2H7XA

Pikromycin thioesterase adduct with reduced triketide affinity label
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
284
structure length
279
Chain Sequence
b'AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I polyketide synthase PikAIV
publication title Structural and Mechanistic Insights of Polyketide Macrolactonization from Polyketide-based Affinity Labels
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h7xA00
1OILA 5ALIA 1YAHA 2WG0A 5DNUA 2D0DA 1BN6A 3FVRA 3WZMA 1LGYA 2QUAA 5AM2A 3O4HA 3PUHA 5K3BA 3R3XA 4CG1A 2G4LA 5AKKA 3DL4A 4P92A 1VE7A 1THGA 4KYVA 3CXUA 2HM7A 5CXXA 1CVLA 1H2XA 3G9XA 1CPYA 1EK1A 3O0DA 1LPNA 1ZD4A 4FKBA 1IZ7A 5AI9A 2HA4A 5F4ZA 1MO2A 1DINA 1XFDA 2QOEA 4CG3A 2JGLA 1AMNA 2RGUA 1MX9A 4INZA 2HL6A 4GECA 4WDRA 3WWPA 5LKRA 2CMFA 5ALDA 5E4JA 2GBFA 5JATA 3HABA 5FKJA 1RP1A 4QA9A 1XRLA 1CLEA 4MQMA 2VSQA 3UUEA 5KBYA 5HCUA 2DQZA 3YASA 3AIMA 3ANTA 2OQVA 5K3CA 2HADA 3OURA 4N8EA 4B82A 3WIOA 5CW2A 1ORWA 3C6YA 3WL8A 1T4MA 4FBLA 4BBZA 5AOBA 3I2FA 1ZD5A 3C43A 2OAGA 1SC9A 1XRNA 5ALQA 4FLMA 1VLQA 5CT6A 3CN9A 3RK4A 5DTJA 2WG1A 1UWCA 5CT4A 4U2CA 1X2BA 4C6HA 1JU4A 4XJVA 1JFRA 2I78A 3WWDA 1VKHA 4UBKA 2C4HA 3DDUA 1HLGA 1QONA 4QDOA 3D59A 5BWCA 2HA0A 5EHXA 4B81A 1XLVA 4X95A 2B4KA 4EBBA 4EUSA 1CUAA 2WHPB 5I9IA 4O08A 3QYJA 4WFIA 2HA6A 2WHRA 2QT9A 1UK6A 3GELA 5BWBA 1Y7IA 3G9UA 1R9NA 3R0VA 3FYUA 2HA5A 2VJDA 4XWGA 3ED1A 1EINA 4ZRDA 2H7YA 3FWHA 2CBGA 4IH9A 3SWWA 3T52A 5KWIA 3LIPA 3QVMA 3V1LA 2BGNA 4A5SA 1DTEA 3D4LA 4YASA 3H19A 2C0PA 4HAIA 4QDXA 2XUHA 5IVHA 2XMSA 2DR0A 2B20A 2PSEA 4KRXA 3FAKA 4W1PA 3EQ8A 2VJCA 1MNQA 1EK2A 1Q0RA 5JAPA 2HA7A 1ZICA 4UFOA 4PW0A 4HVTA 3D2BA 4J0IA 4Y2PA 2JEZA 4WCVA 5JZ9A 1XZEA 4G9GA 4EY4A 4WDQA 5EIHA 1QFMA 1GPKA 3L1JA 3IULA 3AFIA 3IDAA 5CT8A 4ITVA 1UZAA 3B3QA 3DCNA 3I2JA 4N8DA 5IKXA 1R3DA 1QGED 1YSCA 2PUJA 4BP9A 1EDDA 1QIMA 1FFBA 4GW3A 5HFAA 3DJYA 4LIPD 4ZREA 4G8DA 1CUGA 5BOVA 3FOBA 1EVQA 1J2EA 3STVA 4FFWA 5EHQA 4G1FA 1N5MA 1P0QA 1CFJA 2J3DA 1QTIA 1AX9A 4FOLA 4JEIA 2YYSA 1UK9A 5AOAA 4KACA 3HJUA 2VJBA 1H2YA 4K6GA 2I3DA 1VJ5A 4BVKA 2VJAA 1MAHA 3FCYA 4PF1A 1LPBB 4B6GA 3HSSA 1BCSA 2LIPA 4B9AA 2QTBA 1AURA 3IUMA 5ALVA 4FDMA 4QZVA 1HDEA 3PDCA 1RYYA 2XMDA 4DMCA 5HQ3A 1PJAA 3GROA 4J0KA 1YCDA 1WPRA 1IUPA 5AKJA 1ZIXA 4QE3A 1ISPA 5ALOA 1LZKA 4Y2SA 1WHSA 3BE8A 4Q82A 5ALYA 1GXSA 3R3YA 1D07A 4UBNA 4OB8A 1CQWA 3BWXA 4G4JA 4UHCA 5C7YA 1F6WA 5JD4A 2PSJA 5E4TA 3H2IA 2DHCA 2VAXA 3M83A 4X93A 1THTA 3VDXA 1K63A 1E8DA 2RHTA 4E14A 2QMQA 1ORVA 4GHWA 1LPSA 1DQZA 5AHXA 1ODSA 3KWJA 5ALWA 3BDVA 4HRYA 3PF8A 5K3DA 4AZ3A 3ILSA 1XZCA 3PE6A 1VXOA 1QIEA 3X3HA 4EY6A 4F0JA 1ZGBA 4RPCA 4OU5A 4Y7DA 4C88A 4U2DA 2DSNA 4ZGBA 5C8ZA 4WY5A 2G63A 2O2GA 5ALXA 1AQLA 5LZ4A 4X90A 4QEKA 1MX1A 3CCBA 2DHEA 1P0PA 4PV7A 5JD5A 4HXEB 4EZIA 4G4GA 3VJLA 3MUNA 3ZI7A 4AO8A 2BJHA 3B5EA 4JNCA 1IZ8A 1Q0ZA 2WJ6A 3H17A 4ROTA 2PPLA 3WJ2A 1KEZA 4L9AA 4IH4A 5ALSA 1TKRA 4CCYB 3QH4A 1ODCA 2H7CA 1CEXA 5D3ZA 3V9AA 5CH8A 3R3WA 3V1NA 5DYYA 3PF9A 2VTVA 3FCXA 1HQDA 4LYDA 5FOQA 1LBTA 5AM3A 4KRYA 4Y2RA 4C4YA 2WHQA 4MYDA 2GBIA 2OQIA 4EY8A 5LP1A 2JGMA 5D7BA 4F21A 2JBWA 1ZJ5A 4AQDA 3HACA 5FRDA 1U4NA 2C5GA 4IQ4A 5AIAA 1XZHA 4KAJA 5KREA 2R11A 5AI6A 5ALKA 2W6CX 5K3FA 2ZYIA 4GEGA 4CFSA 3LIIA 3H2HA 2QS9A 4M0MA 4X91A 4DNOA 1XZKA 2ZYSA 5AKXA 2ES4A 2XMGA 4F60A 5IVIA 3RKSA 4QNNA 1EDBA 1JJFA 2PVSA 4X97A 3ZLUA 1MN6A 3H2JA 4J3JA 4CIBA 3AIOA 2ACKA 4BZZA 3D5EA 4UBMA 1H23A 3E1GA 4LHEA 2WIFA 4BRZA 3O4IA 4BCCA 3QMVA 3DKRA 4TGLA 1XRRA 4DGQA 2GYUA 3R41A 2XMCA 4QWMA 2PSDA 3WKDA 5AIBA 1GPLA 3FSGA 1JMKC 4FBMA 5JAOA 3NOXA 4ETWA 4B0OA 5A7FA 5C8VA 3BF8A 3VJKA 2OCIA 1GZ7A 1LPOA 4OCZA 1XLUA 4PSUA 4UHHA 1QLWA 1F0PA 3STTA 3H2GA 4L0CA 3TRDA 3G0GA 1W1IA 3R3VA 1USWA 1XZBA 4Q3LA 3GA7A 3STYA 3I1YA 4MXDA 5EFZA 5FP0A 1WOMA 2YH2A 2QXTA 2HA2A 1C7IA 2CB9A 4J0GA 3O9VA 4Y2QA 4H7JA 3E0XA 2RI6A 5JADA 1WPXA 5CTAA 3TGLA 5LZ5A 4BAGA 4AX4A 4H7FA 3IB3A 2VQ6A 4DYHA 4DSZA 2QKYA 5A6VA 5FLKA 2AXEA 1CUSA 3H0CA 5AI0A 5CXUA 5LZ2A 1W6RA 2E3JA 1XZIA 2WUDA 1WB4A 3KWFA 3STUA 5E2IA 1GGVA 1SOMA 1DX4A 2HU7A 3QMMA 5T4FA 2O2HA 1JU3A 3C6BA 4AXBA 4J0JA 1YR2A 3WYNA 4BE9A 2IITA 3TJMA 5JZBA 2VT7A 4BCBA 2WM2A 5ALNA 1Q84A 4N8SA 1QIGA 5EHZA 3A6ZA 4KE9A 3FYUB 4UBIA 2PUHA 3QBJA 4WY8A 5AH0A 1L7AA 2XUPA 5CT9A 4F5ZA 2HHAA 5J3JA 2XUGA 1DT3A 4BDSA 1SFRA 4B80A 3W9BA 1SCQA 4Y2TA 4H18A 3KXPA 2XUAA 4A23A 5DYWA 1JJIA 2OXEA 4BE4A 3QPDA 4U2BA 4BYMA 2AJLI 1ZJ4A 1WB5A 2JGFA 3I6YA 5CH5A 3QMWA 1LBSA 1BEEA 1XZAA 3F8SA 2ONCA 3IA2A 3WKBA 5AKIA 3IUJA 4UBJA 1TQHA 4WJLA 5AKEA 1JKMA 1W52X 4Q34A 3UUFA 3NWOA 1Q83A 3WKEA 4OB6A 4Y2UA 3ESCA 1J07A 1XQXA 4E11A 3PFBA 3E4DA 2QRUA 4G4IA 4GDMA 4MJ3A 1ODTC 1MTZA 4G9EA 5AM0A 3U1TA 1AZWA 1E5TA 3EQ9A 4KE8A 5ALMA 3G0IA 3I6ZA 3C70A 2GBCA 3M81A 1Y37A 3MGAA 3BXPA 3W2TA 4BP8A 2X5XA 2OLEA 1W75A 3PUIA 4P93A 1U2EA 5AI4A 4MEAA 3C5VA 4AO6A 2ZVDA 1QIDA 3S8YA 2J4FA 4UFNA 4AMZA 4DMHA 5EI5A 5JASA 1TAHA 1BCRA 4G5XA 2K2QB 4JUIA 2H1IA 3DQZA 3CN7A 5K5EA 2HU5A 2JEYA 4I19A 4FHZA 1N5RA 5EIAA 1QIFA 3FNBA 5HQ3B 1JI3A 1HL7A 4K6HA 3DD5A 2AJ8A 3HLKA 2HRRA 1KU0A 1LLFA 4C87A 1NU6A 3BIWA 3C45A 5AKYA 2Z3WA 4DNQA 3HEAA 5LZ9A 2PU7A 1CUFA 4KE7A 3WQHA 1CUUA 2PX6A 1I6WA 5AI8A 5AKGA 5DJ5A 1TCCA 5HKAA 4HXGA 4A16A 2WU3A 2BKLA 2DFPA 3QZUA 1GPNA 4FFVA 4NZZA 2BUCA 5DTIA 1SCKA 2HFKA 3KSRA 1QO7A 1B41A 2WJ4A 1XRQA 1AGYA 2WUEA 1HKHA 4KE6A 5AJHA 1Z68A 5FPQA 1EXWA 2VAVA 2XQGA 1L7RA 3M82A 4Q05A 4Q1VA 2OCLA 3O95A 2WIDA 1FFDA 4LXHA 4QLAA 3P2MA 1XRPA 1YB7A 2GYVA 2OG1A 4CCWA 1GKKA 4BTVA 1GT6A 3FLEA 3OM8A 4H7KA 5DNVA 4DM7A 1MNAA 3H1AA 4M0FA 5CRIA 4J03A 4C01A 1WHTA 4Q3KA 2C7BA 3G8YA 4BC1A 2XQIA 2WHPA 3WA6A 2XB6A 2XUFA 3LS2A 5FDFA 3T4UA 4W9RA 3E3AA 3WK9A 2NW6A 3OTQA 1B6GA 3LP5A 4X6XA 2B9VA 1CUCA 1BROA 2O7RA 4QDZA 1E8MA 4DNFA 3AZOA 3KOOA 3WL6A 3K9BA 5HFNA 3N0TA 2XUJA 1RWQA 1EB8A 4BTLA 5C81A 2ZYHA 1J1IA 4CG2A 4WFJA 5LYYA 3D0KA 3S2ZA 2WFMA 4HTAA 2H9YA 1YA4A 1CV2A 1WM1A 4X92A 2EDAA 1IUNA 5ALZA 4PQEA 4MWSA 3R3UA 4KAFA 4UBOA 1E8NA 5JD6A 3QITA 2O7VA 3AIKA 3L1HA 2RHWA 1DT5A 2WIJA 3R3ZA 1VA5A 2OGSA 4KR0A 3STWA 2PKYX 4P9NA 1O6FA 3NGMA 5CT5A 4G8CA 4EA6A 1K6EA 1G42A 1A88A 3DEAA 1YS1X 5AK4A 2XDWA 3ZLVA 4LXIA 2PSHA 4NVRA 5AKLA 3ZLTA 5IH7A 2V97A 3G9TA 2JF0A 3SK0A 5SYMA 1XZMA 4YK7A 5FXMA 5BV7A 5A2GA 2BFNA 4X6UA 4GI1A 1YB6A 5AO9A 1C7JA 1ZIYA 1CUBA 3WYDA 2ORYA 1UOOA 1SCIA 1TIBA 4GWLA 1UKCA 3BIXA 3OPMA 1VE6A 5FPPA 2BUBA 2R8BA 4Y2YA 3DLTA 4PNZA 2AJDA 3K6KA 4DIUA 5ALJA 3F67A 2PM8A 3O4JA 5I8PA 2OCKA 4UPDA 5JZSA 4KEAA 2RONA 3VJMA 3HRHA 2WLSA 4C89A 5DLPA 4N5IX 2C5FA 2QZPA 3DOHA 1BRTA 4MEBA 4DMKA 2G5TA 2ZJ7A 3DOIA 3I2GA 1EHYA 3JW8A 3WWEA 1DWOA 5IVDA 3AZPA 3ZPXA 3Q0TA 4FNGA 2XT0A 2XLCA 4P08A 3LCRA 3AUKA 3V48A 2WUFA 4D9JA 5H3HA 3D2AA 3GBSA 2I3ZA 2QJWA 2FUKA 5HZGA 1TCBA 4ZXFA 2WFZA 3SX4A 4AO7A 2ZYRA 1X2EA 2WFLA 4IH1A 1KU6A 1QZ3A 3QPAA 4BB0A 1WB6A 4X00A 3I1IA 1XKTA 1JT2A 4C4ZA 4OSEA 3BL8A 1QOZA 5ALEA 5T4BA 2OAEA 4Z49A 3W06A 2VEOA 1OCEA 4JYMA 3FBWA 3FSGD 4LXGA 1QTRA 5D6OA 3OG9A 3A70A 3EQ7A 5LKAA 4ZI5A 4BCDA 1F0NA 1TK3A 1ACJA 1EI9A 2I03A 5HKBA 1AKNA 4ZV9A 2QUBA 1P0MA 2WQZA 3WZLA 3IBTA 3FLAA 5AK5A 3IUNA 1CUXA 2B61A 1G66A 1XZLA 3BF7A 2Z3ZA 3N2ZB 2XUIA 1QIJA 3WK8A 2PSFA 4XIIA 5LLSA 2XI4A 1CUDA 4BAUA 4KAAA 4UUQA 4JYPA 3JWEA 5ISMA 3KD2A 4XVCA 4ZWNA 1VZ3A 5K3EA 1BS9A 1YA8A 3LLCA 1MT3A 1K8QA 3F98A 1GQSA 1A8SA 1ZGCA 4AN1A 1R9MA 3F96A 2XE4A 1ZD3A 4UHBA 3MVEA 1XROA 1FJ2A 1IMJA 5T4EA 1Y7HA 4X94A 4W1QA 2JGEA 3HYSA 1N8SA 4BATA 4W1SA 1BEZA 2Y6UA 3WWCA 1EX9A 1CR6A 1L7QA 1U65A 3AZQA 1W76A 1EVEA 2J4CA 5LZ7A 4MQLA 2ZSHA 3G0CA 3V1KA 4J0DA 1XZDA 3Q8WA 4RNCA 4S0XA 1CUHA 3WKCA 2FX5A 1ZD2P 3JYHA 3QPCA 4Y2JA 2XUQA 1J06A 4B7ZA 1CUWA 2HRQA 2CKMA 4I4CA 2H7XA 5AM1A 7YASA 1A8UA 4FLFA 4C4XA 5EGNA 2YASA 1ACLA 5AP9A 3BJMA 3WI7A 3HC7A 4DMFA 2Z5GA 2Z8ZA 4RGYA 2WSLA 5ALLA 2PL5A 3VVMA 2DCMA 2BGRA 2RIPA 4CI9A 5AKZA 1H2ZA 3KDAA 3WIBA 4W1RA 1UT6A 2QM0A 3G0BA 4PSDA 5CMLA 1UOQA 1T2NA 3U0VA 5C8XA 2O2IA 3ICVA 2QR5A 4BRSA 1QIKA 1UK8A 3DS8A 3RLIA 4U2GA 4TPKA 4FWBA 1QIHA 5JAUA 1PV1A 1LPPA 1R4ZA 3HXKA 3D2CA 2IX9A 1C4XA 2WJ3A 1AUOA 4BZWA 4XX1A 4FMPA 2ZSIA 2J3QA 4H77A 3G7NA 1XQVA 2WUGA 3C87A 3DNMA 3SC2A 3HZOA 3OOSA 4BVJA 3L1IA 4OD0A 4BC0A 1E66A 1NU8A 5A71A 1CUZA 3FVTA 3ESAA 4OU4A 1XZJA 1ZI8A 4X3CA 5ALPA 3UMJA 4IO0A 1PFQA 2ACEA 2IIVA 5LIPA 2ZJ6A 1QFSA 3WK7A 1G5FA 4BVLA 4DSAA 3IUQA 1EA5A 4ZV7A 3A2NA 1MAAA 5HF9A 1VA4A 1O6GA 1OXMA 3WKAA 3A2LA 4B83A 2WG2A 5JALA 2EDCA 2WTNA 3R40A 1IUOA 3STXA 4ARBA 5KWJA 5I7UA 3C8DA 1QJ4A 4KJXA 3D7RA 1DWPA 3GFFA 4B85A 2YXPX 4UBLA 3A2MA 5HK8A 4H7EA 4V2IA 3W05A 4J0HA 3IIIA 4EY5A 5HF6A 1GKLA 3MUOA 1CUYA 3GZJA 4QLOA 4OYLA 4PSCA 2HDWA 5T4HA 1MX5A 1BE0A 5DWDA 4GLBA 1AC5A 3FYTA 4DNPA 3PI6A 3I2HA 1UOPA 5A7HA 5AI5A 3O9MA 1H22A 2CJPA 4DLNA 5JYCA 1E3QA 3G0DA 2GZSA 2C0QA 1K5PA 5JAHA 1HPLA 4G8BA 4W63A 4YPVA 1JMYA 4UHFA 1BU8A 5AK6A 4RE5A 1HBJA 5K3AA 5IVKA 2XMZA 2Y2UA 4CIAA 3O4GA 1LPMA 1XQWA 3ESDA 3K2IA 4UHDA 5CBKA 1P0IA 4H35A 4U2FA 1YS2X 2XUOA 3C8HA 3EBLA 5AICA 1QO9A 4NMWA 1CRLA 2JGJA 5ALTA 1XRMA 3WJ1A 2VATA 3ZV7A 3I2IA 1WCYA 1VOTA 4X85A 4HRXA 2XUKA 2OCGA 5ALHA 4TVKA 4QDTA 5JANA 4H7HA 3DYVA 2D5LA 3F97A 2CEKA 5ALUA 4EHBA 3AJAA 4Y2XA 3WL7A 1U8EA 1A7UA 1IVYA 1NX9A 2PU5A 2ECFA 3G9ZA 4BAZA 3IURA 3RM3A 2X76A 2GZRA 3HI4A 3DYIA 3IVMA 2W22A 2VA9A 2OPHA 4FTWA 4K2AA 3H1BA 1DU4A 3H04A 4IHAA 2CUTA 3EF3A 4N5HX 3I6MA 5D3KA 1DQYA 3WK6A 2XUDA 4OB7A 1DX6A 1FFCA 3H18A 2Q0XA 3W9UA 4J7AA 1X70A 2DQYA 1TRHA 3NUZA 3VKFA 1CIJA 4OUKX 5HK9A 4L3WA 1EDEA 5EIEA 2WKWA 4NS4A 3OC0A 1CUIA 1ETHA 2WILA 2VT6A 1XQYA 4JH0A 2VF2A 5AK3A 1CUEA 2WFLB 4AZ0A 1R88A 3C6XA 1XZFA 5K3FB 1N1MA 2C58A 3DKKA 5YASA 3C6ZA 3B12A 2X8BA 3ANSA 3WA7A 4E15A 5EHNA 4DTCA 4H7DA 5DYTA 5CURA 1YAJA 3WMRA 1FFAA 1M33A 4RE6A 4GXNA 5ALGA 2CZQA 1W4LA 2Y1KA 2XQFA 4M0EA 4X6YA 4EY7A 1VZ2A 3PFCA 1XLWA 2V9ZA 2JGKA 2GBGA 2WIGA 4QWWA 1QIIA 3DL7A 3TEJA 1ZI9A 3FLBA 3H2KA 1UFOA 2WIKA 5JARA 3ICWA 5LZ8A 4K6KA 4B9EA 2V98A 5AOCA 4HZGA 3BDIA 4OYYA 1G4HA 3D3NA 5HF8A 4E46A 6YASA 4AMYA 1GQRA 1MJ5A 4WFKA 3RARA 3C5WP 4U2EA 2Z8XA 4MWTA 4LYEA 4ARAA 4EB0A 4UFPA 3VVLA 1ZOIA 2EEPA 3AINA 2P8SA 4Y9SA 5FUMA 1CUJA 5AM5A 2XQJA 2BCEA 3V1MA 1BN7A 1UXOA 1DWQA 2ZJFA 4X7BA 4BDTA 3WWOA 4AN0A 4H7IA 1UKAA 2BAGA 3M3DA 3WK5A 1XZGA 2HFJA 4AB1A 3QM1A 4HXFB 1YASA 2XMQA 4H0CA 5A7GA 4OPMA 1LZLA 5AM4A 3CCCA 2XMBA 4GBGA 3VISA 4FNMA 3WK4A 3PICA 4B84A 1TCAA 5SYNA 5FV4A 2WU4A 4Q3OA 3G02A 1XKLA 1EB9A 1S8OA 2QVBA 4Y2VA 3I2KA 1JJBA 1E89A 3WL5A 5ESRA 1QE3A 2ROQA 1UKBA 1EH5A 2BUAA 1A8QA 3EIOA 5ALRA 3VXKA 1UK7A 1ZI6A 1LPAB 2FJ0A 4L72A 3FYUC 1MPXA 5DNWA 1CQZA 2QXUA 4X71A 2HA3A 4YX9A 1K4YA 1MU0A 5HF5A 5CH3A 2WTMA 3WLAA 4CCYA 1CUVA 2JIDA 4PO3X 3AILA 4J0CA 2XMRA 3BJRA 2V96A 2GYWA 5JIBA 2FJPA 2QJRA 2RAUA 5ALFA 3F9CA 4LKOA 3I28A 3W04A 1R1DA 2XLBA 5A62A 1H2WA 3GUUA 2OGTA 2OGZA 2AJBA 2HIHA 2Y6VA 2AJCA 2PBLA 4MYSA 4UHEA 5E4YA 1FSSA 3ESBA 1VXRA 2UZ0A 1R50A 2HU8A 2XQKA 1FFEA 5AKHA 4K5QA 2DHDA 4HS9A 4FLEA 2JGIA 4I3FA 1F8UA 1LNSA 2Y2VA 4B0PA 4QDUA 3ZWQA 2G5PA
chains in the Genus database with same CATH superfamily
1W1WA 1OILA 2WKRA 5JZMA 5GGYA 2JI4A 3DE1X 1ZJYA 1P8JA 1TVEA 4Y9RA 5GWXA 4QRHA 4BFYA 2Q5QA 1A7KA 3QYFA 1K8XB 4XB2A 1EKXA 1LGYA 1T8WA 2OO3A 2QUAA 2M6KA 3O4HA 3WZMA 3FOZA 1RXVA 2BTQA 3AHHA 3GJTA 4TV9F 4EL0A 2UVPB 5K3BA 3W77A 4V2UA 1GKIA 3DL4A 3LSTA 3WS7A 1T1IA 1VE7A 4PAQA 4DARA 4JI0B 2CXPA 2Q5EA 3KOUA 4FKZA 1ZXBA 2J0VA 4JB3A 4ZD6A 5EP4A 1CVLA 4X7MA 5EE1A 5CDHA 3D0RA 2WICA 5EJAA 1REQA 2CFCA 4NK4A 4FI3C 5DBOA 4PC3A 1RM5A 3FMIA 1IZ7A 3WLJA 1DKMA 1N2CA 4FNOA 4NV0A 3WRVA 2HA4A 4YP6A 5F4ZA 3V3KA 1C0LA 1NVXQ 2VQDA 2Y1XA 2I22A 2VQFB 2FWJA 2ZJ0A 2OO5A 3CGWA 1ZPDA 3PA6A 3PC6A 4FGJA 4HLNA 2QP9X 3E3LA 1UFRA 4OA8A 4RH1A 5ICFA 3UMVA 1ZITA 2F6RA 1N6LA 3HP7A 4JUBA 5D3MA 1E94E 3JALB 2PL9A 3GG9A 5TGTA 3W7BA 1P7YA 1A5BB 2VPZA 4WUTA 1KF0A 3ZTWA 4DCMA 5G0SA 4JQSA 4A36A 2JFYA 2FZ5A 2IW3A 2BZSA 3D3QA 4QGBA 1DZ3A 4TKMA 4Y18A 1QU2A 1QYRA 2CFSA 3RYTC 3KSMA 4O1IA 2RGUA 4BNWA 3IOEA 3JATB 2H16A 3WWPA 4LOAA 5LKRA 1QK5A 2NP7A 4CMAA 2LCIA 1TEVA 5JG7A 1AUQA 1PD1A 3V8QA 1JLLB 1NBWB 3IDSA 2XYQA 5D5HA 2FFBA 3GA5A 2JD2A 2JGDB 4WXMA 4AUNA 1SUBA 3BWDD 4RHEA 1VB3A 3NWPA 3TIXB 2AF4C 3DBHA 1RP1A 2ODNA 3GJRA 3DMNA 1CLEA 4G89A 4MQMA 3CX4A 3UUEA 5HCUA 4G4SO 5K51A 1FVOA 4OMDA 4RK0A 3VR5A 2ESRA 4XYBA 4P38A 3P2KA 5TPZA 3TF5A 2HB6A 2GNPA 2R7AA 3IJRA 4HWGA 1KIMA 5BR8B 4N8EA 2YJTD 2C83A 1Z12A 2WTEA 5GTDA 4AUEA 5CW2A 2R751 4HQFA 3WL8A 1IZ0A 3IAXA 1XRSB 1KDYA 2XJ9A 1BQ3A 2P5UA 3HO6A 3SXJA 3CZ5A 1KK3A 1D09A 3C98A 4PXAA 1QGDA 3A7EA 4NR0A 3TTXA 1W46A 2O2CA 3HBNA 3GLRA 1B1AA 2ZXUA 2V1XA 4PZPA 3EUEA 3N59A 4D0RA 4D1YA 4OXNA 3MS2A 2H65A 3KUDA 5B4TA 4FM9A 1VLQA 1KFBB 3KHUA 3N0VA 3NBKA 5BQFA 1VFPA 4BGEA 4CG0A 1F3OA 4TS9A 3CN9A 2CJWB 3UWSA 2EGHA 1I1QB 5JCJD 1JMVA 4NHOA 2FP3A 3KYBA 5IULC 4FKMA 1UQRA 1G20B 3UB2A 1ZH4A 4F1KA 3G2MA 1PL0A 1KOLA 4LWQA 3OE5A 2MSLA 1UWCA 2CCGA 4HAWA 5KYYB 1DAKA 3WRXA 2VHVA 5LA6A 3PFNA 4DC0A 4B5KA 1BXKA 2F4NA 2HU2A 2JJYA 2PUVA 1D5WA 1CQJA 1P2FA 2CJXA 2RJOA 3PLRA 3WZ2A 3UH0A 1JFRA 2I78A 2PXHA 3OETA 4DJTA 3TW8B 3AMVA 4QO7A 3M3PA 4ODIA 1MJGM 4OHXA 3TOZA 1DC6A 1O0CA 1NVKA 1GDTA 3WHKA 2COUA 3QLEA 1T29A 4RTQA 1QONA 3W5DA 1FTQA 3IAM1 5BWCA 1CR0A 2HA0A 5T67A 3DUWA 2ZU0C 3HU3A 4IFEA 1RP7A 5EHXA 2GHQA 2P9QA 4ZVVA 3R3JA 1WZEA 4ERNA 2O3SA 2GAJA 3GH3A 2XIQA 2V45A 3KB1A 4CNBA 4HC4A 4MO9A 1AF4A 3QKRB 2WHPB 4L0MA 4OF4A 4TTRA 4UEJA 2WE8A 3TLCA 3VU1A 4TMZA 3DFZA 4JSTA 4R01A 4F4CA 4QDJA 1MENA 1DBQA 2P40A 2OM2A 3L7MA 2WHRA 2QT9A 2H1VA 1H2FA 3B7GA 4AJ4A 3FYUA 2OD2A 5JC8A 4TT3A 3A1DA 1HXHA 2VJDA 4XWGA 1OXBB 5DLYA 2X58A 1XVUA 1Q3TA 2OHHA 1GITA 3BFPA 4CPDA 4W82A 1T8RA 2CBGA 2IBMA 4DM4A 3NC1C 3NPAA 5IKMA 3TRHA 3SWWA 1TKBA 2Z6VA 2X8LA 2R47A 4ABYA 4ETMA 1XCOA 4ZCRA 2AQKA 4IWYA 1AV6A 1VSBA 2ECQA 4TKVA 2QJFA 3MLBA 3R3HA 5HMMA 5A04A 4UU7A 1ABBA 2CMKA 3C2QA 3T7AA 1SH7A 2W2PA 4A5SA 4EZBA 1KSGA 1V8BA 3C24A 3H19A 3IXLA 4P83A 5BSWA 2GWRA 1DHRA 3FLMA 1G7RA 3HMKA 4Z9BA 3QBDA 3PX3A 4Q6WA 3GGOA 4HAIA 1ZCJA 3EXHA 4MP6A 2NO4A 1Y3IA 3PE4A 2XUHA 4PS0A 2IC5A 1RXSA 3SDSA 5IVHA 1E77A 3FNEA 3RTEA 2RGRA 4N0EA 5BORA 4PYKA 4D43A 4B3JA 3ER9A 4MRAA 3TX2A 4O5AA 4ESHA 3FCUB 1NUSA 2ORWA 3F1LA 4ND8B 2IV2X 3WB2A 4F84A 2E18A 3HDYA 1LTHR 1UPCA 4PYQA 4R41A 3T99A 1Q0RA 3U4MA 4LC1A 2EWWA 5FPSA 2PUBA 2EV9A 3OOEA 4K26A 4YRLA 1U9ZA 1O4WA 5DB4A 3R9XA 4D25A 3N7AA 5IDXA 2C4WA 1VE1A 3OQNA 3IJPA 3KT8A 2WKSA 4PW0A 3KDSE 1U2ZA 5DGXA 3H5RA 1COZA 1GNVA 1N2ZA 2ORED 3AR8A 4GP6A 4MUEA 1AG9A 4IR7A 5FF9A 4DLRA 1IZ9A 3I34X 3M6AA 4MVJD 3L06A 1O94D 4PSAA 3V46A 1UC9A 2REOA 2ZS7A 2IYPA 2PA3A 3PQ2A 5JJKA 3OY2A 1WUKS 1LTKA 2GVNA 3OVMA 3WY9A 2H0AA 2OSBA 4DV4B 1XKXA 1VBFA 3GFSA 1ZM3A 3T1QA 2EKQA 2BH9A 4P0TA 1Y5IA 1VJDA 3HXPA 1R8XA 1U1DA 3AFIA 1VGVA 3NETA 4TLAA 5KDDA 5E7IA 4ZARA 3FN4A 2IYOA 2A9VA 2FWNA 4L16A 3SN6A 2G3YA 3SEZA 2BKAA 3AUTA 3OFKA 2VDNB 4DE5A 5L4SA 2M6RA 3CW9A 1QGED 2PUJA 1M2FA 4LRQA 2IH5A 3H8VA 1C4KA 5BNIA 4ZEMA 4RZSA 1Q1ZA 2X3UA 1NURA 2HUNA 5HFAA 3ZZUA 1YHYA 3ZW9A 1BC5A 3DJYA 2F55A 2G9RA 3W5AA 2Z4SA 2XB8A 3HBAA 3FOBA 3NGLA 2PBZA 3E9DA 1T36A 2P0AA 2JIZA 2X0RA 4ACBA 3STVA 3FJ1A 4MUAA 3TBHA 3COJA 2R7KA 3DBRA 1N5MA 2ZI4A 3O21A 3N9IA 3ZQKA 1P0QA 1RI3A 2CMDA 1CFJA 1I3CA 1FTWA 1UFVA 1VHLA 3DLIA 4LWOA 5EIXA 1KZYC 1AX9A 4JX8A 1GG2A 2V5AA 4JYBA 4MV9A 2YYSA 3AVWA 5GMOA 4NKRA 3KLOA 2P68A 2X3FA 3L0OA 4NZYA 4QQNA 4A6PA 2HF9A 3RIMA 4OQEA 3UJ3X 4BJHB 1ZLYA 5B4VA 1Z7YA 4TMVA 2RAPA 2GN9A 3QHQA 4KACA 4XSHA 4MHOA 4AQYB 4CL0A 3B82A 4PONA 5JJIA 4MRMB 3MWFA 4Z4FA 3HCEA 3PFKA 1DO2A 2H51A 2VTDA 3DONA 3PEWA 5FOVA 4K9NA 1LPBB 4C3VA 3HSSA 1B6TA 3JXEA 4RZIA 5HILA 2V9CA 3V7NA 5BWLA 2H8GA 2ZBPA 3ELUA 4UDYX 4P35A 2QTBA 3CLKA 4EKEA 2AOUA 4ZKDA 3IUMA 4FR0A 4IDQA 4WZAE 2ZRDA 4NBLA 5SY6A 4ZT7A 1NR5A 1QRRA 4L4RA 2OXRA 1O7JA 2FUEA 1YHNA 2B8WA 4YRBA 3CRQA 1RYYA 1BHQ1 4U4AA 1GR0A 4HPJB 4NMMA 3SBXA 3TRKA 4BMZA 4DMCA 4UVEA 3ZE2B 3U6BA 3QJGA 4Z2YA 1YMQA 3HB1A 3T95A 2FPUA 4QREA 3L1KA 3GROA 1KJQA 4K6MA 1QQBA 2BISA 4FX2A 1UDWA 5A9TA 1KFEB 2CEAA 1E4EA 1UH5A 5CYFA 1AKTA 1DDOA 1PYOA 1QSGA 1C0IA 2ATVA 5CA0A 4DMRA 2J67A 1JV2B 2PX3A 1YDWA 2WQ6A 3AOGA 1U8YA 4P5DA 1XDBA 2CL7X 5CGQB 1WHSA 3GA0A 1BMDA 4KJZA 4WY2A 3KKOA 3K1ZA 3GEPA 4DREA 5CITA 3FTPA 4Q1CA 3JRXA 2HQ1A 4IJQA 5DULA 2AE1A 3OEEA 2C2ZA 4FHCA 4LSWA 10MHA 1F8YA 3O3MB 2EF1A 3BWXA 2JRCA 5CJPA 4OXYA 3KOMA 4FUQA 5C7YA 3DV9A 5I5EA 5FT9A 5JD4A 1GU0A 1NMEA 3L49A 3H2IA 2BP7A 3IAFA 1MOQA 2QN9A 1G8FA 1K6MA 3C7KA 1NUPA 2YQ4A 3LQKA 3PU6A 4Q4JB 1THTA 4NESA 1ECCA 1Z6GA 1WVGA 3SHWA 1NL3A 3V6LA 3VDXA 1VJCA 1VPWA 3P97A 1A1VA 4GKJB 4AW9A 5LBUA 2QYSA 1ILWA 1T4GA 1FMFA 4N18A 3WV5A 4E07A 2PIAA 2C04A 1T13A 4HVLA 4UZEA 5GONB 5BW6B 1MHTA 2Y4NA 4JMLA 4YQYA 4AJHA 5AHXA 4RTJA 4KQ6A 1VIMA 2XBUA 2LZ0A 4ARIA 3CO0S 5I9BA 3VUFA 1SUSA 1RHUA 3B3FA 3QXCA 1GY8A 1C3OB 4HZUB 2O2SA 1HG1A 4CQMD 1SU7A 2PXCA 1NJSA 1B00A 2R3SA 3GK3A 2F3SA 2IOFA 2ZVPX 3AI3A 3GRCA 3HYLA 3PF8A 1QRAA 4XGQA 5JJ5A 1YV9A 2ZVJA 3NHBA 2BFFA 4N49A 5F5NA 5AHRA 3SIPA 1MOPA 4AZ3A 2B25A 4O2AA 1XZCA 4AWXA 1I1HA 1JX6A 1WMEA 3IIJA 4R16A 3P9NA 2HMTA 1O5OA 4ZVPA 4RGQA 1QB8A 1VXOA 2ZI6A 3S5JA 4RQBA 1HRKA 2PNFA 3FDZA 3F6RA 2GAOA 2A58A 3N7TA 5J59A 4DNXA 1CS0A 1ZY2A 1B0AA 4RA6A 3K4QA 3NNSA 4FYMA 3VO2A 3ZDCA 2MT9A 3PA8A 3F6BX 2JLVA 1M73E 5JSZA 4M8SA 4FGLA 4U2DA 3ZV3A 4DLVA 1B0PA 4N7JA 1SCUB 4OYRA 3S7TA 3UHOA 3G2LA 2AUNA 1J9EA 1JZTA 3CEJA 4G1MB 4UATA 5CJJA 4ALMA 2OZLB 3JD3A 3WYFA 1SRQA 4UTZA 1TD1A 3AFHA 4YHBA 3T9EA 1C3JA 3VHXB 2G63A 2O2GA 3FWZA 4I1RA 4R71A 3PHLA 1F2TB 3C3YA 1ZSYA 1OFUA 4E5DA 4FCWA 4JJ6A 1AQIA 4Q0MA 4X90A 3UWKA 5LZ4A 1MX1A 1M0WA 3CCBA 1Y6JA 4RL4A 4ZYWA 5JR3A 2H92A 3V97A 4EMUA 2FEAA 1P0PA 4MWGA 4PV7A 4YPOA 1ZH8A 3TTWA 1QRTA 4B87A 4JS0A 4FMDB 1WZIA 3T34A 5F9HA 3VJLA 1CVRA 1KYYA 2HBYA 1DNPA 2R97A 1DL5A 4QOJA 4F7WA 1NQOA 2FKAA 1RBMA 4D8XA 4M1YA 4KPEC 1FB5A 2BJHA 3HY6A 4JNCA 4LYHA 3EZ9A 2WAYA 5THQA 3RS4A 4RJ2A 3TX6A 3TPZA 1RIFA 2PFKA 3H8SA 2WJ6A 4GBMA 3EARA 4DC1A 4CKWB 4MI3A 2ZRJA 1YJAA 1KVRA 4DBLE 5IHPA 4YUYA 3K20A 3KPWA 3MTQA 3C7TA 1EBBA 2Z3VA 3R7LA 4FZJA 2PVCA 2NU8A 1JWLA 2Q5OA 1Q20A 3GXBA 1UM9B 4MEJA 1KXZA 3WQSB 4GQAA 2XSZA 3BVPA 5GAJA 3RHTA 3CGGA 3BTVA 1GRRA 2O5VA 1Z4OA 3UAOA 1CEXA 3V9AA 5KJFA 4M7PA 3KEOA 1DAFA 2Y3IA 2GXQA 2YMQA 1CJVC 3DVLA 3R3WA 4YRQA 4EVSA 5JUWA 1EWQA 2V4MA 5DYYA 1KZ4A 1EGVB 1LB1B 1DX9A 2H3HA 2I6TA 2JLAA 3PF9A 2NU7B 3THOA 4LYDA 1HE5A 3TZ6A 3HVJA 3RLFA 4Y3UA 1L4UA 1XVLA 4JD5A 4DV7B 2QM3A 4RJIA 1GZ4A 2IZZA 2PT6A 1PJQA 5CW1A 3RAGA 1NW7A 4ZQHA 4IQGA 5TF0A 4ALLA 1U7DA 2H2DA 4PZAA 3R7NA 4Y2RA 3EPPA 4XQ0A 5ADHA 3N7UA 4HJXA 4NAUA 2GBIA 3OKCA 3NBQA 1Z0KA 2IL1A 4GYKA 2DF8A 4X1YA 4QJBA 3MAGA 2OQIA 2C07A 3MA0A 4L74A 1OIXA 3DMFA 4JITA 4CEIA 1UBLS 4RESA 2EERA 2XR1A 1PD0A 1ZJ5A 3KWLA 4DIOA 2Q29A 4M9CA 2C5GA 4AF8A 1E3WB 4UU0A 1CP3A 1VI2A 3F7OA 2IFTA 4IQ4A 3H42B 1SXQA 2PL3A 1XZHA 4K6FA 4JOSA 3KBBA 5HW0A 2B92A 2FR1A 1MF7A 1O96B 2O50A 4IRXA 4L5IA 4RMGA 4D9KA 4DAOA 3OF3A 5ALKA 3TNLA 2QMOA 2J5XA 4H7PA 5A03A 1ISIA 3RG2A 5EYPA 2JA1A 3HU5A 1XDSA 4R8LA 1ZQ9A 2J59A 4XVUA 2VYFA 4P3OA 2VXYA 1XZKA 3LXRA 2OOKA 3W6ZA 4HXYA 5E1OA 2HV9A 5K4HA 3FF4A 2ES4A 2CDCA 2VNIA 4F60A 2YFHA 3KZVA 1VL6A 2C4UA 3GVXA 1DEHA 2XB4A 5FTNA 2FQXA 3AR5A 2BCGY 4FZ5A 1MPTA 1M1YB 4I1YA 4NEHB 2AMVA 4EEZA 1E2GA 5LNK1 3QE9Y 2FX3A 3RW9A 1L3BA 3EDQA 3WSTA 1ZW6A 2BTQB 3H2JA 1ZRHA 1QM5A 3IVCA 1E1RA 4AAYA 4CIBA 1TTHA 1W5AA 1PP4A 1QKIA 3AIOA 5JSFA 2A0UA 4OHWA 2W42A 3ICQB 1EJ2A 2ACKA 1U2DA 4EHAA 2FFHA 4JXZA 4BZZA 1LRJA 2GZDA 2YS6A 1M66A 3HUDA 4RKRA 1H23A 3E1GA 4HDRA 1C1YA 1FSFA 4ICIA 4QBKA 3FKQA 2H4YA 5FUYA 3T7DA 3WGYA 1FLDA 1OI4A 5ERYA 1CJMA 4A0HA 4BCCA 4DBLC 5BQOA 4AY5A 3DV0B 1BKDR 2AG1A 2ZDGA 3TW0A 2P8JA 4DGQA 2VZ8A 1S01A 1HNWB 4UEKA 1HG0A 5LMNB 3R41A 1FF9A 4KMOA 1WUJS 3WIDA 3D7KA 3W5HA 3LZCA 1PNRA 4ZK2A 5AIBA 1GPLA 1Y3BE 3OCWA 4I99A 5JAOA 2EHJA 3GGSA 3NOXA 3TZCA 5A5EA 3LV8A 3PD1A 5K0EA 2R1UA 1LSJA 1U8UA 5B3LA 2QU7A 5AT1A 1E7YA 3BF8A 4MR7A 3VJKA 3FB1A 4PLZA 3ID6C 3M9LA 4HGYA 3RS5A 1E2IA 4EP1A 2AV6A 2ATEA 4ENQA 1Z13A 1SQ5A 1MXFA 1LPOA 1ZD1A 3GRKA 1ESZA 1DC4A 2ZXFA 3S40A 3A4IA 3OWXA 1BGVA 1XLUA 3O82A 5DHUA 5FLYA 3WGKA 4UHHA 1DJOA 1IATA 3H2GA 4HDNB 3ROGA 1O1YA 4EI2A 2DR2A 1DKOA 4OQFA 4FW8A 3R4VA 4MUGA 3WBJA 5L4LA 1JEJA 1FX0A 3MGGA 4Y1EA 3I8XA 3TGWA 2ZJOA 3V2HA 1W49A 1CKEA 1E2PA 4MZXA 4RKEA 1I51A 1OFTA 1Y4SA 2GPWA 3DTYA 4KQJA 2IWRA 2YJNA 3KQSA 1IN6A 2YL2A 4Q3LA 1Z0FA 1GIAA 2I7VA 2JLUA 4YRAA 3AL2A 1L5GB 2O59A 3CR7A 3GNLA 1GPJA 1KZ7B 2J9YB 2W6IA 2JFHA 3F5QA 5K0TA 1Z07A 1TFUA 1N5KA 3BSWA 1H0KA 4HG2A 4D41A 1ISRA 3HU2A 4NDAA 3QX8A 4BUZA 2CB9A 4Y2QA 5DN6D 1GSIA 6PFKA 1W35A 4KUEA 4ZQFA 5CEEA 1ZIDA 2IYEA 1A5ZA 4H7JA 4K6OA 4Q48A 5GJCA 4O4IF 4YUXA 3GLQA 4I9GA 4RVGA 3AR6A 2RI6A 5C32A 1WPXA 4QUEA 4ARSA 1K86A 5CTAA 1H2RS 5I9NA 2I2AA 2HV8A 4D46A 4YAKA 3TGLA 2FH5B 5LZ5A 4AJLA 1PG0A 2HO5A 1P60A 2OEPA 5JNRA 5I7OA 3PITA 4J16C 4EQZA 1M6HA 3VPSA 1XDZA 4FT4A 2QN2A 3RRMA 1P4RA 1D2NA 3OCJA 3P2IA 4XWYA 2AXEA 1IBKB 4JI4B 2YXBA 3VI4B 3INGA 4U7WA 1UZUA 1UJCA 2D7CA 2PGNA 3BM5A 3K96A 3OQ6A 3DLPX 2XE7A 4W9MC 2IY7A 1G21A 1UDRA 3NWEA 3E84A 3DHNA 4HAXA 1BS2A 4MS1A 4OP3A 1E98A 5CXUA 1DAOA 1B14A 5JCZA 1P2DA 5LZ2A 2O19A 1RW4A 2E3JA 1KYTA 2QV0A 2Z6QA 1FK8A 5FBLB 4JOCA 1QYVA 2ZJ2A 3OZXA 2PPVA 3CUVA 4XGRA 4MI6A 4GKBA 3KWFA 2ZYUX 3KAJA 3SF8B 2I76A 1RXWA 1G18A 1AHHA 2C3UA 2I4OA 2HU7A 3M6UA 1RPZA 2BE9A 2O2HA 3CURA 1E1QA 1XNJA 4IX1A 1WB9A 5BT9A 2PRIA 1D6MA 3IHTA 4A3SA 1M9NA 2GPBA 2WYVA 3H99A 4I4LA 4YRRA 4J0JA 4X0EA 2CLLB 2VP2A 4NAHA 1FP4B 4EKYA 2DWQA 3WYNA 4F8JA 1X3LA 2GPNA 2CUKA 2GZMA 3Q98A 3G13A 4PLWA 4ZOLB 3MGKA 5M3BA 4PNEA 3TQHA 2IPOA 1V2HE 3COVA 3PXBA 3DEJA 4FR5A 2A7QA 2AVDA 4LYFA 4L7QA 2GAAA 4A8TA 2P9FA 5JZBA 5EQTA 2WVGA 3ZG6A 3IEUA 2DLCX 1SHLA 1QKJA 2BLLA 3LH5A 3RAFC 1RR6A 1PZHA 3F4KA 4QJIA 4N8SA 1QIGA 1OPRA 4YYEA 5JTUA 1JDUA 1LV8A 1TUGA 3AF3A 1WV0A 4CR7A 4KR3A 3EIQA 3HR7A 4LV5B 1DAEA 3FYUB 4YXWA 2H1WA 3TN7A 2IE8A 5F9MA 4E5KA 3Q12A 3QBJA 3CG4A 1NDQA 2ZTLA 2Q99A 4KN6A 3V00A 2X9QA 4N39A 3L4KA 1YACA 1E9CA 5CT9A 4Z4HA 4GD3Q 7MDHA 5U9CA 1ECGA 4P5EA 4F5ZA 5ED4A 2X5OA 2DOKA 1SVOA 3CTMA 2H52A 3HB9A 4TKVB 4B3DA 5J3JA 3E7WA 1NVBA 5KYVA 4YJFA 1JXQA 4MRSA 1DT3A 1ZCFA 2WM8A 4BDSA 1RCFA 1U0GA 3KYDA 2FTKE 3K0CC 2JI7A 2Y1CA 2A9QA 4GPZA 1QQAA 2WBLC 1G2IA 3Q7EA 2HSDA 2CV0A 1RI2A 4IOMA 3EXHB 4WASA 2W2QA 3EWSA 4BLWA 2P9ZA 1USGA 2XWPA 1RJGA 3K92A 2XKKA 3ZJUA 3QPDA 5CDUA 4U2BA 2QG4A 1G1AA 1NBMA 2GBLA 3RJ5A 1L4LA 1K68A 1RMYA 1LV7A 1THZA 1WB5A 1PTKA 1YB2A 2JGFA 3DAHA 3TM4A 1SQFA 2DFNA 3I6YA 3BREA 4OQZA 5THXA 1AV7A 2FV8A 4CLOA 2AC7A 4RWZA 3K1YA 3B2EA 2I2BA 4WXPA 4P22A 4DV3B 5BPHA 5AHKA 3GT0A 1BEEA 1XZAA 2F62A 2IEZA 2R68A 1Q1AA 2WI8A 3EXAA 3NFRA 3DGEC 3O1HB 4OEHA 1PQUA 3PQ7A 4MJXA 3THYB 2PX8A 2R6FA 4PZ9A 1VDMA 4AMBA 4LX0A 4AG6A 3MN1A 4FFDA 2WP8J 3LZDA 4NMHA 3RYHA 3SNKA 4WJLA 2B6HA 3ZWBA 4L75A 2HCFA 5EXDA 4BX0A 4Q7LA 3LKBA 1ZMRA 1L6RA 2CV1A 3U3RA 4L5JA 2VVTA 3BGWA 5AJTA 4KGZA 4NBUA 2G77B 3FD8A 1E2UA 5DM2A 4DBVO 4YHHB 3UGJA 3ABSB 1K66A 3MJTA 2WC1A 3TRIA 3W9YA 4OJYA 3HDGA 1IWOA 3CLVA 3PC8C 1RPTA 3LWNA 2C54A 5C7LO 3ZZ0A 4DJEC 3GV0A 3O8CA 2W2MA 4E11A 1C3VA 3AVPA 4WQMA 3PFBA 1BA3A 2XDQA 3E4DA 1DOHA 1Z4PX 4OJTA 2WZQA 4O8CA 2O2ZA 4Q4CA 3GLKA 5HCNA 4BB5A 2OHOA 3NGXA 4M7RA 4PLTA 2OZKA 4EH1A 2V4ZA 3P9PA 2VYCA 2BV3A 1TRKA 2OFOA 4PHGA 1VTKA 3I58A 3NEYA 4YAWA 2J0EA 3TH5A 2SICE 1BQEA 1E5VA 2VHYA 2YR0A 2GFQA 3EQ9A 5TQ2A 3G0IA 3IT0A 3QXGA 2GBCA 3M81A 4YRZA 2FHSA 3PHIA 3LYLA 4P3NA 1IBSA 1ULBA 2ATIA 3CA8A 3DUFB 3BSFA 4YGYA 3I61A 2ZWOA 2W5UA 3BCHA 1QAMA 4RKQA 1EGMB 1HTTA 1JE1A 5JO9A 3AUYA 4BV8A 1CVIA 5TIIA 2ZB2A 1JZQA 1SC1A 5JDIA 5JQWA 3DWIA 2BGIA 2I66A 1EBUA 5GIPE 1E61A 3BT7A 3DBRB 5H4HA 4CTOA 3ROXA 2VUUA 2DM6A 1VRVA 1AN0A 4JL6A 4KSCA 6GPBA 4DIBA 1BX3A 1U3FA 3G1WA 1UIRA 3K72B 1FDIA 1GL6A 2I3GA 2JIRA 2YFQA 3FBTA 4CF3A 1RYNA 3CZCA 1SBNE 1OLSA 3BXZA 4NJEA 2G40A 2SCUA 4B3CA 3UAWA 4Z99A 4CTKA 1YI0A 1AN9A 2CXSA 3C5VA 1E5LA 4CJXA 3NUGA 4M9RA 5LMCA 4QM7A 2NLOA 4XGIA 3IQWA 2ZB3A 3UJAA 3UN1A 1TKAA 1XA4A 3L6RA 2C59A 1MDBA 3LFHA 4CLDA 3GQBA 3S8YA 4AMZA 2Q3FA 2FNAA 3KUUA 1DMSA 1Z0AA 2NTJA 3TCKA 3PPWA 1LSSA 3X0DA 3LBFA 1WUIS 2K2QB 2QT1A 1E1CA 2Y27A 3DAYA 2RHHA 1W2GA 3DHVA 3IRVA 1SCAA 1ONOA 4KKVA 3KJIA 2F1HA 3H1EA 1C8LA 1P5JA 3T7KA 3ZHYA 1RWKA 3TE7A 1DHTA 4L02A 3TIVA 4ZDJA 5K5EA 5C8YA 2ECOA 3EH2A 3H5VA 5DIFA 1NKTA 3EG9A 4NYMR 1C1DB 2C77A 2ILTA 4H59A 2JEYA 3OUUA 4R2KA 4YECA 1GJRA 2J9RA 1QIFA 1R4NA 2EFGA 5CIQA 3C5HA 1LK7A 3W34A 1UBTS 1JI3A 3CWQA 5KNDH 5IP5A 5TPWA 1GT91 2FHPA 2ZEJA 2V5VA 2OCPA 3A31A 3TZBA 2ZIAA 1OGJA 2QY9A 3M4JA 4MQBA 5LQMA 4F5YA 1VIVA 5DGTA 2HRRA 1KU0A 4CQJA 1COWD 4YC7A 2WP0A 4YBZA 5BWNA 1NNUA 7AT1A 3CWZA 3DDZX 2FJUA 4R81A 1WHSB 5TEWA 4S0ZA 2D0IA 1OU0A 3E27A 2ZB8A 4G0QA 1GNSA 1CWUA 2W2TA 5LZ9A 3X1MA 1S6YA 1XO1A 1BMFD 3TNDA 4PG8A 5CJ2A 2RI1A 2KS6A 1XMJA 3R3SA 1CUUA 2GFIA 4CU5A 5KDOA 4EK9A 4Z3KA 4O29A 1AY0A 5AKGA 4YV1A 5FUXA 5J2TF 2A5YB 3X1JA 4Z6KA 1ZG3A 3VVCA 1JHRA 4HXGA 3KM0A 5COQA 3E9RA 3DEFA 4AICA 2CNOA 3T9AA 2BKLA 4JBGA 1RM3A 1VM6A 2DFPA 3LPMA 3EGDA 1WSAA 4V0LA 4C0WA 4ZI2A 2BM1A 3OCCA 2P9YA 4D44A 2BDTA 3TIFA 2Q49A 4BQNA 4QOFA 4CDRA 5M04A 3QX9A 3FNFA 3R9IA 1NZFA 1TVKB 2RDMA 3KSRA 5GONF 2PT7A 1IC6A 3BH6A 4OHZA 2WJ4A 3MJ4A 4DRXA 2R5FA 3CJQA 2LE0A 2HMAA 5EWJA 2QAGB 2WUEA 2ZWMA 4D8VA 2H1FA 3ITEA 3MINA 3ZCRA 2OTCA 4OHFA 3DLCA 1KEEA 2XQGA 2WF6A 3F4BA 3O8OB 3PL5A 4GSKA 4EHHA 5K0BA 3QFHA 2XKAA 5CDFA 3UANA 2XW6A 2A0KA 4Q05A 3GJQA 1DUVG 4R6XA 1EJ6A 5CUQA 5AWFC 2IH2A 3L7CA 1M34E 2AOXA 2OCLA 3AU9A 4H6VA 3EE6A 1XTJA 4OFWA 1OROA 4R9SA 2HCRA 4AZ3B 1SUEA 4JGIA 1DBVO 3TG8A 4LXHA 4O2AB 1O94A 3E70C 3TFQA 5FAKA 2PO5A 2GYVA 4J94A 1HORA 2BFBA 2X0EA 2OG1A 2PQ0A 3A04A 1YZQA 5EJGA 4CCWA 1WY7A 5H5JA 2A1TS 2GOYA 1TCVA 3N8GA 2PUEA 1CS0B 2XCQA 1QTQA 2OWDA 5CXSA 3FLEA 3Q3JB 4H7KA 3RRNA 2HNAA 3NUQA 2RHRA 3SKXA 4CFYA 1ARZA 4G1CA 5JSZB 2ZIFA 3EULA 4L6CA 5CRIA 2V6FA 2OP0A 3MXTA 1H8ED 3FOWA 3M9WA 3O1JC 3OZWA 2D1QA 4UE6A 1WHTA 2QQEA 3D8HA 3PRJA 2DTEA 4JA2A 5DWVA 3ECCA 4IBOA 2XQIA 3D9QX 2XRZA 4FDLA 3WA6A 4RTRA 1XTPA 2XB6A 1J5XA 2XUFA 5FOUA 2R0QC 1D2MA 1TFRA 5FDFA 3T4UA 1HETA 3MCWA 2VQ3A 3NBYC 5F2OA 4ZEVA 2C4TA 1B6GA 2BFEA 3PIIA 4S1WA 1KRXA 3NDRA 4XD2A 2B9VA 4G67A 4YTEA 2JFPA 3V6MA 1GTL1 1RT9A 2O7RA 3HWRA 2ONYA 1ZNWA 1RQRA 3IX7A 5FH9A 5I51A 3S81A 4WCDA 3S1AA 3VAAA 3KFVA 3C41J 1NMSA 3B60A 2IWHA 4ER7A 1GPDG 1LLDA 2A94A 3CO5A 3KKQA 2OBLA 4NBTA 1YQTA 3AZOA 5CD1A 3EPKA 1QF6A 4KDRA 3LW8A 1QDUA 1M1YE 3UK6A 5DNAA 4EO7A 3AVYA 4X24A 3W5UA 1YR1A 3LX4A 4E32A 1P4GA 3CXRA 2ZQ5A 2NAPA 4TLEA 2IS2A 4E7OA 2QX7A 1GILA 4GBED 2J41A 2NU8B 3EC2A 3LOPA 4QGGA 2A84A 4J0QA 3EHDA 2HLDD 2PZEA 4CG2A 4ZO4A 4S1OA 4CL3A 1T0UA 4F45A 1XMOB 2WZBA 1QFZA 5TT0A 3P9SA 5IBRA 3UQYS 5JJBA 4IZIA 4BX2A 1GOTA 4LQCA 1QLHA 5C9ZA 3M6IA 9ATCA 5IC4A 1CV2A 4X92A 3UJDA 4E0BA 4DG8A 1DZIA 3K4PA 2IU0A 5EE5B 1EQAA 2IYZA 3T3NA 1H66A 4K3VA 3RHSA 3KWMA 3A0RB 3NCHA 3N2NA 2O52A 1EDOA 1W9MA 5KU1A 1WMBA 3AFOA 1TX4B 5LBIA 4C0LA 4G41A 4UBOA 1CDZA 1KC1A 1PJSA 4FGWA 3FMOB 1SOWA 3UAVA 3NC4A 4O63O 1A7JA 3QITA 1T26A 1EP2B 2F3QA 1NBEA 1CJBA 4C4SA 1MJHA 2W6JD 3HKDA 4BMVA 1V1MB 1WXQA 1B2RA 2OGSA 2QRQA 3JASA 3M5WA 1AGPA 4Y1RA 2PKYX 3DVQX 3GNQA 2WJPA 1SKYB 1O6FA 1NP6A 4YLGA 2V6GA 3H3XA 4G8CA 4C78A 1GP2A 3GCDA 4ZYUA 1I5OA 5EIBD 2OZPA 3PHGA 5JLAA 5BN4B 1DEXA 4NFSA 4V0OA 1YS1X 3BWYA 2YKGA 3K8OE 2XDWA 4TL9A 4EA9A 3H75A 3ZHZA 1PLJA 3I45A 1HQKA 2YY6A 2JHFA 3FHJA 3VPCA 2JCBA 3ZLTA 2YRXA 1X13A 2FN8A 5IH7A 3V4LA 1E20A 1DAPA 2WDZA 2BFCA 3FPJA 3A3OA 1U3DA 1D0SA 4Y8VA 4EF6A 2HYIC 4NJMA 1AOXA 2JLBA 5SYMA 1S2LA 1RYZA 4HQNA 1N2EA 2P6MA 3JTEA 4YK7A 4P81A 3SG0A 2YBEA 3O8RA 4NYIR 3VU9A 5DSXA 1F38A 2DPYA 4XEUA 1ZN7A 2PLRA 3Q2KA 4IX9A 5A2GA 2FXIA 5A3JA 5EIWA 1OOEA 3EEBA 5TMBA 2BFNA 3E5RA 3K0AA 3EDMA 3U7QA 3UJBA 4DR2B 2ZCJA 2FCRA 1LCIA 5C4MA 5AO9A 1OWOA 2FZ4A 1ZGGA 3P32A 5FJJA 2W58A 4M1MA 1JIJA 4YRKA 2ERXA 3OAAD 3LOQA 4YMIA 4A92A 1UOOA 4F72A 1W8IA 4D8TA 3R6GA 2BUBA 5HE9A 3ZHOA 2PFSA 3ZV5A 4EI9A 1JDJA 4MR8B 3W6NA 4BQQA 2ZYDA 4PZLA 4CQMA 1PRYA 2P7HA 1IXSB 4YH1A 4BWVA 5BURA 3FOEC 3QY0A 3AKYA 2OFFA 1T2FA 4KP7A 3C4JA 5KVCA 1I4OA 2C4MA 4RULA 2ZRKA 1PR4A 1YFKA 2R4TA 2WWVD 3C15C 1YS7A 3L7JA 1V16B 3LX5A 4HF7A 4IIVA 4KEAA 2RONA 4MR7B 4WA7A 5F2EA 3A0UA 3VJMA 3JYNA 4ARZB 2D54A 2R62A 1EYZA 1N6KA 3C3DA 3CLUC 3K1AA 2HCBA 4TX1A 4C6RA 2QZPA 4C89A 3DOHA 5HKKA 1YVPA 1I4DD 3HZHA 3GRZA 5IHXA 1U31A 4OHKA 5L3SA 1R6BX 3EMVA 4GGOA 5JISA 1NKVA 1T15A 2I71A 4IIGA 4A15A 3T6KA 3HE3A 4DMKA 1S1CA 5JNLA 3TBKA 1NC3A 2BZ1A 4NNPA 4C0SA 4CMHA 3AZPA 5CIYA 3Q0TA 4I9HA 3IPAA 2CFOA 5AW9A 1WKCA 1NLZA 3U1VA 5KYUA 3SY8A 1L5WA 3K94A 2NU9A 3LCRA 4FFSA 3WB0A 1GTZA 5KHOC 1GUAA 1L7NA 1YC5A 3RUCA 3EPJA 1TZJA 2SKEA 4YV7A 4NCNA 3GDHA 4ZHSA 5IZ4A 5C31A 4Q1BA 4HUQA 3RS3A 3H13A 5LQKA 2GGSA 4FOSA 3GLGB 3L82B 3FDXA 1G5PA 3D2AA 5ICMA 2F48A 4JI2B 2F9MA 1OJ7A 4J49A 3IUEA 4B48A 2ACWA 4J0FA 1M2OA 3RVKA 3DZJA 3BCSA 1I33A 5IYZA 4FFMA 3FVVA 4HWSA 2E1PA 3R74A 1S7GA 2IYLD 4DVGA 5IWCA 1VG9B 1YJBA 3JAKB 4ZXFA 1SU8A 2WFZA 3DOOA 3SX4A 3SS9X 2NSHA 3AUUA 4GGPA 4BNGA 4H1HA 4CUZA 3O73A 1X2EA 4ENVA 4Q7JB 1AF7A 3GDWA 3O94A 3N2KB 3CVUA 2TSYB 3QFCA 1FMCA 4IUDS 4X00A 2VHXA 1UPTA 3WG9A 4Y7CA 5IWAB 3DOUA 1FNNA 4F4FA 1JS1X 2OT3B 3RUHA 1Y3DE 1FRVA 3BRWD 5EKSA 3BL8A 3HQ4O 1OXSC 1QOZA 1L7PA 3BDAA 3FCEA 3LY9A 5T4BA 4EHNA 3GRYA 1YA6A 2IYVA 3SX0A 1Q0PA 4MPJA 4NZ9A 4GKAA 4G1EB 4UM9B 1J0XO 3BWBA 1EDZA 2OENG 2QRJA 5E9QA 3DZIA 1IZYA 3NC0C 3MS7A 4DV5B 4D4MA 1ELOA 1G1MA 3WAGA 5BSVA 3FBWA 3FSGD 4QVKA 4WGFA 3OG9A 5KVQA 2JCVA 5GJWC 3TVTA 3A9VA 5C46F 1T4CB 4O2BF 1SXPA 5T3UA 3KETA 1F0NA 4LOJA 1JSLA 1NQWA 4G0OA 1R5JA 4CKBB 2QTWB 2Q4TA 1YTLA 2V6MA 3GLHE 4EMSA 2MYPA 1EUDA 3L6EA 4PY2A 1MMFB 4BVFA 4Z53A 1ODLA 1T0JB 3AF0A 2I03A 3GIDA 2P7IA 2CT8A 1XD8A 3LU1A 1IFXA 1M2NA 1YCFA 3Q7IA 4MIKA 3BYZA 4ZV9A 2GKOA 1DS6A 1O97D 4LECA 2G04A 1P0MA 1EAMA 2DHRA 3GLVA 1F8XA 1ENZA 2F3PA 1GV1A 1G60A 2WWWA 3OX2A 3U3DA 1U7OA 3DHEA 4ZJPA 3WZLA 3IBTA 5BMVB 4DV6B 1B73A 3R9KA 4XUEA 4BGUA 1GCOA 4CUJA 2SKCA 1Z2PX 3R5FA 4DDWA 4A73A 4D5EA 1M2VA 4DLTA 4Z1OA 5CDYA 4OFBA 2IZOA 3EAGA 1G66A 2MSWA 3PR1A 4OSOA 2NT3A 3AQ4A 4JC8A 3ZNNA 2Q6OA 2Q3BA 1K75A 3BF7A 2BRUA 2ZSKA 3PI7A 5CCEA 2VSOA 4L08A 1A9PA 3CF0A 2XUIA 2IBSA 4BMCA 4YR9A 4XTRA 3LT1A 3MGBA 4A8HA 3OWHA 5E9AA 2YOGA 5DK4A 3OZFA 1DC3A 3IXQA 3LFUA 3STHA 3VDMA 2OV8A 1D1QA 2PSFA 5IU6A 1RQ2A 2YN4A 1JG7A 3QVTA 4I9UA 1XD2A 2YFYA 4KAAA 2BI7A 1X8JA 6CHYA 1L5RA 2X15A 1YB1A 3GDGA 4M7WA 4UUQA 2QXYA 1M8JA 5DX8A 4DABA 5KOYA 2CHFA 4KSBA 1I3KA 1MFZA 1Z5WA 2JFVA 3H83A 4NJOA 3X1DA 4ANFA 3VPDA 4B75A 2OZEA 4E08A 2JASA 5JVDA 4PLVA 3KZNA 3NYIA 1RLUA 4AUKA 4CLOB 5KWIA 1EWKA 2AI2A 1L5YA 3BSYA 3CISA 4GYYA 4J91A 3CPSA 2ZJ8A 3PGXA 3Q2OA 4TV8A 3D02A 2HHLA 1NG9A 4HFJA 2CNKA 4N9QA 2H7VA 1ORTA 3REFA 3SSMA 1DXOA 3F98A 4AN1A 4PQRA 4PPQA 1KI6B 4IMJB 2F1OA 1PE0A 5TMDA 3LM8A 2L82A 4ZO9A 2RE8A 1O9GA 4QJ3A 4PG5A 1X6VA 2RARA 4G1UC 1Y0BA 1E7WA 3RCBA 3UHAA 4QBGB 3U3ZA 4PIPA 3NANA 1T35A 1RZ3A 1RRFA 2FKNA 3TEMA 1GU7A 1KFCB 1V3QE 3H5NA 3LDHA 1GRNA 4W1QA 3B6MA 5H82A 3LGSA 1IPFA 4HB3A 3NB0A 3PGLA 4IM7A 4ND4A 4CHGA 4BATA 1AD2A 1HO3A 4W1SA 2O7SA 3OTGA 2OD7A 1BEZA 4CZ2A 3VKVA 3C7DB 5KNCH 2XDQB 3TQFA 3WWCA 4UUOA 5I8WA 3QKIA 3RRZA 1HZZA 4Z9YA 4ZAYA 1KSFX 2Y92A 2QBYA 1LF5A 1F9AA 2YQ5A 2GZ1A 1JEAA 1RI5A 4QELA 5BWMA 1ZAYA 3M89A 2J4CA 5LZ7A 3IQFA 2H5JA 1U3CA 5A5DA 3PFFA 2X5NA 1JLSA 2RHMA 4IJWA 5DN6A 5KOHA 4PN7A 5DEIA 5TQ2B 5A1TA 2J3IA 5ITSA 1RQXA 2F67A 3EXFA 3NT4A 2HGZA 1VBMA 1ZD2P 4R2XA 4YP0A 2JW5A 1GFIA 4OAQA 5BRNA 2H4WA 4IUYA 5F2KA 1OFHA 1J20A 4YQZA 3JQDA 3UAXA 2KQUA 1M2HA 4NYJR 3JQRA 4D4JA 5DNEA 2B99A 2CZCA 4FOPA 4EIWA 4JU9A 1UPFA 2YJ4A 5IN5A 1GYRA 2XB2A 2JHAA 3LC1O 4MUBA 1KBQA 4EGSA 1CUWA 1PFGA 4WX2B 1PJRA 2HRQA 2UKDA 2CKMA 4PFJA 4PX3A 5I7VA 3DTVA 4JB0A 1IOWA 3F7NA 5DIZA 3WICA 5JCXA 5TVGA 1JGTA 3LF1A 1OLSB 2XNHA 3GCGA 4FLFA 2SCUB 1T2DA 4DY4A 5BOSB 2IVFA 1LQ2A 4PLCA 4R3WA 3HEMA 2KWIA 2YNMC 2P90A 4ED9A 4KZKA 2AQHA 4R1UA 3V4PB 3QFTA 5AP9A 3BJMA 2Q0SA 4MMXB 4FSXA 2P65A 1G6KA 4BN0A 1CHNA 1V4BA 4WBNA 3WI7A 1W36C 1Y9ZA 4G1BA 3BHNA 4HEJA 5FWDA 5KTOA 3BZBA 4QU5A 2BMDA 1NN1A 1XZQA 4QUJA 4JBYA 1Z2AA 4DIEA 4E09A 4LYGA 3U9TA 2WYWA 2CZGA 4NCAA 3TAHA 2C4VA 3FWKA 2HIMA 3IH5A 3IFSA 4QNMA 2R8OA 2F9LA 3FKSA 4QFMA 1MT0A 5CPFA 4ZQIA 1S7CA 5BQPA 4RGYA 5DHPA 2DETA 1Z56C 3PQ4A 1JDZA 1F4LA 2ZB4A 5C8YB 2O8CB 3FGOA 3ABOB 3HKEA 1K6IA 1R0WA 1D6JA 4G25A 1QLJA 3DXXA 2YRFA 2RIPA 4JWKA 1E60A 2GUWA 4TWIA 3ZV4A 3N0RA 3RQIA 2NMVA 4WTOA 1MW8X 2AT1A 2O20A 1MGPA 3JYOA 1ND5A 2W93A 4G5OA 4RL6A 2ZTMA 3WIBA 4IMRA 3QLUA 2IT1A 4BKPA 3EVCA 4AMGA 1JFLA 4LXUA 3I0NA 1MG0A 4PSDA 1I36A 3KUXA 3PE3A 1Q12A 4KIJA 1JAHA 3UYLA 2WKPA 1IONA 3U61B 4KMRA 1T1GA 2PFGA 2B1QA 3HA2A 4EW3A 3QY9A 1YZ3A 2A35A 3C74A 2EBWA 1I30A 4BRSA 1O0SA 5KYKA 1YRLA 1U8XX 3PD7A 3OT4A 2BYTA 1ISSA 1QIKA 3OOHA 1JIQA 3DFUA 1NDHA 2DY0A 2P2YA 5H68A 3B52X 1A9SA 2PGDA 1SEPA 5FWXB 3EMBA 2ZULA 3UJ9A 2Z98A 4FE7A 5F21A 1JHMA 1R4ZA 3OQBA 1QF7A 5C34B 2IX9A 3ZLBA 3CVYA 4KIUA 1OZFA 3FMFA 4ZAGA 3ZWNA 3T1NA 4F4UA 2D6FA 1C4XA 3IUYA 2XGGA 3KB8A 5ED0A 4JOQA 4YCAA 3E5NA 1AUOA 4JVMA 5JS7A 2Z95A 3MLAA 4YAJA 2XEDA 2REQB 3PIDA 2FETA 2K87A 3E35A 1L8LA 1N1DA 1MEEA 4E51A 5HNKA 2EP5A 4LW8A 4C1NA 3KJEA 3BIJA 1FSPA 1IWPB 1TIPA 2J9XB 3O8QA 4RHUA 4BNYA 3HK2A 1JW9B 2KLHA 1GAJA 4BL5A 3DNMA 4DKXA 1XGKA 4QHTA 3MINB 5LWQA 1S8FA 3SC2A 3THXA 4QDKA 4Z0NA 4X3OA 1E66A 4U9IS 5A71A 1OF1A 3PFHA 3TOSA 4TXNA 4AWBA 1XTTA 3W7VA 1FMJA 1ZESA 1QVAA 2G9NA 4A8PA 5A3VA 1LX6A 1WZUA 2H3EA 1C1HA 1MCZA 1JB1A 1ADBA 4TZ6A 3AM1A 4O4HA 1IB6A 1XK6A 1PU2A 2BI4A 4UQLA 2BFBB 2CJFA 2FMUA 3EDYA 1ZL2A 3QKUA 3K9GA 1F2UB 2JI8A 4P4TA 4PC1A 1YDFA 2HF8A 2O5RA 1SXJD 1QFSA 3ETDA 1E5QA 3P5SA 2XA2A 1BOOA 1Z4KA 4NV1A 1DPGA 4GX1A 4RHFA 2J30A 3WK7A 4CCSA 5K03A 1ZNZA 3BB4A 2XCRB 5JRJA 3FJOA 1C2YA 2ZJ3A 1EA5A 2ZE5A 3M70A 1SKYE 3RI3A 3M1YA 5HF9A 1VA4A 2ZBVA 3EC7A 3EX7C 1O6GA 2V0GA 1J39A 4WN3A 1BCSB 1RDFA 1S5PA 2DWUA 2JKZA 2RGDA 5C4GB 1JECA 3A2LA 3FTEA 3KELA 2BFEB 1PJCA 1KTIA 2WTNA 3B48A 3LC7O 3AVTA 4C29A 3MRXA 3FMVA 3E0QA 1ADCA 1WDTA 3IPYA 2GN6A 2NV2B 4GAEA 4GO1A 4F5WA 2H11A 2PMBA 1BXRB 2PH1A 1UMCB 2DPMA 2VSXA 3D7RA 3P0JA 4QXOA 5ESXA 4EJSC 5H8WA 1OBOA 3KHSA 5CPBA 3ABZA 1PUJA 3UB4A 1C7EA 2X2PA 2WAMA 4Q4AA 3CNEA 1XZPA 4RTLA 4U1RA 4CL2A 3RC9A 1P9OA 5DEOA 2GM4A 2ZQZA 3HR4A 3O4FA 1WS6A 4Z4CA 1M8FA 3TMKA 3WIEA 3U48A 5HF6A 5JCOC 2J46A 4C7JA 2VH2A 3BUSA 2Q3DA 2ZYAA 3PGJA 3WRYC 1GKLA 2CSXA 1CUYA 1NXSA 2O0KA 3ESZA 2R79A 1Z6YA 4MUFA 5EZYA 5K3SA 5K8LA 2IJGX 1EQ2A 3RUDA 4G81A 1WQ1R 2K7ZA 4QLOA 4RVFA 4MRPA 3I6IA 2BDUA 1K0UA 2BHLA 5B64A 3EMDA 4OYLA 4PSCA 3G5UA 3CVOA 3LCVB 2XVAA 1R0YA 3L6DA 1SKUA 3L92A 4GLBA 3CT4A 2MIIA 5B1YA 3FYTA 3PI6A 4ZPJA 2JL1A 3TECE 5AI5A 3KD3A 4JFRA 3ZHCA 4ZT6A 5L40A 3KYCA 3LO5A 3BE6A 4UTPA 2ZM5A 1XKQA 3Q3CA 1G41A 4N7BA 1B6RA 4GF5A 4EB6A 4QGHA 3Q8KA 3HO8A 5DSZA 3HKDB 1T3ZA 4MW7A 1E3QA 5JYCA 3L05A 5TMPA 2ZP1A 1TEZA 1WXWA 1K5PA 4LVNA 5JAHA 5AJYA 2UDPA 3JASB 2NAFA 1CLUA 1ZHFA 2NN3C 4HN2A 4Y1RB 4YPVA 3EZGA 5AK6A 1COWA 4RE5A 1Z62A 5IXYA 1G59A 3NHKA 2VHCA 5K3AA 5COAA 3ZE9A 5IVKA 2VP4A 4PHTA 4HT3B 4N6NA 1TT5A 2Q62A 4L5BA 2Q2OA 4TTTS 1Z33A 1W96A 4CIAA 1WXEA 1VYTA 2JVJA 2R6HA 3OZTA 1BMFA 3HXMA 3SZ3A 3ESDA 4RXMA 2YZ2A 4ILEA 4ENUA 4HBGA 2H1HA 2R00C 2Q5JA 4WCFA 4YCMA 1H6BA 1P0IA 1BH6A 2Z57A 3NOQA 5E7QA 1UADA 3RTDA 1VSVA 4A03A 4BLOA 1XHFA 5G0WA 3GLGE 4MV4A 3EGIA 2Q21A 3OJCA 3BK2A 4GLOA 5JH7F 3EBLA 5CLQA 5EFOA 2FB9A 5AICA 1VP9A 4UHJA 3E23A 2I80A 1QO9A 4M8KA 4D97A 1ECFA 2NGRA 4AG3A 2XNCA 3CH7A 4D4KA 2W2LD 1XRMA 3DFKA 1OAOC 5FUWA 2VXBA 2VATA 3H16A 5E1MA 3HLTA 3K30A 1AQUA 3LCCA 3OX1A 2UUCB 3K0AB 2HMWA 4LGCA 4BIMA 1M6NA 4YMLA 5BSGA 3WVNA 1VOTA 2QGZA 4DSTA 4IILA 1TM2A 1Y8RA 2XUKA 4M9SA 4UNPA 4L15A 4LF7B 3G79A 4EFLA 1TYBE 2G5GX 2I0FA 1T5IA 2F1IA 2QN1A 2B36A 2V59A 4H7HA 4HDAA 1WXDA 2BEUB 1OA1A 5HIJA 3SYLA 3SJCA 3S2SA 4EYEA 2D7DA 2CLSA 3VR6A 1KVQA 3C3WA 3AJAA 4XPIB 1ECBA 1W5FA 3R8XA 3WL7A 1XPRA 4J3NA 2DWPA 3DCJA 3FIJA 1NX9A 2PU5A 3G9ZA 3GT4A 4BAZA 2YZGA 2QG6A 3RM3A 2X76A 3MBIA 3T1OA 4Z5XA 1NIPA 4HAZA 3MILA 3HI4A 3GXOA 5L4NA 4U7GA 3G2JA 3M5PA 3IVMA 2VOJA 1J9ZA 3EVNA 1D2EA 1NXVA 2FW8A 5KNBA 3DFMA 1R6XA 1NUHA 3QX7A 2VTBA 1NVVQ 2VA9A 3RSQA 2QN3A 1DLIA 1NP7A 2IQ5A 3I9LA 3MC1A 4K2AA 5FPKA 3H1BA 3GR6A 3H9UA 1EFPB 3K1AB 4PN3A 4QASA 1G291 2CUTA 4G84A 3G85A 1R0LA 2VJLA 2XYVA 3OUZA 4RAQA 5D3KA 2Y93A 5G4KA 4MA0A 3ZY6A 1XZ8A 1DQYA 4EENA 3Q8MA 4AQ7A 3DVSX 5EY5B 2AW5A 2DXIA 3ACCA 5DDIP 2FP4B 2HEIA 4GLFA 4UCQA 4A10A 8GPBA 2I1LA 1IK4A 3NHWA 1HNXB 2CLKB 3P0IA 1Y7TA 1DFGA 2R6ZA 1DX6A 1KOJA 3CZPA 3LQYA 3CX8A 4B6OA 5GZ3A 3GFPA 5DGHA 2NU9B 3W9UA 2I8AA 3A25A 5CYOA 1LH0A 2NZUG 3UJ6A 2DQYA 1R15A 4Y1GA 3HVRA 3OLCX 2EBHX 3NUZA 4IKOA 3AJ9A 3A4TA 1E5XA 4CT5A 2BF4A 3H97A 1UKZA 1TJ4A 1PW5A 4QPNA 4U5XA 3M4NA 2IS4A 1KKLA 6LDHA 5DNCA 3GFRA 3ZNPA 2DT5A 4E3ZA 1GUFA 3AEUA 2VP9A 4WOKA 3HADA 1GGFA 5HK9A 1XXLA 1Z0DA 4YT5A 3VSAA 2W00A 4L3WA 2QTVA 4AZSA 3OC0A 5AQEA 5CR9A 4RPKA 4IV8A 1F1JA 3VR2A 1DC8A 2WILA 3C0KA 2HN9A 2VH5R 2VT6A 4E1AA 2VF2A 4TSFD 2DKNA 5AK3A 1CUEA 1JLRA 5HUHA 4LDNA 3ME5A 3MTIA 5B7NA 1NZJA 2HLDA 1H2EA 4FHGA 1R88A 1PNOA 3LDGA 1C8KA 2I9KA 2C58A 3KZXA 1P75A 3PV0A 4GZMA 4CEHA 3HO1A 3GGGA 1M1ZA 1GARA 2H85A 2WF9A 4G63A 4YIHA 1KDPA 3AGPA 3WLOA 3EZ7A 1NBME 5KQRA 1XQ1A 3OLYA 2OM6A 4H08A 3UA3A 1NN5A 1Z8HA 3AETB 2D2XA 5KYXA 2WWXA 3QVGA 1T91A 2JAPA 5CURA 3CKMA 4ZVOA 5AXBA 4JGGA 4LV8B 1N7JA 1QFXA 4GNKA 2P78A 4DLKA 8ABPA 1HEUA 3EPLA 1V7PC 1X1RA 4U6NA 1XJ5A 5DOVA 2W8ZA 4HX5A 4OJKA 3I30X 1G5TA 2NUBA 3RSHA 1RXIA 5E6RB 3U4QA 4PHHA 1P0CA 1XMSA 3ZU5A 5DW3A 5K0SA 3H5AA 4M0EA 4QQ8A 1KQGA 4EHFA 4OGKA 1PZMA 3I5AA 2W6JA 3VR4A 1JSCA 1EIZA 3E1KA 3HEBA 1JH9A 1XVVA 1PFYA 1KI2A 3FDJA 4EZEA 3FHTA 4JT8A 3TLZA 4IJVA 4BLUA 5E0OA 4DWWA 2RG7A 4B3RB 1I2DA 1UM8A 3RAJA 4KVGA 1X7WA 2WPDD 2QL7A 1XLWA 1EXVA 4CGYA 3BRCA 4BJ5A 1H8HD 3P0HA 1CQIB 2V9ZA 1P3DA 5LMZA 2YXLA 3H3JA 1PZEA 1ZL0A 3UTCA 2GBGA 5FIUA 1ZK3A 3B36A 1QIIA 4RHXA 5FWAA 3TS1A 3T1VA 5JTTA 2FEPA 4QQKA 3DZKA 4FONA 3B6ZA 2GH1A 4Q7EA 2B78A 1UFOA 2P2DA 1ORHA 3AHFA 3ADCA 3ICWA 1DBRA 1D4ZA 2CXHA 2I8CA 1Z3IX 5FORA 1SBQA 3UJ7A 2DULA 1F2DA 2XTJA 4M1WA 4V3CA 4R1NA 5AOCA 4N1AA 1S3GA 1YXMA 4N5LA 4I6JA 4DUGD 3FOCA 3VDNB 5FL3A 1M1NB 1G4HA 1V4VA 3D3NA 3GFBA 4IIJA 4OA5A 3LGAA 4RMHA 2YOFA 4Z7QB 2DTDA 4IVRA 2JK1A 3OKFA 1GQRA 1GRCA 1MJ5A 1OIWA 2OPBA 2OV6A 3I5MA 2VJYA 3ND5A 3OPYI 4KX5A 2FGJA 4UEOA 5P8WA 5CFZA 2RMKA 5K0GA 2PXXA 1NW6A 3GJ6A 2A78A 3I01A 2GRJA 3OU7A 4UMEA 1U7UA 2WTXA 1OASA 4XDGA 1ZVMA 3HB4X 4GZLA 4FEGA 1DTSA 4GUDA 4ND5A 4ARAA 1PS8A 2IP1A 5JVDB 4DS3A 2P8SA 2CXXA 2FZWA 3I64A 2CDNA 5J58A 5MFPA 1B43A 4NEQA 2BMAA 1FXWF 1H5NA 4NBVA 1IIRA 2FWMX 2J5KA 1IJFA 4E31A 1YZHA 3O4VA 1UXOA 2H1CA 4KXNA 4TXHA 5DT2A 4YDRA 4Q7QA 4R9NA 4POOA 3W3AH 2PN1A 1ACMA 4I4TA 5CP8A 1JHZA 4UNNA 4AN0A 3MOSA 1I4WA 1X8LA 4S1VA 5I7FA 1OR8A 1W5TA 2BAGA 3FFXA 3ZOKA 4HMPA 4KXUA 4NFYA 1QYWA 2WQ7A 1YOVA 4LN1A 3AP2A 4RPJA 5E6UA 2HFJA 3BULA 5EJ4A 3W5BA 1ICIA 1OX6A 4TMKA 3H2BA 4K9DA 3F2VA 4WLNA 1KR5A 1DJNA 4ZU3A 4UOQA 4Z1MD 2IA5A 1AA6A 2LCQA 1YFJA 1XT6A 1YASA 2IPXA 2XMQA 2GJ4A 4EQ6A 2WT9A 1ZJ6A 4H3KB 1KVSA 4MHSA 3LLVA 2GN8A 2XUZA 3CCCA 2XMBA 4WJZA 3T4XA 1AS3A 2I91A 3BMNA 4ZZ2A 2XOEA 4ALJA 4BYGA 2X1VA 3HXQA 2QLTA 1IY2A 5E3IA 5SYNA 3QUSA 2IVZA 2DUWA 4C4RA 5IUNC 1ZSNA 2XT9A 5KOHB 3HGTA 1N3YA 2WU4A 4IS2A 3VU8A 3AUJB 3G02A 5BYAA 2O5CA 3CR3C 4PYMA 1FE8A 3NHYA 5D87A 4AP6A 1CFZA 2CXUA 3EXFB 4UXJA 3AJEA 5CCXA 5H4GA 2Q07A 2PGLA 2SNIE 3JQGA 5FNVA 4YP9A 3U4IA 3T8YA 2V54A 1PGPA 1YVEI 4WESB 4EO9A 4XLLA 1E89A 1F6BA 1LRLA 4R4JA 4W5OA 2GESA 4G8JA 4CLEA 3ZHSA 1T3HA 4WVLA 3QFSA 3PTAA 4NENB 1NJ8A 1I6LA 1ZJJA 3COSA 2BKVA 2QUKA 5HIMA 2PUGA 2QW8A 2GPTA 4OBBA 1EEXB 3DTVB 3KPUA 1X1EA 2GXUA 1NBAA 5IBCA 3T7JA 1EH5A 3CF4G 4LZAA 3V2IA 1G8SA 4HLCA 4NTZA 4M49A 5ITZA 2WYOA 4PLFA 4RY8A 3KQHA 3Q1KA 3QSGA 1NQUA 1T8PA 4M7OA 2AN1A 3HA7A 3T5MA 1I10A 3HL4A 1RJ9A 1XCJA 2C1EA 2RHDA 3I5UA 3K1JA 1HZJA 2RKBA 4B6EA 2FXVA 2A9RA 2W4IA 4YUWA 2R8XA 1AKUA 4XARA 3H4VA 1NVWQ 1B3BA 1VLZA 1LPAB 3B78A 2FJ0A 3IILA 2NUAB 2Q5CA 1MPXA 5AJVB 4FXOA 1U3VA 1Z73A 1SQ6A 4LXYA 3NM4A 1IAQA 3WDLA 1M0TA 3N0WA 3CSSA 4GX0A 4YX9A 1J1ZA 1NJGA 2E87A 4XTCS 2QTMA 1MU0A 4GOMD 3IAS1 4XI9A 5AJWA 5AUQA 5CH3A 4FDVA 5THKA 2Q28A 3S5UA 4HQRA 4A8JC 4B34A 4B3HA 3JPYA 3WLAA 1SK9A 5HJ2A 3F2IA 4FFOA 2PKEA 4GXQA 1GPUA 3A3NA 5JMPA 4K8RB 4CQLA 4DN6A 1RS0A 2BHRA 3T7TA 1CY8A 3K70D 1P81A 5K20A 5LR6A 1PEAA 1FTNA 2ZR7A 1HDZA 1KQOA 1YZFA 5B3JA 2MU1A 1D2RA 3N05A 2LTAA 4UVHA 2Q1TA 2V7BA 4BFCA 1XA0A 4OKSA 4UC0A 3AILA 1R5BA 3ZGNA 1QP4A 2PRZA 4MWEA 2E4WA 3K35A 1E9SA 1TMKA 2V96A 3N3BC 1MXHA 4QAJA 4Z0TA 5BSUA 4I50A 3T9CA 5JIBA 5AUOB 2GRUA 2E82A 1GKU