2PZFA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
224
Chain Sequence
SLTTTEVVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 224
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzfA00
2I1QA 4IXMA 4DLSA 1QG4A 4Q4LA 2G6BA 4ZPXA 4NP6A 2P67A 1P5ZB 1YKSA 1FTSA 3DOEA 3TUIC 4W5WA 3MFYA 4QJ4A 4OHYA 5EQTA 221PA 2A78A 4F38A 3GJ6A 3M0EA 3X1XA 1EWQA 2F1RA 2BIFA 2OAP1 2OG2A 4CEIA 1GL7A 2CLCX 2BJVA 2V1XA 4I1OA 2Q9AA 5H1YA 1YRAA 2ANCA 4NH0A 3WNCA 1VIAA 1EXMA 2B6HA 1A4RA 1Z6TA 3X2SA 2PX0A 1E79A 2D2EA 4FCWA 4S2EA 1ZC3A 4HAXA 4ILEA 1IM2A 3CKLA 4R98A 3QOFA 3PFIA 3L43A 2GF0A 4ARZB 1QHXA 1WP9A 2BVNA 2FEMA 2OV2A 2QGNA 4M22A 2OBNA 1ZYUA 2Q3FA 3K9GA 3IEUA 3U3OA 5FL7A 4B71A 4PZYA 4OJQA 3KQNA 2H92A 4EFMA 2GHIA 1M74A 2CLDX 2F1IA 4TSFA 4FI3C 3FB4A 1VYUA 1CJUC 1R0YA 4F4CA 1XMJA 3PEYA 4XIGS 2LCFA 4ZIRB 5C46F 1Z06A 2BOVA 2ZRHA 3GJXC 4Q9LA 4B3GA 1N6RA 2QP3A 1N0VC 5CLQA 3PEVA 2QM7A 1N2CE 3DKVA 4AKGA 2ZRFA 3F5FA 3PJRA 1K6MA 2VHJA 1X1RA 3B1WA 4PQFA 2ZYVX 2GJAA 4ABYA 4TYYA 4MRRA 4LYHA 1TNDA 4LRWA 4OJKA 3T1VA 2FA9A 1U9IC 1LY1A 3DZDA 4D81A 1UBFA 1Z22A 3VMFA 1NVWQ 4AIIA 4JKIA 3W5IA 2QA5A 1ZIPA 3NXSA 1S3SA 4BECA 3J81k 1G5TA 2QL6A 3KL4A 4FN5A 4IFEA 2ATVA 3R7WA 3VAAA 1NP6A 2IC5A 4A9AA 3W6PA 4W5JA 3Q8XB 4URZR 1OW3B 4QBIA 5B2ZA 2BDTA 3ZQ6A 4FWTA 6Q21A 1S0UA 1Z47A 5C4GB 1FTNA 3NKVA 1G17A 3TH5A 1UKYA 1P2VA 3LBHA 4KVGA 2YOGA 1U2RA 2R6CA 3BB1A 3P1JA 1E0JA 1Z0AA 1CU1A 3CZPA 1QDEA 4HLCA 1JB1A 3DPUA 4B2IA 2YWGA 1ESMA 3JZMA 4NCKA 2O52A 3C16C 1E9EA 1EFCA 3NTUA 2DWPA 2GJ9A 2QORA 5JECA 3ZD6A 1II8B 5F9HA 1J8MF 1K8RA 1GILA 4I99A 2FSHA 2KB0A 4QHTA 3BB3A 2JLUA 1Q3HA 4A2PA 3LD9A 3TK1A 2W83A 2A3RA 4IDNA 2VEDA 1NG1A 4D4MA 3PUXA 3VNUA 1KTVA 4M2LA 3HPRA 2HXSA 2ODWA 2QROA 1IQPA 2ZU0C 3C4JA 1VYVA 1E4VA 2ONKA 3PXGA 3B85A 2G9NA 5L8VA 4EPWA 4I1VA 3F8TA 4DLWA 1DVRA 2Z4SA 2D62A 4M9XA 3QXCA 4AD8A 2YWHA 1EWRA 3OE7A 4YMVA 3KJHA 1SQ5A 1ZNYA 3CWZA 2B8TA 4Q1CA 3GP8A 1OXTA 5K8LA 3FWYA 4PPGA 1CS4C 2RGBA 2G0TA 3Q3JB 5IHPA 2V8OA 3SS8A 1ZM9A 5FPHA 2HJGA 2ZI5A 2NTYC 5FR2A 2QMHA 4R2HA 1KO8A 1Q3TA 1SVLA 3AGQA 1OFHA 1YR9A 2QPTA 2F1JA 1MO5A 4JMPA 4DLVA 3GLGE 5FL3A 3K9LA 3AKDA 2QP9X 2PZFA 4WA7A 1N3BA 1VYTA 4Q9HA 2YYZA 3AP2A 2AK3A 3OEHD 2WJGA 4KV9A 2HT1A 2V9PA 3AKEA 1L8QA 2VHCA 2QQEA 4QC2A 3BERA 3PEUA 2ZYTX 1RKBA 1Z0JA 2J59A 2PMDA 3A58B 4PAOA 2Z5FA 3SQWA 1YU9A 4B3CA 1I2MA 1KK0A 5AJVB 4QNMA 3RVBA 1FQJA 2Z43A 1TAGA 4YXWA 4V0ME 5HE9A 2P3SA 4LYFA 5EE0A 3C15C 1M34E 1GVNB 1XTQA 3MCAA 1WXQA 2JJ2D 1R2QA 3C5HA 2V7QD 1II9A 4HAVA 4Q1FA 1E98A 3TW4A 5IT5A 1L4YA 5F9FA 2NZ8A 3GJ5A 3KX2A 2RKOA 5J4YA 3VHXA 3ADDA 2PEYA 1GZSA 3W34A 1IJEA 2W6JA 4PO8A 2RCNA 3NC0C 4OQXA 2XB2A 2GF9A 2B7CA 3OEED 2WWHA 3SE0A 2ZVQX 2EFHB 2XZOA 3M1IA 4EPVA 1IN5A 1YQTA 1RVDA 1U9IA 1D8TA 4BFTA 3TE6A 2QGZA 3QPUA 4HAUA 3MSXA 1D2MA 4TWZA 2W2XA 3OFNA 3RWMB 2F9MA 3X1ZA 4PPQA 1YZNA 1M7BA 4DLRA 4XWKA 3E70C 5EP3A 2REBA 4N3NA 2YKGA 2AD5A 1CP2A 3REGA 2EFEB 4TMTA 3K0FA 4LGMA 5G41A 3V4FA 1QHGA 2NG1A 2WZQA 1W48A 4LK2A 4PSKA 4QFMA 3EPHA 1IXRC 1XD2B 3RSOA 4MGYR 2CL6X 3L8ZA 1FUUA 2Y8EA 3IBGA 3NHBA 5DYGA 2CHQA 4FCTA 2G3YA 1SVWA 4Q5IA 3SYKA 4ASUD 3VU9B 1XPUA 2YHSA 2EU8A 4A0RA 1LFDB 1XXHB 4MKGA 3RS3A 3P27A 4MITA 4UNSA 3BC1A 3BGWA 2BBWA 3I4LA 2OCBA 4HI0E 4ARZA 2PH1A 5FBVB 2VLIA 1CJKC 2OAQ1 4S35A 4BFWA 4D6PA 1W1WA 4GT1A 2XOKD 5EE9A 1OV4A 3EA0A 2VHQA 4Q9IA 4HDQB 1R5BA 3H86A 1E2IA 1HV8A 3T15A 2B92A 2P0EA 2VP4A 1E2PA 4PZZA 1I2DA 1NLYA 4TL7A 2JATA 4ZIRA 1T3LA 4C0HA 4BZPA 3EC2A 4P0TA 3ZS8A 5HCIA 3ICEA 4RFSB 2GXSA 4Q1AA 1GUAA 4BFVA 4DHEA 4DKXA 1JQJC 3IEVA 3LVRE 1AK2A 2IT1A 3T35A 2C95A 3I5YA 3HYRA 1WMSA 3EARA 4LPKA 3SJZA 3LVQE 2AWNA 1GKIA 2GEUA 5DH9A 4V02A 1XEWX 3G5UA 2UKDA 3QXSA 4XOIA 2ZRDA 1EESA 4NDZA 2O8DB 4OKSA 3P4XA 2IYSA 3NEJA 1FZQA 1ZW6A 1X3SA 3TRFA 4Z8XA 2PLFA 2AHOA 1J7KA 2D74A 4C0QC 4Q1EA 1X8JA 5EE3A 2IWRA 4QNRA 2XB4A 1VG9B 2HYDA 2IYYA 3AEZA 1CTQA 2IYWA 4NKRA 2AN9A 1QVAA 2XJ4A 3Q5EA 3GLHB 1G8YA 3RSLA 1B23P 4OK6A 1XEXB 3BWDD 1BS1A 1MO3A 1CR2A 4TTRA 3DZ8A 3X1YA 1VG1A 3NIBA 5DNYB 3IQWA 3UMSA 4BRUA 3SYNA 3QKTA 4XTCS 1MT0A 4B33A 2VP5A 2D06A 3O8CA 3RRNA 1MV5A 2J87A 4IKEA 1CRQA 5EP4A 3WRXC 2WWGA 1T0JB 2ZI3A 1E6CA 4WW0A 1QBKC 4BFUA 3E1SA 1BMFD 2JCSA 4IOJA 4V0MA 2O8FB 1XXHE 2OCPA 2WICA 3T1TA 3FKSD 4D0GA 1G4UR 4OI0A 1NJGA 1XMVA 1KI4A 3A1TA 3NH9A 4LBVA 1II8A 2FN4A 1W47A 2E87A 5JEEA 3AF2A 4LSGA 2EFCB 1E3MA 3AKCA 4PAQA 1UM8A 1JR3D 2A5JA 1TMKA 3GEIA 2WWIA 1SVOA 1H8HD 1SXJD 2RHMA 4JSYA 1DAIA 3FYHA 3BS4A 5FOSA 1SHKA 4LC1A 5E95A 4A8JB 3THXB 3OIUA 1FL9A 4PSVA 1CJVC 1S2MA 2JLVA 4KFSA 1IN7A 3B5JA 4PR0A 1ZUIA 3EZ6A 4MQBA 2V55B 3SHFA 2PX3A 3NH6A 2ZSAA 2ZUDA 4JBWA 1HT1E 2WMOB 2FFBA 1SKYB 2IXGA 2VYFA 3CNOA 3SOPA 4WBSA 4BE7B 2GCOB 1IONA 4JL8A 2CJWB 1ETUA 1W2GA 3EAQA 2XZLA 4TYWA 3TSOA 3T61A 2W0MA 4PX9A 3AUYA 4PHGA 3OZXA 3GLHE 3WP0A 2P5SA 4HAZA 4DSTA 1E69A 1FW6A 4QRHA 3K8YA 1CJTC 4M0LA 1WB9A 4JLPA 5TMPA 3B9PA 1SVKA 4AKHA 1NG9A 1P4SA 4U7DA 4C7OB 1G16A 1FMJA 2UZ3A 1G18A 4C3ZA 1T8TA 3ECCA 2H7VA 4QHYA 1PZNA 4A0FA 4MDFA 1RPZA 1XTJA 2AX4A 3SBDA 3UANA 3CRQA 3CUEF 5LBIA 3TUZC 1FP7A 2IUTA 1KO7A 2AKAB 3OEHA 4DEXA 4Q18A 2ZQ5A 1LB1B 2R65A 2WWYA 3HR8A 3LV8A 5JSZB 2XTNA 3SI7A 1N0UA 4IVQA 2G0NA 1KI6B 4ACBA 3LWNA 1T4GA 1J99A 5JRZA 2F6RA 3FHOA 1NIJA 5FPKA 3FDIA 5DO9A 4NYJQ 1DE0A 2C9YA 4A4DA 5LD2B 2AWOA 3CB4A 3HDTA 4TLBA 2OCYC 1OFIA 1BYUA 2PL3A 3PVSA 3V00A 4XJXA 1NVVQ 1ZC4A 2JJ2A 4C30A 2V7QA 4DIEA 5KUTA 3PEWA 1XBTA 2GXQA 2FZ4A 1TQ4A 2G1JA 3QF4B 5G53C 4TSFD 3AVYA 1JR3E 2IL1A 2ZSDA 4MRSA 2VHUA 3PUZA 4ACAA 5JMTA 2C9OA 2VHTA 1JXOA 1OIWA 1EGAA 3BFVA 3OEEA 3GFPA 2VPPA 4OI4A 1SXJC 4ZKDA 2ZTSA 3SN6A 2CE2X 1F60A 2BMDA 3WMFA 2C8VA 1Q44A 1SKYE 1OXXK 2YV5A 4PSAA 1GRQA 4IDOA 4IEEA 4B3FX 5CIWA 4KBGA 2ZJ8A 5KOYA 5JCPA 2GJKA 1N6KA 2ZXUA 1MABB 2IS1A 3HP1A 3JVVA 4TMZA 3AVVA 1QHNA 1XD2A 2CK3D 5FBLB 4MKHA 4DJTA 5JS8A 4HUQB 2FE4A 1E2JA 1D5CA 2FEOA 4AWXA 4HZIA 4P4SB 2GCPA 5GVRA 3U3RA 1XXHA 1ZUNB 1P9RA 4LJAA 3TIFA 5FUWA 4MH0R 3FGNA 3MGCA 3IIJA 2KWIA 1OPXA 4IXNA 1KSGA 2WWWA 2NO6A 4U02A 1MRNA 2ERYA 3MWYW 1VKJA 1IBRA 721PA 1Z0IA 1ZM4A 1TF5A 3MLEA 4L16A 5CIQA 2QAGB 4YDSA 2WSSD 3I8XA 3DMDA 1KZ7B 5FBQB 4RFSA 3IDQA 4TTPA 3K0AB 2XOKA 4EFNA 1G7CA 5G3ZA 4BZXA 3KKOA 3GMTA 4C2UA 1EX7A 4AG6A 2EWVA 3A4MA 3IQXA 1F2UA 2QY9A 4CYMA 3IPYA 4JLAA 5GJVC 4E5UA 3R8FA 2O8DA 3KKNA 4Q03A 1OXSC 1R7RA 3CZQA 1BIFA 2FPKA 2AFHE 2ASEA 3WBJA 1W4BA 4RCYA 3KFVA 2IYZA 2FX3A 4TQAA 3AVQA 2XNDA 2ZANA 4II7A 5B57C 3GLHA 1ZUHA 5KTYA 1XEXA 1ZM3A 2ZS7A 2O8CB 2IW3A 3D8BA 2VP0A 3A37A 5FR1A 3WRYC 2YC4C 3QXXA 3ZJYA 5D3MB 1ZBDA 4JLVA 1LS1A 4BFYA 1DS6A 4QBFA 1W0JA 3H1TA 4NE2A 1UADA 3IUYA 3UWKA 1LVGA 3H84A 1YJ5A 1VMAA 1W36D 4XWAA 2IYXA 2ZRIA 2ZRBA 4G5GA 4Q48A 4JLNA 5M04A 4CIDA 2VP6A 1M7GA 3C14C 1OXVA 2L0XA 2WSMA 2O8FA 1NN0A 1CJMA 2CE7A 4WXPA 4KITB 3DHWC 4ZV4A 5K8TA 5P21A 1E9CA 3DEFA 2OBLA 3A4NA 1X86B 2GKSA 1P3JA 1DG3A 1W36B 3TJZA 3K53A 3LO5A 4A2QA 2QP4A 3ZZ0A 1RC8A 5KSPA 3WYFA 3TLXA 1BMFA 2PMKA 1UEJA 1NLZA 3CF2A 3FKSA 4CGZA 2ZRAA 4B6FA 3THXA 2QPOA 3F0TA 1KY2A 4URWR 4URXR 5KYKA 1MO6A 2V6IA 1E2DA 3A1VA 1RFLA 3ONWA 4HLQB 4K81B 4TT3D 2FG5A 1JR3A 2R6DA 2BCGY 3LQQA 4EPTA 2BMEA 5EXSA 4LJ6A 4HUTA 1H8HA 4PC6A 1KI3A 1SXJA 1UKEA 1DEKA 1H8ED 1OLOA 2WKQA 2ZUBA 4P31A 3CX6A 4PHHA 4E03A 4RCZA 4BGDA 3KQLA 3MUFA 3QPVA 4FMDB 4M9ZA 1X8KA 1P72A 4JLKA 2GCOA 3B82A 5AJWA 2ZAOA 1FX0A 4Z1MD 2CJWA 2ZYUX 2R62A 4BEBA 2GK7A 3B78A 4FW9A 5E4FA 2Z6VA 2QSZA 2IYLD 4GMXA 4Q9KA 1GP2A 1OYYA 3Q85A 4DWJA 4XH9B 5J4VA 3RS5A 3ADBA 5E7IA 1QRAA 1W5TA 4OHXA 4C7OA 2A9KA 1D9XA 2GCNA 3RS0A 3IILA 4FMCF 3W8NA 1TTTA 3JZAA 2LWIA 5KPDA 2EWWA 2I4IA 2X8AA 5JWHA 3W90A 5JEDA 4KAXA 3I5XA 3GJ0A 1G7RA 3ZLJA 3TR5A 1ZU4A 2Q9CA 2BJWA 1EX6A 4JBYA 1S96A 3K70C 4Z54A 5JSZA 3BE4A 1NMXA 4CEHA 3GLIA 1KI6A 5JWOA 3BAFA 2NO1A 3CR8A 2RH5A 3DM9B 4HB4A 5LPNA 3FTQA 2YINC 4QHSA 4YMWA 2RHDA 2ZJ5A 1GWNA 2CNWD 1Z0FA 1P2TA 3A1SA 3C8UA 2N1BA 1KI1A 4G5SA 4GL2A 3DOFA 5FBRB 4CW7A 4GZMA 4Q47A 2V6JA 4PXAA 5CB6A 2ATXA 2AFIE 3QF4A 3SYLA 5DSZA 3I92A 4GOJA 5BWMA 4X8LA 1W44A 1P75A 2AXPA 4L5BA 4DXAA 5DYIA 1CXZA 1F2TB 3AM1A 1KSJA 1Z07A 1IJFA 5EE5B 3UPUA 3K9HA 1KI7A 4UXHA 5A4JA 1R0XA 2O8EA 4IJMA 1WQ1R 1XF9A 3T1OA 2WVJA 1XMIA 2F3TA 4DRZA 1OKKD 1MABA 1U90A 3OF5A 2FWRA 4NTZA 4C0JA 3WYGA 2F43B 1BOFA 4LJ8A 1Z5ZA 1FPMA 1US8A 4HUQA 4G0NA 5DI3B 2N46A 2ZSBA 2ZEJA 5FBWB 5JJKA 4P4SA 1N0WA 1EFUA 1YHNA 5JHHB 3QVVA 1N6PA 5F98A 5JCZA 2CK3A 3L2OB 2XSZD 1DO2A 1KJWA 3CW2A 4Q1BA 2GBLC 1QZXA 3HR7A 2OFXA 1P73A 1T6NA 2C5LA 2JA1A 3I1FA 3OAAD 4UJ3A 2ORVA 5EXPA 3GLGB 2OXCA 1VCNA 1E2FA 2NGRA 4CEJA 1XD9A 2QAGA 2OBMA 3GFTA 5C4MA 1FNMA 1XDBA 4TN1A 2J7PD 2JLSA 4JLOA 2WIAA 4Q4JB 2F55A 3K0AA 5HZHA 1Z0KA 2ZPTX 2RAPA 1N5IA 3ASZA 4US2R 1DPFA 1N6OA 1COWD 2DBYA 4B73A 1Z83A 4EQ6B 1RZ3A 2C78A 1DO0A 3CH4B 4DCNA 4M1OA 2WSSA 2DFLA 1XWIA 2YNMA 2FV8A 2BHRA 1P60A 3U44B 1XRJA 4PC3A 3ZVNA 3OIYA 3MD0A 5CK4A 2BMFA 3IBYA 1YZUA 4LI0A 1WE2A 1TU3A 3BH0A 1NVUQ 2C99A 3OHMA 3PQCA 1X8LA 2FNAA 4GMDA 5TB5A 3ADKA 3N2IA 2O8CA 5AUPB 1NN5A 4H1VA 4OI2A 5GVSA 1W2HA 4HSEA 3EASA 1CF4A 2IA5A 1YRBA 4FMBB 4TZ0A 3LY5A 1AKYA 2QAJA 5D3MA 1G8HA 2X19A 1LTQA 5TY0A 2DFNA 4IEIA 2BBSA 3BK7A 2PCJA 121PA 4BFZA 4GBMA 1AS3A 1TL7C 2IF2A 3VR5A 3O8BA 5AUOB 2QN6A 4XVQA 1SZPA 4M9SA 4LV8B 2IYTA 1W0KD 2CCKA 4BLTA 4DCSA 4JVNA 5EXXA 3CIOA 3SQXA 4MRVA 4TLCA 2Z4RA 4Q00A 1VHTA 1Q21A 1R5OA 421PA 1YZQA 4B34A 5IRCD 3EXAA 4L15A 1HQYE 2Q3MA 2ZVPX 3WBKA 4U5XA 5CJPA 4KLZA 5HZKA 3AVXA 1E96A 2FPLA 2OLKA 4GOKA 3CNNA 3LNCA 2ZJBA 4BFSA 4CZ2A 4EPXA 1R0WA 4Q4HA 4QG7A 2F1HA 821PA 1KO5A 2WJYA 5KO2A 1KI8A 5KSOA 4D26A 2DWQA 1AQUA 4Y0VA 1CR1A 2IS2A 2W58A 3TVDA 3NDBB 4GDFA 2ZRCA 3R20A 3GQBA 3U7EB 1B0UA 4LJ7A 2RGAA 4C0SA 2W2VA 1YZGA 2FU5C 4NYIQ 2E1RA 4QL3A 3S1AB 3CR7A 1C1YA 5C1BA 4NCIA 3NHAA 3KB2A 1A2KC 2ERXA 2WV9A 4LBZA 3THWA 1F6BA 8OHMA 2GWHA 4A2WA 4TT3A 2J0UB 5JLJA 4MDEA 4WIAA 1EFTA 2YC2C 3KJEA 3MRSA 1OT3A 5FUYA 2OFWA 1H8EA 2P6NA 2FZLA 4KYIB 4BFXA 3AF1A 3KUDA 1TF2A 1G3RA 1Z6XA 3THYB 2HEIA 2ZE7A 2OILA 1GAJA 3U7FB 3A1UA 3ZIAD 2ZUCA 3U3JA 4M1SA 1Z63A 4Z1MA 3CO5A 2BEJA 1UEIA 4BUJA 5FTMA 5AWFC 1Y3AA 1NRJB 4LHZA 1KAOA 1SKQA 4RZXA 2GBLA 4C2TA 4YMSA 5BYJA 2ZSEA 4WAUA 1NIPA 1O87A 3BD9A 3GJ4A 2ZIAA 3LRPA 4OQMA 1TUEA 2WAXA 2WIBA 4GRAA 2HT6A 4LJYA 2QRZA 3QKSB 2YJTD 1P6XA 1LF0A 1ZAKA 3MJHA 2C04A 2QZ4A 3AF4A 5AR1A 3EA5A 3RRZA 1N6NA 1DOAA 1GSIA 2NPIA 4RZ3A 1N6IA 3OIVA 4IVPA 3R9XA 3QXJA 3PITA 3A1WA 2J45A 4OQNA 1UJ2A 4US1R 4EJSB 4C4PA 3U4QB 2FOLA 2GAAA 5KNBA 1RRFA 5FTJA 3T34A 4R7ZA 4XSGA 5KU1A 2RGNA 1Z08A 1WBBA 3GCGA 3WY9A 1EFRD 3UMFA 1G8GA 1GOTA 2ZROA 4F91B 3X1WA 2CNWA 2G88A 2OSBA 4Q4AB 3Q5DA 3MWJA 1JNYA 3D7MA 1M8PA 1NI3A 2A2ZA 4W9MC 2AKYA 1ZNXA 2NQ2C 2IYQA 1N5LA 3CPHA 1D2NA 4GSYA 3ZS9A 1DAMA 2ONJA 2H1LA 5ANRB 2C9CA 3SJBA 2UVQA 5AK0A 1NVXQ 2GZDA 3EZFA 1Z2AA 3G82C 4C9BA 4V0KA 1IY0A 3PV0A 1YR7A 2F43A 3NDPA 5KDLA 4UKDA 4LDJA 1WF3A 5DI3A 3GLFB 4LV6A 2XNDD 3UKDA 1G3QA 5KSYA 2RB4A 3GPLA 2Q6TA 1OKKA 2EYUA 5L3VA 2KJQA 3KJIA 1U0HC 1AA9A 1Z28A 3DMNA 2VF8A 2WPDD 1L7VC 2AL7A 4B44A 5IK2D 4PC7A 2W00A 5DE3A 4I1UA 1IHUA 2H57A 3H2YA 3LX5A 4TLEA 4XTRA 3GLGA 1W0JD 4BZQA 1R10A 4P32A 5A0FA 4C0AC 2ZE8A 621PA 3R9WA 3MAAC 1E9FA 1Y63A 2FMXA 5TDHA 3TBKA 1ZM2A 4LY6A 2XSZA 1E2LA 3N70A 1G3MA 1E9SA 4YMUA 3TNFA 3EZ7A 4JVLA 2KI5A 5E3HA 3OAAA 2ORWA 4DB4A 4DIDA 3RANA 2X2EA 1DAGA 4DDUA 1S1MA 2Q0HA 4DT1B 2XNSA 4KFTA 3ZZTA 3WHKA 2J7PA 1G3UA 2WJJA 1XTRA 1U94A 4KCGA 4A0HA 1C9KA 1R5NA 1T91A 3M6AA 4YMTA 3QKRB 1COWA 1Z29A 1GNPA 1E1QD 2HF8A 4KHZA 4BASA 1E2GA 3LLUA 2B7BA 1YZLA 3EZ9A 3GJ7A 4TMVA 1V43A 3C7KA 3AGPA 4F4IA 4JJKA 2PT5A 1NF3A 3QUSA 4Q1DA 2HLDD 2XTZA 4I4LA 3FFAA 2H18A 5B30A 4RSGA 3I32A 3QSYA 4NCNA 5AUQA 3GFOA 2QMOA 1JAHA 4KLNA 2ZI4A 2HCJB 4P3YA 3GLFE 1MO4A 1OE0A 1V5WA 4F92B 4DLYA 4NZYA 1TUIA 2GVZC 3CNLA 4W7SA 4PO9A 1J70A 4B3XA 2DR3A 4DDWA 4OQFA 5FPSA 2DHRA 2H8KA 2PZEA 1XJ0A 4ZDIA 5CYPA 4OK5A 4AY2A 4PAMA 1W0KA 3EPLA 4R9UC 3FVQA 3EIHA 1QG2A 2DY1A 1Q0UA 4UJ5A 3VR3A 4NYMQ 3CX8A 1KJYA 1PUJA 1AGPA 1XU4A 2FJUA 2ZRMA 3OESA 1ZU5A 3PR1A 4YLGA 2HYIC 3TMKA 2C98A 4HLDA 5FI0B 5TXGA 3CRW1 1KSFX 3S1AA 3SBEA 2ZRJA 3UWOA 4FXPA 4JZKA 1RRGA 4DVGA 5EE1A 3QENA 3WMGA 4F7WA 3VHLB 5AUNB 2O0JA 4UXIA 5CM9C 4WZ6A 4XVUA 1GL9B 4M9QA 3LX8A 2IEYA 1UKZA 4RD0A 2QQ0A 2PJZA 3EIQA 4BLSA 4N0EA 1I4LD 4P33A 1WCV1 2X1VA 1VIYA 1OFUX 1VPLA 2EQBA 2VTKA 4JYBA 3NVAA 4PQRA 3ZYCA 4QJ3A 4ZCIA 4QGAA 1MOZA 1UFQA 4TMWA 1MH1A 3BB4A 2GXAA 2WJIA 1AZSC 2IF0A 3D31A 4GOXA 1M2OB 4AURA 2VH5R 3O47A 4JLDA 1K5DA 4Q01A 4AYXA 2WJVA 2A5GA 4A8JC 2XTMA 1PLKA 1G6OA 4CF7A 2OLJA 1G3IA 2G77B 1E4YA 2ZI9A 2OCAA 4GNKA 4AI6A 4GP7A 4TLDA 4ZCLA 1A2BA 4C0LA 5A5GA 3ZIAA 3VFDA 4BRWA 2O0KA 2R6GA 3SFVA 2VSFA 5FOUA 3KKPA 3BORA 1OH5A 1UAAA 1UDWA 2DB3A 1W46A 1R6BX 1TU4A 3QKSA 1Q12A 3BFXA 3MWLA 1JEDA 2NMVA 3KB1A 3WNDA 2ZE6A 2ZR9A 1N5KA 3PUYA 3AVUA 2RGGA 5HPYB 5E7MA 4EJSA 4N1AA 2WM9B 2QI9C 2NPFA 2QUZA 2GJ8A 2PLRA 2MMCA 5BW8A 1NMZA 3ZVMA 2W0SA 4MA4A 2G83A 3IHLA 4MUAA 4DSNA 4W5HA 1JEEA 2CXXA 3VU9A 1OH7A 3K1JA 1XFAA 5SZKB 3VR1A 1NKTA 2P6RA 5C2JB 2Z0MA 1PV4A 1FNNA 1OHHD 3PIRA 1CEEA 2B8WA 1PLJA 4Q4AA 1RJ9B 1S4QA 5L3SB 1UBEA 2OM2A 1AZTA 1E9BA 2NO9A 2OFOA 2VF7A 3CONA 4HZUB 5FPTA 1E0AA 4M1YA 1EFRA 2BM0A 4PHFA 3W3AA 4AC9A 1KO4A 4YC7A 2IXFA 2QMEA 3B8HA 1A7JA 2HF9A 2P2LA 4V0OA 1G41A 1VCOA 2P65A 4DBLC 1KK3A 2J41A 2PEZA 1GITA 4EIWA 1E2MA 1AIPA 4EPYA 5DHFA 2O5VA 3RRMA 2FF7A 3DKPA 1P7CA 1ODFA 4LBWA 4EAQA 1Q1EA 5LD2C 4LUCA 3GLFA 2XGJA 4B35A 3PCRB 4DLZA 5GJWC 4R2IA 1WDTA 3DO6A 2YWEA 2O8BB 2CL0X 4HATA 2ZRPA 4L4UA 1FOEB 2KBEA 4PANA 1CR4A 2R6AA 3I3SR 1XD8A 3NWJA 3BJIC 3ZQJA 3RC8A 1G8PA 2ZRNA 5KSZA 4HAWA 2BEKA 2CCGA 3AH8A 1EG7A 1G5RA 4OHVA 2GRJA 4RZ2A 1E32A 1UBGA 4KO8A 3QY0A 3MWKA 2LKCA 2QMUA 3A6PC 1ZVQA 2OO7A 4KU4A 4B74A 2WPDA 5IK2A 2IUUA 1LV7A 3W3ZB 4WZBE 1E9DA 3B7GA 4RJLA 1RIFA 1AS0A 1G19A 4JJZA 4QGGA 2CVFA 1UDXA 1SGWA 2QENA 2QEQA 1RRCA 3SU8A 4PC2A 1T8UA 2WJHA 1MRSA 2VIIA 3I61A 4JL5A 2OUKA 4WVFA 3VQTA 1IY1A 4IW3B 1XPRA 3RABA 4JL6A 1XJCA 4UNQA 5SZIA 3CM0A 1QF9A 1P9WA 5EP2A 3UMRA 1XB2A 3GD7A 4CT4B 5SZHB 5FTLA 3SR0A 2REOA 3QKUA 2WMNB 4KJZA 5CDFE 3I62A 2XZPA 2R9VA 4D0NA 3BOSA 2V4ZA 4A8JA 3SFZA 3B1XA 1F5NA 4LBYA 3ZZUA 1AN0A 1E1QA 1KNXA 3QEOA 3U6BA 2EVWX 2QAGC 5J4HA 3BH6A 2IS4A 3RS7A 5HKKD 5H70A 2JASA 3LH5A 4DLUA 3I8SA 2NO0A 1JQLB 1JECA 1DAKA 3B60A 1PJRA 3R9IA 2WHXA 2CL7X 5FOTA 4DCUA 2JLRA 4RZUA 4QGFA 3KKMA 3K0EA 2HLDA 1W4AA 1VG0B 1ZJ6A 1JR6A 3HU3A 4OYHA 2IHBA 4ZKEA 3VNVA 1UBCA 3K0CA 2QPAA 4KSBA 1U8AA 2PJRA 4M8NE 1G7SA 1NJFA 1HE1C 4YONB 3N5CA 4HAYA 3AVTA 1U0LA 4B48A 1HEIA 4AKIA 4H9GA 1Z8FA 2BM1A 4PO1A 5EUQB 4Q19A 1S8FA 5CYOA 1RE0A 3Q7PA 3T5DA 2IUSA 3BRWD 5J4KA 3SZRA 1AM4D 4B6EA 4EUNA 5TARA 3KQHA 4ZO4A 1OF1A 2ZE5A 4JIMA 1E94E 4BQSA 3D3QA 4BPBA 1N5JA 5JI2E 4UNPA 5JJLA 5HR5A 3EWSA 5JRJA 2BKUA 5DI9A 4CVNA 3REFA 1HQCA 1GFIA 4O25A 1OFTA 2YOFA 3A4LA 2MSEB 4TQ9A 1D2EA 3EG5A 2Q3HA 3WHLA 1DELA 1GNRA 4HLUC 4LWZA 2JLYA 3AVPA 1LW7A 1HY3A 4HB0A 5DGXA 4UNRA 1W36C 4PC1A 3LBNA 3RAPR 3THOA 2C96A 3Q9LA 1GRNA 2ZRKA 4KFRA 3O8RA 2H17A 3VKWA 1PUIA 5KDOA 4P4UA 3K0SA 2FDCA 1Z3IX 4MGKR 4O3MA 5BN5A 4FINA 4D4LA 1GRRA 4O2RA 2H16A 3ADCA 1ZNWA 4D80A 4NBSA 4ZDKA 3ZVRA 5FOWA 5FOXA 4XWOA 2J0VA 1VG8A 2ZJOA 4DSUA 5DN6D 3H0KA 3K0FB 4NONA 5J4LA 1MR3F 3AVWA 1MKYA 1ANKA 4O0MA 5JBQA 2ODEA 4PFSA 1ZD8A 2REXB 2YOHA 4C0BA 1KO1A 4NYJR 4B32A 3B6EA 4URYR 4LOAA 5J47A 1XTSA 3W9YA 3L0OA 3IHWA 1IOZA 1QVRA 3U61B 1XX6A 1NVVR 2FGJA 3ETLA 1P61B 3LA6A 2XXAB 1Q1ZA 4I1SA 3CF0A 2F9LA 3RNLA 2FPMA 1KNQA 1VCIA 4LHXA 2NO7A 1HURA 4CDGA 3HU1A 3EWAA 2CVHA 4EPRA 5FUXA 1E9AA 5F2EA 2GVDC 2QE7A 3BFKA 4OK3A 2IYVA 1KKLA 2JJ1D 5IDVA 1E1RD 1RJ9A 3CLVA 3HU2A 5L3SA 1Z0DA 1IAQA 1ONBA 3W5JA 2WKRA 3EIEA 1I4TD 2BV3A 3PUVA 1TQ6A 2JLWA 5DHAA 3UATA 1CLUA 1T5IA 4HZUA 2OE2A 2ZR0A 4MKFA 2YVUA 4BLOA 2R6FA 4LHVA 1TEXA 2A5YB 1KDOA 4WOPA 5CDFA 3FHCB 1OHHA 2FSIA 2NOAA 4M1TA 5KNDA 3P26A 2QRNA 2SHKA 3VR6A 1NSTA 2F3RA 2A7QA 1Q20A 2XEXA 3VKHA 2W6ID 2EW1A 1JPNA 2OHFA 4QXAA 1G20E 4M4SA 3TGPA 4IFBA 3L0SA 4QKQA 4WZAE 1N6HA 1U99A 3ASYA 2IXEA 2O8BA 5EJEA 4OBEA 3E2IA 2RGNC 5J5CA 1TQ2A 3V9PA 1N25A 2UZIR 1II0A 4IVRA 2ANBA 4NHOA 4X8HA 3I73A 1DAEA 1TPZA 4Z51A 5CM8B 2VA8A 2IWHA 1KOFA 5B64A 1AQYA 3UG6A 2JJ8A 3U7HB 5CLLA 4H1UA 1ZCBA 2GILA 3B1VA 2IX3A 5JJIA 1R8QA 1GKUB 1KI9A 4A0GA 2FH5B 2I1VB 1WRBA 3P4YA 3U3MA 3KUCA 1XCGB 1KDTA 3EW9A 4URVR 5EZ6B 2QM8A 1VCMA 2ZS8A 4UXJA 1OB5A 1T0HB 4PZLA 2GDJA 5H8WA 1A5TA 2QT0A 5JZVA 4XD7D 3WYAA 3N2EA 5J40A 1DBSA 1SVSA 4Y0AA 4HLUA 3ZGXA 2NIPA 3QXHA 1GKYA 4UQOA 4FD2A 1O3YA 1Q1QA 2JLQA 4E07A 1SVMA 5BQ5A 4DLXA 1KHTA 1NSFA 5G40A 1YR6A 5EUMA 1TX4B 2P6UA 1YE8A 5LB2A 2GZAA 3FFBA 4NL4H 1VTKA 5JFGA 2ZR7A 3SC3A 3LLMA 3RWOA 2QTHA 3CWQA 1KDPA 3QE0A 3A8TA 3HWSA 3KFXA 1ZRHA 2JAQA 3BBPA 3HPQA 4TZ6A 1NY6A 3GJ8A 2J5XA 2FSFA 1GM5A 3FE2A 2BMJA 1R8SA 2C2HA 2EFGA 3LFUA 1U0JA 1Z2CA 4IRUB 4P4TA 5KDDA 2JLZA 1XPOA 1NL3A 3LAWA 3EZ2A 3IIKA 1OYWA 1DG1G 3WP1B 1P62B 2QTFA 4MRPA 4Q7MB 1UF9A 4TMXA 4LYJA 4RY2A 2ZETA 3Q72A 5BN4A 1GIAA 1ZP6A 1NMYA 5ELXA 4M21A 4TQUS 2XITA 4LYAA 2W2TA 3WNBA 2AK2A 4IDQA 4TL9A 3TUJC 5HKKA 1AJEA 4LX0A 5KNCA 2EFDB 4MYCA 3M4YA 2KSQA 4A36A 2D7DA 2PT7A 2AR7A 1GL6A 3NEYA 2VO1A 3A36A 4IDPA 1BYIA 3LBIA 2DWOA 3C5CA 4G5RA 2ZRGA 4D2IA 3KQKA 3U60B 2FFHA 2IEZA 3F3YA 3PENA 4E09A 1KYIA 1XZQA 3IPXA 1IXSB 2IHYA 2JGNA 3KXLA 4URUR 4PPFA 3ZVLA 4PTLA 4GFDA 4V03A 1NKSA 3X1DA 4QM6A 3WMEA 3FOZA 1XZPA 3PUWA 3L8YA 4AK9A 4D25A 1OSNA 1F3OA 5AJYA 4LCBA 3T5GA 3FHTA 1E99A 4JKYA 4G1UC 3DL0A 1S3GA 3KTAB 3CH5A 1JI0A 4X8OA 4PQYA 3AF3A 5CB8A 4CT5A 2IS6A 3QPWA 1E0SA 1U8YA 4LZZA 2YWFA 5LB4A 3KXIA 1XCMA 1ESNA 5GJBA 4QOSA 2X77A 2VP2A 1KK2A 3QVUA 4L9SA 3QIAA 3U5ZB 2IK8A 1LNZA 3CF6R 4QBGB 2GESA 3QNUA 1RW4A 2GEVA 4DC9A 2WBLC 2IBMA 4KODA 3U2QA 1KZGB 4DLTA 3QBVA 2VSXA 4ESVA 3CBQA 3CX7A 2GTPA 1F2TA 3QQ5A 4G01B 3OIWA 1EK0A 3E5HA 2QBYB 1U81A 1ZINA 1SVIA 4NMMA 4O2LA 2R2AA 4Q66C 2J9RA 4RD1A 5DLQC 4IOLA 2Q21A 1TADA 4TYQA 1SHZA 1W5SA 5TVKA 5DN6A 3HJNA 2J0QA 5EZ5A 2XXAA 3TSZA 2D7CA 2FFQA 1K5GA 3DM5A 4RFVA 1FQKA 2JDID 1NN1A 2JLXA 2NZJA 4KYUA 3QEJA 2A5FA 2AXNA 1R0ZA 4Q7JB 1J8YF 4YQFA 1T9HA 2D3WA 3B1YA 3B1ZA 3UG7A 2D4HA 4FWIB 2OEPA 2ZI7A 3P20A 3SJCA 2WKPA 3IO5A 1OH6A 4TTQA 3W6NA 2IYUA 3ICQB 4F4JA 3EPJA 4Q7LA 2FFAA 4IOKA 1Z6AA 1JJ7A 2VQSA 1IN4A 1JBKA 1X6VA 1AGRA 3UXMA 4DZZA 2ZM5A 3ZD7A 2HXYA 1GTVA 3LDAA 3VR2A 1IXZA 2DFKB 2JJ1A 3R8CA 1KMHB 1E1RA 5GJCA 1N6LA 2HJVA 1JPJA 2CDNA 3RYTC 2OXRA 4Q4JA 1F2UB 2WOOA 4L9WA 4RKFA 1G8FA 3HYTA 1LS6A 1OIXA 4PPNA 4Z8YA 2MSDB 4B2LA 1J90A 3KDSE 4EQ6A 2VRWA 5JHGB 1IN6A 1J2JA 1GDDA 3LXRA 4EJSC 4LHYA 3U3KA 1HUQA 5D3QA 4B3BA 1DAFA 2ORIA 2OZEA 1QHIA 1DARA 3CPJB 1BO6A 1TQDA 2H5EA 3U44A 1JAIA 4JSTA 1DTSA 1W4RA 5L3QB 2GZHA 3TSWA 4JLMA 2DPXA 2IYRA 4BLPA 1E2HA 1HT2E 1OIVA 3BH7A 2W6IA 2O0HA 1G5PA 2RGDA 4BWYA 2HV8A 4LC0A 3G0HA 4Q02A 4DUGD 5CITA 4TL6A 1ZNZA 5HE8A 3UK6A 4DDVA 2ZJ2A 1X1SA 5KHOC 4MRNA 2Q9BA 2GK6A 2QNRA 2OT3B 1Q22A 2C03A 2J1LA 3FMOB 2ZS9A 1OB2A 4OL0A 4RD3A 3Q7QA 4DSOA 4B75A 2KBFA 4PHTA 5AJZA 2JIZD 4OHZA 1E2KA 2PCLA 2RGXA 4K8OA 3T06B 1G7TA 4D4JA 4GP6A 4LHWA 2J0SA 3KJGA 3P32A 5CK5A 3RC3A 1NBMD 4BLRA 2FSGA 5B58C 1VDZA 1QHHB 3TQFA 4DCVA 1QHYA 1YR8A 5KPJA 2ODNA 2RGCA 4ZCMA 4TYPA 1G6HA 3IIMA 4NCHA 2GXUA 4JLJA 1DADA 5F3WB 2ZREA 5AJXA 1KKMA 1IN8A 4POAA 4WXRA 1RRPA 1E2NA 3L82B 4OHWA 2BBOA 4IOMA 3GEEA 2ZI6A 4N0DA 4AKEA 2CCJA 1G9XA 3WXMA 1S9DA 2K5UA 4XD7A 4X8MA 4AYTA 3AB3A 1OH8A 3L0PA 4AG5A 5FFMA 2A5DA 3K09C 1SXJB 4AYWA 1A1VA 3U6KA 4RD4A 2GJSA 2V3CC 2WAYA 3FMPB 5EP1A 1BKDR 1XEWY 4IHQA 4R71A 1L2TA 1SULA 2MMGA 2V1UA 3RS2A 3ZDQA 3SNHA 2ZAMA 1FX0B 4HDCA 4MYHA 3D6TB 3V4RA 1Q1BA 1KY3A 3UIEA 1NY5A 3IO3A 3SJAA 2KE5A 1HE8B 4XSHA 2EYQA 3QG5A 1HA3A 2J0UA 4DB2A 1NNEA 3QI2A 5IF9A 2BCJQ 1CBUA 4HB3A 1XMSA 4J0QA 5BYKA 1G64A 4E22A 2BWJA 4B3DA 2ZRLA 1WA5A 2WOJA 2ZU6A 2QTVB 1TF7A 2QT1A 3THYA 1NLFA 5E7JA 4B76A 3KQUA 1FMLA 4NYIR 1ZD9A 2DYKA 2GNOA 3AV0B 4MGZR 3RDPA 2ZITA 1OJLA 1JXMA 3B13B 1OXUA 4BLQA 2WWXA 3QF7A 3AF0A 3MJRA 4QGHA 4ZI2A 5JI3E 5JWRA 1YVDA 4MYUA 5LDDC 1UPTA 4CEHB 1EFHA 1XJQA 4G3XA 3GLIB 1W49A 2ODBA 1XCPA 1E79D 1M6NA 4ZI3A 2HCBA 3NG1A 3JVUA 4CEIB 1PVOA 2DCUA 1KSHA 2XJ9A 1U8ZA 4B2PA 4A15A 1P2UA 3AVOA 4CRWB 1RYHA 4A6XA 3NBFA 2R8RA 3KTAA 3L0IB 1NBME 3KXKA 4KBFA 4GI7A 5FL7D 1E2QA 2QE7D 4JYCA 4UNNA 1JALA 1A82A 1PLLA 3U4QA 5FOVA 4KSCA 1CIPA 2PBRA 2PZGA 1ZIOA 3U7GA 2I3BA 4Q7KA 2J7KA 4QJ5A 3K0CC 3FMIA 1KMQA 4A1FA 4F93B 1SXJE 2VBCA 3GEHA 1KJZA 4G5OA 5FPYA 1XP8A 3RRYA 3TVTA 4IDHA 1JJVA 5CJ2A 3ND8A 3VX4A 3AP3A 4MUBA 4KI0A 4DCTA 2O8EB 4EKDA 2ZYWX 3IKJA 3K9NA 1YZKA 2GA8A 3C41J 5EXTA 2QBYA 4HYYA 3RS4A 1XTIA 4HB2A 1QHSA 3SDZA 3QBTA 3TAHA 3VX3A 4DDTA 1W7AA 1DAHA 1US8B 2ZJYA 3QG1A 4KXFB 4B43A 1HTWA 4FIDA 4ITRC 5BN3A 3EPKA 5HCNA 3BIFA 1P2SA 4M1KA 3EX7C 3PG5A 4V0LA 2FGKA 1D6JA 4ZDWA 4TLAA 4LJ5A 3CPEA 3CRRA 2P5TB 3LQRA 2CHVA 2ZJAA 4NPHA 4LJ4A 4RD2A 4LJ9A 3W6OA 5DIFA 4ASUA 1S1CA 4JVMA 4MKIA 1ZMXA 1XNJA 1E0KA 4KVAA 4ON9A 4GPTA 2F7SA 3LXXA 4M53A 2A30A 4OQLA 3TKLA 1ZM7A 3IGFA 3R7WB 2HDNB 4K46A 3VTKA 4CEJB 2JDIA 2XX3A 3GLIE 1GNQA 1HYQA 3KZ1E 4KFUA 2CBZA 1Z6GA 1ZD1A 3K09A 4TMKA 2RMKA 5GADl 1KMHA 2QU8A 1E2EA 1KI2A 3TW8B 1XEFA 5BXQC 3FMFA 1VECA 2VSOA 1G4AE 1VHLA 4LV5B 1WBDA 5FH9A 4FCVA 1M1YE 1IY2A 1U98A 1KGDA 2MSCB 4NCJA 3LW8A 1BH2A 1FP6A 4BEJA 3GJ3A 4C0KA 2BKEA 4DT1A 3AP1A 3W8RA 5FTNA 1AKEA 3NBYC 2GETA 1FUKA 4Q9JA 1CULC 1NN3A 2ECKA 3DDCA 4M1MA 5L3QA 5UKDA 1ZCAA 5HTKA 4US0R 4D82A 3T1QA 4A92A 1HH4A 2C77A 4YDHB 3QKRA 3OE7D 1KIMA 2D2FA 2GAOA 1S9HA 3K70D 1E9RA 1R4AA 1LF5A 4JT2A 4RD6A 4JBXA 2N42A 1H65A 1UKVY 1XTKA 2QSYA 3RLFA 3AKYA 5FTKA 3NBZC 4JS0A 1CRPA 2WTUA 2OESA 1AS2A 2LKDA 4A82A 4EDHA 1M7HA 2Z83A 1FFHA 3BXZA 3SHWA 3K70B 5K8UA 3AUXA 1Q57A 1F48A 1CKEA 4DUGA 4HDOB 3VKGA 4V0NA 3NBXX 2RGEA 2X2FA 1QHHA 3ND9A 1KAGA 2CEAA 1ELOA 2QG6A 2AD1A 2E9SA 4HEJA 4MYTA 2J46A 2JIZA 3FPAA 5FUVA 4GZLA 1G1MA 3SEAA 1I4DD 3MMPA 1RYFA 3B9QA 1C4OA 3TQCA 2WWFA 2G1KA 3EC1A 2ZJZA 3ZH9B 4Q4HB 4TL8A 4EFLA 1NBMA 1Z6YA 1T3HA 3KKQA 1G21E 5SZJA 2ZSFA 4D4KA 3QJYA 2CLSA 4ERNA 1TEVA 2HUPA 3AQ4A 5FI1B 2BC9A 4YXWD 3CRMA 1G291 4A6PA 2VP9A 3CRVA 4L8GA 4LPSA 4U00A 3TR0A 3VR4A 4G5QA 1P9NA 4FMCB 4NU0A 1YZTA 4D0LB 3I72A 5DISB 3MG9A 5K8IA 4QM7A 4I81A 3THWB 2W6JD 5H68A 2CMKA 5L3RA 3LW7A 4FMDF 2TMKA 3DVLA 4ZDJA 2VL7A 2J3EA 2GEDA 4QBHA 4JLBA 5G3YA 4MGIR 4DEYA 1KDRA 2DFTA 1L4UA 2B21A 4XVRA 2CHGA 5C18A 3OFND 5JS7A 1W4CA 3TAUA 1D9ZA 3B2EA 3RHFA 4Q21A 1T3SA 4TYNA 4NYMR 2JEOA 5TV2A 2R44A 4OI1A 3H4MA 2XAUA 3O8DA 1CR0A 1KK1A 3FKQA 3NC1C 4JT4A 4JVSB 4M1WA 521PA 2YZ2A 1T5LA 4RVCA 3T12A 4ESHA 2BBTA 2V54A 4RKEA 1GG2A 4B47A
chains in the Genus database with same CATH superfamily
3WKBA 2O48X 3V4VB 3PYMA 3KDPA 3LZCA 1AN9A 1V95A 1YS6A 4FEEA 1I6LA 3EE6A 2ET6A 2G6BA 1NXXA 3TTYA 3GP3A 1R00A 3NHPA 3R4CA 2XVXA 2ZBDA 3DOEA 4LDRA 4RHYA 3E8MA 1L7AA 2HNKA 4BOYA 3MFYA 4PAGA 1KYYA 1CUWA 1JZQA 5JZOA 4RE6A 4EG8A 4K1XA 1GO2A 4O0LA 2DMRA 1WV0A 3D4OA 1J23A 4R0MA 2BIFA 2OAP1 5JCOA 3VSDA 1SU4A 2AUNA 1DDIA 2V1XA 2X0NA 3IXMA 4CEIA 3EMVA 5IH3A 2HDHA 5MN5A 1UC4B 1ATZA 3LCCA 1EGQA 3GRZA 3H9CA 4GHWA 4MHTA 1OC4A 2P9BA 3B3AA 5IT9A 3DS8A 1VIAA 1EXMA 1SIOA 3RO7A 2O2XA 3QYAA 3P9KA 1QDUA 5AK4A 4ND8A 4HVLA 4LWOA 2XQGA 3EXFA 1WSBA 4QJIA 5G1OA 1IM2A 4MUKA 3MC1A 4NHEA 3SQMA 3ZV6A 3L43A 4ARZB 2L69A 3MCWA 4EATA 2FEMA 4M22A 1Y1PA 1K7SN 1GQOA 3D5QA 4G5HA 3B6KA 1ZYUA 3PFHA 3IBFA 4R2JA 4JJFA 5FADA 1DJMA 3T7DA 4PZYA 5JYCA 1XZIA 3CH6A 3VJLA 1F4LA 5KJ1A 5IS2A 2F1IA 3VZSA 3EIUA 4OUKX 4UM5A 3W05A 4CKZA 2XIJA 4YWJA 1ZJWA 1WPRA 4OOFA 4DYHA 4PZ0A 3SF0A 2LCFA 2R66A 3T52A 1XDZA 2AI2A 3U3XA 1Z06A 3TRHA 1BDJA 4OOEA 4Q9LA 2P8SA 4EB3A 2Y6UA 4P4LA 3PEVA 4QLOA 2XE4A 3HACA 3SP1A 1GTZA 2JGDB 1XZFA 2OP1A 4LGYA 1Q83A 1OU4A 2FOIA 3SQNA 4OHMA 1K6MA 1MZPA 3L1IA 2PZBA 4QO7A 3EGVA 2JGRA 1CF9A 1UPAA 1OLXA 4EVRA 3S8EA 3SJUA 3R5JA 2QJFA 4ABYA 3HCOA 4CQMD 2E49A 1J1UA 3GFRA 4C4SA 4J1SA 3LC2O 1LY1A 4K86A 1NVWQ 3KAPA 4AIIA 2QZ9A 2ODAA 5LBTA 3Q0TA 2QA5A 2VH2A 4BU1A 3KHTA 2WA1A 3HXPA 3ZLVA 4JQYA 1PJAA 1RAGA 1VP9A 2WG1A 2XTAA 3PXXA 4FN5A 3KVVA 4RVSA 3TVYA 3AR2A 5K3SA 1BE8A 1QV9A 2H52A 3DE5X 4LS3A 3T5BA 1Q0SA 1SN7A 2IP4A 2O3TA 3PNOA 3Q8XB 4FYKA 3W6PA 3KKKA 1XTUA 5IUJC 2I22A 5C4GB 3DLAA 3IUBA 1C3XA 1P0IA 4FC7A 4M98A 4WCVA 1NV9A 4L76A 4NIMA 5B7NA 1HR0B 5GIPE 1QYWA 5KINB 3F7NA 2Q6VA 4J0JA 1CJSA 2YOGA 4KW7A 3TW8A 3TZ6A 2FPIB 3BB1A 4MZDA 2G5GX 1UJ5A 1E0JA 2VNAA 4YWHA 4JNCA 4U2DA 5TEWA 4C4AA 2PQMA 2Z3WA 1E9VA 4YRGA 2VDKB 4D8TA 3I2FA 3LFHA 1E3SA 1EFKA 3L7AA 1V9CA 2HBRA 3O3MB 1ESMA 1UXKA 4X64B 1ADYA 4XB2A 1L5LA 1E9EA 3NTUA 3ZPXA 1NI5A 4FBMA 4EI8A 1Y1QA 4EHJA 4R0NA 1R8JA 4I6GA 1QO7A 4W1RA 1II8B 4GLFA 2H4XA 2EKDA 2OKCA 2JFVA 2FSHA 2IE8A 3IQHX 5IJ0B 3WFIA 1FU4A 2EX0A 2WHRA 3RQIA 4A2PA 5KTNA 2IPMA 3RJZA 2PGXA 2A3RA 3VR5H 2VEDA 5GIOE 4Y2GA 1PR1A 4FHZA 3S68A 5HZGA 3TLAA 4M2LA 1C4WA 1P81A 3ODGA 4LMAA 1QFZA 3WI7A 1HNWB 1GHTA 1VYVA 3PXGA 4K6KA 1V1MB 4UUOA 1K08A 8MHTA 2G9NA 3H5VA 2PANA 3D64A 1BN7A 1DQNA 2J4DA 4I1VA 1H69A 2I3GA 5HRCA 4MUIA 3NYWA 2J6BA 1DVRA 1CERA 1UP7A 4J75A 3VV3A 4H18A 4MUXA 4YUZA 5B7PA 5I4CA 2VT6A 1QP0A 3TPCA 4YMVA 3CWZA 2B8TA 2I3AA 3MLBA 4Q7QA 3SQWA 1OXTA 4X20B 5IVDA 3BGIA 4PPGA 1CS4C 1VA4A 4TV9F 4EYKA 2O8BB 5IHPA 4DR3B 1ZM9A 2QIPA 3QP9A 1MORA 2HJGA 3H0CA 4QASA 1WXXA 4C29A 3FI9A 1E1LA 1JHXA 4JWTA 1BHO1 4KH1A 5JNVA 5ED4A 1V16B 1VC2A 1RXEA 2F1JA 4GX2A 4N8SA 3W7BA 4JMPA 1ULUA 1LV8A 3GLGE 2XODA 5B4TA 1Y3HA 2QP9X 3E7PA 3IVMA 5E1DA 1TOAA 1N3BA 2X58A 3KSUA 3TZEA 4GXQA 3GLTA 5FUBA 1KKUA 4ESOA 1LDEA 3KEMA 3IURA 5A06A 3RBXA 3ZWDA 3FN4A 2JC3A 2BGMA 2XUAA 3W1EA 4RDHA 4Y2QA 4JITA 3QFRA 1XALA 2FSVC 3JQGB 1P1FA 2PUEA 1OGYA 1VKOA 2J59A 2PMDA 1P33A 1L7OA 3T99A 1KF0A 2M2IA 1ECJA 5J5AA 1L5HB 1LPSA 2FI1A 1R16A 3NIFB 2W6CX 1ZW1A 2FVYA 4LYFA 5I6DA 4EKEA 3KD2A 3O4FA 1GVNB 1XTQA 1TKCA 2XMPA 3MCAA 4LNUA 1R2QA 4NZPA 5K3AA 1II9A 1THZA 4EY7A 5IT5A 4DW8A 2NZ8A 5DU2A 1AG9A 4QAQA 3KX2A 5J4YA 1A9XB 3ADDA 5DGHA 2PEYA 4CCAA 4UHKA 4PO8A 2RCNA 1JYSA 1N2CA 5I9SA 3UB2A 1FW8A 1XHFA 3ZXXA 4AECA 1QORA 4KSYA 1N9KA 1ZX1A 2WWHA 2GN0A 3SX2A 2EFHB 5IYZB 1CZUA 1XTVA 5BQ3A 2XZOA 1QRDA 3DL2A 5K3OA 1T1RA 3RTCA 1JIQA 1I1NA 2IIQA 1X7ZB 2PL5A 5CT8A 3TE6A 4U9HS 4D9GA 3JWEA 2JFGA 3PNMA 3HNOA 4HAUA 3MSXA 2XZDA 3A6JA 2OO3A 4ZK2A 1N3LA 2FZ5A 1QAQA 1M2HA 1VE1A 3PFKA 5A71A 2WTNA 3ZNNA 1BXKA 2QNIA 3MCVA 1Q77A 2H9YA 4TT8A 3VBCA 3ME5A 2AD5A 3I2HA 3R7LA 3WKDA 1JKXA 3U17A 4MVWA 3OD5A 3I28A 1L8LA 2LVBA 3IMCA 4E30A 2KHZA 3K0FA 5CA0F 3RFCA 3TRDA 1YR3A 1ZG3A 4TKUA 3SKVA 10MHA 3NNSA 4JYMA 4GI5A 2YN0A 4MLCA 4BKRA 1JEQB 1LJ8A 2WZQA 2HIGA 4FKMA 4GQAA 4D45A 3OLQA 1IXRC 3CNHA 3RSOA 1NUQA 3D7RA 1SURA 1U04A 1CFZA 3D5TA 4K9RA 4Z4EA 3NHBA 5DYGA 2CHQA 4Q5IA 3SYKA 3WYCA 4ASUD 3KG2A 1PQUA 1XQVA 2DUMA 2NVUA 1XPUA 4ALLA 1BQEA 1XKTA 1CRZA 2EU8A 2N47A 2P35A 1P77A 1XR3A 3D3KA 3I2JA 3KQOA 1PEYA 4P53A 2AOTB 4TPKA 4WN3A 1U4SA 5EWJA 2GN2A 3BWXA 5I5GA 5FBVB 2FUCA 3G5TA 2QVCA 1GD1O 1Y8AA 2HC9A 2VLIA 4UVIA 3UCEA 2DPHA 5H3CA 2OAQ1 3FIUA 2AX3A 3X43A 3DXFA 4MQEB 2XOKD 3O91A 3VNBA 2YW9A 5ETJA 1U5BA 4Q9IA 3JARA 1V11B 2E18A 2QTMA 4P38A 2PM8A 4JR1A 4PYMA 1VLQA 1R3UA 1HV8A 1RQLA 4RPJA 1BXRB 4HBGA 4CCYA 2RK4A 4EA8A 4EEZA 1FJ2A 3ITDA 3JV7A 3PHIA 4MR9A 5EHZA 4REOA 4C4ZA 3OY2A 3I6IA 5IZCC 1CPYA 3GOHA 1O6CA 4BZPA 3AV3A 3OZ7A 1U6JA 2LUOA 3ZS8A 2DT5A 4L8FA 1GUAA 4M55A 4BFVA 4OFZA 3ED1A 1JQJC 4MVJH 4DHEA 4QOHA 3T35A 2FWAA 3I5YA 5CNIA 3EARA 3OF2A 5FHQA 1OAAA 3SJZA 3V1LA 5GINE 3AESA 3IVAA 1KEVA 1LWNA 3L1VA 3NT2A 1BJKA 4LDNA 2AJBA 3B38A 4V02A 3GX1A 1U0NA 3G5UA 4O4JF 4XOIA 4D4IA 2ZRDA 2F3UA 4GQIA 1SG9A 1WMBA 2HCTA 2WVHA 4HS9A 4NDZA 4OGKA 4TUYA 2WF6A 5DT9A 5IULC 1M5RA 2O8DB 4DQVA 3TRFA 1X3SA 1H2FA 3FAZA 2PLFA 3FPCA 1J7KA 4GKAA 4HRVA 3WG9A 1J2UA 1IE3A 2X5JO 3GN1A 3BGVA 3AK4A 1X8JA 5EE3A 5JNTA 3PX7A 1Z45A 4N41A 4UCFA 1FFAA 2IYYA 2A1UB 4YMIA 1ZLYA 2AN9A 3S3TA 1QVAA 1UXJA 3U09A 1ZO8A 3GLHB 1G8YA 1Y9JA 3R3XA 1JH9A 1OLSA 2BFDB 4ZP1A 1B23P 3N2KA 2PGJA 4CQMA 1P2DA 2PIDA 4HPXB 4DQ0A 1DIRA 3BFPA 4BO1A 3QKTA 1MT0A 3I9JA 2VP5A 1YT5A 1K5HA 4B4DA 1K7FB 2Z08A 3I5UA 3RRNA 1NZFA 4WOJA 4R6XA 3BMXA 1MV5A 4IKEA 4Z9BA 3UOGA 1FU8A 3QEMB 2HMAA 4ECEA 4Q3DA 4CQLA 3P9PA 1E6CA 3PU6A 3UQZA 4G8JA 1Q16A 3EXIA 2FPXA 2JCSA 4R16A 1XXHE 2OCPA 2ZR8A 3AI3A 2I7DA 3JYOA 1K3UB 5ESWA 1NJGA 3BPSA 3NH9A 4LQ4A 4QICA 3RVQA 5LP1A 1VL6A 1W47A 5DBFA 3ID6C 2NZVG 4EGSA 3STHA 3AF2A 4YAFA 3W6UA 3RYCA 2EFCB 1RWXA 3CNEA 4FNGA 4BO5A 3GEIA 3VA7A 3QZUA 4LOKA 1NUPA 5LDHA 3K6SA 1AV7A 5K6RA 2QD4A 2Q99A 4TS9A 1AUOA 1C7JA 1RYNA 4AXBA 4JSYA 4NJEA 3QVOA 4INPA 3R0IA 3WTCA 4AZ0A 3KSAC 3MZ0A 4A8JB 3BWYA 1AUVA 1KXZA 3D2LA 3O3CA 3QU2A 5MGNA 2OV4A 3OIUA 3IVXA 1PT7A 4HY3A 2BGIA 1S2MA 2JLVA 1ZXLA 5ALHA 1IN7A 3C3KA 2JD1A 3MRVA 4EGQA 1NM5A 2XHEA 2QTLA 1SC3A 3FR8A 3ZI7A 3SHFA 3SS7X 1A76A 2QMZA 3JD2A 3OM0A 4JBWA 2XUQA 3ZUGA 3LY7A 4UDXX 1W1UA 4HNVA 2R86A 1ZSNA 2WHPB 1B6TA 2Y0PA 2TMGA 2IXGA 4BE7B 3H5AA 1FTQA 1HRDA 1TLTA 1HYEA 4TYWA 3WNZA 5FUQA 2XZLA 1P5HA 3QSGA 4JP5A 2C5AA 1ISJA 3WGUA 5IJ9B 5KX5B 3QEBZ 3TINA 1AXRA 1LTKA 1W4LA 4FYIA 5LWQA 1RLMA 1F7VA 4M0MA 3B3QA 1P1RA 1WZEA 2P5SA 1L9KA 4DSTA 1HOXA 2I54A 1TRHA 3K8YA 4QRHA 1FW6A 5BRNA 3B9PA 1SVKA 1ULTA 3UUFA 3REQB 1YKFA 4GU5A 1LZLA 3L0YA 3HVIA 3UO8B 1P4SA 5EJ7A 5EPEA 5ADUS 1X74A 1ZRNA 1FMJA 4WPGA 5C3UA 3ABOB 3IA2A 2Q3LA 2R7MA 3GCXA 5KI6A 1T8TA 4FU0A 1MUUA 1MFPA 2CXTA 3ECAA 3OIFA 1VHWA 4QHYA 3R9KA 3EPRA 1RPZA 3MOIA 4GZ3A 3TUZC 3UANA 4NDNE 2I2BA 3CUEF 3QNMA 2M1ZA 5HS6A 2OZLB 3A31A 1JHAA 2DHEA 2ATEA 1WUHS 4A03A 3Q8LA 2FZWA 1T9KA 4XB6B 5HVNA 4R1SA 2UYOA 4OM8A 4M88A 2WWYA 5JSZB 1NQOA 2XTNA 4FFSA 3SI7A 2C88A 3KHUA 2K2QB 5FFNA 5T57A 3U48A 1RIIA 1TZJA 4HDRB 4LF7B 3PQ8A 2RC5A 3OLXA 3WLEA 2OPBA 1WU7A 5FPKA 2ZZKA 3ERCA 1DE0A 4A4DA 1LX7A 1K6IA 2AWOA 5LD2B 4E5YA 3HHEA 3CB4A 2YQ4A 2LNDA 1YMUA 1A96A 2EP7A 3PVSA 2JFBA 5K45A 4WADA 4AULA 1U3GA 2A9VA 4XJXA 9ATCA 4DFDA 4DIEA 4O5OA 4FNOA 3FPBA 4GLOA 1DV2A 2AFHB 2OSVA 4QVGA 3ICWA 5JH7A 4EI9A 1XAHA 4CKCA 1I94B 2ZSDA 3FPLA 3G7NA 1M72A 3GDGA 3GGGA 2I65A 3PUZA 4K3VA 1R3DA 5DULA 4RORA 3E22A 3BDAA 1SU8A 3ZCPA 4K3UA 4UVGA 5LOVF 1JFVA 2C9OA 3BFVA 1EGAA 1ZVVA 1J42A 4OI4A 4EENA 4ZKDA 4DR1B 2CE2X 1F60A 1KZ1A 1U5CA 2XOXA 5CB0A 4N7RA 4LZNA 3OKPA 1Q44A 2YV5A 4I50B 4KO1S 3GN2A 1GRQA 2AH5A 2RK3A 1PYOA 2NYAA 4IEEA 4PSAA 2ZAYA 1MC1A 3E9DA 2IDZA 4G1CA 5EERA 5JCPA 2GJKA 3SZUA 2IS1A 3HP1A 1XZLA 1P4AA 3ORQA 2H59A 2Q8NA 2XUFA 3CPSA 3GT7A 3O4VA 2A6PA 4U2EA 1FFGA 2Q7DA 4MKHA 4DMGA 2PUVA 4KQKA 4DJTA 2DEUA 4KXNA 3ZHVA 1A5BB 4HUQB 1IG0A 1R74A 2GN8A 3ENNA 3GGCA 1E2JA 1D5CA 2FEOA 3V8EA 2X0JA 1TT7A 1TKBA 2HNAA 4KKXB 4OJTA 3U3RA 5DLEA 3W3AH 3MPUA 1XRRA 4PNHA 3JPYA 1OC2A 4NQZA 2QDXA 2W2KA 3QTBA 3WIEA 4IXNA 1JSZA 2WWWA 1U1CA 2MSWA 1W0CA 2UXCB 4WY8A 1QNLA 3NHFA 3LPCA 1HSZA 4P93A 4PFJA 5EJGA 2JRLA 2OHOA 3AUTA 3AW9A 2M6KA 4DG5A 3IUEA 2OHHA 5KYXA 2J5QA 5TNXA 3CLSD 1XYGA 3I8XA 3DMDA 3R3VA 1QIDA 3LOUA 4RFSA 4TTPA 3H1BA 4HBZA 4BTVA 3K0AB 5A4KA 1O0BA 2XOKA 4EFNA 3I2YX 1Z37A 3LTEA 5G3ZA 2ISCA 4BDSA 1W9HA 3DDSA 3DV0B 3LIPA 3D54D 1RD4A 2JGEA 1NKVA 2X9NA 1TIKA 4QYSA 3AEQB 5DXFA 3EQ8A 2FZEA 4CMKA 1M76A 4R8RA 4E5UA 2PGLA 2XDQA 4XWYA 3R8FA 3ZNPA 3VBEA 3A11A 2FPKA 3IP6A 4YAJA 4ARBA 2Z56A 1IK4A 4QXPA 6CHYA 4L07A 4DM3A 3PB3A 4B31A 2N3ZA 4H6XA 4MP3A 1WHTB 1UK6A 1P4GA 3LWZA 1F8YA 2GX6A 2RH4A 4L50A 3KPUA 1ZUHA 1N9ZA 1XEXA 2ZS7A 3AUSA 3HJCA 4I9NA 4IH9A 4LAFA 1VP3A 2AMFA 3KWJA 4C2BA 1Z7BA 3WAJA 3ZU3A 1E3DA 1JG6A 1Y9ZA 1H1DA 3G23A 3QXXA 5G0VA 4EMTA 2Z5GA 7REQA 4GLJA 1ZBDA 3WKCA 1BNCA 4AY6A 2O05A 4JLVA 1LS1A 4NV3A 3T7CA 4NESA 3AOEC 3MGKA 1NNI1 3AEUB 4JHXA 1W0JA 3H1TA 5IW8A 1CUZA 1JPVA 4BNWA 1LVGA 4FGUA 3BAZA 4XWAA 3MTDA 3X44A 2ZRBA 4G5GA 3BJRA 4IGIA 2PWAA 4NZNA 4O59O 4Q48A 4YAWA 3PCXA 3VDNB 5KMGA 4GKVA 2QD5A 2H6EA 2WSMA 2O8FA 1Y4UA 4BMNA 2WF5A 1CJMA 1OYVA 2CE7A 1TFRA 2FP4B 4KITB 4HWTA 5P21A 1LW6E 1E9CA 1ZN8A 4ZTBA 6ADHA 1XYYA 3CLUC 3DTTA 2DUJA 3L7OA 4UTZA 3H9EO 4IUBS 5FA8A 2WPNA 3ANXA 4GX0A 1P9OA 1W36B 1IHDA 3RU3A 3ZU2A 3L8FA 1P4JA 5KSPA 3WYFA 2LCIA 2Y27A 4YBZA 3TLXA 4AQYB 2DG2A 2Q3EA 3NOOA 4FE3A 2BUAA 4H7JA 2IGTA 4RANA 3UAWA 3VISA 2X7HA 3FBWA 4CGZA 4HX5A 1N8TA 1T15A 1ECLA 2QPOA 3KOWA 1XQWA 2W8BB 4MAFA 4OBWA 4R8MA 1GGKA 1QFSA 1T2CA 4V0RA 3GXBA 4CUJA 3ONWA 2AFIB 1MZVA 4Z9YA 2Y93A 2BGNA 4TT3D 5BWOA 4Z4FA 4MLZA 2BCGY 4IJQA 4EPTA 2BMEA 3KM0A 1M1NB 4HUTA 5SY4A 1FP2A 4DJJA 1UKEA 4BV8A 4EQZA 4WJLA 1DEKA 3ROTA 1I6WA 3FOAA 4J1QA 4PHHA 2O1EA 2R8PA 4Z49A 3SMVA 5TF0A 3WISA 2Q6LA 3QPVA 4G24A 5EMKA 1KMNA 1X8KA 1CVIA 3E15A 1LVUA 2O2SA 4JLKA 2P4QA 5AJWA 3HDJA 1ZHFA 1SQGA 2ZYUX 2GK7A 2NAFA 3K9QO 4FW9A 1R9MA 4L78A 2QRJA 1BFUA 3OPQA 3ROXA 4NK5A 2QSZA 4KVZA 3TRJA 4AS3A 4WCFC 1IWPB 2P6PA 3ZW7A 5KS2A 5FI3A 1MGOA 3Q85A 1ODSA 1K88A 2DX7A 2OD2A 5J4VA 2FFJA 3J81A 2BFOA 1YJXA 1NYLA 3KQWA 5EI5A 1H3EA 4IQFA 2DRIA 4FEAA 3U56A 2WP0A 3Q12A 3W8NA 5CFQA 4GLBA 3RYIA 2YZNA 3EDOA 3FWPA 4AZTA 3P9QA 1UPFA 2EWWA 4J43A 4KXWA 3K8QA 1FSZA 1FYEA 2AOVA 3H3XA 4KAXA 3DAOA 2WF7A 4RA9A 3FY4A 1G7RA 1GSAA 3ZI0A 3F3MA 4UDYX 3KUKA 3IRVA 3RVOA 1SBNE 2Q9CA 1DDGA 1FYFA 2R5FA 4PZPA 4E5KA 4EZEA 1L7EA 1NYTA 2ISQA 4Y9RA 4F2HA 4Z54A 3BE4A 1NMXA 2Q2OA 3M8KA 4CEHA 3O74A 3GLIA 1KI6A 3GEDA 3GOQA 3SS9X 3UW3A 2RH5A 2DFDA 3ZQKA 5LPNA 2J07A 2OUIA 3UWDA 3QJGA 1DUSA 2YINC 3FTQA 4W9RA 2B1RA 3BHMA 4QHSA 2RHDA 2CNWD 2EJWA 5DRTA 5D3ZA 3A1SA 1VXOA 2V7VA 3C2QA 4J9UE 4G5SA 3ZHQA 4BFCA 3DOFA 4HDKA 2D0IA 4EHNA 2DVMA 4KDFA 3GD5A 5EZYB 2RE8A 2MCFA 4WLVA 1OILA 5E6SB 4IDEA 5BSFA 1V7ZA 2ATXA 1V0JA 1VLZA 2X40A 1A7KA 1G60A 2OWDA 3O21A 4WRRA 4X1YB 2AXPA 4EG0A 1Z4NA 5J63A 5DYIA 4YI5A 4TKVA 2JBAB 2OBFA 4JDUA 4FC6A 1EDBA 1F2TB 5AI6A 2B4RO 5COBA 2WLTA 1R8XA 3JQBA 4I2VA 1IJFA 3REOA 3WLLA 3ZK7A 1M0WA 3ZJ4A 1ZGGA 1KI7A 1LRKA 3T1NA 1FYXA 4HXFB 1XF9A 4ZYZA 3OCZA 5BOSB 5MN4A 4JB8A 1I2BA 1MNQA 4X1IA 4X9XA 2JFNA 4CNBA 5A9SA 2R85A 2HJRA 3TSYA 1GCAA 2IGBA 3CW8X 2EKZA 2F43B 1RJDA 5ELMA 1JEJA 4UAJA 5DDIP 1FPMA 4II2A 4CT0A 5CDGA 3OICA 4AO8A 3M7IA 2N46A 2ZSBA 5ALGA 2FMTA 1H4TA 1E6UA 2V6MA 3IPRA 2ST1A 3NTOA 3JQ6A 4P4SA 4N9QA 1N0WA 1YHNA 5EA2A 2PD4A 2LGJA 3KPJA 3QVVA 5BSUA 3SX0A 2G4LA 1GUYA 3TB6A 3ER9A 2DSTA 2C9BA 2JLBA 1W19A 3C4VA 4BPRA 4EW3A 2XSZD 5HIIA 2R3SA 3LLCA 1DO2A 3MSCA 1GGMA 2J3MA 1TYAE 3IAFA 4WESB 4JI4B 3HR7A 2C5LA 3N0RA 4K8RB 3LU1A 4UJ3A 4E32A 4B3MB 3GLGB 3SC2A 2OXCA 3WGGA 1VBNA 2VYVD 3JYHA 4G8DA 2JVJA 4PWYA 4NAVA 3RUAA 3UICA 4UDOA 1FNMA 5SICE 5J5VA 1XDBA 4E21A 2E85A 2CLOB 1NDQA 3LT1A 1XQ9A 3NBKA 4H7FA 2FETA 3X2FA 2O7RA 4EELA 1Z0KA 4GICA 4EB0A 5DTRA 1M75A 1N5IA 1CHNA 1I2AA 5TR9A 3ASZA 2I0FA 1N6OA 1JGTA 1Q0PA 3S40A 3QXGA 4AJ4A 4O4IA 3LBFA 4B2YA 4EQ6B 3KK0A 5CD9A 1GTMA 4W5NA 4TUYF 2GYUA 3S2ZA 1EK6A 2A9QA 1MPXA 2QN2A 3AZPA 3CH4B 5EXEA 3GZJA 2DFLA 4IIEA 1WSDA 4YAOA 1FNDA 4I5DA 2IU6A 4QDTA 1G63A 2JZOA 1E3TA 3RVLA 2AZDA 1XXLA 5I7WA 3U44B 5EWMA 4AQ7A 2JW5A 1NX6A 3N8HA 1SBZA 1R12A 4CMIB 3WR5A 1BEZA 4C1NA 1NFFA 1YZUA 2C8KA 4EHHA 5ALXA 3BH0A 5ILGA 3U4GA 1U65A 1Z0SA 4CLOB 3DGEC 1FXUA 1SCNE 5TB5A 2I6FA 2ZVDA 3QX9A 3H8JA 4BQFA 5AUPB 1KMCA 5BNTA 2POCA 2FXIA 4FMBB 3V4LA 1AKYA 1I7LA 1KPGA 2QAJA 4HJXA 4NBWA 1J8VA 2A35A 4F8YA 1ZWKA 2HWWA 4GEKA 2DFNA 3HA5A 2HTEA 2R48A 5EJ2A 3PR2B 3AY3A 2XNCA 1AS3A 1EAMA 3IQEA 3IQDB 3O8BA 1FDVA 4Y2PA 4CN9A 4ZODA 1QGUA 2ACWA 3W4KA 5AUOB 2QN6A 1SUPA 2XB8A 4M9SA 4OHKA 4XVQA 4LV8B 2IYTA 2Z9CA 2EJCA 3HJAA 3BD7A 4HSGA 5MDHA 4BLTA 1DCKA 3CIOA 3K31A 2HWKA 1RJWA 1VHTA 2XBLA 1Q21A 4FPXA 4BNDB 3OE1A 3AUKA 3NHSA 1FFCA 4RS3A 3WLSA 3X1KA 4KQEA 4B17A 3DOUA 3OCVA 1B8OA 4L15A 4DJ5X 4KNVA 4AN1A 4PLVA 3FOBA 1BXZA 1A5AB 5CJPA 1O1YA 1WB6A 3C43A 4DG9A 4QGBA 5HZKA 1KVQA 5K03A 4NZOA 3CN9A 2XUKA 1R0WA 4Q4HA 1QIEA 2IEAA 1PJCA 1ZGJA 2WJYA 2Q4TA 1GPLA 1KI8A 4DPMA 1PNRA 4PINA 3DC2A 5KSOA 3F8WA 2X8LA 4Y0VA 5D1HA 1CR1A 1D0IA 5T3YA 4PX3A 2DBVO 1RHUA 1WZIA 1ZH6A 2PBFA 2RHHA 2W58A 4OLHA 4UHDA 3TVDA 5CEJA 2ZRCA 2GBCA 3GC6A 1B0UA 3GJSA 4LJ7A 2W2VA 1NQWA 2EFJA 4NYIQ 2E1RA 3S1AB 3T4UA 5HK9A 3CR7A 1N57A 3QU7A 4YK7A 3AL2A 4YNBA 1FYWA 2FPRA 5KNCH 1TAQA 1DP4A 3KB2A 4KN5A 2ERXA 5LL6P 3COPA 3DVAA 4LBZA 4E11A 1E1DA 5GY7A 4AW9A 4JDPA 1X1DA 2CUKA 3RVMA 3FYUB 1S01A 4TT3A 1LRLA 1U3FA 3FR7A 1QR6A 3OETA 1EFTA 4N82A 3KJEA 4WA8A 1NYRA 2JIPA 3C7AA 4MB6A 2PUBA 2J5KA 3EBOA 1YQWA 1OT3A 4YAKA 2PPVA 4BFXA 2A3NA 3PC3A 2QRPA 1IDOA 3KUDA 4S1NA 3N0TA 2HEIA 2ZE7A 5EXDA 5BSHA 4FX2A 1GAJA 5CCBA 3DBIA 2WSLA 5AP9A 3V2UA 2PFKA 3SZMA 3EUAA 3VPSA 4GUDA 4YP9A 5KOJB 4E14A 4RZXA 4QLBA 1J2EA 1BS9A 4YMSA 5BYJA 3C48A 5KYGA 1CUFA 2P27A 3N6XA 2VATA 1NIPA 2JZNA 2YFHA 3ANTA 4JFAA 4DADA 3RIGA 5BSVA 3GJ4A 4QUKA 4RMJA 2VK4A 2WIBA 4GRAA 5EMHA 3PHHA 4BN5A 4RV4A 4F9EA 2JHAA 3NANA 4XJVA 4C6SA 1LF0A 3L77A 2PUGA 3LKDA 1Z25A 2HK6A 1N6NA 4RDXA 1KJNA 4ALKA 2P9TA 3OIVA 2A0YA 1H05A 1YB6A 3U7QB 4CHTA 3PITA 2G25A 2O3RA 4OQNA 3S8MA 1UJ2A 3RSHA 1QWSA 3OQNA 3U4QB 2FOLA 3K72B 1RRFA 5C1PA 2YV3A 3MNFA 4D02A 3LCVB 5JH7F 1R4MA 2MINA 1WBBA 3ZWPA 1SPXA 2E7ZA 4U2GA 1X7WA 4EM6A 2W4IA 3CEJA 3CUWA 1Q0QA 1GOTA 3PI7A 4R5HA 3OZAA 2YRFA 5TQ0B 2D3TA 2ZROA 3P0RA 2WWVD 2CNWA 1AD2A 2G88A 3IJEB 5EJ5A 1A4IA 1ORDA 1QRRA 4Q4AB 1JNYA 1PJ2A 2IZ6A 5ENDA 4E5NA 5A04A 1V6SA 2HSZA 3EFBA 4RJ2A 3PK0A 2IYQA 1RMQA 1H1LA 4W1QA 4X6LA 4Y6PA 5E4YA 1RLUA 4UPVA 3TLEA 4GSYA 1KY5A 1YA8A 4KZKA 1VE9A 3ROKA 3ZS9A 2LTAA 4BIIA 5AW2A 2ASVA 1GTSA 2PUDA 1MD9A 1SQ6A 1K6JA 2UVQA 4MV8A 1OBOA 3HP4A 5AI9A 3EZFA 1Z2AA 1QU2A 2UYHA 3AL3A 4ZVRA 2HRZA 2BEWA 1BX3A 2VR1A 1A8QA 3PV0A 3MF4A 4JBHA 3TKYA 1F0KA 1V2HE 1YR7A 2XGSA 2OYSA 2WU4A 1UBMS 1ZRSA 3IQIX 1YB7A 4H0FA 4UKDA 4RTSA 1AZLA 2BISA 3OQIA 2OL4A 4Q93A 4LV6A 1NMSA 1G3QA 3DQZA 3GPLA 1E7WA 3MS7A 2ZWIA 3M34A 1U7PA 2Q4DA 1ONPA 4D92A 4BJ6A 3D4NA 4Q3CA 5TMDA 3EVZA 4J2HA 1AA9A 3UOAB 1WX1A 2WPDD 1L7VC 2J6CA 4B44A 1M6YA 5IK2D 3BEDA 3GVXA 5KWEA 5DE3A 4I1UA 1IHUA 4R1QA 2PSEA 1WOYA 1M9NA 3H2YA 3ROEA 5LP6B 3M6IA 4XDGA 4YO7A 3TSAA 3JSAA 1R10A 4P32A 1GGNA 1U7OA 3K92A 4WK6A 3OQPA 3CO0S 3MAAC 2ZATA 3GR6A 1E7RA 1HKHA 1ZOSA 2FMXA 3FWZA 5TDHA 3ZD8A 1ZM2A 3CV3A 1GFSA 3W06A 3VU1A 2XSZA 2VFAA 3N70A 2AVNA 1BTOA 1G3MA 1EVLA 2SCUB 1KEUA 2P2YA 1OAKA 4OXRA 5GQSA 3TPFA 5DKFA 4O2BB 5CT6A 5BORA 1OR8A 4UU7A 4AP5A 1EXDA 3QTLA 3CEMA 4RMGA 3PNLA 1Z6ZA 2ORWA 3EYWA 4M0CA 2VYVA 3S70A 4LVOA 3RANA 1NC1A 2X2EA 4DDUA 5D1NA 4KFTA 4IP0A 2WJJA 1U94A 2X13A 4I1YA 1QK4A 1C9KA 1RRVA 4RELA 1M34A 2AS0A 2VK2A 3DTVD 3ZHZA 3QKRB 2JI8A 4M38A 5A2QA 1X7HA 1ZICA 2HF8A 1OLUA 3DBLA 5AM0A 4BASA 3HUEA 1E2GA 2PNJA 2HA0A 1FVHA 3T7IA 1K06A 1IJBA 4H35A 1YZLA 2IHVA 3PDWA 1BQ3A 3GJ7A 1DRUA 2YIDA 4B82A 3N53A 3C7KA 4EHIA 5KU7A 4YCMA 4GVXA 1Z56C 1QHFA 5JNSA 1FYVA 1VBKA 2Z6UA 2YV2A 1BHQ1 4I4LA 2JH9A 4A26A 1HFKA 3ETHA 4RACA 1P17A 1I8TA 4OIMA 4YBRA 3HHPA 3VSCA 1PN3A 2Y71A 2Z58A 2R97A 4RSGA 1DMRA 1ICEA 3GFOA 4KB5A 2C54A 5JQGF 3QBEA 5IVIA 2WUEA 2HFJA 4MVJP 1MO4A 1OE0A 4F92B 1NR7A 3HN7A 3KOYA 4GC5A 5AKEA 2ID7A 1EHIA 2TMDA 4CTJA 4KAFA 1P39A 4DDWA 1LTHR 5GZ1A 2AEJA 2D1FA 4OQFA 1MEEA 1OFUA 1WEHA 1CIVA 2BRUA 3S44A 5A2GA 2IJGX 3HRHA 4ID9A 3TDKA 2ONYA 5CYPA 4FHFA 2G7MC 4PGFA 3WJ1A 4OA8A 3QHAA 2WVGA 2YMMA 3TPZA 4BE4A 1H6BA 3OLWA 2C42A 1T9CA 1XFDA 4R9UC 5E3JA 4ESEA 5BMVB 1A2QA 1HE5A 3FVQA 5BSRA 2EARA 1MQAA 2X1HA 2G7ZA 1SA0B 4ZJPA 1IRXA 1Q0UA 3TAXA 2DT8A 3DFZA 3FCAA 1GZVA 4Q6WA 1B76A 4XUDA 1ZU5A 3DONA 4PR3A 3TMKA 3KAQA 5CFZA 4BGIA 2GKGA 3O7MA 3SBEA 4TS3A 1K86A 4ARUA 2B78A 3IOMA 1LBTA 3PQ5A 1V8OA 3RT7A 1P2BA 3VHLB 3G2JA 5JDCC 5LFAA 3DV2A 1D1SA 3G1TA 1T1SA 2X2PA 4LX8A 4WZ6A 5FYQA 1GDTA 3GLSA 3A2KA 1Y7IA 2IEYA 4GW3A 5AW1A 2PVPA 5IABA 3E7DA 1UKZA 2QQ0A 2PJZA 3EIQA 4AJ1A 1USGA 2PH5A 4I6JA 4YAUA 1SQFA 3FOFC 1WCV1 1DB3A 1VJ0A 4KNWA 2QUHA 1VIYA 4MUFA 3IESA 3PXCX 4MWBA 4BO9A 3TZHA 4JYBA 3NVAA 4PQRA 3ZYCA 3UK2A 4MRMA 4QGAA 1UFQA 2NU7B 5KJEA 4I36A 1N2EA 2IY8A 3BB4A 4P7JA 1XZDA 1AZSC 3B2NA 3D31A 3U1VA 3W5SA 4HQFA 3N8DA 5IN4A 3O47A 1PZMA 1YSCA 5IXSA 4QQNA 1ICIA 1YASA 5EHGA 3UAYA 4AYXA 3HZOA 5L4SA 1FFSA 1SCAA 4HGRA 4A8JC 4D7AA 4DIKA 5HFAA 4OHOA 3CMMA 3GRUA 4IO0A 2J3HA 1CR6A 4GP7A 3BCSA 3GAMA 3QPAA 1L5KA 3ZWOA 1OI2A 1RWPA 2GLTA 3FI0A 3GZTB 4J6FA 3T0FA 1UDCA 5A5GA 2UYGA 3WLKX 1MBZA 3WLNA 1QAMA 2PAFA 1K3FA 5FOUA 5K6TA 1L0BA 3KQPA 5EMMA 1UDWA 3OI7A 4Y2TA 1K4MA 3QKSA 5C80A 1EVJA 3JQ9C 4HXYA 2V4UA 3AF5A 4PU0A 2MR5A 3LJKA 3EZYA 5JISA 3U31A 2NMVA 4R40A 4DMUB 4HMQA 1DTEA 5IARA 2ZE6A 1JKJA 2QHXA 3KSBC 2ZR9A 3AVUA 1BW9B 3T6KA 4UOQA 4F9GA 2RGGA 5BURA 5HPYB 5KSWB 1PWEA 2YXEA 3DHEA 2QI9C 4G36A 4N1AA 3ZE9A 2PLRA 2MMCA 1NMZA 4AZ3B 3ZVMA 3JWJA 2P11A 2XUDA 3EXHB 4LC9A 4MUAA 3QWAA 4W5HA 1JEEA 2B6NA 2PSDA 3GRYA 3VU9A 4F4HA 1R15A 5SZKB 2MJLA 1OH7A 4BKMA 3ETCA 1NKTA 1EJ0A 3SEZA 4Q37A 2GLXA 4IH4A 4KRGA 1FNNA