2PZFA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
224
Chain Sequence
SLTTTEVVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 73
structure length 224
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzfA00
1IXRC 4HZIA 4M9SA 2Z83A 3CX7A 1VHTA 4KODA 1DAKA 3BFXA 1OHHA 2QY9A 2FEMA 2NGRA 4XVQA 5KPJA 3GMTA 4CEHB 4QFMA 2BV3A 1XEWX 5ANRB 1T8UA 3GLHB 3LNCA 4B3XA 1TQ4A 1VIYA 2REOA 2AXPA 2QU8A 3OAAD 1EWRA 4QG7A 3FGNA 3Q85A 4C0HA 1IJEA 1XP8A 3QXHA 4GL2A 1RRPA 3EWSA 2A2ZA 4Q02A 4OL0A 3AUYA 4IKEA 2W0SA 1ETUA 2PH1A 4O0MA 4UJ5A 4POAA 2JATA 1F48A 1ZP6A 4B3CA 5E7JA 4PQYA 4I81A 1XZQA 2DHRA 4LZZA 3DM9B 1GKIA 3ND9A 1G7SA 2IC5A 2DFKB 3FHOA 5UKDA 2IYZA 3T1QA 4F93B 3U7EB 1T3LA 1WDTA 3WRYC 4GBMA 4FWTA 2ZRJA 2DFLA 2Q3MA 4CDGA 5AJWA 3EC1A 2CDNA 2ZRAA 4F4JA 2QPTA 2FF7A 4BFYA 2R6GA 4C0QC 3RAPR 2A9KA 1XEWY 2WJVA 1W36D 3WBJA 2ZSAA 2W6ID 3KJHA 1GL7A 1ZM2A 3IILA 1RJ9A 4M1OA 1MR3F 2WJYA 3LFUA 2C9OA 1N0UA 1UAAA 3AVQA 4OI2A 3K70C 2CXXA 2QTFA 3H1TA 3HPRA 1NKSA 1N0VC 1Z29A 2OXRA 2PT5A 3Q9LA 2R6AA 5CLLA 1E4YA 2GKSA 4W5WA 4B34A 1RJ9B 4P3YA 3GQBA 1F2UA 4GDFA 3KUCA 3R9XA 2UVQA 4EKDA 3DKPA 4HATA 2RGCA 4AY2A 2EU8A 1EGAA 4AG6A 4M4SA 3LV8A 4IW3B 4WZBE 5FR2A 4J0QA 4QGAA 4V0MA 5JFGA 2GAAA 5A4JA 1XTIA 2FFBA 2QAGB 4TN1A 4TLDA 3BAFA 5E4FA 4Q1AA 1EWQA 2YOHA 4DBLC 1CXZA 4E22A 1XFAA 4JT4A 2WMNB 2A30A 2CMKA 5JWHA 1H8EA 1JAIA 1GTVA 3AGQA 3GJ6A 1BYIA 3EA5A 4AG5A 2QMOA 4MYTA 3D31A 4DSTA 4EQ6A 1Z83A 1S9HA 2ZPTX 1XRJA 3LW7A 4JL5A 4GPTA 5AUNB 2H7VA 3OFND 1SXJB 2FH5B 2WJJA 3IGFA 2RCNA 4P4UA 3TUIC 1CJKC 2WJIA 5TARA 2P5TB 3U7FB 1R10A 2GWHA 5H8WA 3SBDA 2OHFA 2AFIE 2J5XA 1G16A 4PO1A 1ZD1A 3GLFB 1G7TA 2V7QA 4PPGA 4RVCA 4AK9A 1E2LA 4ZDJA 4ZV4A 1N5IA 2RGNA 2J7KA 3KKNA 2R6FA 4K8OA 2J41A 1T3SA 2PMDA 1U81A 3G0HA 5HE8A 4EPWA 2QTHA 3V4FA 1HT2E 3G5UA 1P73A 4K81B 3X1XA 1WCV1 1R0YA 1RKBA 2ZUBA 4OQLA 4HB0A 2ZJBA 1EFTA 4H9GA 4F4IA 3W6OA 2WAXA 1Q44A 4C3ZA 3B5JA 4CZ2A 4XWAA 1IOZA 3QBVA 1G21E 2JLSA 1U94A 1X3SA 4PC3A 2ZRFA 2ZXUA 1VG1A 5CB8A 2JLYA 3P4XA 2NQ2C 2J0UA 5JS7A 2F43B 3AVOA 5H1YA 2QBYB 2WIAA 3H0KA 1YJ5A 4Q4HB 1EXMA 2ZSEA 4Q18A 4MKIA 2FGJA 1UM8A 2J45A 1F5NA 3EASA 4FXPA 1UBEA 5CB6A 2WAYA 1E9SA 4MKHA 3T34A 2L0XA 4B3DA 4MYUA 5ELXA 3D3QA 3BFKA 3AVYA 4B44A 1PLLA 2NMVA 4Q4JB 4HLUA 4XOIA 4QJ4A 1P2TA 1R6BX 3DM5A 2VP0A 3ICQB 2DWPA 4HYYA 1G8HA 4JSYA 1YR8A 3CZPA 1YR6A 3FOZA 3SBEA 1PZNA 4IOKA 3RC3A 4DZZA 4DVGA 4YXWA 1SVKA 2IYXA 2YYZA 5GADl 4A6XA 4WOPA 2IWHA 3A6PC 3RANA 3SJBA 2PLFA 1VCOA 2JCSA 3IBGA 3SQXA 2H57A 3IIMA 5E7IA 1SXJA 3MD0A 2GVZC 3HDTA 4B3GA 4G0NA 2IL1A 1GG2A 4RFVA 4V03A 5A5GA 5AJYA 1DAIA 5DISB 4FMCB 4EQ6B 4FWIB 2QSYA 4CEIA 4CT4B 1KNXA 2MSCB 1AZSC 2R62A 2NO7A 4TL7A 3REGA 3RABA 1ZUHA 3CF6R 4HAYA 4MKGA 1JNYA 4QHYA 4F38A 4LBZA 1B23P 4QC2A 1YZNA 4OI1A 3ZZTA 2PX0A 1HTWA 1W49A 1P3JA 1P9RA 1J90A 5KPDA 1OT3A 1ZD9A 4OBEA 3SDZA 5C18A 4QGGA 3WP1B 5JCPA 3GJ7A 3A36A 1WB9A 3IHLA 1IQPA 1U90A 3UG6A 3K0FB 1VDZA 2VHTA 1FFHA 1FP6A 3M6AA 4Q9LA 1JJ7A 2CLDX 1T91A 5FL7D 4QXAA 3EPLA 1MT0A 3EWAA 1XD8A 2ODNA 4OKSA 3TGPA 1VCIA 3LY5A 4OHWA 3CH4B 1UDWA 5CYPA 2ZAOA 2R8RA 3AKYA 2QMHA 3X1YA 1ZD8A 5AJZA 1Z2CA 5EQTA 2F6RA 2QTVB 3ADCA 4Q7LA 2JLQA 4XTRA 5J5CA 1CRPA 4JVMA 1RFLA 3GJ3A 1G4AE 2FU5C 1OB5A 2VQSA 2W6JA 4Q4JA 3BXZA 3W6PA 2GDJA 4B74A 4EPXA 1YRBA 2DPXA 1SVOA 5KNCA 4TMVA 3RS3A 5KO2A 3UPUA 3SC3A 1YU9A 3TAHA 1HA3A 4AC9A 4QM7A 5L3QA 3K0SA 2GEUA 3ZVLA 1OE0A 4HAXA 4O2RA 2X77A 3Q5DA 4LX0A 5TV2A 2ZR7A 1TADA 2ZRNA 3VR2A 1WE2A 4RD3A 1DE0A 1UEJA 3AF3A 1G291 4KSBA 1JJVA 1WXQA 2F7SA 1S1MA 1SKYE 3WMEA 1SKYB 1N6KA 3AF1A 2HXSA 2O8CA 3EX7C 4EDHA 1VCMA 3PUVA 3OE7D 2HV8A 1Z0DA 2WWGA 1TUEA 1GL6A 1WBDA 5JSZB 4ASUA 1FQKA 2EFDB 2AFHE 3WYFA 2V9PA 5EXPA 3BORA 2FZLA 2O8BB 2BEKA 1EFCA 1UKYA 2OILA 3QXJA 4Z8XA 4XWKA 1SVLA 2RGXA 3X1WA 4HAUA 3I92A 3IO3A 4Q01A 2C77A 2VSOA 3TQFA 1N5KA 3RSOA 4DSUA 2NZJA 3MJRA 1XJQA 5IHPA 3A1VA 4Q1FA 1Z0JA 1K5DA 2PMKA 5H68A 2FPMA 3AKDA 4PR0A 4RJLA 3U7HB 5IK2A 2D74A 1GL9B 4HAVA 3U3KA 1U0JA 2B6HA 4YXWD 2Q0HA 4BFUA 3QF4B 3K8YA 5FPSA 4TYNA 5AJVB 4LV6A 4OQNA 3MSXA 1TTTA 3SJZA 1FX0A 1BMFA 2ZYWX 3GLGA 2JLZA 2AXNA 3W5JA 1EFHA 1LS6A 4XVRA 4DSOA 4BZQA 1OXSC 1T0JB 4C0BA 1II0A 4KLZA 4BFZA 5FOVA 2UZ3A 2ZJOA 1E2DA 1W0KA 2GF0A 3BFVA 4ZCIA 1KO5A 3VX3A 4WXPA 3RWMB 1ZUNB 2OFWA 4MYHA 3NBYC 3QXXA 1KKLA 2WTUA 1C4OA 2ZE6A 3CF2A 1KMQA 2ANBA 5DNYB 4PPFA 2CCJA 3L82B 5FFMA 4BFVA 4HUQA 4D82A 1TU3A 4PFSA 1OH6A 3B6EA 5LD2B 5TXGA 1N6PA 4P33A 4DLSA 1CIPA 4DLRA 2YKGA 4TLCA 1KAGA 2VSFA 1KJWA 1XNJA 3LH5A 4E03A 3NDBB 1W36B 1US8B 4RFSA 3E5HA 4DT1A 3HU1A 2YOGA 4EFNA 4OQFA 5BN5A 4LWZA 5C2JB 1JAHA 2IS4A 4Z1MD 4B75A 2QL6A 5JI3E 1Q1EA 3LRPA 3PCRB 1Z5ZA 4LSGA 2HT1A 2JJ2A 3PUWA 1D2EA 2HF8A 3A58B 5FUYA 1OIXA 1R8QA 2GK7A 2GJ9A 3N2IA 3UMSA 3THXB 4DB2A 1KSFX 3C41J 2BHRA 4JLOA 5FTMA 3L0OA 5LB4A 1ELOA 1YQTA 3KB1A 5B64A 1FW6A 4LJYA 3B2EA 3AVPA 1GOTA 1SVMA 2B8TA 5EXTA 2O8BA 5B30A 5KOYA 3U44B 2V6JA 2GJAA 5FPYA 4XSHA 5HE9A 1G1MA 2A7QA 1WP9A 3CPJB 3OEEA 4Q19A 3O8CA 4KFUA 4NCIA 621PA 4MDFA 4OHZA 1SHKA 2IYUA 3GLIB 3VR3A 3O8DA 4I1VA 3TSZA 2OZEA 2O0HA 3U4QB 5BW8A 4M1WA 3QKSA 2GEVA 5FOTA 4LJ5A 2FOLA 2ZUDA 1E2FA 3FMIA 3W6NA 1AQUA 1N3BA 2J7PD 4GT1A 2VYFA 3D6TB 4NHOA 1KI1A 3TBKA 1W46A 3CX8A 4MGIR 4NU0A 4TMTA 3BWDD 4Q4AA 2RKOA 3K70B 3A37A 1ODFA 5L3QB 1P9NA 1H8ED 2ZREA 3TK1A 3NVAA 5BN3A 4IEEA 1E1QD 2G83A 3LVQE 4C7OB 1JPNA 1TF7A 1V43A 2J3EA 4BECA 1Z22A 4BASA 1GP2A 1T5IA 3MWYW 1E2PA 3T35A 4DCSA 2VHCA 3M0EA 2VP6A 2WWHA 2ODEA 3UXMA 4LPSA 3OFNA 3L8ZA 1CJTC 4NCNA 1VG9B 3AF0A 2IF2A 1W4AA 2WWWA 3EZ2A 2QGNA 4YLGA 2CHVA 1P2UA 5K8UA 4US1R 1VIAA 1IY2A 1TX4B 2VP4A 3CZQA 4TT3A 1D2MA 4B2IA 1SXJD 2CHGA 1U9IC 4DEYA 1NKTA 4KI0A 4DIEA 3SNHA 1UADA 3ICEA 5EXSA 4V0LA 5BWMA 2FNAA 2P65A 2VP5A 3MG9A 3PXGA 3UANA 1Z8FA 1A5TA 4B3FX 1II9A 1EESA 2GXAA 4Q9JA 3ZS8A 1OKKA 4GOKA 3BB3A 2NO1A 1L4YA 1NSTA 2GCNA 4N1AA 1KO4A 4BLTA 1ZIPA 1Q20A 2ZM5A 2XZOA 2ERXA 4FMCF 3U3RA 1UKVY 5EUQB 2Z43A 3CIOA 5DHAA 5TY0A 3W3ZB 1J8YF 4BZPA 2IW3A 2CLCX 4II7A 3K0AA 5B57C 3A8TA 1CR4A 1QVRA 1FNMA 2CE2X 4IDQA 4IOMA 4XSGA 5FOSA 3WMFA 5J4HA 4OQXA 4TTRA 2ZYTX 2FEOA 3DOFA 1CR0A 1E1RD 2ODWA 5GVSA 1KI9A 1VYTA 1XCGB 1MV5A 1TAGA 4LJ6A 4C2UA 1LNZA 1U0LA 2Z5FA 1I4TD 4JLDA 3FHTA 2QMUA 1ZAKA 1M7BA 3PFIA 2RGDA 2BMFA 2E87A 2WSMA 1BO6A 1W2HA 1AIPA 3LO5A 1WMSA 2OE2A 3U3JA 3HWSA 1UBCA 1DAHA 1NVVR 2KBFA 4IDPA 3ETLA 2HF9A 2IYYA 4URUR 1OPXA 2V6IA 4B48A 3VKHA 2LCFA 4JYCA 4RCZA 5JI2E 1W0JD 3WBKA 5IRCD 4BWYA 3RRZA 3SHWA 4QKQA 1N25A 3TUJC 2P2LA 2XTMA 1XEXB 2G1JA 1GILA 1FQJA 4M1SA 3BD9A 4ESHA 2ZE7A 3CWZA 2PL3A 3VHLB 121PA 4F4CA 2FN4A 2XTZA 1X86B 3F5FA 3TAUA 4W7SA 4X8OA 1DO2A 2RH5A 1DVRA 1MO6A 3RHFA 1Z3IX 2K5UA 2F9MA 3DMDA 1LFDB 1W2GA 5FI0B 2OCYC 4TMWA 4CVNA 3U4QA 1NVUQ 4CT5A 3MGCA 2EFCB 3SJAA 3IQWA 1LS1A 3WMGA 1MO4A 1W4RA 3LDAA 4EUNA 1CRQA 1HURA 1KGDA 3S1AA 1MRNA 1RRFA 1KI8A 1X8JA 3U5ZB 4R98A 4KYIB 1LV7A 2J7PA 4DUGD 1H8HD 3FTQA 4G5QA 1DG3A 2GVDC 3ZYCA 5DO9A 4PX9A 4EFLA 3PENA 2RHDA 1VTKA 3CRVA 4BLOA 3FKSD 1FL9A 4G5GA 1P4SA 2YWHA 3K9LA 3A1UA 2HLDD 3WRXC 1I4LD 1GZSA 4QRHA 5CK5A 2WVJA 1TF2A 2GCOA 2QPAA 5FOWA 4HEJA 1J8MF 1OFTA 3ZLJA 2MSEB 4QGFA 3SYNA 2GJSA 4A4DA 2OG2A 4C0KA 1H65A 4IFBA 4TYYA 4QBFA 1E2JA 4U00A 4IVPA 4TLBA 1EK0A 1Z6AA 4DXAA 2QENA 4G1UC 4M22A 3QKRB 4UXHA 3HJNA 3QENA 4RY2A 1W4BA 4IVQA 4JSTA 4MH0R 1EX7A 4FN5A 3PEYA 4E09A 1OYYA 1YZGA 2RGAA 4LYFA 3ZVNA 4RSGA 2AL7A 1UPTA 2DCUA 4P31A 3THYB 2XOKA 3BRWD 2CNWA 4KHZA 4HB4A 3VMFA 2QBYA 4TZ6A 3BERA 1AA9A 3ECCA 3QJYA 3L0IB 4LYJA 1M1YE 1XMVA 2QE7D 3C16C 3QI2A 1ZNYA 1XEXA 2I3BA 1N5JA 1KDRA 1OXTA 1Q22A 1SGWA 2OUKA 5CIQA 2W2VA 1S9DA 5B58C 1AJEA 2J9RA 3GFOA 2XNDD 2QPOA 3GLIE 1BOFA 4HZUA 4AKEA 1XB2A 4P4SB 2GBLC 4PXAA 1HUQA 2DWOA 4Q7MB 2XXAA 1HH4A 1OJLA 4ARZA 3K9GA 2O8FB 2CJWB 4DLZA 2XB2A 4OI4A 4TYQA 4XD7A 4Q48A 1G7RA 1C9KA 1L4UA 1SVSA 2FFAA 3W8RA 2FE4A 4QHSA 1GIAA 3J81k 4GRAA 4OHVA 3KXLA 5J4KA 3F3YA 2VLIA 1QHNA 1U99A 5JZVA 3KDSE 1G20E 4KCGA 4BLSA 2GXUA 4IDOA 1II8A 2AKAB 5JJKA 3K0FA 3TLXA 2VHUA 4B76A 2PJRA 2ZSDA 4HLCA 4FMDB 1LTQA 3THOA 4L9SA 2ZJ5A 2RHMA 4NPHA 3IKJA 2HJGA 2X2FA 4ZDIA 3AEZA 4YC7A 2GILA 1XPOA 3F0TA 3T06B 3OEED 2ZSFA 3LXXA 3PIRA 4JLNA 3EPKA 3GEEA 5F3WB 2O0JA 2PBRA 1XTRA 3ND8A 1COWA 4BFSA 1K5GA 2A78A 2IXGA 3A1TA 1JXMA 1UDXA 1K6MA 2D2FA 3A4NA 4NYJQ 4C9BA 1NP6A 1S0UA 3DHWC 4ERNA 4LBYA 4PZZA 3RLFA 3BB1A 2OBMA 2IX3A 2JGNA 4US2R 2EW1A 4UNQA 5JJLA 2IYVA 4MRSA 2MSDB 1NNEA 4JJKA 4WZAE 2VBCA 1UF9A 3TR0A 2CVHA 3QKTA 1VCNA 2QUZA 2HXYA 2EVWX 2PX3A 3MCAA 2XXAB 2QRZA 5BXQC 1OHHD 3DVLA 5CDFE 3ZQ6A 4EJSC 2VRWA 1GITA 2JJ1A 3BB4A 5AR1A 1NLYA 1N6NA 4G5SA 5EZ6B 4BLRA 5KNDA 3LQQA 1E79D 4M21A 3KB2A 3TR5A 3DZDA 5G53C 3FKSA 3KQUA 1SZPA 3KTAB 4ACAA 2ZJ8A 4PQRA 3SE0A 4QNMA 4LV5B 4RD2A 4KVAA 1E2EA 3SZRA 2PLRA 4Q4HA 2BBSA 2CK3D 3I8XA 4FCWA 4TL8A 1G3MA 2IUTA 5EUMA 3FMPB 1X8LA 4A36A 5CJ2A 1BS1A 3SYKA 4NDZA 5H70A 1XMJA 3SHFA 4L16A 2EQBA 2WPDD 1IJFA 4PSAA 5KSPA 3CH5A 2LWIA 1XTQA 3ASYA 4M8NE 5KSZA 1NSFA 1R5OA 2VO1A 5M04A 3AF2A 2O52A 2IF0A 1KOFA 4RFSB 2EYUA 3C5CA 3MWJA 1P62B 1AGPA 4Q9IA 4DLWA 1IN5A 1GNRA 1F2TB 1E1RA 1E0AA 1GAJA 3DZ8A 5G41A 1RVDA 1OF1A 1XX6A 3GD7A 4EPYA 5FPHA 5F2EA 4ZIRA 3HP1A 4DCNA 4WAUA 3LX8A 3NIBA 4ILEA 4JLKA 3ASZA 1E4VA 4CW7A 4BEBA 1BKDR 5FPTA 2AN9A 3UIEA 2JLVA 2IXFA 2Q6TA 1NIPA 2WWIA 1Z6XA 2PZGA 2GTPA 3M1IA 4IHQA 1W44A 1DADA 2XITA 2RGNC 2RMKA 3Q72A 5LPNA 2PT7A 3DDCA 1KO1A 1Q0UA 1SXJE 1M74A 4HUQB 4NMMA 4KSCA 3K70D 1E2HA 5CDFA 1KK1A 3R7WB 1YZQA 1N0WA 4DLYA 1HT1E 4KBFA 1WBBA 1XF9A 2W6IA 1E69A 2R65A 2F1RA 2OBLA 4C0AC 1MO3A 2ZRLA 3I5XA 1UJ2A 4JLAA 4BRUA 4JYBA 4X8HA 4NCJA 3ZZ0A 3BIFA 1NN1A 3DOEA 3ZGXA 4D0GA 4EPRA 2X1VA 3QPUA 2WBLC 1JXOA 4B73A 2QEQA 4QM6A 4MYCA 3U3MA 3NEJA 3QVUA 1W1WA 2YC4C 4CEJA 4G5RA 4QHTA 3CNNA 2NTYC 3LBHA 4IRUB 4QBIA 3CKLA 2CNWD 3I62A 1DG1G 1DTSA 1EG7A 1OIWA 3D8BA 2VPPA 2VEDA 3P32A 1IONA 1H8HA 1A1VA 4D25A 1KZGB 3R9IA 1L8QA 2X19A 4Q1BA 3KX2A 2GHIA 4YMTA 3KQNA 2GETA 2MMGA 4PAQA 2C78A 2JDIA 3WHLA 2ZRGA 1Z28A 2LKDA 4QJ3A 3DL0A 1DARA 1TNDA 5DSZA 3FE2A 2NG1A 3KXKA 1G41A 4QL3A 4MDEA 1AKYA 4PQFA 4LJ8A 4V0ME 2CCKA 3I8SA 4HLUC 2ZRHA 1P72A 5JEDA 3REFA 2KBEA 4V0KA 4D0NA 3LWNA 1XXHB 2W0MA 1VMAA 2V4ZA 2XGJA 4UNPA 1CJMA 1E79A 3QEJA 3QXCA 2BJWA 1QG2A 4NH0A 2YV5A 4M1YA 5SZIA 2ZJYA 5AUOB 3NDPA 3TVTA 1G9XA 1E32A 4ZIRB 1GNPA 4WZ6A 1TU4A 1VPLA 1DPFA 3Q7QA 1CR2A 4RKFA 1V5WA 5EE9A 3PITA 1TEXA 421PA 1OLOA 2V54A 2ZRIA 1Q21A 2A5JA 3OIUA 4BE7B 4JKYA 5LB2A 1Z07A 2FA9A 1J99A 2BMDA 1Y3AA 2W6JD 2O8EA 1E2NA 1NN0A 1XDBA 2Q9CA 3SN6A 3QF7A 2O8DB 4NYJR 4YMVA 5JBQA 1R7RA 2OAP1 2ZAMA 4KFSA 4LHYA 3MUFA 4O25A 4UXIA 2A5FA 4WW0A 1G3UA 3S1AB 2YVUA 5FTLA 1E99A 4HLQB 4BFWA 1KTVA 4Y0VA 1KZ7B 3OEHD 2XJ4A 2ZUCA 1KI4A 1FMJA 4P0TA 4HDQB 4Q00A 3CLVA 3QG1A 2VF8A 1G8PA 1E9EA 1LVGA 2QP4A 2GRJA 4FMBB 4ZO4A 4W5HA 1S4QA 4Q03A 3OHMA 4B47A 4A82A 5JS8A 3NEYA 4PANA 4TYPA 2W2XA 4GSYA 1WA5A 1UBGA 3CRMA 1FNNA 4F7WA 3VNUA 4NBSA 3NH9A 2A5GA 3QKSB 4D2IA 3OE7A 4JBXA 2GF9A 3OESA 3ONWA 3U6BA 1NLFA 2W00A 2VP9A 5HTKA 2EWVA 2G0TA 1YZUA 2JASA 3NG1A 4U5XA 3L0PA 3CPHA 4YDHB 5K8TA 3P4YA 4N3NA 4EAQA 1NY5A 2JJ1D 2QT1A 1MKYA 1IN4A 4LHXA 2JA1A 5FL7A 5CM8B 4D81A 1QG4A 2G1KA 1GRNA 4NKRA 1HEIA 1G3RA 2C9CA 2GAOA 2MMCA 2FGKA 4TMZA 3VR6A 2QSZA 2FMXA 1A82A 4Q21A 3QNUA 1KDTA 2H16A 2WWXA 4Q7JB 1E9CA 3IEUA 3SYLA 3OZXA 3MWLA 1OSNA 4JJZA 2BVNA 4MA4A 2PEZA 5KSYA 3QXSA 4WVFA 1QDEA 3BH7A 3LX5A 1TL7C 4LJ9A 2XX3A 521PA 2ZIAA 4R9UC 5J47A 1ZNWA 1G5RA 1VHLA 2WPDA 2D7CA 2GZAA 2R9VA 3LW8A 4DT1B 3FB4A 3ZVMA 2ASEA 4RZ2A 5L8VA 1VKJA 2BWJA 4LGMA 3U2QA 4BUJA 4YONB 2ZS7A 2QAJA 4NCKA 1U8ZA 2IBMA 2WICA 5L3VA 3BBPA 4Q1DA 4C0LA 2QAGC 1HV8A 2B92A 4XTCS 4IDNA 1GNQA 2ZRMA 3N2EA 2CVFA 3IHWA 3H84A 1JEEA 3CBQA 3VFDA 5JEEA 4B43A 3K9NA 3UWKA 4M2LA 4JLVA 1P7CA 2ZSBA 3GJ0A 3T1TA 4AYWA 1PLKA 3MLEA 2HYDA 4TTPA 1JB1A 5KUTA 5DYGA 4QBHA 3NH6A 1SVIA 3B60A 1YZTA 4XJXA 3VR1A 3W5IA 2J0QA 2XSZA 2BOVA 2IS6A 4URVR 2WZQA 4UNSA 2V3CC 3SFVA 5G40A 3QPWA 2AHOA 3CR8A 1NN5A 1BYUA 3VX4A 2JIZA 1AS2A 2CLSA 5HCIA 1BH2A 4M1MA 2IEYA 3CNOA 4I1OA 1EFRA 3IBYA 3TUZC 5DIFA 4L8GA 3MMPA 1GDDA 4B6FA 1OB2A 2FWRA 1XTKA 2QN6A 2HYIC 1ZJ6A 3E1SA 3TW4A 4N0DA 3C15C 2QA5A 3WNDA 4EPTA 1QHSA 1NL3A 2J87A 5IF9A 5L3RA 2CHQA 3EARA 4X8LA 3AF4A 5FPKA 1CBUA 1N2CE 3KZ1E 1W7AA 1U2RA 3H2YA 2IUUA 2BMJA 2KE5A 5FUXA 4TMKA 3Q3JB 1X1SA 2GZDA 1N6LA 2ZI6A 3TQCA 1GSIA 2C96A 5KSOA 2JLXA 2W2TA 1CKEA 3RWOA 1SULA 3K09C 2Z6VA 1HE8B 4GOXA 4HB2A 3KUDA 1G64A 2Z4RA 3LD9A 2BKUA 4Q66C 2IYWA 3FMOB 3V9PA 5KHOC 2IYTA 2C99A 1XPUA 3T61A 2ONKA 3ADKA 4KAXA 3WNCA 4RD6A 1OIVA 2NIPA 3Q7PA 1GFIA 2R6CA 1DBSA 5CLQA 3SFZA 1IN7A 4FCTA 1FZQA 5DYIA 4ABYA 1MH1A 2NZ8A 1MABB 4HSEA 4PHGA 1YE8A 4XWOA 4LPKA 4KLNA 3KJGA 5A0FA 1G17A 1RYFA 5E95A 4BFTA 3I61A 4C7OA 1KI6A 1IBRA 5G3YA 4ZCLA 1TEVA 2I1QA 2J0VA 1YVDA 5K8LA 2WSSD 3TIFA 2DY1A 1G6HA 4HDOB 3CX6A 1NG9A 4X8MA 3EG5A 3SI7A 1QVAA 4M9XA 2ZS8A 2ZQ5A 3QKUA 3PV0A 1XTSA 3C8UA 2REBA 2HT6A 1QHHA 2BCGY 2FSIA 4N0EA 2FV8A 2WIBA 5GJCA 3C7KA 1AK2A 2ERYA 1QHIA 3PUYA 1EFUA 1A2BA 2NO9A 3BC1A 4WBSA 4EPVA 3TNFA 2C03A 2XJ9A 3CRRA 2ZR0A 3QIAA 4ACBA 821PA 3B1XA 5HPYB 4URZR 1Z0IA 2AWNA 4OHYA 3LLMA 2RGBA 3HU2A 1P2VA 4OJKA 1X1RA 4Q1CA 2O0KA 3T1OA 3UATA 5JLJA 4DDWA 4DLVA 2NO0A 1U9IA 3FWYA 4B32A 2NPIA 4TYWA 4IFEA 2Z4SA 1R2QA 1DEKA 1AKEA 1B0UA 1KAOA 1G5PA 4TQAA 4A0FA 2ZITA 4DLXA 3HR8A 5KU1A 4PHFA 3B8HA 2WKRA 2EFGA 3KJEA 3NKVA 2O5VA 5JRZA 4O3MA 1QF9A 3UWOA 2JJ2D 3AVUA 5FBQB 2FJUA 2IS1A 3OIWA 5SZHB 5KDOA 1JQLB 3CM0A 1U98A 2N42A 3IIJA 1ZMXA 1P60A 3AKCA 4TQUS 3C5HA 3EPJA 5BYKA 4TZ0A 5BN4A 3B1YA 2CCGA 2OBNA 4GZLA 2J0SA 4AYXA 3Q8XB 3CR7A 2F9LA 1WF3A 1TQ6A 3DEFA 4ON9A 3CUEF 3UG7A 3RS7A 1KI2A 4QBGB 2GZHA 1M7HA 5K8IA 1P2SA 2YJTD 3AB3A 2OSBA 1ZM3A 2KB0A 1Z6TA 1HQCA 3OEHA 4KFRA 4AYTA 3QVVA 2P67A 5BQ5A 4A92A 1KJYA 1II8B 3U61B 2F1JA 4AKGA 1LF0A 3PEVA 4BLQA 2YHSA 1OH8A 2D3WA 5EP4A 2ORIA 4DKXA 2OAQ1 1U8YA 2OFOA 1JR3D 4TQ9A 3Q5EA 4C4PA 1IN6A 3EXAA 1XMIA 1P5ZB 2QROA 4GMDA 4BLPA 2AK3A 2NOAA 1E0JA 2XNSA 4TTQA 2DWQA 1ZM9A 2B8WA 2R6DA 2HDNB 2IYQA 3LA6A 3AM1A 1E6CA 3SS8A 4A8JB 2Q3FA 2G6BA 3O8RA 4DSNA 5SZKB 3WYGA 3AUXA 4KFTA 3A4LA 3MAAC 1L2TA 1VYUA 2ZVQX 2ZI9A 4FINA 2H5EA 2A5YB 2WJHA 2VP2A 4E07A 1ZU5A 2YWGA 3P26A 1IY0A 3AGPA 4FI3C 3AKEA 3RSLA 2F3RA 1PJRA 3B85A 4OYHA 4B33A 3I4LA 5EZ5A 2D62A 5KNBA 1DAMA 1Y63A 4GFDA 1FUKA 2HLDA 3CRW1 1ZVQA 4B2LA 3TRFA 2ZYUX 2F3TA 4JS0A 1ESMA 2AR7A 3EZ7A 2TMKA 1LF5A 2DBYA 3GFPA 3PVSA 2ZU6A 3N70A 1RRGA 3EZ6A 4MRRA 1OFHA 1M6NA 2HJVA 1N6IA 3CNLA 1GKYA 1XU4A 3ZS9A 4ZPXA 2WWFA 2G77B 2P6NA 4M9ZA 3P27A 1XJ0A 1RE0A 1NRJB 2REXB 3FVQA 2WSSA 1YRAA 1YZKA 1Z0KA 1OFIA 1T3HA 2IA5A 4KV9A 3W8NA 1RRCA 2JLRA 4CYMA 1KY3A 2A3RA 2WHXA 1QHGA 3KQHA 3C4JA 4NYMR 1G18A 4FMDF 4UJ3A 4LJ4A 4CEJB 2E9SA 1N6RA 2ZI7A 3EIHA 4LRWA 4OHXA 2AWOA 4EFMA 2YINC 4QOSA 1KMHB 4WA7A 2LKCA 2FX3A 1IXZA 1E3MA 3VTKA 2V1XA 1OV4A 1UEIA 4UQOA 4L15A 1NVVQ 2W83A 4B35A 2QI9C 2G88A 1I2MA 1NJFA 2FFHA 5D3QA 5HR5A 2BBTA 1NG1A 4NE2A 3VKGA 4YMUA 1JALA 3K1JA 2BBOA 2C98A 2W58A 3OF5A 2XSZD 4DB4A 4ZKEA 4A15A 2PCLA 3A4MA 2QT0A 3EZFA 4I1UA 3CW2A 5JJIA 1SQ5A 4DDUA 4ITRC 4XIGS 4GOJA 1ZCBA 2PJZA 3RS2A 4PPQA 3FDIA 4BPBA 2JIZD 3X1ZA 4JVNA 2P5SA 1JECA 1XBTA 1XCPA 1XTJA 3AH8A 5CM9C 1IN8A 2H18A 4GZMA 5FTNA 2V1UA 2IYSA 4BZXA 4D4LA 8OHMA 4LJAA 4F91B 4DEXA 4BFXA 2ATVA 3WNBA 1D5CA 4DDVA 3KFXA 4RZ3A 4RD4A 4AWXA 3THWB 1Z0AA 4Q7KA 1NN3A 2X8AA 3NHBA 3PEUA 5BYJA 1YKSA 1JEDA 2BKEA 4LCBA 1NMZA 4I1SA 1JR3E 3RRNA 2GESA 1KJZA 1DS6A 1MABA 4IXMA 2F1IA 2BM0A 2KJQA 2IEZA 3PR1A 3ZIAD 1X8KA 2CEAA 1E9DA 3IQXA 2WV9A 3GCGA 5FTKA 1E9RA 2DFTA 5JMTA 5L3SA 2XAUA 1E2GA 1P6XA 1IAQA 3QSYA 4TSFA 3QY0A 1CP2A 3FPAA 2EFEB 4BRWA 5D3MB 2BCJQ 3GEIA 3K9HA 1E9BA 1ZINA 4JLJA 3CRQA 4LUCA 3VU9B 5HZKA 2KSQA 3B1ZA 4DCVA 2CE7A 4L9WA 4I4LA 1CF4A 1RYHA 1XWIA 3JVUA 1F3OA 2XB4A 1PVOA 2QE7A 2J59A 3RC8A 1Q1ZA 1E0SA 1OYWA 2J46A 2ORWA 3LBIA 2CL0X 4JKIA 1NJGA 4KU4A 2YC2C 5DE3A 5EE0A 3VR5A 3U6KA 3NWJA 4UKDA 4D80A 3K0AB 4I99A 2IK8A 1IM2A 1K8RA 3HU3A 3FHCB 4IDHA 4LHZA 4M53A 4A0RA 2ECKA 1DOAA 2AKYA 1YR9A 1OH7A 2RGEA 4JVSB 4LJ7A 4PSVA 1G8GA 3IUYA 2JEOA 1WQ1R 4URYR 721PA 4NONA 3BH6A 1J2JA 1XD9A 4MGZR 2ZRCA 3BOSA 2CL6X 4QGHA 5J4VA 5IDVA 3W90A 3VR4A 5DI3B 5LDDC 1ZIOA 1TUIA 4D26A 4C0JA 4NP6A 1ZM7A 2B21A 5C4GB 3A1SA 1XD2A 2ZS9A 4NL4H 2GXQA 1HE1C 1C1YA 3EW9A 4DLUA 4GI7A 2VSXA 4PZLA 3AV0B 5DN6A 4NZYA 3L2OB 2XEXA 2RGGA 1S3GA 4PHHA 3FMFA 3NC1C 5AUQA 3QEOA 2QAGA 4FW9A 2WM9B 1S1CA 3PQCA 2H8KA 3BH0A 1CS4C 3IDQA 4NTZA 2EWWA 4G01B 3GFTA 3GLFE 4MRNA 3KXIA 2I4IA 4B71A 4P32A 4A2QA 4JIMA 2Q9AA 2ZYVX 2IWRA 5JHGB 1E2MA 3U3OA 2OCAA 3VU9A 1Q12A 3ZVRA 1CULC 5FUVA 2A5DA 1Q1QA 3NC0C 2D4HA 4LYAA 2VHQA 2HEIA 1OH5A 2FDCA 2OM2A 3GJXC 1W48A 3O47A 4QNRA 5EP1A 4KYUA 2QQ0A 3RS4A 1A2KC 2ZRKA 4A0HA 4Z54A 3GPLA 4A2WA 4PHTA 4PC2A 2OEPA 1QRAA 3NBXX 4W5JA 4ASUD 1G4UR 3GLGE 2FZ4A 2KI5A 2IHBA 4DCUA 3F8TA 3CPEA 1HY3A 3HYTA 3JZMA 3I3SR 3GJ5A 4JBYA 2GCOB 4IOLA 4TL9A 1ONBA 3ADBA 5F9FA 4D4KA 1CEEA 3DO6A 5EP3A 4ZCMA 1W5TA 4TL6A 1UFQA 1YR7A 3TJZA 1GRRA 5CYOA 4IEIA 2CBZA 2VF7A 4KVGA 1RPZA 3NHAA 5CIWA 3DMNA 1VYVA 2Z0MA 4ZI3A 1Z08A 3QQ5A 1KK2A 3TE6A 4AI6A 3PG5A 4WXRA 4XH9B 1RW4A 2P3SA 3P1JA 1NF3A 3NBFA 4G5OA 1AS3A 2P0EA 4KITB 2FPLA 1PUJA 1BMFD 3CWQA 4V02A 5GJVC 5AK0A 4DDTA 1S96A 2ZJAA 4MRPA 5CITA 2QNRA 3L43A 4HAWA 3TVDA 4C30A 2E1RA 4BQSA 4URXR 2C95A 4MKFA 5FBLB 1CJVC 1Z6GA 2JLUA 1J7KA 1W0KD 1W36C 5DH9A 4LBWA 2BEJA 1KO8A 3EZ9A 4EJSA 1M8PA 3I72A 3PJRA 4F92B 4YMWA 1KSHA 2JDID 4LC0A 3WYAA 1R0XA 3KJIA 3W34A 3ZD7A 3ADDA 2PZFA 1Z47A 5DLQC 2CK3A 1R0WA 4IJMA 3EIEA 2FG5A 1ZNZA 1D9XA 1S3SA 1N6OA 4MITA 5J40A 4TLEA 1Q57A 2GJ8A 1E2QA 2NO6A 5FBWB 2WKPA 4OQMA 1J70A 2GK6A 2ONJA 1KSJA 3PUXA 1CJUC 2EYQA 3TW8B 4CEIB 4MGYR 4OK5A 3WHKA 2ODBA 3ZJYA 5HCNA 4BEJA 1ZW6A 1G3QA 3R8FA 4A8JC 3EC2A 1SKQA 2ZI4A 3EA0A 4QJ5A 1OXVA 4CGZA 3X1DA 4KJZA 1NMYA 3WXMA 3SQWA 1HQYE 1SHZA 1AS0A 1NMXA 1ANKA 4HUTA 2QM7A 2VTKA 1XXHA 3FFAA 2Q21A 4JLPA 4OK6A 3T1VA 2HCBA 4PC6A 1R5NA 2P6UA 1IXSB 5DN6D 1I4DD 3H86A 4JLBA 2ZVPX 2ANCA 5HKKA 3N5CA 3I32A 3SJCA 1P75A 3BGWA 1DAFA 4LHVA 2YNMA 2UZIR 3GLFA 2R2AA 2QM8A 2VL7A 4M0LA 3LLUA 4FIDA 3RVBA 2R44A 2ZU0C 2N46A 3B9QA 1JR6A 1AGRA 3KKQA 2C2HA 3E2IA 1D8TA 4R7ZA 4FD2A 4OK3A 1UKZA 1BIFA 2C04A 2AD5A 2FSHA 4GMXA 4FCVA 1JPJA 1IHUA 2NPFA 1W5SA 1M2OB 1R5BA 4RZXA 4O2LA 1G19A 3CF0A 1TF5A 3TSWA 4S2EA 2BM1A 3GJ8A 1DO0A 2Y8EA 1ZNXA 2J0UB 4PAMA 1O87A 3HPQA 3RS5A 1NBME 4US0R 1KKMA 4UXJA 5AJXA 3PEWA 3KL4A 2IYLD 4HZUB 4LYHA 1E98A 1Z2AA 2GNOA 2PCJA 2V8OA 1U0HC 2ZEJA 4TLAA 3QG5A 4D0LB 1D9ZA 2FPKA 1CR1A 4HDCA 3ZIAA 4AIIA 4D4MA 5TDHA 4C0SA 3FKQA 4M9QA 1SXJC 1OXUA 3LQRA 6Q21A 5TMPA 4OI0A 1UBFA 4TSFD 1NBMA 1KYIA 2C5LA 1KIMA 3R20A 5GJWC 1KMHA 4DJTA 2OXCA 2OCPA 4PSKA 4B3BA 4M1KA 3RYTC 3SEAA 5L3SB 3ZZUA 5KDDA 4LHWA 1NVWQ 1T8TA 5DGXA 3TKLA 4ZDWA 2H17A 2GCPA 2D2EA 3AQ4A 3AVXA 2VHJA 2ZI3A 3LBNA 1KK0A 3EIQA 5J4LA 3L0SA 1ZC4A 4PC7A 4MGKR 5F98A 2B7BA 3GLHA 1ZM4A 1KHTA 5TVKA 1U8AA 4PTLA 2DFNA 4ZKDA 2ATXA 3BJIC 1NI3A 1EX6A 5EE1A 1XZPA 4IOJA 3IO5A 1ZU4A 1NIJA 4IVRA 2VH5R 4PZYA 5FOXA 4ARZB 2O8FA 2N1BA 1G3IA 1CTQA 4DC9A 3THXA 3CB4A 1RC8A 1R0ZA 2IUSA 4LBVA 4Z1MA 4KO8A 1A7JA 5EE3A 5IT5A 2P6RA 3THWA 1QHXA 2ZROA 3H4MA 1CU1A 1R4AA 1TMKA 1PV4A 2I1VB 4H1UA 4CEHA 5SZJA 1E2IA 1MRSA 1QHYA 1US8A 2VIIA 4M1TA 2X2EA 4K46A 2WWYA 2QZ4A 1MOZA 2BC9A 2IXEA 2YZ2A 1TQDA 2ZI5A 1M7GA 3MFYA 4MRVA 4CF7A 3OIYA 5IK2D 3THYA 3AVTA 1Q3TA 2BBWA 1FX0B 4HB3A 1UKEA 1ZRHA 1S2MA 1W0JA 2D7DA 2XZPA 2F1HA 1XCMA 4Q4LA 1Q1BA 4B2PA 3ZQJA 3QE0A 1KI6B 1TQ2A 1KO7A 1N5LA 1FTSA 3GEHA 4LY6A 4OJQA 3FFBA 4EIWA 5FOUA 4DHEA 4UNNA 5CK4A 5HKKD 5TB5A 3X2SA 4RD1A 2AK2A 3DKVA 3CO5A 5C46F 4PAOA 5DHFA 4AURA 4R2IA 4C2TA 4AKHA 5FTJA 5E7MA 4DCTA 4A2PA 3T5DA 3W9YA 2F43A 3LAWA 4JL8A 1QBKC 1D2NA 5HZHA 3RNLA 1FTNA 5F9HA 1Q3HA 1PLJA 3O8BA 4IXNA 4JLMA 3T15A 3W3AA 3I73A 1T5LA 4P4TA 4JBWA 2OCBA 3P20A 3B7GA 3T5GA 3K09A 3TH5A 1R8SA 3B82A 2RAPA 1Z63A 2OT3B 3OAAA 3G82C 5FBRB 5C4MA 3IEVA 1OFUX 3GJ4A 2OLKA 4LI0A 4R2HA 1DAEA 4Q47A 4URWR 4A1FA 4TT3D 1A4RA 1RIFA 1ZBDA 2SHKA 5JECA 5CJPA 4GP7A 1F2TA 2IS2A 5GJBA 4Q1EA 3SU8A 3KKOA 2V55B 2J1LA 1JQJC 2C8VA 4L5BA 4ZI2A 1VG0B 4NYIR 1KK3A 1T4GA 5JHHB 1KY2A 2FSGA 3IPYA 3GLHE 5DI3A 3ZH9B 4ESVA 5G3ZA 4LOAA 2DYKA 3BE4A 1LY1A 2QRNA 1OXXK 3VAAA 5FUWA 4H1VA 2WMOB 4EJSB 1ZCAA 4KBGA 1LB1B 3K0CC 3R7WA 2G0NA 2OFXA 2XOKD 3QPVA 4E5UA 3AP3A 4PPNA 1T0HB 4G3XA 2QGZA 3T12A 1LW7A 3QF4A 1NY6A 4HI0E 1ZYUA 2RB4A 2WOJA 3E70C 2F55A 1PUIA 3UKDA 5FH9A 3TMKA 3B78A 2OO7A 2G3YA 2XNDA 2ZJ2A 4LK2A 1S8FA 2BMEA 4Y0AA 1O3YA 1JI0A 3D7MA 1E1QA 2WKQA 4PC1A 1F60A 1E96A 4CRWB 2WJGA 1VECA 3C14C 1F2UB 2D06A 3KKMA 1FMLA 2FFQA 3U44A 5D3MA 1XMSA 2YOFA 2O8EB 2OV2A 3AP1A 1ESNA 3IPXA 4RKEA 2CL7X 4YMSA 2ZTSA 1L7VC 4UNRA 2JJ8A 1M34E 2G9NA 2DR3A 4AKIA 2BDTA 1EFRD 1P61B 2BJVA 3MRSA 2ZRPA 1G8YA 3LVRE 1JBKA 3PUZA 4V0OA 2Q9BA 4L4UA 5EJEA 3SR0A 3AVWA 3AVVA 4DIDA 2O8CB 2AX4A 1AQYA 4TWZA 4ZDKA 3KFVA 3U60B 3WP0A 3HR7A 1W47A 3B9PA 1FP7A 2DB3A 2ZETA 1DAGA 3EPHA 1OKKD 1G6OA 1QHHB 3R8CA 4XVUA 1Z6YA 2OESA 1NVXQ 4RD0A 3VHXA 3VQTA 3V4RA 3RRMA 4Q5IA 4U02A 1GKUB 1E0KA 1G8FA 2B7CA 5B2ZA 1JR3A 2GEDA 4PO9A 4DUGA 3EAQA 1RZ3A 3K53A 4NCHA 1KNQA 4RZUA 1P9WA 3WY9A 3RRYA 2GBLA 1DELA 1Z0FA 3NBZC 4Q9HA 4WIAA 1AM4D 1KI3A 2GXSA 1G7CA 3HYRA 4YDSA 2O8DA 4HLDA 1E2KA 1X6VA 3UMRA 4A8JA 3MJHA 1E94E 2QMEA 1MO5A 2XTNA 5E3HA 2IHYA 3ZD6A 1G5TA 4NYMQ 4V0NA 4A0GA 4D6PA 5KDLA 4Z51A 5JCZA 1XXHE 4XD7D 3GLIA 5FI1B 2VA8A 2QP9X 1HYQA 1WRBA 2GA8A 3NXSA 4LV8B 1AN0A 3AP2A 4GP6A 5EP2A 1FPMA 1NBMD 2ZE5A 1E9AA 2H92A 4AD8A 2V7QD 3GP8A 3MWKA 4Q9KA 5GVRA 1SVWA 3K0EA 4JMPA 4GNKA 4JZKA 2C9YA 5KYKA 5JRJA 4MUBA 3GLGB 4JL6A 3QOFA 3U7GA 2QP3A 2QG6A 2ZRBA 2XZLA 2YWEA 3BK7A 4A9AA 3IIKA 5LBIA 1KSGA 2PZEA 3SOPA 3UK6A 3VNVA 3NTUA 4CIDA 3TSOA 3ZDQA 2Q3HA 3QKRA 4YQFA 4DRZA 4HAZA 1AZTA 3BS4A 3UMFA 5KTYA 5J4YA 1D6JA 2ZJZA 2GJKA 2IYRA 2UKDA 4TMXA 2H1LA 3I1FA 2ZE8A 4Z8YA 1COWD 3KQLA 4BGDA 4R71A 3B1WA 2KWIA 1TPZA 4JVLA 1XPRA 3L8YA 1YZLA 3V00A 3FYHA 3R9WA 221PA 1FUUA 1KDPA 4A6PA 1NLZA 4D4JA 4DLTA 2QORA 5AWFC 2ZANA 1GWNA 5LD2C 1VG8A 1QZXA 4LC1A 2ZR9A 4U7DA 4W9MC 2IT1A 1N6HA 1ZUIA 3K0CA 5AUPB 5JSZA 1GM5A 1Z06A 5JWRA 2JAQA 3DPUA 2HUPA 1IY1A 3QBTA 4MQBA 4JT2A 4KXFB 5P21A 5EE5B 2HCJB 3CONA 3QUSA 5EXXA 3LXRA 3KQKA 4S35A 4LDJA 1GUAA 4MUAA 1XEFA 1I2DA 4PO8A 5FL3A 1FOEB 1XJCA 1GRQA 1GVNB 3B13B 4NYIQ 4Q4AB 1KDOA 1T9HA 2OLJA 5DI9A 5FBVB 2CJWA 4RCYA 1XD2B 2QQEA 3RS0A 1YHNA 4B6EA 2BIFA 2ORVA 1ZC3A 1KI7A 2JLWA 3I5YA 2ZRDA 4P4SA 3KTAA 3M4YA 1T6NA 5JWOA 3VKWA 2EFHB 3JVVA 2FSFA 3RDPA 1F6BA 1W4CA 5C1BA 3KKPA 5FR1A 1E9FA 1CLUA 1OW3B 2AD1A 2YWFA 2WOOA 3OIVA 4DWJA 2PEYA 3A1WA 3B1VA 3JZAA
chains in the Genus database with same CATH superfamily
4LG1A 2PJUA 4HZIA 5CHEA 3IVGA 2PGNA 5FYQA 1J2YA 1XDWA 3BFXA 3LYAA 4X1KB 2GX6A 3DBLA 1YS6A 1GXSB 1QYWA 2HNKA 2QY9A 2FEMA 3E3NA 1OVMA 4OHBA 3ZE7A 1P44A 3O82A 4YWHA 4P0PB 4CEHB 2WILA 2CLFB 2C5BA 4IICA 3VI3B 3GDFA 3CQ9A 3ZIUA 1VL0A 3PTZA 3KHUA 4FFVA 2G1AA 1CUIA 1F3LA 1T8UA 3GLHB 3LNCA 4RF3A 4FSDA 4RFLA 5ANRB 5TMBA 3W9BA 4BO7A 1M2VB 2WJ4A 1KPGA 1T2VA 2ZSKA 3DBIA 3FGNA 2GN6A 4QG7A 3G3EA 3VZRA 5EJ6A 1KOLA 4OL9A 3HDYA 1NQAO 1Z38A 3QXHA 4HH1A 5B7NA 4H3HB 3P9KA 1Q84A 2A9VA 4MEBA 3JQCA 1PO7A 3EDRA 2R1TA 5LQSA 4IKEA 3PK0A 2FZVA 1ETUA 1WSBA 3PNPA 4O0MA 1DXOA 2F3QA 1KYYA 1FLVA 4YHHB 1WVGA 1ZP6A 4F3NA 4WZBA 4A8TA 4CLOB 1PGJA 2PKYX 1GKIA 3MK31 1G7SA 1HBJA 3ND9A 3QUTA 4ZVUA 3LHDA 5UKDA 2IYZA 4PYJA 4F93B 3ZE6A 3U7EB 1WDTA 4CDRA 3K0HA 1YI1A 4WXMA 4B7XA 5LWHA 2PGLA 4WJKB 1SVNA 3A3YA 2H2GA 1KXJA 2GNPA 2YIJA 4EKGA 4F4JA 1OI7A 4LCJA 2G9RA 2R6GA 4WECA 1ZIDA 2EF1A 1DUIA 4FB5A 4ZP1A 3IEKA 1T5HX 1EWVA 3I8OA 4XEUA 3SPXA 4BX9A 2W6ID 4RA6A 1NV8A 4AW9A 1ZM2A 2FEXA 3M9XA 3SZGA 4YA6A 3UV6A 1DV2A 1MR3F 1UAAA 2IFTA 3OFSA 3K70C 2VH1A 3L5KA 2A1UB 5BV7A 1Z29A 2OXRA 3Q9LA 3RYCA 3ELUA 4W5WA 2GKSA 5FUMA 4P3YA 3GQBA 3L7MA 3WADA 3CXUA 3KUCA 2UVQA 3STHA 1NVTA 3WLAA 4AECA 3DKPA 1U28C 2X0IA 2RGCA 4LNHA 4RACA 5BUCA 4M4SA 3D2CA 3JQEA 4IW3B 3BJZA 3ZW7A 1E5TA 3JQPA 4P1ZA 2W2LD 3AW8A 4J43A 1LX6A 1R74A 5JFGA 3HLKA 2ECQA 4ZCSA 1FTWA 2Z1MA 2H4ZA 2K6GA 1XTIA 4N0PA 4IIDA 4L4YA 3HUUA 3BAFA 5EWJB 3ONEA 4M89A 3LYHA 1IL0A 4XE5A 1NVFA 2ZB4A 3IOEA 3KAQA 3MELA 4DBLC 4EARA 3VPDA 1GU0A 4JT4A 2J3DA 1UK8A 4EI2A 3RFUA 1MEEA 4MV9A 1ODLA 2GLXA 1XNQB 1JAIA 1O94D 3LBAA 4YJFA 4RTKA 1BYIA 5KQLA 4AG5A 1VPTA 2DBRA 3A32A 1IYZA 4XARA 2MU1A 4D46A 3EHEA 5F4ZA 3BIJA 3EB9A 1Z4LA 1Z83A 4E6PA 5EEGA 1IZ0A 2MIIA 4ARIA 1S9HA 1WEHA 2Y92A 2ZPTX 3K6JA 3T4XA 3GUHA 1VPVA 3LW7A 5F52A 4TN5A 5AIBA 3FNFA 2B7LA 3W06A 3EPRA 4D44A 2G4VA 4P4UA 3OLWA 1CJKC 3ANSA 3NI2A 3U7FB 3N8KA 4AZTA 4ZANA 2GYYA 5ISMA 4EK9A 2AFIE 2J5XA 4LGYA 2PZMA 2QTRA 2WFAA 2CLMB 2VQ6A 1JEOA 1G2OA 4AK9A 1X87A 4HNSA 1WMDA 2J7KA 2XYVA 4JJEA 1OZHA 2YASA 4TUYB 4TVKA 1WU7A 4UDNA 2W22A 1AHPA 2LV8A 1UPUA 4P7JA 4IUYA 3BMNA 4CKBA 5LA6B 3V4FA 5EMMA 3TZLA 3KTFA 1P73A 4K81B 4WA8A 4E32A 1RNLA 1R0YA 1GG5A 1WCV1 2DBQA 4GG1A 1B1AA 4LTNA 2P62A 2IUFA 4G84A 1S3IA 4X7PA 3OT5A 4E5MA 4H9GA 4F8JA 4PGFA 3W6OA 4QBTA 2XIJA 1D6NA 1Y0BA 2FQ1A 3B5JA 3NHZA 4OFXA 1FVHA 4LZOA 3QBVA 2JLSA 1U94A 4YUWA 4IWNA 5K6RA 2ZXUA 4DLLA 1FSZA 1VG1A 1W76A 3N7TA 4WGGA 3LPDA 3I9OA 4WUTA 4BJ6A 4YRGA 2EF0A 5JS7A 2JLYA 1TEHA 1DQNA 2XI4A 1LSUA 2R86A 3KT0A 1J97A 2WIAA 2PX8A 3CLSD 3C7DB 2LBPA 3U7RA 1U2GA 3F5DA 5CA0F 2OD9A 1T6BY 5EIEA 1FXSA 2FGJA 1BOOA 3SQOA 1RXCA 1TM3E 5IFLA 3EASA 4FXPA 4XX0A 4S1VA 1OXBB 2WAYA 1E9SA 5HFAA 1K6JA 1HDOA 3M1YA 4FE4A 1BE8A 4NCBA 2DECA 1XP5A 2GMWA 1YRQA 2PSFA 4W4TA 4ZZ2A 2DERA 4OHPA 3HM2A 4W8HA 2YV1A 4WNIA 4XOIA 1DBRA 2R00A 3DFFA 2DWPA 5BRNA 3OX2A 4W9MC 1YR6A 4DREA 1V8BA 2HK8A 4LZWA 4RJTA 5JZOA 4B3HA 4FHCA 3FOZA 2Q8QA 2RI6A 3SBEA 1PZNA 4IOKA 1SZDA 5K3EA 2R68A 3RC3A 4CF6A 4DZZA 1A9YA 2G72A 4EMTA 3EH1A 3MWGA 3Q6MA 5ENVA 4A6XA 2UYQA 5GAJA 4WOPA 4QQKA 4XGNA 3FSGD 1A27A 1J0CA 4F2DA 2JIDA 4HNAB 3TPZA 4OAQA 1ZRSA 7ABPA 2B4AA 5E7IA 1OTYA 1SXJA 1ZMOA 4JA2A 1JKMA 2NYRA 3HBJA 3NRJA 5IBRA 2IL1A 1GG2A 1ZCZA 3R3HA 2XOXA 2JFXA 4H6VA 4AN4A 3OOWA 5A5GA 1DAIA 3LMKA 1BXGB 4FMCB 3WDLA 1SKUA 3SR4A 3UJHA 1W5BA 1UMBB 2H59A 3MINA 5G0UA 4FWIB 2XA1A 3GLUA 1C1DB 4CM4B 4CT4B 3GEMA 2OHVA 1NXQA 1REQB 4CLEA 1BKSB 1Q0TA 1SXIA 5SYMA 2AJBA 4BATA 4IMRA 2GPNA 4ZEXA 1Z13A 3T0GA 1TDJA 3ZI7A 4MVJP 1OR8A 1WB6A 3PQDA 2X5KO 1N7HA 5LQAA 1PR4A 4O4HB 1P3JA 1U3DA 5KPDA 5FA8A 4DV2B 3OUUA 1NXXA 5C18A 4TKMA 3RTDA 1XDDA 5K0CA 1WB9A 3IHLA 3QITA 3K0FB 1Z26A 3HVKA 4PO3X 1EVLA 4K6CA 1TO6A 4YFVA 5DCWA 3BYZA 1MMFB 2WG1A 2EHJA 2R5FA 2CLDX 4N49A 5CDGA 4QXAA 4YJHA 1LBTA 1JV2B 3PPWA 2OQIA 4HGOA 4DPMA 1BXRB 2CLKB 5KTPA 3EPLA 2I5PO 2FN9A 5EHZA 3T3EA 4EUFA 9LDTA 5DWVA 5CYPA 3LTNC 3CH4B 1UDWA 1CHDA 2PWPA 3ICPA 3JVDA 5AHOA 2R8RA 3OMLA 2QMHA 3DD5A 3X1YA 1ZD8A 1Z2CA 5JASA 4YREA 1ESEA 2IELA 3ISTA 4FNMA 1KZ6A 4Z7JA 3ADCA 2JLQA 1D2GA 1UMDA 3GJ3A 3QTTA 1G4AE 4EYQA 1ZK4A 1IMOA 1EX9A 1OB5A 2P27A 3T0FA 1C4KA 3KQOA 2EFJA 3BXZA 4BX2A 1ONOA 3FSRA 3W6PA 2IHNA 3KDAA 1RDFA 2WSIA 2GDJA 3EVCA 5T64A 4JNKA 5DM70 1AKWA 3LXMA 2VUSA 1YKGA 3EFOA 4GI3A 2FRDC 4AF8A 2VHWA 4QATA 2YRWA 4EL5A 4AF6A 3NCHA 1GTRA 1MUUA 4C05A 3UPUA 3DZBA 3TAHA 4AC9A 3O2NA 3K0SA 4QGBA 2GEUA 5JY1A 1OE0A 3HCAA 1QFZA 5LQJA 2I6FA 2ZYIA 2ZR7A 3E15A 4WK4B 2QRJA 3SAJA 4AY6A 1GLGA 2QVCA 1WE2A 1KEVA 3AF3A 1E20A 2O4UX 1JJVA 4NICA 1WXQA 5COQA 4BX3A 4RQTA 1YB4A 5I5GA 4G1BA 4KUHA 3WWDA 4B3IA 1N6KA 1YR1A 3AF1A 3D0OA 2H9AA 4UBJA 3PE6A 3EX7C 2W8BB 3ZXSA 1RQ2A 3R7LA 2C82A 5FTWA 5ETJA 2Q5CA 4KPUB 3DOHA 4ECAA 4HX5A 4G86A 2EKBA 5LJIA 4BLWA 3H1BA 3FNGA 2ZBGA 1F0PA 2V9PA 3MZ0A 1VSVA 1QVZA 5EXPA 1QRRA 3CLTC 4ND6A 4DA9A 5EJ5A 4QYSA 4B3TB 2FFRA 2Q6LA 2KM1A 4U1RA 5JNTA 4DXHA 2XDYA 5AVXA 3PDHA 1MQSA 2OILA 2V5VA 2YJNA 5C1OA 1QKKA 3HB1A 3ZVKA 4FQ5A 2Y2UA 3QA9A 4P4GA 1GGNA 4N18A 4LFBB 4YT8A 2OBYA 1I3MA 1KH3A 1M0TA 5A9RA 1JIVA 2WY2D 5K4HA 1DRJA 1N5KA 1SQSA 3IBFA 2I6TA 3PFBA 4ZYWA 9GPBA 5J59A 1E61A 3RSOA 2OPBA 1XJQA 3A1VA 4II3A 2ZCVA 1QQ5A 2I4TA 2G6TA 4QPZA 1RMYA 2I78A 3G85A 1R4MB 2FPMA 3PQ8A 4JI1B 3MVEA 3RUDA 4ZJPA 2OV1A 2D74A 5FWXB 3COVA 1UJBA 4KUEA 4EHNA 4JWKA 1LRKA 4XWTA 4YXWD 1Y33E 2JANA 2P9QA 3N8HA 3QF4B 1QRSA 2C4WA 5E2IA 3M6XA 4E2YA 3UC5A 3R0ZA 4A1OA 1BMFA 3OTHA 2ZYWX 1MC5A 4CGYA 4I8IA 4EZIA 4BBZA 1RWNA 3IA7A 3IVRA 4Q3OA 2AXNA 2YJGA 4UMFA 1EFHA 1LS6A 2ZIUB 3W5JA 5F7XA 3EBPA 1T0JB 3LO8A 2YZGA 4BFZA 1RLUA 2JS7A 2ZJOA 4LOLA 2PL5A 1BQ3A 1E2DA 2GF0A 4AXBA 4ZCIA 1E62A 3E9RA 4ZVOA 3DEAA 2IZ5A 5C8ZA 2XWBF 1KMQA 2ANBA 3R44A 2XZTA 4ZAXA 2AC2A 2JGJA 3L82B 2QRVA 2FY8A 2FPIB 1V71A 2R7MA 1SCUA 1GYPA 4J2TA 4QYIA 1R6AA 1DZ3A 5NLLA 5JS1A 1NRWA 4PCVA 2VSFA 2YQ5A 2ZP1A 3EUEA 2FK8A 3LH5A 3EGVA 4FDMA 1DBQA 4GEKA 4K9MA 1IMJA 4EA6A 1APBA 4Q9DA 1DXYA 3PUIA 4CI0B 4EYGA 5DU2A 3FPEA 1JA1A 2PLNA 3M2PA 4EFNA 2ZJ4A 2BRUC 5DNVA 3D0RA 1ACLA 1JSRA 4E33A 2L18A 3UGJA 3W1VA 1FDVA 4N12A 5JI3E 2A86A 1Q1EA 3FH0A 3CPSA 2V4UA 3OZDA 3JYNA 2B82A 3A58B 4ASUA 2OV6A 1RCTE 3HCBA 4AWBA 1UWVA 3LT2A 4DB2A 4J2OA 3NWEA 1PHPA 2ATCA 2ST1A 4MROA 4HH3C 2HRQA 1YQTA 1MQ8B 3QVMA 3B2EA 4CF5A 4EYOA 1SVMA 5IAKA 1GDHA 1ZMTA 3C3AA 5KOYA 4X1YB 2CSXA 4MR8A 2GN2A 3HJCA 1W5FA 1XCLA 2E6UX 3PB3A 1WSWA 3LQ1A 2BW0A 1M2VA 3ZTTA 2PVPA 3G8BA 3T9BA 2AOUB 3MMSA 3GLIB 1T9DA 4NK5A 4LW8A 3O8DA 3VR3A 3TSZA 4OV6B 2DJIA 3IAFA 3IT1A 5EWLA 4JP3A 1TZBA 2O0HA 3W4KA 3U4QB 3QKSA 2GEVA 4BLUA 2FOLA 4AZ3B 3F1LA 4JQSA 3W6NA 3DBLB 2J7PD 1JXAA 4WNAA 5E1MA 3D6TB 3UQZA 5JG7A 1EXDA 3VU3A 2O5RA 1KWGA 2RDMA 1X94A 3KEMA 4BO3A 4V0SA 2J67A 3CVWA 3BWDD 5LMNB 1KEEA 2HJ9A 1UZLA 1XE3A 1IHOA 2PVCA 1F1BA 1NF8A 2H65A 1RM3A 2WUEA 2YVKA 1H8ED 3EHDA 3OKFA 4NR0A 4NV1A 2QD3A 3N0RA 5FOQA 3RAFC 5E4JA 5LQUA 3LVQE 1Y5LA 4TRJA 2PAAA 1JHDA 1ULZA 3EIFA 1Z22A 1Z4QA 1GP2A 2GD6A 3O91A 1E2PA 3V1YA 3MWEA 3ZE8A 1E6MA 2NXNA 3DFZA 3ZUPA 4C0WA 1NGSA 4KN9S 3ZX5A 3DVAA 2VP6A 4UPDA 5CEEA 1SBIA 2P2GA 4IFTA 4NQZA 1D1PA 3L8ZA 4CHGA 1NPYA 1VG9B 2BGUA 4FFSA 4TRMA 1ZJJA 5K51A 4DJAA 3H4TA 2QGNA 4YLGA 4X61A 3HY3A 5K8UA 2XWJI 3AR9A 4KL8S 4BTLA 4CQNA 4DR6B 2VP4A 5EWMB 4B8ZA 1YDGA 2GBCA 3A9VA 4Y6OA 5TVGA 3HDGA 3VJLA 5LP6F 4HEHA 4ZEMA 1LRLA 4DIEA 1NKTA 2A4MA 4P81A 3T3OA 2W7TA 2FRDA 4M88A 5JQGF 4LFAB 3ICEA 5EXSA 1JQDA 4FFOA 1J2UA 3LZ6A 4U7PB 5TQVA 1UK9A 3WE7A 2V0NA 4M37A 5ALXA 1Z8FA 2IV3A 3K8ZA 1II9A 2JFVA 2IDMA 1K5PA 2JAHA 4YO8A 4UARA 4EZBA 1ZITA 4U8HA 3O95A 3JXEA 3P9IA 3R41A 1BDMA 2CWWA 4JWTA 1VDMA 2NUPA 2FZ5A 5H59A 4BB9A 5A4DA 4MVWA 1DKMA 4L4SA 4C4OA 2Z95A 4KIFA 3G1UA 3A1DA 3BD8A 4BV8A 4HVTA 3CIOA 4TLMB 5G02A 4NZMA 3QJGA 3ICCA 4U7JA 4BZPA 4Z2AA 1LC3A 2ALJA 3ANYB 1D6MA 4OYRA 5EYPB 1PR9A 3K0AA 5B57C 1W6UA 2HK7A 3SS7X 1CR4A 1FNMA 5FOSA 1JA0A 1X7WA 2QAIA 2X2OA 1V7QA 4XSGA 1W85B 4OQXA 4QSHA 1GGFA 2DVMA 3G9ZA 3IOYA 5GVSA 5AOAA 2X9GA 4LJ6A 1NONA 2E89A 1U0LA 2EQAA 2HQ1A 1WHSB 2WAOA 1L1RA 4Y8VA 5EIWA 4EITA 5BMVB 4M76B 4WKPA 4BMNA 2WFLB 1HWYA 2RGDA 2BMFA 1D1SA 1BO6A 1IK6A 3DP9A 4P9NA 1W2HA 1A5SB 3GDWA 3KQPA 3QYJA 4JT8A 5CVUA 4C5CA 1WMSA 3EY9A 3OA0A 4EYKA 3ZE9A 3ESQA 4KRXA 1P4HA 3FCXA 3H3FA 2WWVD 3U3JA 3U37A 5BRAA 5LKAA 5KNLA 3MCZA 3E84A 3PC2A 4ZQEA 2KBFA 3HXMA 2RK3A 1XK6A 3FWZA 1OPXA 3LUPA 3L0DA 4UTVA 3RUIA 2XHZA 4R1LA 4B48A 4EJ6A 1C1HA 1U1FA 4IX1A 4YP1A 1QAMA 2JBHA 3DMGA 2RAFA 4P3PA 5JI2E 4H0NA 4U6SA 4YCJA 4WL0A 5IRCD 1H05A 2Q0XA 1QHEA 3RRZA 1H3FA 2FW6A 2PA0A 3K9CA 4L5YA 1A2OA 1C9DB 4FONA 4K9DA 2WQZA 5IW8A 3SHTA 4D43A 1XEXB 2P35A 2WHPB 1FVOA 4B6JA 4MO2A 1YR2A 1X86B 4MMXB 1E66A 1ODJA 4WEQA 3NO4A 3K4QA 1E3EA 2OENG 1HG0A 2X8JA 3CEMA 4GBJA 3R5FA 4NZNA 5BSUA 5ESRA 2FMTA 1DVRA 1CNEA 4RF4A 2HBYA 4MS3B 1G0OA 4ND4A 4D8XA 4W5RA 3OZIA 2PAFA 1U0SY 2QX6A 3NANA 5LXTB 4RY9A 5TMEA 3TGWA 3G2PA 3FYCA 4INOA 1XYVA 2XQGA 1G42A 1PV1A 4CVNA 5KNCH 3OZRA 5AW2A 4PLPA 2VUUA 1X7ZA 1LS1A 1MO4A 1W4RA 3GL9A 3HY6A 3LDAA 3MINB 2GCEA 4JBIA 1YIOA 3MERA 4C22A 4EG8A 1KGDA 2PWZA 4AP6A 2FQQA 1P0FA 5CNJA 1MRNA 1RRFA 1UBSB 1I6LA 3USZA 4B3JA 2BTOA 5I8ZA 1Q1AA 3AM4A 5EGNA 1Z4MA 4R98A 5EJAA 1LV7A 4BU1A 2G9UA 4DLNA 1XQXA 3EUWA 2OO5C 3VJRA 4PX9A 1L1FA 3Q11A 1Y9ZA 4GLOA 3G9UA 4I3HA 1IG3A 4DVJA 4CU5A 2FEWB 4MLPA 2VKQA 4OLFA 1XELA 3T3NA 4BLOA 1CUDA 1FL9A 3L07A 1P4SA 4G5GA 3T5CA 1JDUA 2XW6A 2GA9A 1AMOA 3DXZA 1GZSA 2PT9A 4JSRA 4I4IA 2IEBA 2QPAA 2BGGA 1C3VA 4Z4FA 1W88A 3TMAA 1QYDA 1K98A 1SBNE 3TRJA 2B4QA 4HDKB 1XN4A 5FAXA 3ZLJA 4QGFA 3WGKA 4CLDA 2V3VA 4NXNB 3TOXA 4TV8A 4TYYA 3G6KA 1E2JA 1Z45A 2HIAA 2P8SA 1E3QA 2D8AA 3NTOA 1UBTS 2H5LA 3RVQA 2Z6QA 5M3BA 1F5SA 3HM9A 3KQVA 1VQ1A 3SVZA 4G1UC 3FDJA 2FPGB 4HMQA 1B0AA 3HCPA 3TL6A 4PZ0A 3HJNA 3QENA 4D3SA 5JR3A 1NMQA 4IVQA 4MH0R 5A4IS 1EX7A 1OYYA 5BYAA 2RGAA 4OBWA 3M6FA 3ZVNA 2FJ0A 2DCUA 2R4TA 3T95A 3DPIA 3FM9A 3THYB 1DX6A 2CNWA 2R3SA 1Y3DE 3BRWD 3CFYA 4IJVA 4TZ6A 3SQDA 3BERA 1EFDN 3OKAA 1M67A 5CU7A 4LYJA 1FDUA 1LPMA 1M1YE 2D0OB 3H6GA 4QQ8A 1NQTA 2A67A 2CFCA 1XEXA 1L7RA 2Q9UA 3GT3A 3AUFA 3QWHA 5ULLA 5AVSA 3MTBA 1W9HA 2QDXA 2NUAA 3GFBA 3PT9A 4QSMA 3SSOA 2C7RA 1SZJG 1W93A 1ZW1A 2I65A 3F5QA 5F4BA 1S9DA 4UZSA 1Z8HA 1AJEA 4TXNA 3GFOA 3H9CA 2XNDD 1EB9A 2QPOA 4CTNA 2DCMA 1XB2A 2VPQA 4N3BA 3I9FA 2XVZA 2GD2A 4Q7MB 1UJ6A 1HH4A 2BFEA 2C1ZA 4K6HA 5FQOA 3Q41A 4ARZA 4CM9D 5LYYA 3CE6A 2X8BA 3SDSA 5F9MA 3WHIA 2IDKA 3ELBA 1J1IA 3K1ZA 3NPMA 2DAPA 3PDJA 4Q48A 2FFAA 2I54A 3ZU5A 1P5FA 3W8RA 3T5AA 2FE4A 3WLLA 3B6IA 1GIAA 5DXJA 3J81k 1D09A 1NF2A 3PNKA 4GRAA 4OHVA 3KXLA 4ARBA 2FSVA 3KDSE 3EDYA 4BLSA 4FNOA 4IDOA 4E2FA 4Y2QA 1II8A 3GPIA 2QUHA 2AKAB 1CDZA 1PR0A 2VZEA 4IH1A 4O29A 3E35A 2IY7A 2ZR8A 5H7XA 1ZGAA 4EB6B 4Z3OA 2ORED 1BVHA 4LX8A 4PX2A 4X1OA 4ZYUA 5KTMA 3CZAA 4EG1A 3OQBA 2X2FA 2GR9A 4CMCA 3BMQB 5F21A 1UC9A 9ATCA 4OMDA 3GZNB 1XPOA 3F0TA 2VJDA 3K1AB 2CMHA 2ZSFA 4NS4A 4LF4B 1WD7A 4TMFA 2PBRA 3F1KA 4OFWA 1QH1B 4F46A 2N3ZA 1COWA 3OPVA 3QLJA 4YRZA 3BWYA 3D6VA 4Y7DA 1YVRA 2BUBA 3LP5A 3QLUC 4N03A 4HHEA 3A11A 1QS0B 1L7AA 1SC4A 1SC1A 3A1TA 1UDXA 3I37X 3RW9A 1R6XA 1YK1A 1I4EB 2W2PA 4C9BA 3NU1A 5LYJB 1DSSG 4IV0A 3E4CA 4BNMA 2QOEA 3R3XA 3F97A 3SM9A 3DWEX 3BB1A 3OCXA 1M34A 3BMCA 2EW1A 3RAJA 3GQBB 4UNQA 1XR3A 4BU0A 5JJLA 2IYVA 4MRSA 1SCIA 2MSDB 1OYVA 3BMOA 5B1YA 4B6PA 2IZ1A 1AH2A 2QUZA 1FP1D 3K96A 2PSSA 2PX3A 3MCAA 4G0VA 2J08A 1DDOA 4OQDA 1I4OA 4JV5B 5B4VA 1Z36A 4JK3A 3FRJA 5ILOA 1OHHD 5EN4A 3DVLA 1PJLA 5LQKA 2XOEA 4NMLA 4K7JA 2BE9A 4XIJA 3PE4A 4EWLA 1GNLA 3H3XA 3SHOA 5IZ4A 5AR1A 5IANA 5EZ6B 1JU3A 4G5SA 4L2IA 1SBZA 5KNDA 3MXOA 3P0FA 1EG2A 3LQQA 3MUEA 3RV4A 4M21A 2WHQA 3PRYA 3F2VA 3C3XA 2W2MA 3IB3A 1XKQA 2ZTVA 3KTAB 4PQRA 3SE0A 4OFBA 4KXQA 4LXHA 2Z2XA 2Z58A 2PYZA 1BEUB 2HL6A 1BH6A 4LV5B 1E2EA 2WLSA 4JUAA 1DFIA 4XB6B 3JQAA 3HN7A 2ZBUA 3TL3A 5SICE 1HDXA 1ORWA 1WEKA 3NAMA 2H1WA 3I05A 5EUMA 4G0WA 3FMPB 4UM5A 1F8UA 3R2JA 2PVSA 3VTAA 3K8QA 3PQ2A 3UBMA 4NF2A 3UKOA 1XMJA 4HRYA 3NHMA 2R1TB 4YP7A 4C4SA 4L16A 4HQFA 3TLAA 1JEQB 5EWMA 4GI5A 1WZIA 1I7PA 2QLFA 3EZYA 3R0XA 9MHTA 3ZE2B 5C8VA 5BO5A 2YY5A 3NETA 4HZGA 5DLYA 3RVSA 2A0WA 3LT1A 2GSDA 2O2CA 4HRXA 1R5OA 2C5SA 2JIPA 2PS0A 3MT7A 5SY6A 4ER5A 2O52A 4FZ5A 4RFSB 2FLVA 4RYDA 2O3SA 3N2ZB 4Q3DA 4UQLA 5H82A 2P77A 3OF2A 4PR3A 4QDXA 4Q9IA 4X1KA 1V0JA 5HIMA 4DLWA 2H4WA 4F6RA 1B16A 4QTZA 1GAJA 1Q50A 3S5JA 1KH2A 4EVSA 2GO1A 2NVUB 5KI6A 2WFZA 3W5VA 4A5SA 3UJ8A 5FPHA 2WZCA 4MWTA 4N5LA 5LCXA 3Q9NA 2XA2A 4FE3A 3HXPA 4DOMA 4WESA 4ILEA 3PIDA 3KSZO 3V6MA 4YJ2A 5AXCA 1BKDR 1ZRMA 3JQRA 2AN9A 1T13A 3UIEA 5ERYA 3ILVA 3QZUA 5TRTA 1G59A 3HXTA 2GTPA 3M1IA 3OZAA 2OORC 3G7UA 1DADA 1VRVA 2RGNC 2XITA 4BKRA 3LU1A 1KO1A 1CNFA 3ETGA 3QE3A 4UM7A 4BYGA 5B55A 1M74A 2TMYA 1HSOA 4EO9A 4KSCA 3SLRA 1RRMA 4I6GA 4XGIA 1R9GA 3IUQA 1ZIXA 1KK1A 2OCLA 3GH3A 4QELA 3ULKA 3TN7A 5IAEA 3ZK8A 1C50A 2ILTA 4GKBA 4DLYA 1SB9A 1HT1E 4ER7A 3R75A 3GG9A 1N2OA 4RTNA 3ORSA 2R65A 4AWAA 3NMUF 2XCUA 2F1RA 2OBLA 3P9QA 1V3VA 2ZRLA 4C0AC 3MCWA 1JHXA 3RFXA 3TQRA 1H1LB 3G2NA 3GMIA 1GZ4A 3P9SA 4JYBA 2PLWA 3ENNA 4X8HA 1T1IA 4AROA 4P2GA 4CMAA 2P90A 2I9KA 4B7UA 3C3CA 3QPUA 2WBLC 4P38A 4R5HA 1KJQA 3JQ7A 4K03A 1KTIA 3H5AA 5HKLA 3U3MA 4KQ6A 3AFNA 1ICEA 3R23A 4NS1A 1UQRA 1N8SA 3JU3A 2OZKA 4DJDC 1VC2A 2RHHA 4GEGA 4QHTA 3IPRA 4U2CA 1QCZA 2M9MA 2RHLA 3DV0A 4IRUB 4QBIA 3GVHA 3T5MA 3FZGA 1ZVVA 4XPIA 1OIWA 3HS3A 1RZVA 3D8BA 2ZYRA 4MS4B 4PFJA 1IONA 3G2QA 3QGMA 1D5WA 2BISA 1B41A 2YXEA 3LTEA 5FADA 1UBJS 2FEPA 3HXLA 3NOQA 4Y9DA 2LDXA 4YMTA 3KQNA 2P4EA 2HHAA 5LZ4A 2MMGA 4E4TA 3QYFA 2W2QA 2OGUA 1KIAA 1KVSA 3WHLA 2ZRGA 1Z28A 3HVRA 1A8SA 5I5EA 1QIIA 1WM1A 1U0FA 3Q0TA 4O2BF 4B5KA 5DSZA 5AVWA 2QJFA 1RAAA 4QL3A 4MDEA 5KKNB 4V0ME 3LOPA 1DRKA 3NBQA 2EQ5A 3I8SA 4MTLA 4ZHQF 1LI4A 3TBFA 3REFA 2EG5A 1F7VA 3VVBA 4O5AA 4UATA 2ZJ1A 1VMAA 2V4ZA 4HGRA 3QA3E 2KLBA 3UV3A 3QXCA 2W6ZA 1QG2A 4R40A 4KQ9A 1CQIB 1PL8A 1J0EA 1O7JA 1L5MA 2ODPA 2PWYA 2ZJYA 1YDFA 4P34A 3REQA 1K7EB 3K8OE 1JMVA 1G9XA 1N75A 1P4AA 1E32A 1QV6A 1IRXA 3OIDA 3DMRA 2P9TA 5BSRA 4E30A 3PD0A 5I7VA 2ACWA 2D1TA 4B46A 4XGRA 1A97A 1QANA 3Q7QA 3EIWA 2UAGA 4QNNA 3NEAA 1LCIA 3QE2A 5C0OE 1LBEA 4UHEA 2VCEA 3RQIA 3V1UA 4B4OA 2D2IA 3HYCA 2WT9A 4RKFA 1KQOA 5EE9A 1WKCA 3PC4A 3T38A 1B8PA 3ZHRA 4EHKA 4H4DA 2ZRIA 5BSGA 1Q21A 3OIUA 2G06A 4PZAA 5LB2A 3FOFC 4BNUA 1J99A 1XZ8A 3ZOZA 2YVLA 1T4MA 1FW8A 2W6JD 1PE0A 1E2NA 2Q9CA 2ZAYA 4NU8X 4QARA 1OAOC 5ESXA 5ADUS 5AM0A 1YB6A 3E22A 3FSJX 1FYVA 1N0IA 3NHKA 3WMXA 4JY7A 3W2TA 2AB0A 2ZTUA 1GGJA 3GGGA 3LUHA 4KFSA 4LHYA 3SX0A 2WWRA 3ITNA 5KNCD 2CWDA 1YRLA 2YH2A 2I2DA 1WCXA 1E99A 2GF2A 4HLQB 2WE8A 1Z62A 1KZ7B 4Y0VA 2O0MA 4A73A 1U7PA 2P1ZA 3CXRA 3DUWA 5DN9A 1KU0A 3CLVA 3QG1A 2HIGA 1I7DA 4MJXA 3D8TA 2JH3A 1SWWA 3R9XB 4LMPA 1F0KA 1K7XB 4UHHA 2CEKA 4ZO4A 5AJHA 1NJSA 1S4QA 4Q03A 3OHMA 4EKYA 4A82A 2HM7A 3GXBA 3NEYA 4MPJA 1U0NA 4R2XA 5J5AA 1FNNA 3ZWMA 4I4TF 3NH9A 2WSYB 4DA6A 1GY8A 4J8PA 3OE7A 4HJXA 2ZGVA 4RHCA 1LRJA 2ET6A 3D7KA 3JTEA 3C24A 4C7XA 3L0PA 1IVYA 4FZVA 5I7EA 4EHBA 5TS2A 1G66A 1X9GA 3JQQA 3OQPA 4UEOA 4EAQA 3HJFA 1Z2EA 3PRHA 3HO1A 3B3QA 1IN4A 1X1EA 4DNOA 1C3JA 2LCQA 4DMKA 2BEVB 4D81A 4KQKA 5EJIA 5LA6A 4DCCA 2BYTA 3AHGA 3CG0A 1W30A 3BWBA 1CJBA 3MTGA 3P97A 2EBWA 4IJ5A 5EIOA 1L4KA 1CERA 1HXHA 3VBEA 2CT8A 4OX9B 9ABPA 1ZHHA 1GZUA 1C9JA 1R15A 2QSZA 2RG7A 4N5HX 4X95A 3VR6A 5L7TA 3QNUA 2W6PA 4Q7JB 2WWXA 3O03A 4MUHA 1RHQA 3OZXA 3AHCA 3TINA 4HVLA 4JJZA 2Z09A 5KNBH 1EXVA 1ZA1A 4WACA 4E5PA 5CB0A 2PEZA 2ROQA 3OVMA 1GPMA 3H5IA 3LX5A 4W5QA 2XX3A 3OUZA 521PA 4R9UC 1L5QA 1G5RA 2D7CA 3LW8A 1Y8QA 1ZH8A 4AM8A 4S1PA 4DT1B 4RZ2A 2EJCA 5L8VA 1VKJA 2BWJA 4UVDA 3U2QA 1N2XA 2ZS7A 1VLVA 4HLNA 1W75A 3CSDA 1QFJA 3OJOA 4RPHA 3TOZA 1WD5A 4EY6A 4HVCA 3RSZA 4HY3A 2QTLA 4NHEA 2O07A 2Y2VA 4J7CA 2FOXA 4Q1DA 2WDPA 1OFGA 1I0IA 1YS7A 3PVZA 5EVJA 1TZCA 4E1VA 4X6YA 5TQ0A 1M2FA 1YFJA 1AF4A 1CRZA 2MSWA 1UPBA 2PXCA 3ABZA 3EDCA 1GNQA 2WUFA 3KU1A 3FLMA 4TM8A 3WLJA 4HDSA 3H84A 1JEEA 3ORQA 4F9TA 1XXLA 3KTOA 3O4VA 4I4TB 4JLVA 1NW6A 5JH7B 3QBEA 1Y5NA 1O58A 2YW2A 3B2QA 2KHZA 3HFSA 1MQ9A 3NAZA 1Z5NA 2VI5A 3PFKA 5BMOA 2OOKA 1TZJA 1U9ZA 3N75A 5AKJA 3WQHA 2HYDA 4TTPA 8ABPA 4FEYA 3Q0EA 1Z8DA 4R05A 4QBHA 1Y8RB 2QPLA 3STUA 1HPLA 2HZBA 4ESEA 2F4VB 1PFQA 1R66A 2QZ9A 1CUXA 1KWKA 5EQJB 1L5ZA 5T8KC 1F8XA 4FT2A 5G40A 1XZGA 4KX5A 1AE1A 2GB4A 4G67A 2VK8A 4FYVA 1WVMA 1BYUA 1YOVB 2XBUA 3T54A 2VWPA 2G82A 1BFUA 2X0FA 1SBHA 1T3GA 4QVGA 4AMVA 1GTJ1 1I13A 1NMSA 2CXNA 3CT6A 3GJTA 2AZXA 4A27A 1E1LA 4I1OA 1EFRA 1C29B 2AEEA 3IBYA 4B87A 1WMBA 2CXOA 4DIOA 1WMAA 3QX8A 1EJBA 3TW4A 4L8WB 3WI7A 3EDQA 2HCTA 3KYDB 5K8VA 3D8NA 3C15C 1IXKA 1L9XA 2GZ2A 1AKVA 2QA5A 3GLQA 2PR2A 1QHSA 3WNDA 1KHHA 4AY3A 5L3RA 4EPTA 2DPYA 3TRDA 3JWIA 4DF3A 4Y18A 4DG5A 1W6RA 1QE3A 5ED0A 4LXXA 1CS0A 3GRVA 4MPTA 4GPIB 4KMSA 3KZ1E 2JRCA 3RE1A 3DNFA 1XZFA 4FZRA 5FUXA 5AVQA 2WPNA 2C2GA 2ZI6A 3VOSA 1XTUA 4R1TA 3NB0A 4UCQA 4UFNA 1JZTA 1MP0A 2ONYA 3RBXA 2JLXA 2VWHA 5K7SA 4ZHQB 1M76A 2LGJA 1CKEA 3CKMA 3E3OA 4OAPA 3K09C 2Z6VA 1HE8B 7YASA 1NW7A 5CDSA 3R3SA 3KUDA 4LRUA 4O2BB 2E18A 1G64A 2QD2A 3V9PA 2Q3JA 5DNAA 5JLAA 3ZY3A 1LBQA 4CG1A 1GV1A 4ZVTA 1YWGO 3P2YA 3P9CA 4CTKA 1TKBA 1F2VA 3SVLA 3ADKA 4ALKA 1NVDA 3QVWA 3F4LA 5THKA 4BP8A 3EVGA 1RWPA 3E9NA 3AUUA 3VYUB 1JJIA 4FCTA 1ULUA 1IY8A 4CQLB 4F86A 5GIOE 1HL3A 4ABYA 3M6LA 1E6LA 5CCEA 4PWYA 5C53B 5EFZA 5A2QA 4D4LA 3DPSA 1NV9A 1QKJA 3GT4A 4EENA 1ISRA 3B9BA 1JHUA 3DE4X 1FFCA 3KJGA 5EIHA 1YL6A 4ZVNA 4PW0A 3BCHA 5A0FA 2R96A 2WINI 4BEVA 2IP4A 3KWJA 3LM8A 3FPHA 3MN1A 4ND2A 3FYDA 4O1IA 5E6RB 1TEVA 4RUKA 1YVDA 3TIFA 5J5VA 1X7YA 4M0CA 1HYGA 1TM4E 3G1WA 4U7GA 3SI7A 1NG9A 2XODA 2Z2ZA 4U7HA 3QKUA 2CUKA 1NUAA 4R2KA 3EXHB 3OPYB 3PV0A 2CMGA 3U1BA 3D1VA 4R7TA 3W2GA 2BCGY 3KQMA 2J5BA 1K6XA 1H9CA 3NJ8A 1O9BA 1PT5A 4KR7A 3JALB 5HQ3A 2P0YA 3SQLA 2O3RA 1ZVKA 2PH7A 2WIBA 2WU1A 4QTUB 5FYDA 1AK2A 1IQ0A 1LGYA 1HQKA 5D1NA 2NU7B 2UVPA 1A2BA 2NO9A 4WBNA 1NU6A