2H7XA

Pikromycin thioesterase adduct with reduced triketide affinity label
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
284
structure length
279
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Type I polyketide synthase PikAIV
publication title Structural and Mechanistic Insights of Polyketide Macrolactonization from Polyketide-based Affinity Labels
pubmed doi rcsb
source organism Streptomyces venezuelae
total genus 97
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h7xA00
2DQYA 4AN0A 1BEZA 1JFRA 2VJCA 3D2AA 3GUUA 3WIBA 2QT9A 4CFSA 2BUAA 4MQLA 4X85A 4QNNA 3OURA 1R9NA 4H7IA 3R3ZA 3ZLUA 1CRLA 2HM7A 4W1PA 4F5ZA 1YR2A 1J2EA 5A6VA 3M83A 1G42A 2RI6A 4DNPA 3HC7A 3K9BA 1FSSA 3U0VA 4ZRDA 1G4HA 3FLEA 2XUGA 4K6GA 3V48A 4G5XA 4BZWA 3WA7A 3DS8A 4DYHA 4J0GA 4FFVA 3F9CA 1GQSA 4JUIA 4B85A 4OD0A 2YYSA 3OTQA 4DSZA 3F98A 3ESCA 2PSDA 1IMJA 1VLQA 5AIAA 4MYSA 1CR6A 4ITVA 3N2ZB 1UOQA 3PF9A 2FX5A 2HRQA 3U1TA 5AJHA 3BF7A 5JD4A 5HK8A 4W1SA 5JIBA 3V1MA 2WILA 2WUGA 3H2JA 5AM0A 3TRDA 3RKSA 3R3VA 1QLWA 4LXGA 4QZVA 3FSGA 2PVSA 2AJBA 4XIIA 2B61A 5ALQA 1CUJA 4CI9A 3DCNA 4BE9A 3SWWA 4UHHA 2CJPA 5E4YA 1K4YA 5CH8A 4EHBA 5DNVA 1EH5A 3QH4A 1AGYA 1Q83A 3I2JA 1YASA 2ACKA 1UKAA 2PX6A 3AJAA 4CG2A 1WB6A 2PSFA 4J0DA 3RK4A 3WK9A 5IKXA 2HU5A 1AMNA 3BDIA 1HKHA 5FXMA 5AKIA 4QWWA 3I2KA 5HF9A 1BS9A 3C8DA 4H77A 5JZBA 1LPNA 4DMKA 1J1IA 5AI5A 3D2BA 4YK7A 3WK6A 2I03A 1TKRA 2HFJA 3VJKA 4WDRA 5J3JA 1WB4A 5AM3A 4ZWNA 3H2GA 1QOZA 3K2IA 2QJWA 3D5EA 3DJYA 3C6ZA 1AC5A 1CUCA 5JAHA 3YASA 4PSUA 4B83A 1L7RA 2WHPB 1F8UA 4QLAA 4GHWA 2Z8XA 1O6GA 5LZ7A 4B6GA 1GKKA 1JJBA 3QYJA 1N1MA 7YASA 2WG2A 1DQZA 3H17A 5CT5A 5ALYA 3F96A 4Q05A 5ALRA 3LS2A 4X95A 2VT7A 1UOPA 2OGZA 4ETWA 5K5EA 1MNQA 3GFFA 3O4HA 4M0MA 1I6WA 1K6EA 1E66A 3I6MA 3PI6A 5ALLA 3IUNA 3WWOA 3A6ZA 3DEAA 1ZGBA 4OU4A 4FTWA 4LIPD 4MWTA 1PJAA 1XZKA 5BWBA 1HLGA 5CURA 3ZPXA 5ALEA 1IUNA 1E8DA 1UKCA 3HEAA 3D4LA 5ALNA 4UHFA 3DDUA 4BCDA 4Y2SA 1ZD4A 4FFWA 2ECFA 4MQMA 4X92A 4AN1A 1LGYA 2JGJA 1L7QA 3JYHA 2PUHA 3SX4A 5LKRA 3DKKA 1CUZA 4X97A 2HL6A 2H9YA 4JNCA 3IDAA 2WU3A 5ISMA 4C87A 2GBFA 5HF6A 2XUOA 3D3NA 3PUIA 4FBLA 1RWQA 1R4ZA 5ALXA 5K3CA 1EDDA 5FLKA 1DU4A 1UK9A 4C89A 3EQ7A 3D7RA 2H7YA 3B5EA 4G4IA 3BJRA 1QIEA 3VJLA 1XZJA 3OOSA 1XLVA 1G5FA 5DTIA 4GBGA 4K6KA 3G0IA 1MO2A 1TQHA 4EZIA 2I3DA 2QUAA 4ZGBA 5FV4A 3ICWA 5BV7A 5LZ9A 2WHQA 1RYYA 5HKAA 4G9EA 3DKRA 5ALGA 2XUFA 1DWOA 4C88A 1C7IA 4LXHA 1GPNA 2H7CA 3L1HA 4HXFB 5AI0A 2VAVA 4FLEA 4GW3A 2XUQA 4Y9SA 1EDEA 5ALIA 3HABA 3I2GA 3GBSA 2EDCA 2JIDA 4KACA 3I28A 5BWCA 3OG9A 1R9MA 4B82A 3QMMA 4KE7A 2GZSA 1USWA 2PU5A 1UZAA 4HRXA 2B20A 2WJ4A 3HSSA 5AM5A 2V9ZA 4WY5A 1XFDA 1ORVA 3G7NA 5LLSA 1QTIA 1CUAA 2V98A 2WU4A 4PSDA 4U2DA 1H2XA 3HXKA 1LPAB 1VA4A 4AO6A 3H0CA 1A8QA 2WFMA 1XLWA 4WY8A 1K8QA 3STTA 3LIPA 3E0XA 1EINA 2HIHA 4IO0A 1FFEA 1LPOA 5AICA 3TJMA 2FJ0A 1LPMA 1VA5A 3M81A 3C5VA 4IH9A 4AZ0A 3WWEA 2CBGA 1R88A 5AKYA 5LKAA 2WUFA 2OCLA 4PQEA 4EBBA 4BTLA 2XUHA 2WIJA 3NUZA 3QITA 1OXMA 2PL5A 5AM2A 4FNGA 1FFAA 2QMQA 2Y6UA 3PDCA 4FNMA 5ESRA 1EK2A 4BBZA 1F6WA 4MEBA 2WHPA 2XDWA 5AIBA 2GYWA 4HAIA 5AI4A 2ZSHA 3N0TA 2Y2VA 2QUBA 2WFLA 4FWBA 5EGNA 3DD5A 4KR0A 4BCBA 4Y2RA 1E8NA 4DMFA 1XQVA 3EBLA 1EXWA 2XUJA 4KRXA 4RGYA 2VF2A 3T52A 1CIJA 4X71A 4H0CA 4PW0A 2C0QA 4FLMA 4H7DA 4OCZA 3WJ1A 3PF8A 1ZGCA 2HA4A 2XUKA 2ZVDA 3LIIA 5YASA 3WKBA 3QPAA 4X90A 1NX9A 1UFOA 5DYTA 1U8EA 5JZ9A 5I9IA 2J3DA 1MU0A 2J4FA 3W9UA 2Y2UA 1E3QA 2IX9A 2B9VA 1PFQA 5D3ZA 5LP1A 5JD6A 5LIPA 2WIFA 3R41A 1AZWA 3DNMA 1C4XA 3AIKA 1Y7HA 4MYDA 1M33A 1ZIYA 4INZA 4NVRA 1GQRA 2HRRA 1MT3A 3C5WP 2OAGA 5ALSA 4CCWA 3MUOA 5EHXA 4BP9A 3QMWA 3QMVA 4MEAA 3HACA 3H19A 4KE6A 5E2IA 1MX5A 1MTZA 3R40A 3I2HA 4JEIA 2VATA 5D6OA 5E4TA 4WFJA 5C8XA 3EIOA 2OXEA 4F0JA 5A71A 6YASA 4P9NA 1EB9A 1CUIA 4Y2QA 1BCSA 4UPDA 5CTAA 5FPQA 4J0HA 5DNWA 1UK7A 4J0JA 4KEAA 2WKWA 5AOBA 3IVMA 4YX9A 4HS9A 4X93A 1A8SA 3A2MA 4YPVA 1JJFA 2WIDA 1YB7A 2J3QA 1BCRA 1CPYA 2HA7A 2HA6A 4O08A 2OCIA 4KJXA 1CUSA 3ANTA 2AJCA 3FLAA 4QDXA 1PV1A 1UKBA 2GZRA 1CUFA 4BCCA 2EDAA 1D07A 4OSEA 2E3JA 4L72A 5ALUA 2OAEA 1QO9A 1ZD3A 5LZ4A 1P0MA 1IUPA 4PSCA 3WL8A 4N8DA 4U2CA 1XQWA 1WB5A 2D0DA 2HU8A 3WL5A 4EY7A 3S8YA 2XMQA 4I19A 3AZQA 3FYUA 5K3FA 5DTJA 3R0VA 1EX9A 1J07A 1FFDA 5ALFA 4ARAA 2QXUA 4AMZA 2RAUA 1O6FA 1N5RA 2VQ6A 4CIAA 2G4LA 1XZMA 3E1GA 1CV2A 2RHWA 3I1YA 4N5HX 2XMGA 1S8OA 2DSNA 3DLTA 1JMYA 2PSHA 3FNBA 2YASA 5F4ZA 5JADA 4L0CA 3LP5A 2XMBA 2ZYHA 3W9BA 4BRSA 5AK3A 3HZOA 5FPPA 4Q3OA 3O9VA 4J0IA 3O95A 1EB8A 3H18A 4P92A 4RNCA 4CG1A 1AKNA 1W52X 3E4DA 3G9UA 2JBWA 2HA3A 2XQFA 4OPMA 1GKLA 4N5IX 2V97A 2ONCA 4BB0A 3KXPA 5IVKA 4FLFA 2JGLA 1YB6A 3PFBA 4UHDA 3C6YA 3S2ZA 1AURA 5CW2A 4ZV7A 1Y37A 4JYMA 3SK0A 4OB8A 3CCCA 3WL7A 3CN9A 4E46A 3Q0TA 2XQKA 2BUBA 3VVMA 2EEPA 1E8MA 3NWOA 2ZYSA 1OILA 3WYDA 4EY5A 1ODTC 1KU0A 4G9GA 3ESBA 2Z5GA 3H2HA 3E3AA 1BU8A 2ZJ7A 3BIXA 2XLBA 4Y2PA 5DYYA 1JT2A 4ZV9A 3OC0A 4GECA 3UUEA 1L7AA 4B0OA 1HPLA 2XQJA 2Z3WA 4JYPA 4J0KA 1W75A 4LYDA 3FWHA 3UMJA 2WFLB 1XLUA 2QS9A 5CH5A 5ALMA 2Z8ZA 1EVEA 1LPBB 1ODSA 4PNZA 2XMCA 2GBIA 1JI3A 3C87A 4RPCA 5CRIA 4BAUA 1P0QA 3T4UA 1DX6A 5FOQA 4OYYA 5C7YA 2JEZA 2AJDA 2ZYIA 4OUKX 1EHYA 1R1DA 4RE5A 1QZ3A 4G4GA 4QDUA 2BKLA 4Q34A 5JATA 5KBYA 4ROTA 3V1LA 1IZ8A 1N8SA 4UHEA 4KAFA 3WZMA 2BFNA 3PUHA 2WTMA 3WK4A 3O4IA 1QTRA 4H35A 5JARA 2XE4A 5IH7A 3RM3A 3VJMA 5CT9A 4X6XA 1GGVA 2QOEA 5EIEA 4U2GA 3KWJA 4OB6A 1LZLA 4D9JA 2O7VA 4Q1VA 3FYUC 1XROA 3BWXA 4F60A 1CQWA 3H2IA 2BAGA 3STXA 5C8VA 2H1IA 4C4XA 3G0GA 2AXEA 5EHQA 3O9MA 1XQXA 4WFKA 1XRNA 5IVIA 2PUJA 1NU6A 3IUMA 3R3WA 3WMRA 4XWGA 3BJMA 1QO7A 3W06A 1CUYA 1YA4A 1BN7A 5AI6A 5T4FA 2PBLA 2VAXA 1BE0A 3AILA 1MNAA 5DNUA 2Q0XA 3EQ8A 3H1BA 2X8BA 3AIOA 2OCKA 1ACJA 4FDMA 2AJLI 4FHZA 3AUKA 4QA9A 2WJ6A 4NZZA 4G8BA 3OPMA 4DNFA 2JGKA 1ZJ4A 1JMKC 3ZWQA 4TVKA 5DWDA 4DSAA 3W05A 5ALHA 1H23A 4L9AA 2C0PA 5CH3A 1Q0ZA 4UBNA 5ALKA 1VZ2A 1CUVA 5FRDA 4U2BA 5AI8A 1XZLA 5AO9A 4IH4A 3SC2A 4UUQA 5LYYA 2XUIA 5JYCA 4X94A 2PSEA 5K3BA 2QVBA 2XUDA 3I6YA 1JU4A 1F0PA 5K3FB 3FYUB 3CCBA 3FSGD 3PE6A 4G8CA 5AKHA 1C7JA 2PU7A 5ALPA 5FP0A 5AOAA 1BEEA 1XZDA 1ZOIA 2ZJ6A 1P0IA 4GI1A 3KD2A 3BIWA 4N8SA 3C45A 1IZ7A 1R50A 2G5TA 4Y2TA 4DMCA 4W1RA 4AXBA 3G0CA 4TPKA 3WK8A 4UBIA 5HF8A 5LZ2A 3WWCA 2QJRA 1BROA 3VKFA 3BL8A 3M3DA 3A2LA 1CUDA 1GT6A 1XRPA 1TCAA 3IB3A 4DM7A 1E89A 4L3WA 1SCIA 1QIMA 2DQZA 1WOMA 3QPDA 3G9TA 4Y2UA 5T4EA 4E11A 2VJAA 1F0NA 3ESAA 5HKBA 5AKLA 2G63A 3FVTA 3KSRA 1SOMA 5FDFA 3FCXA 3F97A 1UK6A 1QONA 5IVHA 4Z49A 1VE6A 1DT3A 2H7XA 2YXPX 4J7AA 5LZ5A 3ANSA 5AKGA 2B4KA 3A2NA 5JAUA 4GDMA 2BGNA 4UBOA 5KWJA 3D2CA 3ZI7A 4DNOA 3IUJA 1X2EA 2WLSA 4C4YA 2YH2A 4DTCA 4K5QA 1UOOA 3UUFA 3JWEA 3MUNA 4H7FA 5CXXA 1B6GA 1QIIA 1R3DA 5HF5A 1BN6A 4DLNA 4M0EA 1XKLA 1CUUA 4HZGA 2CB9A 1IUOA 3MVEA 1U2EA 3WWDA 1JJIA 3V1KA 3AZPA 1ETHA 1ZD5A 2K2QB 2Y6VA 3NGMA 2I78A 3HI4A 4OYLA 4BATA 1EI9A 3I2IA 4EY4A 1UK8A 4C4ZA 5DLPA 5AK5A 4BVJA 3O4GA 2GYUA 4BE4A 4X3CA 2DFPA 4FMPA 2FJPA 3FLBA 4K6HA 4V2IA 1ZJ5A 1QFSA 1XZEA 4X91A 1DWQA 3QM1A 5DYWA 2WG0A 4LKOA 3WQHA 2C4HA 4EB0A 5AHXA 1LLFA 3AFIA 4Q3LA 4OB7A 1X70A 3B12A 4WJLA 4GWLA 3F8SA 1ACLA 1AX9A 1JU3A 2ACEA 2PKYX 5JZSA 2HA5A 3STUA 1VXOA 4Y2YA 5JANA 4S0XA 1P0PA 5SYMA 1TAHA 2XLCA 3TGLA 4WFIA 3O4JA 4HXGA 4A16A 3W04A 4UFNA 2IITA 2HHAA 1XRMA 2WSLA 4MXDA 3BXPA 4RE6A 4EY6A 5A2GA 3NOXA 1CUXA 2GBGA 2BGRA 1W76A 4H7KA 1GXSA 1XQYA 3G9XA 2JEYA 4IH1A 1LBTA 4G1FA 4Y7DA 4ARBA 4DGQA 1THGA 3HRHA 4P93A 3WKAA 4J3JA 1DTEA 3O0DA 1UXOA 3DL4A 2I3ZA 3F67A 3H2KA 4LYEA 2CEKA 4AB1A 1XRRA 2VJDA 4DNQA 5AKKA 4EUSA 5A62A 2PM8A 2GYVA 1WPXA 2UZ0A 4WDQA 3QZUA 1HDEA 3AIMA 3D0KA 3IUQA 5JALA 2VA9A 1CUEA 1ISPA 2OG1A 3G9ZA 2VTVA 1ZD2P 4BC1A 5HFAA 4UBLA 3L1IA 1AQLA 3KDAA 4FBMA 5T4BA 3AINA 3FAKA 5ALZA 4AO7A 3CXUA 3C8HA 2ZSIA 5FKJA 4Q82A 4B9EA 1SC9A 3V9AA 1MX1A 4PO3X 1ORWA 2GBCA 1MAHA 1JKMA 4GXNA 1Q0RA 4KE9A 4BAZA 1ODCA 2WIGA 1J06A 3ZLVA 4B84A 2ZYRA 1B41A 2XT0A 2WFZA 2FUKA 1DINA 1THTA 1A7UA 5D7BA 4LHEA 1GPKA 1QIHA 3IA2A 3WJ2A 1QIGA 4B0PA 4XJVA 5LZ8A 4G8DA 1QIJA 4KE8A 1TIBA 2VT6A 2HDWA 5AK4A 2QXTA 1G66A 1XRQA 1CLEA 4DMHA 3GELA 1TRHA 1H22A 2BJHA 4QDZA 2QRUA 1H2YA 4F21A 2X76A 4AX4A 1MJ5A 3IBTA 1QFMA 1W1IA 3L1JA 4OU5A 3FBWA 2VJBA 4A5SA 3HLKA 1VOTA 3H04A 4W1QA 1LZKA 1U65A 3RLIA 1K63A 2XB6A 4BYMA 3R3UA 1TCBA 3JW8A 3DYIA 4XX1A 5EHNA 2ORYA 4KAJA 2O2HA 2O7RA 4U2FA 3VVLA 5SYNA 5D3KA 4JH0A 3HYSA 4MJ3A 3WYNA 2CKMA 2WM2A 1CUWA 1NU8A 1IVYA 1XKTA 5HQ3B 3CN7A 5AI9A 3M82A 4AMYA 1YAJA 3OM8A 4PV7A 5AK6A 4BVLA 3ZV7A 3C6BA 4M0FA 1VKHA 1DX4A 1QE3A 1CUGA 3HJUA 5AKZA 5CBKA 2Y1KA 1QIDA 3I1IA 3STYA 5HZGA 2R11A 3V1NA 2RGUA 1DT5A 2JGEA 2JGFA 2OLEA 3C43A 3QBJA 4E14A 4HTAA 3WK7A 3DL7A 5A7HA 2V96A 1ZICA 2ES4A 4W63A 5ALVA 1QGED 1GZ7A 5AH0A 5ALTA 4QE3A 2JGIA 5BOVA 2WQZA 1FFBA 2JF0A 3DOHA 5A7FA 3KWFA 2ZJFA 4Q3KA 4B81A 2XI4A 4C01A 4HRYA 1E5TA 2OGTA 3I6ZA 2WG1A 5JD5A 1AUOA 2CUTA 2RONA 2VEOA 4KYVA 1MN6A 4B9AA 3GA7A 5FUMA 2HU7A 2JGMA 4BRZA 3LCRA 1YS2X 3ICVA 3WKEA 3IULA 4J03A 2QZPA 1DQYA 4W9RA 2XMDA 1XZHA 1EK1A 2W22A 1FJ2A 1W6RA 5CT6A 4BAGA 4BDTA 2DR0A 1QIKA 5AKJA 2HA0A 4KAAA 4Y2XA 1XRLA 4UFPA 2OQVA 3FVRA 5HK9A 2XMZA 5DJ5A 4ZREA 2OPHA 3G0BA 2WIKA 4CCYA 4X6YA 3STVA 1A8UA 3RARA 5AKXA 3PICA 2XUPA 5AM1A 2BUCA 4HXEB 4LXIA 5I8PA 3VXKA 4IHAA 1T4MA 1YAHA 4BP8A 4AQDA 4I4CA 2PSJA 5E4JA 4FKBA 4PF1A 1WHTA 4K2AA 1H2WA 1QJ4A 3BE8A 4CIBA 5KREA 1A88A 3PFCA 4QEKA 3ILSA 3MGAA 1WPRA 5K3DA 1QIFA 5JAPA 2RIPA 3C70A 4UHCA 3WZLA 2VSQA 4BC0A 5AM4A 2XMRA 2XUAA 4UBKA 1CVLA 2QTBA 3WI7A 2RHTA 5EFZA 4BZZA 5JASA 3W2TA 4FOLA 4X6UA 2LIPA 5T4HA 3DQZA 1WM1A 3EF3A 3KOOA 4U2EA 4MWSA 4X00A 3C6XA 5HCUA 1XZCA 4YASA 1SFRA 4C6HA 2BCEA 1CUHA 4NS4A 5ALDA 2IIVA 1EVQA 5ALJA 4AO8A 4UHBA 5C81A 1HBJA 3ED1A 1MPXA 3WWPA 1LPSA 5CT8A 3WA6A 2OGSA 4ZI5A 3WIOA 2QKYA 3FOBA 4IQ4A 1SCQA 1H2ZA 5AKEA 5A7GA 5EIAA 1HL7A 5H3HA 4UBJA 1XZAA 3WKDA 4I3FA 1EDBA 5EHZA 1ZI8A 1CFJA 2AJ8A 1KEZA 1YA8A 3FCYA 1ZI6A 5CT4A 1Q84A 2DCMA 2PPLA 3R3YA 2DHEA 1OCEA 5K3EA 3G0DA 1LPPA 1CEXA 5C8ZA 3GZJA 2WUDA 3K6KA 3ESDA 3A70A 3X3HA 1LBSA 1Y7IA 4UFOA 3VDXA 1XZGA 3WKCA 4EY8A 1RP1A 1KU6A 4Y2JA 3R3XA 1UT6A 4WCVA 3EQ9A 1FFCA 1T2NA 5EI5A 4H18A 1XZFA 1U4NA 1YS1X 5JAOA 5HQ3A 3WL6A 1WCYA 5CXUA 3DYVA 2Z3ZA 3VISA 4E15A 4NMWA 1LNSA 3IURA 3ZLTA 5HFNA 2HFKA 4DIUA 2WUEA 5ALWA 1CUBA 4BVKA 2ROQA 2XMSA 5IVDA 2CMFA 4B80A 4UBMA 2O2GA 2C5GA 2D5LA 3B3QA 3DOIA 2OCGA 4AZ3A 3BDVA 4H7HA 5AOCA 1HQDA 5KWIA 1YCDA 1UWCA 2WJ3A 5EIHA 3TEJA 1VXRA 4EA6A 3H1AA 2J4CA 1EA5A 3P2MA 4GLBA 3GROA 1K5PA 4QDOA 2WHRA 4H7JA 3D59A 3G8YA 4XVCA 4B7ZA 1TK3A 2HADA 1MX9A 2C5FA 5CMLA 1VZ3A 2QR5A 3BF8A 5K3AA 4Y2VA 3WLAA 2CZQA 3AZOA 4P08A 2WTNA 1VE7A 4ZXFA 5ALOA 4QWMA 1MAAA 4HVTA 2XQGA 5AP9A 2C7BA 2P8SA 4KRYA 2NW6A 1X2BA 3LLCA 1YSCA 4J0CA 3G02A 3STWA 1W4LA 3Q8WA 2O2IA 1XZBA 1GPLA 4GEGA 4A23A 1XZIA 3FYTA 3I2FA 1CQZA 2X5XA 1N5MA 1ZIXA 1ZI9A 4QLOA 5I7UA 1WHSA 2G5PA 2HA2A 2R8BA 4CCYB 1Z68A 2C58A 4QDTA 4TGLA 2XQIA 2DHDA 4X7BA 2W6CX 1SCKA 4G4JA 2QM0A 4BDSA 2DHCA 4H7EA 1BRTA 1VJ5A 4BTVA 4CG3A 3QPCA 1TCCA 3WK5A 3QVMA 4N8EA 1DWPA 2OQIA 3IIIA
chains in the Genus database with same CATH superfamily
3BREA 2C1XA 1QLJA 2I6SA 2OBXA 3GP8A 5TPWB 2DT8A 2BHLA 2VJCA 3D2AA 3GUUA 3LPCA 3ONNA 2I4LA 2QT9A 1EVIA 3P0EA 4K9OA 4KQIA 4MQLA 1J42A 4YAIA 3MUEA 1OYVA 4YXWA 1MRZA 2NZYA 1UZUA 3LYAA 4TQUS 3OFND 1XVIA 2C5BA 3KE9A 2Q0HA 4MA0A 4ABTA 1KOGA 3AY0A 4QVIA 3EGXB 2QIPA 1Y5MA 2GDZA 1QPBA 1J2EA 3BKWA 3GLVA 4HF7A 1KKUA 2GJKA 3HC7A 3ZJ5A 4DSTA 4JXZA 1I6KA 1WCXA 1FSSA 1O96A 3RSZA 3GLTA 3ACDA 3GRRA 1ZSNA 1E59A 1NE7A 2B21A 3O8OB 3FHCB 3FLEA 4JLJA 5IKPA 5IXSA 1J8QA 2AX4A 2W93A 1WTAA 5F2NA 5LDGA 1M2OB 1XIVA 2HLDA 4KXFB 1UFQA 2GTHA 3PWSA 1LRKA 1CR4A 2AJTA 4OI2A 2XT9A 2BSQA 5EAIA 4Q4JB 4J0GA 3SBDA 4OBXA 2PRZA 2C04A 4C2AA 4DCSA 2ORWA 1HURA 2VYFA 3F9CA 2D2FA 4O4JF 5IKMA 4R1TA 5IX8A 4KPYA 1T9CA 1YIAA 4GMDA 4DR1B 2OC9A 1XA3A 5CIWA 1US8A 1B6SA 3IP1A 5DX8A 1D2AA 1YFJA 4URZR 2EX4A 4HMQA 4MINA 4M1MA 5IEJA 1U9JA 1GPBA 3C8MA 1HZZA 2XE7A 3P4UA 4I1YA 3FUVA 4YP6A 5T3YA 3Q8KA 1Q1EA 4LJYA 4IQ0A 2OMKA 4NHEA 4Q16A 3VC2A 3C7KA 2RHRA 2PNFA 2V0NA 3IYLW 2VHVA 3LXXA 3AT1A 1KYWA 2GS9A 3DO8A 3QG1A 1B8OA 5CVUA 1Z08A 1JR4A 4IKPA 1F7VA 1IMJA 1AZLA 4DA0A 2DGDA 4C7VA 1Z35A 3L07A 2NXCA 1E1QD 2BRUA 3O47A 5AJVB 2CUKA 4OLAA 1E2GA 1U0EA 2Z57A 3NH6A 4JOBA 2V8OA 3A1WA 3PF9A 3E3MA 4OGKA 1SK8A 3HQ4O 4MYUA 1JN0A 2PLFA 4RMNA 1AB5A 3HCWA 3SDSA 3VVBA 1PV2A 2PO7A 3NG1A 5B57C 13PKA 4HAYA 1SZDA 2GF9A 3BMOB 3C14C 1IZ0A 4R2JA 1GOTA 2GZHA 1T9DA 3L93A 4FI3F 1U3VA 3RT1A 2IEZA 4MAMA 3TQSA 1SWVA 4C6RA 1SIWA 1JHQA 3H2JA 3R5JA 3RKSA 1NMZA 4U7HA 4YPOA 3R3VA 1U2GA 1U1DA 2R66A 2ZRPA 1OWOA 2QORA 1NPYA 3LC7O 3OO0A 5SZJA 3ZG6A 1ZDMA 1UC4B 2F1HA 4CXMA 4MP8A 2AJBA 2D5BA 4MZDA 4BQPA 4MUJA 1K4KA 5C53B 2B61A 1ADYA 1T2VA 1X1QA 3IPRA 3O4FA 5ALQA 1EFPA 1QG4A 3E1KA 1CUJA 3H4MA 3M1AA 5GZ6A 3ROMA 4CI9A 1V5GA 2QW8A 1A27A 2HK9A 4C03A 3CBQA 5K99A 3QVKA 3MF4A 2OL4A 3E9ZA 3GRKA 1XEXB 2J08A 4FXPA 4TV8B 1ESEA 2O8EA 2PY6A 1J2UA 5TT1A 1NC1A 1JXMA 4EHBA 4JB2A 1HF3A 3AG6A 2R00C 1UKYA 4C0LA 4G5SA 5MDHA 4RTPA 3A1NA 4FCWA 4ZOLB 1SXJC 3L7DA 5IDWA 3EUAA 3BCHA 3WB0A 1EH5A 3L1VA 4EPRA 4X41A 5E1OA 4LTMA 5CEJA 1RWVA 1BQ4A 2QZZA 5ELLA 4NX2A 1JG4A 4HNUA 4IFIA 3LNCA 2V6GA 3NANA 2PSFA 4EARA 2G07A 3Q3JB 3SE0A 4YHBA 3O9ZA 2D54A 1G60A 2IE8A 4F2PA 5JH7B 1RT9A 2P0AA 3BQMB 3WK9A 2AZ4A 2XVMA 4FS8A 3NDRA 4KMRA 2J3KA 1GR0A 3JTEA 2I1VB 4H16A 3VZPA 1Q0SA 4JC5A 3AHGA 1ISHA 4I6GA 4X1KA 2NG1A 4HDMA 2W6JD 2C5SA 2GASA 3GFPA 1CY1A 3QFFA 5TT0A 1XHEA 1YKFA 3I2KA 1EX1A 1P39A 4FFNA 3KJGA 1QQTA 1YQWA 2H16A 2PBFA 3C8DA 1FYEA 1QNFA 4RVDA 1Q1QA 3U7QB 2AQIA 3EGVA 3KAJA 4Q6WA 2VSOA 3BMQA 1K5DA 3GN2A 4MUYA 3BYZA 3DVAB 4GM1A 3TNYA 1ENYA 1M67A 1N7HA 4JBHA 3ONEA 4XZ3A 3NFYA 3HJNA 4PZCA 3GEHA 3OKFA 5EUBA 4GSKA 3IR7A 2OBBA 2QLJA 1IJKA 2ZEJA 3CLSD 3LPMA 2GK7A 1P5RA 2HFJA 1CU1A 1NF3A 4R68A 2VTBA 5DP1A 5J3JA 4UATA 1V9CA 4I1VA 1QOZA 2PWAA 2QJWA 3D5EA 4LNAA 3RTEA 1TADA 3UQZA 1MF7A 2YIDA 2JLUA 3TFOA 2X19A 2YWXA 4Z3DA 3AB7A 4CMHA 2FMIA 1AC5A 2VP5A 3ETLA 2CXOA 4RKFA 4G97A 5FWDA 4TRMA 3L6CA 2FMXA 4KO1S 4YAWA 2ZSUA 1JA1A 2WHPB 1JSLA 4FD2A 4KH0A 1F8UA 4QLAA 1N2EA 3ZU6A 1J0BA 3FR7A 3QP9A 4MQFA 3WGTA 1QQAA 1JU9A 3SVTA 4G0UA 2SKDA 4P3OA 3OETA 1W2WB 4Q9IA 5LZ7A 1E2QA 2XA9A 1LQ2A 1A9YA 1MLDA 2IHZA 4Z2YA 1IPFA 1GKKA 3AKEA 3CWCA 4UVHA 4HVCA 3K5HA 1XWWA 2E4WA 3BWCA 1C9EA 3CWQA 3JVVA 4GRIA 5HKKA 5LQMA 2FSPA 4JLOA 2PT5A 3INTA 1ORTA 2Z9CA 2SICE 4L8VA 4MR8B 4ZVMA 2B30A 3RBVA 1YUMA 4Q7JB 4ARSA 4EJSA 3B5JA 1GDDA 3A58B 2P6OA 4YJGA 5ALRA 4MNTA 1DLIA 1PIWA 2XBUA 5CK4A 3BXGA 4NE7A 1KNXA 3ZE6A 1E7SA 3IDOA 5K5EA 1Y8CA 3QUSA 1MNQA 4YMUA 3GT4A 4GBMA 3GK3A 3GP5A 3K20A 5F51A 4ZZ3A 4Z7JA 4KLZA 1H1LA 3WDLA 1SUAA 3DO6A 4CQMB 4I08A 2JLXA 4BMZA 2PS9A 1V3TA 4TWIA 1B0ZA 4KIUA 4ENPA 1GPMA 2XAAA 3N5CA 4YV7A 2ZE8A 2QLBA 2EZTA 2BMAA 3HO8A 4PEVA 2FPMA 4KIJA 4UVEA 5B2FA 2B92A 3O75A 2O2ZA 4ETNA 1KHHA 1P0FA 1ZGBA 4Y8VA 3KQOA 1ECGA 1M1UA 1DRKA 4TKUB 2NAPA 1YTLA 2AG0A 2XGSA 4HQLA 4DKJA 1NBIA 1M0WA 2XYVA 2XCRB 1I4LD 4M60A 4ENTA 3H5OA 1HLGA 1SXJB 4GZ5A 3PQDA 1TM7E 5CURA 4O4LB 1JKJA 1TVKB 3VNAA 1DAOA 1WU7A 5B4TA 1PL8A 4ARCA 1EUZA 1IUNA 4R9NA 2R97A 2XEXA 5AVOA 4BS9A 3OU2A 2ZI5A 4JX8A 4F8EA 1GZDA 1HZZC 1X1BA 2VJOA 2WJIA 3EDCA 3HEAA 4JYBA 4TZKA 1GGJA 2CNWD 4IZ6A 4UHFA 3VKVA 2ZBFA 4LDJA 3FKSA 3MHTA 2BFFB 2NU6A 2FSIA 5JMTA 2JLYA 4KUGA 1IY0A 4RSGA 1AQJA 3U1BA 3LPNA 5AVVA 2J33A 1VRCA 3HB7A 1P7ZA 5D8DA 3RJ9A 4E08A 2BRUC 1KAGA 2QRKA 1O97C 2JGJA 4ESEA 3QX9A 4RHUA 1KDOA 3UG7A 4ZI7F 5IWCA 2PUHA 3SX4A 2AQHA 3EFEA 2PGOA 1RZRD 1L5KA 3U7JA 2O1SA 2OM6A 3DKKA 1NVXQ 3S6JA 3DL0A 4GOOD 3BAFA 1YNSA 3JQRA 3IDAA 4MIOA 2HRBA 3V55A 2H2WA 4CM9A 5EE5B 1GCIA 2OOSA 3WL3A 2Y0BA 4QYXA 2NSYA 2DPLA 3FVWA 1NLMA 3D3NA 1PDOA 1HDZA 3FG9A 4E4TA 3U48A 2VPQA 5KI6A 2IHTA 3DOUA 1M1YB 1MJGA 4IHJF 1R5OA 4M54A 2BFPA 5AJZA 2OV3A 4WCFA 5AJWA 5DW3A 1UK9A 1GZUA 2H00A 2DUNA 5GV7A 2XWPA 2ZDQA 5F77A 3ER9A 4CEJB 5AMXA 1RI2A 2QY9A 3CLUD 5DIFA 3RR2A 5IJ9A 4HX2A 3NGLA 3Q1LA 4X20A 1EE9A 3DV2A 4X8LA 4IXNA 3WRVA 2H5EA 4C0QC 3T5BA 4KZKA 4CL8A 2Z2KA 3CGGA 4Q12A 4B71A 5IZCA 2EP7A 2DULA 1X8LA 4MR9B 3VJLA 1BMQA 1KIAA 1NRJB 2R6HA 3KR0A 4UNNA 2KBFA 2YV2A 2ZRNA 3JAMA 5EEHA 5DM0A 1WXIA 1PR5A 2J09A 4WECA 5G4KA 5C4GB 4DBZA 3OCUA 1XLVA 2F43A 3OOSA 1WF6A 3K16A 4AZWA 4XDGA 4OJQA 3DBLB 4MAFA 3L8DA 5E6SB 4AF7A 4HYTA 3E8SA 1GU1A 3K72B 1ZIDA 3L0IB 4PE5B 4L78A 4B4DA 3Q1KA 2JFVA 4ZHQF 4W8OA 1A7JA 2LTAA 4K6KA 3SIWA 1TJYA 3Q2KA 1GL9B 2X23A 4HGPA 4PGFA 1MO2A 1TQHA 5KNCH 2CJYA 3CM0A 3EMBA 3QKWA 4OHMA 4E30A 2H08A 4U9HS 4ZGBA 3AVXA 5FV4A 2ADOA 4HZUA 4D9FA 1IIRA 2DQSA 3ICWA 3L01A 4KK3A 5DDIP 3COVA 4GT1A 5B3JA 4BX2A 4EVIA 5BV7A 2CSXA 1JEYA 1FXWA 3ZJTA 5LBTA 1VG8A 1RCUA 1DBPA 1X8XA 4PXAA 2D62A 3JPYA 2V6FA 4R98A 4ZQFA 5CFLA 2XUFA 1PZNA 2CLDX 4PO9A 1C7IA 1ZOPA 4UXHA 4PGMA 4LXHA 4Y6GB 5FTKA 1YJCA 2PN1A 3KX2A 1CERA 3OEEA 4WE3A 2YUTA 2WM3A 1SCBA 3L5OA 1NX6A 4YRJA 2H1HA 1L8QA 4CUJA 1RQ7A 1Q1ZA 3FN4A 4WMLA 2Z6UA 5JZMA 3BQ9A 3HCAA 2HBYA 4R5MA 4XGRA 1V35A 3N2KA 1VKRA 3AFGA 4HKTA 3WQRA 3P9NA 4DAEA 3CF4G 2R5WA 1SPXA 2XUQA 3I6QA 4A8TA 8ADHA 2FYTA 1ZRNA 3A9TA 3CG0A 2DUMA 4S1NA 4I4NA 1N78A 3SLKA 3OFNA 3DDSA 4JB8A 4L8FA 4QGBA 3RVBA 1FP1D 1XMPA 2GESA 1SR8A 2YIVX 5FNVA 4MWOA 5TQ2A 3WSTA 2LRHA 3U2QA 3UATA 1EWTA 1T1EA 1ZWKA 1FYWA 1JVSA 3M7IA 2IW1A 2FWPA 3FPEA 4B7UA 4FGZA 1RYDA 2BMDA 3KOWA 1Z0IA 5DWVA 4DREA 1LF0A 3GVXA 5CGZA 3W2IA 4HV4A 2HIAA 4MIKA 5JRDS 3RD5A 4JCCA 3QU9A 1E4VA 3U3MA 3QOFA 4D4GA 1WZNA 1BMFA 1B0UA 2PH3A 2W2MA 1QWSA 1SMKA 3PPWA 3OQIA 5FL7A 1EDOA 1UZAA 1SURA 3EXHC 4HRXA 1CY7A 3PCXA 4IF6A 1FMJA 3LRTA 4EJSC 1EWQA 4US1R 5AM5A 1BTOA 1MKYA 2NO4A 4WH0A 3SXJA 4WY5A 5ITWA 1J20A 1M9NA 3FNFA 2BISA 3LUAA 4AUEA 1QTIA 3P9RA 3K5PA 2JCVA 2P9GA 1CUAA 4YUZA 1JPJA 2G77B 4D45A 2BPOA 3HXKA 2YFQA 4QYIA 4W6QA 4EEXA 1IB0A 2PKCA 4TVSA 2BMVA 1FFXA 2CVQA 5I9NA 4BXOB 4NEQA 1W46A 1G5TA 4QPNA 2EKQA 2ZRCA 5A6SA 1EFPB 3A26A 2CNOA 3MXTA 3HYTA 5AQEA 1OASA 4HNGA 1QH8A 4Z0NA 1D9XA 1X9HA 1JQAA 3Q7RA 5IM5A 1I94B 3KM0A 4A2CA 5I7OA 3G88A 3EEBA 3I3OA 4C7KA 1QFXA 3HG7A 3MWYW 2B36A 2O8EB 4BZPA 4UEQA 2YVKA 3LCUA 3T3PB 3LGXA 2QUKA 3NXKA 2NU8A 1M5UA 2AYYA 2EF1A 2G82A 5KTPA 2ZT6A 4PQFA 4EG4A 2VF8A 3DFKA 4LMRA 2YHUA 4DCJA 3OPXA 3TS1A 3IPYA 3GFSA 3ONWA 3EK2A 5JSYA 4CDGA 1K9VF 2A78A 4LJAA 2PQ0A 4XQEA 3MCTA 3ECSA 3COSA 1RIIA 5BW6B 4PR0A 4DJDC 5BSGA 1HE1C 4CL0A 4DYVA 2EQBA 2OCLA 1W8IA 4Y1RA 2PKQO 1JLKA 1QZTA 3L0OA 1J9EA 1Y8AA 2GVNA 2SBTA 3AQIA 4URFA 3RVSA 2D7DA 1E1DA 1G98A 5C31A 1YE8A 2XUHA 3V6MA 2IDJA 2BGWA 3HV2A 2JCGA 4LBZA 4MW7A 3A4VA 3DOCA 4LJ5A 2GD1O 2QIOA 4B44A 4HDMB 1XVLA 1FJXA 3QITA 4YCMA 3H5AA 5K2MA 1G7RA 4GR4A 3VU9B 1XTQA 1YGPA 4FN5A 4IUDS 4OQQA 1B7GO 3VA7A 2ADFA 4YS6A 4ZICA 4RK6A 2QMQA 2RGDA 2C2MA 3R9IA 4Z5XA 2EBWA 3KJQA 3MMZA 2G8NA 3V3TA 2GZAA 4FNMA 5ESRA 5H82A 5LP6A 3DOEA 3KKQA 4FZVA 4G2NA 2ID9A 4JIMA 1UXKA 1K7YA 2GD6A 2O9JA 2XDWA 3B3FA 5AIBA 3JV7A 4EITA 2QZSA 5I3ZA 1QOPB 4AZTA 1YQTA 3IP7A 1T3ZA 3F6SA 4HAIA 4TXNA 1KC3A 4CJXA 4TSFA 4YMSA 1TM2A 4WCFC 2R25B 1E0KA 1GA6A 2VYCA 4KR0A 4D98A 3CLVA 2Q27A 4AUNA 3FDJA 1QNLA 1ZH2A 4Y2RA 3TIIA 1IK6A 4ACAA 1SU6A 2JI9A 3ROFA 1S02A 3ORSA 1OE0A 3P2YA 3EBLA 2FGKA 4OQZA 1T8PA 2G06A 1Y3BE 1T5IA 3KU1A 4FYVA 2I76A 4PLTA 3VU0A 1ND5A 3VZCA 4RGYA 2OA0A 3ZGVA 5IZCC 2IPAB 3T52A 3AEUA 4EJ6A 4LHYA 1N25A 1QH1B 4MQFB 4MSUA 4PW0A 4AU1A 1FS5A 2R6DA 4MA5A 3VC3A 3VO1A 2C0QA 4XFDA 4EPVA 3AL2A 2R48A 3QXXA 3PR1A 4H7DA 3WJ1A 2HF2A 3QKUA 1J23A 3PF8A 3HCNA 1ZGCA 3KTAB 1Y5LA 4ZEVA 3UMFA 3EXHB 2QTFA 4BFWA 3ZK8A 3F2IA 3LY5A 1AS3A 1E1RD 4EJSB 4PYRA 1J7JA 3EAQA 2VXYA 2FEWB 4YJGB 5I9SA 4LDAA 2FPRA 2ZW9A 5EKXA 3TKAA 4IEEA 2FXVA 5DYTA 1U8EA 2WF9A 5JZ9A 1NN5A 3D1LA 3KBBA 4H0NA 3V1TC 3Q6MA 4DUPA 4YYZA 5B3JC 4X8MA 2DBZA 1PL0A 1QYWA 3NHMA 4K1LA 1JG1A 4ZYVA 2PLWA 3EAGA 1RQNA 3B36A 5ADWA 1H1LB 2B9VA 2PWPA 1PFQA 3R5KA 3DM9B 2OVBA 4OQNA 3CT6A 5IAKA 4LOAA 4HB3A 2FPXA 1V1RA 5JD6A 5LIPA 1MDFA 2BDUA 3R41A 1AZWA 1PUJA 1UBSB 3DNMA 1E4YA 4DG9A 1C4XA 4MS3B 4LZOA 3U7FB 4Q6BA 1Y7HA 3G17A 4MYDA 2ZJ8A 3P9ZA 4XLTA 2OR3A 1OIWA 3HUEA 3GNQA 1GQRA 1V5EA 2HRRA 4UKDA 1A8HA 2GTPA 3CUUA 1S8NA 2WVHA 4TUYA 1GRVA 2RHGB 1RE1A 3T4PA 3B9BA 3L0CA 2OAGA 2BMFA 1G8KA 3MIZA 2DC1A 4NE9A 4TV8F 2CVFA 4DUGD 4EO4A 3HBNA 4QXPA 5ESDA 1BZYA 3IESA 3TIFA 3ZWAA 2JJ2D 2Z2YA 3QMVA 1FFWA 3HACA 4NI5A 4PWYA 3W2HA 1RRFA 3HWWA 3TRKA 1JKJB 5COBA 1QH0A 1MB0A 4F4CA 2GJ9A 2AG5A 2Q45A 1VRWA 3AETB 3KDSE 1EEXB 1WPQA 3LO5A 1SEPA 3LZ6A 4RMGA 1L9XA 3D43A 1S1CA 4MS4A 4DKXA 5K03A 4RLSA 3CGWA 2YJ6A 3U60B 1HE5A 2NU6B 1TC1A 1MD9A 4LG1A 1Q20A 1K66A 2C7GA 4KXLA 5BV2P 5JH7F 5LQNA 1ORIA 5I7AA 3PWTA 5AD1A 3A6DA 4ZT2A 3UY4A 1E2FA 1BGWA 3ELUA 3UXEA 1VDMA 5M2QA 1OI7A 1KJYA 5D5QA 3QY0A 3H9UA 4FIDA 2I4MA 1T8YA 5FPQA 3IIJA 1LDEA 1L5LA 3T1QA 2W00A 2Z09A 2WDPA 4RJ2A 2ZIZA 1P4SA 4YIKA 1FSZA 5JFTA 3MQ4A 2E2WA 1CY8A 1UK7A 2I1WA 2IUTA 5JISA 4B6QA 3CJQA 5EESA 3T54A 2BELA 2HCRA 2PS3A 2UVQA 3GT0A 3LKVA 1A71A 2QZJA 4J0JA 2YVQA 2HOQA 4LYAA 1YBHA 3FRJA 3CZQA 3IAM6 2D59A 2R1VA 1F2UA 1Q7EA 3IVMA 4XQ9A 4X54A 1NQ5A 2CHGA 4PX3A 3KKOA 2WIAA 3IAUA 3RRYA 4WCFB 4ZTZB 4X93A 1Z17A 5DM70 3KZVA 5J2TF 3A2MA 1YR7A 2IIPA 4EYOA 2PWYA 5IJ9B 4I6EA 1R18A 1RZRA 3A32A 3UPDA 4X20B 2NVOA 8GPBA 3X44A 3PENA 5ED4A 2QGNA 3M70A 4H3VA 2W8ZA 4O08A 5CA0F 2GZ1A 1Z2CA 1UL1X 2DKNA 1YRYE 3HKEB 1PD0A 3MERA 4MVJH 1R0SA 1C81A 2B1JA 3PUWA 1QPZA 2P4SA 5G4KB 4QDXA 3H1EA 1XMSA 3FDFA 5A03A 1NJ1A 4B79A 4V0ME 4JI1B 1XFAA 3OZBA 2Q4EA 4ZEMA 1VIDA 3JVEA 1D07A 1YR8A 4FOOA 3IXMA 2R4QA 1ZKDA 5L7YA 1B43A 2C8JA 4L72A 1RWNA 3S70A 1OAAA 2YZ2A 3ORHA 2GF2A 1SBCA 4XSGA 1TO6A 3GDGA 4MJ7A 5F9MA 3DCYA 5KHOC 4BVGA 4D9HA 1O9HA 4PRZA 1ZM7A 2RJOA 3PHJA 3T3HA 1JEYB 3SHFA 4AG3A 3BHNA 2YINC 1I2DA 2CMHA 1V41E 4BNZA 1P0MA 2VRBA 5L3ZA 1A5BB 1RXUA 2COEA 3KZNA 3TNLA 3TW4A 2CLIB 3OFJA 3DUFA 3R6TA 4URWR 4PPQA 4A73A 2VJNA 2WQ7A 3LFTA 4QNRA 2XTZA 1I8TA 4PYLA 4XWTA 5JXGA 4BB6A 4BASA 4U2CA 4KQMA 4YAJA 4F97A 3OX4A 1XYGA 3SJUA 3UK1A 3NKLA 4TQ9A 1QBGA 1QK5A 3OCYA 5LP6C 3AM5A 2V1UA 4FFRA 3LE8A 2OD7A 2LCQA 3N2KB 5KYVA 2VJKA 4DV6B 2A3NA 4GI3A 3PNVA 3S8YA 4UNIA 1W7AA 3LG2A 2FWIA 1OVMA 3KR2A 3MPUA 1FFDA 2QXUA 3KWLA 5TR9A 2VFAA 4B8WA 4YGXB 5FHQA 3UXHA 1XX6A 2R9VA 3FDXA 3LDFA 1QHSA 2G4LA 5BT8A 3J81A 4G36A 2JCSA 4I1UA 1UDRA 1O8BA 3S7TA 1XP5A 4HEA6 2DXIA 2RHWA 5TX7A 2I3BA 5B1HA 3IOMA 1XHLA 4HGYA 3LL4A 2PMCA 2W6ZA 2DU8A 4GQIA 4PQRA 3SOPA 4D9NA 3HVUA 1Z5ZA 4O2RA 4DG8A 1IFXA 2A57A 3ZVNA 2WYOA 1JB1A 3IAAA 3FNBA 5CHYA 4EBFA 3DE0X 3CLSC 3UKDA 3M6WA 1NJGA 1G8JA 3K73O 4UXJA 2XCOA 3TIXB 4QXAA 5KEIA 1OMOA 1SXHA 3LP5A 2XMBA 3SS8A 1XWIA 3O3NB 4B6PA 1E1KA 1V0JA 2GR9A 2V7PA 1YBMA 3CBGA 4BRSA 4KBGA 4BN0A 2DSTA 2AZTA 2O1EA 1SBQA 1UBLS 5IM4A 4AM8A 5EXSA 3T7TA 4EMUA 3P96A 1LY1A 2ZIUB 4YJ3B 5FPPA 1SOUA 5AVJA 2YXEA 4MULA 3EHDA 4EZBA 1OB2A 2EW2A 3A9SA 2V74B 4NDZA 3VYTB 4EHNA 3O95A 2XVAA 1BWQA 2C9YA 2PT6A 3LK6A 4IDBA 5FPTA 2CJFA 1BXKA 5EMHA 3H18A 3CZ9A 3COJA 4PHCA 3Q7TA 1RXEA 3S27A 5A6SB 1W52X 3RVOA 4DDHA 1IN8A 2OZKA 4LNUA 3AERB 5KTOA 1QH8B 1Z18A 4OPMA 1CHDA 3R0JA 5D00A 4EGJA 2J9YB 2O4CA 1Q91A 2VI5A 3EW7A 4HWRA 3A6HA 3GLQA 2ZWIA 4YFYA 4C4OA 3OZVA 4ISCA 1OI4A 4NZNA 5IAGA 2NPIA 1E0DA 2ID7A 4UHDA 5CJJA 2NU8B 5C32A 1B8VA 1FBNA 3MJFA 3OTOB 3ROQA 1NGSA 1AURA 1PWXA 2X6QA 3R77A 2IP4A 5CW2A 1SPBS 2NXWA 5JJBA 4M8NE 1NV8A 1URPA 3GRAA 5TEVA 4DM4A 2AC7A 3EUWA 3OJLA 4E7OA 1SBHA 3C5EA 2P9TA 2GM5A 4OB8A 1DEAA 2PL3A 2YYZA 4E46A 1WULS 3Q0TA 2XQKA 2BUBA 3O3OB 5FBVB 1SOAA 3NWOA 5FUBA 2ZYSA 4Y1RB 1TM4E 5BN3A 5EN4A 1KE2A 4GMGA 3GUVA 1VLMA 2W48A 4U8GA 1KDZA 1YZQA 1XDUA 1ZPDA 4XJTA 1NIJA 1P5HA 1QYDA 2M2IA 2PD6A 2XCQA 2YJ4A 2YICA 2PMFA 3CE9A 4GP9A 4N49A 2DY0A 3U4AA 4KXVA 2HK8A 3E3NA 4CM4A 1FP7A 1KU0A 1ML3A 1O03A 4M9SA 1WLSA 1Z4OA 2VDMB 2Z5GA 1JHYA 3Q5DA 1Q22A 4F11A 3K35A 2QXYA 4NTZA 2DECA 3BJEA 3BD7A 5THQA 2XLBA 3WLRA 4C2UA 4MIEA 5IU6A 4NBVA 5TJHA 3OZXA 1F6DA 5LP6B 4XQCA 3T0FA 5C8DA 1DCFA 2Y99A 4GECA 1S1MA 4XWYA 3QX3A 2JARA 5LJIA 4N82A 3WGOA 1FYXA 1DQSA 1EGQA 3IVCA 2PIDA 2QD3A 5KQRA 5T6MA 2G9NA 1GUZA 1Q7CA 2AXQA 3ZBQA 3OCVA 2V0GA 4JWKA 3UMJA 4OTZA 4CIYA 4D0LB 4NC9A 1XLUA 2QS9A 1TD9A 2TMYA 5ALMA 1E96A 1R37A 2Z8ZA 3Q6IA 2O2CA 2CV1A 1EK0A 4I4LA 4R16A 1FNDA 1FVOA 1ZKMA 2HT6A 2PX2A 3PXCX 4RPCA 4PZYA 2VL7A 3EEFA 1AQNA 3QQ5A 1GNQA 1C7FA 1LKZA 2Z58A 1XJQA 2JZCA 4ZD6A 3NHRA 4DWJA 1GTMA 4ALKA 4BUZA 3UB2A 3AONB 4ZAXA 2QD1A 3V8MA 2CCJA 4IQFA 4KV9A 5C7YA 4B3RB 2VNAA 2PT9A 2YV4A 1RM0A 3PNPA 1T1RA 4RZSA 3TTSA 3NC4A 5LQCA 4Q21A 4RH0A 4JL8A 1JWBB 2AOTA 1Y3CE 1DEXA 4G4GA 5KNLA 3KUXA 3FDIA 4FHEA 4HGQA 4W8GA 5DT2A 3TE7A 1H8HD 3KZ1E 3VNBA 4A6EA 1MAWA 4BUJA 3V1LA 3KJEA 2CB0A 3CLUC 3HGQA 4Y18A 4DT1A 2HWWA 4YUYA 3C6MA 1N8SA 1ZONA 2W90A 1YOVA 2OO7A 4PSKA 2X6TA 3GRPA 4PTZA 1DBQA 3UJ7A 4DDMA 1YQGA 4IJVA 4L2IA 5JMWA 3FZYA 4CPDA 4S1WA 2HLHA 3CY6A 3WK4A 1IDOA 2PGLA 1R0WA 1V1RB 3EAFA 3O4IA 4JT2A 1QTRA 4RXTA 7AT1A 1DC5A 2C8KA 4A3SA 3ND8A 3RREA 1LWOA 1TXGA 2OZVA 3N74A 3VV2A 4XPIA 1IBCA 3IVGA 3N07A 5AJYA 5L53A 5LQDA 3V7FA 2YFHA 4UDXX 1I32A 1Q15A 1E1RA 4TUYB 2V03A 1NW4A 2XPCA 4OB6A 4QUKA 4R51A 5C3MA 1NXWA 4WESA 3FAZA 1Z06A 1LC3A 1GLGA 2WEKA 4U00A 4KR3A 4TWJA 3BWXA 4GKVA 1T5LA 1YGYA 1CQWA 1Q11A 1RHQA 1T2UA 2VF4X 3H2IA 3G2LA 3ITKA 4FS3A 5IN5A 4D4MA 2A30A 1L7MA 4H1HA 2BAGA 2ZUWA 3F6CA 4YAFA 5KVVA 1N3YA 1R0CA 1DIHA 1KPHA 2EFYA 2NZ8A 521PA 3RSHA 5LXTB 2NP6A 2GK3A 3GJ0A 4EHIA 3F6PA 1Y4AE 1KEVA 5I7VA 4C4XA 3GMIA 2O14A 3G0GA 2QEQA 3M3PA 1G17A 2AXEA 3JZFA 5CIYA 2C2HA 3NHFA 1RI1A 4MW0A 3O9MA 1XQXA 1XCOA 3H2ZA 5ENZA 2OV1A 4WFKA 1EG2A 1Z8FA 5JO9A 5BPFA 5BOSA 1EGMB 4JLAA 4RF3A 3H8VA 1CJTC 1S8AA 1T0JB 5A2QA 3DZ8A 3QY9A 4PBSA 3W8NA 5BSUA 1QO7A 4N5NA 2ANBA 2XGJA 3IBCA 3JQCA 4MI1A 4LTDA 1ABFA 4PFQA 1YA4A 2FF7A 4F3RA 1BN7A 1P0CA 2YL2A 3I05A 5T4FA 2IPNA 2PBLA 2BHTA 1QGDA 2GLXA 2VAXA 4CM6A 4OI0A 5DULA 1UPFA 2E49A 2OCBA 2O8CA 2R1VB 4JQSA 2Z5FA 3G59A 3E7PA 5FR1A 4ZCMA 5AVYA 5JMOA 5DNUA 3U4QA 1GRQA 3EQ8A 3D8NA 1YE3A 1N5OX 5E9AA 2X8BA 3CKLA 3D4OA 1QRAA 5K6RA 1EU1A 1Z16A 1G41A 2HWYA 2P27A 3C4QA 3E05A 3ZQJA 3GMDA 2WTUA 2HCTA 3GJRA 1OW3B 2YIJA 3O8BA 1USIA 4L0DA 2VF5X 3CEAA 3TGWA 4ZYZA 4FHZA 1X1SA 4MHOA 2COKA 4DN6A 4QA9A 2DFNA 1U8CB 2A6PA 2OV4A 1NDHA 3M4XA 1KJZA 2HK7A 3MS7A 1YDGA 3QXGA 1XJ5A 1YE5A 5CYFA 4OQDA 4F5WA 2I4RA 3K4HA 4OK5A 4MWEA 3T06B 5H81A 4Q3BA 2F67A 2MMCA 2A9OA 3KXKA 3TAHA 2Q5LA 3DDOA 4ZT7A 2EJUA 2Q7DA 1YFKA 4AJ1A 4YMHA 3NWPA 3VRHA 5IYZB 2PX0A 1XLTC 4P4UA 1POXA 4C20A 1AMOA 1YBFA 1QVVA 2Q1SA 3OCXA 3R7BA 3FIJA 3P27A 2D13A 2QL5A 2RGGA 4YEDA 3UMGA 3WB9A 2DB3A 2P2CA 3A14A 4U2BA 5FRDA 2PZBA 1E79A 1MC4A 1U5AA 1XZLA 1TUGA 4MW6A 1B93A 5TF0A 4K7JA 4DZZA 4AY5A 3RADC 2B2XA 5AO9A 2PX8A 3TQHA 1BGVA 1GWNA 3IP6A 1OLUA 3QXHA 3TZHA 1XXLA 3DUFB 3ZQUA 3A1UA 2F90A 1VLJA 3M33A 5JCXA 2Q9AA 1KY5A 3BTOA 3DP7A 1OYYA 4HOYA 3NHKA 1KMMA 1PYOA 1RKQA 4XI9A 5K3BA 1O5IA 2QVBA 3QWBA 5D85A 1EQ2A 2ZYTX 3AJ8A 1ORRA 2X9GA 3NRJA 2H4WA 5ICCA 1JJAA 1JU4A 3CZ4A 1JFFA 4C0WA 3G2MA 3LXRA 2WWYA 2A9PA 3DFFA 3L06A 1HDYA 1QC5A 1YU6A 4ZK6A 4C7MA 1NNLA 3ZWMA 2O6LA 3PE6A 5AKHA 5ALPA 4FDVA 2EW1A 1J1ZA 1TAGA 3V4OA 2Q3BA 1S01A 2IEGA 4JA0A 1DUIA 2JAOA 4R6WA 4S1TA 5ILQA 3CZMA 3X1DA 2ZCUA 2Z1MA 1V1MA 2AWOA 2ZR9A 2P4QA 4FGWA 1AGPA 4N3CA 4OJYA 4N8SA 1P6XA 5KC9A 2PVCA 2GEBA 4Q1FA 3WBJA 2NUAA 2I2DA 5HKLA 2G5TA 2IXAA 2WYIA 4ER5A 4IXWA 4DA6A 4W1RA 3JRWA 1A8PA 1WDWB 2ZZNA 3BCUA 1OGJA 1AV6A 4U5QA 1RPZA 2VUUA 4ED9A 2ZSAA 2REOA 5AW4A 1V3UA 1ARZA 1C5KA 2QJRA 1XNHA 2WYVA 3T7JA 1L7OA 1H9AA 2VNIA 5LU9A 1CULC 1QS0A 1CRWG 1GPDG 1PS0A 4A03A 5EUMA 4YROA 1G21E 5EINA 3QA9A 1KPGA 1FC0A 3L18A 3GMSA 2C2XA 4IBOA 5AJTA 4BNMA 1SXGA 3ITEA 1XRPA 2ZDGA 1DKLA 3FMFA 4PTYA 1A4RA 4NEGA 1YMUA 4CE6A 3EVFA 1PR1A 3KXDA 5IASA 2DQZA 1T15A 3LYHA 3TLXA 3UMBA 3E5RA 2VJAA 1O6CA 3LAWA 4D9BA 4E11A 1PQYA 4TXLA 1VG1A 4X7RA 4MKRA 4N0MA 2GJSA 1E5QA 2IF0A 1C8LA 3W9SA 5HKBA 2GN1A 5FDFA 5BSTA 3U7EB 4LNUB 3ZHVA 5JWOA 2IOFA 3B3GA 1UK6A 2Q6OA 5AUPB 1R8JA 3HWRA 4MR7A 3FW1A 2QM3A 1YOBA 2KSQA 4Z49A 1VE6A 1W30A 5CPBA 1HO3A 1HG0A 1SHUX 4P58A 2H7XA 5BQOA 5JXHA 2F3PA 1ZBQA 4J7AA 5LZ5A 3TXXA 1O9GA 2RG7A 4WASA 4WNAA 2B4KA 1GKIA 3KLPX 4QUBA 3ZU4A 3CLRD 3RT7A 3OUUA 3ZS9A 2EFGA 4MUIA 5HZKA 4AWAA 5E6UA 1YIDA 5HWSA 3GOHA 2ZGVA 4JBWA 1GPH1 1RXVA 3CW2A 2PWBA 3EW9A 4RQTA 4RTMA 1OV4A 2HJRA 2D2VA 1JXOA 4A0QA 3I23A 4O3MA 1SEVA 3NVMB 5B3LA 1Z07A 2LWIA 2EW8A 1A9QA 1JVNA 2X1VA 3LY8A 1R5NA 4OY3A 4GGMX 2WLSA 4L9RA 4PYOA 2DPHA 1N8NA 3HCEA 3P71T 4JIGA 3EVDA 4YMTA 4C4SA 1P5JA 2AK3A 5JCJD 1UOOA 3UUFA 3JWEA 4KXWA 4MCHA 4HS4A 4RD3A 1JXQA 1FXWF 5CXXA 3KTFA 4XUCA 4CM4B 3GLRA 5EKTA 1XALA 1DELA 4NR0A 1BN6A 1NYQA 1PJRA 2FP4A 3GFRA 3K5WA 1W35A 2P7HA 3KVVA 4FEAA 3GUZA 3AF3A 3NOOA 4NLLA 3HRIA 5FCDA 3RYTC 4QBIA 1JG6A 3E9EA 1UM9A 1CB0A 1NUTA 2EFJA 1CRPA 1P44A 2YHBA 3CSDA 3FYCA 4HEA1 3ZBUA 5KOJA 3VFDA 3B1XA 3KK0A 1HR0B 5KNCD 2L69A 2IS4A 1IUOA 1KYXA 5D86A 5DBOA 2ATXA 1JA0A 4AC9A 4ECAA 4ERXA 3QUAA 4ZYTA 5MFPA 1V96A 1JJIA 2AOVA 1CCWA 3W2EA 4EEKA 3F4LA 4F9GA 1CQIA 1FYDA 3C6QA 721PA 4G1CA 4ZO4A 4LX0A 2ZWVA 3KT3A 3JQQA 4P81A 2IS1A 3PZRA 4M0DA 3RKUA 3HN7A 1ETHA 1NYLA 3VM6A 3IOBA 1PEKE 2J59A 3JASB 3USCS 4RYDA 5FNVF 3N2GB 3FFTA 2VVTA 4Y6PA 2Y1EA 4JZYA 1AS2A 4YRMA 1KEKA 2I78A 2BZ0A 2H52A 4EY4A 4YRIA 3J7TA 3WTBA 1AUXA 1WUJS 2QQEA 5DLPA 2IKSA 5JV5A 4P0PB 1W93A 1T2CA 1KAQA 1Y3AA 2AKAB 1U4OA 3G2IA 4HJXA 2GYUA 4IOMA 5K4GA 1GUDA 2VRNA 2WTEA 4P7KA 5IKEA 4LJ8A 1VPWA 3PNYA 5LYJF 2FCAA 1QANA 2CFTA 3KQMA 3Q9UA 2YKGA 1TGVA 4AWXA 2FJPA 4U63A 2AZMA 4TMYA 1GEGA 5ENDA 4JVLA 4M46A 2PE5A 3SFTA 3BC1A 2E18A 4B87A 5DNEA 3D3KA 4IF4A 4X91A 5FWXA 1DWQA 1NI4A 4DMGA 4DT1B 4HDKB 3ZTYA 3QM1A 3IVAA 1YOVB 4TKVA 1CWUA 1FQOA 1G1MA 2BFEA 3CH6A 4OFXA 2VNSA 5CD9A 3B9RA 3LX6A 1VJTA 4TTQA 2D2EA 1JHXA 4L2IB 5FI0B 4AURA 3KZKA 1U4SA 4EB0A 1ZMBA 2FWMX 3SR3A 4HY3A 3A27A 4Q3LA 1CLUA 2P1ZA 3H4TA 1GL6A 3HVIA 1FBTA 1XE3A 4BEBA 4DLZA 5HPYB 2BP7A 3OO1A 1U8UA 4KSYA 2FZ5A 4XRRA 4YBZA 3WHLA 3CWZA 4UU0A 1P2UA 3UW3A 3RU2A 2PYIA 1U7PA 2PFSA 2ZIVB 3FUXA 3TUIC 4URUR 2F3RA 2HA5A 3PSHA 3STUA 3NBFA 2IOHA 2Y93A 3IBSA 5IDQA 4TTAA 5JANA 1H8HA 4OGFA 2QMOA 3U9SA 9ATCA 3IJPA 4S0XA 2NX2A 2HX1A 3FOWA 4D9GA 2OV6A 3C16C 5SYMA 4CGYA 4XRGA 3PD1A 2AK2A 1POWA 2QGFA 1J5PA 4UUNA 4WFIA 1GIAA 1QRSA 4TV9F 5KINB 4UOZA 3VOAA 3EPRA 4R8RA 4GVPA 5CNMA 2EL9A 5LC1A 3AHFA 2IITA 4RXMA 4DIFA 2FG5A 1B3RA 1V16B 2VQSA 4MA4A 5DV9A 4RMIA 3BXPA 3WMFA 4XB1A 1LDMA 2HSDA 1U9YA 3T0IA 5K4HA 2GILA 4L28A 3VAZA 4GL2A 4EY6A 1FP4A 5ARCA 5A2GA 2J46A 1UXIA 3RU3A 2QSUA 1UOEA 3K0SA 5ECYA 2GBGA 1UPXA 3HU3A 1AS0A 3BGWA 2XTAA 5CLJA 2XECA 3ILHA 1ELOA 1W76A 3U0BA 1XQYA 4B6JA 5JWRA 4HHEA 4RVFA 4O4HF 4WOKA 3B1KA 3MBOA 4PCVA 4PQYA 1SQGA 2NUPA 2PLAA 3FCAA 2PKRA 3G5TA 3HLTA 3OFKA 4XB6B 2NZUG 4NABA 2OKCA 2FQYA 4G1FA 3ZUPA 3BZUA 1I24A 3KTOA 3K6SA 1ULTA 1V3QE 1ITZA 1OZAA 3ANYB 4IGEA 3TTTA 1IVSA 1KQFA 2PGIA 4DGQA 3B1ZA 4WXPA 4EYEA 5TMPA 2OV8A 3NT4A 1YHNA 3ZNQA 5LP6F 2O8CB 3BRCA 2IP2A 4CYMA 4E31A 3ESZA 2HSZA 1L5FA 3IT0A 2C4TA 4NF2A 3TFQA 3U4QB 4O5AA 1X8JA 3NLLA 4U6SA 3EIUA 1M1NB 2XW6A 1CJKC 1G4UR 5I5GA 3NYIA 2OBNA 3AOGA 2I3ZA 2Q5HA 1QF7A 3BK1A 4HPWA 1CK4A 4N76A 3OJCA 5CM2Z 1WZIA 1XRRA 2AUMA 3QVOA 2ATIA 4GPIB 1E6LA 2PM8A 5CVCA 2GYVA 4AG6A 5KQPA 2G1PA 4PINA 2J9GA 3RF7A 1OXUA 2H06A 2ZJ3A 4CMBA 2DE0X 5DBGA 1GYPA 3PXDA 3B53X 4HQ0A 1DV1A 1G6Q1 1HQKA 1I3CA 3P5SA 4HAUA 4CVNA 3EDQA 2QLFA 3QZUA 1I7NA 4AS3A 1FTYA 1A4XA 3EVBA 3I9V6 2FMTA 4WNCA 1T8SA 5D1HA 1Z4QA 4F5EA 2WHXA 1S8FA 2VTKA 1PFKA 3PPVA 3OZTA 3FJ1A 5I4IA 1HNZB 2XB2A 1N6KA 1I7SB 1W47A 5L6MB 1ZD2P 2CNLA 4R6XA 4BV9A 4Q9KA 2IOYA 5C1DA 1JS1X 3L1IA 4PHGA 1AQLA 1FSGA 2WP8J 3DFIA 1FTGA 5EMMA 4KR6A 2GX6A 5J23A 3HKDA 1AA9A 2W6PA 3E58A 4FBMA 2C97A 4UAJA 3ETDA 4EDHA 2ZYAA 3GPIA 1PN3A 2C59A 1MVOA 3H16A 4DLXA 4X6LA 4HTFA 4G25A 4Q82A 3UJNA 3RS4A 3C3XA 2P90A 1E94E 4B9EA 1ZH0A 4ND8A 3IEPA 1NVEA 3OEHD 4CQLB 1OLUB 4B3JA 1T5OA 3Q3IA 1PG5A 4MTLA 2E87A 2I7XA 4J76A 4K81B 2WD8A 1N1EA 4NICA 4XKJA 5AHOA 4KO8A 5JBQA 5HZHA 1J06A 4X61A 1JHZA 4B84A 1Z6YA 4BLUA 3EWAA 221PA 1B2RA 4G4SP 4QREA 2YHAA 4N12A 5ERXA 1KVSA 4N5MA 5TC4A 1YDFA 1DAMA 2WFZA 3AI2A 3BG5A 4COKA 3TUZC 1IEVA 3AR6A 2L19A 4KMMA 2LVBA 1C4WA 4JL6A 2QVLA 5BT9A 3TEMA 4ESOA 2H1CA 3IA2A 3KQVA 3OTGA 3MLEA 4RPGA 1KDVA 4D2IA 1CDDA 2NNWB 3LTEA 3ROEA 2A4MA 3UMSA 3KLBA 3ZW9A 2Z3VA 1HSZA 1G38A 1QIJA 1VJ1A 3VHLB 1ZCAA 1UPBA 2BFMA 1TIBA 4NU0A 1Q14A 1MJNA 2HDWA 3M6FA 5AK4A 1BX1A 4O3FA 2CHVA 5JYBA 2AYXA 3JZMA 4L50A 3U80A 2H5IA 2QXTA 4HDOB 1GAQA 2IPLA 1ID1A 2WM9B 3MBKA 4JJIA 4E2WA 1CLEA 4BLOA 4DMHA 2NUAB 1AHNA 1TRHA 4I7EA 3IMEA 3BULA 3SHOA 2M9MA 3LZCA 1R8XA 1CG6A 3SSOA 2NSHA 2ORED 2EYUA 4D25A 3R9XA 5BWLA 2OZLA 4D3ZA 2Y1GA 5E0KB 3FOEC 1CNEA 2Q2VA 2IEAA 4E21A 1Y34E 4F3NA 4XFKA 3HN2A 1JHRA 4XIJA 4LKRA 5AVSA 4GX1A 1PZEA 1J2TA 1QS0B 2ZS8A 3F78A 3GEDA 3JQFA 5IBQA 2GXSA 3OTIA 4G0OA 4NECA 4UAGA 2P79A 5FUXA 3THSA 3ZKWA 1ZNQO 2JD0A 3AG5A 3QFSA 1X0XA 2PHZA 3HLKA 4A5SA 1NN3A 3JVIA 1LQTA 2AKEA 4HUQB 3A4TA 5K8CA 2DPGA 4HDCA 1JH9A 1U65A 1XKXA 3DBOB 4A92A 1DDIA 4JELA 3PKZA 1Y5IA 4JZKA 4JDUA 4QJ4A 2NVUB 1GJRA 4DOMA 3JYQA 3ZDDA 3LUKA 4BYMA 3LW8A 2DFLA 3V6LA 1KL7A 4HH3C 4J6EA 4DV7B 3F4KA 2H17A 2X0DA 1ANKA 4EW2A 4MR7B 3VVLA 1RDFA 2P9HA 4GYJA 5D3KA 4UUMA 4JI6B 3JQBA 4IMJB 2C4VA 4JOCA 4AJIA 4C1NA 1DKOA 1E9EA 3FD8A 2WYUA 3R4VA 4N03A 2CKMA 2ZRFA 4Q7EA 1GHTA 4B76A 3M9WA 1JP7A 2VLBA 3RVMA 3ZOKA 3EG5A 2AEFA 3UGQA 3FGNA 4LXTA 1SXJE 3ND7A 5EMNA 2WAOA 4GICA 3WBBA 3LVQE 3D8RA 1M34A 2J6BA 4QX6A 5E6UB 2RKBA 3IEUA 1Z6ZA 4N7JA 4RIHA 5FTNA 4D3XA 1FP2A 1M83A 4D9KA 3L8YA 1RLTA 4AMYA 2G83A 3EGWA 3R24A 5CB0A 5L4NA 4Q02A 5E0OA 3TBKA 3O8QA 1VMIA 1SC4A 3AK4A 3DE1X 4M0FA 4DV1B 1TL7C 2NO9A 4L4RA 3AJ9A 1QE3A 3Q98A 2FZEA 1J6UA 2BSAA 2BFAA 3DXZA 3E2MA 2AVNA 2ZULA 3F49S 5C1PA 3HJUA 4NFHA 2W2VA 1KXZA 2XIQA 5DISB 2ZUEA 2Z4TA 3OIFA 3IP9A 2Y1KA 1GN8A 4MKFA 2OQ2A 4NPHA 5D7NA 2RHHA 2YBDA 2D4AA 4BEJA 5IK2D 3VPDA 2RGAA 4MVJD 4RMHA 1HEUA 3H8SA 3NBAA 2FP4B 3I1IA 5CFOA 4PC2A 4AS2A 3KZCA 4FKZA 1P74A 4Q9DA 5FUQA 3SBEA 3B6ZA 3ABOB 5LNK6 2FW1A 4YJKA 2IV2X 4JLSA 1FSPA 1UM9B 2H9IA 3NVAA 2JGEA 2JZOA 4N0PA 3BGSA 1ZA1A 5KOJB 4AL4A 2YJNA 3C43A 3QBJA 1QYIA 2XGMA 3PR3A 4R69A 3U4GA 4N41A 2FUNB 1NFQA 1JTEA 4AZ3B 4RACA 3RFCA 1H2AS 5JY6A 1UBTS 1TIKA 1QKKA 5DI3A 4ZOEA 3NIFB 3D0RA 3OKPA 4MRVA 2B0JA 3L7NA 5DX0A 5A7HA 5FO0A 1CQIB 1ZICA 4A91A 2CV0A 4P83A 3QIVA 1QGED 3QELA 4DC0A 2H2FA 3SQLA 3VR1A 2RHMA 5EJ9A 1WD7A 1GZ7A 2OY0A 4MGYR 1NF2A 5ALTA 4BHTA 4QE3A 5JZOA 3ZZ0A 1Z8NA 4M21A 1OXSC 3CSSA 3JTMA 1VJ0A 2Z30A 2YYAA 4IGFA 4D02A 2FJUA 3FYDA 1H5NA 2HEGA 1SKBA 5DEOA 2I2BA 1AUPA 4WLVA 1NXXA 4JGBA 1E2NA 4YWJA 1Q0TA 2IBTA 1VLZA 3GLHB 1E5TA 8LDHA 1KJ9A 1OA0A 2VIIA 4QTZA 3UEOA 4CETA 1S7GA 4JR1A 5KNCA 2ZVJA 1T9AA 3EH2A 1D9ZA 3EF0A 4FONA 1GCUA 2FHSA 1TCVA 2JDID 3I4CA 2W6QA 4WBNB 5BNZA 5LQKA 2ZE7A 5JO0A 2FEXA 2QTVB 4KYVA 1PFVA 1MN6A 2V7TA 3CPJB 1ZNWA 4INPA 1P4RA 4CFZA 4S1OA 1T3LA 5FWXB 4FYIA 2YS7A 1NI4B 4JLMA 2R5FA 3GA7A 3DLBA 1F2TB 1B26A 4RHXA 1CIVA 1EUCB 4TKVB 2JGMA 4OEHA 2BFEB 5PGMA 5IM4F 1OT3A 1VP3A 1PR6A 4E5MA 4G6ZA 4HMPA 2C7PA 1J7KA 2P2YA 2QZPA 2VQFB 2G70A 1GPUA 2W2QA 2ZBRA 1BX0A 2CL0X 4ACBA 3DFMA 2OHVA 4RVUA 4BQFA 2ISSD 3OPYA 2BP7B 4TLCA 4IVPA 3M3HA 2X2OA 2XMDA 3WLKX 3LSYA 1QR6A 4AYWA 1VKNA 4B43A 2W22A 3A3PA 3MNFA 3HJFA 2GM9A 3KCQA 4M1WA 3CR3C 3HYCA 1LJUA 1D8AA 3RK0A 4BDTA 3PI7A 3WRXA 4A0SA 3DEFA 4TLEA 1Y1PA 3IC5A 2J9FA 4ZKEA 1C14A 4C7JA 2YQ5A 3GOQA 1Q3TA 2N1BA 2C8LA 2YNMD 4OHWA 4RIIA 5HRAA 5IBCA 1KZ9A 1M2FA 2ZJ1A 3GV0A 4CTJA 5KCZA 3HNRA 2JAQA 4MV5A 3SCZA 3FVRA 3TQQA 3X1KA 5K0ZA 2GRJA 1U8YA 2JA1A 3JALB 2FEPA 2NSLA 2W0MA 2JH9A 5DJ5A 4ZREA 5FPHA 5GY7A 2QUZA 3SNKA 3G0BA 2RJNA 4C0KA 4H1WA 1N75A 4NYMQ 3L82B 2PXHA 1KZYC 4ZI2A 4JUBA 2VHEA 3HZHA 3ZI0A 4BN4A 1FP4B 2Z95A 5REQA 1JYEA 1V9SA 1WQ1R 3PICA 3SDBA 3EQZA 3VSEA 3TR0A 3WNBA 2XR1A 4QG7A 1ZGZA 1QHFA 1D1TA 5G3YA 3VAAA 3PFKA 5AM1A 2BUCA 1RVDA 3SY8A 1PBTA 1W0KD 2Z2XA 4AKIA 1DRWA 4QPJC 3Q3HA 4FUQA 3N5KA 1Y1RA 3G2NA 4PYQA 1X15A 1N3LA 1ZD8A 2Q2QA 4DCTA 3MW8A 4K9PA 3FTDA 4AQDA 2Z2JA 3A3YA 3I37X 3TOCA 1SUBA 4EB6A 1CNFA 1EP3B 3WHKA 4NH0A 2I2XB 1CR0A 1NSTA 1V4VA 2FZGA 2W2OA 3CISA 3HDVA 4AY3A 2R3SA 6CHYA 4PPFA 4XTRA 5D1NA 2WABA 2FW7A 1K7EB 3D3WA 1F48A 1GUAA 5F64A 2ZBEA 4EOGA 4Z8YA 5IAOA 4G1UC 3HJCA 5JDIA 3RTCA 2V4ZA 1U7HA 1N2BA 5JAPA 3L41A 3BEOA 4KQ2A 2RIPA 4ND3A 4A26A 3O0TA 4QT4A 3C70A 4UHCA 3TPFA 2PEYA 2JHPA 1TEVA 2BEWA 3BZBA 5LMNB 4P0QB 5BWMA 1RHUA 2XMRA 3EWNA 3R0XA 4BECA 4W5RA 1JALA 1O08A 2G0NA 5EFZA 1KY4A 4BZZA 3BZWA 1ESZA 4D5GA 4W6ZA 1K8YB 4D42A 2KQUA 2V3WA 4MCAA 4NARA 3LP6A 1A2KC 1I33A 2ADMA 3PX3A 4LRQA 3A6GA 2VP4A 4REMA 4EG7A 1TA0A 2QP3A 3AL3A 3DQZA 1WM1A 3EF3A 4L4YA 3O26A 5T4HA 2EP5A 3RUDA 4A82A 4NMHA 5BMVA 2W37A 1WCV1 4RBNA 1QHEA 4X00A 2CE2X 4WKBA 1LI4A 1ST3A 5FFFA 1ZMRA 2QNRA 3PFIA 4IGKA 4UE6A 2R8YA 1FMCA 3UYKA 3WRYA 3HKDB 3RCBA 3HXLA 2RKOA 3ROTA 3ZWPA 3SZMA 2J41A 5KYTA 4TYYA 4YCNA 2XDQA 1SIBE 2H9AA 3C4JA 4HTFB 1YS7A 1OA1A 2BEVB 3CTMA 4QYTA 4OUDA 5F5LA 5B55A 1EWRA 4HLCA 4UHBA 5C81A 2YZGA 5DM60 3CLRC 3ED1A 3HUUA 4FHDA 1N6NA 1C80A 4I2VA 5GWXA 1I4TD 4IJQA 4QLBA 2A0KA 5CT8A 5BW5A 3ZOZA 1B0AA 2D0OB 2VJQA 2QKYA 3FOBA 4P7FA 1UC9A 3NHJA 2E89A 1SCQA 3RDPA 1H2ZA 3ESQA 5A7GA 2RC5A 3LX8A 3QVUA 3D6UA 1YS4A 3ASVA 2HZ7A 4TTJA 1QQBA 3I62A 4I3FA 5EHZA 3CZRA 2HQBA 1G7SA 5F35A 3I72A 5BXQC 2GN9A 2QJTA 4HLUA 3A1TA 3MT0A 5DSZA 3KEMA 4QBKA 3SEQA 4QHYA 3R3YA 4PY2A 2PPVA 2YW9A 4TMZA 2DHEA 4EAQA 1VMKA 1FB5A 4I5EA 1G9XA 4UE2A 4LXXA 4PVCA 1OCEA 2PQ6A 5GAJA 2IX3A 1XB2A 2C4KA 2HB6A 3ZE0B 1PG0A 5KHLB 4PNEA 1M8JA 4HDNA 1T5DX 1RYFA 1W5AA 2JC3A 4LHZA 3MYRA 5GQSA 3RSOA 4C7BA 2JCBA 1NM5A 4BGEA 3UGJA 3UC9A 3WFZA 1QGUB 3PKIA 5J5VA 1T9GR 5C8ZA 1JQ3A 3VU9A 4M0KA 1XC7A 4ERNA 4JBIA 3R0IA 4IJKA 2ZIGA 2WNIA 1KEUA 5EZYF 3WIEA 3AUSA 1H66A 5K0SA 1W8DA 2OZLB 5LWHA 2YWHA 1C3JA 3VDXA 2VP3A 3EBOA 2B5OA 1O7JA 3I12A 2DG2A 3IJRA 2OHFA 2VYVD 4J1NA 1NP3A 1SG0A 3L9WA 4LS3A 1MHTA 4OYHA 5B12A 3R3XA 1UT6A 3AGPA 4XTCS 4J43A 4LE2A 2PANA 4DLAA 3ZKWB 3B6MA 4JKOA 4BO6A 2VDOB 1MG5A 4I4TA 3X2EA 1FFCA 1NHGA 3DL2A 1E3TA 3TW8A 3QFCA 4H18A 2GA9A 3IE2A 3KLMX 2DR3A 1AKTA 3BH0A 4XJXA 5TS3A 1CHNA 3I9V1 3T9AA 4IAOA 5I7FA 4Q0MA 1TZ2A 1IRIA 5JS8A 4R1SA 1Z0FA 3QPVA 1ZQ1A 3EXFB 1SUDA 4WT7A 2OZPA 5CXUA 4FT4A 2W2NA 3BERA 4XE5A 5J5AA 1NBWB 4C2BA 1Y0BA 1WBDA 3M6IA 4WD3A 2BM9A 1A5ZA 1Q6ZA 4Q3DA 3UOGA 3ZLTA 3D3EA 1OGYA 2JBHA 2XYPA 1GV1A 4F4FA 4EF4A 4MYCA 2E1PA 4POOA 1CUBA 2V6BA 4KAXA 1F3OA 1IL0A 2ROQA 4AXXA 5JQWA 2XZLA 2FHPA 2XMSA 3AR8A 4BMPB 1RLOA 2BEJA 1S2LA 3OCCA 1GILA 4KYTA 5JLAA 3ESXA 4X1YA 2CMFA 2ZSBA 1M34B 3TDKA 4GXRA 4WBXC 3RHZA 2JAXA 2R751 1G1AA 1KVUA 3WRWA 1MVNA 1X19A 5AR1A 3D1VA 2AMVA 2OXRA 3O8QB 3TW6A 2GBLC 1DFHA 2ZUVA 4PYKA 3UK2A 4R3WA 3WLEA 3WO0A 4A6PA 3DHWC 1GGEA 4YJ2A 2J9RA 4FE4A 4HYQA 1RR6A 3EOBI 3TH5A 1GZ4A 1AKWA 4H7HA 1GZSA 1I1HA 4Y9RA 5CUQA 5FTMA 4V0NA 5B1SA 2C3PA 3AL0C 4LJLA 3QOWA 4EA7A 1YCDA 1X7XA 1YKGA 2X9LA 2PSSA 3AESA 3B6EA 3GJ7A 4BB9A 3ZGZA 3EY9A 5DHRA 3BT7A 5IAEA 2WVGA 4II2A 4N3NA 5EIHA 1L1FA 3U09A 3TEJA 2C5LA 1PKEA 2B0CA 4WN9A 1VXRA 2Y0EA 4BWGA 2GCNA 4EA6A 3ZBTA 2WSMA 4QFBA 2JLWA 4JT9A 3NV7A 4LRWA 1P29A 5EP3A 3KKMA 1HTTA 4HWKA 5IF9A 2FSUA 4LISA 3H84A 1NXTA 1QR2A 1NG9A 2FFRA 4RZHA 3OQMA 1QVRA 2QLMA 4QDOA 5A4MS 1X1EA 2JI7A 3RSSA 3CVWA 5DI3B 1TPZA 3SZRA 1EQUA 1VE3A 1YJ5A 3V97A 5B4VA 2HU2A 4DV2B 2B3TA 4D26A 1YMQA 3TSCA 2JLZA 2BGMA 5FT9A 1H94A 3QGMA 4KV7A 4LJRA 4HPJB 2ZQ5A 2LCIA 1QORA 4DLVA 4MVJA 2G4VA 2GFQA 3WOHA 2WSIA 3SFZA 2BFWA 4IX9A 4R9VA 3D7NA 4I3HA 5KQMA 3IRVA 1NXPA 2PV0A 2GN2A 5COAA 2W6IA 3CLKA 1NVWQ 4RA9A 4DA8A 1P4HA 3CPSA 3WLTA 4UDYX 7MHTA 3AWDA 2Q29A 2XYHA 1OX6A 2FOLA 1Y1LA 1U3DA 3GAFA 4F2WA 4D3DA 3AR3A 4CNBA 1L3BA 1OI2A 1UXHA 1BO6A 1JZSA 1RJWA 1QK4A 1GFWA 1LRJA 3UJ6A 2FSHA 2BM8A 1Y4UA 3AZOA 3OP1A 4TXMA 5FPSA 1K8ZB 4WXRA 1PVOA 2WTNA 5CFPA 3WRYC 3ZWWA 4WNYA 4JUCA 1TM5E 1VE7A 3ST7A 4BMXA 2HZBA 4XX0A 1ID8A 2W2TA 2Z6VA 1YDHA 4JQOA 1MAAA 4P4GA 1KY2A 1UJ5A 2ZRDA 5JSQA 1A4UA 3ZQ6A 2XWBF 4L73A 2CXUA 5EJIA 3JX9A 3K8QA 3FNGA 2ZBQA 4RS4A 1ISMA 2VCHA 3PJGA 2X0FA 4CLOA 1WJGA 2RGNA 4MCIA 2WI8A 2W98A 3DMDA 4QU8A 4ZXPA 4AKTA 3OPYB 1Z33A 3STWA 4EB3A 5HCNA 2PBZA 2JGDA 5FX2A 2JDIA 1K7FB 3GLIA 1JIKA 2P30A 3ND5A 1EFVA 4HQOA 4C30A 1WSBA 4FOPA 2C92A 1RAAA 1EK5A 1XZBA 2EKDA 2IEDA 3EZXA 5CHEA 4DHWA 3ITNA 5KX5B 1XZIA 1C3EA 1FNMA 1OF1A 4Q4DA 3IPAA 3FMGA 1L5VA 1OIXA 4AWBA 4D5EA 2IWRA 1GLVA 5KTKA 4F7DA 3GLUA 1N5MA 1W94A 4QLOA 5BNFA 3QWAA 2OB2A 3A4NA 1NJ6A 1G20A 4JVNA 1SXQA 3K0BA 5H7XA 2FOXA 2VC2B 2WLTA 3A6LA 5AYVA 3ZZMA 5KTSA 1Q95A 4YR9A 3WV5A 1G8SA 5DIZA 1OOEA 1SIOA 4C0JA 4TGLA 2OWEA 3HB5X 4M88A 4ZTUB 2QBYA 5KKCA 2AUNA 1YR1A 4RXUA 5REQB 1NM5C 5E9WA 3A37A 4TZTA 2GWHA 1T0PA 1SOVA 1YH3A 3I9NA 3ODPA 4GYKA 1N4DA 5IH3A 1C8BA 3W5IA 1JI0A 4KTTE 3RUCA 2FW0A 2DHRA 2ODEA 5J43A 1OWLA 2IYOA