2PZFA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
224
Chain Sequence
SLTTTEVVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 73
structure length 224
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzfA00
3R9XA 1T6NA 4OHVA 2QRZA 4MRRA 1MO5A 2IS1A 2F9LA 5HCIA 4GI7A 3A58B 4II7A 4RKFA 3A6PC 4I1UA 2ZR0A 1L7VC 2RHMA 3NBFA 1YZNA 5H70A 3QXJA 4BFUA 4D0NA 4HUQA 3Q72A 1SKYB 4YXWA 3K1JA 4UJ3A 3DEFA 2EW1A 2H92A 3FB4A 4MGIR 3T35A 4AY2A 3QENA 1T3LA 2ODNA 4QOSA 3UG7A 1W7AA 1NL3A 2UZ3A 1TADA 2RGNA 2WPDD 3CKLA 1OFUX 4WZ6A 5BQ5A 3Q5DA 1EX7A 4DCUA 2CBZA 3E1SA 2JLQA 4N0EA 3LW7A 1BYUA 4RD6A 5EQTA 8OHMA 4JS0A 3BORA 2BC9A 4NP6A 1JXMA 1XRJA 1U9IC 2HXSA 4MKFA 4D25A 4HZIA 4NU0A 3NH9A 1WDTA 3OEEA 3HDTA 4IDHA 2CDNA 3GFOA 2CE2X 4Q4AB 4YMSA 2VF8A 4GZMA 4RFSB 2OCBA 1GL6A 1JPNA 4TT3A 5KNBA 2FSIA 2OT3B 3VR1A 5DE3A 3IIMA 5E95A 1AA9A 4V0KA 1KHTA 1R5NA 3AB3A 4KYUA 1FMLA 1N2CE 1SVKA 3AUYA 3EPHA 4JJZA 5AR1A 1H8HD 2PJZA 1OJLA 1TAGA 2ZYTX 5EXPA 3THYB 3NDBB 4PHTA 1TL7C 1N5KA 1SKQA 2QTVB 4D0LB 4KBFA 5F2EA 4WXPA 4Z8YA 5TMPA 3QVVA 4HUTA 5CJ2A 1OKKA 2ZRJA 1XCPA 3REGA 2R44A 2HLDA 4QNMA 1U8YA 4LJYA 4MDEA 1M8PA 4HB3A 2ORWA 1KK2A 2W2XA 2O8CB 3CF6R 1JI0A 1G18A 1W5SA 3B5JA 2NIPA 1N3BA 3MWYW 1E2GA 1KNQA 1E2IA 2OM2A 1XD2A 3KKQA 5J47A 1KJWA 4XTRA 3P4XA 5DSZA 621PA 4HAXA 5M04A 3SDZA 4KAXA 1GL9B 4RCYA 4V0OA 3W6PA 4DEYA 2SHKA 2ONJA 2K5UA 4PHGA 3ND8A 3QUSA 2FSFA 4KO8A 3ZYCA 2BMFA 4XVRA 1PJRA 4PQYA 2ZPTX 1JQJC 1RIFA 1E9FA 2DWOA 2MSDB 1LNZA 1N6IA 3KKNA 3MRSA 1RJ9A 4MH0R 3C5HA 3NEYA 4URWR 5EE0A 3HJNA 1OH6A 1D6JA 4PC3A 1TQDA 3B1VA 2DPXA 1IJFA 2BKEA 5JI2E 3UATA 2DYKA 2GCPA 4IDPA 1NN5A 1EGAA 3U3JA 4M4SA 1FZQA 3EPLA 2RGBA 4HDQB 4AK9A 2WKPA 3LH5A 2PX0A 5FTKA 1KI2A 4C3ZA 1IONA 4HAWA 1US8A 3HU3A 1JJVA 1QBKC 3NTUA 2VSOA 2ZU0C 3PEUA 4I99A 4M1OA 4B2PA 4ZDIA 4CEJA 4DT1B 1MH1A 4HZUA 4DUGA 4QG7A 5CK5A 4QHTA 2V1XA 3ZVLA 1ZINA 4QGHA 2YYZA 1CJUC 2A5YB 3RC3A 4DDWA 3D3QA 5FOWA 5L3QB 2ZE5A 2DFNA 3B6EA 4WOPA 3EASA 3U3OA 3TUIC 1SXJC 3GEEA 2FMXA 1G3MA 3GLFE 2B6HA 3DDCA 3KJGA 4NYIQ 2P65A 4WZAE 5CM8B 2A5GA 1V5WA 3U2QA 2CCKA 3A36A 4OQLA 1F2TA 4MYCA 2J0QA 3SC3A 3T06B 3PVSA 4LV8B 4QL3A 1P60A 1WQ1R 2PL3A 5JCPA 3AF3A 3EWAA 4KVAA 2Q9BA 2ZITA 3A8TA 5HKKD 4WVFA 4BFVA 2A30A 5JBQA 2GRJA 3CX7A 1HT1E 4QBFA 5LD2B 1T3HA 3T1VA 1RRFA 4QM6A 2NOAA 4OI1A 3VU9B 1KAGA 1NSFA 2EFCB 2W58A 1BYIA 1MABB 4KJZA 2A9KA 3SYNA 4LX0A 1KOFA 1UM8A 1NY5A 2BEJA 1VHTA 2LKDA 4LV6A 5IRCD 4G5OA 4L15A 5AJWA 1GNQA 1FUKA 4LHWA 3F8TA 1IY2A 1OPXA 1T4GA 4L5BA 1Z0JA 1W44A 4MYTA 5FPHA 2A5DA 5FOSA 1RW4A 1G3QA 3ASYA 4B3DA 3WRYC 4FMCF 1G1MA 1YR7A 2XITA 1RRPA 2PEZA 3NC0C 2V9PA 5EP4A 4F4CA 4JKYA 4LJ8A 3ICEA 1DE0A 1T8UA 4L4UA 5KYKA 2P6NA 2WMOB 4JLOA 2H18A 3UKDA 1WBBA 3BFKA 1U99A 3P27A 2REXB 3RAPR 2XXAA 5KSZA 4KVGA 4URZR 3QKRB 3SR0A 2QSYA 1ETUA 2DWQA 1ESNA 2BCJQ 5TY0A 1Q1BA 1P73A 1PUJA 3HP1A 3A1UA 3MG9A 5E4FA 2OCYC 3AGQA 3LX8A 5E7JA 2NZ8A 2IS4A 5FL3A 1YZKA 2XZPA 2FWRA 3GLHB 1GM5A 1P61B 3EPJA 5AJZA 4X8MA 1TU4A 2EFDB 4M9ZA 4QFMA 2V1UA 4MKHA 4AYTA 1IOZA 1R8QA 3L8YA 1XWIA 1VCOA 1GUAA 1GSIA 3H4MA 1Z08A 2CLSA 4C0JA 4D6PA 2NO1A 3VR6A 5KU1A 1U94A 2Z83A 1HQYE 4MDFA 1CRPA 1OKKD 3H84A 4Q9JA 1UBCA 2IYUA 5E7MA 2WJJA 5FPTA 5E3HA 1HTWA 3FKQA 4M0LA 4BEBA 5B64A 4LJAA 5IT5A 3I32A 1E2DA 2Q3MA 4A0HA 1M7GA 4JKIA 3GLGE 4CEIA 4BLOA 3R9WA 1NN1A 2X2FA 1Z0DA 3IBYA 1Q12A 2A7QA 2BWJA 3VHLB 1KMHA 1QHYA 2WIBA 1E2MA 3B1ZA 3HPQA 1DO0A 2QA5A 2P5SA 2C04A 4GOKA 1II9A 2GEUA 4IDOA 1S1MA 2WWXA 3O8BA 3TBKA 3BFXA 4P32A 2BM1A 4OBEA 4P3YA 5D3MA 1TUEA 5JWOA 1ELOA 3T1QA 2V55B 3CWQA 3FKSA 4TTQA 1N25A 1LW7A 1R5BA 3M0EA 1XEXB 2GAAA 3X1DA 1CULC 1NKTA 2DCUA 4P4UA 1II0A 1KSHA 4Q9LA 2GBLC 1TTTA 3X1WA 1ZYUA 3P1JA 4HLDA 4F92B 2BBOA 3LLUA 1JNYA 3QXXA 4FINA 3QI2A 1OV4A 4RZ3A 3MWJA 4ITRC 4US1R 1UAAA 1IBRA 4N3NA 2QBYA 3AVXA 1OW3B 1CJMA 2QRNA 5FI1B 3FVQA 4RD3A 1OYWA 2ZU6A 2WKQA 4NBSA 1VCNA 2DBYA 4M9SA 3CH4B 2J0VA 5FOXA 4EUNA 5FUVA 1WBDA 5FTJA 1KO4A 3FDIA 3QKSA 3G0HA 2OHFA 4MKGA 5UKDA 2ZAMA 1N6NA 3CO5A 4BLRA 4HAUA 4EDHA 2GCOA 1HV8A 2IC5A 4DUGD 3GJ0A 1E2JA 1G8FA 4PPNA 4IOKA 2HT1A 4URYR 1XJQA 3CRW1 2C03A 1M2OB 2QP4A 4BFYA 3RWOA 4HUQB 1W1WA 3MAAC 3W6NA 1QHNA 3ZVRA 3IIJA 1JEEA 1OH5A 1DELA 2I1VB 4KYIB 1D2MA 5DYGA 2I1QA 4DLSA 1D8TA 2WVJA 1AK2A 3OAAA 5G41A 4DB4A 2PCJA 3SBEA 5KNDA 3CONA 2AXPA 2R6GA 1Q1EA 4IXNA 1P9RA 1KI4A 3I62A 1XDBA 4N1AA 3EW9A 2FZLA 1KO8A 1GFIA 2F43A 4PFSA 2AWOA 2QN6A 2QU8A 3C7KA 1YKSA 2FFHA 3QXHA 5DLQC 3H1TA 5FR1A 4U5XA 3LLMA 2BMDA 3SU8A 4ILEA 2WJVA 4LSGA 3WNCA 1MO6A 4G3XA 2JJ1D 2WTUA 4MRSA 3RSOA 3SYLA 3P20A 3ZD7A 4HEJA 1DAHA 1YZUA 3BH0A 1Q0UA 1NLYA 2QG6A 4YLGA 1J2JA 4EPRA 1KDOA 4G5SA 2C9CA 4BECA 4IEEA 2BCGY 3F0TA 4DSUA 2XTNA 1W4AA 2XB2A 2ATVA 1X1SA 2HUPA 1E9CA 1FNNA 2QT0A 1NIPA 3LRPA 4CVNA 4TYQA 3FMIA 1U0LA 2ZUCA 1G5RA 3W34A 1RC8A 1SGWA 1VIAA 2YOFA 3I8XA 3QPUA 4DCTA 2V7QD 1TQ4A 2C78A 4V0LA 2KB0A 1Z6XA 3T12A 2CHQA 2ZI7A 1FTSA 3CRRA 5FTLA 4DIEA 2CK3A 2ZIAA 2FNAA 3L43A 4IOJA 3CZPA 1N0UA 3GMTA 1XD2B 1RRCA 3F3YA 3HU2A 1EFHA 1SXJA 4CYMA 3THOA 3RS3A 3EXAA 4RJLA 4G5GA 1YZQA 2J5XA 3PITA 4JL8A 3KB2A 5JFGA 4YDSA 3K8YA 1N5IA 2VP9A 1J90A 1SVLA 2QNRA 4GMDA 2FG5A 1E6CA 1HE1C 3AH8A 1ZNZA 2FOLA 4Q1BA 2AK2A 4JVSB 4D81A 3A37A 4BLPA 1W0KA 3B7GA 3G5UA 1UEJA 4EJSC 1E2LA 1XFAA 4DBLC 5CIQA 4E09A 1KJZA 3L8ZA 4UXJA 2G88A 1XD9A 3B1YA 3K0SA 4PC2A 3SJCA 4HAYA 1BS1A 1IN7A 4EFMA 5HZKA 2R9VA 4ZCLA 1US8B 1S4QA 3ZZTA 1UKZA 4LDJA 3RANA 3QJYA 4CEJB 4URUR 2DFLA 3OZXA 1E32A 2FU5C 4HZUB 1RYFA 4NYMQ 3T5DA 3U3MA 1ZM2A 4M2LA 2ZYUX 4EQ6A 1XPRA 3FKSD 2JDID 5GJWC 1R6BX 3BE4A 2IUTA 2QROA 1KTVA 2OLKA 3VX3A 4RSGA 1ODFA 4OK3A 2QAJA 3FMFA 2FFAA 3WYGA 4U7DA 4NCKA 4RZ2A 1OE0A 1W4CA 2KSQA 3GEHA 3T1TA 5DI3A 4S2EA 3SN6A 3GJ6A 1F2TB 2VQSA 3Q7PA 3ND9A 3TJZA 2O52A 2WWFA 5SZJA 3NG1A 5L3QA 4H1UA 4HLCA 1Z06A 3W6OA 1L4YA 2KI5A 2WZQA 4LC0A 3D6TB 4MGKR 1E4YA 3RS0A 1OT3A 4XVQA 5K8UA 3I5YA 5ANRB 1KDRA 1VKJA 2WPDA 5GJBA 3QXCA 4LI0A 5D3QA 1LF5A 2F1RA 2VH5R 3EIHA 1Z8FA 1G41A 4TWZA 4FMCB 4DB2A 3ZS8A 1OH8A 1NBME 1PLKA 2FSGA 3PENA 4KITB 2IWHA 3SZRA 2VPPA 4F7WA 3K0EA 1F48A 3TAHA 4RY2A 3QG5A 3B8HA 4WBSA 2J1LA 2WOOA 3F5FA 4DEXA 3EIEA 5EUMA 4K8OA 2WV9A 4JIMA 1EG7A 3CIOA 2WWHA 1R7RA 2GAOA 2DY1A 2MMGA 2XXAB 4Q03A 1P62B 3AVQA 1XB2A 4Q66C 4DLZA 2GZAA 5AK0A 3N2EA 4K81B 3WBJA 1RFLA 3KXIA 4GPTA 4QM7A 5H1YA 3K9LA 3K70C 2YV5A 2Z6VA 2Z0MA 1R2QA 3FFBA 3OIVA 4PXAA 1J99A 1XTSA 3WXMA 2FJUA 3T15A 4ZIRA 4ACBA 2WBLC 2WKRA 1PVOA 2GBLA 4Q47A 1G3UA 1WP9A 4M8NE 4DHEA 3KQLA 3AVTA 1C9KA 5TARA 1BMFD 3RRZA 1XTKA 3GJXC 1H8EA 3DL0A 4IHQA 3IQWA 1CR4A 1X86B 2KWIA 3KL4A 2WJYA 3KQKA 4KXFB 3VQTA 5FBRB 3IIKA 4Q4LA 1CKEA 1NRJB 4Q48A 3OEHD 5F3WB 3B2EA 3OE7A 3ZZUA 1NVUQ 2R2AA 4MGYR 4Q7JB 5J40A 5JMTA 2A2ZA 1KAOA 1JB1A 5J4LA 3JVUA 1NSTA 1ZC4A 4NCJA 1XZQA 3CRVA 5IK2A 4CEIB 3UMFA 1J7KA 3TAUA 1G6HA 4DLWA 1YZLA 2ZR9A 5LB2A 3C14C 1KMHB 5J4VA 1SXJD 3ADKA 1Q22A 3GJ7A 3UANA 2CL7X 5HR5A 3M6AA 1S9HA 4Z1MA 3KUCA 2H57A 1G8PA 5CB6A 3Q3JB 3DO6A 2JCSA 3IHLA 2G0NA 1T91A 3AF2A 1B23P 2VBCA 2QTHA 1F6BA 4UXHA 4AC9A 4XWAA 3C15C 2PT5A 3WHKA 1Z2CA 3UMRA 2Q6TA 4PZLA 2BJVA 4XWOA 1P2VA 1VHLA 1W0KD 2JIZA 2QP9X 3KJEA 1CP2A 2GILA 2IYQA 4E03A 2YC2C 3NKVA 3AKCA 4UNRA 2LWIA 2YC4C 2FEMA 4B3BA 3U7HB 1GRQA 1S3GA 2F3RA 1YZGA 3CR8A 1AKYA 1NN3A 3C8UA 4MYHA 4A0GA 1BH2A 2QBYB 2GVZC 4I1OA 4B3XA 1GVNB 4DSTA 5AJYA 1LTQA 2OESA 4JLPA 2A78A 1ZIOA 2FV8A 3WMEA 1HUQA 4BFXA 3H86A 2D7CA 1W36D 2ERYA 3CX8A 3QKSB 4PQFA 2D4HA 1E3MA 3GFPA 2ORIA 1LV7A 1W49A 3DMDA 2EYQA 2GCOB 1YU9A 3ZLJA 1QHXA 1KY2A 2CE7A 2WSMA 2XSZA 4M1KA 4RVCA 5AUQA 2P6UA 4WXRA 4LHYA 2YNMA 5G3ZA 4US2R 5JZVA 2F9MA 3QPVA 1AJEA 1BKDR 2O8DA 3R9IA 2FF7A 1XNJA 5C4GB 2CXXA 1P2SA 3SQWA 4P31A 2D2EA 2AD5A 1IXRC 2JA1A 5B57C 4UNNA 4Q1FA 1P9NA 1TMKA 2XAUA 4NYIR 3ZVMA 3KQHA 3B1XA 3G82C 3TW4A 4XJXA 1YR8A 3LDAA 3QBTA 3A1WA 4M9XA 3T61A 2AHOA 2ANCA 2ZRBA 1MOZA 4DC9A 1QVAA 4DLUA 3L0OA 4X8HA 2F43B 2B8TA 3QG1A 5A4JA 4A6PA 1AM4D 1EFRD 4CT5A 5G53C 2VP6A 4YMVA 4ZCMA 5JRZA 3O47A 4YMWA 2AXNA 4B48A 5L8VA 1RKBA 4TYWA 4HB2A 1IN8A 1G17A 2C99A 2ZRIA 1XTIA 4E07A 4ZKDA 4EJSA 3I72A 2ZJ5A 1Z3IX 4F4JA 2Q3HA 1G7RA 3ADCA 3AGPA 4RZXA 3RC8A 4EKDA 2OXCA 5AJXA 1E0JA 3RDPA 4WA7A 3DVLA 2Q9CA 3R7WA 4DIDA 1DAEA 4BZXA 2VIIA 4ZPXA 3GQBA 4RD0A 4URXR 5TV2A 2G3YA 5LBIA 2W00A 2DWPA 1XXHA 2CVHA 1MT0A 4GP7A 5FOUA 4GRAA 2AWNA 4HLUC 2ZS8A 1D2NA 4POAA 2AKAB 4Q1CA 4P4SA 5BXQC 3BH7A 2ZI3A 4JBYA 3QSYA 2NPFA 4LHZA 1QF9A 4NONA 4G5RA 2R8RA 4Q1DA 5EUQB 4MA4A 4LRWA 2C5LA 4M22A 2PLFA 1QRAA 3QF7A 3U5ZB 1G19A 4Q4HB 1KI8A 3SI7A 4Q9KA 1NVXQ 2WJIA 3KXKA 1SXJB 3LBIA 4PO8A 2CJWA 2EWWA 1FL9A 5FPYA 3X1XA 1JAHA 3X2SA 4KFSA 1KI1A 1YR6A 2FGKA 1H8ED 1T0HB 4C9BA 4B33A 3FHCB 2ZE6A 1G7SA 4ARZA 1ZUHA 2MSEB 2IXGA 4M1MA 3W9YA 3KJIA 4LJ7A 2C9YA 4TYYA 5KDOA 4QKQA 1FUUA 1WA5A 3EIQA 5H8WA 1UKVY 3OE7D 4KHZA 1YE8A 2ZYWX 3VMFA 1LS1A 2HYDA 3TKLA 1S0UA 4LZZA 1UKYA 4W5WA 5H68A 1SVIA 1W47A 3FGNA 4JVLA 3KFVA 2GVDC 5IK2D 1E0AA 3IUYA 4LHXA 2HEIA 3SBDA 3SS8A 5AUPB 1AGRA 2AK3A 1PLJA 1VDZA 2GXQA 1EX6A 1G8YA 4A0RA 4O2LA 1ZBDA 1W4BA 1OIWA 2OBMA 4Z1MD 1G7TA 1W36B 1KZGB 2WIAA 3U6KA 1ZJ6A 4JBWA 1G64A 2L0XA 5EZ6B 2ZTSA 3GLIE 2HCJB 4EFNA 2WWWA 1N5JA 1X6VA 2IBMA 3IGFA 4EQ6B 4LWZA 4AURA 2PLRA 1AZTA 1FTNA 2JIZD 3H2YA 2RGXA 5J5CA 3VTKA 1DVRA 1UKEA 2W6IA 3FWYA 5J4YA 4C30A 1AS0A 1E0KA 2ODWA 5L3SA 4CZ2A 5DI3B 3ZIAA 3A4MA 3HPRA 2NMVA 2OEPA 2Y8EA 1AN0A 1QG4A 4Q02A 1XTRA 3EA5A 4GZLA 4JLBA 4OI4A 4TLCA 4BQSA 3LQQA 3U61B 1SHKA 4OHZA 4U00A 2H16A 1XPUA 2XJ4A 5F98A 3X1YA 2IYVA 4G0NA 4GT1A 4QGFA 1N6OA 4Q18A 2Z4SA 4PHHA 4JLNA 3L2OB 5AWFC 1NIJA 3K9GA 5KSPA 2XSZD 2BBSA 4BRWA 1NG1A 2XTMA 1E1QD 3RRYA 4C7OA 3EG5A 2ECKA 4C0LA 4HYYA 1XJCA 2QTFA 3TLXA 4JLKA 5IF9A 1G4AE 2QMEA 3IDQA 4Q00A 3AVUA 4JBXA 2F1JA 1TQ2A 4PSKA 4TLDA 4BZPA 1VECA 2F6RA 3H0KA 4LYJA 2JJ1A 2B8WA 3CPJB 3CX6A 1N6KA 2OBNA 2ZQ5A 5JS7A 5K8TA 1DPFA 1VMAA 1UF9A 4M1TA 1UBEA 3V4FA 2WAYA 3CW2A 2YKGA 2J59A 1W36C 5JHGB 3BB4A 5LDDC 1E99A 1HA3A 4ACAA 4M1YA 1MRNA 1CU1A 4DLYA 2EYUA 2FGJA 1VPLA 2TMKA 3AEZA 4HATA 4ZIRB 3LXXA 4MRNA 2DB3A 1ESMA 5FL7A 5DNYB 2IF0A 5FH9A 3CPEA 1E9AA 2ZJYA 2V7QA 4KFRA 4NDZA 1UBFA 2EQBA 2D2FA 4XVUA 4AKGA 1N6RA 1U81A 4NKRA 3W3AA 2ODEA 4Q7KA 3WP1B 4BFTA 1YR9A 2XOKA 4DSOA 3IHWA 1SZPA 5KO2A 821PA 4QGGA 2HCBA 1II8A 1S9DA 4NCHA 5JI3E 4RCZA 1XCGB 1ZIPA 2GEVA 3RLFA 3SFZA 1OB2A 4B2IA 2F3TA 1AKEA 1G7CA 2OV2A 4B73A 5EXXA 5KSOA 4DRZA 2YOGA 2CNWA 2A5JA 5DN6A 2GNOA 1M7BA 1U98A 2ZRMA 3ZGXA 1KJYA 4LBVA 1SKYE 1GKIA 1EFTA 1KIMA 4FMDF 4TMKA 4IXMA 1E79A 3EARA 2XGJA 4LY6A 2X8AA 2EFHB 2OLJA 4OI0A 3KFXA 4B34A 2QEQA 5JHHB 1ZM3A 1IXSB 4TL7A 3BWDD 3AF1A 5BN3A 4AYWA 3ZVNA 5EE1A 1VG8A 4OQFA 3PQCA 1IN6A 2FPKA 2REBA 1EWQA 1LB1B 2BV3A 4C2TA 1Z22A 3E2IA 4JLDA 3SJBA 1OH7A 3DKVA 3TVDA 4R98A 4D2IA 4H9GA 1OXUA 1NMZA 3GLFA 3A4LA 5EZ5A 5DYIA 3GCGA 3U44A 3EZFA 1ZUNB 2VEDA 3LQRA 1ZRHA 2JDIA 3D31A 1NLZA 3LA6A 3GJ3A 1U9IA 1XMSA 1P5ZB 2ZI6A 1T3SA 1E2EA 1QHSA 2ZUBA 1N0WA 4CT4B 1G6OA 4QRHA 5G40A 4TMXA 1G16A 5DHFA 1IHUA 3B82A 3PJRA 1W5TA 2OG2A 1EFCA 2CEAA 4KFTA 2OCPA 4OQNA 1CR0A 5FBWB 1G291 4JYCA 5FUXA 4TL6A 4BRUA 2BBWA 3THXA 2OZEA 1FX0A 2W0MA 2GA8A 2VP4A 1P4SA 2ZUDA 4NMMA 4TL9A 2AFHE 4HLUA 4AG6A 2EFEB 2VHJA 4NYMR 1DADA 1Z07A 3LW8A 3U3KA 3WRXC 2O8DB 1E2NA 4YQFA 3K70D 3SQXA 2W6ID 5KNCA 2N46A 4PR0A 1XMIA 2XTZA 1XP8A 1VCMA 2NO9A 4D4LA 2CMKA 3ZIAD 5KDLA 2QPOA 3R8CA 1GDDA 3QKTA 1O87A 3TQCA 1GKYA 1DARA 2AD1A 1JQLB 4UXIA 3TSWA 1OXXK 2XNDA 4OK5A 2JATA 3QE0A 4HDOB 1Z6GA 2KE5A 1Z63A 3SJZA 5CYPA 4AIIA 4A82A 1CR1A 1I4TD 2GESA 2X77A 4LBWA 4OI2A 3FOZA 3U60B 2OUKA 3L0IB 3WY9A 3ICQB 2KBEA 4ZDWA 4ZI2A 4B3FX 4BE7B 4B74A 1K6MA 2ZRPA 3BD9A 2J9RA 1ZCBA 1X3SA 3EZ9A 1KKMA 1TF2A 1KO5A 2FA9A 1NJFA 4Z51A 3K0AA 1UJ2A 2O5VA 4GDFA 1GZSA 3QF4A 2NO6A 4CF7A 3WNDA 1VIYA 2ZREA 4LYFA 2QMHA 2R6CA 1JR3E 5GJCA 1TEXA 3A1SA 2J0UA 1BIFA 2ZJOA 3R7WB 3MMPA 4TMWA 3CRQA 4ERNA 4AI6A 1DEKA 3O8DA 3TUZC 4PSAA 3FHOA 1IY1A 4BLTA 4TQUS 5JECA 1YZTA 1XXHB 3BGWA 4X8LA 1KNXA 1BMFA 1PV4A 4C0HA 4NYJQ 2PCLA 1FFHA 4F91B 2YVUA 1VYTA 4P4SB 1ZU5A 4CEHA 1FP6A 4DZZA 4PC1A 1ZM9A 4KFUA 1I2DA 1KZ7B 1S8FA 4A6XA 3OHMA 4KU4A 1SULA 2YWEA 1RE0A 2KJQA 4B3GA 1NNEA 3SOPA 121PA 3TVTA 1OIVA 5FL7D 3OEHA 2W0SA 3SJAA 5JJKA 2AFIE 1DOAA 2DFKB 3GJ8A 5FOVA 4BUJA 1E2HA 5CK4A 1AQYA 2CJWB 1KO1A 2OAQ1 2XOKD 2ZJ8A 4DVGA 3NWJA 3IEVA 4EJSB 4Z54A 2R62A 3FTQA 4ARZB 1XD8A 1E2FA 3DZDA 3IILA 1SVOA 2VLIA 4Q4HA 4QJ4A 2YWHA 1R0XA 2QAGC 1QHIA 4O2RA 3I5XA 1U2RA 3KX2A 1NVVQ 4PX9A 2CVFA 3ONWA 2OXRA 2Q9AA 1DO2A 2W6JA 2WAXA 5FBVB 2CNWD 5P21A 2PZGA 2ZE8A 5DN6D 4JYBA 4MITA 4PSVA 2IEYA 1DAMA 5DISB 3ZJYA 5C4MA 1KSGA 2VSXA 2CHGA 4HI0E 4C0AC 1E79D 1XPOA 4LC1A 3Q9LA 4KI0A 2IXFA 1Z0FA 3DHWC 4JL6A 2HV8A 3ZH9B 1YVDA 4OKSA 1NP6A 1FQKA 1Q1ZA 1KYIA 3RRNA 3RS2A 2PMDA 3E5HA 5K8IA 3IKJA 1M7HA 1EWRA 3CBQA 1QG2A 5JJLA 4ON9A 4DDVA 1P3JA 5IDVA 2RGCA 3KTAA 1U8ZA 2UZIR 3KDSE 2R6DA 1EK0A 3C4JA 4RFVA 1Z6YA 4YONB 2PT7A 4EAQA 1DAFA 4TLAA 4AG5A 2WWGA 1C1YA 3K70B 4YMUA 4PPQA 2QPAA 2JLVA 4TQAA 5L3SB 2FPLA 3RYTC 3GLHE 1FQJA 1KMQA 3LY5A 3K09C 2VYFA 2G1JA 1I2MA 3AV0B 5TDHA 4QJ3A 5GVSA 2WICA 1TF5A 1JECA 3JZMA 1E2KA 1M6NA 4BEJA 4PO1A 1NG9A 3TGPA 1R10A 2IHYA 2JEOA 2P67A 4LOAA 4PC6A 3SYKA 2RKOA 3T34A 2QGZA 5JS8A 3WMGA 1IQPA 1KI3A 2ZS9A 5BN5A 2IS6A 2O8FA 4ZDJA 2GKSA 2JASA 1E1RA 2ZJZA 4KODA 2GDJA 1G8HA 3T1OA 4QXAA 2BBTA 1AZSC 4C7OB 4G1UC 4D80A 3M4YA 1J8MF 4A1FA 1EFRA 1OFHA 5JWHA 4ZDKA 2QE7A 2W2TA 1XEFA 5AJVB 3NHAA 2BMJA 5KPJA 4GNKA 3TMKA 4CRWB 4F38A 2ZS7A 3MD0A 1G3RA 2E1RA 3LBHA 3U6BA 2XNDD 4A2QA 2G6BA 2O0JA 1HH4A 1IAQA 5JCZA 4LV5B 4GFDA 3HR7A 4OJKA 1XBTA 2A5FA 4QHSA 2ZRAA 3QKUA 2GF9A 4B44A 3NBYC 4IW3B 1E2QA 3CLVA 5DH9A 1UBGA 2ANBA 4NPHA 4Q9HA 3QEOA 2C98A 2ZSAA 1CJTC 4OHXA 2LKCA 1JBKA 4TMTA 3I8SA 1KDTA 3OFNA 1II8B 4PZYA 4ZI3A 3ADDA 1VG0B 3IEUA 5DGXA 1IY0A 1R4AA 2ZSBA 3EAQA 1U90A 3K9NA 2G1KA 4FI3C 1B0UA 1K8RA 4KV9A 3S1AA 2IEZA 5C2JB 2GJKA 3MWKA 4KLZA 521PA 2IYSA 3RVBA 2LCFA 3MJHA 4FMDB 5EJEA 1F60A 3GP8A 4UJ5A 3AP3A 4FIDA 4OK6A 721PA 4CW7A 1Z28A 2CCJA 2IYLD 4LJ6A 3VKWA 1RRGA 1Z29A 1LF0A 3DOEA 4PO9A 3MWLA 2Q3FA 1V43A 1E9RA 5DHAA 1C4OA 2QENA 2YJTD 2X1VA 1WE2A 2JLSA 3PEWA 1GRNA 4UNQA 2VP5A 2QUZA 1W46A 2PZFA 2YWGA 5DIFA 3T5GA 4A2PA 3AM1A 4W7SA 4Q01A 3BOSA 4HLQB 1N5LA 2PX3A 1ZP6A 1I4LD 2DFTA 3DMNA 4RZUA 1KKLA 4US0R 4P4TA 2IYWA 2W6JD 1H65A 4D4MA 3REFA 3GLFB 3B9QA 3FPAA 4OQXA 1CF4A 3DM5A 2MMCA 4Q4JA 3U44B 3K0CC 2ZRNA 4DCVA 4PANA 4OJQA 2E9SA 5CIWA 1D2EA 1IN4A 1MO3A 4MUAA 2D3WA 1A7JA 1IM2A 4NH0A 1XMVA 3OF5A 5LPNA 1OXVA 4PPGA 4F4IA 1NI3A 5JEEA 4NTZA 3N2IA 3U3RA 3A1VA 3ZD6A 2GHIA 3CNOA 3THXB 1K5GA 2WSSA 1JXOA 2RMKA 3HYRA 3WYAA 4XSHA 5L3VA 5SZKB 1FX0B 2NQ2C 3V00A 1E9DA 5AUNB 1NBMA 4JJKA 3WYFA 4B75A 2J7PA 3TIFA 4O3MA 4O25A 4GMXA 2QQEA 6Q21A 1GG2A 5HE9A 3VR4A 5A5GA 1O3YA 3P4YA 4IKEA 4EIWA 1CS4C 1OFTA 1P2UA 3AVWA 1E1QA 1S1CA 4E22A 1TF7A 3AF0A 4UNPA 1OIXA 1T5LA 4FWTA 3SEAA 2GJSA 1NJGA 3L0PA 4ABYA 2J0SA 4TL8A 3PUWA 2OILA 2IX3A 1Z47A 2J41A 4TLEA 1OXTA 3IO3A 1CR2A 3HU1A 3K0FA 3ZDQA 5CDFA 2VF7A 3U7EB 3IO5A 2D62A 2P5TB 1E9BA 3TR0A 4C4PA 4LUCA 2QAGA 1E1RD 4UNSA 3DOFA 4I4LA 3IPXA 1E4VA 2HT6A 4IOMA 4GBMA 5LB4A 3RABA 1VTKA 3K0AB 2PJRA 3ZZ0A 5JLJA 1HEIA 1I4DD 1W2HA 3QF4B 2ZEJA 1Z0AA 2QE7D 3CWZA 3GJ4A 4C0SA 2A3RA 1X8LA 1GOTA 2ASEA 2H8KA 2YWFA 2ZRFA 4GP6A 2JLZA 4MRVA 3CH5A 2J0UB 3TSOA 4DLRA 3UG6A 2ZE7A 2ZVPX 1WXQA 1QHHA 2HJGA 2GF0A 1N6PA 1MO4A 4S35A 4FD2A 3BERA 4L8GA 4AWXA 2NGRA 3KUDA 1KI6A 2ZVQX 3AKYA 2NO7A 3SE0A 3RS4A 2O8EA 1N6HA 2HDNB 3OIWA 5B2ZA 2G77B 4LYHA 4CEHB 3L0SA 2ORVA 1HURA 2OO7A 4RD2A 1TQ6A 3HR8A 1NMXA 4IVPA 3QQ5A 1RYHA 3A1TA 2Q0HA 4A9AA 4LJ5A 4V02A 3GLGB 3PCRB 2JLUA 1W2GA 4PAOA 2G0TA 3B13B 3NBZC 2NTYC 2J87A 1QVRA 5SZHB 2HF8A 1DAGA 2XEXA 2OBLA 1VG9B 3K9HA 4AKHA 5FI0B 1CEEA 3U7GA 4FWIB 5CLQA 2ZAOA 3K09A 5EE3A 4NL4H 2GXSA 3TH5A 1F3OA 3CNLA 4TZ6A 1N6LA 4GOXA 4Q19A 5FOTA 3OFND 3PEVA 3SHWA 1T9HA 2RH5A 1OYYA 2IUSA 2C77A 3C41J 3D7MA 1K5DA 3AP2A 2FE4A 3CF2A 4LHVA 1GP2A 3DPUA 3NC1C 3B60A 1E9SA 2Z4RA 4TLBA 3I3SR 1OLOA 2PH1A 1CBUA 1VYUA 4MKIA 1R0ZA 4A2WA 3ECCA 4OYHA 4QGAA 1OXSC 3UMSA 2IXEA 2IT1A 1G4UR 1CLUA 421PA 1PZNA 2EU8A 4HSEA 1T8TA 3OIUA 1GTVA 1A2KC 2FEOA 3AUXA 3QXSA 4BWYA 3NH6A 2ZR7A 4A8JC 5JWRA 1IN5A 2YHSA 4JT2A 5J4KA 2BIFA 1Q57A 4ZKEA 1G5TA 2RAPA 3Q7QA 2QQ0A 2P3SA 3GD7A 4M1WA 2XZOA 2XX3A 2GEDA 4XWKA 3KKPA 3KTAB 4V0MA 1Z0IA 5FBQB 3NHBA 2JLYA 4LJ9A 1JJ7A 2FSHA 4P0TA 3W90A 2BEKA 2W2VA 1FNMA 3RNLA 2FZ4A 3MFYA 1P9WA 1XU4A 1MKYA 1W0JA 2F1HA 1AS3A 2ZROA 4A36A 1ZUIA 3CR7A 3ETLA 4B35A 3SHFA 4DJTA 3LNCA 1R5OA 1SVMA 1P7CA 1Q3HA 3CRMA 1CXZA 3THWA 3FMOB 3RRMA 1Q20A 3LXRA 4BLQA 2VTKA 5JSZA 1ZMXA 4NZYA 3W3ZB 2V3CC 4TTPA 1XZPA 2WWYA 4JLAA 4A15A 1L2TA 2QT1A 1R0YA 2EVWX 3KQNA 2WSSD 2O8FB 4EPYA 4UQOA 1Z2AA 2V6IA 4P33A 4A92A 4DXAA 3FHTA 2N1BA 4L16A 1L4UA 3BK7A 1NBMD 2IYRA 1G3IA 2J7PD 2C8VA 4XH9B 1ZNWA 3IBGA 3NBXX 4MGZR 4D0GA 1JEDA 1Z6AA 1ANKA 2F1IA 5K8LA 5GVRA 3TSZA 1KSFX 4BASA 1G9XA 1T5IA 4W5HA 3KQUA 1NY6A 2IS2A 1CTQA 4CIDA 3VNVA 1ZNXA 3BS4A 3EWSA 3VR5A 4TTRA 1KI9A 2CLDX 2CL0X 2JLRA 2QI9C 3VX4A 3D8BA 3NEJA 5FUWA 3VNUA 4XTCS 1COWA 2NPIA 2ZM5A 4FN5A 4OQMA 2IK8A 1U0HC 3O8RA 3BFVA 2JLXA 1Q44A 2JJ2A 3KB1A 4Q7MB 3M1IA 3VR3A 3SFVA 4B76A 1FP7A 4R2HA 5DI9A 3GJ5A 1HE8B 3KKOA 1F5NA 1KDPA 3ZS9A 2WWIA 2J3EA 1KY3A 3CPHA 3ADBA 1KI7A 2QZ4A 2IYXA 3K0CA 2VHQA 5FBLB 4D4JA 1Y3AA 2I3BA 3GFTA 4XIGS 4DLTA 3B78A 3IPYA 1GKUB 2D06A 1G8GA 3I92A 5GADl 2ZSEA 3EZ2A 4IVQA 2UVQA 4YXWD 1VCIA 4W5JA 3S1AB 1DG3A 3UXMA 4MRPA 4D26A 1LFDB 1A2BA 2W83A 4LPKA 4X8OA 2G9NA 2VRWA 3K53A 1CJVC 3FMPB 2XZLA 1XEWY 1KO7A 3TE6A 4NYJR 3BXZA 4MYUA 4JLVA 4N0DA 3I61A 1LVGA 1QDEA 2JAQA 4HB0A 3I4LA 5IHPA 4DLVA 2AX4A 4YDHB 4LGMA 2OFXA 2R6AA 3E70C 2CCGA 1X1RA 2ZRDA 2GCNA 2NZJA 3VKHA 4DSNA 3LBNA 2C9OA 1OFIA 5FPSA 2V6JA 4DCSA 4A0FA 1A5TA 4R2IA 1OSNA 1ZNYA 3OEED 1YHNA 4NHOA 3GLIA 1T0JB 4Q1AA 1KSJA 1EESA 3EC1A 3NXSA 4FCWA 5HTKA 3LV8A 4JSYA 4TT3D 2GJ8A 4B43A 4E5UA 1AGPA 1XTQA 3WBKA 4UKDA 1RZ3A 2BVNA 221PA 1YRBA 2WJGA 3P26A 3TR5A 2ATXA 2BMEA 2QGNA 2QMOA 4R71A 4Y0AA 1XCMA 4TN1A 4V0NA 4W9MC 3PUYA 1NVVR 1MRSA 4Q4JB 5EE9A 4M1SA 4GSYA 4WIAA 5ELXA 5KDDA 3W5JA 4KSCA 2H17A 1ZW6A 1UADA 1GITA 3RSLA 2PMKA 2O8BA 2BKUA 1DAIA 4HB4A 2I4IA 1ZM4A 2HLDD 3CZQA 4IFBA 1E94E 4YMTA 5LD2C 2RGEA 2GJ9A 3LFUA 5FR2A 4ASUA 1TNDA 3KJHA 3WP0A 1GL7A 4QBHA 1WCV1 4DCNA 1F2UA 4F93B 4U02A 4DWJA 5TB5A 4TZ0A 2UKDA 2VHTA 5EE5B 1WRBA 3U4QA 1Q1QA 1N0VC 2VP0A 1NVWQ 1WB9A 5HPYB 2IL1A 1DBSA 1P72A 2YZ2A 2RCNA 3NVAA 4QNRA 4L9WA 1GIAA 1W0JD 2DHRA 1UDWA 3LVRE 3JVVA 4DDUA 2ZSDA 3AP1A 1YRAA 3VHXA 3FFAA 1E9EA 2HJVA 2O0KA 3RS7A 5G3YA 2B92A 2IW3A 1IJEA 3VKGA 1ZD9A 1SXJE 2IF2A 3RHFA 4WZBE 1M1YE 4IDQA 5EP3A 3K0FB 5B30A 5BN4A 3DKPA 2Z43A 2C2HA 1U8AA 2ZRCA 5HCNA 2N42A 2BOVA 2C95A 2XNSA 3LO5A 2ZJAA 4IRUB 4LCBA 5E7IA 5CITA 4RKEA 3BB3A 1TEVA 2QAGB 5FUYA 4B47A 4QC2A 5J4HA 1RPZA 1QZXA 5KTYA 1A82A 1EFUA 3AQ4A 3OESA 1EXMA 1XF9A 2J46A 1XTJA 2IWRA 4EPTA 3Q8XB 4ZO4A 4JLJA 4Z8XA 4JZKA 3PIRA 4PC7A 4C2UA 4Q7LA 3CB4A 3N5CA 2GXAA 2AKYA 5L3RA 2ZANA 1TUIA 3R20A 3UWKA 5F9FA 2ZRGA 4GL2A 3AVOA 2OCAA 1G5PA 3QVUA 1QHHB 1XJ0A 2ERXA 2QPTA 3RS5A 1A1VA 1ONBA 4A8JA 4JVNA 4KCGA 1ZC3A 3ZQ6A 2IUUA 4TSFA 2VHCA 1HT2E 1KI6B 1IXZA 3EZ6A 3WNBA 2O8EB 1Z83A 3AF4A 4L9SA 3VAAA 4BFSA 4D4KA 3AVVA 3NDPA 1COWD 3BC1A 1SVWA 1Z5ZA 3BAFA 2VSFA 5TVKA 2ZYVX 4IEIA 3MSXA 1FMJA 5EP1A 3VFDA 3B9PA 5JJIA 2JJ2D 4O0MA 1E2PA 1WF3A 3C5CA 2J45A 1FOEB 3QEJA 3B1WA 2ODBA 3I1FA 4NCNA 4IJMA 4LBYA 4IVRA 4RD4A 1OHHA 5EP2A 4ZCIA 2MSCB 2B21A 2GK6A 2IHBA 2IYTA 3AVPA 4I81A 4R9UC 3J81k 2ZRLA 3GLGA 1NF3A 4G01B 2YOHA 4FMBB 3PUXA 1MR3F 2BJWA 2YINC 3Q5EA 1JAIA 2QY9A 4QBGB 2AR7A 4HAVA 2VO1A 4FCTA 2WOJA 1S2MA 5CYOA 5KUTA 4XD7A 1TX4B 1FW6A 5TXGA 5CB8A 3UPUA 1XMJA 1S96A 1BO6A 4Q4AA 2NG1A 2PBRA 4RFSA 3IQXA 4BGDA 1ZM7A 3Q85A 3PUVA 5FFMA 2ZJBA 4Q9IA 3PEYA 4JLMA 5FTMA 2O0HA 2PEYA 2ONKA 2HXYA 1RVDA 2QORA 3MLEA 3QBVA 2JJ8A 1LY1A 3FE2A 4HDCA 2OAP1 4BFWA 2QM7A 4C0QC 1ZAKA 4I1VA 4LPSA 1DTSA 1E69A 4ESHA 1Q21A 3THYA 2HYIC 4JL5A 2OFOA 1U0JA 2FH5B 1GWNA 1UDXA 1ZD1A 2P0EA 1Z0KA 1S3SA 4MUBA 3TK1A 4KLNA 5BWMA 2B7CA 5CLLA 1CIPA 1QHGA 1E98A 4TQ9A 1Z6TA 2RGAA 3CM0A 5KSYA 3CNNA 2O8CA 1CRQA 2D74A 4JMPA 3EZ7A 4A4DA 3DM9B 2BHRA 4QJ5A 1VYVA 3B85A 2RGNC 5F9HA 4BPBA 2QL6A 1M74A 1X8KA 3MCAA 3C16C 2IA5A 4EPXA 2ZRHA 2GZDA 4IDNA 2F55A 4M53A 1RJ9B 1OF1A 3THWB 3W5IA 5C1BA 3PG5A 3LVQE 5JSZB 3BH6A 2JGNA 3UIEA 1L8QA 3GPLA 1TU3A 1J8YF 1UPTA 4ASUD 1A4RA 5AUOB 4LJ4A 4DDTA 2H7VA 2IYYA 1GRRA 4KBGA 3EX7C 2GJAA 2QSZA 5FTNA 2OSBA 1ZVQA 2QM8A 2ZI9A 4R7ZA 1UEIA 5KHOC 3FYHA 1JPJA 2VP2A 2Z5FA 4RD1A 2WM9B 1D9XA 2CLCX 2J7KA 3TQFA 4C0BA 1JR3A 4B71A 1J70A 5C46F 4D82A 2WHXA 3O8CA 1GAJA 2H5EA 3SNHA 3DZ8A 3HWSA 4ESVA 4URVR 1DS6A 2FFBA 4PZZA 1PLLA 3W8NA 4Q5IA 5CM9C 2E87A 3RWMB 1W48A 3VR2A 3W8RA 1OB5A 1GNPA 3TW8B 2C96A 4NCIA 4B32A 4DT1A 2REOA 2JLWA 1AQUA 3EA0A 2GWHA 2WJHA 5EXTA 2VL7A 2OFWA 4WAUA 1P6XA 1TPZA 1ZU4A 2VHUA 2F7SA 4LBZA 2QP3A 4EPWA 2DR3A 1Q3TA 1R8SA 1R0WA 4MQBA 4BZQA 3V9PA 2ZXUA 2GTPA 3AKEA 2RB4A 2PZEA 3KXLA 3UWOA 2CL6X 1ZCAA 1LS6A 1NMYA 4PTLA 4PPFA 4ZV4A 1DAKA 2R65A 3MUFA 3PXGA 5BYKA 3LX5A 3AVYA 5DO9A 4EPVA 3ASZA 4V03A 2Q21A 5JRJA 1W4RA 2FN4A 5B58C 3AKDA 5KPDA 4M9QA 4TSFD 4EFLA 3PUZA 2D7DA 3VU9A 2AL7A 3QNUA 1MABA 1NKSA 3KKMA 4NE2A 3UK6A 3WHLA 3X1ZA 3TUJC 1HY3A 3CF0A 4I1SA 5HZHA 4TYNA 4PQRA 3CUEF 4TMVA 2X19A 2GXUA 1CJKC 3OAAD 2XJ9A 2NO0A 4JVMA 2H1LA 1YJ5A 1SHZA 2CHVA 2ZJ2A 2EWVA 3JZAA 4M21A 2XB4A 4QHYA 2GZHA 4TYPA 4B6EA 3P32A 4GOJA 4QBIA 3EPKA 3TNFA 4C0KA 1H8HA 4AYXA 4HAZA 1OHHD 1YQTA 5CDFE 1DG1G 1VG1A 5HE8A 1KK0A 2FX3A 4JSTA 4LK2A 2ZI5A 3GLIB 2KBFA 2FPMA 1E0SA 1HYQA 3QKRA 4H1VA 4B3CA 1KK1A 1Y63A 1D9ZA 4FW9A 4PHFA 4DLXA 4Q1EA 4XD7D 1G20E 1UFQA 2B7BA 3QY0A 3BJIC 3R8FA 3GLHA 4IOLA 2BM0A 2V54A 4XOIA 1SVSA 1X8JA 3TRFA 1PUIA 5SZIA 3OIYA 3KZ1E 1JR6A 3NIBA 4OHYA 2O8BB 2X2EA 5JEDA 1HQCA 4Y0VA 4CGZA 3HYTA 2GETA 5GJVC 3GEIA 2FFQA 1AS2A 4OL0A 4FXPA 2RGDA 5C18A 1F2UB 2CK3D 4WW0A 1WMSA 2ZETA 4AKEA 3V4RA 1XXHE 3U4QB 2V4ZA 5A0FA 3N70A 2ZI4A 1NLFA 1AIPA 5CJPA 4AKIA 1ZD8A 3A4NA 3PR1A 1FPMA 5BW8A 2HF9A 4CDGA 5FPKA 5D3MB 4Q21A 1M34E 1E96A 1MV5A 3BBPA 1GNRA 2RGGA 2WMNB 3QIAA 5BYJA 3MJRA 2FDCA 5EXSA 2RHDA 4BLSA 1SQ5A 1XX6A 2P6RA 2VA8A 2GK7A 3QOFA 4YC7A 4BFZA 1NN0A 5KOYA 1G21E 1GILA 1P2TA 1P75A 2P2LA 3ZQJA 1BOFA 4KSBA 1KGDA 3U7FB 1XEXA 2V8OA 3LWNA 4XSGA 3BB1A 2ZSFA 4FCVA 3LD9A 3LAWA 4DKXA 2EFGA 2IYZA 4J0QA 1XEWX 1JALA 4JT4A 2AN9A 3PV0A 4AD8A 2BDTA 4TMZA 1KK3A 2R6FA 4PAMA 1D5CA 3BRWD 2QMUA 3PFIA 1JR3D 4IFEA 3WMFA 3I73A 2OE2A 3QPWA 4PAQA 4B2LA 2G83A 3L82B 3BIFA 5HKKA 4K46A 4V0ME 4G5QA 4B6FA 4LYAA 3MGCA 4A8JB 3EC2A 2ZRKA 4OHWA
chains in the Genus database with same CATH superfamily
3K16A 4ZOLB 2I6TA 1BTOA 1KZ1A 2CFTA 2N1MA 3GUHA 2IS1A 2IIQA 2DHDA 2NTVA 5HCIA 2A0UA 4GI7A 5BV7A 2FZ5A 4Z53A 1BMQA 1VHQA 2K7ZA 2ZR0A 3F47A 4FX2A 3JTEA 4DMMA 1YZNA 3FLEA 1KBZA 3I6QA 3QTLA 4G9BA 4QUHA 5DW0A 3P97A 2E5LB 1LVUA 4RK1A 1NRXA 5JISA 2JARA 2EW1A 4M49A 3JWGA 2H92A 3FB4A 1J49A 5HBGA 4BMDA 1QX3A 3SX2A 3X43A 3O95A 4QOSA 2UZ3A 4TUYA 1TADA 2WPDD 3FHLA 5AKXA 2O6LA 4FLFA 1PD1A 2R1TA 1SCDA 1I5RA 4N6NA 1KYXA 3UV6A 4GAEA 5AW8A 3E1SA 1IM5A 1QZ3A 2QTBA 4UNIA 3H2JA 4RPKA 5KSWB 5AW2A 4G36A 4TUYF 8OHMA 4KI7A 4OQQA 4U63A 4JS0A 3BG5A 4Z0PA 2BC9A 3RYIB 3ZY5A 2M6LA 4B9AA 5CBPA 3KWLA 1SR8A 1U9IC 5EKSA 2P6MA 3K5HA 3OFJA 3Q12A 4MVJG 1QZTA 3FCXA 2L17A 3PGVA 3GBVA 3RSQA 5C4IA 2EIXA 5CB4B 3OC6A 2ZTVA 4M0DA 4R1UA 5EIAA 2CDNA 4Q4AB 1LH0A 4Y3UA 3X44A 3AUAA 4GZMA 4MUMA 2QX7A 4RH0A 5BV8A 1MB9A 1W5AA 3NB0A 3VAYA 3SSMA 4V0KA 1R5NA 2BGMA 1JHZA 4P5EA 3RKRA 1FMLA 3BWEA 3RFUA 1FBNA 3TXYA 3D0KA 2WUDA 2MDTA 4WEQA 4EUEA 5AR1A 2XBUA 2ZYTX 4ND3A 1X1EA 1NGSA 1QH8B 3O92A 3IUEA 1AO0A 3OQOA 3S2ZA 4Z8YA 2P90A 4JMLA 4UREA 2ZRJA 3C70A 3DQZA 1XCPA 3D59A 3KYDB 4HNAB 4OAQA 3REGA 2PU7A 2R44A 8ATCA 4QNMA 6YASA 4XEHA 1MTZA 1GTMA 2C5FA 3HKDB 4U6NA 3I0ZA 2WT4A 5BV0A 2FRVA 1KK2A 2W2XA 8MHTA 3CF6R 3I30X 5LP6C 4UVHA 3B5JA 1TT7A 2P30A 2JGJA 3A70A 1FRQA 1NF9A 4QU0A 3D5EA 3T7RA 1KNQA 1E2IA 1MV8A 1XDZA 5C1DA 2I9PA 3CLUC 2WFLB 3UOGA 3CNHA 4YUXA 1AQNA 1Q74A 2XNJA 1P5HA 3AIKA 1DC5A 1KQGA 2QLBA 1W29A 1X15A 2YYAA 1ZIYA 4RIFA 8GPBA 2DKFA 3FOFC 3W6PA 2SHKA 3A3OA 2ONJA 2P77A 4LEIA 2HNKA 2H65A 3V1YA 3ZYCA 2BMFA 1FMTA 1E4OA 4PLFA 3MTQA 4XVRA 5CH5A 5A7GA 3DFKA 4C5AA 2TRSB 2MCFA 1J24A 3L7LA 3LCMA 1V0JA 3KKNA 2DWOA 2MSDB 3MRSA 1N6IA 4MH0R 1DRKA 1PWZA 4S1PA 4URWR 5EJGA 5AW5A 2IUFA 4JEUA 5FWYB 3RIHA 1M1NA 4LE2A 4FGJA 3B1VA 1HT3A 4BB6A 4YPOA 1IJFA 2BKEA 2XA2A 4F0JA 3GELA 5JI2E 3UATA 4ZQEA 2GCPA 4NZNA 4DARA 3KSBC 1C80A 4LOIA 3ZD8A 4JYPA 2RGBA 1V1MB 2PDAA 1S6YA 2EX0A 3LH5A 3UFXB 5CCEA 4RQTA 4EY7A 1AKNA 1KI2A 4YRGA 1U9ZA 5H3HA 1ZGGA 4ENRA 1KBOA 1ULTA 1JJVA 1JV2B 4TTTS 1ZOPA 3NTUA 2VSOA 3SS8A 3PEUA 1RQXA 2RONA 5CVEA 1MH1A 4DUGA 1L4HA 1RJDA 2ZJ4A 2X0IA 3ZVLA 2HQOA 4MUJA 2QSJA 3L01A 4IIEA 1RYBA 2A5YB 3RC3A 3D81A 2QJOA 2O48X 2Y1WA 3D3QA 3FW1A 4TXJA 5FOWA 3MNFA 4N3GA 5L3QB 3B6EA 4IV0A 4QREA 4WOPA 3IDFA 4HAIA 1SXJC 4MW1A 1OTYA 5AKGA 3CXRA 1QFSA 4J2TA 5CM8B 3U2QA 2CCKA 2DG2A 4ZQBA 3DBOB 4FQ5A 4HK4A 3O83A 1E6LA 1KHHA 1MDBA 2OV4A 4MYCA 2ECQA 1TT5A 5HF5A 4BGVA 3EXHA 1GKLA 1WV0A 3JRXA 3KXPA 4W1QA 3AF3A 1DEAA 5MF6A 1J8VA 3EVTA 4BN5A 3AR3A 4ZAXA 4ZZ0A 1O6FA 3Q11A 3DB1A 2WJZB 4WVFA 4A03A 4R81A 3LK6A 5LD2B 2EX1A 4RH3A 2MHCA 3T1VA 2XUDA 3D8RA 1APBA 4GXRA 2GLXA 1U5BA 2EKLA 3NT4A 3VU9B 1BYIA 1SBIA 4HWPA 1QGUB 3SE7A 4LV6A 1NI5A 1VHTA 3EODA 5IRCD 4L15A 2EKDA 1CK4A 1FUKA 3CUWA 3F8TA 4MHTA 1LQTA 5AHRA 5GGXA 3P19A 4M6WB 3E3OA 1W44A 3T9EA 2PR7A 2A5DA 3IQHX 1CDZA 1RW4A 2R8ZA 3ASYA 1EE9A 2PX2A 3UB2A 2G9ZA 4DY4A 2W6NA 4UDYX 1V7ZA 4FMCF 4KXYA 1G1MA 4CM4A 1T2AA 1Y8RA 1YR7A 2V6FA 1FYDA 1V3QE 2V9PA 3NYWA 5THQA 1HOXA 3WLRA 2VUTA 3ONEA 4LNUB 4NNJA 2AQIA 4L4UA 5KYKA 3TX6A 2WMOB 2O20A 5ETJA 1WBBA 3O4RA 3BFKA 1JSZA 3ZY3A 2XXAA 5I7VA 2BTEA 1X1TA 4YV7A 1HDCA 4OYYA 4UTZA 1EMDA 4J8PA 3QKRB 4U6QA 2QSYA 3SR0A 4XRGA 2VJBA 2YUTA 1EGQA 1ESNA 2DWQA 3QOWA 4NK5A 1WQ3A 2FWIA 3GQVA 2C57A 2ZZMA 5J3JA 5HSGA 3HA2A 4TVOA 3VKVA 3UK1A 5FL3A 5AI0A 3LQ2A 4UAVA 4B6QA 3ER6A 4XLZA 2PGXA 2JI8A 4JJAA 5J9FA 3KTOA 1GM5A 3GAAA 5HGJA 4X8MA 4INAA 3IUBA 4J3JA 1SB8A 1EKXA 4MIOA 2GYYA 4AY3A 4MKHA 2A5LA 4RJ2A 1ZXXA 2Q4TA 4BO5A 1WEKA 5A9RA 2W4MA 3TTXA 3RSGA 2YV4A 3L1VA 4RA9B 3RVRA 3IR5A 5TS3A 5CB0A 5HRCA 2IU6A 3AETB 4IILA 4S1WA 2AC2A 2BGRA 3LY9A 1Q0HA 3EJ6A 1OROA 5D87A 1HXHA 2RJ3A 4DQDA 5HIIA 5IC4A 5E7MA 2ID9A 1T0IA 3FKQA 3FB1A 4EF5A 3D64A 4BEVA 2NUBA 1QFZA 5A2QA 3I32A 1PNRA 2LIPA 3SZMA 4E5MA 4JKIA 4CEIA 3WL4A 1QIFA 1ESZA 1N2HA 1Z0DA 2X2FA 2C7OA 5T4BA 3STTA 5ILQA 4FE7A 2BWJA 2VDVE 3RQIA 3VHLB 1KMHA 2Q5JA 2I6QA 4XFDA 1QHYA 3RU9A 1LC3A 1X1AA 4GGPA 2HW8A 4D9EA 4EA8A 3NO4A 3UGTA 2GEUA 5K3DA 4IDOA 3N0WA 2WWXA 3OT1B 4L76A 2WAAA 3BFXA 3LUDA 2X42A 2OC4A 4GX2A 2R00A 3EQ9A 1NQXA 2V55B 3UM9A 5LQNA 2ET6A 5E9WA 2R96A 1E1NA 2WHPA 3IAEA 4GYKA 1N25A 3ZNNA 4K5QA 1R5BA 3V46A 3GRAA 1NKTA 2DCUA 5CA1B 5KVAA 2GBLC 2UVPA 2ODQA 2JAPA 3X1WA 5ADVA 3BSYA 1MU0A 2NQTA 2WHYA 3K9WA 1JNYA 4FINA 1M6VA 3RU7A 3QVGA 4D41A 4EHLA 1WS6A 1JBEA 2FG6C 3QI2A 4TOIA 1GA6A 2VDQB 4ITRC 1XDSA 3P9SA 3TBFA 4Y6RA 3AVXA 4XDYA 2QBYA 1HR0B 3L7AA 4YQEA 1DC7A 3KPUA 5EN4A 4F5ZA 4KRGA 2AEFA 2WKQA 2ZU6A 4EUNA 2DBYA 3GPIA 1SMKA 3P0IA 2WZDA 1E1YA 4HFRA 1CUIA 3BULA 1EFVA 4Z86A 1WBDA 4P53A 1BFKA 1XSEA 3QKSA 3G0HA 2ZT8A 4MKGA 3TEJA 3CO5A 3EGIA 1SFRA 4HAUA 3WICA 2OQVA 3QVXA 4KWTA 4RF5A 5F5XA 2N75A 1T3GA 2NZYA 2O2DA 3WA6A 4YK7A 4DUGD 3IE1A 1W19A 3GCXA 3MCZA 4R2JA 2VYNA 4IOKA 4PPNA 4UFNA 3V7FA 4R16A 5GOTA 2QU7A 1YUMA 3CRW1 3KETA 4LF5B 1O4VA 4RQAA 4LGCA 4BFYA 4YI3A 5EMKA 3A2MA 3M1LA 4DSZA 2AS0A 2WQ6A 5HNKA 2VYVA 5L3ZA 4ALNA 4JEHA 4DREA 3K92A 3S7TA 1EAMA 4LXYA 5DFAA 3L9WA 2I1VB 1OH5A 1OBHA 1FLVA 4L0CA 3ZWNA 4TUYB 3DLIA 1QV7A 1QX4A 4JR0A 5AO9A 1Y3BE 1DX4A 2R1TB 4E32A 5ERYA 1DQSA 3SBEA 2CXRA 1Z2PX 3AL3A 4PQGA 1TKRA 1Y33E 9GPBA 3RBAA 3IP8A 4OXKA 2Q4OA 1R6AA 1T8WA 3A4VA 3TD2A 4WK4B 2B4KA 4UDXX 4AZ3A 4CN9A 4EJSB 1KO8A 2GOYA 2HX1A 5C3UA 1A69A 1DXQA 2QN6A 3HUDA 5CBPB 1YKSA 3NMUF 2I4NA 3D4LA 2BZSA 1KZHA 4ERXA 1T8RA 2BY4A 3FKJA 3SU8A 3BE5A 5C9ZA 2WJVA 1WPRA 3WNCA 1ZR4A 1QM5A 4YAKA 1MO6A 2EL7A 2GPYA 1U5AA 2CD9A 2JJ1D 2WTUA 2Z04A 5ALYA 2H6EA 4QASA 3UW1A 4DJEC 3B2NA 4ILKA 2FW9A 4X41A 4J0HA 3ZD7A 2DERA 1DAHA 1WDMA 2H2IA 5AKJA 4P4GA 1EUCB 1TECE 4JELA 1J2JA 4EPRA 4G5SA 2BGLA 5AQ1A 3VMMA 4IEEA 2OOKA 1PTJA 3F0TA 1LLDA 1YMUA 4I5IA 4MUYA 1YR3A 2FQ1A 2HK7A 3TPZA 2ATVA 1E9CA 4UMDA 3MJEA 2QT0A 3LRPA 1ESDA 5HIKA 2EFJA 2YNMC 4B1FA 1I3NA 1L5NA 2YOFA 3QPUA 5L7TA 2NXEA 1Y4DE 4WASA 4IIXA 2X76A 3IUQA 5B6IA 1DQZA 3EVAA 2IYOA 4ZK6A 1H4VB 1IU9A 1TQ4A 1YB1A 4AMGA 4V0LA 2JG3A 3OTHA 3EFBA 3T12A 1P5FA 1OXMA 2FOXA 3V1NA 4E5VA 2ZIAA 3OQHA 1HDZA 4IOJA 1N0UA 3NM4A 4MR7B 3U62A 1VQ1A 2H2FA 1LX6A 4G4SO 2HJSA 5EJAA 3T3PB 3QTTA 4GSKA 1TYZA 3I9V6 4EHFA 4CYMA 3THOA 4GDMA 3RS3A 1P1JA 3EXAA 4CMEC 1QLWA 4MZDA 3D0QA 5FWAA 1E3MA 1HLPA 3R6GA 2OV8A 3UWMA 3DD5A 3PE6A 2WJPA 3PF9A 5FBKA 5JAHA 4YDSA 4L0MA 3LC0A 3M3PA 1L4FA 3G23A 1E2UA 2QNRA 1UCFA 3EDQA 1SXPA 3UC9A 2FOLA 3QUQA 3SJUA 4C4OA 1E63A 4ESOA 2F3SA 2QD1A 1U3UA 3HBJA 1NBWB 3N7AA 3ZBPA 1TCAA 1M1NB 3Q9SA 4GWLA 5A71A 2AZ4A 2V0CA 4Y1GA 4DBLC 2PMWB 3JQ9A 3PVZA 4EMTA 1TO6A 1A8UA 1RQ2A 4E09A 3OUZA 1AV6A 1L9XA 3K73O 3TF5A 1TMYA 3L8ZA 2G88A 4UXJA 1LPPA 3FIUA 4KXUA 3E8XA 3AM5A 4RVOA 3P52A 4PC2A 3K0SA 2DU8A 4OFZA 4CIWA 4FGUA 2HMVA 3CUTA 3U4AA 4QBKA 5EPEA 3UMCA 4EECA 3RYFA 2Z09A 1DQPA 1DUSA 4Y2VA 2M6KA 2WHEA 3IMCA 1S4QA 1PR4A 1Q91A 3BRWA 1PL0A 1H2RS 2OSVA 1RAHA 3KQOA 1PV1A 2FU5C 3OZXA 1LK5A 1QG0A 1RYFA 3R3JA 2WIGA 1KU0A 3G3EA 4FHGA 1YKFA 4G67A 4M2LA 5DTIA 2ZYUX 3U49A 3TQRA 4EQ6A 2JDID 4HGRA 2RHOA 2NT4A 3ESBA 3I9LA 3LOPA 3BE4A 5GJWC 3C1TA 3DV9A 5BNFA 2J5KA 3WYGA 2W48A 4LAFA 2QAJA 4OK3A 4U7DA 2VTEA 2ZXFA 2R6JA 1W4CA 3HUTA 5IG2A 3AR9A 4LI3X 1E1LA 5HRUA 2JPDA 5DI3A 3T1TA 4XCQA 4L28A 2XECA 4TMYA 2H2DA 5DTJA 1TT5B 3EXHB 5SZJA 3OU2A 3O74A 2CHFA 2VSQA 5C35A 4H1UA 1QFYA 4UAJA 3BGOS 3R7NA 2PWZA 3UWSA 3W6OA 4BJ1A 1X19A 5K8UA 3D6TB 1LZKA 1E4YA 1IEQA 2QD3A 3FFTA 3OWXA 1FIUA 1L5KA 4E4YA 3LYHA 1U5BB 1NUPA 2HIGA 4KDCA 2ZUVA 1QYXA 4IGFA 1LF5A 3PDWA 4RX1A 5GV8A 2F8SA 3CNEA 2QSUA 4AU1A 1G4HA 1MQSA 1A76A 5LQMA 1Q16A 4FMCB 1JTEA 3AT1A 3ZS8A 4G5HA 4LZPA 3RK0A 1WWKA 4DV3B 3OSZA 1PLKA 3KT8A 4EHAA 1KJQA 2PYDA 2FYTA 2MYNA 2VYVD 5AXBA 2VPPA 4X54A 5HKLA 2XB6A 3IE2A 1REQB 3QG5A 5K4GA 4CM4B 4WBSA 1Y8RB 2J1LA 4NECA 2UV8A 1TTQB 3F5FA 3Q3EA 2YN0A 1CVRA 5K3OA 2GKGA 2VAXA 5SYAA 3RAGA 4DA7A 1EG7A 4GKJB 2C5EA 2WE8A 1AA6A 2DY1A 3KV3O 5KMGA 2XXAB 1D2AA 2X1LA 4Q03A 3DXYA 3V42A 2Q7DA 1PUXA 3AVQA 2DH5A 2WQZA 1XB2A 1I6LA 3QLVC 5AK0A 2C7QA 4K81B 2J9FA 4DUZB 3PXAA 4J2HA 6ADHA 4KTTE 1GN9A 1TK3A 1RLTA 1P4RA 5H1YA 3K9LA 1LJ8A 2BZGA 2B1GA 1KE2A 3K70C 3JASA 3OIVA 4BMZA 1XKLA 3HHEA 1XTSA 3WXMA 4K28A 4C5BA 3KT0A 1CVLA 1E7SA 1EZ4A 4ACBA 1ZZGA 1N8KA 4Y9DA 1B7GO 2WKRA 1M1XB 4Q47A 1WP9A 3AHEA 4MQ5A 4C7BA 1RKUA 2NVUB 3UYLA 3E9DA 3IVRA 4XUGB 1UUFA 3AYZB 4QEZA 1FJXA 1O94C 3GJXC 1IRIA 3AIIA 3L4EA 1H8EA 3LGSA 2ZT5A 1XZBA 4YALA 1L4GA 2E18A 2JD1A 4R4JA 1CR4A 5A6SA 4BNVA 2PU5A 3VQTA 1SKAA 1UZMA 4EI8A 1JG7A 1CKEA 1C81A 2XF8A 1LWOA 5A5VA 1QZUA 3ZZUA 5J40A 2PLWA 2R2AA 3C3DA 1DFIA 3H17A 4MGYR 4Q7EA 5DTMA 3R7SA 4DCMA 2A2ZA 3NPMA 2CJFA 2R7KA 1HKHA 2RBGA 1NUHA 4F3KA 1E92A 5AESA 2WUWE 4R6WA 1OBOA 2Q28A 2VDPB 1YNOA 4AF7A 1SG6A 5JVDA 5CLGA 5BV2P 3QGMA 5AVZA 2W42A 4CEIB 3EEQA 1PYGA 3AJ8A 1FNSA 5JT1A 1G6HA 1RXSA 2PJDA 1U3DA 3HH8A 4YXFA 1YFJA 3C14C 1KMHB 3A9CA 1R0BA 1GPWB 1P2FA 2D1RA 2YHIA 3ADKA 3H1BA 3ANNA 3C97A 2CL7X 3GJ7A 3M6AA 3L8DA 2J3KA 1HK7A 3QPDA 1TKBA 3VR5H 1XLTC 1DP4A 1G8PA 3KLBA 3O8NA 3UICA 1DMSA 4MS1A 4YMGA 4ZAVA 3OHSX 3IHLA 1ZI9A 1Q7RA 3V1UA 1B23P 2WP8J 5DF1A 3G2KA 3ZZNA 2WHPB 4BQNA 2BZ1A 3BXFA 3UMRA 1P3DA 2CXPA 2OXEA 2BJVA 4XWOA 4BWFB 1TU0A 3BQ9A 5JY6A 2UVPB 1CP2A 2GILA 2YC2C 1PR3A 2AUMA 3AKCA 4GC5A 3HDHA 1M6VB 3OIGA 3QVGB 4EYOA 1X0XA 2FEMA 5K8VA 4B3BA 3U7HB 1GRQA 2PPVA 3H2IA 1YZGA 3CR8A 5EPOA 1ZUNA 2DZDA 2NYAA 2QBYB 3RFVA 4I1OA 4JQSA 5AW0A 4AMBA 3MK31 1LTQA 2OESA 4JLPA 4CMIB 4DPKA 3IUSA 1XZ8A 3Q3CA 2FV8A 1P4AA 3MJFA 3PC8C 4BFXA 1EFVB 4IJ5A 4WBNF 5BQOA 4IV5A 3QKSB 1C7ZA 2WF7A 1YBHA 1L7MA 1NVDA 3O3CA 4IGKA 3FCOA 1X7XA 2EYQA 1X7ZA 1BX1A 2P9JA 1ZSNA 2VAMA 2YHAA 3HBLA 3LHIA 2QRUA 1KY2A 1S7CA 2WSMA 5AUQA 3ROPA 3VH3A 5JALA 4MTLA 3GDOA 3E7WA 3GRVA 3JCZA 3LL7A 4C3VA 1RPJA 2HA2A 3GY0A 3LPNA 1YDHA 5E2BA 4ZYUA 2B82A 5BR4A 5ICMA 3QI7A 2NXJA 4U2BA 1BKDR 4B3RB 1IHXA 4L4ZA 4CLRA 1RWKA 3KHUA 5I48A 1G2PA 2AXEA 3PX3A 3R9IA 4AS3A 2GBCA 2BH2A 5I3ZA 1KVUA 2A4MA 3C7DB 1BDIA 1D4AA 4Z2YA 1NOKA 1C41A 2ADOA 1DIHA 1JPVA 2D2EA 2XW6A 2YH2A 3B89A 4H6VA 3TEFA 2JA1A 2OV6A 3H42B 4PG6A 5F76A 2XT9A 4DQXA 5J1TB 1LSUA 1NUSA 1TMKA 1SCNE 2YIJA 4PRYA 3KWMA 4XB6B 1YR8A 3LDAA 5EL0A 1E7RA 1EZ1A 3DWEX 2AHOA 2ZRBA 3F73A 2HWXA 1QVAA 4DLUA 3L0OA 4AZ3B 2ISCA 2VF5X 1THMA 3U5TA 1AM4D 1EI9A 3KNZA 3SS9X 5JRZA 5EVCA 3V3TA 3GZ4A 1TVCA 2AXNA 2OCLA 1W25A 4B48A 1I9GA 2HD4A 1P33A 2BEUA 4G9EA 2NTJA 4PX2A 5LBTA 4RA6A 3P2IA 2GEBA 1YJBA 4HB2A 1IN8A 1G17A 4WUTA 1QTNA 3G9UA 2ZRIA 2XVAA 3FYUA 1Y6RA 4RDHA 2ID7A 4WKNA 4E07A 4ZKDA 3QP9A 2JKZA 3I72A 3T5PA 5C37A 2WZBA 2I54A 3Q3GE 4PQEA 1G7RA 4AUNA 3AGPA 1F6DA 4RZXA 4EKDA 1T1IA 4QARA 2X0EA 1EVLA 2FXIA 3LCUA 4U7PB 5AJXA 4OAOA 5FQNA 3DVLA 3R7WA 4DIDA 2KLBA 1OXKB 4P5PA 4O5AA 4RD0A 4NEHB 2QK4A 4JXJA 4YRAA 4Q1VA 2XHEA 4AJEA 2HB6A 2DWPA 5HF6A 4CCAA 2Q2WA 4P36A 2CVHA 5HXAA 3GGSA 2GCIA 1SY7A 4GRAA 2O07A 4HLUC 2ZS8A 8ABPA 3TFOA 2AKAB 5EINA 4Q1CA 1I6WA 4P38A 2OXFA 3V34A 3O21A 3W1EA 4LHZA 3HVKA 1Q6ZA 4PLVA 2NAPA 5KJ1A 4G5RA 3GEPA 1T6BY 3DLHA 4LRWA 5TGDA 3O2QB 1YF3A 4M22A 4QDOA 1SKMA 2PLFA 4R9SA 3UCFA 3QF7A 3U5ZB 3EFHA 2ZJ7A 2WJIA 3VDXA 3HLKA 2ZB8A 4PO8A 3CE9A 4FFOA 1FL9A 3IRUA 4M1ZA 1KYVA 2BLLA 5T64A 2QL9A 4AP9A 1SUWA 1RYDA 1H8ED 5AI5A 1A8HA 2A0FA 2JD2A 2MSEB 1F51E 2Z3WA 2H9YA 4I6JA 4M1MA 4NU6A 3VOAA 3ISTA 3W9YA 1XK7A 2AFRA 3ENKA 4X92A 3A6KA 1DAPA 1F6WA 4FYVA 4DXDA 3Q8LA 2E5WA 5JVDF 1YE8A 4YJ3A 1OA1A 4X0EA 2QXYA 2D2IA 2NXCA 5DHPA 1S0UA 3D2LA 3EFEA 3B7PA 4HWOA 4N5HX 1LDNA 5H68A 3HVUA 4JVLA 2IV7A 2ZVDA 3M6UA 1JFSA 1FYEA 3ZDEA 2Q3JA 4LHXA 1TK9A 2JZOA 3GR6A 3FNIA 2PA0A 4PLTA 1AGRA 2AK3A 1X1DA 4QUGA 3FETA 4UM8B 5B1HA 3K35A 4ALKA 2XUGA 2WW8A 1W4BA 3G49A 4O2LA 2OBMA 3RYFB 2AEMA 1KZGB 1I4OA 1I2BA 2NQ8A 2WIAA 4LVCA 4V0SA 2QUIA 2WTNA 5K2MA 1JHOA 4ITUA 4JBWA 1AD2A 4NE7A 5EZ6B 5U4XA 1DOHA 2XUJA 3E9CA 2HCJB 4OBWA 4EFNA 1QB7A 5DM60 3IGFA 3CH6A 4EQ6B 3PHIA 3FN4A 2IEBA 2PLRA 4HHEA 2Z9DA 5F2NA 4EJ2A 2X5KO 1VLJA 2VI5A 4RULA 4HL6A 2FUG1 3DAOA 3QKWA 3FWYA 3HJBA 2FKNA 4JAVC 5JQGA 1IVSA 1J97A 2X40A 1XMXA 3A6EA 3HSSA 4UE6A 3T7CA 4N9QA 5DI3B 2C58A 2IVZA 2PRKA 4OLAA 3D7SA 4ZOAA 1YK1A 3OCUA 1QG4A 4NMLA 4UVIA 4IGIA 2VSNA 3LQQA 1XWWA 2YJZA 1KJ9A 1Q11A 3U3XA 1ZGBA 4U00A 3G17A 4O4LA 2RBKA 1I8TA 2H16A 1XPUA 1BA2A 1M1ZA 2XJ4A 4FDAA 5F98A 1XT6A 2IYVA 3GN1A 4HNTA 1N6OA 3OICA 1OPRA 3L2OB 2IYEA 4OP2A 4QPZA 5AKYA 5EIOA 5AWFC 5KSPA 3TLYA 3UHAA 1DLIA 3HXLA 4M87A 3DCNA 1CF2O 5KQGA 5KYTA 3UAWA 4B6JA 2GSWA 2YVKA 5U4QA 2XYPA 4E08A 3HB1A 3QX8A 4R3UC 1B16A 1XJCA 4HYYA 1K5HA 3U26A 2E5FA 4I5DA 3SZ3A 1KWKA 3GGPA 3HFJA 3D7LA 1ZCFA 5CPFA 1G4AE 1CDOA 1FDRA 3IFSA 1SCAA 3P5SA 4Q00A 4TPKA 3FPHA 3ADPA 3LS2A 4I50A 2F1JA 2Q1XA 3LKZA 2JIRA 4JBXA 4BS9A 5K8JB 1QXSA 1XV5A 1E61A 5G0SA 1RM4A 1U7PA 2PAAA 1G55A 1V25A 2RBEA 3BRSA 3OLWA 3RLIA 3KPWA 1K86A 1P19A 5KMGB 5JS7A 4KQCA 4P8RA 1SCBA 4I50F 1MJNA 1UF9A 1UBEA 3T99A 1LTHR 5E1BA 3V4FA 2WAYA 3UPTA 3CUUA 1U4NA 1TYEB 2J9FB 3EC7A 3HNOA 3ZWAA 1JLRA 1HA3A 1O9GA 5LIRA 4KOEC 3JASB 4YHHB 4GNRA 1VPLA 4LS3A 4KDRA 1ABBA 2QMZA 2V0NA 5DNYB 1CEXA 2VYCA 5JAUA 2IF0A 2RHBA 4WNYA 3CPEA 4GUAA 1ULZA 1SUDA 1VBFA 2YV2A 4PPYA 4NDZA 1UBFA 3LOQA 3AJEA 4E5NA 4XVUA 1Z33A 3WLAA 5F12A 2GCGA 1U81A 3HMQA 4X63A 1S2GA 2O2XA 1YR9A 3GLVA 4OGGA 2GB4A 2XWBF 1N3YA 5FT9A 2BF4A 4HNHA 5A6SB 3T3NA 1FRFS 3PIDA 2AG1A 1SWWA 1II8A 3FBTA 3M1YA 4X24A 1I0IA 4NCHA 1RLMA 4PGGA 5C8XA 2I2DA 1XCGB 3D6JA 4NH4A 2P0AA 1W76A 3SFZA 2VP3A 2JLBA 4B2IA 1G7CA 4RL6A 5HFAA 5LMCA 1L5FA 2Q3LA 3GIDA 5EXXA 3V4LA 5L6LB 3IP3A 4HGQA 2YOGA 2IHNA 4BKMA 2GNOA 2ZRMA 4PZDA 3BZWA 4I6GA 5A1TA 5JVDB 4Y6GB 4XYGA 1PGOA 1F4VA 5F7XA 5KNLA 2PUCA 4CM3A 2HJHA 2ETVA 4U7TB 1SKYE 1GQOA 2M98A 4W9NA 3HCPA 3OX4A 1E79A 3G89A 1B42A 3EARA 3GROA 2V96A 4HR7A 4J3FA 2H7XA 2YHIB 4LY6A 2WT9A 1PZEA 4YCAA 4FSHA 2OO3A 5C1IA 4RPLA 5IT4A 1D1PA 4KRXA 4I4IA 4MS1B 1WXHA 2NO5A 6NULA 1JPUA 3H3FA 3ZVNA 2V7EA 2I8CA 1VG8A 3NPAA 4PLHA 4XLTA 3GJRA 4OQFA 1LQ2A 2REBA 3H1GA 5ALRA 2QR3A 2BV3A 5L3VA 2BDUA 1XPJA 1Z22A 3H7IA 1R00A 4J0CA 4F1KA 1TQHA 1OH7A 1URPA 2IV2X 1L6IA 1MB0A 2OO5A 3BDAA 4HMQA 2AF4C 5EHGA 3V1LA 4D2IA 4X7MA 1A5AB 5LQKA 5L6MB 4QWMA 4YAOA 3A4LA 5KVQA 2G67A 3U44A 3FUTA 1ZUNB 2VEDA 3DCJA 3F4BA 2G4CA 3KYCA 4DRYA 4UUNA 5FORA 3LA6A 3L9XA 1V6CA 5EHIA 4F45A 2VDJA 3LLVA 1FFDA 5D85A 3D4PA 1XMSA 4UVEA 1NU8A 4FW8A 1TKCA 3ZTTA 1T3SA 1E2EA 2XTAA 3V4SA 2ERCA 3DQPA 5ARBA 1DKOA 4EBFA 4QRHA 3L6EA 3KE8A 1T2DA 4L4RA 1IHUA 3B82A 3KOUA 1H9CA 1YGPA 2DCMA 3ACDA 1X7XB 1X7ZB 4DCGA 4KFTA 2ZTUA 5FUXA 2I67A 4BO3A 3HBAA 4JYCA 3U31A 4D9GA 4QELA 3FWNA 1P4SA 1D6SA 1RM0A 1XHFA 2ZUDA 3H0CA 1T26A 3BFJA 4TL9A 2VHJA 3G2OA 4LRQA 4C21A 2WSLA 4GO1A 1PT9A 4DTIA 5A3RA 1P9OA 2P2ZA 2YL2A 3SIRA 4CLRB 2XGSA 5E2AA 5KNCA 1R88A 2XTZA 4KPYA 4G89A 2I4MA 4JBIA 1UWCA 1EH5A 1WBJB 2CMKA 1K8QA 1UK7A 3CKMA 4NULA 3GYGA 1Q92A 3DULA 4ARCA 2P78A 1I3CA 1NLMA 5LU8A 1OXXK 2FWJA 2AIRA 4HFJA 3FPSA 5IVIA 2MYTA 5JW6A 2ZT6A 3RHSA 3W7BA 1NVBA 2HR1A 1Z63A 3EZNA 4LRUA 4RVHA 1SZJG 4RF2A 2EF1A 4Q34A 3NBQA 1CR1A 4OI2A 3T1YB 1SD2A 4U0KA 5TPWA 3ICQB 2KBEA 1CR6A 2GAIA 2VPZA 3DMYA 1QTIA 2VRCA 1NJ1A 2ZTHA 1X7GA 1FS5A 1K6MA 2BEUB 1Y5LA 3KUUA 4ZDWA 5HW0A 1YR2A 4OYLA 2BI8A 2ZYAA 3GLUA 1RTKA 1TKAA 3FYUB 3HUEA 4K87A 2FA9A 2X14A 1NJFA 1DOZA 2VG8A 1DXHA 1VOTA 3FG9A 2Y27A 1GZSA 3RTCA 4CF7A 5HOEA 2GM9A 1VIYA 1X7WA 3VPFA 1A7AA 4EG5A 2RE8A 1SUAA 1KETA 1TEXA 3QKIA 3R7WB 1NUUA 4TMWA 4ERNA 4D9NA 4DR5B 5HTOA 3S0JA 2G04A 3T7DA 1V8FA 4NENA 1G5FA 1QLJA 1FB5A 5JECA 1YZTA 2MOKA 5REQA 3LT4A 4NYJQ 2PCLA 4UOEA 3JWPA 3K6RA 1X8XA 4RENA 3AHGA 5AOCA 1FNBA 1Z4QA 1MLDA 4KFUA 5JSKA 3F4LA 4A6XA 1VPWA 1KE1A 2PYIA 4LSZA 5DM2A 2QN1A 1V5IA 3C3BA 5FEMA 2Q07A 2OZKA 4Y2PA 4HXEB 2XAAA 2FX5A 1W581 2ISQA 2WYUA 2W0SA 4ZXPA 5L7WA 1Z2OX 3HZRA 1FYWA 3SEQA 3GJ8A 3NIDB 1JFRA 2FLWA 3HXPA 1E2HA 4MB0A 4P4NA 5CK4A 1M0EA 3SHTA 2BD0A 1KO1A 4ZN6A 4GQAA 1AHPA 4HN2A 3M3DA 5F9MA 4G86A 1P5JA 1B14A 3E7XA 4FZJA 2HRQA 2GAFA 4EI2A 2C5AA 1SVOA 3QEAZ 1XN1A 4YAJA 1TM7E 2PUTA 1UOEA 4HTAA 4O2RA 2C4WA 3L1IA 2PN1A 4L3VA 4IJUA 1O8BA 1V2HE 2CVFA 1WW8A 3GAMA 3PUIA 1G6KA 3ZHSA 3GPBA 4YJ3B 4BJ5A 4TKVA 1UQRA 1NW7A 2QX9A 1OREA 3EGDA 2Q5QA 2O1EA 4ODIA 2JZCA 2PZGA 5C5DA 4QECA 4EI9A 3CSSA 3PXEA 4UULA 3IVAA 3VH4A 3EVCA 3UK2A 4EKIA 1XXLA 2HLPA 3FNBA 3JYOA 4XWTA 2A1UA 3LDFA 1E79D 2C7PA 1KEUA 2QTGA 3G7UA 1DZIA 3R40A 3ZU4A 5EGSA 2HV8A 2IUEA 4HEA1 1Q1ZA 1KYIA 1B6SA 3E9NA 3NBAA 2PMDA 3E5HA 3NV9A 5H0IA 4CETA 3IKJA 4JR2A 3WWCA 1INLA 1XQ6A 1I9CA 5K3BA 3RUCA 1P3JA 2Y1CA 2RGCA 2G82A 4FYYA 3EEOA 3C4JA 4LDPA 2BFCA 1QPZA 3NHSA 1WZNA 4BU1A 4BVJA 1T1JA 1WSWA 2VKQA 3FDJA 4AG5A 2WWGA 5DNAA 5FF9A 3RJTA 3EXG2 3TOXA 2QYTA 2H4ZA 3SZLA 1JHUA 5JQGB 4TQAA 1LTKA 2R1UA 5BSUA 1GDHA 3MOGA 1B8OA 4F21A 2AG6A 1QK5A 4XKJA 2RHWA 5CT8A 4DUYB 1T9KA 1J07A 3QMPA 2C7GA 4RIGA 2VYFA 2G1JA 1I2MA 2FJ0A 2JBHA 2Q29A 1MUUA 3NHUA 3V4ZA 4HRXA 4M9RA 1X70A 1JQ3A 3VYTB 2C1XA 3OD1A 3JZMA 4O1HA 3WGZA 1M6NA 1CYEA 1R10A 2E4YA 4O4LB 1NQAO 3USCS 3DFUA 4LOAA 5H7XA 3JAWA 1K92A 3QUBA 4B3HA 5NLLA 5ER6A 2RKOA 3T34A 5BW4A 2COKA 5L40A 1X38A 3N39C 3WGYA 3A0UA 4W5OA 4M7RA 4PSCA 2PGIA 2I7VA 2JASA 3JQCA 3KQWA 2D2VA 2HIHA 1KF0A 4NQZA 5ED4A 1MEJA 3QEBZ 3QBEA 5DHSA 5JO9A 3UHFA 1WOMA 3DAPA 3DDHA 3OPYA 2B61A 4YA6A 1N9GA 4G1UC 1J8MF 1RRMA 3NRCA 3PJGA 4RHCA 1YWGO 4KO1S 4A1FA 3GNQA 1EFRA 3FUVA 5KNCD 1OFHA 4UEWA 5JWHA 1Z26A 3WIDA 2W2TA 1RPAA 3AR7A 5EFZA 4ZDKA 4B85A 3H18A 1N4DA 2Q1WA 1P0MA 4I50B 1C3OA 1GVHA 1U0RA 1WXDA 1XJ5A 2WJAA 5CYFA 4P7KA 2FRXA 1KQOA 2DLNA 3CRNA 4RHFA 1WZ2A 4INJA 1IIBA 2Z2KA 3CEAA 1CZUA 3HG7A 1M8FA 3LBHA 1Y9DA 5JR3A 1NRIA 1USKA 1UBUS 4BO6A 1B8VA 2DBRA 1IAQA 1LRKA 3HCWA 2P2YA 5JCZA 3KT6A 2A5FA 4X95A 5A3QA 5TF0A 3UHOA 5BWNA 3DMTC 4IW3B 3CLVA 3FZNA 3EHDA 1EPUA 1SIBE 2VJCA 4WFQA 2VRCD 7YASA 1KRWA 4YP0A 2WLTA 1CD5A 4QSHA 5TMEA 4UHDA 4URFA 1HM5A 2XUZA 4KV7A 5AIBA 2IOYA 3OZCA 4F4FA 3PNVA 1P45A 1KIAA 4FMPA 3KL2A 2W70A 4QVIA 2E89A 1T3ZA 3GDFA 1JBKA 2X9GA 4TWIA 4MW5A 3OLVA 3NKFA 1II8B 4PZYA 2C5GA 1RJWA 1BE0A 5JDIA 3KR2A 2N0SA 3IEUA 1FFXA 1YDGA