2PZFA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
224
Chain Sequence
SLTTTEVVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 73
structure length 224
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzfA00
4DUGA 2EW1A 2OBLA 5AWFC 4TLEA 1BYIA 3PJRA 4MYTA 2YWFA 1QG2A 2FSIA 2ZXUA 4Q7LA 2WSSA 3TW4A 3ZD7A 1A1VA 2GRJA 3DM5A 3FPAA 1LF0A 1JQJC 4TZ0A 2FSGA 3AF2A 4JLAA 4U5XA 3HJNA 1KIMA 3TAHA 3OEED 1U9IA 1RYHA 2E87A 4D80A 2VPPA 3A1UA 3EARA 1YZGA 2C03A 3BFXA 1F48A 1S3SA 2C9YA 3LD9A 3T34A 4GDFA 3AVVA 2IS1A 5JEEA 1E2NA 3CR7A 1DAMA 4TL6A 1IQPA 3HYRA 2N42A 1X8KA 2ZRJA 5CJ2A 3MWLA 3H0KA 3ZVNA 3MFYA 3U6KA 3GLGE 2HLDD 3L43A 3QEJA 5FUWA 2F1HA 3KKPA 3KKNA 2QENA 2N46A 4LJYA 2C8VA 1DO2A 4KAXA 1BS1A 5JHGB 3CF2A 1W46A 5B2ZA 4BFTA 1D8TA 4M1WA 1KMHB 3NVAA 2GXUA 3OHMA 2P3SA 3U3RA 1UM8A 3S1AB 1P4SA 2OLKA 1R8QA 4C0BA 4Q00A 1VG0B 2GF0A 4C3ZA 2GXQA 1ZW6A 3ADBA 3TSZA 3P20A 1OHHA 4QGHA 1U98A 2XB4A 4PC1A 1E9AA 2XTNA 4LC0A 4MUBA 3KZ1E 1SXJB 1DEKA 1VKJA 3ND8A 1EXMA 4LYAA 4E5UA 2EFEB 4ZV4A 3HR7A 3BB1A 5LD2B 3QKSB 2WMNB 2QZ4A 3C5HA 4A2WA 5E95A 3ZZTA 1G7SA 2OCBA 2A9KA 4JLDA 2ODEA 1NNEA 4I4LA 721PA 5KPJA 1Z2CA 3CRQA 4DCSA 1YZTA 2V3CC 1W5TA 4DCUA 3PR1A 2HF8A 2VHJA 1E2LA 1GL6A 1TQDA 3C41J 3CH5A 4JLKA 2XSZA 1OH6A 4F38A 1C4OA 1VDZA 4OKSA 4P31A 2FFQA 1FOEB 4N3NA 4M9ZA 3DKPA 3WMGA 4EQ6B 4DVGA 3LW7A 5KSZA 3PITA 3QKRB 1X6VA 4Q9IA 3LBHA 3RNLA 5C18A 3WY9A 1G291 2Z43A 1KI7A 4RZ3A 1G41A 4TYPA 2EFGA 1YKSA 2GILA 2RMKA 4FMBB 4KODA 3U44B 2DWPA 1T3LA 3QPVA 4ILEA 3A4MA 4IVQA 3SFVA 4JVLA 4QGAA 1F2TB 1G6HA 1XU4A 4NPHA 3W6NA 1XPRA 2EYUA 4JL5A 5CYPA 4B6EA 5FTMA 4B2PA 4B32A 2ONKA 5H8WA 4EPXA 5AJYA 1SXJC 4KFUA 2QT1A 2WSSD 4AKGA 2ZE8A 1OXVA 1Q3TA 2G83A 1FTSA 2GA8A 2QPOA 4AYWA 1A7JA 2QMUA 3MJRA 2W58A 1E79A 2G77B 3GLIA 1WXQA 1MT0A 2ORIA 1TQ4A 1S0UA 4KO8A 4Q7KA 3G82C 2GCOB 5FR1A 4OHXA 1JNYA 2D3WA 3T5DA 5JECA 2QE7D 4UNSA 3TRFA 3O8RA 8OHMA 3HPQA 4UXIA 4RFSA 2O0HA 3U3KA 1KI3A 1AS2A 3LQRA 4PSVA 1G21E 1N6NA 4FWIB 3N2IA 2CXXA 1KSFX 3P32A 5BN5A 3CW2A 1G1MA 5J4HA 4LJAA 1IXSB 1XMSA 2XZLA 2G3YA 4HLDA 4KSCA 1EFUA 3E5HA 1YJ5A 4HEJA 3ADCA 1NMZA 1DO0A 2OCPA 3TR0A 1S4QA 3ZVRA 2IXFA 3QVUA 4Q5IA 4BPBA 3FFAA 4YMVA 2XJ9A 3AQ4A 4NCJA 3CX7A 4ZO4A 4C0JA 3FKSA 1R10A 2GJSA 2HXSA 2W2TA 4MYCA 5TY0A 2RKOA 2YHSA 2ZETA 3AEZA 2UVQA 5B30A 1C9KA 3THWB 4XOIA 4BLTA 4F4IA 2NO9A 3I4LA 3V4RA 2RAPA 3VR5A 3L0SA 3GCGA 2I1VB 1K8RA 4K8OA 4M2LA 4U00A 5TB5A 1NVXQ 1NL3A 1PV4A 2ZE5A 1OXTA 2VHCA 3JVVA 1HY3A 2WJGA 1WF3A 3TUZC 4KV9A 4IJMA 1L7VC 1N5IA 4HUQA 2CK3A 3OIYA 1XD9A 2GAOA 1VIAA 3WRXC 1TF7A 3P4YA 3OESA 4KI0A 2CJWA 3I72A 2HUPA 4EQ6A 1ESNA 1JAHA 2RB4A 3LNCA 1G4UR 2WICA 2O8BA 3MLEA 4XWKA 3THYB 2RCNA 2BMFA 3NDPA 3NTUA 4Q9LA 4M0LA 3QBVA 3DL0A 5EE1A 3HU3A 1P2UA 1LFDB 1Z0FA 3TE6A 1XPOA 4C0HA 1H8EA 2HYDA 2Q9AA 4GBMA 1RE0A 3ZGXA 1QVRA 2IF0A 2ZSBA 4IHQA 2WIBA 4BECA 1PLLA 3FHCB 5E7IA 4QKQA 4TMZA 2ZUDA 4HDCA 2FN4A 4FINA 4JBWA 1JXMA 4RZ2A 5UKDA 3VFDA 5JEDA 2NPIA 4NYMQ 4CZ2A 3NBXX 3GMTA 3A8TA 1ZCAA 4KFRA 4QL3A 2ZU0C 3GLFB 1TTTA 3HU2A 4OHWA 3AKEA 4R7ZA 2XZOA 2JDID 5EP4A 1WB9A 5B58C 1QHYA 4C2TA 3ND9A 2JLZA 2BV3A 1KDOA 1EK0A 1Q44A 3BJIC 2LCFA 1NSFA 2Q0HA 4BE7B 5JSZB 3MWYW 1KI8A 4MDEA 3REFA 2F1IA 2NO0A 1DOAA 1UAAA 1R5NA 3UPUA 3NKVA 2AKYA 2W6IA 2WBLC 4OHVA 1QG4A 2AFHE 3AM1A 1E1QD 4MRSA 4G3XA 521PA 3T1QA 2ZREA 3SN6A 3U4QA 3U7HB 3IIKA 4IVRA 2DWOA 4KU4A 4JVSB 4U02A 1NP6A 3WMFA 4IOJA 2JAQA 4EPYA 4L15A 2JLQA 4V03A 1M7BA 2ZYWX 4KHZA 2DFTA 2O8BB 4PX9A 5D3MB 1D2EA 2ZRMA 3SBEA 1KY3A 3I1FA 4F4CA 2A7QA 1ZYUA 1B23P 1KI6B 3V4FA 4BGDA 5M04A 3PFIA 4GOJA 1SVKA 1AM4D 2AHOA 3FOZA 4Q01A 1FFHA 3C8UA 3EW9A 2CCGA 4RD6A 1UJ2A 1Z6TA 4TZ6A 1OIVA 3AUYA 4QBGB 3WMEA 3MRSA 1NY6A 1Y63A 4FXPA 4AWXA 4PHTA 1NSTA 2AKAB 2OXCA 2ZSFA 1G8FA 4D0LB 2V54A 2VA8A 4YC7A 1T4GA 1CR1A 1L4YA 1ONBA 4D2IA 4P4SA 3U7GA 4B33A 2ZIAA 2GVDC 1ZD9A 1E3MA 1NBMA 3RRNA 1QHGA 1GNPA 4HDOB 5LD2C 1HT2E 1W4RA 1F6BA 2Z6VA 1IXRC 2F6RA 2PMDA 4M1MA 4OI1A 3EG5A 4RCZA 1OV4A 3KQHA 5JWRA 1NN3A 3TSOA 1CTQA 4I1SA 4U7DA 4NL4H 1SKQA 4RJLA 2ZS9A 5FOWA 4CEIB 1Q1QA 1VECA 3PG5A 4OK6A 4URWR 2YJTD 1HEIA 2J0UA 1YVDA 1K5DA 2BBOA 1U9IC 2O52A 1XFAA 3ZYCA 1LF5A 2C98A 3BXZA 2RGAA 3AF4A 4OYHA 1E0JA 3RWMB 4EAQA 4XJXA 4D0GA 1Z0IA 1LS1A 4NCKA 4QOSA 1E2QA 4E09A 1P62B 1GP2A 3GFPA 1XD2B 2RH5A 3X2SA 1LY1A 2CEAA 2VL7A 4YLGA 3TW8B 4D0NA 4OQFA 3TJZA 3CNNA 2IK8A 3BH6A 4YDSA 1H65A 1KMHA 4BFWA 3ZLJA 2OILA 3G0HA 1JR6A 2GKSA 2A5JA 4KVAA 2D06A 2IYZA 3K0SA 4HDQB 4MDFA 1AK2A 4XTRA 5CITA 1W36C 2WWXA 2XTZA 3LVRE 1VYTA 1U0JA 4AKEA 1SXJE 1U0LA 1XTSA 3GJ4A 1LTQA 2GEUA 3I61A 3M6AA 3Q5DA 2HLDA 4O2LA 3U5ZB 3LX5A 3QKSA 1CR4A 2GESA 3Q9LA 4NTZA 1N0VC 2QPAA 3NEYA 4FCVA 3CUEF 2IS2A 2QRNA 1N6LA 3L0OA 4TL7A 2IS6A 3O8BA 3GD7A 3B9PA 4Q4JA 1CJMA 2CE7A 2QMOA 5FL7A 1Q57A 2AD5A 3U3JA 3DOEA 3ZZ0A 1IN8A 3NC1C 5DSZA 1LNZA 2BCGY 1UF9A 5HKKA 1Q1ZA 3LRPA 4JIMA 4MRNA 2OHFA 2AXPA 4AYTA 2KI5A 3T1VA 1NG1A 1NN1A 1U8YA 1OIWA 1GUAA 1FL9A 2EFHB 3UXMA 2AL7A 2ZI3A 1WDTA 4Q4HB 1SVIA 2QP9X 1D6JA 3L8ZA 4KFTA 4RY2A 3W5JA 4E03A 2RGEA 4M1OA 3UMFA 5FL7D 4ZDKA 4C0SA 1XD2A 2WOOA 4HB4A 4B3DA 1W48A 3IQXA 4Z8XA 5KYKA 4DDWA 4V0OA 1AQUA 2JEOA 3B1WA 2J9RA 2BEKA 1GSIA 1T0HB 3AGQA 1CJUC 3UG6A 1JR3E 2BKEA 1SXJA 3HWSA 1XMJA 2ZI5A 3MG9A 4B2LA 2OV2A 2GEDA 3GFOA 1DAEA 3TH5A 2Q6TA 5JJIA 3ZVLA 2DCUA 3QXJA 1UEJA 4P3YA 2IX3A 4LHZA 2YV5A 3OEHD 2JLWA 1M34E 2OE2A 4NCNA 4CEHA 3QENA 3SZRA 4NYJR 5HKKD 4NU0A 4A0HA 4LPSA 4LJ9A 3IUYA 3QF7A 4QBIA 4Z51A 2B6HA 4DCNA 2RGXA 821PA 5HPYB 1UKVY 5EP1A 5GJVC 2IYVA 1SXJD 3LLMA 2X2FA 2B21A 2DFKB 4ZDWA 2WWWA 1GAJA 4X8OA 3CBQA 6Q21A 5AUPB 1CR0A 2PX3A 4PZLA 5TDHA 2C9OA 2DFNA 5K8LA 4MYHA 3PUVA 1VHLA 2KBFA 3TVTA 4TYNA 4MGKR 4MKFA 1TMKA 2ZM5A 1U81A 1Z22A 4UNRA 1F2TA 1MRNA 2BEJA 1E2GA 3GJ0A 1OFUX 3ZVMA 4IRUB 1EWRA 1WRBA 1VYUA 3TUIC 2B8WA 3L82B 4WZ6A 1FMLA 2A5FA 1JR3A 1GFIA 4OBEA 4HUTA 4Q7JB 4ZDIA 1YZKA 2WJYA 3THWA 4FCWA 4POAA 2BBTA 4FMDF 4HB3A 4LCBA 1XDBA 2ZSAA 3MGCA 3GJ5A 4V0LA 2QY9A 2DR3A 1FUUA 1KJZA 5FTNA 1RYFA 4HZUB 4UXHA 4EDHA 2WJIA 1G8HA 3LY5A 3WXMA 3LV8A 1XXHA 1E2EA 4DT1A 1G8GA 2D4HA 2ODNA 4CF7A 2PJRA 1XCGB 4C30A 1GILA 2OO7A 3TNFA 3U3MA 2ZQ5A 1W36D 2H16A 3EIQA 4I81A 1OPXA 4ABYA 4JLJA 5CYOA 1Z8FA 4YMTA 4C7OA 1NIPA 3TQCA 2QM8A 2WJJA 1R7RA 1G4AE 2ZPTX 4PR0A 5FPSA 3AVTA 1KNXA 4LGMA 2R6DA 1RJ9A 2QGNA 4NH0A 1ZVQA 4PPNA 2H8KA 4NYJQ 1IY1A 4Q4AA 3FMIA 1R0WA 2ERYA 4TWZA 1TUIA 1ZC4A 1JI0A 2A30A 3EZ7A 3IHLA 4A0FA 1W0KD 4TLDA 5JWHA 1E9FA 3AVOA 1KZGB 1LV7A 2ZYUX 4TMXA 4JLMA 3DMNA 3EPJA 1IJEA 1XXHE 4OK5A 3UIEA 1Q12A 4OJQA 4WVFA 4JL8A 4C2UA 2NOAA 1SVOA 3AKCA 4KYUA 4FN5A 1ZM3A 3VX4A 4V0NA 3CRRA 1L8QA 1W0JA 1COWD 4URZR 2PT5A 3T06B 3TK1A 4EFLA 5AJZA 3VNUA 1F60A 5EXTA 1L4UA 2ZRDA 1P7CA 2JASA 3QKTA 4AG6A 4DLUA 3MSXA 4TL9A 4LYHA 1DADA 4QNMA 2ZYTX 1QHSA 2FG5A 2QQEA 1GNQA 4HLUA 2Z4RA 1ZNXA 2QI9C 1SQ5A 4GZMA 4PQFA 1YZUA 2ZS7A 3QNUA 4TLBA 2VHTA 4LRWA 3T61A 3C7KA 2VP9A 2B92A 3K0CC 4WZAE 5AJXA 1OXXK 1RRPA 5C2JB 2QSYA 4NMMA 2QT0A 4NCIA 2OLJA 1KKMA 1S9HA 3AVUA 4HB0A 5CM8B 2R6AA 2CVFA 3LFUA 2ZJ2A 3CZQA 5BWMA 2QA5A 5FBLB 2VBCA 3VR2A 5EE0A 1OFTA 3VU9A 4RFVA 2EFDB 2W6ID 3BFVA 3CIOA 4LSGA 5F3WB 2F3TA 2O5VA 3BD9A 4S35A 4B44A 2VYFA 3U61B 5JWOA 1JECA 3RWOA 4M1TA 1GOTA 1J70A 1AKEA 2J45A 2QM7A 2CK3D 2G88A 2Z5FA 4LHXA 1Z0DA 3CF6R 4PHFA 5EP3A 5IK2A 1E4YA 3HPRA 1T5IA 3FKQA 2CL0X 2WWFA 4QBFA 2REOA 2VP5A 4QFMA 2J0VA 2NPFA 2Z83A 1BMFD 1CS4C 3C5CA 4N0EA 1Q1EA 3QQ5A 1VG8A 5FPHA 3EIEA 4ACBA 2ZRGA 1IY2A 1CR2A 2FV8A 1P5ZB 1M7HA 4DHEA 1KGDA 1KK1A 3THXB 4RD0A 4XH9B 1H8ED 4CGZA 2KWIA 1JEEA 1N0WA 1GITA 3Q7PA 4XIGS 3T35A 5LPNA 1WMSA 4DIEA 5IF9A 1S96A 1ODFA 3NBFA 4LOAA 4JL6A 2FF7A 4TTRA 1E2HA 2CNWA 5HTKA 4GFDA 3GLFA 2C77A 4G0NA 1E69A 2GETA 4PC7A 4MRRA 5DLQC 5LB4A 1O3YA 2CVHA 2ODBA 2GBLA 4X8HA 2BOVA 3NWJA 3R9WA 2B7BA 4L4UA 3KTAB 2JDIA 1E1RD 3ASZA 4PO8A 2D2FA 1SGWA 3OAAA 2I3BA 4DXAA 4LJ8A 4AKHA 2ZSDA 4V02A 5JI3E 4Q18A 4DCVA 1EFRA 2IYUA 4QHTA 2IYSA 3BFKA 2BVNA 3K09A 2IA5A 3WP0A 3VHXA 5CLLA 2OZEA 1M6NA 1BIFA 1EX7A 1J2JA 1XF9A 5DI3A 1P3JA 2C95A 4GT1A 3WRYC 3CRW1 3ICEA 3T12A 3TAUA 4I99A 5AR1A 4M21A 1GG2A 1JPNA 5JRJA 3AVYA 4ESHA 3B1YA 1E2PA 4BZXA 3EC1A 3P27A 3GFTA 1IM2A 1XTQA 2PEZA 5H70A 2G9NA 4UJ3A 1NI3A 2ZS8A 1KAGA 3IHWA 5BQ5A 5FBVB 1OB2A 3Q72A 1YRAA 2OBNA 2FWRA 5FH9A 2N1BA 4W5JA 3SI7A 1M8PA 4AYXA 3F5FA 3QJYA 3SE0A 1YHNA 2WV9A 2QTFA 1G8YA 3L2OB 4LK2A 4WA7A 4URXR 2J59A 4DIDA 2AXNA 2IC5A 2F1JA 4PQYA 3E1SA 4ZKEA 3QI2A 1NKSA 2GJ8A 2ANBA 1MO6A 1DBSA 3U7FB 2Q3FA 1PVOA 1W4BA 1DPFA 2V6IA 1KMQA 5TXGA 2D7CA 5C1BA 2CJWB 5FOSA 1P9NA 2P6RA 1ZRHA 1Z0JA 2ECKA 3DZ8A 2OFXA 1YR6A 3VR4A 1RFLA 3TSWA 1R5OA 1FUKA 3FVQA 4WBSA 5IHPA 3B9QA 4UNNA 4WAUA 2WMOB 2ODWA 3BBPA 4W9MC 4JT4A 1MABB 1UEIA 3IO5A 1S3GA 2Z4SA 3KKMA 4OQNA 2C5LA 4J0QA 4IOKA 1M7GA 1Z83A 3VKGA 4Q19A 2JLVA 1GKIA 1US8B 1U8AA 1FP6A 1XTIA 3KL4A 4NYMR 1IHUA 3THXA 3C4JA 3SS8A 1U94A 1E9DA 3O47A 3Q3JB 1W7AA 2J87A 4ARZB 2CCJA 3BGWA 5KU1A 1VG1A 1RZ3A 4MRVA 5DISB 1KNQA 3B7GA 2PMKA 3KDSE 4DBLC 1HTWA 1Z3IX 2C9CA 1DAIA 3QUSA 4Q4JB 4TQ9A 3HP1A 4BUJA 3DDCA 2GTPA 3RSOA 4FI3C 2QMHA 4MGIR 4UJ5A 3FTQA 4PZZA 2V4ZA 3SJAA 4JJZA 1AKYA 5EP2A 4V0ME 3EXAA 4ZI3A 4I1VA 2WKPA 5FPTA 3V00A 4DJTA 3QBTA 3A37A 1JBKA 3WBKA 2BM1A 3X1DA 4A2PA 1Q1BA 5GJBA 2HJGA 2WAXA 1TX4B 1VYVA 5FTKA 4ZCMA 1X1SA 4DRZA 4BFUA 3VR3A 1VCIA 2GVZC 2FU5C 5G3ZA 2FOLA 4QC2A 2QMEA 2J5XA 4O3MA 2ORWA 1W0KA 4MKHA 1YU9A 1UADA 2SHKA 1G6OA 4LUCA 5A0FA 3SR0A 5DYIA 4D4LA 1MOZA 1HE8B 1MABA 5FOTA 1PLKA 3A1WA 2O8CA 3AP3A 3B78A 4D6PA 3MD0A 2OFWA 1OW3B 1BYUA 3K9NA 4CEJA 4M4SA 2R65A 3AP1A 3FKSD 2G1KA 3KXIA 4JKYA 1D5CA 2IYWA 2VF8A 4TQUS 3GQBA 3CPJB 4MITA 2QQ0A 4G5GA 1SULA 4M1YA 2HJVA 3QXCA 3A1SA 4PPQA 3D8BA 1G3MA 4OQLA 2GBLC 1RKBA 3OIUA 1AN0A 1CXZA 2O0JA 1N5LA 2CDNA 2ZITA 4NP6A 2V7QD 4PXAA 5JS7A 2XNDA 1UDXA 3OAAD 4P0TA 2XX3A 3PEWA 4HZUA 4V0MA 1KDTA 4KYIB 3ZH9B 2VHQA 3QIAA 3GLIB 5EZ6B 1XEXB 3K09C 2JA1A 2C78A 2FZLA 2HT6A 3M1IA 2GCOA 2WWGA 1YR9A 2IS4A 4QRHA 3TQFA 1E99A 1I4LD 4MGYR 1HQYE 1VCOA 1Z6GA 3EASA 1FX0B 1SVMA 2FZ4A 3EPLA 1ZUNB 4AD8A 4KVGA 1BOFA 2ZJZA 3CX8A 1XMVA 3R8CA 1Z6XA 4OHZA 3QPUA 3W3AA 4RD4A 2JJ1A 2HDNB 3IBGA 3J81k 1VCNA 2ZJ8A 4EPRA 3QY0A 1HQCA 1TNDA 1Z6YA 3LLUA 4Y0AA 3W5IA 4OI0A 2ORVA 2QEQA 3P1JA 4LHVA 5G3YA 4B6FA 1U90A 3SOPA 4DLRA 2HYIC 2VO1A 4HB2A 3Q8XB 1W36B 3QOFA 1GRRA 3IKJA 4LBZA 1VCMA 1FX0A 3U60B 3Q85A 4Q7MB 1NLFA 1IXZA 3JVUA 3K1JA 4A8JC 5AUQA 1KZ7B 5FFMA 1A4RA 4A0RA 5TMPA 3ZDQA 1ZM2A 3E2IA 4O0MA 1R2QA 4O25A 3AVPA 4A9AA 1I2DA 4DWJA 2XAUA 4US0R 3AUXA 1DELA 3CF0A 5B64A 1YR8A 3A4NA 5KDOA 3LAWA 2QN6A 1E1QA 3SEAA 1F3OA 1JALA 1W49A 1IBRA 1WQ1R 5HR5A 1TU4A 4EJSB 1E79D 4PC3A 3KQLA 5DE3A 1OJLA 4US1R 5F2EA 3CWQA 1UBFA 5CDFE 3PIRA 2QPTA 4EPTA 4K81B 2OT3B 4LC1A 5BW8A 1XNJA 2F7SA 3QXXA 4JVNA 1HE1C 3UMSA 4B47A 1TADA 1T0JB 4JT2A 3TLXA 4DB2A 1OYWA 3CB4A 2ASEA 1TUEA 4RZXA 2OM2A 1KDPA 1N5KA 3FGNA 5JFGA 2J46A 1DAGA 4A4DA 5J47A 4TSFA 3W34A 3WNBA 2B7CA 4G5RA 2FGKA 3CR8A 4HAYA 4TMWA 4URVR 4ZKDA 3OFND 2BMDA 2MMGA 3QEOA 3RS7A 3TGPA 2GAAA 4JJKA 4XVQA 5DNYB 3WHKA 3Q5EA 5G41A 3VAAA 5K8TA 1ZCBA 4C7OB 4LBYA 1QRAA 2IWHA 1MO3A 4BFZA 3FYHA 1S1MA 4QJ5A 1NKTA 4HI0E 2ZAOA 3ASYA 4YMSA 2C04A 4LWZA 2HCBA 2JJ8A 5L3RA 1RPZA 5JZVA 1A82A 2H92A 2ZJAA 1N6HA 1SVSA 4ZDJA 1UPTA 5DN6D 3GLGB 2XSZD 3O8CA 3BS4A 2BCJQ 4EPWA 2YNMA 1IONA 3BIFA 4B35A 4JLOA 4DEXA 2GJAA 1Q22A 1WCV1 3BOSA 4M1SA 1GNRA 1CP2A 5AJWA 2V1UA 2CHQA 4II7A 5K8IA 1NN0A 2HF9A 4BLPA 4HLCA 1BH2A 2ATXA 4JSYA 3U4QB 4GI7A 1NRJB 5EXXA 3REGA 5EE3A 3GLGA 5J5CA 1ZNZA 121PA 2IYLD 2ZROA 2QBYB 4QJ4A 2X2EA 1SKYE 2IUSA 3RVBA 3UATA 3AVXA 2PT7A 3EA5A 4W5HA 3KJIA 1WE2A 2AFIE 3IDQA 4WXRA 5FTLA 3DM9B 4GP7A 4BRWA 1WBDA 1B0UA 1QHIA 1YZQA 3BWDD 3GEEA 2W2XA 1JJ7A 1KK3A 1OLOA 3W8NA 4GMDA 4OJKA 4OL0A 4IEEA 5FPYA 4DC9A 4DLVA 1ZNWA 4Q21A 5L3SB 5IDVA 4KLZA 2F9MA 2ZI6A 3PEUA 3RS2A 1HYQA 2Z0MA 1R5BA 3WP1B 2GZHA 1E98A 1ELOA 1WA5A 5GVSA 4PSKA 3EC2A 1LB1B 4RD1A 3AF1A 1NVWQ 3QG1A 1K6MA 2R9VA 1E9EA 4DSTA 1E9RA 2HEIA 2P6UA 3ECCA 1KKLA 2YWGA 1ZM9A 4KCGA 2JATA 5BXQC 2YKGA 4IFEA 1KTVA 4NE2A 1ZP6A 1M74A 2W2VA 2XNSA 3L8YA 5BYKA 3MAAC 2O8FA 621PA 2D2EA 2KJQA 1E2JA 2P0EA 5EJEA 3NC0C 1J90A 3IILA 4OI4A 5J4LA 1O87A 1UFQA 3ADKA 5EZ5A 4A92A 1E2IA 1JPJA 2X77A 4MUAA 3KUCA 4UKDA 3CO5A 5FL3A 4LDJA 1KK0A 3AVQA 3LDAA 3R7WB 4KITB 2WIAA 2CE2X 221PA 4YONB 2FX3A 5CM9C 4PAQA 3EIHA 4BLRA 1DAFA 1EG7A 1N6PA 1NVUQ 1OIXA 3ZIAA 1W2GA 1CULC 4A2QA 4EPVA 2BMJA 5KNDA 2QRZA 1G7RA 5JI2E 1COWA 2DPXA 3VNVA 1UKZA 4DSNA 4DDVA 1VHTA 2GCNA 3GLHB 2QAGC 3SU8A 4ZCLA 4JS0A 5DGXA 2EVWX 3BB4A 4L9SA 1II8B 2JCSA 4CRWB 2WPDA 1TQ2A 4IW3B 4OHYA 3K9LA 5L8VA 3QPWA 2MSDB 4GMXA 4ON9A 4B3FX 2DY1A 2V1XA 1UKYA 4TTQA 5EXSA 3X1WA 5KOYA 1RRGA 1S8FA 3VMFA 4TTPA 1XJQA 1GKYA 2GHIA 2R6CA 4DLXA 2AK3A 2PH1A 2ZRHA 4Q02A 2XXAB 2IL1A 1W47A 3K53A 5DI3B 2J0UB 1XMIA 1N6RA 2OG2A 1Q0UA 3OE7A 1OFHA 1CRPA 4A36A 4BEBA 1II8A 1XEWX 2NG1A 4TL8A 3RS3A 4JLNA 4BFXA 1W4AA 3P4XA 1QHHB 2XJ4A 3ICQB 1LW7A 1JJVA 2BC9A 3WNCA 2KE5A 4NKRA 4LHYA 1YQTA 4DDTA 1ANKA 2IBMA 2EWVA 5GVRA 3RS5A 1GRNA 4S2EA 5J4VA 2R2AA 3DOFA 4BFYA 4P4SB 2P5SA 5AK0A 1G3IA 1IJFA 3AB3A 4RD2A 1P75A 4M53A 4M1KA 2EYQA 2VP6A 1G8PA 3C14C 1NJGA 3DPUA 4JBXA 1P73A 3WYAA 3GJ8A 4NDZA 4PHHA 2WSMA 1T8UA 3MCAA 4YXWA 3H1TA 2FPLA 2QL6A 2YWHA 3KB1A 3RRZA 5FI1B 3CRVA 2F1RA 3SNHA 4WOPA 1T91A 3W90A 2JGNA 1AGRA 2C96A 3PEYA 1QVAA 5CB8A 4D4KA 2A5DA 5JMTA 2LWIA 4QG7A 2WJHA 4PZYA 2FA9A 3TVDA 3K70D 4ASUA 4BLQA 1I4DD 1UKEA 4JYCA 1AS3A 1XWIA 3I3SR 4GPTA 4QXAA 4Q9JA 3UWOA 4HAVA 1G5RA 2FPKA 3UK6A 2C2HA 2FE4A 4A6XA 4Q03A 1OHHD 3GJXC 5KDDA 3Q7QA 2YVUA 3WYGA 4QM7A 1SVLA 4DEYA 1HUQA 1TL7C 5FBWB 4CVNA 3H4MA 3GLIE 2ZRLA 1Z47A 4B2IA 3RRMA 1MV5A 1ZMXA 2PLFA 4B48A 4ZI2A 1GRQA 1DG1G 2W83A 4WXPA 3B13B 4AK9A 4Z8YA 2WWYA 1KSGA 4HLQB 1XTJA 2UZIR 4DZZA 2PLRA 3NH6A 2HT1A 2V8OA 3LBIA 4A1FA 2R8RA 3LH5A 1KI2A 3BK7A 4LJ6A 1GVNB 2RGNA 3SFZA 4KLNA 1E0SA 1AJEA 3C16C 2MSCB 4EFNA 4ZCIA 1G17A 1X8JA 2FFAA 1ETUA 2NTYC 2VIIA 2XOKD 3DMDA 3EWAA 4QHSA 2NZ8A 1GZSA 2IXGA 1W1WA 3WYFA 4HYYA 4DLWA 4IFBA 1MRSA 1P9RA 5E4FA 2FGJA 3SJZA 4A8JA 2BBSA 3BE4A 3K0AA 4PTLA 1CBUA 1KO5A 2J7KA 2ZJYA 4E07A 5LB2A 5G53C 3BERA 2A2ZA 4IKEA 4XWAA 4ACAA 2Y8EA 2EQBA 1E2MA 2WZQA 3R8FA 1XEXA 1N6KA 2P2LA 3PCRB 3IQWA 3PEVA 3RYTC 3KXKA 4JLBA 1NMYA 3EZFA 1ZD8A 4DSOA 2YYZA 3D6TB 3K0FA 2J0SA 1OKKD 1XEFA 3G5UA 1E9SA 5FBRB 4HSEA 1J8MF 3X1ZA 4UQOA 2J7PD 4GSYA 5KNBA 4M8NE 4CEJB 5GJCA 1OF1A 2QTHA 3ZS9A 1DAHA 3IGFA 3DZDA 4EJSA 4Q9HA 4YXWD 1MR3F 2F43A 3QE0A 5DO9A 2I1QA 3KKOA 2CLDX 1X3SA 2L0XA 3PV0A 3LVQE 3B85A 4HLUC 1Q20A 2QSZA 2X1VA 3KQNA 4G01B 4R98A 1RRFA 3EAQA 4AC9A 1U8ZA 4QGGA 1D9ZA 2BWJA 3K0CA 5SZIA 1T8TA 3AP2A 1TAGA 1G3UA 1U2RA 5LBIA 4F7WA 3KJGA 2FEOA 3I32A 5JCZA 1NG9A 1P2TA 4YQFA 2ZANA 4IXMA 3IEUA 4LBWA 3H86A 1Z08A 1YZLA 3I73A 5FUYA 4C0LA 1MO4A 4JMPA 2QNRA 1VIYA 3NEJA 2AWOA 3VR1A 3OE7D 2QORA 4L16A 4F4JA 1RRCA 2GZAA 2ZVPX 3IBYA 2XZPA 1RW4A 4FCTA 2IYTA 1D2MA 4LI0A 2E9SA 1Z29A 1E9BA 2R62A 5CLQA 3HYTA 1CLUA 3I5YA 3RHFA 2ZR7A 1Z28A 4FMDB 5J4KA 1P9WA 2H7VA 5FOVA 4P4TA 2IF2A 4QHYA 4RFSB 5KO2A 4DLYA 4BWYA 1R0ZA 4MKGA 3LX8A 5HZHA 1G20E 1Q3HA 1ZINA 3OF5A 1XB2A 1KI4A 2ZRAA 4XVRA 3FB4A 5LDDC 2OESA 1XCPA 4FD2A 2IW3A 3CONA 3A58B 4XD7D 2NMVA 5DHFA 4Y0VA 1EESA 1E0KA 1E2KA 1JEDA 2NZJA 2OAQ1 3PXGA 1IAQA 5CIWA 1FZQA 2F55A 4JYBA 1WBBA 4WIAA 5EE5B 2H17A 3RS4A 2BM0A 4CYMA 2ZSEA 2CHGA 3FMPB 2QTVB 3RC8A 4HAXA 4HZIA 3SYKA 2OFOA 1G18A 3FE2A 1PZNA 4G5QA 3RSLA 2PEYA 3KFVA 3AKDA 5HE9A 4BFSA 2B8TA 2IYQA 5CIQA 4AURA 3QF4B 3EPHA 1KJYA 2JJ2A 1T3SA 4TMTA 3ZJYA 5IK2D 2QU8A 2PBRA 1KSHA 5A5GA 3K0FB 3EA0A 1DARA 1R6BX 4TYQA 2ANCA 1NBMD 3QKRA 2P6NA 5BN4A 1CJKC 1W0JD 2ZRBA 3CKLA 4L9WA 1E96A 2VSFA 5JLJA 2FMXA 3BRWD 4CEHB 4CT4B 2YOFA 3U3OA 4XSHA 1XD8A 1T6NA 2D62A 2IWRA 4W5WA 4TYWA 1ZU4A 1XJCA 2JJ2D 3D31A 1NBME 3WNDA 3M4YA 3BAFA 3N5CA 2F9LA 3I5XA 3IPYA 3K70C 2ZRFA 1Z6AA 4PPFA 3ZZUA 1PJRA 1KHTA 4C0AC 1BO6A 2ZE7A 3UG7A 2GJ9A 4UNQA 1SKYB 1XCMA 3GEIA 1P2SA 1A5TA 2OXRA 4QNRA 3R9XA 2PZGA 2GXAA 2IYXA 3QVVA 2LKCA 3AV0B 5DN6A 2NO1A 4B73A 3GPLA 5E7JA 1AZTA 1N6OA 1R0XA 3VR6A 3I92A 4IDPA 4R9UC 2AK2A 2A5GA 2R44A 3I8XA 1E1RA 1E6CA 3RDPA 2R6FA 3B8HA 2X8AA 4A82A 3TUJC 2BMEA 4NZYA 2WKQA 3ZS8A 3RANA 1YRBA 2XNDD 4Z1MD 2V7QA 2EFCB 3NDBB 1Z2AA 3HDTA 1IN6A 2REBA 1DAKA 1KK2A 3SYNA 3BC1A 2OCYC 4NYIR 4EJSC 4JKIA 3WBJA 4PO1A 4BLOA 4G5SA 4TSFD 2PX0A 1TEXA 1G16A 2O8DB 3RC3A 2VP4A 4FMCF 5AUOB 1AZSC 2VQSA 3GJ7A 2O8FB 3EWSA 2AX4A 3PUYA 4MA4A 3DVLA 1P60A 5EE9A 2BJVA 3F8TA 3KX2A 3QKUA 3PVSA 3AGPA 3R9IA 4H1VA 2FSHA 4KSBA 1GM5A 4AI6A 1Z0AA 2R6GA 1NLYA 1QBKC 4HATA 3B1VA 4TMVA 2XEXA 3PENA 3UANA 3BB3A 3OZXA 3SHWA 3TIFA 1KO1A 2P65A 4CW7A 4LX0A 3VTKA 1KO7A 1OYYA 1AGPA 4H1UA 4B43A 1T5LA 2C99A 1XRJA 1HH4A 1XEWY 2ONJA 3RS0A 4OK3A 5J4YA 2IEZA 3U44A 2O0KA 1N6IA 1SHZA 2QGZA 4M9SA 4MH0R 4Q1DA 4RD3A 4O2RA 5FOUA 1NIJA 3VKHA 1RVDA 4I1UA 4IDQA 3BORA 1JAIA 5H68A 5FUVA 4LY6A 1M1YE 4IXNA 2ZI4A 5BYJA 1L2TA 3M0EA 3OIVA 1SHKA 2GK6A 2PJZA 4DUGD 4A15A 5G40A 3GJ6A 2QE7A 2AN9A 1EWQA 5KSYA 2XXAA 4YDHB 1PUIA 4LJ7A 1LS6A 1C1YA 4OQXA 4ARZA 2XITA 3MMPA 2GDJA 1J99A 4ZPXA 4ZIRB 1NN5A 2D7DA 1HURA 2H57A 2BBWA 3T1OA 2YZ2A 1IN7A 1GL7A 3CM0A 1CF4A 4KFSA 3FDIA 3T15A 3NBZC 2VH5R 2ZJBA 3W9YA 1P61B 1UDWA 4CIDA 2G6BA 4RSGA 1KYIA 4R2IA 3SC3A 3W3ZB 1I4TD 2YOHA 3UKDA 3KUDA 1IN4A 4A0GA 3B60A 2EWWA 4JBYA 5D3QA 3FMFA 2X19A 1E2DA 4D82A 4LV5B 4BLSA 3DKVA 4ZIRA 2ZI9A 2ZR0A 2VTKA 1QHNA 4AY2A 1N0UA 2FJUA 4M22A 2PZFA 3CZPA 3OFNA 3RAPR 2GCPA 4Q4LA 5F98A 4ITRC 3D7MA 3SQWA 2GNOA 4LV6A 2A78A 5C4GB 3VQTA 2ZAMA 4P4UA 3KTAA 4FMCB 3A1VA 4M9XA 5K8UA 2MMCA 4PAOA 5HCNA 4B3GA 2O8CB 1DVRA 4Q1EA 2CHVA 2JLYA 4RCYA 4BEJA 1E32A 3A36A 4DDUA 2FPMA 1RC8A 2GK7A 1KSJA 1N5JA 2W00A 2W0SA 5JJKA 4LBVA 2O8DA 5L3VA 1GL9B 2VLIA 3FWYA 2E1RA 2OAP1 4AKIA 2ZRKA 1D2NA 4URYR 5D3MA 4DKXA 2QP3A 2IT1A 3JZMA 3IO3A 1AQYA 5E7MA 4UXJA 3AH8A 1GDDA 2V9PA 1UBGA 2NO6A 4DLTA 2Q9CA 4KBGA 1P72A 2NGRA 1ZM4A 2ZUBA 2F3RA 3ZD6A 1ZU5A 2J3EA 4LPKA 4R71A 4PO9A 1AA9A 2AWNA 4Q1CA 1G64A 3B1ZA 2J7PA 1ZJ6A 3N70A 1BKDR 1JQLB 4XVUA 1CJTC 1EFHA 1FTNA 1NY5A 3THYA 5JBQA 2QAGB 1W5SA 2NIPA 2OEPA 3E70C 4MQBA 4TMKA 3QSYA 1FW6A 3ONWA 1ZM7A 2G0TA 4HAZA 1OH5A 3OEEA 4PAMA 1XX6A 4MRPA 4Q4HA 3GLFE 1T9HA 1S2MA 2FFHA 1CIPA 4G1UC 5EUMA 4B71A 5C46F 1TF2A 2W6JD 1DTSA 4EUNA 4L5BA 2BHRA 1AS0A 2PL3A 3AKYA 4V0KA 4US2R 3NG1A 1TF5A 2CNWD 2FEMA 1S9DA 3NHBA 4Q66C 4A6PA 3T1TA 3NBYC 1KY2A 5BN3A 5JRZA 5H1YA 3V9PA 4GRAA 2ZI7A 4LJ4A 2BJWA 1A2BA 5A4JA 2KB0A 2CL7X 2FSFA 2ZE6A 1NF3A 1RJ9B 2BDTA 3SHFA 4IDHA 5FR2A 1ZD1A 1SZPA 4JLVA 2NQ2C 3K9GA 2IHBA 5DYGA 3W6OA 3LQQA 4Q9KA 4ESVA 2QBYA 4GZLA 4LYFA 3FHOA 4XWOA 2F43B 4IDNA 3X1YA 3K70B 5KSOA 1DG3A 1R0YA 3UWKA 1VTKA 3IIMA 1MKYA 3SYLA 4KJZA 1Z07A 1J7KA 1Y3AA 1S1CA 3EZ2A 2HXYA 5EQTA 1XXHB 1IN5A 1JB1A 4DT1B 1DE0A 1P6XA 4E22A 1I2MA 3F3YA 1E4VA 5CJPA 4BZPA 1D9XA 1Z5ZA 1Q21A 4IEIA 4RVCA 4Q1FA 2EU8A 1SVWA 1UBCA 2TMKA 3LW8A 4TQAA 2K5UA 2NO7A 1HT1E 2CLSA 2ZTSA 3CRMA 1II9A 4PC2A 3RLFA 4D81A 3B2EA 2RHMA 1PUJA 4EFMA 3I8SA 2AD1A 4JZKA 2A5YB 1KAOA 4QM6A 4B34A 5ANRB 5JS8A 2FDCA 1R4AA 1AIPA 1QHXA 2RGBA 2HV8A 3QF4A 2JLSA 4PQRA 5KPDA 4L8GA 2P5TB 4Z1MA 5JHHB 4H9GA 3THOA 3GEHA 2IEYA 5JJLA 2WTUA 4FW9A 1A2KC 2JLXA 3VKWA 2HCJB 2IHYA 3C15C 1H8HD 2CCKA 4D4MA 5SZHB 4Q1AA 2YC4C 2REXB 4PPGA 4N1AA 4EIWA 4YMWA 1OE0A 2KBEA 2WKRA 1XJ0A 5FTJA 1GKUB 1X86B 2XGJA 3A6PC 3U6BA 1EFCA 1E2FA 3H84A 4B75A 4NONA 1T3HA 3UMRA 1EFRD 4IDOA 3R7WA 1J8YF 1TEVA 3EX7C 3HU1A 2IUUA 1ZIOA 1ZUHA 3MWKA 1OH7A 2W6JA 1G19A 1ZAKA 5HE8A 2ZUCA 1M2OB 4Z54A 4CT5A 2VHUA 4URUR 3NIBA 3NH9A 1QZXA 1KI1A 2JIZA 2YC2C 2ZJOA 4KXFB 1CU1A 2VEDA 3KJHA 3SJBA 2OCAA 2RGGA 1GIAA 4F93B 2IYRA 4LJ5A 4C0QC 4Q4AB 4GOXA 2H18A 3PQCA 4TT3D 5EXPA 5KDLA 2XOKA 4DLSA 4GP6A 4D4JA 3FMOB 3TMKA 1IY0A 1OT3A 2RGCA 1Z06A 5JCPA 3GLHE 3CPEA 2RGDA 3LXRA 2FFBA 1XPUA 3GP8A 3DHWC 1F2UA 4EKDA 2BIFA 3DEFA 2J0QA 1E9CA 3QXHA 4TLAA 1Z63A 4QBHA 3WHLA 2UZ3A 1ZNYA 3VX3A 4BRUA 3ETLA 2V55B 3KB2A 3DO6A 1YE8A 5CK5A 2WOJA 2WWHA 4Q47A 5L3SA 5DHAA 1FP7A 4BQSA 1W4CA 3KQUA 3SDZA 4XSGA 3KFXA 5SZJA 4LYJA 5L3QB 3W8RA 1R8SA 4B3CA 2O8EB 1G5PA 4B3BA 3EPKA 1UBEA 3A1TA 2XB2A 3RABA 3TR5A 2JLRA 1G5TA 2MSEB 1XP8A 1ESMA 1TU3A 1X8LA 4RKFA 2PCLA 2P67A 3P26A 1XTRA 3L0IB 3K0EA 2VP2A 3L0PA 1KDRA 3IPXA 3K9HA 4HAUA 3MWJA 5DIFA 4DB4A 1TPZA 4TLCA 2BKUA 2FNAA 3QXSA 2VRWA 1HA3A 2IYYA 1ZC3A 2WVJA 5FPKA 5B57C 2CL6X 3R20A 3LA6A 3VU9B 4X8LA 4X8MA 1IOZA 2WM9B 3MUFA 4P32A 4YMUA 5F9FA 4B76A 1EGAA 2RHDA 3H2YA 4NHOA 3TKLA 2JLUA 4AIIA 4JSTA 1OFIA 5F9HA 3CWZA 2WAYA 5AUNB 3JZAA 2IXEA 3U2QA 3U7EB 4TYYA 3CPHA 4PHGA 1RIFA 3X1XA 3PUZA 4AG5A 4D25A 1KO8A 1V5WA 2CMKA 2ERXA 2GZDA 3PUXA 5SZKB 4QJ3A 2QP4A 4B74A 1FMJA 1Z0KA 4WW0A 5C4MA 1ZUIA 4LHWA 1OKKA 2ZR9A 1G7TA 2G0NA 2ZRNA 1N3BA 1OXSC 3SQXA 1YZNA 2A3RA 2DWQA 4KBFA 5E3HA 5ELXA 1ZIPA 4RKEA 3O8DA 5TARA 2J1LA 4DLZA 5L3QA 5KSPA 2O8EA 1W44A 1X1RA 2QROA 4Q48A 1OB5A 3OIWA 4MKIA 4R2HA 4ASUD 4OI2A 3B82A 4P33A 3LWNA 1G3QA 1V43A 2PCJA 2WPDD 2QAJA 1VG9B 3LBNA 5TVKA 1DS6A 4XD7A 1CEEA 1NMXA 3MJHA 4LZZA 4UNPA 4JLPA 4TN1A 1KOFA 1E0AA 3F0TA 2W0MA 1W2HA 4G5OA 4BZQA 2I4IA 4IOLA 1CKEA 1F2UB 2ZJ5A 3CH4B 4LV8B 5J40A 1NJFA 2LKDA 3FHTA 5CK4A 1P2VA 4PANA 4JVMA 1OSNA 1G3RA 2VP0A 3KJEA 4HUQB 4PFSA 3CX6A 3EZ6A 3FFBA 2AR7A 5TV2A 3ZQJA 2PZEA 2WHXA 2ZRCA 1G9XA 2GXSA 4F92B 5HZKA 1VPLA 1KJWA 4C4PA 2RGNC 3ADDA 1OH8A 2IUTA 4W7SA 4Q1BA 1NVVR 4F91B 1CJVC 3NHAA 3TBKA 1U0HC 2DYKA 1NLZA 3D3QA 5IRCD 1XBTA 3W6PA 4GOKA 4ERNA 3AVWA 2H1LA 3SBDA 421PA 1JXOA 1ZBDA 4QGFA 4PC6A 4I1OA 2GJKA 1N2CE 2H5EA 4XTCS 3AF0A 1KO4A 4C9BA 1QDEA 3BH0A 2VSXA 4N0DA 2OUKA 2ZYVX 3KKQA 4NYIQ 4TT3A 1CRQA 4NBSA 4DCTA 4MYUA 2DB3A 2CLCX 1LVGA 1FQJA 2VF7A 1XTKA 1WP9A 4PSAA 2ZRIA 4BASA 2DBYA 2Q3HA 2UKDA 3N2EA 3CNLA 1EFTA 2G1JA 3VHLB 1FPMA 1GWNA 1QF9A 2QUZA 2V6JA 5IT5A 1GTVA 3B6EA 1K5GA 5GJWC 2Q3MA 2QAGA 5JSZA 4FWTA 2YINC 4BFVA 1MO5A 3GLHA 4M9QA 4C0KA 5P21A 5DI9A 3HR8A 3S1AA 1XZPA 3CLVA 4D26A 3IEVA 2WJVA 1FNNA 3K8YA 2CBZA 1KI9A 1E94E 5AJVB 2Q9BA 3QG5A 1US8A 5FOXA 1EX6A 3A4LA 1FNMA 2VSOA 4WZBE 4GL2A 3EZ9A 1H8HA 3PUWA 5KNCA 3BH7A 1HV8A 1G7CA 4A8JB 1QHHA 5KTYA 4OQMA 2GWHA 3GJ3A 2OBMA 2ZU6A 4CDGA 5DH9A 3NXSA 3I62A 2J41A 4HAWA 1YR7A 5EUQB 4CEIA 2Q21A 1XZQA 2ZVQX 4IVPA 3IIJA 4K46A 1U99A 1VMAA 1N25A 5CDFA 1BMFA 5FBQB 3RRYA 4GNKA 2KSQA 2GF9A 1KI6A 1NVVQ 2YOGA 3OEHA 5FUXA 2JIZD 5CB6A 4NCHA 3KQKA 3KXLA 2FH5B 1OXUA 2YWEA 5GADl 2XTMA 4IOMA 4RZUA 3B5JA 2OSBA 3ZIAD 3ZQ6A 5KHOC 4MGZR 1FQKA 2DHRA 3B1XA 3LO5A 3CNOA 4FIDA 5KUTA 1MH1A 1TQ6A 1JR3D 1II0A 2ATVA 2QG6A 2ZEJA 4DSUA 2JJ1D 2GEVA 1PLJA 1F5NA 3LXXA 5HCIA 2D74A 2WWIA 3SJCA 3K0AB 4B3XA 2ZRPA 3AF3A 3T5GA 2DFLA 5FI0B
chains in the Genus database with same CATH superfamily
3RJ9A 4AP6A 3P9PA 4EI9A 4M0DA 5BVGB 2CF5A 1WXFA 3ERCA 1BYIA 3Q9UA 3PJRA 2IIBA 1JAYA 2ZJ4A 4AECA 2QG4A 1UBRS 2FSIA 1QHFA 1A1VA 1LI5A 3LHSA 4LNUB 3TLJA 3NMUF 1DCFA 5FWYB 3C6QA 4JLAA 2J3QA 3ZV6A 1KIMA 2W2LA 3JTMA 3L8GA 5IW8A 3OEED 1U9IA 4TV8A 3ZBTA 5JOQA 4BY9E 2E87A 5HTOA 2HM7A 3A1UA 3BFXA 3IESA 3AVVA 1UM9A 1L7BA 1HPLA 1R6XA 3CR7A 5CCDA 5JXIA 1DJQA 2FKNA 2VUUA 5HRCA 2WNSA 5EIXA 1QQTA 2WVAA 2Q4RA 2X58A 2BGJA 2ZYRA 4AJJA 3B70A 5K3CA 2ET6A 5EJ7A 1FTGA 5H82A 2FN9A 3MFYA 3ELYA 1V8ZA 1CNMA 5IXYA 3KKNA 2QENA 4RW0A 1GUBA 3ZI0A 5JHGB 3FCEA 2Y67A 3CF2A 5A9TA 3KZNA 3UYLA 3CW9A 2GXUA 2WD7A 1ZJJA 1ZSNA 3ETCA 4GGMX 4TM8A 3RSZA 4QFBA 3IDAA 3ORQA 4MDHA 1ZN8A 3NOQA 3WLOA 2XCUA 1RAAA 4C3ZA 5BSMA 4N4AA 2E4UA 1Y9AA 4LNAA 4S1NA 4YQYA 1ZW6A 2FWNA 4X1KA 4XPZA 3TSZA 3P20A 2LZ0A 5IMSA 4QGHA 3IB6A 4DR7B 3LC1O 2ZTHA 1U98A 3KAPA 1TVKB 5JCXA 1OWLA 1D4FA 3W9UA 3H1GA 3ZGLA 1FFCA 1M54A 2XTNA 5TQ0B 4ZYTA 3ND8A 1RM3A 1SXJB 1VKJA 3TTXA 4F71A 5B12A 1GYPA 4HEHA 1SD5A 3BB1A 5A05A 4MWCA 4BVGA 2WMNB 3IR7A 4HYTA 4DG5A 5IFKA 3ZZTA 2B4RO 1G7SA 3IAFA 3WAGA 2CFTA 1B0ZA 1YUBA 2X5XA 3ZGOA 5BQ3A 4K0RA 1DEOA 3BSYA 4JT8A 3T7IA 4WMLA 4Z0NA 3O7WA 1W5TA 5IPFA 3PR1A 2HF8A 3DOJA 3RT1A 4UOQA 2F3PA 4BUCA 1VKOA 1NM5C 4LEIA 3SSAA 4F38A 1O95C 3WMGA 4N3NA 1FCJA 5AW7A 1HQKA 5KYUA 4N47A 5IS2A 3LW7A 2PRKA 5J23A 1H6BA 2BH9A 3TLAA 3LBHA 2CFSA 2YVQA 3RNLA 3WX0A 3AF5A 4Y9TA 1ULBA 4FEEA 4LI3X 4JI5B 3UH1A 4FMBB 1M2GA 2CB9A 3CZMA 3FLBA 3PQ6A 3KXDA 4HVLA 2Z6UA 1H9AA 4ILEA 4KR2A 3EQZA 1TZ2A 3DUFB 1KWGA 3BTOA 5JJCA 5LYYA 4IVQA 3RROA 3ZTYA 4RADA 5KREA 3DKKA 1F2TB 1L4FA 2A0WA 3GAFA 4NPHA 5DFAA 2EYUA 3W6NA 1XPRA 3OBBA 4B2PA 3DR5A 3NAQA 5FYQA 2QPLA 2M2IA 3PNLA 5B6IA 3SHQA 3L9WA 1KFJB 2FMFA 4HDSA 1HSOA 3ZC3A 2O8NA 2ISSD 1V16A 2B1RA 2WIJA 4KFUA 5BXYA 2QT1A 1BS9A 5DX8A 5JXGA 5TEWA 4Q7QA 2ZE8A 1ZICA 3N1UA 5CDGA 5LQSA 2ZSKA 7YASA 2AXQA 1IHYA 1FTSA 1HE2A 2GA8A 2QPOA 3DMTC 1A7JA 1UMCB 1P0MA 3V3TA 4ZQGA 3S5JA 3RTDA 1KR2A 1VE9A 3UCFA 2ECOA 2ENUA 3FDJA 5JD6A 1LRJA 5KQRA 3TRIA 3T5DA 4O4IA 4CN9A 1E3JA 4PE5B 1ULSA 4MQEA 1U04A 3PF9A 3DLAA 1RXYA 2QLLA 3VDNB 3HPQA 2OFPA 4BIIA 2WI8A 4OX9B 2RCYA 4XB6B 4B4VA 1TYAE 4RSRA 2LIPA 3OCVA 4NV0A 3D6AA 3G68A 3KQSA 4QLAA 4HRVA 1ZZEA 5I7FA 3H87A 4IIJA 4BO2A 3W7VA 1N6NA 3DXYA 4FWIB 3HBFA 2BT4A 3GELA 3N2IA 3GA0A 3P32A 4UM8B 3T7RA 3SGLA 3U7QA 3W1EA 2BUAA 4WEQA 4F6RB 1FDSA 4QOIA 1G1MA 1UJMA 3ULKA 4LJAA 1Y3BE 3GUCA 4DYDA 2CC2A 3E9QA 2XZLA 2HWYA 3D8NA 4HLDA 5ECGC 4WCFB 3E5HA 4OM7A 1QCZA 4F4HA 1W9HA 5GOTA 4YIKA 4AO6A 3CF4A 3L46A 1RQRA 3H1BA 3LOPA 4KMMA 1M1YB 3QVUA 3I6BA 4NULA 3DLBA 5B36A 1GU0A 4TKVB 4U2FA 1M0EA 2ZRQA 3CX7A 5CB4B 4Y2QA 4YRTA 1U6JA 2P6PA 1R10A 2HXSA 2W2TA 1GZ5A 1EVYA 5B30A 3IR6A 1C9KA 5CURA 4F6LA 4GXRA 4MI6A 4OQYA 3V80A 2R8XA 1T26A 2J3MA 2PWAA 4RU1A 3RUIA 4Z4FA 3F6PA 2OORA 2CMDA 4MKXA 3FUWA 3L0SA 5ECYA 2I1VB 4KVFA 4RTNA 2EKDA 1QCYA 3M1LA 4M2LA 5T5QA 5TB5A 2FCRA 5ALQA 4E3ZA 3DVQX 4EM6A 1Z4PX 1ADJA 4YUWA 5BO5A 3O31A 1T1GA 3VNSA 3SS9X 2BEWA 2NUAA 4MVCA 3GQBB 5HQTA 2XF2A 2ZATA 4NESA 2CK3A 2DWUA 1O1YA 2Q7DA 1XD9A 5HHTA 1L3BA 3ILXA 3R1IA 4FN4A 4EHBA 4PCAA 1RAGA 3WRXC 3ZBQA 1RHUA 3P4YA 2HO5A 1WY5A 4DOMA 3JV7A 5A0TA 2HUPA 3E6AA 4YJFB 1ESNA 1JAHA 5AVOA 1TC1A 1G4UR 3KO8A 1VBNA 3CX4A 4J94A 4RVHA 3O74A 5FKJA 1RTTA 4FGWA 3QXGA 2BMFA 1Z73A 5IDXA 3QBVA 4DAEA 5EE1A 1P2UA 1QDLB 1Z0FA 1O0CA 2YFKA 1H8EA 3ECSA 4ZTZB 2Q9AA 5IFLA 4GUDA 1AY0A 3DNFA 1UZNA 4I55B 1YZVA 2IF0A 2VWQA 2GN9A 3HCBA 4M83A 4TVSA 4AW9A 3BRSA 4RMJA 1EQ2A 3DW1X 4BNDA 5E7IA 1H5QA 4C3VA 5B64A 2C84A 4HDCA 4JBWA 5IEBA 2I99A 1WCIA 2AUMA 3LMKA 3VFDA 3MT0A 4NI5A 3VV2A 2IU6A 4JX8A 4PBTA 3UJPA 1ADCA 5FLEX 4QL3A 4KIJA 2P3LA 2ZU0C 3GNQA 1OI2A 2H63A 3GRAA 3HU2A 5JTUA 3D4PA 4S1PA 3DMPA 2CWWA 3OZIA 3Q4GA 3DDSA 5B58C 3R44A 1DUSA 3S2EA 2CNLA 3BWBA 3HO8A 1KDOA 4MV1A 3HXLA 3BJIC 3OFKA 5CT6A 3QPCA 1YA8A 1YFKA 1MH9A 3FWZA 1HMPA 3VR5H 1ACJA 4JHLA 5ABPA 4LKOA 2C2XA 1Y48E 2G9QA 2ZBRA 4ANFA 1DOAA 1SCKA 4BCCA 4BVJA 1R5NA 2CHEA 5KBYA 2K2WA 5E0KB 2R60A 3H2BA 4QREA 1U3FA 4CMKA 4OHVA 4CT0A 2Q6IA 1QG4A 2AFHE 2COKA 5B4VA 2VFAA 1E1QD 3UBTA 4MRSA 3QWHA 1TA9A 2XUAA 3ZU3A 2PYDA 4IVRA 2DWOA 2PLNA 4U02A 5GIOE 3HJGA 5JU6A 1CYDA 3M3DA 3TQHA 1FFYA 2GRAA 2GS9A 13PKA 2LD4A 2UUOA 4L15A 4TTVA 4V03A 2Z98A 3DD5A 2ZYWX 5ESDA 5M5BA 1HDOA 4KHZA 4NXNB 2DFTA 4UULA 6YASA 1B3BA 5D3MB 1SC4A 2O8BB 1D2EA 3DMHA 1YE5A 1DDOA 2W6NA 3I1FA 3SBEA 4CIWA 1EZ1A 3NDJA 4LYYA 4QYSA 3GDWA 4U7TB 1B23P 3DSRA 4BGDA 5DTRA 4GOJA 3TB4A 2NXEA 1AM4D 1B6RA 2AHOA 2XKAA 4LQCA 4Q01A 3RK0A 4R4JA 1FFHA 1XYGA 4FHGA 3ZY6A 4G8JA 3EW9A 4NECA 1FFWA 3SKVA 1Z6TA 3DWGA 5THKA 2HWWA 2XMZA 1T9GS 3EGEA 3M6FA 1YJAA 4WACA 2WMYA 2WIKA 1PG2A 1NY6A 4U8HA 2OB2A 4AWXA 2HA4A 5JPIA 4B82A 3ENZA 2XUFA 1K27A 3DMYA 2YXBA 2PD4A 1GRVA 1YDFA 2VA8A 1RZUA 4JP2A 3QE2A 3HDGA 5BN1A 1VDMA 2H59A 1P17A 3F7TA 1PT8A 2LGJA 3U7GA 2DX7A 3CT4A 4P2GA 3ABQB 3T6KA 3QBJA 2WLSA 1KDVA 1O94D 2OCGA 2O07A 4G07A 3RRNA 1PSDA 2RH4A 5LD2C 2DTXA 3UTCA 3P5BA 3SYRA 4GNRA 4N5DA 3KQTA 3R76A 3PDHA 2EG5A 5J2TF 2BZSA 2LRHA 3EG5A 2CBXA 1AU9A 5M3BA 3RR2A 4BVBA 5JWRA 1NN3A 4Z53A 2VZ9A 3B12A 2D5LA 1E6LA 4I4TB 2ONZA 3BZUA 3MTJA 4FOSA 2CDBA 3PG5A 1WDMA 1HE3A 2YJTD 2J0UA 3CN7A 3GMDA 1YVDA 1XZNA 3N75A 3B20A 1NW3A 3E7XA 4G0QA 2CVZA 2FX5A 3SHTA 5IZ4A 1U9IC 1A72A 2QRPA 3BXZA 1LDGA 4IY1A 2W7TA 2XGOA 4C7KA 4DS3A 4JBHA 1S01A 1Z9BA 2WP8J 3I4CA 3QFRA 3FNFA 1E2QA 4MK4A 1R8YA 1UJBA 1O08A 1T9BA 4KW7A 4ZVPA 1X9IA 2NSLA 3IS3A 2OCXA 4GQBA 3ROKA 3O8QB 1I2CA 1UWVA 1SD1A 2JGAA 4WCDA 1SVNA 3STVA 1F5SA 3ZZNA 2CEAA 3GRYA 2QKYA 4OFWA 1Z2DA 3LYAA 2YZNA 3RHTA 3TJZA 1AO3A 4C7VA 3AILA 2IV7A 1ADBA 4DY6A 1OLXB 2IXAA 3N8GA 2WTMA 5A4DA 1IZ7A 2IYZA 1E3WA 4HDQB 2QTBA 3CS3A 4AP5A 2EP7A 1B41A 1TM7E 2I6UA 3OO1A 4CG2A 3NATA 3E7WA 4E14A 1U0LA 3HUTA 2CUNA 3HVJA 1LTQA 2GEUA 2FW7A 3DV9A 4IP0A 1Y3CE 1U7XA 5JS2A 2B30A 1GFWA 3LX5A 1ULHA 1LWNA 1TMYA 2WJ6A 4MIEA 4Q3KA 1H3FA 1TMOA 1ES9A 1OTHA 3Q40A 5C51B 1FLDA 2IS6A 4NAHA 3H5WA 3O8BA 1YV9A 3GD7A 3TZLA 1XHLA 4EKIA 3EMVA 2HO4A 5TGTA 1CJMA 5FL7A 4Y1FA 4G4SO 3DOEA 1NFFA 3ZZ0A 4WNIA 3DNMA 1NVFA 2J5QA 3H75A 4H0CA 5IN4A 1SHJA 1Q1ZA 4I9UA 3DC7A 5LZ5A 4MRNA 5F5NA 2AXPA 2G7ZA 2KI5A 4QUJA 2D1YA 4UUNA 1OIWA 1CK4A 4QUAA 1U0GA 4H4DA 5COQA 4KL8S 2ZP1A 4K3UA 4QVGA 1Z4QA 2AL7A 2RJ3A 3R5XA 1Z4IA 2QP9X 3A32A 5CHEA 1XRRA 3JVIA 3NO4A 2R751 3CSSA 3JSAA 1AE1A 2E5FA 4E03A 3RSQA 3RBVA 2WQZA 2FRXA 3NIFB 3RS8A 5JYCA 1FFAA 1T4BA 1YNOA 2Z56A 1CJBA 3UT5A 2I9PA 4YWHA 3SYMA 1U7DA 2C2KA 5EN4A 4IGEA 3LL4A 4HB4A 4B3DA 4MNTA 3Q6IA 5I7EA 4LQLA 3SE7A 4CMJA 2JEOA 5AXDA 3B1WA 3C87A 1CY0A 2JW5A 2ODAA 5FUMA 1XCOA 3AGQA 1Q3KA 1FSFA 3PFCA 1VP3A 1N8SA 2BKEA 3ELUA 4MEBA 5KYXB 3MJEA 1UH5A 3IMFA 2ZI5A 5AVQA 4FX2A 1PR2A 3KR2A 2JZCA 3UM9A 5AJUA 4XM2A 4WUTA 2L2QA 2DCUA 2CZQA 1GTL1 1LXCA 1FPQA 3FZQA 3V4ZA 2OMEA 3RJTA 4DCPA 2VBIA 2YV5A 4ND2A 5L4NA 2RHOA 4E4YA 3CNHA 2QMZA 4YP5A 3OZBA 4MVJF 3ANSA 3SZRA 5HKKD 1Z0SA 4AF7A 4LPSA 1PIWA 3IELA 4NE9A 4QBIA 1JIKA 1NONA 1PD0A 1RKXA 2QWXA 3DZKA 2R25B 3HDQA 2C5GA 4C1BA 4F2DA 2ZAGA 3OTWA 821PA 5HPYB 1TVEA 5KOJA 1C7RA 3NRBA 5J2UA 1C4KA 4RYDA 4RF5A 1GTSA 1V3VA 2J07A 4J7XA 2HCTA 5ENVA 4ZDWA 2WWWA 4WUVA 4IDBA 2KM1A 4X8OA 3RYIB 1EIWA 1CUBA 4BMCA 2DFNA 1IRIA 2ISQA 3BRCA 3UXYA 4TYNA 1L7XA 1VHLA 3K5PA 4BAUA 5IT9A 2ZM5A 4BXOB 3FGPA 1Z22A 1MRNA 1N5OX 3I9LA 3O3CA 4RK5A 3GJ0A 3EZGA 4M1ZA 1XZAA 1PHPA 4D8TA 4HN2A 1JEJA 4IRUB 3ZVMA 4UEOA 1EWRA 3CCFA 3MMNA 5C53B 1J1IA 1XQ6A 2B8WA 2ZIXB 1DU4A 4J16C 4V0QA 5FO0A 1G2OA 1DWOA 1I4EB 1NVTA 2A9JA 4JI2B 2RKBA 2Q29A 3PNBA 4LTNA 2AKEA 1GFIA 2AEEA 3ECAA 4GRIA 4MO2A 1NWCA 3SC4A 3ZG6A 4HUTA 1EFVA 2CUZA 1I6MA 4KXVA 5KYNA 2WJYA 2WM3A 1OY1A 1P6UA 1R1DA 1JV2B 3LC2O 2W6PA 3DVSX 4FCWA 3PKZA 4LCBA 4UTPA 3VSEA 1OT5A 5LOVB 4KE9A 2ZIUB 4WX2B 3Q9NA 2RBKA 1Y6ZA 1M34A 2QY9A 3OE5A 1FUUA 1KJZA 4O2AF 1WAMA 2CLKB 1XLWA 3E2MA 1JT9A 3I09A 4H17A 4LOKA 5C34B 1G8HA 5KZMB 3C3MA 3LY5A 4HXFB 3V1UA 3WXMA 3L7OA 3LV8A 4D44A 4PYIA 3HB5X 1V5FA 2E18A 2OHGA 4N3GA 4RE5A 5FUQA 2X8JA 2D4HA 1NR5A 3JPWA 1SUPA 4UTXA 5J2TB 1R6TA 3GZNB 4QU0A 5AM3A 2G9RA 4I81A 3UAWA 3F9IA 1WQ3A 1Z8FA 1CUEA 4C7OA 5BVHB 1NIPA 4QOEA 5E4TA 2NUBA 1ZQ9A 1JDPA 2C3UA 1R7RA 4EGAA 2CZGA 3CLTD 4FZ5A 3P45A 1KOJA 4LGMA 2P9TA 5CB0A 2FZGA 1RJ9A 2R6DA 4KXLA 3HL4A 4WESB 5E1MA 1KRXA 2AEJA 4DUYB 1DRWA 2ERYA 3OLXA 1ZC4A 1AQNA 2BFAA 2WJZB 3IHLA 4IV0A 5LXTB 2X3FA 1SK9A 3AVOA 3KHUA 4H27A 2NU9A 4TMXA 4JLMA 2R8YA 2Z8YA 3DMNA 3GW8A 1ABBA 4OK5A 1XXHE 3Q8KA 1Q12A 1SC3A 3NVMB 1P3Y1 4S2UA 3P9CA 2NOAA 2OVFA 2IOYA 3AG6A 1SVOA 1U7HA 3ZHSA 1PNVA 4KYUA 3BHIA 5AVVA 3ZW9A 4NBNA 1IJBA 1GZDA 1FMCA 1ZM3A 3B6ZA 5D00A 3LUGA 1PEAA 4MHOA 1DSSG 2C0CA 3PX3A 8MHTA 4URZR 1LPBB 4EFLA 3VNUA 1F60A 2JLAA 1NRXA 1L4UA 4FP9A 1XDDA 1E7WA 3OIGA 4MHTA 1P7CA 3S8MA 2CWDA 2PO7A 4YT4A 1DKPA 2ZBDA 4MCJA 5I7RA 5LU9A 3EVCA 2HSEA 1CUWA 2XYHA 2X9GA 4RPHA 1ZK0A 5D86A 5K7SA 2X1MA 3JARB 4ZZ2A 2M1XA 2EW2A 3HRKA 4QNMA 1QHSA 2FG5A 1EFAA 1RWQA 3QU7A 1QUEA 2BFBB 3FYDA 4ALLA 2JGLA 1OLUA 4Z0PA 5FEUA 4PQFA 2ZS7A 3TE7A 1DRVA 1WUTA 3JRWA 1B2RA 3SZLA 4GXNA 4R3NA 5JARA 5LOVF 2VP9A 2B92A 2GYUA 3BEDA 3BMNB 1UXJA 1BU8A 3PEFA 5AJXA 3TQRA 4NMMA 3R7SA 5J2UF 2QT0A 5HF9A 4JY7A 3QMWA 2B34A 3UV3A 2XLBA 1DBVO 4ZI7A 3ZWYA 3RRBA 5FBLB 4WA8A 4GPZA 4WY8A 4RFVA 2CJYA 2EFDB 2VNIA 3DAOA 4C7BA 1Y7IA 3FCXA 3E1KA 4LSGA 4BQNA 1C3OB 4E6EA 1EM8B 2F3TA 5EKTA 5BNIA 2P1DA 4PLYA 2MCFA 3VDRA 3ZHYA 4B44A 3A4IA 1EVIA 4TRMA 4E2WA 4IDGA 4CR7A 4KQ9A 2B20A 2H0QA 1X7ZA 1GOTA 4RWZA 2J45A 2QM7A 4WQMA 4PHFA 1E1CB 1Z0DA 3KHKA 3VA7A 2PKCA 4X45A 1DT3A 3HPRA 2ROQA 1Z0ZA 1Z2PX 2I4MA 3WKEA 3OUZA 3S2IA 4IHJB 2Z83A 1VQ1A 4AZWA 5BT8A 3C5CA 4GKJB 1JHAA 4TLMB 3LQYA 3QQ5A 1XSEA 3M8KA 3EIEA 4XGNA 3PHIA 2XUIA 1EGHA 4HDSB 2FV8A 3I37X 2ZTVA 2W6MA 1KGDA 4FS3A 1DRUA 4N40A 4RD0A 2XT9A 4EI8A 1H8ED 4CGZA 2NVWA 3JQDA 3TBHA 2VNAA 1N0WA 4YCMA 2D0OB 1O89A 1U3TA 4EMBA 4DIEA 3RUDA 3OT4A 4X65B 4RDIA 5AVXA 1WDWB 4LOAA 2JVJA 5HDQA 4B83A 1HNZB 2FF7A 1L7QA 1VIDA 2C3OA 3FNIA 4P1ZA 4TTRA 3BT7A 1QZUA 4ZANA 2CNWA 1A4UA 4QUDA 2EZTA 2DBQA 2O6LA 4IM7A 3WLRA 4AZSA 3GLFA 1IQ0A 4PZ9A 4K2AA 2DCMA 1WW3A 2VG8A 4EI7A 2YFHA 4B6RA 3IUSA 4E5VA 2BOVA 2I1WA 2VYND 5DCUA 2B7BA 1A8QA 5DDIP 1QZZA 1X8XA 3EXFA 1G1AA 3OAAA 1L5SA 5DASA 2W2NA 2QG9A 4PLHA 4MW1A 4W99A 4AKHA 3BGIA 3A3KA 5JI3E 1JQDA 5EEHA 4MQ5A 4FFOA 4DCVA 1KP3A 5TGZA 1UOPA 5K3FB 2CLIB 4QHTA 1D1TA 4F8JA 3JALB 1F2DA 3K09A 3W0LB 2IA5A 4CLOB 3T3IA 1LBQA 5LQJA 2OZEA 1M6NA 4JNKA 4IUBS 4N49A 5C8YB 4MUMA 3VDMA 5DI3A 5KYVA 3VOSA 4D96A 4WBNF 3ORSA 4XWTA 2F8MA 2IOFA 2P9HA 4UBMA 3ICEA 4KNVA 1DJLA 1UBOS 1C0EA 2XADA 3ZOZA 3NONA 4WFIA 1GG2A 1JPNA 1E3WB 3JW8A 4ZVVA 5JRJA 4ESHA 3AVYA 4YJDA 1C9YA 4B4OA 1S4MA 3L0YA 2OO3A 3PB3A 4WRRA 2PGOA 1XTQA 3BM5A 2PEZA 3ZNPA 3D7SA 4LF5B 2V9ZA 1KAGA 3WIVA 3HCEA 3LE8A 2D3TA 4U6QA 5BQ5A 1XO1A 4FGZA 4JDPA 3BJMA 2GBIA 3G9ZA 4F85A 4MWOA 2GBPA 4P93A 1C7ZA 2OAEA 1C7EA 1X80B 3QJYA 4LVNA 3SE0A 3V7UA 4ALIA 3MCUA 4D43A 2GZ2A 5LQUA 1EEHA 1G8YA 4TS1A 4WA7A 1DJPA 2BTEA 5COBA 3OE4A 3GYGA 4GC5A 1SOVA 4PQYA 3JQAA 3JQBC 2WWTA 3G5TA 5H5JA 5K0NA 5SY6A 5JBIA 5KYWB 3D9QX 2PFKA 1MO6A 2HIHA 3D6VA 3UAOA 4EHLA 4PXYA 4B0PA 4I5GA 2JFZA 1NBIA 1H6CA 2RAFA 4AJLA 1DPFA 4HWGA 2WNIA 3D7NA 1ISFA 3STHA 3M33A 4CL2A 1A77A 3MELA 3WGHA 4RVGA 2CJWB 3F6YA 1N57A 3GRVA 4QZVA 1Y80A 4D3SA 3AFMA 3U16A 3L7JA 2CVQA 1E6WA 1YR6A 3VR4A 3OTHA 4WE3A 2P6MA 2QDXA 4WBSA 4PNHA 2B3TA 3GUVA 4OLHA 1RPJA 5IC4A 2ODWA 4W9MC 4JT4A 1MEOA 5D5PA 3T1YB 1JDNA 2HA3A 1SOMA 2RHTA 1XL0A 3IO5A 4IMIB 3D6JA 3L7LA 1WIWA 1G63A 1LQUA 2H2DA 3U7JA 5CVEA 1VCHA 4O8ZA 2P7IA 3PA6A 4R9NA 3AZQA 5CNIA 2P3QA 2X3UA 3QU9A 4QOHA 1GKIA 3ZE2B 4AROA 4X61A 4BQQA 1O95A 9MHTA 1OFUA 4NYMR 5EZSA 4IZOA 2ZT5A 4EY5A 3P0IA 2A57A 4II3A 3AK4A 1E9DA 3FZYA 3GMSA 1W7AA 1YB5A 1JQ5A 1FFEA 3QVMA 1RZ3A 4R1UA 3IPCA 2DEUA 1KNQA 1AN9A 2VK4A 4CF5A 3B7GA 3KDSE 1KPHA 3EEBA 1RYYA 1Z3IX 4MQLA 3WGTA 4XM1A 4ZVTA 1GQQA 3E15A 3KR9A 1YB4A 2BDUA 2IP2A 4TQ9A 4B3SB 1HDRA 4TS4A 3ISVA 3ZU2A 2GTPA 3RSOA 2PGLA 3D1JA 2G67A 3EVNA 4C2BA 2QMHA 4D4GA 4ZOBA 4JJZA 3AERB 1ORDA 1KS9A 2XCLA 3I4FA 3PE4A 2P30A 1R6DA 4FBLA 1CJCA 1C0LA 2V0NA 2WKPA 3D6MA 3K1YA 4WADA 5JAOA 2H06A 5MGNA 4XQEA 1UOEA 3DMTA 3CJRA 2YWJA 2WC1A 3WQRA 3DL4A 4BBAA 1X0XA 1XI2A 2HJGA 1CV2A 1QFYA 3ZHTA 5I01A 2PRSA 2I2CA 2KLHA 4W1RA 3ZV3A 1N1EA 2BSQA 4AJKA 4B7CA 4BFUA 3MWDA 2MTBA 2P9EA 3W1WA 4GF5A 2G5GX 3PNKA 1OILA 4DXDA 4O3MA 3HEMA 3Q3VA 5JS1A 1YMVA 2ORWA 3TLBA 1K1EA 1UADA 3GO4A 4R6WA 4EHAA 2FEKA 4JXJA 3B7WA 4MINA 4PLCA 2NO5A 4YV0A 2DLDA 3SR0A 2HGSA 2EKLA 5E8JA 1H1LA 1EGVB 3LLCA 2PXAA 3HYCA 3QYPA 1BOOA 2OFWA 2PL5A 2Z9CA 4C03A 2ZUVA 1L5VA 2R65A 1NOKA 3AP1A 4JKYA 4RA6B 5DT9A 1JX6A 3UG7A 4RULA 2BZGA 3PDIB 4TQUS 1YR3A 2J31A 2Q8NA 2JFXA 2WKWA 3CPJB 3LUAA 1SULA 4PPQA 2HJVA 3QXCA 3AY7A 4OYYA 1FNBA 1Q6ZA 1TKAA 3L0DA 4FDLA 3OIUA 3JD0A 5IAJA 3VJKA 2JEZA 5DM4A 1LNQA 1TRKA 2CDNA 2H2FA 1PG5A 3KK0A 3A04A 4LOHA 2ZITA 4KDCA 2V7QD 4NP6A 1SK8A 1R5JA 2XUZA 3QM1A 3P2KA 3EEIA 4P0TA 5JY1A 4QDXA 3PYXA 3MVEA 5TVGA 3PPIA 4V0MA 1Z26A 2JKYA 3ABRB 4MR9B 4RNCA 1R74A 3FMGA 4KLAA 1Z4OA 1CUUA 1XEXB 3DJYA 3ORRA 4M1EA 3O4JA 2QMQA 1NX9A 1Y8AA 3UAGA 2GCOA 1YR9A 5LZ8A 1N75A 4H60A 4B4WA 1V48A 1E99A 1DTWB 1PWZA 3CY6A 4FJ0A 3WRYA 4EFKA 4MGYR 5EPOA 1HQYE 1VCOA 3EASA 2NU8A 1FX0B 1SVMA 5EYPB 4BVLA 2FUKA 4UHFA 4NY1A 1QTQA 1BOFA 1TXGA 3CX8A 3PC8A 3R8CA 2YDXA 3KWLA 3W6ZA 1ZY2A 5JH7A 1JSCA 3EAGA 2EGGA 3KYIB 4B9EA 2JJ1A 4CKCB 2JRLA 1E4EB 1VMEA 1DP4A 3LLUA 5D85A 4OI0A 4J4HA 4BNLA 5K8JB 2CNBA 1GGEA 2QEQA 5EPEA 4B6FA 1YFJA 3EGDB 2EXXA 2VT7A 3AWDA 2PYZA 3BF8A 4DLRA 3WOVA 1RBYA 3CVWA 1NASA 3O21A 2HIAA 1TEHA 4WERA 1DG9A 1GRRA 3NUQA 4EMSA 3NX4A 2J9FB 4CN8A 1PSZA 3Q85A 4Q7MB 1NLFA 1NBAA 2JGKA 3IVRA 3M5WA 1KFEB 1SBNE 2HU2A 2PXHA 3SR4A 3SIPA 3CVYA 4CHGA 1JHYA 5AUQA 2FMKA 3DBRB 3IUNA 1Y7LA 4P84A 2GM9A 4AQ7A 3IOCA 1D07A 1U11A 4MB6A 3ZDQA 1DC7A 4AX4A 1ZM2A 3K3PA 3MGGA 1I2DA 2NZXA 1WEHA 5LDGA 2LUOA 1G8MA 4MVJD 4MVWA 2Z8XA 1XMOB 1J8DA 4U7WA 1QV6A 4DV7B 5D01A 5CEFA 1XDSA 2Y05A 3OBIA 5DRYA 1Z4MA 3ZDDA 1APBA 4IG4A 3UPDA 3KSBC 3RK1A 5IC6A 4WECA 4EJSB 3WWOA 5NULA 4US1R 4ZEXA 3BL6A 3DHVA 1UBFA 3OZ7A 2IKQA 4PSDA 4R8VA 2MR6A 2JGFA 3TLGA 1EYZA 2F7SA 1Y8RB 3O6VA 2H9IA 3QXXA 4Q05A 1HE1C 2VDUE 1VM6A 3GY0A 3MB8A 3FI0A 4HGRA 4UD2A 3IXLA 4UBNA 3VO2A 1LK7A 2ASEA 3C3KA 2P11A 2EHDA 5T3YA 2OM2A 5HRUA 3GEPA 1KDPA 4E33A 1NXSA 2FUNB 2J46A 4ERXA 5J47A 1S8NA 3G49A 4UBOA 3X1JA 4TSFA 4LFAB 4C4RA 2O7VA 1YNSA 3Q8WA 4RVUA 2OXEA 4GVLA 3ESBA 5HGJA 1CLEA 1WKCA 2E55A 2FGKA 4HAYA 4H7PA 3OFND 2OV8A 3TGPA 4GI5A 1LQTA 1OX6A 1MDBA 4OXNA 1P7YA 1XNGA 5FTWA 3VAAA 3GFGA 5K8TA 4LGCA 4HXYA 4OYRA 1R0CA 3VU1A 2A6PA 5DNVA 4Z7OB 4LBYA 4P9NA 3FUVA 2WF5A 4TLLB 1KXZA 2JNWA 2O48X 3FYHA 4FX5A 4G9BA 5K0CA 1L5HA 6NULA 5LZ7A 4P22A 2JJ8A 3PRHA 1I4WA 3GRUA 1WW2A 3SEQA 1A82A 1QYCA 4KHPB 1N6HA 2BKLA 3PI7A 3ZH2A 5K0SA 2PT9A 4YA6A 2XSZD 2ZUTA 1NFQA 2GCGA 3TCKA 3FSEA 1L8OA 1KZ4A 4B9AA 2NQTA 4RESA 4BWFB 3C3CA 3FCCA 1V7PC 3GQVA 1DXYA 1HTTA 4JLOA 1A8SA 1DI0A 3UH0A 1ISPA 4DEXA 2DVMA 1SHUX 4F60A 4M1SA 1GNRA 3PUIA 5E6UA 1CP2A 1TFUA 1WZ2A 3PYLA 5K8IA 1C80A 3CUUA 2BFFA 4CKBA 4LZLA 1BCRA 2HF9A 1I7SB 3LUJA 4P0PB 4WN9A 1EFPA 2QVLA 2XB8A 3A1NA 2NXJA 4PZCA 3GLGA 1DKUA 2IYNA 3DYBA 3JYOA 5E2AA 3IAEA 3L6UA 5J5CA 121PA 4IIDA 5TMDA 2OD2A 3TZQA 1IE3A 1ODTC 4P92A 2AZMA 2QBYB 1GGJA 1A96A 3C1TA 1PDOA 2BFBA 3R0ZA 3UJ3X 2PT7A 4A3SA 2JAOA 4G8CA 1GNTA 1OI4A 4OSOA 2UUAB 1QFZA 3KYDB 2ZWMA 3KJIA 1WE2A 3WG9A 1PUXA 1WUHS 3IVXA 4JSRA 2AFIE 4MUNA 1UMDA 4QBKA 4BMZA 2VC2B 4BX0A 1NXQA 4R1LA 1KYXA 1QHIA 1SWWA 1YI1A 2GYYA 3BWDD 5BV0A 5HBRA 1KK3A 2JBAA 3OPYA 4P38A 3TLCA 2FP4B 4Q3LA 4YDRA 3W8NA 1Q0LA 2C4WA 1YK1A 2XDAA 1CY2A 4KLZA 5EWJA 5DWQA 4HQNA 5AOBA 5KVAA 2FAXA 4UM7A 5I7OA 1HYQA 4MV0A 2GHQA 2Z0MA 1HNNA 1QYVA 3WP1B 2GZHA 1Y1LA 5ILGA 1BZYA 1C1HA 2QN2A 1NPYA 3NDIA 1LB1B 2QE6A 4YJGA 5FLYA 5TS2A 3AF1A 4HQOA 2R9VA 4UEQA 4V24A 3W2FA 3K0HA 1RWXA 2HEIA 2P6UA 1XLTA 3OZRA 2WYIA 2WT4A 3RJZA 4ZJYA 4TZKA 5EMKA 2H65A 2W22A 4KCGA 5AK6A 1MO2A 5KYGA 4IFEA 3A9SA 1KTVA 2FN8A 2WTEA 4ME6A 1Y8RA 2Y0BA 5C3MA 3HVKA 1AUPA 4R1OA 4ETMA 3KWJA 3MAAC 1T36A 4XDGA 5REQB 3WLJA 3SNKA 2O8FA 5EXDA 1WLSA 2D2EA 3ONVA 2FFRA 2P0EA 2JIPA 2O3SA 4HQ0A 5F23A 3VPCA 3HHPA 2FPRA 1J90A 1EZ4A 4ZAGA 4L4ZA 5EZ5A 1E7YA 2XDYA 1NQUA 1JPJA 3FDFA 2X77A 4M1QA 3IHTA 4GS5A 4MUAA 3W8EA 4OP1A 4BV8A 4D56A 1PBNA 5DBIA 4TWJA 3R7WB 2JCVA 2CE2X 2I6SA 4YONB 1W19A 4LXIA 2FX3A 3EIHA 4BLRA 3TS1A 4QUBA 3SLKA 1OIXA 1PJ4A 1W2GA 4ALNA 1NVGA 5E4JA 4EPVA 1UFVA 4LDQA 4Y2XA 2QRZA 4KUEA 5LQRA 3WGIA 5JI2E 2I76A 2WWRA 3H5RA 2EF1A 1W59A 3KLPX 4PYNA 2PS9A 1UKZA 5P8WA 2H48A 3LUDA 1NR7A 4DSNA 2GCNA 2PS3A 4DCJA 4DDVA 3A05A 1YACA 3LC0A 4ZCLA 3QVXA 3U49A 3WGLA 4HEA1 3JD3A 2JCSA 1YDGA 1TJ5A 1GTRA 4JA2A 3ZDAA 5EIFA 4EGCB 2MINA 4OHYA 4REMA 2VSNA 1ZGBA 3WIOA 3H9QA 3EGXB 3LRXA 1UKYA 4MKZA 3N6XA 2UUPA 4GXQA 2ZB2A 1C4WA 1MU0A 1RRGA 1S8FA 3U1TA 3W5AA 1ZHOA 2QT9A 4H16A 1XJQA 3O1JC 3R7LA 3UGQA 1BDHA 2QN1A 3LX4A 4J1NA 2PH1A 1NDHA 2ZRHA 3KUXA 2NNWB 5L95A 4YN3A 3BZBA 2WA1A 1KR5A 2J0UB 3K9CA 1TJNA 3NIDB 4DCOA 4E13A 5AOVA 5LIRA 4RFLA 2AA3A 1M2KA 1JG7A 1K2WA 3GLTA 1ZAYA 3JAWB 1CP3A 3NVDA 4MJ3A 1TAHA 1YS1X 4YAOA 3TL3A 2IGTA 2BC9A 3WLEA 3OZDA 1UUFA 3EDYA 3KQMA 3NKFA 4NKRA 3LIPA 4AMGA 3RS5A 2IBMA 1QRRA 3IMEA 2RHLA 1GRNA 4GR5A 4N82A 3MWGA 4S2EA 6GPBA 3BEOA 3FHLA 5AM4A 5I9IA 5J4VA 1PJSA 3DOFA 4CKWB 1AXEA 1YCGA 1U3VA 3AHEA 5K0TA 1G3IA 4YS6A 4B84A 3AMVA 1TI7A 3IQDB 4X3PA 2EYQA 3WTCA 4GM1A 2WHPB 3C14C 3HZZA 3JXEA 4ZTBA 3S68A 2PD3A 3FPGA 4TXLA 1U6KA 4GC9A 5JSFA 3GJ8A 3K1AA 4PHHA 2WSMA 2Y9PB 2YWHA 3AX6A 3VC1A 3ZHXA 1XKXA 3CRVA 1D3AA 4KRFA 3E2PA 1S7GA 3RIXA 2UXBB 4R7GA 1QVAA 4NH4A 2EJCA 3AINA 4NOKA 2HMUA 4Y98A 3VR5D 4A8PA 4XRGA 4ZGBA 5BW4A 2P9QA 3LPNA 4QG7A 4PZYA 2FA9A 5ES3A 3TVDA 1GTMA 1QIDA 1XTVA 2DHCA 3ILSA 4Q0MA 4ED9A 1UMBA 1I4DD 1W85B 2ZUSA 5L4LA 1XWIA 4Q9JA 3VHRA 3WYCA 5HM8A 4Z3OA 3UWOA 2OGUA 2FPKA 3K5WA 5JAMA 1NWHA 4DSAA