5I7WA 4DB4A 1WSWA 2R6DA 3TZEA 1UDAA 2GCIA 4K9KA 5EUBA 1G8JA 2IYPA 4RDXA 5H3CA 4HR7A 1RC0A 5ALYA 2GCNA 4YJ2A 1U90A 3D5TA 4H31A 5FTJA 3DFIA 1IWPB 4O0LA 5IANA 4OHUA 5A1JA 2I71A 2JFHA 4GUAA 4MKFA 4M8LA 4GPIB 2OZPA 4YRSA 4RX1A 2EVWX 2QWXA 1I4EB 2HQ1A 4YP5A 4I55A 4ESHA 1DJMA 2FQYA 3D0OA 4RGVA 4WFQA 3GLGB 4R9UC 4FHFA 5IVKA 4GR9A 1N5MA 1NVDA 1WMSA 2FWIA 2ECOA 4JLMA 2IXDA 3SGLA 5KZMB 2BN4A 1ULAA 2AOUB 4JL5A 3GG9A 1L5HA 3HE3A 4O0MA 2FI1A 2XOEA 2A59A 2BIFA 4HDAA 5E0OA 1DXQA 3L46A 4I9FA 5FOSA 4MYDA 1G7TA 4HGQA 2YWFA 2IV3A 4QGSA 1LLUA 1ATIA 2A9OA 2EKZA 2IW1A 2O8VA 4HGZA 4HDKB 2DE0X 3L04A 3IR7A 4Q9IA 1O9HA 1NULA 2B8WA 3KIPA 5IDYA 2JD2A 4RZIA 2P65A 1WF3A 4Q3BA 1H6AA 4FINA 4BQEA 1DAFA 1FU7A 1RE1A 2H3EA 3KQMA 3D1JA 3GVCA 3O90A 1Q83A 4UHBA 1H23A 4F8JA 2VPQA 5CT9A 1PR2A 1YWGO 1R0BA 3HS3A 3NNDA 1P0MA 2PYIA 1C3LA 1GZHB 1IHXA 2BONA 2NNWB 2PRZA 2Z30A 3MIIA 3ZNQA 3GA7A 3HRIA 3TGWA 1P33A 2AFIB 3LUKA 4IHAA 3ZE8A 4P3YA 3NOVA 2PIDA 4YV1A 1ZFNA 3CX8A 2NUPA 1YS1X 2YFYA 3EXG1 8ADHA 1BCRA 2GWHA 2C0QA 5TMDA 1CXZA 1CUEA 1PT5A 2AMYA 2Q28A 4B3JA 2LD4A 2VH5R 4MKGA 3GEBA 1E9AA 3HU1A 4GW3A 1Z35A 2ADFA 5AESA 3CZCA 4X6XA 2WW8A 1U1CA 1WB5A 4IHQA 4ZYWA 4RXMA 2X13A 3KM0A 3R3JA 2BF7A 3DEFA 4HLNA 1G21E 1IJEA 2O0JA 2Q9UA 3FYUA 4AO7A 1G8FA 1RZUA 1QWSA 3SYMA 3NWEA 4OA8A 3HJBA 2F9LA 1US8A 1PNVA 4LY3A 4MW9A 4PC2A 2CHFA 1QP8A 5FF9A 3RKSA 3SY8A 3GDHA 4PRLA 3RYIB 1CE8B 4TTVA 4B76A 5HCIA 3DBHB 3O94A 1NI4B 3GCDA 4HQFA 2V3WA 2ZUDA 2NQTA 4J0DA 4W9NA 2G9RA 4X7RA 3C3CA 2ZIXA 2EJUA 2XUJA 3DF7A 3Q9NA 1Z2CA 3H5RA 3R3ZA 1FYXA 3IKLA 4TV8B 1RXSA 4WOBA 5EESA 3RVSA 5FAKA 1H1LB 3I0MA 2OQIA 4M22A 3T4PA 1YCDA 3BG5A 4URHA 4R2JA 1IN6A 2WHRA 1NXWA 4RJTA 1MEOA 1XZNA 1KYQA 3VYVA 1MVLA 1EFPA 1UADA 1WDKA 2ZRHA 3HL4A 1Y9ZA 2IKSA 4XXHA 5KWEA 1YHYA 2CXUA 4NJEB 2J41A 2PZEA 1IY1A 4OJQA 4YQEA 3SR4A 4EQ6B 3L49A 3DNFA 5KSYA 5FHQA 2ZUFA 1C29B 2AX4A 3GMIA 3VR5A 1YBHA 4OATA 2YR0A 1KDPA 4Q9KA 5C5IA 2ZE6A 4EP1A 3AVXA 2VBGA 1T5HX 4KNVA 2PMEA 1VKZA 2Q8NA 2ZJ3A 3MAGA 1PVDA 1CS0B 1E7RA 1FRFS 1GKUB 1V16A 2XI4A 1JBKA 3OT5A 4KWIA 4NOLA 3G2NA 2FMIA 1J1UA 3B38A 3F9IA 4PZDA 2YMMA 3PSAA 3CNHA 5TQJA 3S28A 4CLRA 1JKIA 4FILA 2FPUA 3BM5A 2PSEA 4JLOA 4MS4B 2JKZA 4L5JA 4EYQA 3TFWA 5EIAA 2QW1A 1E5XA 1NN0A 3EYWA 1ML3A 4ABYA 4MKZA 2ONYA 4K0KB 3T5GA 4NEGA 4X7MA 3CZ9A 3LLSA 5TVKA 5IHXA 2F8TA 4LZPA 2XX3A 3RTEA 1PLJA 1CD5A 4BB9A 1EZZA 2XNJA 1NM5C 1KXJA 5EIWA 4NG4A 4OREX 3OZFA 2HCRA 3PYLA 4W8OA 3HDHA 4O4JA 2PU7A 2AR9A 4LGVA 5AVVA 4FGSA 3CX6A 2GAOA 4HDMA 1DE0A 3Q72A 3G1TA 3N5KA 4MGEA 3U2QA 4D9BA 2DETA 1DPFA 1E8MA 1KRHA 4GIBA 1FPMA 1QJ4A 3IMKA 1Z34A 2HK6A 3ZKAA 4BCCA 3PDUA 1MEEA 4Y6LA 1N3YA 3CO0S 3K1JA 2F8LA 2BI8A 2NYVA 2QI9F 2FHSA 4RF4A 3BSYA 2AG0A 3QPBA 2RFLA 4XGRA 1W0CA 5EEGA 4IFIA 5L7WA 1NYLA 2QX7A 2QV0A 1GL3A 1ZCFA 1U6JA 3GA0A 4M53A 4RVFA 5YASA 4YRZA 2QT1A 2QN9A 5GWXA 4DMMA 3KLPX 3THRA 1Z8DA 3CN9A 5K3FA 1F9EA 3AM1A 2BL4A 3EPPA 3JYPA 3QPVA 1AQNA 3WNZA 2JI8A 4I2NA 3JASA 1WABA 3SLKA 4B3SB 3LBYA 3JQ8A 2WDZA 2JAUA 4NBTA 1VL8A 4HUTA 3JQDA 5DNEA 1DX9A 1GPDG 2YY7A 5JYBA 5CJ2A 2Q7XA 3K4QA 3GNTA 3TZHA 3O38A 4YFYA 5J5VA 1JHOA 2GVDC 1OXTA 3F78A 4PV7A 1TEHA 1EVEA 4DL9A 1XUOA 3BCHA 4DQVA 1I5EA 4MB6A 1KY3A 4MRMB 4FX5A 1KJ9A 4UC0A 3P9ZA 4RACA 3TQSA 4UFPA 2AGVA 4R1UA 1GVNB 3K30A 5F2KA 3THYA 3H6GA 4PAMA 2ECFA 2JI4A 5B53A 4EPXA 1QFYA 2MINA 1M1ZA 3RUAA 2YV2A 1ZVMA 2UXBB 4GP6A 2NZ8A 4OHWA 4RY0A 3GUCA 5EVCA 5ERYA 1ECFA 4S2UA 2PM8A 2Q3LA 1C4XA 3BAFA 3N7UA 1L5NA 5D51S 1EG7A 1S2MA 1D2RA 2GAJA 4XWKA 1IPFA 3NIWA 2ID7A 2PPVA 2QTZA 2P0AA 1AQYA 3B78A 4K87A 3SCZA 2Q9BA 1NXXA 4JI0B 4X00A 5CEJA 1NXSA 3ZWVA 2ZJ5A 3D3NA 4L72A 1RZVA 2BP7B 2VDJA 1JECA 3L41A 4IHJA 1A9SA 3EDYA 4QD3A 1JKFA 3TN7A 4MUJA 2QGZA 4HD8A 1U0GA 2C04A 3IIMA 3V1LA 4WY2A 1HYGA 1GPKA 3SD7A 3EAFA 4YIHA 1V5WA 2Y4NA 3I62A 1U1IA 4PZLA 4AJ4A 4EIWA 1X94A 1SQ0A 3EULA 1X92A 4Y2YA 5DYTA 4FYIA 1U7OA 2G4LA 3MTGA 2GNOA 5EXTA 4IS2A 1A4UA 1VE1A 2W6PA 3NJ4A 3SDSA 1ECBA 2PNFA 3OEWA 1SPBS 4X41A 3EFEA 3M49A 1XL1A 2OZEA 1KBZA 1IM5A 3MWLA 5GM2A 4GPZA 2BBSA 4JBXA 5A6SB 3CLHA 4PBTA 5B7PA 1W5BA 2JG3A 3BMXA 4MQMA 4I4IA 3WL7A 3L8FA 4FZ3A 2VUIB 1QF7A 4YDRA 3WK9A 3AJ9A 4D8TA 1J25A 4HYEA 2VO1A 3GRYA 3X1DA 4ACBA 4P08A 1OHHD 1HE1C 1JXQA 4QIHA 4B43A 1X87A 4DCTA 3V9AA 2YVQA 4DA9A 1U63A 2REBA 4X1KA 2WU0A 4JBIA 1YZQA 2WDPA 3R24A 5B3JA 4QYXA 1ZOSA 1ZSYA 2IXAA 3ABIA 4G25A 3GELA 1RM5A 5HJ7A 2KI5A 4D4HA 4BS9A 4Y2GA 1EGMB 4BLVA 1KY4A 1ORVA 2W2VA 3MBIA 4LX8A 3VKGA 5F2EA 2CNKA 1L7NA 4OEHA 2KLBA 4O4LB 1UXJA 3BORA 5I7AA 4J0GA 3LZCA 3KEFA 4QPJC 5LDGA 4BL5A 5CLJA 1ZSNA 3LK7A 1CYEA 2IZ7A 2OCDA 2VF8A 4OI4A 1DAPA 1RFGE 2AC7A 1WZNA 4GOJA 1IUPA 2VJLA 3WIUA 4DV5B 1T4BA 3FZEA 4N7BA 3WL4A 4JYCA 3BEDA 3DF9A 1DG1G 5FULA 1NJ2A 1TZJA 1P0CA 1G18A 3E4CA 2WNIA 2PH3A 2RMKA 3COPA 4PZUA 1BDBA 1SUIA 1VL2A 2EU8A 4YJFA 3P2IA 2DWPA 3PK0A 4LZNA 1Z4NA 4YRCA 1IN7A 5CM9C 3ZDFA 1L4MA 1YVRA 2C5FA 3WGGA 3LQRA 4MGYR 4M1MA 4QGBA 3G6KA 1KZ1A 4IKEA 3NDRA 4KIWA 4L74A 5KOHB 1NLYA 4EHLA 2PLAA 4X71A 1Y82A 1AMOA 4DWWA 2YIDA 4J7AA 3QJGA 4U02A 1WVIA 1Z5WA 1P18A 3KYIB 2WAMA 4HN9A 4L0DA 1CUAA 4OGGA 1QDEA 1XKLA 1R8SA 2DUJA 2FPSA 2V9CA 4NZOA 2AUMA 1U94A 3OKFA 1NMZA 4C6TA 4B6QA 3BK2A 3WLSA 3EG9B 2PO5A 2PLRA 3M4YA 3TQCA 2HNKA 1ISSA 1O5TA 3IP9A 1QP7A 2PIAA 2GJSA 1CF4A 3UJ8A 1IHPA 4JP3A 1WMDA 2HHAA 1PZFA 1C7JA 2QE7A 3ESBA 3EQZA 4QFMA 3WNQA 2Y0EA 3GEMA 1X7DA 3ENNA 4R81A 4L4SA 1E94E 3OQ6A 4J2TA 7MDHA 1IG3A 4HWRA 5HDBB 1A76A 4ZQFA 1BROA 1RCFA 5LIRA 4K26A 1SXIA 2H4JA 3UT6A 4FGLA 1Z63A 1MB9A 5ILGA 3OTOB 2AZTA 2KW5A 3PD7A 1CJUC 3GRCA 3IUJA 1AN9A 4FJ1A 4R2MA 3FFXA 3LVFO 4ANFA 2GPAA 3Q1KA 5BWLA 4K1LA 3ETNA 2Z9CA 2A3NA 1DO8A 4YT5A 3P96A 1KEEB 3IVMA 1ANKA 4GI3A 1JTEA 2LCFA 1ZD8A 1RXEA 5A4AA 3BTVA 4ALMA 4RTJA 1Y6GA 2ZM6B 4KREA 1ZPDA 4ZZ0A 3F3MA 3I12A 4OHCA 3UOWA 3NDIA 1RXYA 2XWJI 3F1LA 4ZTBA 3RB8A 2NO0A 3SF8A 1LGYA 4LF6B 3EQ7A 4JL8A 3CQ9A 3H17A 1WNFA 2XKJE 1W0KA 4RWZA 2DVMA 4BIMA 4DREA 1SPXA 2II6A 2LV8A 3R4CA 4XB2A 2QRPA 3KB8A 5EQDA 4ACAA 1GPH1 1A1VA 5KTKA 4FCWA 4WL0A 4JH0A 4L9RA 2GSWA 3MELA 5JDCA 1DEAA 3D0RA 3PXUA 2Y67A 2J5XA 3E7PA 3C1TA 5J4HA 2PSFA 1PQ4A 4Y1RA 4R9VA 1F5SA 2IP2A 2DKNA 4PEVA 4KAJA 5MN5A 3ZDRA 1DC6A 3IP8A 3IQIX 4R40A 4YQZA 4BRZA 3F71A 5L51A 4WACA 3TEFA 1DRJA 1R9MA 3LUBA 2RBKA 4O4IB 1RQLA 3L7LA 2WKWA 3AF2A 2XCRB 1GDTA 1JFFA 2XTZA 2QM7A 2RCYA 2W37A 4U7WA 5CX1B 1VFPA 3BN3A 4QULA 1D03A 4C78A 5JHHB 2GT1A 2ZZMA 3WGUA 5KVSA 3A1SA 1XQ1A 1X1AA 2ZUWA 3GGOA 3K1YA 4TV9A 2XQKA 4HYYA 3Q8KA 3J81A 3ZOKA 4YBRA 5A3QA 3HDGA 3B3GA 1FX1A 3ZQUA 4JLDA 3QKTA 4NZMA 4BJ3A 4F5DA 4B75A 3BFKA 4W9MC 1IRIA 4N3BA 3S68A 3UY4A 5K5EA 4FNAA 4EI2A 1SBYA 1UPAA 3MNFA 1PK7A 1POWA 1YTLA 1Y5LA 1UC4B 3AY7A 4PSVA 1XZ8A 3T7IA 4CKZA 3UK1A 1ZUWA 3DMGA 5LNK1 3IDOA 3H7AA 4YVFA 3QF4A 5DYGA 3KPVA 3N8IA 1HXHA 1YE8A 1DIHA 1TYEB 2FUG6 2VPZA 2PDAA 4JUBA 2HF2A 4F0JA 4BN4A 3DO8A 3WMFA 1RQRA 3AY0A 4YJ3A 4N47A 3WGLA 1SH7A 1FXWA 3FCUB 4RK4A 5IAKA 1L5LA 2QYTA 4FOOA 5KSOA 2Q5QA 1V8PA 3T3HA 2C8KA 3B6JA 5ADVA 3A6HA 2YRFA 4JJ6A 1LQ2A 2YXBA 2B0JA 1RJFA 1G8YA 2OGUA 3B1WA 4FQ5A 1OTYA 1SHTX 1HE4A 1U99A 4QVKA 1KJIA 4EUEA 3VSCA 2EZ4A 2XUKA 3CZPA 3SN6A 4UTNA 1KI8A 1E9DA 1EFPB 5JS8A 1B42A 1V7ZA 3H11A 1P4SA 3H19A 1HDGO 1S02A 2O2IA 1B0PA 4LUCA 5L8VA 5LSAA 4ETIA 1UBEA 3KVOA 1NVAA 1RRKA 1SURA 1QE3A 5G3ZA 1KGSA 2GOYA 2CXPA 3ZWNA 3PFFA 1UAGA 1LSUA 1E62A 1I51A 2ZUSA 5IBQA 1XTJA 4QUDA 2R60A 2JCXA 4YBZA 4LJYA 4HNAB 1J1IA 3ADBA 4JQOA 4KAXA 3NHLA 2QMZA 2AN5A 3SS8A 1CY2A 2NO1A 1EWKA 4TRMA 3R23A 1YCFA 4ZOLB 4DCJA 1VMKA 3G8DA 3QHQA 3RUFA 1AQLA 2XVZA 5LMCA 1E69A 2IUSA 5FA5A 4WFJA 4F97A 4BKOA 2PUGA 4ZQGA 1T4MA 3PDJA 1C9EA 4XOUA 3GLUA 5D5HA 1NW8A 1O03A 3MMPA 4YCMA 3PRHA 4KE7A 1GQFA 1GU1A 4A6PA 1OZHA 4RQAA 2XXBA 1NKSA 3QMMA 5JMTA 1NBIA 1OW3B 4RMGA 2A8YA 1DO2A 2BMEA 3L0BA 1YL6A 2GILA 4NCNA 1GOTA 1D1QA 3K09C 4TRRA 4YRGA 4B8WA 4JCCA 3LQ2A 4NH4A 4FVTA 3CR7A 2ODEA 2Z8YM 3OP1A 1X7XB 1Y1RA 1NJGA 2FUNB 1YU6A 1BMTA 2YCLA 4XE5A 4AMZA 4B71A 4B73A 4MPTA 3WSVA 1JALA 1VMEA 5MFZA 1Y1TA 3DKVA 3OJEA 1Z5PA 2I9PA 3JQEA 2GD0A 3PPVA 3KDPA 1LPNA 3GP3A 1JLLB 4ND2A 1OHHA 2I4NA 3FUXA 1QC5A 4MK4A 3E81A 4A26A 2NXWA 2AZMA 3JQQA 3GRKA 4HNAA 3FUVA 3ML1A 3QPCA 1F3OA 1XU4A 2BGLA 1IOVA 2YBDA 2O2YA 3DQZA 2VQDA 2WUEA 2ATIA 1E0DA 4OB7A 3QVGA 3LA8A 4D8YA 1F0YA 1FLAA 2MU1A 3IUPA 3EA5A 4GKBA 3EIOA 1TIPA 3CRVA 3OKPA 4TWAA 2BT4A 4ZAXA 5AW8A 3JZMA 4WK4B 4NCBA 3QWIA 3W5AA 2G4VA 3DHEA 4FSXA 5I7UA 3I9V6 2WD7A 1WV0A 1O97C 3A4IA 3NANA 5K3DA 2OMEA 1LDNA 3U1BA 3RF7A 4GLJA 2ILTA 5BWCA 1CERA 3SJZA 5GP1A 2X7HA 3U48A 4XFJA 5HFNA 4RTQA 4YIKA 1KEVA 3SE7A 2WC1A 3HYTA 2O2HA 2FEWB 5H83A 3O9MA 2YZ2A 4B4WA 3M1YA 1HBJA 4YCAA 2B4TO 3QFHA 4MGKR 1RRFA 3VR6H 4WPGA 5K6TA 2XCTB 1QV9A 2ZB3A 3Q6IA 1GRVA 3F2IA 2QUIA 3TVYA 2EG5A 3I2YX 1QE5A 1CUGA 5F4ZA 1AO3A 1ZR4A 4M0CA 4MPJA 2DSTA 4TUYA 2AZ4A 2PG3A 1K2WA 3DCYA 4HLQB 4EPVA 5BVGB 4G1EB 1UPUA 4IIJF 5I9TA 1IUKA 1T25A 3VAYA 1NF9A 5BMVF 4Y6OA 3S2SA 1BAPA 4NSNA