2H7XA

Pikromycin thioesterase adduct with reduced triketide affinity label
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
284
structure length
279
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I polyketide synthase PikAIV
publication title Structural and Mechanistic Insights of Polyketide Macrolactonization from Polyketide-based Affinity Labels
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h7xA00
2AJLI 5AKHA 3G02A 2HHAA 2IX9A 5A71A 4KRXA 4FHZA 4UUQA 4P93A 4FBLA 5A7FA 1VE7A 3STTA 3O9MA 3SWWA 3GA7A 1O6GA 2QUBA 4W1QA 3BF7A 5AKJA 3WLAA 1AMNA 1CUHA 3STVA 1TCCA 4EHBA 4Y2SA 3H2GA 4W63A 5JZ9A 3WKCA 3WWPA 4DMHA 1VLQA 1KU0A 3ZI7A 3FNBA 3LIPA 3HSSA 2WUFA 4PNZA 4RE6A 3FSGA 1LGYA 3F97A 2DHEA 2ZYRA 1N5RA 1B6GA 2O7RA 1QTIA 1XZBA 5FV4A 3HEAA 1QIMA 3C43A 4G1FA 4BATA 2B4KA 2DSNA 1N1MA 3A2NA 1N5MA 3WJ1A 4PF1A 1LZKA 2XQIA 4A5SA 3B3QA 4UBKA 1VA4A 5KREA 1XRNA 1LZLA 3D5EA 3SX4A 3BF8A 5AM2A 2WJ3A 3C70A 1EA5A 1I6WA 3FYUC 4PV7A 4QWMA 1JT2A 1FFDA 4Q34A 2QR5A 4XJVA 2ZYHA 2BUAA 3I2GA 3X3HA 4JYMA 2QOEA 1YCDA 1YR2A 1ZIYA 4X71A 2R11A 3G9XA 1Y7HA 3R3UA 1J2EA 4B81A 5JATA 1A8QA 2PSJA 4P08A 3WK8A 5HK9A 4FLMA 3G0CA 1AURA 2OGTA 1QIDA 5E4YA 2K2QB 2XMQA 3O0DA 3VISA 5CT5A 4H0CA 3C8HA 3G0GA 4AMYA 4E15A 1CVLA 2JGFA 4KE7A 1ORVA 3A2LA 4WDRA 5BV7A 3HJUA 4H7HA 4L9AA 5CT9A 4GW3A 2QTBA 4DIUA 1ZICA 1JFRA 2ACKA 4WFIA 4C89A 3O4HA 5HF8A 1A8UA 1W52X 4AMZA 4E14A 3IIIA 5IVKA 3EQ9A 2HA6A 4HXEB 4Y7DA 3HLKA 3C5VA 1HKHA 3K9BA 4Y2UA 5IVDA 2WJ6A 3TJMA 3WK4A 3RKSA 3LS2A 3TGLA 4PQEA 1JMKC 4H35A 3B5EA 3DDUA 3I6MA 1B41A 2ES4A 1QIEA 4DSZA 2WG0A 1CIJA 1SCIA 1ACLA 2WJ4A 4J0GA 1EB9A 3WMRA 3I2JA 5FDFA 1M33A 4MJ3A 2ONCA 4BVLA 4UHEA 1CRLA 4B80A 1VXRA 5T4HA 2HDWA 4B9EA 1P0PA 4TGLA 5LP1A 4BP8A 1S8OA 3TRDA 2QS9A 4DTCA 1CQWA 5EFZA 3D2AA 3E0XA 4GWLA 5DYTA 2E3JA 4K2AA 4KE9A 3P2MA 5HKAA 4OU5A 4INZA 2UZ0A 1TAHA 4BYMA 4ROTA 1EB8A 4ITVA 5ALPA 4LKOA 3H1BA 5FOQA 4RGYA 4Q3OA 4H7EA 1LPSA 5FRDA 4DNQA 5KWIA 1W4LA 1DQYA 2WIGA 4M0MA 4B85A 5AKXA 2XQGA 1QO7A 3DEAA 1ZI6A 5FP0A 5HFAA 4UHFA 1CUIA 2ZYSA 3GZJA 4N5IX 1XZJA 4MEBA 1EXWA 3WKEA 4AZ3A 3T4UA 4G8CA 1E8NA 3QMMA 4JYPA 4J3JA 1MPXA 3BE8A 4WY8A 4HXGA 2PU5A 3W9UA 3BWXA 2V97A 3L1JA 2BJHA 1WPXA 3PUIA 1CLEA 3FVTA 4X92A 5HCUA 5H3HA 3FLAA 3FSGD 3M82A 4GXNA 2XQFA 3C5WP 2ZJ6A 3V1NA 2CUTA 2EDAA 3MGAA 5CT8A 1BN7A 5AKLA 3W06A 7YASA 2WHQA 5CURA 4X3CA 3F8SA 3WWOA 2HFKA 5AOBA 5DLPA 3V1LA 3I2HA 1ZJ5A 2Z3WA 3HI4A 4B82A 1DX4A 3DKRA 2CBGA 3LP5A 4DYHA 5ALSA 2OAGA 1R9MA 4G8BA 1PV1A 1UK7A 4G5XA 2PSDA 4YK7A 3DNMA 5ALEA 5ALMA 3DQZA 4L0CA 3O95A 5JAPA 4ETWA 1J07A 1F8UA 5ALZA 1EX9A 1XFDA 2WG2A 5HZGA 1R50A 3WQHA 5ALTA 4FFVA 2H1IA 2WIJA 1X70A 3WL7A 3OURA 5K3AA 4FWBA 5JD4A 4I4CA 3QPDA 4IQ4A 2XMZA 4H7DA 4OU4A 1RYYA 4H7KA 1WHTA 2XUOA 4DNFA 3DJYA 1CV2A 2B20A 3UUEA 5CW2A 2FUKA 2X5XA 5AKYA 5HQ3B 4UPDA 1L7QA 5CT4A 2Z8XA 1QIIA 4B84A 6YASA 3GUUA 1XRQA 4BAGA 4DMFA 1H2XA 2W6CX 1QIKA 5CRIA 4BCBA 5ALNA 2XMDA 5T4EA 3AIMA 5EHQA 5LKRA 3ESCA 3IBTA 4K6KA 2HRRA 1E3QA 2J4FA 3O9VA 1GXSA 3WK6A 4K5QA 3W2TA 1SOMA 3FYUA 1EI9A 1UKBA 1GQSA 4OD0A 3IURA 2W22A 2PX6A 4DNOA 1XRRA 4BZZA 1USWA 4UBIA 4FBMA 2YASA 3I2KA 2JGKA 3L1IA 4QLOA 1THGA 4LYDA 4GHWA 2OGSA 4YX9A 2C4HA 2VT7A 2XUKA 3VXKA 1OILA 5HF9A 4I19A 3R3XA 3I6ZA 5DNVA 1C4XA 5AK5A 4WDQA 5BWCA 2HA3A 2BGRA 3D0KA 3H18A 3IUNA 2GYUA 1O6FA 5D6OA 2RHWA 3OTQA 1LPAB 5AI4A 2QKYA 3H2HA 1G42A 5LZ5A 4V2IA 2CJPA 2QMQA 3ESAA 3G0BA 3BJRA 3KD2A 2OGZA 1WM1A 2FX5A 1BCRA 5AJHA 5DJ5A 2VAVA 2Y1KA 3STXA 3QZUA 5CT6A 4CG3A 1XZDA 1Q84A 4OB7A 4E46A 4L72A 4G8DA 5EGNA 4X91A 3C6YA 5I8PA 3PF8A 1ZD4A 4GBGA 5FPPA 4QZVA 1UZAA 1UOOA 2YYSA 2VJDA 1TIBA 4WJLA 4WY5A 3STUA 5AICA 3WL5A 5IKXA 1THTA 3QM1A 3VJKA 2DQYA 4W1SA 5FUMA 3LIIA 3D2BA 2OLEA 3CN9A 3QMWA 2XUPA 1E8DA 2V98A 1NX9A 1UKAA 1UK6A 2HA4A 1XZIA 4JUIA 1TQHA 4U2CA 2FJ0A 3WIOA 4X85A 4H77A 3G9TA 2GYVA 3QBJA 4BTVA 2C58A 3BXPA 1CR6A 3I2IA 5K3DA 3HZOA 2JEZA 2ROQA 2AJ8A 4K6HA 3PE6A 5EIHA 2OCKA 2OG1A 2P8SA 3AIKA 1UT6A 3FBWA 4KAFA 4Y2YA 1FJ2A 4J0JA 2ECFA 3R3YA 4P9NA 5HF5A 2Z3ZA 2D5LA 2WM2A 4G4JA 4HVTA 3S2ZA 4OSEA 4J7AA 2JGIA 5HQ3A 3HC7A 4HXFB 4F0JA 2DFPA 1YSCA 1PJAA 4Y9SA 4Z49A 2RGUA 1UKCA 4IHAA 2RONA 4J03A 2ORYA 4QLAA 4F60A 1GZ7A 5JANA 4W1PA 5CH5A 4AB1A 2DHCA 4EY5A 2QXTA 2WQZA 2PSEA 5CTAA 3PF9A 1P0QA 4X94A 3WK7A 4BZWA 1KU6A 1XQYA 2XMCA 3F96A 3OPMA 3H19A 2CEKA 4UBNA 4C6HA 5ALVA 2J3DA 1MTZA 2GBIA 1JJFA 3DL4A 4CFSA 4DNPA 1IUPA 2JGMA 4WFJA 2YXPX 3VKFA 2OXEA 2X8BA 2B61A 5BOVA 5JYCA 1CFJA 1YB6A 1CUCA 1EDBA 3DKKA 1GQRA 1D07A 3U0VA 1XQWA 3PDCA 3ANTA 4XIIA 2WHRA 3D7RA 3ANSA 2ZJ7A 4N5HX 3WL8A 1TCBA 1A7UA 1ZOIA 4QDTA 3A2MA 2WLSA 4B83A 3C6XA 5J3JA 4KE8A 4OYLA 2BUCA 3WYDA 3O4JA 2O2GA 5AM0A 3N0TA 1IZ8A 3ZLTA 5JAHA 5K3BA 3M83A 2VT6A 2HFJA 5AM1A 2WTNA 4FNMA 2Z8ZA 3JYHA 3KDAA 1DQZA 4X95A 3OM8A 1MAHA 4X90A 2HA5A 1XZGA 4OYYA 4C88A 3WKAA 5F4ZA 4EY4A 3IUJA 3E4DA 5AO9A 4OCZA 1E66A 5AM5A 3H2KA 1L7RA 1T2NA 2WUEA 1GPNA 2C0QA 5AIBA 2HM7A 1CEXA 3KXPA 3W9BA 2QUAA 5LIPA 3EF3A 4HRXA 4OB8A 3V48A 2GYWA 3AJAA 4FNGA 2XE4A 1VA5A 3EQ7A 2I3ZA 4N8SA 2HA7A 2X76A 5ISMA 1SC9A 3G0IA 1N8SA 3VJLA 4L3WA 1LLFA 1H2YA 3CXUA 3BDIA 4AO6A 3FYUB 1YAJA 4RE5A 4UHDA 3WIBA 1ODSA 3QMVA 3C6BA 4Y2TA 2CKMA 1FSSA 3B12A 1AGYA 4W1RA 1E8MA 3F98A 3Q8WA 2XUQA 1YB7A 1WOMA 3HYSA 1U2EA 4EY7A 4XX1A 4NZZA 1XQVA 1ZGBA 5DNWA 3LLCA 4EY8A 2PL5A 5D7BA 1QIFA 3R40A 2V96A 2XB6A 5T4BA 4AN1A 2XMBA 1W75A 2H7XA 1MT3A 2QJWA 2RI6A 2AXEA 1EVQA 2HA0A 1HL7A 2GBGA 5AKZA 3WWDA 4MXDA 4LXIA 3K2IA 3R41A 1XLWA 4UBLA 2JGLA 3ILSA 5AI8A 4PSCA 5C8ZA 1YASA 5DWDA 4AZ0A 1F6WA 4PW0A 5A2GA 4ARBA 2C7BA 3TEJA 4UBJA 3EQ8A 1T4MA 2VSQA 3FCXA 4ZXFA 2C5GA 5A62A 4OPMA 2PSFA 5JD6A 2QXUA 3AFIA 2CZQA 2HU8A 1SCQA 1QLWA 3I1IA 4G4IA 1EVEA 4BRSA 4NVRA 4I3FA 4UHHA 1BEEA 3F67A 5JIBA 4G9EA 4AXBA 2OPHA 3PI6A 2XQKA 2G5PA 1AQLA 4HAIA 4FMPA 4YASA 4EA6A 4AX4A 1Y7IA 1UK8A 2BFNA 3H04A 1X2EA 1CUXA 1XLVA 1ISPA 1EH5A 3R3ZA 1XLUA 5AK3A 4EB0A 3HACA 1DU4A 1XZLA 5ALJA 1AX9A 2BKLA 5C7YA 4BB0A 2WHPA 2OCGA 4Q05A 1IZ7A 4QDXA 1K6EA 1BEZA 2XUAA 3WWCA 3FLBA 2RAUA 1ZGCA 5LLSA 3G0DA 2XUIA 5AP9A 1PFQA 3ZLUA 1XROA 1TKRA 3WKBA 3PUHA 5A6VA 2WILA 4CG1A 2H7YA 2WFLA 1VE6A 1LBSA 1WB6A 3RK4A 2G4LA 3DYIA 3OC0A 4RNCA 4UHCA 1G4HA 3VVLA 1DT3A 3DOHA 2EEPA 3AUKA 4FOLA 2QM0A 1MNAA 5ALHA 2QJRA 4S0XA 1JI3A 1CUEA 2PUJA 3DCNA 5D3KA 1XZMA 3NWOA 2GBFA 4Q82A 3G7NA 5ALWA 5JADA 1F0PA 5LZ9A 2XLCA 3IUQA 4Q1VA 4BC1A 1IUOA 4X6XA 1VJ5A 2PPLA 1DWPA 1AUOA 1K5PA 2WU3A 2DR0A 4KAAA 3E1GA 5KBYA 3M3DA 5HFNA 5AOAA 4MWSA 1HBJA 3ESDA 4GDMA 3DOIA 1MX9A 2HADA 5K5EA 4CCWA 1ZD3A 3ED1A 1WPRA 1UXOA 3ZV7A 5T4FA 1XZKA 4H18A 3FAKA 2RHTA 1CUZA 1BRTA 3L1HA 1TK3A 3BDVA 4IO0A 5KWJA 5D3ZA 4QWWA 1X2BA 4BRZA 4AO8A 2WU4A 3A6ZA 1CPYA 1U4NA 3I6YA 3BIWA 1UOQA 5ALLA 1SFRA 4OB6A 1W6RA 4BCCA 4MYSA 4PSDA 1LPPA 4TVKA 2I78A 1MAAA 1K63A 3KWJA 2VA9A 5ALQA 2Z5GA 5DTJA 4BVKA 1H2ZA 2EDCA 1CUUA 2I03A 3R3WA 3R0VA 1GPKA 2V9ZA 5AHXA 2XI4A 5AM3A 2Y2VA 2C0PA 2GBCA 5DNUA 3AZQA 1ORWA 1U8EA 5HF6A 1SCKA 1XZAA 5IVHA 5AKIA 4YPVA 1K4YA 4GLBA 3PFCA 4KE6A 3D4LA 1Z68A 4DLNA 3WL6A 1ZI8A 3BL8A 1MNQA 3STWA 5FPQA 4Q3LA 5EHXA 4B6GA 3A70A 3C6ZA 3AZPA 2XMGA 1DT5A 3FCYA 4LXGA 4QDUA 3HABA 1HLGA 1CUBA 4RPCA 1ODTC 3C87A 2WUDA 2Y6UA 2WIKA 4N8DA 1DX6A 4BBZA 2Y2UA 1ZD5A 5ALGA 4ZV7A 4BTLA 1R9NA 2AJCA 4UFNA 5FKJA 4BAZA 5IH7A 1UOPA 1DWQA 2NW6A 3M81A 4FLEA 1QFSA 3U1TA 1Q0RA 1CUWA 2I3DA 2PM8A 3FWHA 4BE4A 1HQDA 4P92A 3IVMA 1XRPA 3WWEA 5SYMA 3GROA 3AILA 1BE0A 1RP1A 3GBSA 2WFZA 1BN6A 1MO2A 4QE3A 5EIEA 3FVRA 1OCEA 4AN0A 1WB5A 3T52A 3FOBA 2ZVDA 1JJIA 2C5FA 1K8QA 3QH4A 3OOSA 1JU3A 1ODCA 2XDWA 4Y2RA 4U2DA 5JASA 3HXKA 4J0IA 3IA2A 4Y2QA 1W1IA 1MJ5A 5JAUA 3QVMA 3IB3A 4B0OA 4QDZA 4JEIA 1TCAA 2PU7A 1JU4A 1XKTA 2OQIA 3G8YA 3AINA 1CUGA 4QA9A 2DCMA 2O2HA 3D2CA 4FKBA 4UHBA 1HPLA 4WCVA 1QIGA 2LIPA 4X93A 3ZPXA 5AKKA 3WYNA 1FFCA 2VEOA 1GT6A 5E4TA 1WHSA 4KR0A 1H2WA 2VJCA 1VXOA 2WIDA 1UWCA 1CUAA 1EHYA 1LPMA 3ICWA 3W04A 5CXUA 1A8SA 1YS1X 2AJBA 5AOCA 1C7IA 3SC2A 1XZHA 3R3VA 4JH0A 1E89A 2XUHA 4C4YA 2QRUA 4AO7A 3BIXA 4G9GA 1FFBA 3NGMA 3IDAA 3C8DA 4DM7A 4FDMA 5DYYA 4BE9A 1IVYA 2XQJA 3DD5A 1DINA 2VJBA 1J1IA 2WHPB 4B7ZA 5I7UA 1H22A 2ZSHA 4BDSA 2FJPA 3I1YA 1EINA 5ALXA 5JAOA 2JGJA 2ZSIA 4ZGBA 4CIAA 1QE3A 3JWEA 5LZ2A 1EK1A 5AK4A 4AQDA 3Q0TA 2DHDA 5FXMA 2OQVA 1JJBA 1AKNA 4LXHA 4Y2JA 5HKBA 3JW8A 1BROA 1XZCA 2YH2A 3CN7A 3MVEA 3IULA 4BC0A 2WKWA 3CCCA 3ZWQA 5I9IA 1CUFA 5ALRA 3GFFA 5SYNA 1U65A 1CUYA 4K6GA 2WFLB 4FTWA 5ESRA 4UBMA 1BCSA 1LPNA 5EI5A 3WA7A 1NU8A 5LZ4A 2ZYIA 3PICA 2IIVA 3YASA 2J3QA 1CUVA 4TPKA 1GKKA 1ACJA 2CMFA 4BVJA 4WFKA 4EZIA 4U2BA 5DYWA 4IH1A 4MYDA 5JZBA 4KEAA 2OCIA 1A88A 4KJXA 2CB9A 4CI9A 1XZFA 1E5TA 1XRLA 1YA4A 2OAEA 3UUFA 3CCBA 3LCRA 4J0CA 3KSRA 5DTIA 1DTEA 2XT0A 3GELA 4X6YA 1Q83A 1MX1A 1VZ3A 1CUJA 2Y6VA 3VDXA 5CH8A 3WI7A 1ZD2P 4HTAA 5YASA 1L7AA 4KAJA 1IUNA 2JGEA 5CH3A 3VVMA 1FFAA 1R88A 2R8BA 1MN6A 1EK2A 4Y2PA 1P0IA 3V1KA 4PO3X 4DSAA 1GGVA 4BDTA 4UFPA 2QT9A 5CBKA 3AIOA 3QPCA 4DGQA 2PVSA 5IVIA 5K3FB 5LZ8A 2VQ6A 1QFMA 5AM4A 1VKHA 1KEZA 4CIBA 4NMWA 5C8VA 3D3NA 1JMYA 1ZJ4A 4KRYA 3H17A 4GECA 5JZSA 2QVBA 3G9UA 4BAUA 3QITA 2PUHA 3H1AA 5ALDA 3KWFA 5EHNA 3STYA 4C01A 4MWTA 4KACA 4JNCA 2OCLA 2QZPA 3VJMA 4X6UA 2VTVA 1LPOA 4E11A 1P0MA 2BAGA 4M0EA 1ZIXA 4Y2VA 5CXXA 1AZWA 1EDEA 2XLBA 5K3CA 4G4GA 2XUGA 4CCYB 3IUMA 3DYVA 4H7FA 2HU7A 4A23A 3K6KA 2J4CA 3N2ZB 1NU6A 4MEAA 5C81A 2IITA 5CMLA 3I2FA 1CUDA 2HRQA 3DL7A 4Y2XA 5AK6A 2WSLA 1VZ2A 4CG2A 1QJ4A 4ARAA 5LKAA 2HL6A 4D9JA 4ZREA 5A7GA 4J0HA 2VATA 1OXMA 5C8XA 1QZ3A 1YAHA 2XMSA 4FLFA 5E4JA 1XRMA 4IH9A 3RLIA 3DS8A 2VAXA 3WZMA 2Q0XA 3MUOA 2B9VA 4BCDA 4C4XA 2WFMA 2VF2A 1LBTA 1EDDA 5K3EA 4C87A 4W9RA 4C4ZA 3RARA 3OG9A 1G5FA 1YA8A 3W05A 4QDOA 4ZWNA 4HRYA 1YS2X 2O7VA 3RM3A 4DMCA 5AKGA 2ZJFA 3WKDA 3MUNA 1TRHA 5AIAA 2DQZA 3HRHA 3H2JA 4Q3KA 2H9YA 4LIPD 2GZRA 3ESBA 2O2IA 5ALFA 5AH0A 3AZOA 4KYVA 5ALUA 5BWBA 4J0KA 2XUFA 1R3DA 5JALA 4XWGA 3WA6A 4NS4A 2WUGA 4LHEA 1AC5A 1GKLA 5EIAA 3E3AA 4GI1A 4X97A 4GEGA 4PSUA 1W76A 5AI5A 1MU0A 2BUBA 4XVCA 1DWOA 2RIPA 2G63A 3ICVA 3UMJA 1RWQA 1GPLA 2D0DA 4U2GA 3V9AA 2JEYA 1XZEA 3PFBA 3I28A 2H7CA 5LZ7A 3KOOA 1G66A 3DLTA 4X00A 4DMKA 2WG1A 4MQMA 1QTRA 1HDEA 1IMJA 1H23A 4ZI5A 4J0DA 1R1DA 4B9AA 1XQXA 1R4ZA 4U2FA 5K3FA 2VJAA 4U2EA 2HA2A 2XUDA 1F0NA 4A16A 1LNSA 2XMRA 3WK5A 4MQLA 3NOXA 5ALYA 3SK0A 4EY6A 3BJMA 1CQZA 1ZI9A 2G5TA 1C7JA 1WCYA 3O4GA 4ZV9A 2HU5A 1UFOA 2PKYX 4EUSA 2JIDA 1QOZA 1JKMA 3ZLVA 1QGED 4UFOA 5A7HA 1MX5A 5AKEA 4LYEA 4HZGA 4H7JA 2ACEA 1QIHA 2PSHA 4F5ZA 3D59A 3NUZA 4OUKX 3QPAA 2BGNA 4B0PA 3O4IA 3FLEA 1Q0ZA 5EHZA 1XKLA 3C45A 3WZLA 4CCYA 5FLKA 1QONA 2HIHA 3S8YA 1VOTA 2WIFA 4X7BA 1FFEA 4BP9A 5AI9A 5HK8A 4F21A 1ETHA 4QNNA 4O08A 5ALOA 5ALIA 3EIOA 5JARA 2JF0A 5AI0A 3EBLA 3F9CA 2PBLA 5JD5A 3WJ2A 4ZRDA 1LPBB 2JBWA 4EBBA 2BCEA 5ALKA 1BS9A 1QO9A 2WTMA 4IH4A 3QYJA 3G9ZA 4HS9A 3WK9A 3FYTA 3H2IA 4H7IA 5LYYA 2XUJA 1QIJA 1WB4A 3V1MA 2AJDA 1BU8A 1Y37A 4FFWA 1UK9A 5E2IA 1J06A 4QEKA 5AI6A 4N8EA 4UBOA 4M0FA 1CUSA 3H0CA 2GZSA
chains in the Genus database with same CATH superfamily
3MCTA 3A1VA 3ASUA 3AHDA 1DI0A 5HE9A 3RREA 4A1FA 3SQXA 3B3AA 3F71A 3JD4A 1CY4A 3G02A 5B1SA 4Z3DA 2HHAA 1JECA 3FMGA 1UPAA 4YRDA 3TAUA 1FUUA 3R9XB 4NL4H 1NRIA 1WCWA 2QM3A 3ZE9A 4GKVA 4FHZA 3SEAA 1SXJA 4QM7A 2F1JA 5EUMA 1H1TA 1OD6A 4V3CA 2F8SA 4JEMA 2XSZA 4K8OA 2JANA 5JSKA 2R4QA 1WW2A 4WUTA 5A7FA 5JCZA 1E3LA 2J7KA 3NYWA 2PL3A 2YHAA 3KKMA 3SWWA 2VSXA 1T2EA 2CCKA 2V8BA 3GA7A 1Z0AA 1T9CA 2QN7A 1F38A 2QUBA 5DHAA 2PO5A 4UCWA 3MJRA 2P91A 2C59A 4KQKA 2DEUA 2J0SA 3QG5A 1X9IA 4C7XA 2JGDB 3ZH9B 1Q92A 2OHVA 2V03A 4HEA1 4IFBA 5IC4A 3T1HB 3I2YX 1CJBA 1ISHA 3AR9A 7MDHA 4AICA 3A6PC 1OASA 2WI8A 5EC8A 5GY7A 4OL0A 4ARIA 3BZUA 3BXHA 1YGYA 4Y2SA 3NNNA 3QJ5A 4MVWA 1NXPA 5LD2C 4FOSA 4QTTB 3AUFA 2OUIA 4AJ1A 5HRCA 4N0EA 3B3JA 3LVQE 4W63A 2CFIA 2IC5A 3WKCA 4KXFB 4CL2A 3IESA 1JIQA 4DMHA 4BTEA 2O5VA 3LUBA 1ZNWA 4HLUC 2M1XA 1E32A 1AKYA 1H8EA 1J8YF 4DYHA 2JFWA 3JCZA 3CWCA 4J4TA 3KBBA 1OFUX 1L7VC 4Q7JB 4PNZA 1Y5LA 5ESWA 5JMWA 2IEIA 3BD7A 3KO8A 1W36B 4AFNA 4RE6A 4TYWA 2PRKA 4ZAYA 5DF1A 1EZ4A 3C3DA 1CP3A 3B6ZA 3SZGA 2BRUC 4ZPXA 4PTYA 5D01A 4B44A 4FOTA 3B1ZA 4NABA 1N5RA 4U0JA 4XGRA 3C41J 1GL3A 1Z36A 4EDFA 1NP6A 5KTTA 3MT0A 4J3NA 1JDSA 4BQEA 2XRZA 3R6TA 2PWPA 2PDAA 2V9PA 2J8ZA 3UB2A 4HI0E 1DOHA 2Q9UA 2EBFX 3P9NA 1QTIA 1EVZA 3RSCA 3RUDA 5JE8A 4EO9A 2DLNA 1ZBDA 1G21A 1QIMA 3A9TA 4GZMA 3A58B 3IKVA 4LXQA 4XDGA 1TVCA 4Z9YA 1OGJA 3QUCA 1JXAA 3FPAA 4J29A 1RBMA 3NWPA 5M04A 3TRFA 1L5OA 2AVNA 2D5BA 4ZU1X 1L2TA 3P9KA 2IYZA 4AMVA 4EPVA 4HVLA 5IUKC 4PSVA 2QG9A 4ESVA 2JCSA 2O50A 3X2SA 2JFYA 3K5WA 4H6WA 1SBQA 4PSAA 2FEKA 4KSYA 4PF1A 2W43A 1EIZA 3U4HA 4C29A 3HJFA 1FW8A 4JDUA 1SUPA 2TMGA 1YZUA 4TLEA 2WJVA 3ADOA 4WZBE 4X8LA 1XB2A 2ATEA 2O0MA 1C30B 2H4ZA 2R1TB 3EN0A 3EQZA 4PLHA 3AL0C 2OO3A 2HBYA 3IPLA 2NU9B 4P38A 4YY3B 2C9ZA 2P2YA 4CMCA 5I7AA 3GDHA 1XRNA 2ZYDA 3I23A 2QDKA 4MJ7A 3RHSA 3U19A 1LZLA 1WCV1 1K7CA 1TGYA 2QMHA 4QFCA 4G8JA 2BEWB 2C9OA 3HWRA 1Z4QA 3IQXA 1W4ZA 3OPYA 2WJ3A 3FYUC 2DBVO 1XYGA 2BM9A 4QWMA 2PUFA 4D4JA 5FPSA 5C5IA 5JO9A 4OHWA 4UTZA 3UUGA 5J43A 4KRGA 1AHPA 3HCNA 2QRNA 5ICFA 2F1OA 3FWZA 3AI3A 4UZSA 1YR6A 2NU7A 3BL6A 2QOEA 5BSTA 4B79A 3AFGA 2BHTA 2B1IA 4IIVA 1E4VA 1P1BA 1YR2A 2DHQA 4KGZA 3TR0A 5GM2A 4FE7A 4J0QA 2W7TA 3QFTA 2QLJA 5CDTA 1EZ1A 1N3BA 1NONA 1BHJA 1V47A 2X5KO 3P7MA 1A4IA 3JD1A 2HMVA 2QTZA 1I9CA 4IGKA 4AYXA 5KIAA 2GN0A 2C3PA 2DPLA 4K9MA 1U3WA 2FZWA 1J4AA 1Y7HA 3DL0A 3GGJA 4GPD1 5F4BA 3TLBA 5EHIA 3ZK7A 4B81A 5JW6A 2YNMA 1ENPA 5HK9A 1N0VC 3VR5A 3G0CA 1V1MB 3FX2A 5GGYA 2C2XA 3ZE6A 2UKDA 2JCXA 1PP4A 3KR2A 3NBUA 3PCXA 4ND6A 4MUMA 1LFDB 1AV7A 2GCOB 3RODA 3EG9B 1KFJB 1M8JA 3MGBA 4G41A 5DM2A 2YMQA 1QIDA 4MSUA 3S7ZA 2I5PO 2K2QB 4KFCA 3TLAA 1I4TD 1EAYA 2EZ9A 2Q6LA 2Z3VA 3O0DA 4LRXA 3RYHA 1KRXA 2QROA 3QLVA 3VOTA 3OT1A 1TGVA 4HGRA 5IAOA 4B3MB 4H0CA 3ST7A 4AMYA 3V6MA 4OH7A 4B8YA 4C0BA 4W5WA 1M0EA 4KE7A 4HSEA 1IWBB 2RH9B 2J07A 4YFVA 1ORVA 2P5UA 4W4TA 4WKBA 3SJCA 4E21A 1ZNYA 1GGMA 2M6KA 2PFSA 1RYFA 3MEQA 3N0XA 4XTCS 5BV7A 2ERCA 4RIEA 2C00A 5E9WA 3CVJA 4O2BB 4YP7A 4OP3A 3CLTD 3GH1A 3EFOB 5AJUA 3RIEA 2VZEA 4QQRA 1VE9A 3TX2A 5K45A 3NHYA 4AKIA 1H2RS 3S5JA 2G4CA 4U6NA 3GB9A 4RKRA 3VMFA 4OQYA 3R74A 1KSHA 4Z9FA 3VOBA 4P34A 4DIUA 5KTKA 1JFRA 2ACKA 3OQBA 5K4GA 6CHYA 4Y9UA 1GKUB 3Q41A 4MIEA 4UASA 3T7KA 3RWOA 3ZCVA 4WXHA 4BFSA 5KTYA 1M8PA 1QZTA 4FQ8A 4AMZA 5FFNA 1E3MA 3ZS9A 3ZCQA 4EGJA 4FHEA 4G26A 5IABA 1BX3A 4PBRA 3PEVA 2H3EA 3H5NA 5CLGA 2Z58A 3HLKA 3R7LA 4TS9A 4Y2UA 2CNKA 1SURA 2WJ6A 1QGZA 1EX1A 2JJ8A 3F3SA 2L18A 4DCCA 4FP9A 1EG7A 3LS2A 1JZTA 5A03A 4RIFA 2VCYA 1JHXA 3OM1A 3S99A 4L22A 3W34A 4FEAA 1H0RA 3UJ6A 4DLVA 3BH0A 3CVOA 3I9KA 5JI2E 2CNWA 1NMZA 4H27A 1C8LA 2JFNA 4H35A 4H6XA 3B5EA 1LNZA 2BFMA 3FZYA 1JSXA 3H7AA 2GRJA 4OLJA 1GXSB 4GSKA 4RU1A 1Z83A 1PS9A 1WV1A 2NZVG 2ZAMA 3I6MA 1B41A 2X2EA 1SOUA 2ES4A 3TL3A 1U0NA 3ESYA 4DSZA 1NMXA 4IQGA 4IG4A 1G0OA 1Y34E 1UC4B 2HTFA 1TYDE 3CWQA 4FZ5A 2ZRIA 2YFHA 5HKKA 2QP4A 4UUBA 2XKBA 1UR5A 2WJ4A 3ESZA 4J0GA 4ZO4A 1L5GB 1C1DB 1KFCB 1U7PA 1NT4A 2QV0A 1FS4A 3I2JA 3TB4A 1UKYA 4PZUA 1FYEA 3VR3D 1ZHHA 2W58A 3EZGA 2IYLD 4J1NA 3E7FA 3U6KA 3HDTA 1R5JA 4UHEA 4C4AA 2OQRA 4M9ZA 1KJJA 3RUEA 5JXWA 4JXZA 5C46F 3FFWA 2BFWA 2GCEA 3LC7O 1SIBE 1RLUA 2VUTA 1H94A 2IVZA 2FA9A 4TGLA 3A05A 5CBPA 2N75A 5AXAA 1KQOA 2FQWA 4QXMA 3TRDA 4Z7NB 2GSDA 3GRAA 1QF9A 2YXBA 1EWVA 1Y1TA 4GVXA 3KTOA 4A0HA 2YS7A 2BMWA 3KG2A 4Y9DA 2Q0SA 1PV4A 3MT7A 1X8LA 2ZT8A 1EFLA 1ZVVA 3C3XA 3ROXA 5DIZA 3KOYA 4EKIA 1JDPA 3D2AA 1PW5A 3MHPA 4GWLA 2Q7XA 3H3XA 4TVOA 4UE6A 2EF0A 3RSZA 3VR4D 1A1VA 2WT4A 1AUPA 1S02A 2JAQA 1EJ6A 2NU8A 2XPCA 4RADA 4W5TA 2G28A 2DT5A 4PAOA 4EI9A 2G1PA 3KXDA 4V0ME 3C6MA 4X7PA 2D1SA 2ZWOA 1TAHA 5CEEA 1OI3A 4JL8A 4EM6A 3KTAB 4F5DA 4EENA 2Y05A 4ROTA 1EB8A 1X1CA 1F5SA 2ZU6A 3W5VA 5ALPA 4HQRA 3MGKA 2I80A 4DIBA 2BP7B 1C1YA 4LKOA 3H1BA 4DMRA 1QYXA 4UUPA 1SKQA 2HPAA 4RGYA 4Z9AA 5TJHA 2D54A 3KSUA 5TE9A 4GC9A 4P4UA 4J8PA 3DKVA 3MJHA 5FNVA 3W3AH 4DQVA 4H7EA 4LPSA 4IDBA 3U13A 4CQLB 2A7QA 2JKYA 5KWIA 4M9XA 1DQYA 5AMXA 1Z8FA 4OHBA 1Y1RA 4S1NA 4R0MA 3PQ5A 3H2YA 5SYAA 1E6WA 1RM4A 3Q2KA 1JDBC 2ZWPA 2A9RA 4DC0A 3FCSB 5KMGB 2W8ZA 1J2UA 2WF7A 3MHTA 2FZEA 2GM4A 3SCZA 3W5AA 3WSWA 5F76A 1KYQA 3EZ7A 2RI0A 5COQA 1CUIA 3BYZA 1DO0A 4N65A 2PT7A 2XV1A 3ADKA 1U0TA 2PL9A 3PS9A 4L5CA 3W2EA 1V8FA 1D2GA 3OPVA 4MVJG 4MEBA 3OQHA 4PCVA 3QFRA 1JA9A 2EIHA 3T4UA 4NZOA 5BWLA 2PUEA 3OQNA 3NAQA 1G5TA 3N8NA 2AMJA 4LRWA 5ADVA 3EODA 1R10A 3CKKA 3HKCB 1GCAA 3TOSA 3VSEA 1C7ZA 4J3JA 4XDYA 3VV3A 1JHAA 4HOYA 5ERGB 1D5WA 2WJYA 4PVDA 4BKRA 2C2ZA 5E4FA 3ZHSA 5DNEA 5B1EA 1EM8B 3L1JA 4EECA 3NIBA 1CQIA 2CF5A 4JBYA 3DOEA 3NKLA 4ZT2A 3PUIA 1CLEA 2AG6A 1VECA 3L7IA 3FYDA 4U39A 3B1XA 3LT1A 1UMDB 1V48A 2E4ZA 2O3UA 2X13A 4NCNA 4WZZA 3I6BA 1H6DA 4DCOA 3FSGD 1ZN8A 4GXNA 2VWGA 2XQFA 3C5WP 3BFKA 1UXGA 3QHQA 5F21A 4J9UE 1VGRA 1PZFA 2C3YA 2ZJ6A 4OFBA 3QGMA 1QQAA 2XWBF 1BN7A 1W2WB 1GKIA 2HJGA 3N2EA 1SHTX 1GY8A 4MWDA 3HU2A 3D9QX 4X3CA 3F8SA 4WBNB 2HZBA 1DTWB 4PWYA 5FTWA 3T4XA 4BJ3A 1E1CB 2Q3LA 4H08A 5BSMA 5KSZA 2DBQA 3AFMA 4D9NA 1NA5A 2C42A 1GVNB 2HGSA 4GPIB 5DLPA 4LTNA 4ENPA 2AZMA 4FX5A 4CIWA 1TIKA 1FRZA 1YL7A 2JJ1A 1X19A 2PA3A 3LXRA 4MWOA 1IOZA 4ZCMA 3KQKA 2QQ5A 3NVAA 1DX4A 2EYUA 2H9AA 4IRUB 4LJ9A 1SEVA 3RU3A 3DKRA 2JI6A 2DHRA 4MPJA 3FIJA 2B4RO 4MA4A 2QHXA 2R60A 3F2VA 3M4ZA 1SD5A 3BMCA 1TC1A 3H4VA 2ZIUB 2OAGA 3NGXA 1F51E 1KO4A 1O4WA 4ND5A 4B6RA 1SMKA 4DSUA 1NGSA 1Y5RA 4JOQA 2IXTA 4G5XA 4LSMA 5FF9A 4V0RA 2QL5A 1Y3FE 3O8OA 4W9NA 4YK7A 1J0XO 4NBVA 2IOYA 1SN7A 5H82A 4QUIA 1CRWG 3ZIUA 1OIWA 3IELA 3O95A 4LA4A 4O5AA 3UA4A 5JAPA 1HE5A 1F8UA 3OHPA 4DQLA 4IKOA 3S2EA 4FCVA 2H2WA 1JVBA 1V26A 3DZIA 3K9GA 4XKJA 1ONPA 4KPFC 3RW9A 2PZMA 1KDYA 4PEVA 4X62B 5DWVA 4YRIA 4JC4A 1RRMA 3DNFA 1PR2A 4Y30A 1NJ2A 5ERXA 3KVRA 5J63A 3WLOA 2Q3JA 5H0IA 4D45A 1DIOB 1H2FA 4QOHA 1ML4A 1P72A 5IM4A 4RTNA 1N77A 2NWQA 3DM9B 4IFTA 3WL7A 1FP7A 1UWKA 2RGAA 3OURA 4DPKA 5M29A 1R4MA 2DFNA 1JHQA 4FWBA 1BWPA 2FVXA 3QPDA 4IQ4A 5KYUA 2CFOA 3G17A 2XMZA 3KCNA 3L0SA 3OX3A 5EQJB 4C43A 2R79A 3H2SA 1IZYA 3HMKA 1BXRA 2G9VA 1JDNA 2E55A 2OP0A 1WHTA 5JH7A 2B34A 4H7PA 2FDRA 4LAFA 1Q3KA 2P3LA 4DNFA 3C3JA 3TLMA 4LDQA 5KOJA 1YKFA 3E2PA 2ZRDA 4QTUB 2HWWA 2VAWA 2Y76A 5BRAA 1K7SN 2X5XA 5AKYA 5HQ3B 3EXFB 4PX3A 1B3BA 3W0LB 4ER7A 3AWDA 2QMZA 3KEFA 2EBWA 2G82A 1B4DA 1HH4A 3MS7A 3P0EA 4QUKA 3A9RA 5CT4A 3O84A 4Q6BA 3JD3A 3DL2A 5JZOA 1EMDA 4LK2A 1L0BA 1U3UA 3OO1A 1A2BA 4BAGA 4NDAA 4ALLA 5A0VA 2PLNA 2H5IA 4HQ6A 3WGKA 4BFWA 2BFAA 1H2XA 4OQPA 3G0OA 3T41A 4UVGA 4FXOA 4F2GA 5BV1A 1ZY2A 4BCBA 3VR6D 2I3BA 2Q3HA 3E9MA 2GTIA 1NV8A 1GTMA 4IRMA 5EHQA 1DHTA 3TLZA 3T3MB 3VKGA 4JEUA 3F47A 2FSVA 4C07A 2XAUA 1NBMD 4HDRA 2HWYA 1DG3A 4X8OA 1T2DA 1C3VA 4GDFA 1K08A 1BW9A 1CR0A 2F67A 3ORHA 2OORC 2AOVA 2IEGA 3D0RA 1W4RA 2ID9A 3Q87B 3VHXA 4K5QA 3MERA 4MUYA 4J0FA 4Q15A 5HGJA 2ZUVA 1JHOA 4IWYA 1UKBA 1PR0A 1R9GA 4OD0A 4ZYUA 3FOFC 4HNAA 2FW8A 1U8TA 1CVIA 3N2KA 2J0EA 4Q1EA 4LRYA 3R8FA 2VC2B 1OI7A 2GKGA 2HN9A 1JJAA 2H48A 2H4HA 3DZCA 4M87A 4U3JA 2YASA 4UBIA 4A9AA 4DVGA 4ZMBA 3ZGOA 1KEEA 3NHAA 1U02A 2VUUA 2ZB7A 1XTJA 3KB6A 2JFOA 1U2ZA 2HQ1A 1CF9A 1L8OA 2R6HA 3L1IA 4I1YA 4BO7A 4F3NA 4RH1A 3O3OB 4ZPJA 3OEED 1THGA 4GHWA 5A3VA 3B6IA 2OGSA 2WICA 3RVJA 4AKHA 1Q22A 1UQTA 5A05A 4PZCA 3U7GA 4PG7A 5E7QA 2ZJ3A 4LV8B 3B6KA 4JBHA 5I5GA 1GA6A 2ACVA 2WM9B 1OU0A 5D1HA 1BHQ1 1U0HC 3BICA 5HF9A 4GZ3A 1KBQA 5AVTA 1PSDA 4N5MA 4NG4A 4UATA 3ZE0B 3LC1O 4L1KA 4CDNA 7REQA 3JQFC 2Z4RA 2H85A 4WDQA 5EJ4A 3K15A 1GCOA 3IUSA 4DGSA 2HA3A 5LLDA 4Z86A 1E6EA 2UZIR 1W35A 3H18A 4OATA 3RFTA 2FG7C 5C37A 2Q7OE 1PV2A 1O6FA 5D6OA 5EG5A 5FBZA 1Y3DE 2PRZA 3DXZA 3IAUA 4KPUA 1CJKC 1AO3A 2RGDA 4L5JA 3UGKA 4H1VA 2YL2A 3O3NB 2PT6A 1IJFA 3KZNA 4KGDA 3TSZA 4D46A 3VNBA 2CV2A 1XVAA 3PGJA 3Q9LA 3MFYA 5I3ZA 1SKMA 5CJ2A 4HX9A 5MFPA 1X94A 2GO7A 3W5CA 5EPEA 3UFXA 3V8BA 1G3UA 3KSAC 1EP9A 1YDFA 1JAYA 3WP1B 3WFJA 5B7GA 3AI1A 4KL8S 1PWYE 3G0BA 2ETXA 5HS4A 3ZGVA 2WRZA 2R6JA 2K4MA 3KK0A 1KY4A 5IBPA 4BUZA 2CGEA 2I6QA 2PYDA 3Q11A 4KMRA 1QZUA 2VAMA 2HK7A 5SZJA 2IDJA 5DXAA 2VAVA 4Q9LA 5T3UA 2DR2A 2RKOA 5IJ9A 4V03A 5IFKA 2PIAA 5E95A 2Y1KA 1GEEA 1SOVA 5H4GA 4JT9A 5KYYA 2VTDA 1O9GA 5CT6A 3KC2A 3C2QA 4HWPA 1EE1A 1V45E 2WB2A 1QHSA 1Q84A 1T9HA 5T3YA 5C3MA 4Q9IA 3L5OA 1FP4A 4KXLA 5GZ1A 4NFSA 3OEHD 5E1DA 4WLEA 2O7NA 4M53A 1CJVC 5DWQA 2VL7A 4JN6B 5GM1A 1J0AA 4H0FA 4AJOA 3K9FC 3E3MA 2XKKA 2YS6A 3M4XA 3PF8A 5KCMA 5WRFA 3M7IA 2WR8A 1JYEA 1TXGA 2NUAB 5KX5A 3N6XA 5FPPA 1G59A 1LSJA 3NXKA 3ZDRA 5SICE 3DHEA 3DGFC 4NPAA 1FJHA 3QSGA 2K2WA 5AHKA 4CEJB 2J9FB 3R6WA 5G40A 4DBZA 2FLKA 1NBAA 4FHFA 1IYZA 1UZMA 1R66A 3WHPA 2PO7A 1ZFNA 3PA8A 2QSUA 4PRKA 3JQ8A 1YBVA 1ZJJA 4EATA 3TQIA 1NXSA 4D99A 3QE2A 2QY9A 2VP5A 3CUWA 3STUA 1QV9A 3DO8A 5AVXA 2HOQA 1GIAA 4YMVA 2V1UA 1LVHA 1NRXA 3WL5A 2HWXA 4HAWA 2ZRAA 5IKXA 3C3EA 3NNSA 3QM1A 2JBAA 1NNLA 3HWSA 5B2EA 2KWIA 5FUMA 1PR4A 5H16A 2WVGA 1XJ5A 4QGGA 4DV0B 1WZ2A 3N07A 1FS5A 3QMWA 3S2UA 1VL8A 1Z0FA 1NX9A 1SCDA 3DUFA 3JWPA 4MIYA 3Q7QA 3T99A 1X1BA 2BE7A 1FL9A 1VJGA 1XZIA 3WHIA 5LL6P 2OFPA 1TQHA 5GOZA 3KT3A 4RY9A 4Z1MA 4U2CA 4CL3A 4YXFA 2G4VA 5F2NA 1DXYA 4MVYA 4K6CA 2HMSA 5TQ2B 4A1OA 2H3HA 2BBWA 3IL2A 4WPGA 3Q10A 4DV1B 4YV0A 4TTIA 1RI3A 3IV6A 5A9TA 4ETNA 1WQ3A 1LJ8A 4I6JA 1SIWA 2ZR9A 3EVDA 3DZGA 5F2OA 3MG9A 4J6FA 4EG0A 3AM1A 2WJGA 4ZT3A 4URWR 1HNZB 3IKJA 4RW0A 5CVDA 4YT5A 4DRYA 2VJPA 4FB4A 2UXCB 1BX0A 1Z4OA 3OQJA 5E3HA 3EIHA 1Y48E 3O5AA 4A4DA 4DG5A 2XVAA 4WIAA 5CBPB 1O6BA 4E3WA 1A9XB 3OEYA 4K6HA 4JP5A 2QW0X 4MS4A 5D8DA 5EIHA 3SKVA 1YDGA 2JJ2A 4IAOA 5F77A 2PE5A 1C4OA 2PD3A 1UJ5A 3BKXA 2OCKA 3VDNB 3GVPA 1AMOA 3DVQX 2YHBA 3QF4B 1XLTC 2ASVA 5CM8B 4F6LA 1GG2A 3H99A 3AIKA 1UT6A 4P4TA 3WNCA 3KOMA 3LT4A 3SM3A 1ZBQA 4HBGA 2PRSA 3PEWA 3ORSA 3RTDA 1SB8A 1FJ2A 1QHHA 1J0EA 1K7YA 1I5RA 1Y8CA 2ECFA 2P3SA 3RSSA 2PXCA 3DMTC 4OOFA 3AW8A 2KHZA 4KQGA 2LR0A 1GITA 1PAUA 3P0HA 1L5KA 3FHJA 4HVTA 3U3JA 5AW3A 1T3HA 1EP1B 4MQ6A 1LS6A 2JGIA 3O2QB 1U2GA 1LRKA 3HDVA 5BUQA 2W0MA 3RFUA 2I6XA 4S1VA 3HC7A 3BPSA 1ST2A 3UATA 3ZWMA 4OBEA 5EP4A 4X9XA 4F0JA 5LQCA 3RYCB 3NOVA 3CVUA 5EVJA 1SBNE 2SKEA 1PJAA 3LCVB 1MB0A 2FETA 4NU0A 4FFPA 1ID1A 1ZH6A 1TZ2A 4V1CI 5ESXA 1F2UA 4PC2A 1A7JA 4IJMA 5E6SB 3SYLA 4ND8B 1NRWA 2IZ7A 3P0FA 4NBTA 2D5IA 1E1RA 2CJWB 1DAKA 2H2GA 4CNQA 1GZ7A 5JANA 1U98A 4DVJA 2ATIA 4QECA 3ZDFA 3FMVA 3RK0A 5LBIA 2ZE8A 2DHCA 4OUDA 1EFRA 3QXCA 4F72A 1W8DA 4PQFA 1QCZA 3D3EA 4URXR 3WRXC 3RVDA 2J5KA 2H1RA 1CY8A 2DWOA 2PSEA 3GJYA 2ZIAA 3C48A 3C6QA 3V8EA 4EK9A 1VGQA 1NVKA 1PWHA 5CTAA 4UCXA 3HJBA 3PF9A 3ZKWB 1P0QA 2R6R1 4NI5A 4X94A 1E63A 4YAGA 1KU6A 2JVKA 2XMCA 1UH5A 3F96A 1IWPB 3OPMA 3H19A 4IY1A 3C4QA 4KXYA 4GD3Q 2F7SA 2GK4A 3CH7A 1C3JA 4ENVA 2GVNA 2NZWA 2XT6A 1MTZA 2VQFB 3SYMA 1SBZA 2FW6A 3AU9A 4R4JA 5EKUA 1YRBA 3L8DA 5C9ZA 4I55F 3B9BA 4TM7A 5IUNC 1CE8B 2ODEA 3K0FB 3L7KA 4B76A 2A9JA 3VKFA 2FZKA 5I7WA 1JPJA 2FR0A 4NXNB 2X8BA 2QVZX 2B61A 2I1WA 4U7TB 5JYCA 1C2TA 1CFJA 1YB6A 1ZLXA 4G5GA 4EW6A 2OO7A 3NH9A 2J9XB 3JASB 1K6JA 3EC2A 5CA1B 5B3AA 3ZWAA 1SBHA 1RHRA 1GQRA 2HLHA 3MF4A 1APBA 1HSOA 1KEWA 2N3ZA 4E51A 4LJLA 4FGLA 4TQUS 2J6CA 3H5WA 3PDCA 1DHRA 5EQFA 4LY0A 3U9LA 4MVJF 4J07A 5JS2A 3D7RA 5FX2A 2ILTA 1T6XA 1PFGA 2BGJA 2EYQA 2VHEA 2CBZA 3A0RB 4LZZA 3T5MA 2PZBA 2WWTA 3JWGA 1O94A 5FI1B 2GPSA 1WUTA 3LT5A 2WC1A 1HDRA 3K9WA 4XX0A 3U80A 3T6KA 3FVQA 4NOLA 3LFHA 3O91A 3HV0A 1JTFA 3QBVA 3WYDA 5KTPA 1A3CA 3LHSA 2VJMB 3GIWA 3PKJA 3O4JA 1KZ6A 1I2CA 1PT6A 1UUFA 3L9XA 3WAKA 3HWX1 5AM0A 2VTEA 3PQCA 3W7BA 4DIEA 4UPVA 5J4VA 3UXYA 4GL2A 3ASZA 5FLYA 3I5AA 4HMPA 3PKIA 1TZBA 5E7MA 1PR9A 2Y4NA 5BSRA 2IYVA 4M55A 5JNUA 1O96B 2HT6A 2JAOA 3O8LA 2X8JA 3QIVA 1NPYA 4OO3A 4OY3A 2HFJA 4E08A 1VB3A 1HE3A 1N78A 2GJAA 4I36A 5K0TA 2V5AA 3OZAA 3T7SA 3CLTC 4GFDA 3DSRA 3M34A 3F4LA 2GD0A 4AROA 1KK1A 3K4PA 4X95A 3LQKA 2VZ9A 3LKVA 4OQXA 5G4LA 3R5JA 1R4MB 1I7QB 3I9LA 2P9HA 3GFOA 4X90A 1J8FA 1XZGA 3ORRA 4OYYA 4TQAA 1XTTA 1MIOB 3F0TA 3GNLA 2UZ1A 2WYUA 4GBJA 5EIFA 3SOZA 3JZFA 4K6OA 1W5FA 5KVCA 3RBVA 4PLYA 1WHTB 4UMFA 3E4DA 4R9UC 4B1FA 3L93A 1V7PC 1JEDA 5AM5A 1IY8A 2PZEA 2YC4C 1OX4A 4GR5A 5CK4A 3TXYA 5FHQA 5EUCA 1BE1A 1EVYA 5KHOC 5JT1A 2V5UA 6Q21A 4I1SA 4FSXA 4HGZA 3SFZA 3WGOA 4TX1A 3WZ2A 4KIFA 5E9JA 4INJA 1GPNA 2C0QA 2VI5A 2YFKA 4HF7A 2HM7A 3HO6A 5H9WA 2KBFA 1GV1A 1G9TA 4RC9A 3MGGA 3UAXA 3LUFA 1L3BA 4OB8A 1IVNA 3SI7A 4F3YA 3RQIA 4IJVA 2AQ8A 5DPMA 4LOJA 4FNGA 2C84A 1JR3D 1N75A 1ZIDA 2BI7A 3BIFA 3F5DA 1VA5A 4P5PA 1LNQA 1YCGA 2I3ZA 2ZXUA 2Q8NA 2PX2A 1VPEA 1BH2A 2CXSA 3BQMB 621PA 3FNEA 4DV6B 2BV3A 2VSOA 3TS1A 3GVXA 4DMMA 2GT1A 5KQGA 2WQ7A 1OU4A 1KA9H 5JSUA 4L3WA 1LLFA 1YJXA 3RHFA 3CXUA 1K66A 3BDIA 3QU9A 1Y82A 4OHUA 1J8DA 1AK9A 4AU1A 1CNEA 1VJ0A 2VHYA 2ZBQA 1QO0A 3GA5A 1DXOA 2QI9C 3NYRA 3O1LA 4RE5A 2CMGA 3N2KB 1J56A 4PC1A 4WZAB 3T7DA 4WESA 2IP2A 2XADA 3UWMA 4EMTA 3AEXA 1EDOA 1OQAA 3U37A 1X1DA 4U3JB 2ARKA 2OVBA 2AMYA 1SBTA 3SSNA 3LRTA 3W8DA 3C6BA 5M2QA 1VCHA 4MA5A 2HREA 1M5TA 4MROA 2FRXA 4JJKA 1V6SA 3PUZA 1PLJA 2PGLA 5BNFA 1HDXA 3B12A 4Z7JA 5C8DA 4Z99A 3CX6A 2R8XA 5J2TF 3HU3A 1M2WA 1CJTC 1FVOA 2BH9A 2ZCVA 2BPOA 5BQPA 4UNPA 5DCWA 3TXAA 3VKWA 1JBKA 4QYMA 4DIMA 5J4HA 1UM9A 4KBFA 1YB7A 1KFBB 1XVTA 1EJ0A 3HYSA 3U31A 3HBJA 3CE6A 1YUMA 3G7SA 3CPHA 3HRKA 4QD3A 2GARA 3CO0S 3SLKA 3KJQA 3O2NA 5KVVA 1VBKA 4PICA 4A8PA 1XQVA 1NF2A 2P5SA 3BJEA 4L7VA 2F6RA 2NZUG 3L05A 5EMLA 5FADA 3DB2A 2Q2VA 5REQB 3O47A 1H65A 4QVIA 1YQDA 3A7DA 3MTBA 2V96A 2D5CA 3NCHA 1ABFA 2P79A 2Q4DA 3Q40A 1VPVA 4D4IA 3W1WA 2QJWA 1UDRA 4YAOA 4ZYXA 3EUWA 1GFZA 2DBRA 1HL7A 1XUOA 2K87A 1Z22A 2UZ4A 4GVLA 4MGIR 4WMLA 2IPNA 2QUZA 1R2QA 1Y4DE 2OCDA 3VR4H 2BKUA 4MXDA 3VYTB 1N2ZA 1NI4A 3MW8A 2XTMA 4PZPA 1EK0A 3QLTA 4TTJA 3R41A 1T2UA 1XLWA 3G2OA 2W9XA 3OMXA 4FFBA 1V6AA 5TF0A 1P7YA 2XSZD 3ILSA 2IOHA 3OP1A 3GLUA 1TQ6A 2WHYA 1UMKA 1M6NA 1YASA 4XYLA 1J7KA 2YINC 4PW0A 5ULLA 4ARBA 1G3QA 6YASA 4KLZA 2PN1A 1M73E 2B82A 4EJ0A 4UOZA 1SUIA 1T4MA 2OBBA 2AK2A 4TL7A 4WADA 4KNYA 1QHNA 1XIVA 3FCXA 4B8ZA 3O9ZA 4WT7A 3TW6A 5I4KA 2C5GA 2ZZMA 1UOEA 5IJ9B 2PSFA 2LTAA 4JJAA 1YRYE 5IMBA 1RDFA 2ZUDA 4WFQA 4N40A 1KEVA 3TMAA 4C7MA 3ZLBA 3Q8KA 4D8VA 1XTRA 5EXDA 1RJFA 1ZXXA 2RJ3A 5G3ZA 2C2KA 1AXRA 1M8KA 1PLKA 3OQ6A 3LY8A 1G6KA 4QBGB 4LYGA 1KVSA 4QODA 3PSHA 5L9AA 4HTFA 2GN2A 4NVRA 4I3FA 4UHHA 1BEEA 2GN9A 2FPPB 2O2CA 4G9EA 4AXBA 2JLXA 1JQDA 3RSHA 1HUQA 1GQFA 2XQKA 2X1HA 1H8ED 2ADFA 2G5PA 2WYHA 1FNSA 2Z4TA 1NW8A 2COKA 3FCCA 3GJ6A 3PCTA 4JENA 4C04A 2F3UA 2Z9CA 4ZXPA 3F6YA 5HA5A 2A86A 4YJ3B 4CUKA 3CHYA 3V7NA 1FYFA 4TUYA 4EA6A 1DGQA 3N5KA 1SD1A 3HPRA 3K20A 1HDYA 1LBIA 2NM0A 1UK8A 2NAFA 4OBWA 4BV8A 5HYVA 2G76A 3JAMA 1FTQA 3H97A 1QUEA 2H59A 2JBAB 2Y1WA 2HJVA 1DLJA 1O2DA 1ISPA 2B4AA 3LNTA 4Q4HB 5G1PA 3ROKA 4DR3B 1PJ2A 1NFQA 2VAPA 4RKQA 4F11A 1XLUA 4PPFA 2SCUA 3HACA 3AVQA 4U7PB 3WGYA 2P9YA 2WFAA 1KP3A 3CT4A 4WK2B 2I9PA 1K5HA 1LKZA 5ALJA 3NATA 2B83A 1EUDA 2P3OA 4IZIA 5BY2A 1MW8X 4TMYA 4F7WA 1KP9A 2QJFA 4FIDA 5I9SA 1KMNA 1DG9A 4F9EA 3FHCB 3NC4A 4QDXA 1CQXA 1A9ZA 1FRFS 2AN4A 3DEJA 3F3MA 1ZN7A 3I8SA 2QN1A 3OPXA 1LCIA 1ORRA 1CRQA 1NP7A 1RM5A 2O2XA 2R6GA 2XYGA 3FLBA 3OKFA 3BGDA 4IDFA 2ZVPX 4AW9A 4BEVA 5LLSA 4TQGA 2BH2A 1STOA 3CRQA 3TFWA 1HYHA 3NBYC 4UTOA 4DQ0A 5LCXA 1GAWA 2XVYA 1PL8A 5AOVA 1XPRA 5LQNA 2OFOA 3QEAZ 1L6RA 3EJ6A 1PJ3A 4CL0A 1H05A 4G65A 1V4VA 1YF3A 2JI4A 4QASA 5ITWA 1MH1A 2GQ0A 5ICCA 1NJFA 3WKBA 2JRLA 3ZX5A 3EGWA 1Y8RB 1YC5A 4EPYA 4ENTA 4F6RA 1ESZA 3PUHA 4L76A 3DDCA 1A5ZA 3HXTA 4WKPA 2RKWA 2XD9A 1NFRA 2XZPA 3HJTA 2GSWA 4I7EA 4MAAA 4CG1A 1XQ1A 1RLMA 4JP1A 3F5FA 3ZIAA 1E1LA 3OIWA 1MG5A 2EXXA 1LBSA 4HAZA 4RS3A 3D5TA 4OK6A 1T5SA 2LXNA 4YGXB 4UHCA 1Z5VA 3EDMA 2WSSD 5CVTA 3ZDQA 3PJEA 3UHFA 3LYUA 4MTCA 1W4BA 4WERA 4YALA 5B6IA 1JDJA 5TPWA 1IOVA 2ZVJA 1LY1A 4J6EA 4D8TA 2FEAA 5ALHA 3JY6A 3OT4A 2QN3A 4RPLA 3VHQA 1QHHB 1TYCA 1HZZC 1WXWA 1KOLA 2GM9A 4TSRA 3GUZA 1T4BA 4EY3A 1FJGB 1JI3A 3DCNA 5D3KA 3GJ7A 4YRQA 5EKTA 3QPBA 1Q0TA 1NDHA 1XZMA 4ZP1A 1GZUA 4GOJA 3RBXA 7ABPA 4FM9A 2FWBA 2IGBA 4HT3B 2A67A 2YNMD 1OBOA 1WMDA 4Z4FA 3E7WA 2GBFA 4NJMB 4Q82A 1ZO8A 1XX6A 3VR5D 4CT4B 3QE9Y 2V7VA 4TV8F 4YUVA 3N2YA 3G7NA 5AQ1A 1DPGA 1MZVA 2O2ZA 5ALWA 2C57A 1YONA 2OZKA 5JXGA 1FDSA 1I9GA 4GMHA 2HF2A 3AV3A 1R0WA 4CTKA 1CWUA 2A0FA 2R65A 2AHOA 1I14A 2C2BA 2Q1WA 1CHDA 1ND6A 2ZGVA 4O63O 4I4LA 1U28A 4YDRA 5DYNA 3UAGA 2BFDB 4LDNA 3T9AA 4G1EB 1OVGA 2YC2C 3S3TA 3VBCA 2J0QA 2F90A 3UW3A 5FPYA 3ICCA 3AR6A 3KRTA 4OX9Y 4PG8A 1M1YA 2ZRQA 1VJ5A 2ZIFA 1M7HA 3H86A 1HEUA 2W2MA 4CM9A 2O6HA 2PPLA 3RFCA 4LN1A 4F04A 1KAQA 4CEHB 4U7HA 2CF6A 4GU5A 3VR6H 2KE5A 3DBVO 4GMKA 4BVBA 1SM4A 5J9FA 1M75A 1TX4B 3PNYA 4KCGA 2IEDA 5KBYA 4U63A 1F9AA 1X0VA 2B6NA 3IOEA 2VJNA 4MVJM 1N2HA 2XCLA 4GDMA 4PQRA 2R7AA 4G4SO 3DOIA 5J5CA 4ZJUA 4XVQA 1M6YA 3UQZA 3QFCA 1X80B 1MDFA 1WUIS 1ZD3A 1MT0A 3DBRA 4OMDA 1T8PA 1T24A 5B1DA 1DQPA 3WIVA 4E31A 4RQTA 3OHSX 3UAOA 3RHZA 1TMGE 2OESA 1ESCA 2V5VA 1OR8A 2EJTA 1PG5A 4G0PA 4H18A 4D1YA 3D4IA 1HX7A 4RQAA 4G0NA 2ZWAA 4YR7A 1EE9A 1M8GA 1YZHA 1TK3A 3KVVA 2IELA 3BDVA 1KVQA 4KXUA 1Y0BA 5D3ZA 2C2OA 4HWOA 4JI8B 2WU4A 1JFSA 3G13A 1R6AA 3WDMA 2VG8A 2CLFB 2QVGA 1PBNA 2CNWD 4CR8A 2ZIZA 1U4NA 4OH1A 1XNGA 3BIWA 2H00A 1UOQA 5ALLA 1V8DA 5F5LA 1P0FA 2PKQP 4BCCA 3QYFA 4AYTA 2VDPB 1UJ4A 4LZPA 3VDRA 4Q3CA 3V4SA 2EX0A 3ZHUA 4F1WA 2B5OA 4JMLA 4C7KA 1CQPA 1RC0A 5ALQA 1GVHA 2CK3A 3AR5A 4S35A 4ZQGA 3U16A 1O1YA 3BD8A 4XYEA 1KWKA 3IQIX 1JFTA 3SQMA 4YLEA 4TT8A 5T64A 4ZEWA 1IU9A 1CUUA 3DDSA 3L0YA 3OF2A 2IODA 1RR6A 3CKMA 3HJNA 4RJIA 2H1CA 3F46A 1X7ZA 2CYBA 2X19A 2YDXA 3GEIA 3UWPA 4AJ2A 3GFPA 3G82C 4C6SA 1T2FA 5I4BA 2D1QA 4RF5A 3TIIA 2WYWA 5CD1A 2GCNA 3PL5A 4IZ6A 5JAZA 1YTUA 2QMEA 4KR6A 4YMHA 1ULUA 4OP1A 3TNYA 4BVFA 4C4PA 4OFZA 4OHKA 1CBUA 3G8DA 4DCTA 5AM3A 1U7HA 4G37A 4I3HA 1M2JA 3C3YA 5TT0A 3D0OA 3D6VA 3ADDA 1VIDA 2RHMA 3E9DA 1XZAA 2J9ZB 1JA1A 2QRGA 2WSIA 2OPBA 3NO4A 1JJVA 2RE8A 3NS7A 1IRXA 2CW5A 2LCIA 2Z98A 3LG2A 5AK0A 2XYPA 5A9SB 3GZTB 4CTMA 4DLNA 1E96A 1FTGA 3NHJA 4KQCA 3U26A 1MGOA 1F0KA 1K3FA 1HYBA 1MNQA 4EJ2A 2ZU0C 3N9IA 5JSYA 3ZE2B 1CTQA 5EHXA 1OX4B 3ONVA 1IQUA 2C83A 1PVDA 3DCIA 3C5EA 4X1IB 3LF1A 4XDZA 3BORA 1LQ2A 3AZPA 4P35A 4F4FA 5JSQA 5TQ0A 5F64A 3FCYA 2VFAA 1HLGA 3HABA 1YIDA 4L3OA 1KEKA 1DSSG 5MHTA 2PVCA 1RE1A 3GEMA 4RPCA 5FUVA 4E2FA 1MCZA 1KR2A 2DBYA 2ZJOA 1IY1A 4KDRA 3Q5EA 3K31A 1E7RA 4OHCA 1EBFA 1E59A 2HWKA 3V2GA 4BQFA 4YYZA 5FUYA 4E5VA 3PNVA 4TV9A 4TKUA 1I5OA 4Z4GA 4C2AA 2IU4A 2WWRA 4OBBA 1U2PA 2WPNA 3CR7A 5LQJA 4JJGA 3AEQB 3RVOA 5BV8A 3PX7A 1Z7YA 3LBAA 4BBZA 1ZD5A 4GKAA 4Q3DA 4TMXA 1DJLA 5K51A 4PCUA 2WU1A 2FFHA 4BMZA 1OC4A 4KO4S 5LB2A 4L08A 3UTDA 4LNHA 2AJCA 2VF4X 3L07A 3Q5DA 5IAJA 1KGDA 1XXHB 3GLQA 4U00A 3ZN2A 1UOPA 1ECFA 1THZA 2DULA 2GN4A 3PI7A 3O90A 2AZDA 1CB0A 3MYYA 4DRZA 3O26A 1TUBB 1DC4A 5P8WA 5C1PA 3COVA 3OZGA 6ABPA 1P8JA 4MGYR 4WESB 1RAEA 3JQEA 4JJEA 3WXMA 2RGWA 3FWHA 2PM8A 4NMMA 1CY6A 4OKIA 5H68A 3AEZA 2R85A 1P9OA 1I3NA 4AMGA 4Q4JA 3AF4A 3PR3A 4KQ9A 1ZUHA 4PWZA 5CCDA 2I67A 1QHFA 4MPDA 3DE3X 2R6CA 3WWEA 5EP1A 3RIMA 4XFJA 3FPFA 3GROA 4BMNA 4E2ZA 1BE0A 1RPJA 1WVGA 3MJVA 3L7MA 1UM9B 1BN6A 3EJWA 4C06A 2PRIA 3BXGA 1Y7LA 3ZGZA 2PX8A 1KSGA 2UYOA 8AT1A 1HQCA 1Z62A 2VRCA 3T52A 4H2DA 4KXQA 3I42A 4MAMA 2FN9A 3PDWA 1ZCJA 1EM6A 4D3DA 1QCYA 3COYA 3OOSA 1JU3A 1YU6A 1S7CA 2FMIA 2XDWA 3BIOA 3B5IA 3MAGA 4GAEA 4L5YA 4OQLA 4M0LA 3UT5A 1X86B 5FQOA 3IR7A 3NP9A 3PV0A 2G8NA 2ZSUA 4XLTA 4Q03A 5BN4B 3VFDA 5JASA 5KNBA 3A1SA 1WBJB 4J0IA 1J9GA 1QZZA 3G2MA 1N8NA 1I5EA 3LLUA 2C7PA 2FW0A 4MRMA 2JH3A 1RFLA 1VCOA 3IA2A 1L7BA 1F5NA 3ZJUA 2CHQA 5JISA 2VPIA 5DV9A 4B0OA 3IB3A 4L9SA 4Z53A 1AMUA 3AWIA 4YV7A 2EW8A 1X9GA 4X3PA 1Z2DA 4YDQA 2P6PA 4G23A 4PE5B 5HFJA 5BXQC 2IT1A 1VGVA 2H57A 2NVUA 2OQIA 2YHSA 5E6RB 1Q1EA 3JALA 3N7TA 3R7AA 1HG1A 2P2LA 4QA9A 1G5QA 1HZJA 2BE9A 1II8A 3H2ZA 4GOXA 3N39C 2ZRPA 2DCMA 3T7TA 1TJ5A 2A8YA 4AF6A 5HNKA 1EIWA 2O2HA 2ZS8A 3D2CA 4LTDA 1HPLA 3RWMB 2B8WA 1WE2A 4ER5A 4C2BA 2FFJA 1EGVB 4LZJA 2OWEA 2LIPA 4RVHA 4X93A 3VR0A 3ZHOA 3ZPXA 2IYTA 4LRTB 3FJ1A 4PN7A 1M2OA 2O4UX 3LFTA 3WE7A 1JLLA 1Q1BA 5DXJA 2FMTA 2H4YA 3BWBA 1FFCA 1DC5A 2H0RA 2HQBA 2VEOA 3LUJA 2PH7A 3F9RA 4CGZA 1OREA 4B7XA 1SHJA 2MWMA 3KZOA 3RV4A 5TMPA 5E4TA 1WHSA 4MMXB 2QR2A 3UO8B 1H2WA 4I55A 2JGAA 2VJCA 4BO2A 5C8YF 3U7FB 5TS3A 5KJEA 2CVQA 4N5DA 3MMPA 5I51A 4ZT4A 1SXJE 4ZJPA 2VS1A 1LPMA 3G9QA 2JA2A 2CLLB 4HDOB 4QELA 3HYRA 2DSTA 3W04A 2HRDA 1QBGA 3EYWA 4N7BA 1GZSA 1N5JA 3RUIA 5AOCA 4PYQA 1C7IA 1P74A 1YQEA 3DH0A 4QULA 3SC2A 2RHCA 3GD7A 4WQMA 1E6LA 4UPEA 4ZI7A 2PH3A 4KQEA 3OBBA 4IHJF 4M6WA 3I4LA 2QTCA 1E89A 4C4YA 3EF1A 1TIPA 2VHXA 1H8HA 3RS8A 1I6LA 3IQHX 3I09A 5KYGA 5DGXA 3MWJA 3OI7A 3TJRA 2ZZNA 4ZICA 3DT8A 5TIIA 3AUYA 2VUSA 4KN6A 5I8ZA 1ZG3A 5IDWA 5G1OA 5EIEA 2SCUB 3IDAA 4YRLA 3SJUA 3C8DA 4H16A 2YICA 4FDMA 1TVKA 1ONOA 5DYYA 3ZEIA 1IVYA 3N2GA 3A26A 1DINA 5I7UA 3GGOA 4IXWA 4O2AB 2JA1A 1JWAB 2CV1A 1XHLA 1FVXA 2VA8A 1L4GA 1PFYA 3I1YA 1EINA 1N2BA 5SZHB 4XCVA 4JL5A 2DX7A 2HNAA 1QE3A 2QZ4A 2GETA 2YYAA 3KUKA 1DAFA 4FJ1A 2L82A 3IP3A 3JWEA 4UCFA 3UM9A 5HIKA 4WKGA 3HBLA 4WEOA 1BE6A 1PDWA 1XQ6A 3EVTA 3LTEA 4HQKA 3GJZA 4HN2A 3PX2A 3PBKA 3IPXA 4U4AA 1UBUS 1KDRA 4ND1A 4AQDA 4WCFB 3AVYA 1P33A 5E3IA 2F3QA 1ULAA 2ZULA 3PYLA 1SCAA 2NZJA 3DMYA 1DL5A 2FSUA 2NIPA 4LXHA 4BNHA 3G89A 1ZJ6A 3WLTA 2IYFA 5L4NA 2WPDA 3NBZC 2YH2A 5GZ3A 2UUBB 1GAXA 2N46A 3ZBQA 4CQNA 5L7WA 1AGPA 1BVRA 5K8JB 2IHBA 1OLXB 5IF9A 3R23A 2OXRA 3TLKA 3A36A 4FW8A 3R9IA 3KYJB 5B6JA 1OAOC 1FMCA 5ALRA 2FPLA 3S1AA 4EW3A 4TKVA 3VZRA 1Z6ZA 3LCMA 4C4RA 1E9AA 3JVDA 1U65A 1CUYA 1K9SA 1H66A 1L8LA 2FV8A 3HBAA 4K6GA 5ILGA 1XNQB 1ZL0A 2G7MC 3N8DA 1BCSA 1LPNA 4WA7A 4ZQHA 5EI5A 2IW3A 3WA7A 1XVIA 3DP9A 4ND2A 4IILA 4Q9AA 4QFDA 4D41A 5LZ4A 1U31A 5M7EA 1V3QE 1I1QB 4ZVMA 4IVNA 1OLUA 1FUIA 3DLHA 1NV9A 1RAAA 4M60A 2J33A 2KPOA 2PXAA 1A9QA 1D0VA 1ZCZA 4WBSA 3AFOA 2B99A 4NAVA 2ZUCA 3K0AB 1Z0KA 2B78A 2ZT5A 3GLIB 2L69A 2V7GA 3Q2OA 3S29A 721PA 4R81A 4DJJA 4ESEA 2AG8A 3CZ4A 4FUQA 4LC1A 1GKKA 2FN8A 2FF5A 3FOAA 1IBLB 3RVKA 2YV2A 3V2UA 2PPVA 2V6GA 1QK3A 1T4GA 1U2TA 2Y1OA 3Q0EA 4GQAA 1K5DA 3C3WA 4BVJA 3LHFA 3MCZA 3NWEA 4NC9A 4EZIA 2W42A 1WXXA 3D8NA 5DYWA 4PLVA 2ODWA 4CIVA 4PAQA 3ZYCA 4MKXA 4D9EA 1TMKA 2EERA 5BR4A 2RG1A 4MYDA 1UP6A 2VEDA 4QU9A 2XY4A 4J91A 1ISSA 4UOQA 2HIAA 4HR7A 2BMAA 2GFQA 2EIXA 2VK8A 4KJXA 4KW7A 1R0KA 4L4SA 1AQIA 1GCUA 4YHBA 2FEXA 3MD0A 3G0HA 5ELMA 1XZFA 1XRLA 2OAEA 1M83A 2PBFA 2X6TA 3F5SA 4OQFA 4Y1RA 4YS6A 4CVNA 4YMLA 3U09A 4J0CA 2CXUA 5FYDA 3P97A 1TYZA 1CYDA 1LTKA 3GELA 4M9SA 4E5PA 4X6YA 1RQRA 3A31A 3G2QA 3R20A 4K86A 4AJ4A 5JTUA 4NOMA 5A4KA 4F3RA 4BJHB 3IBGA 3KVYA 4YUWA 2XNHA 2YVUA 5CA0B 5ARCA 3VDXA 5CH8A 4E0BA 3CF4A 3HG7A 3PLRA 1CULC 4TMKA 3JXEA 2OVFA 1L8AA 2OTCA 1F6BA 1TQ8A 3IOCA 2Q6OA 4IVRA 3NHFA 1N6OA 1IUNA 4PRYA 2JGEA 2B3TA 2EF1A 2NYVA 1YJBA 2HNKA 4BKPA 2NZ2A 5J2TA 2IU3A 3RJTA 1GJRA 2ZR7A 3IKMB 3KZKA 4W5QA 3QEMB 1RJGA 5IK2A 4OLFA 3MRXA 3F4KA 3PUYA 4YREA 4BKQA 2EX4A 1X3LA 4PO3X 5CDUA 1PUIA 2AOUA 3E2IA 4UFPA 4NKRA 4GZLA 5CBKA 4Q3AA 1OA0A 4Q47A 5E7IA 2PVSA 2HI0A 3EVCA 1A8HA 2FKNA 5IVIA 1W96A 2VDRB 5LZ8A 1S3SA 1QFMA 1XDGA 1DP4A 2VQ6A 4L6IA 4DQXA 1M67A 2CNDA 2H4FA 4JXXA 3EPHA 1KEZA 2WVJA 3WO1A 3LC0A 4LJRA 4DLXA 5C8VA 3D3NA 1B00A 1PKXA 3WGLA 2ZTUA 2ST1A 1PT9A 4Y6PA 3CH4B 1ZD1A 3H17A 1LRJA 4X63A 1G8AA 1Z63A 3JU3A 1VI6A 2ETVA 4IQFA 1T5LA 5HUHA 3QEBZ 1J0CA 1WW3A 4WI1A 2WZDA 3L49A 3KVNA 4BRWA 1FLVA 4FFMA 4ILEA 5JCOA 3FB4A 3KR1A 4C78A 3KOXA 4FYXA 4DLAA 1DRVA 1C3OB 1GGNA 4HYEA 2R66A 3B6MA 2D06A 2ZBDA 2MR5A 1B8OA 3EYAA 3NHRA 3QITA 4JLBA 2POQX 3OJEA 1G6HA 3IQDB 1GPDG 3BMQA 4HAYA 4MR9B 1F8XA 1ITZA 2GUGA 4MK4A 4NY1A 1QNLA 3AHIA 3WXBA 5BSFA 4R05A 4Z1MD 1B1CA 4G67A 4W5NA 3KYDB 4LXYA 4C01A 1GGFA 1XU9A 2X7XA 4BN0A 3KVOA 2ZITA 1XPOA 3QVJA 4K3UA 4HWKA 5ETJA 1V95A 2NP7A 1N6IA 1N7JA 3GYGA 2C2HA 3OZEA 4ZC1A 2A9FA 2DE0X 4BL5A 4BO9A 1FCJA 5BVHA 2HB6A 2ZIWB 3DE4X 4OHFA 4M0EA 5CLIA 1PSZA 2RBEA 1YZKA 4JU8A 4E07A 3DCYA 4DJDC 4FMBB 1NPDA 1L5MA 1TT5A 3G79A 3L0PA 3QWBA 4ZDWA 4U9UA 4ERXA 3TLGA 1VRVA 4B2LA 1YQXA 5A4IS 2AFHA 4G4GA 1DTSA 1PQWA 2FPUA 4BNLA 3PEYA 4B6JA 1PJSA 3WR5A 4FK8A 2XUGA 5KTNA 1ZM7A 3A4MA 3B9QA 3DYVA 3NX4A 4H7FA 3K9NA 4H1HA 4F8YA 2JBHA 2EKZA 3I0NA 3SVZA 1IOLA 1UBSB 3UKJA 2G3YA 3PLNA 2J4CA 1DC3A 1W34A 3N2ZB 3WTCA 4QJ3A 3O73A 3HPQA 3C1TA 4Y6QA 2BJWA 1QKIA 4L4RA 4YCNA 5CB4B 3PNKA 4BIIA 1NATA 3TSOA 2MYUA 3T95A 3DPIA 1U7XA 5JMTA 1RAFA 3EDRA 3EEOA 1N2CA 2VXCA 3R6GA 1XEFA 1ADBA 3NV9A 5IN5A 1CUDA 1EFHA 3DL7A 1W19A 3MCWA 3TDKA 1BDIA 3CJTA 3IO5A 1QDLB 2VHJA 5AFSA 1A98A 1J99A 3U3XA 1N32B 4QPZA 3AOEC 4KKVA 1VZ2A 1DAMA 1ACMA 1EHCA 1QJ4A 1MG0A 4KQ1A 4NAUA 1MVOA 2HL6A 4RZXA 5BQ5A 1KDVA 1NMQA 3SIPA 3ZDEA 4HMOA 4JR0A 3GJSA 3RC9A 5A7GA 3MYRA 3T0FA 2J59A 3V34A 1PYOA 4PYLA 2ZUBA 1YO6A 4LF6B 3G5LA 1AUVA 2EWMA 1M72A 1SR8A 1PDVA 1VG1A 1XZPA 3OZCA 4D3XA 3ILYA 2MR6A 4B3BA 2IE8A 1B73A 3BZWA 5LN1A 3GYBA 3TLEA 1RJEA 4UQOA 1W4AA 3GARA 3V80A 1SC1A 3OE5A 3UPDA 4AJEA 3FB1A 3EW9A 5F3RA 1FLAA 2XMSA 1OX5A 3WS7A 3S81A 5E4JA 4GE0A 4R9RA 4BB6A 3RLIA 1X1AA 3RRBA 3ZTTA 5FBVB 2YZ7A 2ZUSA 1RABA 2JFQA 2QWXA 1KVRA 5I4CA 2OV8A 5FOUA 1WP9A 1U2DA 2QX7A 2C0CA 3QXHA 5B2ZA 1EFRD 1EXNA 3EGCA 1Q50A 1K27A 4ZOQI 5B64A 1KIMA 1XYYA 2WEKA 3UA3A 4C4XA 4KDFA 2WFMA 2RGRA 4C0JA 2GZ3A 1HEYA 3O1JC 2ZB2A 4M54A 1JR4A 4KDCA 1EDDA 1KZGB 1X7DA 3B20A 4OQZA 4PINA 1KXJA 4CTNA 1UPUA 4JYAB 1JALA 4W9RA 1L3CA 1DIBA 1JHUA 1FE8A 4QC2A 3TBHA 2WJIA 3F49S 3KZ1E 1RCUA 5HRAA 3P9SA 1B0PA 1GUZA 2G80A 4ARCA 5U4XA 1ZA2A 1LF0A 4Q48A 4DMCA 3D7SA 4R1NA 2V0CA 4X65B 3HUEA 4O8CA 1MC1A 2VJOA 1UINA 4XFKA 3EVFA 4WBXC 3OMLA 1I3LA 4G2TA 2OO5A 3H0EA 4LMPA 1NKVA 3HRHA 4TTAA 4YP1A 4GWGA 4MWCA 4D9HA 3H2JA 4YJGA 4CLOA 7AT1A 3D6AA 3IIMA 2BIFA 2E37A 4LIPD 2GZRA 3ESBA 3IIJA 3PXGA 1Z34A 1Y1PA 1N5LA 5H5JA 2ZUEA 5A02A 1VIYA 2HJ9A 4Q1DA 4BQOA 4DM4A 4MRMB 3A3OA 4TV8A 4UVHA 4DR1B 1OGYA 1W85A 1JEQA 2I7VA 3NFYA 4NJEA 4R7GA 4AUEA 4TRJA 5L3ZA 1SCJA 1GLNA 5BWBA 1D4FA 1O94D 4FN5A 4G0WA 3IOBA 4PAGA 2AMVA 2XUFA 1D3AA 2GZHA 4FX2A 4C3VA 5BWNA 3ER8A 3U49A 2H2FA 2YMMA 3IO3A 3ZI0A 2DVMA 4MDFA 4NU5A 1E2JA 3CTPA 1MB9A 1QB7A 2R1VB 1XMIA 3PX3A 3ENWA 3N3BC 4LHEA 4MAFA 4QPPA 1T1RA 3AFHA 2ZRNA 3E3AA 4XWOA 2NXNA 1U3DA 1VKJA 2P78A 3QLVC 4OHXA 1J8MF 5DU2A 2QLTA 1ZK3A 4GEGA 2X5JO 3W6OA 4Q00A 4PSUA 3R2JA 4QYTA 3BXOA 3VR5H 1V1JA 4ENQA 2C7RA 1W76A 4DT1B 1T6NA 4HAVA 2EW1A 2I55A 1HFKA 3CX4A 4PO8A 4XD2A 1DWOA 4JVMA 3ZWVA 2R2GA 3GY0A 5BN5A 4MGHA 1L8QA 1P0CA 5I7FA 3PDHA 3HZHA 3EEBA 3GD5A 4B4KA 3D6JA 3NHSA 3O8QB 3QNMA 2QQ0A 5CNMA 4UUNA 3V9AA 1QRRA 3GT7A 3OLVA 3RIHA 3RK1A 1BC5A 2FRDA 2ZAYA 1WHSB 1Y5IA 2ZT6A 3OEWA 1KMMA 4QGHA 1E2QA 4POOA 2Q50A 2JHFA 2ZPUA 4HUQB 5EJGA 4JR1A 3NDPA 1MW9X 5FORA 1QRSA 6AT1A 2DFLA 4JXKA 3ZD6A 4IMRA 1S89A 3N58A 3TKYA 4MWEA 1ZGZA 1KQGA 2O8EB 2CLDX 1H93A 1R18A 1BDBA 2Z1MA 4MKIA 3IDOA 2VPWA 4NV3A 2XF8A 2ZWIA 3QYAA 4MQMA 2G25A 4Q1BA 4DXDA 2Q0HA 3IVGA 4C7OB 4P54A 4D0GA 1RLTA 3H5LA 4OHRA 3FDXA 1KK0A 5C80A 1LK7A 4M6WB 4IS2A 3C3MA 3VAYA 3N6VA 2YWDA 4UREA 4B9AA 1ES9A 1XQXA 4L02A 5AVRA 2Z5FA 4EVRA 3NDBB 1CR2A 2YQZA 1ZS9A 4FYHA 3ZZMA 2W6JA 2ZRMA 3GJ3A 3AJ8A 4PZ9A 1KIFA 1P9RA 2JKZA 4U2EA 1ZKMA 1C9YA 5CW1A 2GLTA 1A4UA 4EGSA 2W6IA 1BVYF 1C14A 1TUGA 1TVKB 2FCRA 2QRPA 4EYKA 3LL4A 1YR3A 1GT91 2YX1A 3JATB 3WSVA 2W2QA 1LD3A 1E2MA 3NOXA 5ALYA 2W8BA 1ONBA 5KYNA 1R0XA 3OM0A 1OBCA 3C8MA 4R84A 1WBBA 1CQZA 2V58A 6REQB 1R5OA 1SBIA 1TAGA 1YJ5A 3CJQA 3NVDA 2O19A 2M6SA 1QR6A 1WCYA 2B1GA 2P9CA 2VDNB 2Q9CA 5HKLA 1N0WA 2P9QA 4V0NA 1I2ZA 3D6MA 1TJ3A 1DDOA 1GNRA 3MBKA 3TFQA 3U62A 2D3WA 3QKIA 3V2IA 5JU6A 2PKYX 4D0SA 5CB6A 3HA5A 4I50A 1TQDA 4OHYA 1FSZA 2B37A 1JKMA 2ZQZA 4MV5A 2OHHA 4UFOA 3TW0A 1GL7A 4QBIA 4ZCTA 4KIUA 3AUTA 1BKSB 1EE2A 2I33A 1IIRA 3EGDB 1YZFA 3IMGA 1MX5A 2KX7A 4IYRA 3DDWA 3DLPX 1L7EA 2YWHA 3I0MA 4H7JA 1C50A 1Z9BA 1ULHA 1X7WA 3I01M 1GA4A 2IW1A 2XX3A 3CB4A 1KI6A 3EOAI 1GSAA 3K9LA 4TMFA 3SHTA 2ZSFA 5LQMA 4F7DA 1DIGA 2I7CA 1HOXA 3NUZA 4JOCA 4UKDA 4IVQA 3BJIC 3LJKA 3SEQA 1W6UA 1P9NA 2ZBRA 5HXAA 1WO8A 3C1OA 4QYWA 4WLFA 1A77A 2WA2A 3NNDA 3JQBC 3FLEA 1I10A 1Q0ZA 1QF7A 4O4LF 3Q8LA 2JJMA 1FFYA 3OCVA 1E5VA 1P29A 3IP1A 4JZKA 2AIRA 4OK3A 4A73A 2XGJA 3JQRA 3C45A 1Z2AA 2VYVA 1P31A 4QJ5A 3DQQA 5BUZA 3NYIA 2J0UA 4CKBA 3LWBA 1Q77A 1CEEA 1HI9A 2A0WA 1D6JA 3X0DA 1C8VB 4GF5A 3HCFA 2OEPA 3FBTA 2TECE 4XB6B 4DV7B 2JZCA 3EB9A 1VHJA 2E1PA 2Q21A 1PZNA 4PRZA 1UKVY 5HK8A 4F21A 1JU9A 3RO7A 5JFTA 4KLCA 4LF5B 3P2OA 4RK5A 2CY0A 3SHOA 1ETUA 4AJHA 4INPA 5D85A 5DNAA 2COUA 4JB3A 2NQ2C 1NYTA 3QBEA 1VHWA 1HE2A 4YRPA 3EPPA 3GFGA 1UPXA 3EIOA 2JF0A 5AI0A 3EBLA 1QRAA 1D9XA 1NASA 2JAWA 3DZBA 3FTDA 4HO1X 5KINB 4CKYA 1VHQA 3U7JA 3VZQA 5IT0A 4QBFA 3L43A 2PBLA 3T5BA 3CE9A 1K06A