2H7XA

Pikromycin thioesterase adduct with reduced triketide affinity label
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
284
structure length
279
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights of Polyketide Macrolactonization from Polyketide-based Affinity Labels
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Hydrolase
molecule keywords Type I polyketide synthase PikAIV
total genus 97
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h7xA00
2WKWA 5AOBA 1ACJA 2QRUA 4KACA 2QM0A 5AKHA 3VJKA 1IVYA 1W76A 2WLSA 1MTZA 2HM7A 5E2IA 1EB9A 5T4BA 1F0NA 5EHQA 4ZWNA 4GLBA 4ZV7A 3WZMA 1EI9A 3M81A 5D7BA 2O2HA 3D5EA 5ALHA 1YAHA 1JMYA 1UXOA 4K6HA 2VTVA 1ZD4A 3ANSA 1CUJA 3VVLA 2WHRA 4Q1VA 2XUQA 5DYYA 4BP9A 4KR0A 4V2IA 4Y2TA 3IIIA 4QLAA 1MPXA 2VJAA 3NGMA 5T4HA 2OGTA 1CUFA 3DL4A 5FKJA 4HRYA 2H7YA 1Z68A 2VATA 3WZLA 1VXOA 4BVKA 1XZEA 1E8DA 5CT9A 4W63A 2XQFA 3RLIA 5HKBA 2VJBA 4LKOA 2WUEA 1CFJA 4IH9A 1I6WA 5C7YA 5C8VA 2QZPA 2HRQA 3DKKA 5AM1A 1QOZA 3WKBA 2HU5A 1CUSA 2O2GA 1OILA 3G0IA 3W9UA 3F67A 1P0MA 4U2EA 3HSSA 4MEBA 2PL5A 3C6ZA 1R3DA 3OOSA 3LCRA 2PU5A 2OCIA 5AKZA 1VZ3A 2XUIA 1O6FA 1JJIA 5AIBA 4BATA 4RE5A 1TQHA 2ZYIA 2GBCA 4WY8A 2HA4A 1ZI9A 4ARAA 2PVSA 2RHTA 5JZSA 3HEAA 3BXPA 1QIHA 3NWOA 2PSFA 4DMCA 3ED1A 1ZGBA 1L7QA 3WQHA 3WWCA 1H2YA 4BZWA 3WKDA 3K2IA 4FNGA 5DJ5A 4FFWA 4MXDA 5HQ3A 1GQSA 1W75A 4BCBA 4N5HX 2VA9A 2H7XA 1XRNA 5AKGA 1FFDA 1P0IA 1GXSA 4GI1A 4W1SA 5ALIA 3H17A 5D3ZA 2PSEA 4LYDA 4GWLA 2XE4A 2BJHA 2G4LA 2K2QB 3W9BA 2RI6A 1GKKA 5AM4A 4AZ0A 3FLBA 4S0XA 1ZOIA 4H77A 2Z5GA 4UBMA 3K9BA 4HTAA 2WU4A 3ICWA 4P93A 3STWA 4AB1A 1LPSA 4UHBA 3H0CA 5AKKA 1BROA 5EIEA 3G0CA 1N5RA 2AJ8A 1OXMA 3V9AA 3HI4A 2VJCA 5A2GA 4K6KA 2XQGA 1TIBA 4UBIA 2XMZA 5FDFA 1JJFA 3IDAA 2IITA 3QZUA 1CUIA 4L3WA 5JATA 2BUBA 2Y1KA 3A2MA 5AKJA 2C4HA 3TEJA 4C87A 3E0XA 1IZ7A 2B9VA 1G66A 1WOMA 5AKXA 1ZD2P 5DLPA 1QLWA 3C6YA 5IKXA 3CXUA 3VJMA 3O4IA 1U8EA 5E4JA 1CUBA 2H9YA 2RHWA 3I6YA 4FKBA 4C6HA 4J0KA 1XZBA 1F0PA 4EA6A 2BKLA 4B9EA 4X7BA 3WL7A 3ZPXA 1FFEA 4YX9A 1SCIA 5AH0A 1CUAA 3WL8A 1YA8A 3WK5A 1J2EA 1YA4A 1XLUA 1N8SA 1YR2A 3C43A 1EH5A 3BJMA 3HLKA 4DIUA 7YASA 1VJ5A 1FJ2A 1DU4A 1J06A 3K6KA 3IUQA 2J3QA 3I2KA 3FYUC 2CEKA 4F60A 6YASA 1UOOA 1TKRA 5LZ8A 2WHQA 3DOHA 2WG2A 1LLFA 4Y7DA 1R1DA 1UK8A 1XRLA 2XLBA 4A16A 4KAFA 2PX6A 5ALTA 2ECFA 1XZFA 3QMWA 2JGLA 4BC0A 2CKMA 1FFBA 2XMRA 5AICA 3SX4A 4J0IA 1GKLA 4FWBA 4JH0A 4XVCA 2E3JA 3M83A 3RK4A 2PPLA 3FCXA 1JT2A 4GDMA 5EGNA 3QH4A 3BIXA 1R4ZA 5JARA 2BGNA 3R41A 4BBZA 4OYYA 4U2BA 2WHPB 3H2GA 2WG0A 3QBJA 3AZPA 4U2GA 5H3HA 3MUOA 2OGZA 4DYHA 1A8QA 5HZGA 5KWIA 1EDBA 2XUOA 3V1NA 5I7UA 1K8QA 4YASA 3BDVA 4ZGBA 1WHSA 5JANA 2ZVDA 1YASA 4CG3A 2DFPA 2QKYA 3QPAA 5CT4A 4BZZA 4M0MA 1SFRA 4JYPA 4FMPA 3SWWA 1XKLA 1K63A 3DCNA 1LNSA 1QO7A 4Y2RA 3E1GA 4WDQA 3WL6A 1BN7A 2Y6VA 3WK9A 3GBSA 5AOCA 2RAUA 3V1KA 5CMLA 5ALWA 5SYMA 4W1QA 4C4YA 4X95A 5JAUA 1VE7A 4E11A 5ALVA 3AJAA 4CIBA 3BDIA 3E3AA 1C7IA 5K5EA 1NU6A 1R9NA 2XUGA 2ORYA 5ALSA 1P0QA 3IURA 2JGFA 5EFZA 2WQZA 5AKLA 1QIIA 5E4YA 2JEZA 1QIDA 3UMJA 3MVEA 3WKAA 5CTAA 2QXTA 1X2EA 3H2IA 4B81A 1AMNA 4MEAA 1PV1A 2C7BA 4N8SA 3OM8A 3PUHA 3TJMA 2VT7A 4QDZA 4FOLA 2JEYA 1PJAA 1ZD3A 1TCBA 3ESAA 5D6OA 4G1FA 1BN6A 5LP1A 2YYSA 4DMKA 2BUCA 4DM7A 1UOPA 3LLCA 4BTVA 1C7JA 5A7FA 3PE6A 2PBLA 1NU8A 2OQIA 4GXNA 3HABA 1EDEA 1ZIYA 1W6RA 4BVLA 4B85A 1AQLA 4Y2JA 1WB5A 4OPMA 2HA7A 4P08A 4QDXA 4EUSA 4OUKX 3HC7A 4QEKA 1G5FA 2CJPA 2WIFA 2HL6A 3I2IA 4PNZA 1USWA 5JAOA 1LBSA 2CBGA 1Y37A 4XWGA 1JMKC 4UHDA 3F98A 3JWEA 3R3WA 1A8SA 1CUXA 1CQWA 3D2BA 4B82A 3HACA 1Q0RA 3A2NA 4JYMA 4B0OA 4QE3A 2V97A 4F5ZA 2Q0XA 3PUIA 1QIGA 1UK6A 3C6XA 5ALFA 4RE6A 4KEAA 1HLGA 2JGMA 1EXWA 2PSDA 1DX4A 5ALDA 3DEAA 4RPCA 4Y2YA 4KAJA 1VE6A 4KE9A 5CXXA 2GBIA 5LIPA 2H1IA 2WFLA 1MNAA 4BCCA 2P8SA 1QIMA 3AIOA 3ZI7A 2ZJFA 2O7VA 3C87A 3D7RA 2I3ZA 5BOVA 2XUFA 4P92A 5K3BA 2XMGA 4CCYA 4H7IA 3MGAA 1B6GA 1XLWA 4PSUA 1KU0A 3F9CA 5LYYA 2OPHA 4LXGA 5FXMA 4H18A 3BIWA 3B5EA 1ODTC 2EDAA 1MAAA 3T4UA 5AM3A 1ZJ4A 5AK6A 3GFFA 4QNNA 5JD5A 2WUFA 3LIPA 1HDEA 2OGSA 1MNQA 4I19A 1LGYA 3H1AA 1XRQA 3A70A 3FBWA 3MUNA 5ALGA 3OTQA 1UKAA 2Y6UA 5AI8A 5AM2A 1XFDA 2WIJA 1L7RA 4ZREA 3DQZA 2HFKA 1MX1A 2GYWA 1EK1A 2WIKA 1DTEA 3L1JA 1DQZA 2YXPX 4GBGA 5HF9A 4YPVA 3PF9A 1MT3A 3AZOA 2WIGA 3HJUA 5AKIA 4ZXFA 5AM5A 4UBOA 4L0CA 2ACKA 3SK0A 5DYTA 1XROA 5JYCA 4U2CA 4O08A 2B61A 3ZV7A 2RIPA 3R0VA 3WWEA 5FV4A 1ODCA 4GEGA 1E8MA 1YB6A 1DWQA 2AJCA 3NUZA 4BAZA 4LIPD 2ZYRA 4FDMA 1TCCA 4KJXA 4C4ZA 3Q0TA 1RWQA 1MX9A 3WL5A 4LXIA 3EIOA 5AI4A 4UFPA 2OLEA 3WA6A 1XZCA 4CG2A 4HXFB 3R3ZA 1QE3A 1CUGA 4U2DA 1DT5A 2VF2A 2VAXA 1DWPA 2HA5A 2WTMA 4C89A 1IUNA 5ALRA 4PV7A 5AI0A 2ZSHA 3O9MA 2ACEA 2XMBA 4FFVA 2AXEA 3O4JA 3G7NA 2PSJA 2DR0A 3O95A 2Y2VA 4N8DA 2GYVA 1MAHA 3ZLUA 2X8BA 3KDAA 2OAEA 1UK9A 1BE0A 3R40A 5DTJA 1N1MA 3G0DA 4A23A 1YSCA 2XMDA 4EB0A 1AC5A 2ROQA 4UHCA 1QGED 1QIKA 3V1LA 4J03A 4AO8A 5K3DA 3WKCA 1VOTA 4ZI5A 4TVKA 3G9TA 5JD6A 2X5XA 2HA0A 4DLNA 3H19A 3QVMA 3O4HA 1QIFA 3GROA 3V48A 3G9UA 4X00A 3W04A 2VJDA 3AIKA 1CV2A 1KU6A 4J0HA 3D2AA 5CH3A 3D0KA 3IA2A 1H2WA 2QJWA 4WFIA 3ZLTA 1XLVA 4XX1A 1DT3A 3O4GA 1RP1A 4EY7A 4CG1A 3BJRA 4FLEA 2WG1A 2WM2A 2R8BA 2QS9A 4BTLA 1E3QA 1XZHA 5KREA 2QR5A 1UFOA 2PSHA 5IVDA 3F96A 5JAHA 2DQZA 4W1RA 5FLKA 3I6MA 1EVQA 4LHEA 1TRHA 4P9NA 5CH8A 5ALKA 4BVJA 4Y2SA 5ALPA 2XQKA 1RYYA 4G4IA 2C58A 2HU7A 2QTBA 1EVEA 4PQEA 4Q82A 1CUWA 4KE7A 3UUFA 5ALJA 4B80A 5ALLA 1EK2A 3JYHA 4X3CA 3ESBA 1W1IA 4WFJA 4OB8A 4AQDA 4E14A 1CUUA 1Y7IA 1BCRA 3WA7A 4EY4A 2V98A 4GW3A 3D2CA 2GBFA 3LP5A 4H7FA 1Q0ZA 3D4LA 3STYA 5CURA 5ALNA 1GZ7A 3PI6A 2ES4A 2I78A 3QPCA 1K4YA 2HA3A 3IBTA 4B83A 1MU0A 5FPPA 5BWCA 4W9RA 1EB8A 1ZIXA 4GECA 3STUA 4J0CA 4ZV9A 4J0JA 1CR6A 2JGKA 1QFSA 3GUUA 2WUDA 4H7EA 3GELA 1J07A 2V9ZA 4Q3OA 1WPXA 4BB0A 4MWSA 2WIDA 1Q83A 2PM8A 4N5IX 2DQYA 3C45A 3W2TA 3WK6A 2BAGA 3YASA 3BL8A 3PFCA 1UWCA 3FYUB 5CBKA 2Z8XA 4FNMA 1CUZA 4FBLA 1CUHA 3DDUA 1MX5A 5ESRA 2JGIA 1GPKA 1XRPA 4B0PA 2CB9A 3DNMA 4HRXA 4OU5A 3U1TA 4HS9A 1LPOA 2OCLA 1QZ3A 1JFRA 3VVMA 2J4FA 2HFJA 2DHDA 5EHNA 5D3KA 1JU4A 1XZIA 4UBJA 4BP8A 3PDCA 4AO7A 3G0GA 5C81A 1UKBA 4X92A 3EQ8A 5CH5A 4QDUA 3OG9A 3QM1A 2JBWA 1CUCA 1ETHA 1SCKA 4NS4A 1VZ2A 5A71A 2C0QA 5KWJA 4HAIA 5HF8A 5A7HA 5C8ZA 2WTNA 5AO9A 4OSEA 4IH1A 4YK7A 2C5FA 1THTA 2XUAA 5YASA 5HFNA 2X76A 1BS9A 4H7DA 3FSGD 2WSLA 3C5VA 5AIAA 4BCDA 4IH4A 4EBBA 1D07A 5DNVA 2WJ3A 3HYSA 4TGLA 3WLAA 1ORVA 3KD2A 4H0CA 5IVHA 4X85A 4BC1A 4CFSA 3EF3A 1CIJA 1A7UA 1E8NA 4H35A 1CUDA 3H2HA 3FNBA 1BEZA 4QLOA 1CPYA 3H2JA 4WDRA 3KSRA 4M0FA 4EY5A 1EINA 1Y7HA 5DYWA 2IIVA 1QFMA 1H2XA 5FUMA 1ZJ5A 3IUMA 3WYDA 3H04A 3HXKA 1XZDA 3X3HA 2DCMA 4EHBA 3AFIA 1DWOA 4D9JA 3A6ZA 3VXKA 2HADA 3KOOA 2EEPA 1W4LA 4B9AA 5T4EA 4Q3LA 5ALOA 4M0EA 4Y2QA 3WYNA 2WFMA 3ZWQA 1R50A 1YS2X 1ZICA 4B6GA 4NMWA 1T4MA 2DHCA 3RM3A 2R11A 1LZKA 3CN7A 2FX5A 4UFNA 2O7RA 2O2IA 3V1MA 3EQ9A 4HXGA 4QDOA 1LZLA 1WB6A 3H18A 4JNCA 3ESCA 1YB7A 4PF1A 2XUKA 3GA7A 2UZ0A 1ODSA 4I4CA 4H7KA 5IVIA 3OURA 4HXEB 4OCZA 3NOXA 2XUDA 3R3YA 1QJ4A 3WMRA 2Z8ZA 2WHPA 4GHWA 5C8XA 2ZJ6A 3N2ZB 4AN1A 2XUJA 2YASA 4G8BA 5LZ5A 3M82A 2GZSA 3BE8A 3WKEA 4AMYA 4C4XA 3D3NA 3FVTA 3BWXA 1WB4A 4MQLA 5K3AA 3WK7A 4WFKA 5A62A 2J4CA 5HFAA 4DNPA 3EQ7A 1IUOA 4Y2XA 4Q05A 1O6GA 4HZGA 5JZ9A 3FLEA 2WILA 4TPKA 3FLAA 2WFZA 3C70A 3ANTA 2WJ6A 3DS8A 2FJPA 4BRZA 1XKTA 4AZ3A 2ZJ7A 3L1IA 5K3FB 3C8DA 1B41A 2Z3WA 2PKYX 2QJRA 3HRHA 5ALZA 3HZOA 5ALYA 1PFQA 5I8PA 1BEEA 4BAGA 2OCKA 4UBLA 1J1IA 5AKEA 2D5LA 4LXHA 4NZZA 2BUAA 2ZYHA 4J7AA 4CCWA 4DNFA 4QWWA 3C6BA 3G9XA 5HCUA 1XZAA 3DKRA 1IMJA 4JEIA 1CLEA 3EBLA 3LS2A 4WJLA 1N5MA 2XMSA 5K3CA 4OB6A 3AUKA 4IO0A 4AXBA 3H2KA 4EZIA 4J0GA 5ALUA 4UFOA 4FLFA 3WWDA 2VT6A 3PFBA 4UBKA 3FWHA 3AZQA 1VA5A 1XQWA 2EDCA 1JKMA 5E4TA 3O9VA 3DYVA 5AJHA 1H2ZA 5AHXA 3I2JA 1FSSA 1K5PA 3G0BA 3OC0A 4X90A 1XQXA 2CMFA 1NX9A 2GYUA 4MYSA 1WHTA 3JW8A 1BU8A 4MQMA 5AK3A 1LPPA 4X97A 3G9ZA 3QPDA 1IUPA 3AILA 3STXA 5AK5A 1LBTA 2QUAA 4DTCA 4B7ZA 4UHHA 1E66A 3DYIA 5ALMA 4LYEA 4IHAA 3CCBA 3WIOA 1QTRA 5EHXA 3QITA 2V96A 5DTIA 1AX9A 5I9IA 5ALXA 2ZSIA 3IUNA 1JJBA 1FFAA 2W6CX 4DMHA 2W22A 5JD4A 3I2FA 4B84A 4ETWA 1AGYA 3M3DA 1XQVA 1R9MA 5LLSA 2XQJA 1G4HA 2LIPA 3Q8WA 1A88A 1AUOA 1E89A 4F0JA 3C5WP 3IB3A 3QYJA 3I1IA 1XRRA 1U65A 2J3DA 1CEXA 1YAJA 1ACLA 5BV7A 5EIAA 3PICA 5KBYA 3R3VA 4ITVA 2DHEA 1G42A 5EHZA 5FRDA 1A8UA 1GT6A 1ZD5A 3I6ZA 4G9EA 3CN9A 4CI9A 1JU3A 1E5TA 1QIEA 3WK8A 1VLQA 3UUEA 4OU4A 2PUJA 4FBMA 4JUIA 1WM1A 4MYDA 3L1HA 2QXUA 3DJYA 1XRMA 2QOEA 2B20A 3E4DA 5K3FA 4DSZA 1IZ8A 5SYNA 1GPLA 4G5XA 1JI3A 4ARBA 1GPNA 4MJ3A 3STVA 3I1YA 1VXRA 2B4KA 2I3DA 5AK4A 4CIAA 3KWFA 5JALA 2XMCA 1TAHA 4X71A 3KWJA 4G9GA 1ZI6A 3S8YA 5LZ4A 2GZRA 3H1BA 5AI9A 5IVKA 1U4NA 3R3UA 3B3QA 4AMZA 2OG1A 3ESDA 3D59A 4G8CA 5LKRA 3IULA 2XDWA 1P0PA 3FAKA 1S8OA 4L9AA 4BAUA 4MWTA 3RARA 4J3JA 3WWOA 3G02A 4WCVA 1EDDA 1XZJA 2XQIA 2WJ4A 2C0PA 2ZYSA 5DNWA 1VA4A 4C01A 5LKAA 3ICVA 4WY5A 3W06A 2PUHA 4G8DA 1DX6A 3ZLVA 1KEZA 2NW6A 5CT5A 1LPAB 1C4XA 3GZJA 1UOQA 3FVRA 4Y2VA 3DLTA 4I3FA 4Z49A 2I03A 2RGUA 2Y2UA 3W05A 2IX9A 3VKFA 4DNQA 4QWMA 3I2HA 4QA9A 3N0TA 2OXEA 4UHEA 1CQZA 1YS1X 1AZWA 1ZGCA 5FOQA 3VISA 1DINA 2WU3A 1XZGA 2BCEA 4XJVA 4EY6A 2VSQA 5BWBA 2G5PA 1Q84A 5HKAA 1HPLA 1UZAA 4RGYA 5J3JA 1R88A 3I2GA 4OYLA 4U2FA 1U2EA 3C8HA 3AINA 4BE4A 1CRLA 1MN6A 3P2MA 1VKHA 2AJDA 4H7JA 4BDTA 1ZI8A 1F8UA 1H23A 2G5TA 4Y9SA 4E46A 2VQ6A 5ALEA 3OPMA 3A2LA 1UKCA 2HA2A 5HK9A 1XQYA 3DOIA 2GBGA 2HA6A 3I28A 4PSDA 1YCDA 5AOAA 3LIIA 5DWDA 2OCGA 4K5QA 5CW2A 2JF0A 2HRRA 4KAAA 1QONA 2G63A 4BDSA 1WPRA 4UPDA 4X93A 1CVLA 1LPBB 1ORWA 4HVTA 2VAVA 1ISPA 3IVMA 5HK8A 1XZLA 4C88A 1LPNA 2OAGA 1UK7A 2BFNA 1QTIA 2JGEA 4X6XA 4BRSA 4KE6A 5HF5A 2HDWA 4DMFA 3BF7A 2XMQA 5AM0A 4UUQA 3WWPA 5LZ7A 4G4JA 4FLMA 3FCYA 1AKNA 1L7AA 3QMMA 3R3XA 3WJ2A 4QZVA 2QUBA 4DSAA 3FYUA 1GQRA 3FYTA 4KE8A 4KRXA 5JZBA 2RONA 3DL7A 5AI5A 2CUTA 4PW0A 5T4FA 1XZKA 3QMVA 4UBNA 3VDXA 4Q3KA 4OB7A 1HQDA 4INZA 5FPQA 4X6UA 5DNUA 4G4GA 4FTWA 4KYVA 1EX9A 5JADA 2HIHA 3WI7A 4N8EA 4AN0A 2ONCA 1M33A 2Z3ZA 2D0DA 3TGLA 5AI6A 5IH7A 5HQ3B 4E15A 1H22A 2AJLI 3AIMA 5CT8A 2XT0A 1SCQA 2XUPA 1FFCA 1LPMA 5CT6A 1SC9A 2AJBA 3T52A 5JIBA 4Y2PA 3WJ1A 1DQYA 1TK3A 3F8SA 3O0DA 1BCSA 2VEOA 3BF8A 4J0DA 5ALQA 1HKHA 4BE9A 4OD0A 4QDTA 2YH2A 4IQ4A 5A7GA 1HL7A 5JASA 1W52X 2HU8A 2QVBA 3FSGA 4X94A 3WK4A 1QO9A 1UT6A 5CRIA 4PO3X 4CCYB 1MO2A 3KXPA 5K3EA 3VJLA 2JIDA 3RKSA 5FP0A 2FJ0A 4A5SA 2XI4A 5A6VA 4K6GA 3FOBA 2C5GA 4NVRA 2QT9A 3SC2A 1OCEA 3IUJA 4FHZA 4Y2UA 2DSNA 3WIBA 1QIJA 3B12A 2XUHA 4Q34A 5EIHA 1MJ5A 1THGA 2H7CA 4X91A 3U0VA 2HHAA 1X2BA 1EHYA 3S2ZA 4DGQA 1GGVA 4PSCA 4H7HA 4BYMA 5LZ2A 3ILSA 1SOMA 5ISMA 4X6YA 1CUYA 1BRTA 3DD5A 3STTA 4AX4A 2CZQA 5EI5A 2JGJA 3PF8A 1F6WA 5JAPA 4F21A 2XLCA 4AO6A 5AKYA 4UHFA 3F97A 5AP9A 5LZ9A 2WUGA 1TCAA 4RNCA 4ROTA 4ZRDA 1X70A 4K2AA 1XZMA 5F4ZA 2XB6A 2BGRA 2OQVA 4XIIA 2PU7A 4W1PA 1CUVA 4KRYA 3TRDA 5HF6A 1AURA 4L72A 2QMQA 3G8YA 1T2NA 4DNOA 3CCCA 1HBJA 2FUKA 1EA5A 1CUEA 1WCYA 1K6EA 5CXUA 4EY8A 2WFLB
chains in the Genus database with same CATH superfamily
2H2IA 2AMVA 4MQEB 2E1RA 4R6XA 4EARA 5KWSA 4B09A 1FTSA 3QE4A 5KVVA 1AHHA 1W4ZA 3ZGXA 4NYIR 5J2UA 3GJQA 1KQGA 1JIXA 1FVXA 1NVXQ 3KDSE 4QJIA 5AKHA 1H4TA 4YQEA 3W5DA 4CN9A 3VJRA 4DA9A 1MA0A 2FETA 4Z7JA 2EJTA 5FR1A 2JGDA 4JB3A 3L7NA 2PH7A 3SYKA 2DF8A 1ZVVA 1EB9A 3GA5A 4XX0A 4IY1A 3FTNA 1NXSA 1YUNA 3WO1A 3M9XA 1B8OA 2AMLA 1I94B 2NUAB 3KJZA 4ZV7A 4YAEA 3WZMA 5AW7A 3WGQA 5LU8A 1J49A 3CTMA 4GQAA 5BUSA 1SELA 2YOFA 3R74A 3V1UA 1DMRA 4I1IA 4UXIA 2G25A 3E58A 1RHKA 3I39X 4JOBA 1UJ2A 2Z04A 4UATA 1IJBA 2OYRA 3WRXC 2NV6A 2O2HA 1AK1A 4NJEB 3ZWCA 3ZIDA 3AY6A 5ALHA 3A7EA 221PA 5FPTA 4DV2B 3K0FB 1QQTA 1ZEJA 2VXOA 1YRQA 4XSGA 2GFHA 4TV9B 1VYTA 1Q1NA 3PE3A 3T3EA 4Z2AA 2B1QA 1VLJA 4FJ1A 4PYOA 1JHOA 2B69A 4B3BA 4FOTA 2EERA 4RDIA 1FDRA 4GICA 1CS0B 4P58A 1KIAA 3NIGB 1E4EB 1G6KA 2GUGA 2XYPA 1MRNA 4RIGA 3WLJA 4DLTA 1M6NA 6Q21A 3VAZA 5GMOA 4OL9A 3LL7A 5D86A 1LVHA 3IIIA 1L8QA 4MPDA 2TSYB 5JFTA 5L4LA 2QAIA 4IDOA 1Y3IA 4JLBA 5B1DA 5TJ9A 4HUTA 1GLVA 3M1LA 1LS1A 5ILQA 4RZXA 1KC1A 1CUFA 4Q1CA 2HYDA 4TVBA 1FYXA 1K2VN 2ZIWB 5ITVA 2HBZA 5ESWA 3N1UA 5FKJA 1UKEA 2OFWA 3ONWA 4H60A 2VATA 4BU0A 3MLBA 2GNAA 2X4DA 2GXSA 3CXRA 4QRDA 3T3OA 4NE2A 2YZ2A 1V95A 5ECDA 3VDNB 3W3AD 1SXJA 1FP4A 4W63A 1EFRD 2XTNA 4NBKA 1I80A 2YIDA 1FDIA 5CVEA 1U9JA 2Q5CA 5M7EA 2OCAA 2YINC 1RCUA 2LV8A 2BH9A 3KQOA 3RYCB 1W7AA 1NP7A 5JHGB 3PTAA 2QTRA 3JQBA 4ZVKA 1PLLA 4IYRA 5E2BA 1XEAA 2O48X 2P6UA 5ILOA 4NKRA 4NNPA 1Y8QB 5LP6A 2AD1A 3NS7A 2UVDA 3AHHA 1NI4A 2P90A 3AEUB 1AGXA 3DKKA 1SXIA 3M6UA 1E2GA 2EG9A 2JH3A 3QU2A 2ZIXB 4RA6B 4BWGA 1SKYB 1O54A 5A9TA 5EP3A 1ADFA 3VZQA 3QLUC 2VP3A 2IXGA 2VPWA 2O2GA 2ZRFA 4OQ4A 3VYUB 1Z5NA 2OZLA 4MOWA 3RVBA 1PVVA 3L4KA 3W9UA 3PFFA 4AKEA 1JQEA 1MB4A 1F9AA 1UINA 2QD3A 2R6ZA 1TZMA 2FH5B 4RD2A 1RAHA 4RHFA 2NUBA 4L0DA 4GOLD 1VL1A 4UCXA 4OI0A 1P0MA 4HY3A 3AI2A 3RT7A 4U2EA 2BMDA 1QB7A 3DMTC 4K6OA 4LHWA 1DUSA 3T34A 3N6VA 3IERA 3Q9LA 5J4KA 1EFLA 4DXDA 4KNYA 3CNHA 1I14A 1CRWG 3C6ZA 4PTZA 4FQ8A 3GLIB 5JBQA 1L7MA 3LCRA 3MYYA 2OHJA 2CJXA 1W0JD 1WXXA 1TQ2A 2FFQA 4KO4S 2MSWA 1O96A 1IHYA 4HBZA 2IZ5A 1NW9B 5AKZA 1NP3A 1Y5MA 4C21A 1E1KA 1ZINA 5JSKA 2W6MA 4A0FA 4DSNA 2AB0A 2FP4B 4KVZA 3S4YA 3O3CA 4R2IA 5HILA 4QGBA 2B8EA 2QN1A 1TQHA 2ZYIA 1DCKA 2XF8A 4BP1A 5C8YA 1V8OA 4Z0TA 4JBGA 4CKEB 1P8AA 4JJGA 2W2XA 5IJWA 1SVUA 4O4JB 4WY8A 4X62B 4BASA 4INPA 1JJAA 1NJ5A 2R6JA 4ZK2A 3E1KA 1TD9A 4MUHA 3FWPA 3W8DA 3CHYA 4Y0VA 3Q7PA 4ARAA 1FZQA 1Z28A 1CY6A 2JZNA 2PVSA 1TA9A 1YI1A 3D4PA 3NVMB 3OPYI 1JI0A 3QMPA 1P73A 1CVIA 2OBFA 2AYXA 3LT5A 5JZSA 4LGCA 4X45A 2ZTHA 2KWIA 4RTSA 4LRYA 1GZSA 3B53X 4E94A 1W6UA 1U3DA 3C14C 4KAXA 1V1JA 1M2EA 3DZDA 1JKJA 3RC2A 3L4BC 2YFHA 4OL0A 3EZFA 1WS6A 3PQ4A 4BJ5A 2I2WA 3BHIA 5GINE 4FNGA 1BJKA 3EXG2 3GVIA 3UIEA 5A4DA 1H3NA 1ILEA 3OX1A 1TU3A 2CYCA 3EDMA 4R31A 5DJ5A 1L9KA 4EKGA 4ES6A 2FN3A 3AVWA 2O52A 5J1TB 4U63A 1J22A 1GQSA 2W2TA 4GZLA 3RKUA 1JEOA 4BV9A 1EFPB 2ZBDA 4RQUA 3LDGA 4R01A 1FFDA 2XNHA 2PCLA 3U5ZB 4W1SA 1WY5A 4U00A 3VPFA 3N59A 2RKOA 1AXRA 2PSEA 1REQB 1GN9A 1V39A 2X9VA 2IUTA 2QENA 3G17A 3KZ1E 2EKBA 1VPDA 1JAYA 4IFBA 3FOAA 3LECA 4LYDA 4WNAB 2G4LA 2Q5QA 2E4ZA 2IYNA 3AG6A 3MJVA 5G0TA 4GM0A 3WIDA 5A04A 1BWPA 3SXJA 1V8DA 4S0XA 5HJ5A 2G70A 3SS9X 1HO3A 1ZY2A 5GOZA 4D4IA 1WU8A 1ZOIA 2LKCA 1TUBB 4OHYA 2ZIVB 2Z5GA 4AKTA 1KK1A 1BX0A 4UBMA 3RLFA 3ZDYB 5KTRA 3K9BA 2GAIA 4AU1A 2YWJA 4NULA 1YONA 2IY9A 3ICWA 1V4VA 2E48A 4PEVA 1TJNA 2VAWA 5M2QA 2ET6A 3IVGA 2QIPA 1E3TA 4TS1A 2H31A 3TMAA 1NULA 3QEOA 1AHNA 3GMDA 4IPTA 4PLYA 4EHLA 2CLDX 1XYYA 1GV1A 3COJA 3ASVA 1NNUA 4GLFA 2XNSA 3CO5A 3O4RA 4G37A 4BU1A 4C7JA 4ENTA 3KWMA 5BXQC 3ZJVA 2EW2A 4PFQA 1AS3A 2IL1A 1JPVA 3EA5A 1W4AA 2PZEA 3R8CA 3K5WA 2NUAA 2OILA 3NDRA 4JELA 1U31A 3TPFA 1OXMA 4FDTA 4CV2A 3AOEC 3EXG1 3K9GA 4X66B 3BSWA 1N4AA 1B6SA 4Q7LA 1NVEA 2HQ1A 3V3TA 4KTVE 2IIBA 4MKHA 3ZXXA 5HKKA 2VJCA 3PWZA 4J29A 3UK1A 4DFDA 5BWLA 2I4OA 4QFMA 1SN7A 4AULA 2R85A 2R7NA 4P86A 2Y0EA 3PDWA 5E9WA 2WA1A 2Q3JA 1M10A 3ISTA 4HDRA 1Q0QA 4LHVA 4B4OA 1G3QA 4YJ3A 3T7SA 3HCPA 2WINI 3C16C 1CUIA 4REMA 1V45E 5J59A 2YZ7A 1K9SA 4PIMA 3RE1A 3D9QX 1TXGA 3PLRA 3GJ4A 4ENWA 4CEHB 2FEMA 2FPIB 2G08A 1A0OA 4GI2A 4GO1A 2BUBA 2Y1KA 1A9TA 3EPPA 3EIFA 4PPFA 3VUFA 3EGXB 2Q3EA 1ZRSA 1EFCA 1FQJA 1SUAA 3PD1A 3E0XA 2AOUB 4JJ7A 4QJBA 5K6AA 3K0CA 5H1YA 1V16B 1I30A 1VLHA 3CH4B 3KZOA 5AKXA 4UASA 1ZD2P 5CYOA 1FMFA 3HLYA 2DSTA 3C6YA 4WCDA 5IKXA 2Z6UA 1PX2A 3VJMA 4L9SA 4FN4A 1NJSA 1U8EA 4A73A 2FE1A 4QHTA 2R8RA 4QJ3A 3HDHA 4BKRA 4BX0A 3IBGA 1D1SA 4LXTA 2FSHA 1PZXA 4RGQA 1CDOA 4M86A 2ZJOA 2HSJA 3ZHBA 4XPZA 5MN5A 1V6CA 1T6BY 2DPGA 4WV3A 4ZARA 3MGBA 3VKHA 3ND7A 1EWQA 2V6BA 3NHRA 5JROA 4D6XA 4TSFD 4ZAFA 5K0FA 2NX2A 2KW5A 5DH9A 4Q12A 4X61A 1I3NA 1NF2A 4JVSB 3C74A 3KPWA 3VMFA 5LQAA 5FA6A 4LOJA 3Q87B 3Q88A 3CVWA 1HGXA 3BC1A 4ZRMA 2X3YA 3WL8A 3K8OE 4OLHA 3UICA 4RA6A 4B5LA 4C03A 2XQVA 3HK2A 5EWLB 3A6FA 2BLNA 1XLUA 1X8LA 4CMHA 3PWKA 3SS8A 1LBEA 2EZTA 4H6VA 1N3YA 1VHTA 4B7UA 5JEEA 1JPUA 1GAXA 3HA7A 5DIFA 5J4LA 5F9FA 5AVQA 2L42A 2G1PA 3HO1A 2PWPA 2O5CA 3LUCA 1NMXA 4CM9D 2NXWA 1GSIA 3G2MA 9GPBA 5JCXA 1GTJ1 3T7IA 4LWOA 4JEUA 2QUKA 3P27A 1JHQA 3CNBA 3THSA 5JJKA 3PXDA 4S1PA 1Q7TA 3SOZA 1DU4A 1PDWA 2PIDA 3K6KA 4XR4A 3RRYA 4RF5A 1PT9A 2RKWA 3EEYA 5KOHA 1EBUA 1PLJA 2Y76A 5C3UA 1UOOA 3CX8A 4QGHA 4MVWA 5LZ8A 3HJCA 1JIIA 3HNPA 1E64A 4KLRA 4YO7A 2IH4A 5ICCA 1DV2A 2Z95A 2CV0A 5E3JA 2PKRA 2WG2A 2BGTA 4QTYA 5DTQA 1WMFA 3VNBA 1MCZA 3RPEA 1FLNA 1H0KA 2CXXA 1JHAA 5BW4A 3PR3A 1ODKA 2C2OA 4S2UA 1DCTA 1FYVA 1XVUA 4A16A 3QOFA 4KAFA 1WSDA 2ARKA 4QIHA 1UPAA 5GIPE 3ZKAA 5I8ZA 4F7DA 3I8XA 4IEFB 5ALTA 1GNSA 3WGNA 2NNLD 3ESRA 2JGLA 4CMCA 3C3JA 2DEUA 3KKOA 4L0QA 1CLUA 4BNDB 3VAYA 2OECA 4FMCB 3FJYA 4J0IA 4RESA 4X7RA 1GKLA 1PFUA 3SX4A 4FKZA 1E92A 4FWBA 3GLHB 2BR3A 5E6SA 2V0NA 5HBRA 3TLZA 3VO9A 3K6SA 2YYAA 4EENA 2WC1A 2Q1YA 5KSPA 1JZSA 2GVDC 4XIFA 1ZZEA 3MIZA 1XCPA 4UTZA 5JAUA 3OOYA 2I62A 2Y0BA 4TTAA 2FK8A 4X3PA 3E4CA 3DMPA 4GDMA 4AI6A 4K05A 3NWPA 3E03A 1DJLA 4BFSA 2DKNA 2ZIZA 3LL4A 3QW4B 1UWVA 1N7GA 2NVUA 5JAZA 3CVVA 1P1FA 3I6IA 2RB4A 1GFWA 2C2XA 2P9YA 5BNFA 3RTEA 2XE6A 4U2BA 4YRIA 3AKYA 3LP6A 4N3CA 1L7EA 1MQ8B 3W77A 2XKJE 4L7VA 3GJ5A 4JODA 1HZJA 2F3RA 2J0UB 3AV0B 4M6WA 1OXSC 1A8QA 4B32A 4DCJA 3X1ZA 4DYHA 5DB4A 4P34A 1FDWA 1OA0A 3D2LA 4KIFA 4P82A 2YHSA 3H6HA 4EKDA 2CFIA 6ABPA 3JZFA 1K8QA 1CZUA 2REQA 4YASA 3T7CA 3FNEA 2CF5A 4M9QA 2FEOA 1WHSA 4MDEA 5JANA 5E7JA 1WULS 2VK4A 2AUTA 2DFPA 2G0NA 3K70B 2L69A 3ACBA 4M0MA 3AM5A 2BF4A 4HFMA 4BZZA 3PB3A 4FMPA 2GN9A 1Z5OA 2IEBA 1NC1A 4HH1A 4I9NA 2HK8A 4F5DA 2FFRA 1XKLA 4CDGA 1RJDA 4JI8B 1K63A 2H9AA 2X13A 3GJXC 4FCTA 4L9WA 2CY0A 4UCWA 2PMEA 3DCNA 3WIEA 3ORHA 2WIAA 2QEQA 1QO7A 1KXJA 1YS9A 2MSLA 3V8QA 5LLDA 3VNVA 2FPPB 2QM8A 3NOOA 4IM7A 4NOMA 5JXHA 3P45A 2P4UA 4DA6A 4LF9B 5B57C 4ZEXA 4FZ3A 3G2IA 4CM9A 2QE7A 4M76B 2NU6A 2D1RA 1MG0A 4WDQA 3OPVA 2DTXA 2X23A 5H16A 1M2HA 5LBTA 3S0JA 4FE3A 3S2YA 5A9SB 1ML3A 4LGMA 5JSYA 2AKEA 2BTOA 4MR7B 3ZCPA 1NPDA 4TLCA 3HDJA 5AOCA 3TGPA 5EUBA 4QYIB 2P5SA 4AG3A 1FYDA 3PUXA 4LJLA 4DC1A 4YDHB 2BFAA 5AUPB 3N2YA 1GDTA 3CINA 1OUMA 4G1VA 4KQXA 2PRIA 4LV6A 1Y8AA 2NWQA 4QTZA 1WQ4A 1T3HA 2RC5A 4EMUA 3GLGA 2PGJA 4E11A 2N75A 4NZ9A 1YDGA 4CIBA 2IOFK 2YHAA 1OLUA 3W7VA 3PX7A 1KI3A 2JI7A 1C7IA 3T1VA 3ZXUB 1AH2A 3UT5A 2KB0A 1GZ4A 1I4DD 1Z33A 1R9NA 4IP0A 2QSUA 2CK3A 2OM2A 1QOPB 2QBYA 2QMEA 2Z83A 2IVFA 2B25A 1P0QA 3GW8A 4B8ZA 5JNRA 4G5OA 5EFZA 3T7KA 3WE7A 3JRNA 4A0GA 3LVFO 1T0UA 1QIIA 4L5BA 5FUVA 3VC3A 3B1KA 3P0IA 1TOAA 4MARA 4HDSB 3L77A 4R40A 3CRW1 3UMJA 5K01A 2NSLA 3MVEA 3REFA 5E9JA 3RI3A 4LRTB 4DMRA 5KQSA 2QHXA 4IBOA 4MS1A 2VSXA 1KAQA 3SF8A 3UF0A 3ZI0A 1ZMTA 3KQHA 3N5CA 1YBMA 3OCUA 4CEJB 5F3WB 3HWSA 4W99A 1QQAA 1WXGA 3CB4A 2E21A 4M2LA 5FL7D 3JQPA 3MWYW 4ZYVA 1C8KA 2QYOA 1XP5A 3D7LA 4PYRA 1V7CA 1FRFS 2OVBA 2WHYA 3I76A 4WA8A 1RHQA 2WP0A 1P31A 1EFRA 1Q74A 1QV7A 3GCXA 4IIVA 1NT4A 2D59A 1LCIA 3JPWA 1G8KA 3M7IA 1XD9A 1G59A 3DH0A 3ESAA 4YRKA 2ZCJA 1TT7A 4NABA 2RSLA 3KQSA 4G36A 4PLTA 3G1WA 1NN3A 1X0XA 3ZHRA 3EXEA 1CF2O 5EJ8A 2IVZA 5JO0A 4LFAB 3NP7A 2GEBA 4HVAA 1CY1A 2K2WA 1XC7A 2YYSA 3BGVA 3FPFA 3GRFA 3IV7A 3N7AA 4FN5A 4LSZA 1UOPA 4DMKA 4EWLA 3AFGA 3FWYA 4FMDF 3TCNA 1RRKA 1PL6A 3VNQA 1QYRA 4GKAA 4Z9FA 4MW6A 4ZA2A 1VTKA 3LE8A 1DAKA 1ODLA 1P1JA 3X1XA 3MIIA 1P6QA 2I9PA 4LHXA 2OQIA 1JKJB 1V2HE 2WSSA 3BKXA 2RG7A 2WSIA 4GXNA 4WLNA 4QM6A 4MKRA 5D5PA 4UE3S 5H81A 2QM7A 4B2IA 1X15A 2VAMA 3C8UA 4KXLA 3VPSA 4Q4LA 3TQIA 3KYCA 1OLOA 5IFKA 4B85A 2PVCA 5LDHA 1W34A 1L3IA 3NEAA 3HA2A 1E58A 1E0DA 4MK4A 2CMDA 3VBCA 1JDBC 1PQPA 1MB3A 1WB5A 2HA7A 1O97C 3NQ41 5T5QA 4JBXA 1PV4A 1HSZA 3VDMA 1KNQA 2W4MA 3OOEA 2IDKA 1EGAA 2R7AA 4HN4B 3WLQA 3VSEA 1TE2A 2QUHA 1G17A 1AY0A 1WF3A 2X22A 1GA6A 3IHLA 3OQBA 4RKRA 4WKNA 5FTNA 2AYZA 2B8NA 1BX3A 1REQA 2CJPA 3C2QA 1SBNE 3AETA 4Q21A 1IOWA 4RCZA 3T61A 3I2IA 3ES9A 1USWA 1J8YF 4TWIA 4R3WA 5IDXA 1O95C 2VNAA 4H4CA 2XYVA 4KODA 3V4FA 2J6HA 1WE2A 1Y37A 2E4YA 3DVQX 1QBGA 4BJHB 2PJRA 1T4GA 2V74B 3R3WA 3SE7A 1RVDA 2IA5A 4HK4A 1RKBA 1ECFA 1CQWA 1ZNXA 2O7SA 3D2BA 1KJNA 5LJIA 2HUPA 3KEQA 2X1HA 3COWA 2VPQA 5FCDA 1GLNA 2HLPA 4ZOLF 3UA4A 5C8DA 1Q0RA 2GETA 5J4VA 3ZZMA 3R7FA 1IWBB 2V7PA 3O75A 1B8PA 2GS9A 1A2QA 3USES 2O8DA 3ZWMA 4H15A 4WZBB 1QPGA 1LTQA 3ZXSA 3Q6NA 4Q93A 4F5ZA 5B2EA 1D1TA 2R68A 3O82A 4FYPA 3L6DA 1BHQ1 1O89A 4GZ5A 2IGBA 3AHJA 4MQ6A 1RQ2A 3PUIA 3RUIA 1QIGA 2CW5A 2ZE7A 2PX3A 5ALFA 4A91A 4RZ2A 4BGEA 2BYTA 4RE6A 2PN1A 2M32A 1CR1A 4KEAA 3AB7A 2ODAA 2P0AA 3SYNA 1NW4A 4R7GA 3AR3A 3G8AA 3I04A 4OQPA 3T1HB 5FJJA 2NSJA 4UQPA 3WGMA 2OBMA 4JT4A 3IHTA 3DEAA 4HH0A 1EESA 2AC2A 4L73A 4BNMA 3WJAA 5B1YA 2WVAA 5DULA 2IHVA 4JJAA 1DXOA 1QTNA 5TGZA 2ZUCA 3JARB 4NYMQ 3UENA 5JSHA 3JALA 5HZHA 4A6PA 1WHSB 1QK4A 2A67A 2DJ5A 1X8KA 4FC7A 4ERNA 3TLGA 4DV6B 1MZPA 1M5UA 2ZKIA 4YCDA 4FGWA 1BMQA 4JLNA 5I7RA 4KR6A 2DP4E 1S1CA 2HLDA 4N7BA 5FORA 2B8JA 4DKXA 5LIPA 3T1TA 1B8VA 2H1IA 2K87A 1H65A 4Q3CA 1Z4NA 1ZGZA 1QCZA 2AOUA 4I08A 2JI8A 2CE2X 1XDSA 3QNMA 1GNQA 5EVCA 4KTTE 1RM5A 5WRFA 3AVOA 3I53A 5CB4F 3L92A 3SBDA 4N47A 1KO1A 4JC8A 2C5EA 3A10A 2C5HA 1R66A 3PV0A 3ZBUA 3E1SA 2NXNA 4J90A 4PANA 1F51E 2XUFA 4P92A 1PNVA 1GQOA 2XMGA 3I2YX 5CJJA 1CZNA 3IIKA 2PD6A 4M1WA 4J0FA 4YNBA 5B6JA 3LYHA 1B6GA 3KNZA 3FNQA 4GOJA 3EQZA 5AVTA 4KRFA 1WMDA 2KBFA 1NXVA 1WRBA 3U7FB 3O8BA 4PSUA 2VT3A 3DE2X 3K72B 3BAFA 4HTFA 4I50F 4NZYA 1KU0A 1T15A 4RY0A 3UOGA 4CF3A 3D31A 3SVZA 4D9CA 3HGTA 3F9CA 1B2LA 4QUIA 1Z6ZA 4F1WA 2HCBA 4U7GA 1JHZA 1JQKA 3JTEA 1GL6A 1LVUA 4LXGA 1OLUB 3HGMA 1SCUB 4H18A 2AV6A 1I3CA 3DT6A 4O4HB 4ZOAA 4TS3A 3KPJA 3U81A 4PIVA 3UATA 3VKVA 1OXBB 3FFTA 1ODTC 2EDAA 5FL3A 3UMYA 5AM3A 4ND1A 1ZJ4A 4BKQA 5GJCA 4A8JB 4CF5A 3A3YA 1L4KA 3UJCA 1OHHA 1Z17A 2B8WA 2GN1A 3EUEA 3P0HA 3EZLA 1HDEA 1L3BA 5BWMA 1NUPA 3EHDA 4RBNA 2IOHA 3EIXA 4I19A 3B9PA 4HDSA 4Z53A 2QX7A 1A97A 3H1AA 4RSGA 3S99A 4HQOA 4DL9A 1XRQA 4BBPA 5JS1A 4EQZA 3QK7A 4AZ0B 2IZ6A 3HCBA 3MUNA 5TMEA 3RRFA 1CSEE 1UKAA 1U6JA 5JS6A 3ZQUA 4MDHA 1G8MA 121PA 1XFDA 2AX4A 2NTVA 2WIJA 3HUTA 3OJWA 3DQZA 4U8HA 4ZREA 5F23A 1NAHA 1YCHA 1MX1A 3P2KA 4G8JA 4HZUA 4OHRA 4PX3A 4LWZA 4CMIB 1CIPA 1DTEA 3C5CA 3ZVKA 1DQZA 2VDPB 1KFJB 2OV8A 4RM2A 2JGRA 1MR3F 4Y8VA 3DBLB 2NZUG 3R20A 1N8TA 3LC7O 3HVIA 4L4ZA 5BYAA 3AZOA 4G01B 3HJUA 1F5SA 1ZCFA 1XEXB 2WM9B 3PR2B 3SZGA 4BQOA 3EEFA 1ZK2A 2ACKA 2WZDA 3V7NA 4N41A 2NYUA 1JT9A 4K9RA 2ON6A 4IGFA 1MV5A 2H7VA 2ONYA 4EYOA 4JFRA 4R1TA 1BHSA 4LYHA 3ZQJA 4I5GA 1OPRA 4XI9A 1Y9ZA 4X1IB 5HOEA 1KP2A 1LC3A 1M6YA 3IQGX 3EFOA 2LRHA 4IHQA 4UU7A 1ODCA 1MEEA 4ZKEA 3WWEA 3ZZ1A 3GGGA 4BNVA 4GEGA 1E8MA 4BNWA 5IC6A 4YVFA 1C9YA 3DFZA 4S1TA 4BAZA 1KE2A 2PUFA 2ZUSA 4BVEA 3N2GB 3AJRA 3RREA 5C51B 1T36A 2Q5EA 4MW4A 3L6UA 4C4ZA 2FPKA 3Q0TA 4LY0A 5FAXA 1XJ0A 4YMHA 3OEEA 1E1CA 2RHBA 2BDUA 2PS3A 3WL5A 2EKPA 4L2IB 1CRQA 5CM8B 4FHCA 2DBZA 3GT4A 3N9IA 5JNSA 3GFBA 2OT3B 4FU0A 1XZCA 5T8KA 3WA6A 2J0UA 4M6WB 1UPXA 2KMLA 1D2RA 4JX8A 2ZT6A 4OI4A 3HKDA 4OXXA 4TMZA 5MHTA 2AN4A 1XMQB 1CUGA 4HXYA 4OXIA 1DBIA 4U2DA 1LTKA 4YUYA 3U44B 4MNTA 5CHYA 1FNBA 1H2EA 1TM4E 5ALRA 3B3GA 2NZYA 3G6KA 1YUBA 1ZM4A 2AXEA 2CDAA 3RJZA 1XTBA 3NT2A 4FVTA 5G1OA 3M3PA 1NM5C 1E2QA 1WG8A 2Y2VA 5K6TA 3SFVA 4N8DA 3T7TA 4YJ2A 1U5AA 2E5FA 2QRJA 4JI2B 1T5DX 3WL3A 3HWWA 5TARA 4JQZA 1LLUA 4R2XA 3UCFA 1MJNA 5B7GA 3AB3A 3QE2A 1UK9A 2GNOA 1A2OA 2CHGA 3VU0A 3FBGA 4A8JC 3AP3A 2BTQA 3SZOA 4RPIA 2YYYA 3CKYA 2OXFA 3ABOB 3G0DA 5DBGA 1N9GB 1YSCA 2XMDA 5DLYA 3FXAA 3ZU2A 2BR4A 4AWXA 3PCTA 1QIKA 1S89A 4J16A 5IUNC 4I1VA 2AC7A 3AEQA 3ONNA 4QYIA 1UDCA 1U2DA 1EK5A 2NG1A 3CLVA 3WKCA 2XWQA 1F2VA 4CM4A 4XIYA 4YV0A 3KQVA 5TB5A 2FTKE 2ZQ5A 4JSYA 5FOSA 2ZANA 2PUEA 3L05A 1C4WA 1IN4A 2YY5A 3NG1A 2DFKB 2NVWA 1OBCA 3MGGA 2B4RO 3H19A 5HCNA 2IPNA 3T94A 5AW5A 1SIOA 3IEVA 2GOYA 1KYIA 1H2AS 1Z6XA 2GN4A 4WLFA 3K1JA 1LB1B 1NQTA 1YDMA 2LTAA 1JR6A 4Q4JB 1NQVA 4X00A 1KMNA 5UKDA 3V48A 2M2IA 4AJEA 5KOJB 1N2IA 1CV2A 2SKEA 2PXCA 4KN9S 5FTWA 2ZTVA 4HADA 3LFTA 1QF7A 2R1ZA 3LZ6A 2QDXA 4KQJA 3QKSB 5KVQA 1XKXA 4URUR 5A6SB 5LBUA 4YRMA 1KBOA 3SD7A 3U4GA 3HDYA 1AUPA 1DG1G 3IEIA 3FTFA 3SP1A 4L6IA 1XLVA 4BN0A 3MG9A 3TD2A 3GJ3A 4EJMA 1YJAA 3NH9A 3OU6A 2QGFA 4EY7A 1YRLA 2XRYA 5BURA 1IZYA 3OIDA 4DPLA 1YZTA 1D1QA 4FLEA 1VHDA 1ZVMA 2HO5A 1S96A 1N7HA 1W581 1I3LA 2PAAA 3EQ2A 4UD2A 3G79A 3SYTA 3V7FA 4BTLA 1XZHA 4CEJA 1E2LA 3D5TA 5KREA 2QR5A 1MGPA 3PYLA 3UV3A 1EJBA 4HGQA 1JALA 4CMJA 2HJSA 1IBKB 3OIYA 4KFRA 4W1RA 2MYTA 4US1R 3RUAA 2V4UA 1IY0A 3RC7A 3DAYA 1L6RA 1PR5A 2JCXA 1CB7A 1EVQA 3E5NA 3I6MA 1TRHA 3P96A 3RYCA 4MV3A 4DG8A 1B3RA 3NV7A 3ICPA 4N0MA 4YHBA 1MC5A 2A0UA 1KARA 4R5MA 2FDCA 3CUSA 4BVJA 3NBZC 1G7SA 2R8PA 2XCUA 1QWSA 2HSDA 2OY0A 2ZYVX 3AONB 2XQKA 4RHTA 1SVOA 3OM0A 4WTOA 5LP6B 2J6CA 1XDGA 1W94A 2PGLA 3UFXA 5BSWA 2DUNA 4IZIA 2QTBA 3W6NA 1K7EB 5DCUA 3GEIA 3FUXA 2D1TA 4Q82A 1QRSA 5KYWA 4BMOB 2JKVA 3IEPA 1CUWA 2HXGA 2EQAA 1NTOA 1YS7A 3LQ2A 4GT1A 3KKLA 3UUFA 5BV2P 1NIPA 3ZE1B 3W0LB 5ALLA 4CI0B 2NLOA 3NRCA 2CDRA 2QG4A 2VXCA 3QWBA 1YR9A 2P9ZA 4X65B 2ZSUA 1J09A 3ESBA 3QX8A 4LC0A 4Y9UA 1EUZA 1D5CA 1TZCA 4MW2A 5HFJA 4B46A 5CVJA 4UOEA 1JLMA 1AF7A 2NZVG 3OD5A 4RK5A 5C35A 1R8XA 4CQNA 3K9QO 4E14A 3IP7A 3RRJA 1Y7IA 1IM8A 1CULC 1DG9A 1JWBB 2X0KA 3GLSA 1AVTA 2JRCA 3OCVA 5EIWA 3FWKA 4BKPA 1QH9A 4BPRA 1N2EA 1JLHA 3D2CA 2QRKA 4GW3A 4ME6A 3EVDA 3CCFA 4NMHA 1CIVA 1N92A 2VH1A 4RCYA 4YWHA 2ZS7A 1XDUA 3U9TA 4DANA 4KO3S 5CURA 5DRYA 2ES4A 1W48A 3QPCA 2Z2KA 2IV3A 3DAFA 1RRPA 4F5WA 1P7ZA 3IBTA 2R8ZA 4X24A 2PYIA 5DBEX 2J0VA 2OHIA 3TG8A 1P1BA 1SBCA 3VR6D 1USIA 4LE0A 2Q4RA 2HRCA 1EB8A 3MBIA 1ZIXA 3PI7A 4ZCQA 4DPKA 4NYJR 1IU9A 2V65A 4J0CA 4C7MA 2GWHA 2OO5C 5JS8A 1CR6A 2JGKA 2SHKA 4H7EA 4TYMA 5ICFA 4V03A 3BWMA 2RBKA 4MUBA 4M9CA 4XWOA 4DVGA 2GUWA 4IHKA 2R6GA 1EVLA 1ZX1A 2O5VA 2ZFUA 2ZAYA 2ZBPA 4OAOA 2Q6VA 1NVAA 2QRZA 4BNUA 1E2EA 4OBXA 3WR5A 2DQYA 1NJGA 2H52A 1DCMA 1II0A 3PNBA 3PRHA 3GRKA 3L8CA 3R0QA 2EKQA 4MV9A 3WK6A 3FIUA 1KFCB 2GM9A 4MVJF 3PFCA 4W82A 3VNAA 2EW1A 1T3GA 4U7DA 1AB5A 1NMZA 2MDTA 2RI0A 3LX8A 4GNKA 2JLWA 2IYPA 5IDVA 3RRMA 4Z5XA 1RKUA 1BVYF 3BL6A 1HORA 3DDUA 4G4SO 4WMLA 2H1FA 4MJ7A 2NO1A 2A94A 3DPIA 4L28A 1JBEA 4OXRA 3BB1A 5FYDA 3HQ4O 4EITA 4E5UA 1IONA 4Q3EA 3PZBA 4UUPA 1U9IC 4TXMA 3VZDA 4PX9A 3NFRA 1ST2A 3L7AA 1RWOA 1UL1X 2DETA 4OU5A 1Q15A 4CKCA 4N1AA 5TC4A 5JMWA 3RJ9A 1QNFA 1QHHB 4R16A 3TKAA 1QZ3A 2C31A 2EGGA 2OP1A 3LHIA 4ISCA 5GONA 5H3LA 1S02A 2QPOA 3Q8XB 3RVMA 1CDZA 4ZJPA 2UUBB 3TH5A 2RHHA 5DZSA 1JU4A 1XZIA 4MCHA 4LJRA 1G16A 4BP8A 2H4HA 2FZLA 2OB1A 3AIIA 1NE7A 1T9DA 4MYHA 2G9RA 4OJNA 3GGDA 5KYTA 3VR2D 1CR0A 3M4NA 4X92A 3EGOA 3EQ8A 3OQPA 1RYBA 4L4RA 4QDUA 3ZE2B 4BMNA 2C97A 5KZMB 1UMBB 1P6XA 3FZQA 1CUCA 3S1LA 4EJFA 1RXVA 1ETHA 3A1SA 3PUJA 1SCKA 2QN9A 3OT1A 1Y80A 6CHYA 1PIWA 1YZKA 2BD0A 2W00A 2RAVA 3G6WA 1YBFA 3IMFA 4QGFA 1DOAA 4RD0A 2C4MA 4L5CA 2Q50A 4TRNA 4YJHA 5DHRA 2O2YA 5L53A 4N4AA 3L46A 5HF8A 1QQ6A 2A0KA 2CHUA 3WDLA 3K70D 1T0HB 2VQFB 5JRDS 3T38A 3IAS6 2GF0A 1JG4A 4PIPA 3GHYA 4E33A 5AO9A 4OSEA 1EP3B 2HQRA 1WO8A 3L5OA 3L9XA 4NK4A 2DLCX 3CE6A 1MW9X 5YASA 3DQQA 1KZ9A 3CNLA 1ZAYA 2ASEA 3O91A 3AVVA 1ZXXA 2NPIA 3UV6A 4EEZA 2FPWA 4X0EA 4CHGA 1CXZA 4YJGB 2WSLA 3VNRA 1P3DA 3OQ1A 5AIAA 1W85B 3WQRA 4EAQA 5TT1A 2JHFA 3V55A 4OHMA 1IBMB 5BQFA 4BCDA 1QMPA 2ZB3A 4IH4A 3U7QB 4D9FA 3BJEA 4TZ6A 1CY4A 3ME5A 5KOJA 3ZBQA 4ENUA 1M3SA 2PT7A 4EBBA 4YLYA 3F3YA 4L07A 1MJGA 1J39A 2P30A 3F5QA 5LUAA 5IK2A 3COZA 2SICE 4M7PA 2BKUA 4DXAA 1VCIA 2AQIA 1EP2B 4YQZA 3QTBA 4V0KA 2PS9A 3EVZA 1K7FB 3DW3X 4ILKA 1L4FA 3KFLA 3PQ6A 4OQQA 5C8YF 1QDEA 2PR7A 4A26A 5C5DA 4BC1A 2FN8A 3FOEC 1ZW1A 1ZC3A 2BOVA 4W5HA 2L2QA 3AK4A 5HIJA 2HH9A 1A7UA 4ESEA 1UIRA 1GVNB 4RVOA 4PICA 3ZV3A 3FNBA 3N70A 4GL2A 1U63A 3QF4B 3A05A 2PLRA 3AEKA 1XWFA 3AF1A 1R27A 4KDCA 4QXOA 5SY4A 3LU1A 1BEZA 1RPZA 1IVSA 2VYFA 3UAYA 3GRVA 4C7KA 4FYYA 2VK8A 5FWXB 5K0BA 3UCXA 3L7OA 1F8XA 4G5FA 1Z82A 1TVMA 3L4SO 4OOFA 3UHAA 3U09A 3KHKA 3ZWDA 4F2DA 3IMEA 4JVOA 3BD6A 4U7JA 3OECA 1A9XA 1UJBA 4TT8A 1X86B 2BHSA 1H2XA 4Z8XA 3SSNA 2FX2A 3ERCA 2IQIA 4PPYA 4KYTA 2WVHA 2GGSA 1D4ZA 3A4NA 3ZX4A 3WYDA 3ZIUA 3H04A 2N9UA 2Q3LA 4MX8A 3ADPA 1F06A 3HXKA 1W19A 3PGKA 4ENPA 3TN7A 4DABA 1EKXA 4XYMA 5E8JA 1F3OA 1WF6A 3D6VA 2IIPA 3H9UA 2ZZMA 4G0VA 1X7DA 3A6DA 4C0HA 4DY4A 1V8ZA 3KLNA 2ZB2A 3O0TA 4UVGA 4DN6A 4YXFA 2HADA 5BYKA 3BCUA 5BRNA 1EM8A 3WWZA 4ZEVA 1LLCA 1WX1A 1V25A 2EEPA 3X0DA 3D4NA 5J2TA 4LOAA 3L1UA 4JASB 1R50A 3QVVA 1DELA 2HBQA 2HSWA 2WMOB 1NNI1 5EVJA 3S2IA 2V9CA 4RZUA 4AT1A 4B6GA 1U0BB 4IZ6A 4JVLA 4ML3A 2AXNA 4N54A 5CU7A 2YW9A 3UOWA 4GUDA 1C81A 4QX6A 1IEVA 4HG2A 4BV8A 3LQYA 2JBAA 1RDFA 2O2IA 3V1MA 5JZVA 2M6RA 3DB2A 3QUCA 4IHJB 4TWRA 3F4LA 2G07A 1SCDA 2K7ZA 4WKBA 4Z1OA 1XF1A 3NDIA 4RORA 5BPHA 3FMFA 1C9NA 3EG9B 3EQ9A 1JB1A 5JTUA 1KYYA 3D3WB 1CW2B 5AHWA 2C9BA 4A2QA 3FCCA 3T1QA 2QTZA 5A3JA 2ZZKA 3REQB 2FHPA 4S3MA 2PQ6A 1OSNA 1YQWA 2SCUA 2Q9BA 4NAHA 2UZ0A 4YN3A 1ZH6A 1JIQA 5IVIA 2OV2A 2V5UA 3HEMA 2Y1GA 3DJFA 1OBFO 3C3EA 4HXEB 2POQX 3DWIA 1ZNYA 3H3XA 4B87A 1FU7A 5DGCA 3GQBA 3DBOB 5AQ1A 4FMCF 1WEKA 4HLUA 1YB1A 2WSMA 4QO8A 2P5YA 2VHJA 4I2VA 4GHWA 1KEUA 2P69A 4H31A 7AT1A 1SC4A 3JQQA 3KYDA 2X7JA 3H1PA 2VBCA 2ODQA 1QGAA 2XKKA 5FQOA 1VCOA 1P1KA 3V5NA 3LHSA 5LZ5A 1EVKA 5EE5B 2AEMA 1XTRA 3VBEA 1JS1X 5KMGA 1DQSA 2DKOA 1JXOA 4Q7MB 4US0R 4BQPA 5GV7A 3SE0A 3DZ8A 1Z5VA 4NK5A 4WT7A 1H4SA 4BMZA 1O08A 4HHEA 4CZ2A 4YRAA 2Q4OA 3LZDA 4OHWA 2GN2A 3KPYA 1D2NA 1PJZA 4LY9A 4QFCA 3EXFB 3KDPA 1JR3A 1XRSB 4UM7A 4Z6KA 3NIWA 3FVTA 2JJ2D 4GF5A 5TPZD 2I1QA 3M0EA 1ODJA 5BR7A 3QLVC 5F4ZA 3DNFA 2JFGA 4WVFA 4IWNA 2X5KO 4D82A 1QOQB 1JSCA 5A62A 4HAOA 1T5HX 3PXXA 4RK6A 1Q2UA 2W93A 4LXQA 1VRWA 5HM8A 3OT1B 4DYVA 1IUOA 5BOSB 4A3SA 1QHEA 4JBLA 4QOSA 1MO4A 2IEGA 2F62A 4YJHB 4CU5A 4DIBA 1FXUA 3P0RA 2BFEA 2I6FA 1GPYA 2KLHA 3A8TA 3MOGA 4FB5A 1YL5A 4B3HA 3Q0EA 2WILA 3L8MA 3RTCA 2N3ZA 3F3MA 4BKOA 2FLWA 2I8LA 2QQEA 4TPKA 3WVNA 4ALJA 3UJNA 1QSGA 2FZWA 3VTFA 1FUIA 4M0CA 1PGNA 3EAQA 4AZSA 2IY7A 3I04M 4LQCA 1YGPA 5DSXA 2VTBB 3ANTA 5A4JA 3QUAA 3OZEA 1I36A 1YNOA 4MH0R 4P4LA 4AJ4A 4CLHA 3Q3VA 4HP8A 4L5YA 3RGGA 1U3GA 1LJ8A 1OFIA 2O3RA 3H1GA 3T7RA 5BVGB 2FJPA 4QBIA 4NOKA 3I0MA 2UYYA 5HUQA 2OB2A 1W0KA 2JJYA 3U7QA 2IKSA 3COYA 2R48A 4HWKA 3N2IA 1V4NA 5K3FB 2V0CA 3L1KA 2Z3WA 1MD9A 3HRHA 1JH8A 4EVRA 2NQ2C 2B37A 2QLTA 4TQAA 4UJ5A 1NHWA 3CVXA 3FTCA 1R4NA 2VAPA 3KJNA 4II7A 5F12A 1YTUA 2H3EA 4BAGA 4ETIA 1NC3A 3HJFA 1ZNQO 2OCKA 2Z98A 4R8SA 4UBLA 5AKEA 2H51A 1ENZA 2D5LA 4QPPA 3MPUA 3WC4A 3ZY2A 2VSYA 4PZZA 5JAIA 5J5CA 5ICMA 1R8YA 4H4EA 4CCWA 4DNFA 4DLLA 4QWWA 4D0GA 4DCCA 3C3CA 5JCOC 4MJXA 4AS3A 2DQSA 3G9XA 3OLVA 2BJVA 1ZBDA 5ES3A 3FPAA 1N33B 3V46A 2D1FA 1IMJA 1N5IA 3A37A 4KPUA 4Z99A 4CM5A 4QREA 5IAAA 4WJLA 3BCRA 1XGKA 1CP3A 5F35A 1EXDA 3ZDFA 4W7SA 5EQFA 1RWNA 3JVVA 1J6UA 1U02A 3OZGA 4FSHA 5FWXA 3R7AA 1JUDA 2HRZA 5K3CA 1A5TA 1UOEA 2PT9A 3E05A 3ZVLA 2OQRA 3UJBA 2R8OA 3LKVA 3WGKA 1N0IA 1Z0KA 4JLOA 5J63A 2DPXA 4V0RA 2IEZA 2CNDA 4C3OB 3MWDA 3TE7A 1HQCA 3O21A 4EZIA 5KTPA 2C1ZA 1U9YA 2D4HA 1LRJA 1TEHA 2C2KA 4YBRA 5ALUA 4DUPA 3KSZO 4Q19A 3AVQA 5JWHA 4FIZA 1RBYA 2YXBA 3LT0A 4K9OA 4C0KA 3LRXA 5D3MB 1VIAA 4Q0MA 1Y1TA 2VT6A 4QBFA 1JYSA 4BNYA 3SFZA 3PPXA 4HDAA 4URZR 5TQ2B 1E2KA 4EX7A 4KN8A 1TX4B 1JLLA 2EX0A 1IHXA 1MC4A 3O9VA 4MA0A 3W8FA 2RK4A 2PZGA 2XT6A 2I2XB 3FVWA 4GVPA 2OWEA 1Q3HA 3ELDA 3PDIB 4IWYA 1EM8B 4MW0A 4P4NA 4R9VA 3VKGA 1PZNA 3DYVA 4NQZA 3EC7A 2Q3CA 2JI6A 2Y4NA 3CF4G 1VECA 2Z1MA 3KAQA 1FTYA 3PWSA 2EW8A 4OUDB 4P3YA 5TF0A 3I2JA 2ADFA 2WWTA 3O03A 2R4TA 3KC2A 4WA7A 4COOA 4LJ5A 1T3LA 3OZIA 4X90A 3A9TA 1NX9A 3EWNA 3IUSA 4JCCA 4WOJA 1TT5A 1XCOA 2AVDA 4MYSA 1SUDA 2NGRA 1I51A 3LZCA 1TEZA 4IRXA 5KJ1A 3UW3A 1E2BA 4HAWA 5HX7A 3A1DA 2HUNA 2BHNA 3TLYA 3LX5A 1WSWA 4GRAA 4MA5A 4X97A 3TCXB 3IB6A 2P2ZA 4IOJA 3W6UA 2PQ0A 4GQIA 3CW8X 3LDUA 3D3WA 3FMOB 3MA0A 1TYDE 4WZ6A 1HDRA 1C1HA 1WZCA 2C3MA 3IALA 1SUEA 3U39A 4ZYTA 4Z4EA 1SIBE 1TKCA 1ML4A 3T3PB 4XRGA 1GCGA 4LDJA 1AN0A 4D8XA 3H2SA 2PV0A 1NV8A 3IMCA 1GUFA 3K9FC 4UHHA 1LBHA 3U3ZA 4C0LA 1FDOA 4F3YA 1OF1A 4OTZA 2CDCA 3QV1A 4DS3A 4ZGWA 1PKEA 1W2HA 1CYDA 3F2IA 3HJAA 4LYEA 1QU3A 3CCBA 3PQ2A 3WIOA 1FVOA 4JVNA 5IXJA 1F7UA 3X1YA 3B8HA 5AJZA 1NZJA 3R6GA 1DOHA 5E6RB 3HXLA 3JRXA 5EHXA 3CIFA 3QVXA 4INAA 2O6LA 3IQIX 4PC2A 1AX9A 5B2FA 3L18A 3LC2O 4R0VA 5AWFC 2VHWA 3KUXA 2ZSIA 3LW8A 4C5CA 2J7PD 4EYGA 1XNRB 2OE2A 1R8SA 3OE5A 3PENA 3X1MA 1JJBA 2PUDA 2B4TO 4OP2A 1I10A 3IEMA 4KMMA 3O73A 1DQPA 3T0FA 4ZEMA 3U4CA 1Q50A 1XPOA 2R62A 3KYDB 5JD4A 1DRVA 4UU1A 3FE2A 4C2UA 1TNDA 4QATA 4XSHA 4C2TA 1G5QA 1UZLA 4JT2A 3BGDA 2VKTA 1GXSB 4BLSA 3SEFA 4QGSA 4KQIA 3P2JA 2YWEA 3PTLA 2X0EA 4JOQA 5ITZB 2OHVA 8OHMA 3UAVA 3TPCA 4QPDA 2LIPA 5HZKA 1SCAA 4CLOA 1IYZA 2UZIR 2PT5A 3EXFA 2IYWA 2G4CA 3M8KA 4FUTA 4X41A 3UGQA 4B4VA 5C53B 3VVCA 4FFBB 2PZBA 2H48A 4O4LF 2DTEA 4Y6LA 1E4EA 5IVPA 3BS4A 3SYLA 3U6BA 4B33A 2D3TA 5IN5A 2AZMA 2FSVA 2YW2A 2FWRA 4XB6B 1XDBA 1RKVA 3F5SA 3VO8A 1YVUA 4GZMA 1XRRA 1HI9A 2GDZA 1CEXA 1QH8A 3D4IA 4C1BA 1YAJA 5B3AA 1TD1A 3MAJA 4RPKA 3VHRA 1RM0A 1N3IA 4J94A 1NUHA 4K88A 2R6FA 5GJBA 5HRAA 1QV6A 4YR9A 4H08A 1C0EA 3R3VA 1MQ9A 3AF6A 3A28A 4ITVA 5F51A 1CJTC 1K9VF 1X1AA 4ND4A 4FB4A 9LDBA 3ICQB 1FFHA 2DHEA 4GVXA 1A96A 4X1YA 4A2PA 4CQJA 5FI3A 2ZRHA 3D7KA 1QHYA 1A8UA 1ZD5A 2G17A 3I6ZA 2P8JA 2PXHA 2CNLA 5BRJA 1ABBA 1JU3A 4IAOA 1F38A 1E5TA 4X1KB 1B15A 2P9TA 3UV7A 5AW1A 3GQVA 3PWTA 3L4JA 2JKYA 3GT0A 1RLIA 1YHYA 1ESZA 2OBLA 2BZ1A 1X1CA 2XA9A 4X8LA 2X0FA 1T9ZA 1A9XB 2VUTA 3HN6A 4CHTA 1TYEB 1BG6A 1WXEA 4FBMA 4JUIA 1DKLA 5DHFA 4FYKA 4PZ0A 4M98A 1YR1A 1SWWA 3VR4H 1LQTA 5C2JB 2H1LA 4CL0A 1L5SA 1UP7A 2JARA 2QXUA 2V5VA 2XBLA 1XRMA 5SZKB 4A8JA 1Q16A 4I4IA 2B20A 5K3FA 2R4UA 3EVAA 3HWX1 5BSUA 3UM9A 4IVNA 3NR2A 2G7MC 4A6EA 2C7RA 1K2WA 2AL7A 3HFGA 2I7DA 3E8XA 1RQLA 1IZ8A 2NPOA 1J2YA 3C3AA 3CUEF 3EVCA 3JQAD 1NYRA 3MPOA 3ISJA 3G8BA 3MWLA 3R23A 2P75A 4J9UE 3RHZA 3RVQA 5CDGA 4Y1GA 3GCZA 2XAAA 3I1YA 2X4GA 4Q02A 3M1YA 1SWVA 2CJWA 3EVGA 1VXRA 2CXQA 3F71A 1UR5A 4QXAA 4RENA 4RGBA 1QC5B 3VR6H 4AMVA 3AKDA 1Q1ZA 3FF4A 1ZA2A 3WLTA 2FZGA 3QYFA 5KWVA 3TYXA 4OLAA 2PUAA 3QY0A 1YBAA 4CTMA 1T35A 4Y18A 1TAHA 4WXHA 1EJ2A 3DQPA 1FTGA 2PEYA 2V6FA 5TEWA 2VJMB 5JWOA 3CZAA 2FP4A 3KAPA 4IKOA 5G40A 1U7OA 5LZ4A 3P9RA 3UO8B 1R6UA 1FUUA 5AVWA 1UJ4A 2BCGY 3NEJA 4RYDA 1UDXA 5AVSA 1PEKE 2QI9C 2D5CA 4OHBA 3AB8A 1H8ED 4GX2A 3QRWA 1I24A 1QRDA 2CYAA 1YA6A 2BDTA 1DUIA 3W79A 3QVUA 3OTGA 4PG4A 5FUWA 1N7IA 1ZCBA 3W5CA 2LR0A 3FTQA 1QHNA 1X8JA 1MEJA 2LZ0A 2O23A 4A03A 4DA4A 3PFHA 4G8CA 5EWJA 3K5PA 3EFOB 5GV8A 1XJWA 2VJYA 3Q41A 2Y1CA 3AEZA 4M8NE 1HEYA 5IM4A 5BT8A 1NUUA 3DG9A 5EJGA 4L9AA 2R7LA 2GFQA 3FCEA 4N49A 4ZVQA 3TW4A 4BAUA 4C7VA 2FW9A 1XHLA 2DPHA 4QPZA 3TDNA 1G6Q1 3B2QA 4J91A 5IPFA 2MU1A 1E3EA 2YMLA 3CZQA 1KDOA 4GMHA 4IJKA 1NUQA 4EG3A 3LK6A 4HWSA 3RV4A 4CLRA 1CZOA 1XZNA 4WCVA 1PG0A 3PDIA 3TNFA 1S2LA 3GMSA 1QAQA 3KOUA 2ZYWX 1TQ8A 2P7HA 5GZ3A 3ZDBA 4L2IA 4JLWA 2WMNB 2C0PA 1NUAA 2NUPA 5TX7A 1NY5A 1ES9A 2A3RA 2EX1A 1ZJ6A 2OOSA 4TMWA 1Q0TA 1P2UA 1SU6A 3OM9A 1SBTA 2YQZA 4QVIA 2HYIC 4WY5A 4AWAA 5CGQB 1YL6A 1DX6A 1L7DA 3AHDA 4OK5A 3S28A 1E1DA 2EWVA 2D0PB 3ZLVA 1KEZA 2P41A 3C3XA 4DZTA 5AW2A 621PA 4UM8B 1AMUA 1NRXA 1K0FA 1QE5A 1URPA 2P6MA 3GZTB 4GMDA 3KE8A 5FTMA 2CLKB 3NV9A 4BLQA 1RXWA 1ZMOA 1N32B 1W87A 2GERA 2DY0A 3UA3A 3GZJA 1UOQA 1Y6JA 1M1XB 2OA0A 2EOAA 2ZAOA 2BLLA 3I5MA 3OWXA 1II8A 3DHYA 1D7AA 5TEVA 3VVBA 1R0LA 4P3OA 3IESA 2J3HA 1JIVA 4MZXA 4RK1A 4BO0A 3KQTA 1OE0A 2EJVA 1QP0A 3IVRA 1KH3A 2Y2UA 3HV2A 1UBEA 4FGKA 1JEDA 4HQ6A 4LXXA 3VU9B 1J5EB 1PJBA 2GXUA 3MLAA 1Z2EA 1EAMA 2CLLB 4M0KA 1NTRA 4PX5A 4QA9A 4J4TA 1NW5A 4HAZA 2C2BA 1H93A 3DPSA 3H5NA 4UHEA 3X1KA 1ZSYA 4QDJA 1AZWA 2RMKA 5IS2A 3PZRA 1DRJA 3AVYA 1FP2A 3FCAA 1RRVA 2Y92A 1KMIY 2C1XA 2DH6A 3VISA 4ZCMA 1DINA 1UBSB 4A7PA 4DDUA 1Q1AA 2REBA 1AXEA 3LUHA 2C4NA 1FSGA 1USGA 2HC9A 1A1SA 4XJVA 4JXXA 1WLYA 1FFWA 1B26A 1A04A 1SA0A 3EVFA 4KLAA 4D8YA 3TFWA 5A5DA 2ZSEA 5HQTA 2G9ZA 1W59A 1LSUA 1KTVA 1TIPA 3D02A 5BWBA 1MXFA 3QFRA 5D1NA 1Q84A 1IHDA 3OF3A 1HM5A 4YMLA 1G20B 2C7PA 3NHLA 3ZK8A 4BX8A 5CM9C 4QYSA 4WNIA 4U2FA 4HZIA 4MQ4A 4LRUA 3H87A 3R5HA 2OAQ1 5K2OA 4ZU6X 3FI0A 3NAGA 3RIYA 1R5JA 3DA8A 3AINA 4KNVA 4BYGA 1CRLA 4IDAA 2YMQA 3BE5A 1YDFA 2X3UA 1UPCA 2EL7A 3FUTA 5AHRA 4R41A 4I14A 3LXRA 3BGSA 4LBVA 3S70A 5B5SA 2VSFA 2ZQYA 4PPGA 1U8FO 2RHJA 4UAVA 2ZI6A 3I05A 4H7JA 3MAAC 3PPIA 5FTKA 1KSFX 1G20E 2Q1UA 4R84A 3AQIA 1H0RA 3HJTA 1MTOA 1W46A 2H92A 4E46A 1XT6A 4J1TA 2NV2B 1KYZA 1KMHA 4DIKA 3EODA 4AJ2A 2F43B 3V8VA 3I64A 2J46A 5K6AC 4Y9RA 5M3BA 5TV2A 3UKJA 2X2EA 4TLEA 1DS6A 2RGNA 5AK0A 4JK3A 5KO2A 3ESXA 3BPSA 1N2XA 3HY6A 3MS2A 4PSDA 2I2AA 3ABRB 5AJXA 1R7RA 3L3BA 4JR0A 4TMVA 4U3JA 2OV1A 4XQ0A 3W4KA 5AFSA 2CFRA 3C0KA 1LJLA 3N3AC 5DNAA 5KTYA 1IZ9A 2FSGA 5TDHA 3IBYA 1COWD 1E3SA 1R15A 1U4SA 3BB3A 4KX5A 5CW2A 3VAAA 3U61B 5KTOA 4NCNA 1C7QA 1S9DA 2YXDA 1OTYA 2EKLA 3AW8A 4RJJA 3COSA 3NHMA 4NBNA 2G63A 3SHVA 1W4BA 4JLMA 2XVXA 3DO6A 4MCJA 1Y3BE 2ZBVA 3A11A 3PGA1 3ZBTA 1L5FA 1W4CA 1I1OA 4KDFA 4UPDA 3FTEA 4X93A 1H69A 2ID7A 3WAKA 1OIVA 5A5GA 3AL3A 3QEAZ 1RU3A 1ZH0A 1LRLA 2YRWA 1JDZA 2QVXX 2R7MA 2YN0A 3DE0X 2VAVA 5JJBA 1YK0A 4JJ8A 3OCXA 3AUTA 4ZOBA 3WRXA 1ITZA 3RVJA 1I2ZA 3ENNA 2VDQB 2XYGA 2M1ZA 4EL5A 1Y6RA 3O47A 2QQ5A 3CRRA 1QHSA 1YZVA 3LUFA 3NHFA 1FP4B 1SVSA 1UK7A 3CF0A 5A2QA 2XA1A 2GR9A 1ATZA 1JTEA 2NMVA 4YMVA 2EHDA 1M2FA 4KE6A 1QRAA 2FRVA 5CVCA 5JG7A 2H2WA 2QXYA 2W4QA 3DCIA 2IYLD 3HL4A 4ODIA 3I9V1 4TUYF 3OY7A 4U7TB 4ZQGA 4DZZA 1V9LA 3WRYA 3ROTA 4EA8A 3OJLA 4XWKA 4D4JA 1T4DA 4O2BF 4DIEA 5AM0A 4ZQBA 2W58A 5EWJB 3QSGA 2JA2A 1GQYA 1GD1O 3VX4A 4ZZ0A 2I55A 4TROA 4UTOA 5LQSA 4BNXA 4JLAA 2IBTA 1UBFA 4PHFA 3QMMA 2KSQA 3W5JA 4S0ZA 3N8DA 3B1XA 1IXZA 4F2HA 2ZZNA 4QZVA 2QUBA 1YI8A 1O3YA 3ANNA 3M5DA 5IKOA 4TV8B 4OJQA 3ZGZA 3CJQA 2WWXA 5K1ZA 4LECA 4DEVA 3N07A 5EJ6A 5DE3A 3AX6A 3PRYA 4FDVA 3FR7A 3GLQA 4CLRB 1GQRA 1Y5LA 4G0OA 1Z5ZA 2GK3A 5EHGA 3SVLA 1HX7A 2QI9F 5LB2A 4Z0HO 5K6RA 4R7TA 3FYTA 4KRXA 5I3CA 5TLSA 1DTSA 4X9XA 1UM8A 2Q6TA 1KYTA 1XTKA 5JZBA 1PR2A 4Y6QA 8MHTA 3D8HA 1G8JA 5AI5A 3L7BA 1ZDMA 2PGIA 2CUTA 2VHUA 3ENKA 4V1CI 2O0KA 1KYWA 1GYPA 3I5UA 3QMVA 1SG9A 3LWBA 4G84A 4UBNA 2ZJ8A 3VDXA 4I46A 3TR6A 5DI9A 3PGLA 1V6SA 2GN6A 3QXSA 3HVKA 3LWDA 4CKEA 1YULA 3V33A 4URVR 4Y9DA 3RU3A 1INLA 4OB7A 1HQDA 1XI2A 5HTOA 4CT4B 3LXMA 1Q57A 3E82A 5DGIA 4QJ4A 2NUTB 2C5LA 5IJXA 5DNUA 1SB8A 2Q0QA 3HFJA 3QKWA 3VPXA 4OKIA 1VI5A 2J41A 3CO0S 3G88A 3ZWVA 5DBHX 4KPGA 1Y7PA 4YMGA 4M0DA 3KETA 1L8OA 4MLCA 4XGNA 3QV2A 3BDAA 1D2MA 3KLPX 3ABZA 3SJ7A 1U0HC 3DDOA 3KSDO 4L8FA 4DIDA 5FLYA 1KDZA 2A5JA 2QTLA 5BSVA 2Z3ZA 1GKIA 2HWWA 4BMVA 3N58A 3TGLA 5IH7A 4HQFA 1U0TA 4KPYA 1US8B 2NADA 4PBSA 1PL7A 2OZVA 1BIFA 4HQNA 2WAOA 1KFKB 4UOQA 1NLUA 1TAQA 1UFVA 4G0XA 4X7MA 5I7EA 4DQUA 5AQEA 2AJLI 4M88A 1DO8A 5CT8A 4B6JA 2EZ4A 3OHMA 5B1EA 4JP3A 4UZSA 2IHUA 5CIYA 1SCQA 4ASUD 2ODWA 1SG0A 5FULA 1DOZA 3EK2A 2ONKA 1IJKA 3L8HA 1E0JA 2PMWB 2FKNA 3KQMA 1G20A 3RWOA 3T52A 5IBRA 1KOFA 1G4AE 4ZYWA 1TL7C 1EIZA 3KLOA 4MYTA 3HCDA 3OIWA 4EMTA 2QBYB 3QU5A 5I7HA 3RUCA 1ADBA 2P9HA 1JJVA 1EQUA 1TK3A 2W2QA 5A3SA 1SOUA 1SD5A 1ZOPA 4RADA 2NTYC 4PQFA 3LTEA 3LV8A 2Z6QA 1YS4A 2NP7A 4M22A 2QGZA 2HF2A 1HKHA 1A50B 3MCWA 4PAWA 4C9BA 2YH2A 4OSOA 5FA5A 3WBBA 1SD1A 1X7HA 1XJCA 4R68A 5JZOA 1B0PA 3PLAE 1GQQA 1QQ5A 1RXCA 1EG7A 1VI2A 2OTCA 4LC1A 1W52X 4QICA 5FH9A 2QVBA 5IAGA 5K9ZA 4RS4A 1BHO1 1M34B 2ZIUB 2PNJA 1Z07A 2ORWA 2C9DA 1X1EA 2N1BA 1X38A 2WWFA 4WIAA 4GOMD 4B4UA 5F5NA 1UT6A 4AYWA 3OZDA 1XBTA 5D01A 3SZLA 3PEUA 2FLVA 2WTEA 2ZSAA 3Q6MA 4G41A 5DBFA 3QVWA 4G5YA 5T7BA 1E96A 2RH9B 1U7ZA 1B23P 5FP0A 2ID4A 2I3AA 5DM4A 2VDUE 3IKVA 3KIPA 4QT0A 4WPGA 3OOHA 1QVZA 3BMCA 3HYNA 4G65A 4ISBA 4ZN6A 5A6VA 1P7YA 3NP9A 4P35A 2BJWA 1HR0B 2H08A 3DPUA 2QJTA 2VN8A 5I9NA 3IQFA 2JHPA 2LBPA 2G9QA 4V38A 3HJGA 2D8AA 2CZCA 2ZVPX 3AUAA 3DE3X 4XOIA 4YJ3B 4CGYA 1SK8A 1NXPA 1ULHA 3IUJA 3G2PA 3DC7A 2Y27A 4CV3A 5KTSA 1T34A 2QD2A 2B2XA 4UNRA 4TQ9A 3VHXA 3I8OA 4P54A 4CEHA 5LXTA 4EDHA 3N7UA 1M1YE 5FUYA 4BNGA 1NXXA 2ST1A 4QU0A 3Q40A 1MJ5A 2H7CA 2PNFA 2VRWA 1DQRA 1RKXA 5CDFA 2C4TA 2HHAA 2F59A 5GONF 1WBBA 2AKYA 2GAJA 2PMBA 1BHJA 1YVRA 1Z25A 3A04A 3BMQB 4JBHA 2D4AA 3TIIA 4D0NA 1EHYA 1YU9A 4B7AA 2NP6A 2XZPA 4Q7JB 4NAVA 3W4JA 4A4DA 4RSHA 2RGDA 3JU3A 5EPUA 4N48A 5I51A 3CW9A 2FR0A 4UDYX 5FF9A 5LZ2A 1D6MA 1Y1LA 4OIFA 2N1MA 1A77A 1SOMA 2A8YA 4NCHA 5EL0A 1AMOA 1YQEA 2F55A 4NCJA 4QQNA 5ISMA 3M6MD 1V1RB 1CUYA 1N2CE 3VYTB 1BRTA 5JXGA 1E6KA 4BWYA 5DN6A 1JEJA 2IS1A 4HBGA 2JGJA 1C9DB 2CL5A 5CLQA 3EOAI 3IMKA 1T1IA 5HEKA 1N7JA 1POXA 3MSXA 5DHTA 1CS4C 3PF8A 1E0AA 4Q00A 3SQLA 2QYTA 5JAPA 5IFLA 2ZIGA 2ZBGA 3C7TA 4W8GA 3X1DA 2VPZA