1SPBS

Subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
264
structure length
264
Chain Sequence
SVPYGVSQIKAPALHSQGYTGSNVKVAVINSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIVSTLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine proteinase/prosegment)
molecule keywords SUBTILISIN BPN' PROSEGMENT
publication title The prosegment-subtilisin BPN' complex: crystal structure of a specific 'foldase'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 89
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1spbS00
1S2NA 4DZTA 2XRMA 3EE6A 1TM7E 3PTLA 3A3NA 1SCNE 3F49S 1KDYA 1TM4E 3QMPA 4HVLA 2Z58A 3F7MA 1Y34E 3AFGA 3I37X 4WOBA 1GNVA 4OV6B 5AMXA 2GKOA 4NE7A 3LPCA 2WUVA 2TECE 2ZWOA 1BH6A 4OMDA 1WMEA 1DUIA 5FAXA 1TM5E 1WSDA 4WOCA 1SH7A 2HPZA 4H6VA 1SBNE 3BX1A 3ZXXA 1GTJ1 1BJRE 1HT3A 1ST3A 1THMA 1OT5A 5B1DA 1YJAA 4YN3A 1SUDA 5CW1A 4NE9A 3T41A 1JEAA 1SIUA 1SUBA 3WQBA 1NDQA 1Y9ZA 4Z2AA 2PMWB 3EIFA 1MPTA 2Z2ZA 1P7VA 4CG0A 1CNMA 3DE3X 3DE5X 3SICE 2ST1A 1KE1A 1DBIA 1SELA 1PEKE 1GTG1 1GTL1 1Y4DE 3DE6X 1MEEA 1BE6A 3WHIA 2ID4A 1Y4AE 3GCWA 1NLUA 5ARBA 2PKCA 1WVMA 1LW6E 1S02A 5FBZA 4CFYA 4FONA 2W2QA 4OMCA 5JXIA 1TMGE 3P5BA 2IXTA 4LVOA 3D43A 1C3LA 1SBHA 4ZARA 1VSBA 4JP8A 1AK9A 4AKTA 3EDYA 4GI3A 1R6VA 3LXUX 1SCAA 2W2MA 1WMFA 3L1KA 2V8BA 1R0RE 3BGOS 5JXGA 1AQNA 1SUCA 1AV7A 5JXHA 3H42B 5FFNA 4H6WA 2ZRQA 5ARDA 2ID8A 2G4VA 1KDVA 3SQOA 1EA7A 1SCDA 3PRKE 1S01A 5I9SA 3GT3A 1GA4A 2E1PA 3Q40A 1SCBA 1SVNA 2SICE 3DE2X 1TK2A 3QTLA 4C3VA 3WIUA 1AH2A 3DE1X 4RYDA 3AJ8A 1SUPA 1YJBA 3BPSA 3DDZX 4MZDA 2X8JA 5AVKA 2ZWPA 1SN7A 1SIBE 3DVSX 1C9MA 4H6XA 1SIOA 2Z2YA 5SICE 1TO2E 2PYZA 2Z57A 1GT91 1GA6A 1GCIA 3VV2A 1PTKA 1TO1E 2SNIE 1KE2A 1IAVA 1SBTA 4K8RB 4AKSA 1AVTA 2WUWE 1TM1E 1Y33E 3HJRA 1KDZA 1C9NA 1Y3CE 1AF4A 5AQEA 4B5LA 1Q5PA 1XF1A 2SBTA 1ZVJA 3TI7A 3QFHA 3CO0S 1CSEE 4J94A 3D9QX 2PWBA 5ARCA 2PWAA 3A3OA 3GT4A 4HX2A 1TM3E 1BFKA 1ST2A 1SBCA 2Z30A 3I30X 5B1EA 3DE0X 2PQ2A 1P7WA 2DP4E 1T1GA 1SBIA 1ZVKA 3DW1X 2X8JB 2QTWB 3LPAA 3CNQS 4CFZA 1YU6A 2HD4A 2SECE 1V6CA 2PRKA 3DE4X 3F7OA 4I0WB 1YJCA 1OYVA 2DQKA 3A3PA 1GA1A 3OSZA 3DVRX 4ZOQI 1BE8A 1Y3BE 3VYVA 3WIVA 1Y3DE 1C9JA 1PFGA 1UBNA 3VV3A 1A2QA 2B6NA 1Y48E 1Y3FE 4KPGA 1NDUA 3DWEX 1PJ8A 2WWTA 5JMOA 2P4EA 2W2PA 3VHQA 2W2OA 1T1IA 2DUJA 1OYOA 4KB5A 4BWGA 1P8JA 1T1EA 4DWWA 1EGQA 4M1ZA 3UNXA 1SUEA 2XTJA 4LVNA 4C3UA 1GNSA 1IC6A 1SPBS 2WV7A 4DJ5X 3GCXA 1R64A 1SUAA 3I34X 5JXJA 3ZXYA 1BFUA 3TI9A 2IY9A 2W2NA 3DE7X 1WMDA 3DVQX 3Q5GA 3DYBA 1AU9A 1SCJA 1V5IA 3DW3X 3TECE 2Z2XA 3VTAA 1Y1KE 5K7SA 3AJ9A 1TECE 3VSBA 4NMXB 3I2YX 2Z56A 4KG7A 3LPDA 5AVJA
chains in the Genus database with same CATH superfamily
1TYCA 4LXTA 1ADFA 2ODAA 2XKBA 1OYWA 3HSKA 5MN4A 3TUIC 4JJIA 4DLRA 2CSXA 3PX2A 3WBBA 1PNOA 3FCCA 1CFJA 1NV8A 2BMJA 2R79A 3N2YA 4R40A 9ATCA 2VZEA 3TXAA 1PDWA 1SCNE 2V98A 4GC9A 1WDMA 3C1TA 4HUJA 2RI6A 3HRHA 5FPPA 4MO9A 2XVAA 5FO0A 2WA1A 4AWBA 4F46A 1TL7C 2XW6A 2K7FA 3CWZA 2CK3A 5KYNA 3AL3A 4CQMB 3GLIA 1E79A 1VPWA 3CX4A 2QTVB 1A95A 2OAGA 3KCQA 3LVFO 3NYQA 5JBQA 3C45A 1KMHB 2PLRA 4ITVA 1HDGO 2H0AA 4WOBA 4MKFA 1KVUA 3ZCUA 5BPHA 2YRFA 1NT2A 3NWPA 5CLJA 1B74A 3ER9A 5JSUA 4FFBB 3VPXA 1XXHB 2Z1DA 4J03A 5AW8A 2TECE 4G37A 4ARAA 1JKMA 5CDUA 3L49A 1B26A 5C7YA 2DQZA 4H15A 1PWHA 5JJCA 5AXBA 2AJCA 1E1CA 4F5DA 3LBFA 1X1CA 2JD2A 2OHOA 5DX8A 4ESHA 1OBCA 3K6RA 4EA6A 1PDVA 2W2LA 3EXEB 1PNVA 3G6KA 1SK9A 3I1YA 2QVCA 4D79A 2P0EA 2OG1A 4YR9A 5J9FA 1CDZA 2ADMA 2QW8A 1FNCA 3VTKA 2EJCA 2VF4X 3AEUA 1CUCA 4ALKA 2ZKIA 4CDRA 2ZGVA 1VJRA 1UOQA 1AV6A 4KFUA 2PJDA 3VOTA 1UK7A 2JH3A 4UPEA 2EBHX 4F4UA 3KUXA 1D1PA 1PR6A 1VGQA 2B20A 3ETEA 1NYRA 3FYUB 1MQSA 3FYDA 4WNAB 5JSZB 1R12A 5I7UA 1VPEA 1CPYA 1P9LA 1W581 3ZW8A 3IBTA 4FWIB 5K09A 4Y2XA 3LSYA 3S2SA 2YMLA 1WB5A 2AOTB 3C4JA 3A9WA 4FSHA 4N6NA 2PSFA 2BAGA 3G1UA 4NNOA 3A6HA 4PAMA 1W29A 1YS9A 4URYR 4TL8A 1JE0A 1LI5A 2XSZA 4LN1A 3CCCA 4KLRA 5AHWA 5BWBA 1Z7BA 3IALA 4EG8A 1L5RA 2VHQA 3EXIA 5JAZA 5JNWA 1LPPA 1ZKDA 1T13A 1QP8A 1SXJC 2YRWA 1ISHA 3L7NA 4H08A 2W9XA 4CRWB 1P19A 3DMTA 4JJKA 4JVMA 3B8HA 1A7KA 1EM8B 3N6RA 3UPDA 5FLEX 1AD2A 1F4LA 1QX4A 4WZ6A 4BO9A 3ZZUA 1O87A 3CRW1 5CVJA 4BX3A 3UH0A 2CHUA 2GCOB 1A96A 1NTRA 4MYUA 1QPBA 2EKZA 2Z2ZA 3IDOA 4EG3A 4B6FA 2PGIA 1KMMA 3R76A 4O4JB 1JKJB 4DDHA 1SKUA 2MSWA 1JNYA 1OD6A 2AVDA 4UFOA 3UQZA 1G2IA 1CZLA 2B5OA 2FDRA 1FB5A 2J41A 4G8BA 4LJ4A 1MNAA 3TH5A 1E6WA 3N28A 2CJWA 3KFVA 4YNBA 4HDCA 1FNDA 4K9MA 4OIFA 3RVNA 4C4XA 2BONA 4FHGA 1LF5A 2PV7A 2IEYA 3KQOA 2ZRAA 3H05A 1YL6A 4WLNA 4EB3A 4EATA 3FB1A 3RK1A 3LXMA 1MH9A 1ZITA 2A84A 3AG5A 3MINB 3NKVA 2ZYWX 4MUJA 2GPAA 4WJKB 5KVSA 4RVSA 2ID4A 3D02A 2ECKA 1YDEA 3P2IA 1DT3A 1DIGA 3VAYA 2N1MA 4MW1A 4GI5A 2DPLA 1I80A 3ND6A 1GADO 1ZVQA 13PKA 4HAVA 2CWWA 3STVA 2EWWA 4U6NA 4K9NA 2PRZA 5HOEA 2IXFA 1FYEA 5EC8A 1AO3A 3ROZA 3AEKB 4I36A 4QFCA 5H82A 4ALNA 2HT1A 1G21A 4KPEC 1YO6A 2C5SA 2P5UA 1E9DA 1I5RA 2ZJFA 4QUGA 5EE9A 4DWWA 1NXQA 1TKAA 1WR8A 1TLTA 4UFNA 1N2EA 4EO7A 3D7NA 3MUOA 2VP6A 5IT9A 3HL0A 4QQKA 3L6RA 4FR0A 1U3CA 2JGDB 3A6KA 2D1FA 3AK4A 3JYOA 4IRMA 2FG5A 4JVLA 4WY8A 5CM2Z 3P5BA 3HJHA 4M1OA 4NV1A 3DLAA 5D5PA 2G9NA 1JR3E 3V9PA 2AFIB 1Z8DA 3C3JA 3DBHA 3QX7A 5K8JB 2GB4A 3RTDA 1XB2A 2WYOA 3D43A 4RVCA 4CCYB 3PCXA 4GZ5A 2WM2A 4JI7B 5DX0A 4ZTZB 1F2TB 1L4UA 3R41A 1PN3A 1L5HB 2X1VA 5KNCH 2E0IA 2I0FA 3T5DA 3R5JA 2VUHB 4D1YA 1KBOA 4FINA 2VDOB 2XVMA 1RJDA 2V6GA 2H4HA 4IL5A 4YJFA 4Y6RA 4LXXA 1DFIA 2X22A 3MTAA 3C7CB 3BK1A 4UDYX 2O7SA 3UMSA 1BEZA 5DGTA 3JVIA 1YKGA 3LKBA 2GD1O 1G8YA 1CUIA 1UC9A 3IE0A 3K6KA 3L7LA 4Q6BA 2AW3A 3U7QB 4DR5B 1R4MA 2X77A 2O8EA 3AHJA 3DOUA 1OLXB 1VGVA 3IELA 4MKGA 5EVCA 1X2BA 4IXNA 1YHNA 2DH6A 1JU9A 4X00A 1TDJA 2O8NA 3GLFB 4X5OA 2JGRA 1E6KA 5F2KA 2XGGA 2ZRQA 4OXXA 1U0TA 4G4GA 1HDIA 5L51A 2FFBA 4M1EA 1NULA 1TAGA 2JFFA 2NPFA 1MQ8B 1A82A 4F9EA 1ADCA 2O8VA 1ZCZA 4CIDA 4EMBA 2WUFA 4PC6A 2ZZMA 4CEHB 1GILA 4RNDB 2WVJA 3NGLA 1KDVA 4JLWA 2AG5A 3U4DA 1E1YA 3EW9A 2P9JA 3I58A 3O03A 3VJLA 4NS4A 3WB0A 5EJ2A 2JGEA 5K0BA 2VAXA 3DF7A 2RKWA 3UICA 3N6XA 5K8VA 1EE1A 1NQVA 1OYYA 1WHSA 2DUNA 2AOUA 4W5QA 3G82C 5HUJA 1YFJA 5L7TA 3L0ZA 4RXUA 2DBRA 4PY2A 3RVQA 5JWRA 1DV1A 4J0GA 2RGBA 1SR8A 3K1AB 5F52A 4TTAA 3T4PA 4JB0A 4FYHA 1YK1A 2HLDD 4DLAA 2OM6A 3P9XA 4MGKR 4U4AA 4DC9A 5J4LA 1E2HA 5TS2A 3O2QB 2CF6A 3L8FA 4MH0R 4X54A 5C31A 3VR6D 5TY0A 4ZVSA 4Z5XA 3HRKA 4DLNA 1LFAA 2BEKA 1CVRA 1TQDA 1IHOA 2A0UA 2FMFA 3AB3A 3TKLA 3WIUA 2OUIA 3K0FA 3HBJA 1ZD3A 2JCBA 4EK9A 4DG8A 1JA9A 3W9BA 4QA9A 2PZJA 3AGQA 5CLGA 5AJTA 3MWDB 2J4DA 1W88B 4QTYA 4IS3A 1BKSB 2VA8A 2R1UA 3E3MA 9LDBA 1FFYA 5I3ZA 3N7UA 2AX4A 2V7UA 3K53A 1K6XA 3ZUPA 4OJQA 3LBNA 1PL7A 4UATA 3OQNA 3P2KA 4WKCA 3LY9A 5JISA 4TT8A 2VYNA 3V4OA 1QBKC 3ZV6A 4QODA 3NXSA 5FNVB 2RSLA 5HJEA 3BZWA 3M1YA 3JWJA 1SIOA 3AM1A 2EU8A 5CCEA 4FIZA 3PXGA 1YFZA 4FN5A 4MRVA 5K6RA 5FUYA 4JBIA 2AVNA 3GK3A 5G0UA 2W0SA 4BE4A 3KEOA 4NAUA 2XZLA 1J2EA 3MGAA 3WGOA 2WJ4A 3ORYA 1MABA 2PH3A 2XPCA 2I8LA 1KQGA 3LUPA 4LZZA 2ZVQX 1QV6A 1XWWA 3TQTA 4ZTUB 1PLJA 2GEUA 4LDPA 4WY2A 3RFFA 3RF6A 1A9OA 2ISQA 3CF2A 5AM0A 4AKSA 2COUA 2QVXX 3C1AA 4PAGA 1GRQA 1HK7A 1HSZA 3R7DA 2J4FA 4NFSA 3SS9X 3AIKA 1L5MA 1Z2AA 4D56A 5IMSA 2HTEA 3W5CA 3ESXA 4QPNA 3UMVA 4QHYA 2WOOA 4GMFA 2GZRA 3RUEA 2P40A 2HCBA 2M98A 3LT0A 1PYDA 1CY2A 1R16A 4FGZA 2HADA 3TQSA 1NBIA 1RRFA 3RS2A 1VMKA 4CKBA 1I1QB 1QZZA 3MVEA 4UDOA 1TE2A 4MQFA 3NTQA 1AJEA 2VJAA 1F8UA 1YR7A 2HEIA 2J9GA 2WHPB 3G9TA 4G1UC 5KWVA 1KSJA 3GPDG 2XLCA 1KWGA 3HLTA 2CSUA 4Z54A 1ZUNA 3V2UA 4EP1A 1K06A 2P4QA 4ROTA 3TAHA 1FS4A 2ZJ1A 3LC0A 3BHMA 2FWIA 2YN4A 3NWBA 4Y8VA 3OLXA 2W6CX 4BEJA 2WFAA 3ZH9B 4BV8A 3SZ3A 3ZQ6A 1NX6A 4OFBA 4PLCA 3P0RA 3ELYA 1UIRA 3UJBA 1CLEA 3D6HA 5ALHA 1WLYA 2XGOA 2GCEA 4GMHA 2AS0A 3K09C 3MSXA 4BB6A 1QU2A 2Z9BA 3PIRA 3UCFA 4B79A 1PO7A 5TJHA 1DQYA 3U44B 1DDIA 4DS3A 1JF8A 3O8LA 4PZYA 3SWWA 5B1EA 2XMBA 4A7PA 1HT1E 5HRCA 5TQ2A 5JMWA 1Y63A 4Q4DA 1O96B 4XDYA 2IYVA 3B36A 1JG4A 2F1KA 4FHZA 5JTUA 1XVIA 5LCXA 3KAQA 4D99A 1VECA 1KYZA 1HMPA 3CNNA 2ZR8A 1Z4MA 1S3SA 3U60B 2HWWA 3PNPA 2GYWA 4JBXA 1HE5A 3W9UA 1AHNA 2QRGA 4EI7A 5IJWA 1OUMA 4IAOA 2PSDA 1ZMTA 2QTWB 5DXJA 1W5TA 2CHQA 1UWKA 3IMGA 1C81A 3FIUA 5DCWA 2Q0XA 1G66A 3DT8A 2FZKA 2WEKA 4RQUA 3RS8A 3UN1A 2RGXA 3EC2A 4EQZA 2ASVA 2J3EA 4HATA 4J6EA 3W3AA 2P68A 2RC5A 3CNQS 3EOZA 1GVHA 3U17A 1VP3A 4DSOA 2HMUA 3MTEA 3WLQA 3R9XA 1C9DB 1E60A 2R2GA 2ZYSA 1W8DA 3RTEA 2X5OA 4FBLA 2ECFA 4AF7A 5F76A 3FM9A 3CRNA 1VHJA 4R2LA 2HJRA 1GA1A 3T4XA 2IOFK 3VR2A 5GADl 1L1FA 3THWB 3ETHA 1TLFA 3R7AA 5AHOA 4AWXA 3TF5A 4ZTBA 5ALPA 2HHHB 4ZI5A 1ZNXA 2C98A 1TT7A 3DMFA 1IM5A 1CE8A 1MC5A 5JJKA 2AR9A 1VIVA 3B7PA 3CMCO 4Z7OB 3QPVA 3ABZA 4HRXA 1KI6B 3ZDEA 4AZ3B 4BNKA 1F6BA 2AG0A 3SS8A 4QSMA 1KJZA 2F3RA 4HDSB 3C70A 3D6JA 3GDGA 3O3CA 1N5IA 3RCBA 4CR7A 5HIIA 3RRZA 1C1XA 1VHTA 3T5AA 1LU9A 3JYNA 3VUFA 3W7VA 1B1AA 2YFHA 3QXCA 4KPGA 2BW0A 1K5GA 3K0AB 2O2YA 1C8KA 2RBKA 3M1LA 3JYHA 1XF9A 4RK5A 4S1OA 4EI2A 1TKBA 1WD7A 2WTEA 5TNXA 3VDQA 4K9OA 5CURA 2B7LA 1HTWA 4YRRA 2FX5A 4ZQBA 1PL0A 3GJSA 3H9BA 5B53A 2G06A 2IYZA 3PITA 1ZCFA 2B3DA 1ZIOA 2W2OA 4Y6LA 1T2FA 2Q9CA 3DOFA 5A4FS 3M6AA 2EW1A 4MGEA 5KOHB 5ES3A 2D2XA 2D5CA 4KBYA 3A1TA 4Q4AB 1J2JA 1OYOA 1XLVA 1NVVQ 3EMBA 4MUXA 1PX0A 1OAAA 1BE1A 3IA2A 2WUEA 4O0MA 2QRNA 1PQWA 3FZNA 1X3SA 3KETA 4ZRMA 3HKEB 4GQIA 4YBRA 3TR5A 5AXAA 2ZE7A 3FAZA 1JEDA 1KU6A 1Q0HA 5F33A 4YCDA 4ED9A 2A6PA 4C3UA 1FMFA 1C7QA 4R2HA 2I67A 4A9AA 5FX2A 3GP8A 3BCUA 3QWFA 2I33A 3TFQA 3DCYA 1F0KA 3NCTA 1I1OA 1T3GA 2WVHA 3DS8A 3EF1A 4GQAA 4KYTA 2LW7A 4NOKA 1JHRA 4Y9UA 5D7NA 1ND6A 4XYLA 1GLNA 3ANYB 2ZW9A 4P54A 3YASA 4ASUD 5KHLB 4IQFA 1QRUA 5ECYA 1XN1A 4GP7A 1AIPA 3ZWPA 3U7HB 1F2DA 1NLFA 2J0EA 3BORA 3HYRA 3L8EA 3V32A 4B3TB 5FWNA 1G19A 3O92A 2W2NA 2WYIA 4CKEA 3AI3A 2R8BA 3EZXA 5CT9A 1BXGB 4WIAA 1L5VA 4D02A 5C46F 3LHSA 2C8LA 3TLBA 3HP7A 2YVKA 2YFYA 2NSDA 3R6TA 4GLLA 3ZHYA 1CR4A 1MG5A 3K72B 4QTXA 1JB9A 1TD9A 2ZVDA 4FYPA 1MTOA 5KDLA 1Z5OA 3C0KA 3TRFA 4B34A 3MUEA 3AQIA 2O8FA 1C0IA 2BFPA 1GGEA 3Q3CA 4MHSA 5IJ0A 2X0JA 3FWHA 3THOA 3P8ZA 3AQ4A 4J8PA 4DW8A 4QYIB 4KQWA 4N41A 4XIIA 3GEGA 3EFEA 1LPOA 3UYKA 4BTLA 4MWTA 4PYIA 1J99A 1JA0A 3EQZA 2DBZA 3NFYA 1TZ2A 2CL7X 2VJBA 2QDXA 4K6CA 1Q20A 3M7IA 3S28A 2W2KA 4CKXA 3QLUA 2HA6A 4X20B 3C6KA 2P2ZA 3DEZA 4GMXA 5FWXA 1HBJA 3W5IA 3X1YA 3ZGVA 4BN4A 2JBHA 1E3DA 2GXAA 2FZLA 3GLGA 1XEWY 4EGQA 2D13A 5LR6A 3FF4A 1K4YA 2FEAA 3WHLA 4EZIA 5FWDA 1KFCB 4V1CA 5EZ6B 3AR8A 4IJ5A 1DRUA 3QVGB 4BNWA 2G6TA 3SM3A 3NUZA 1O89A 4I6EA 5BWOA 5KYYA 5I45A 3BD8A 3T9DA 4E11A 2BEUA 3HB5X 3N7AA 2WTNA 2NO0A 2Q28A 3KLMX 1RPJA 3H6HA 4PO9A 1Z37A 4FVTA 4MDEA 4CBVA 4GR5A 2CY0A 1Y34E 2MOKA 1JNXX 4JKOA 5F9HA 3SIRA 3AIMA 1H66A 1PSDA 1WTCA 4QYWA 4RGVA 3RT7A 4E1BA 3IB3A 5HGXA 1CUYA 2IUSA 4FMBB 4A23A 4NE7A 4CM8A 4XVCA 4PEVA 2OXIA 2X2OA 1XQ9A 2OK7A 4PLTA 1FK8A 1EA5A 5KNBD 1N7JA 2XVXA 1XELA 1V2HE 4I5DA 1WMEA 4TTPA 3C3MA 1EX9A 5JYCA 3KOMA 1M8GA 3FWKA 4W9NA 1KSFX 1VCNA 3KR1A 5ALKA 1DHTA 4KXWA 3ZGNA 1V47A 4P36A 3VNAA 4P3KA 1XCLA 1TCAA 4DLUA 2BFAA 4RKFA 4WOCA 5JJLA 1N5MA 3T7AA 4ZEVA 2DPGA 2ZB4A 3GU3A 4NYIQ 2XA1A 2OSBA 4KR0A 5AM2A 3FGPA 2IL1A 3GRYA 1A50B 1DO2A 2BDEA 2YWFA 1QNFA 4HV4A 1NC1A 2HHLA 4G1EB 5KMGB 2B8EA 2VSQA 3WL8A 1J8DA 1HT3A 2GUGA 2BELA 1D0SA 2I4MA 4LDNA 2QTCA 5BNIA 1QIMA 4MYDA 5B1DA 2QLTA 2NWQA 3HA3A 5FT9A 2ZP1A 1DIHA 1QP4A 1CEEA 3HBLA 1EFDN 4AZ0A 5A4DA 2RHLA 3OD5A 3OQBA 4UEKA 4UTOA 5CJ2A 3SX0A 2IEGA 3FHJA 2CXHA 5KWSA 2DKNA 3AR3A 1MO5A 2H2AA 3M6LA 4GSLA 4Y18A 5BN4B 4QQ8A 4YRMA 2QPLA 3DL0A 4TM7A 3WI7A 1JQDA 4L5JA 3KDPA 4HC4A 3TJZA 3HUUA 1P17A 1R00A 2DYKA 3DOJA 1HXHA 1B43A 1LPSA 1RAHA 2J6BA 1R7RA 3ZOKA 4PRLA 1VYTA 1GU0A 1ESDA 3QOYA 1RYHA 1II8B 3HV0A 4KL8S 4E51A 1CF4A 3Q8WA 4CG0A 5AICA 2OK8A 5DO9A 3E9DA 1JLKA 3D1JA 2QI9C 4ZO6A 5JT1A 4LBYA 4BTEA 1CIPA 1J0AA 1SXHA 3WIBA 2JA2A 5FTLA 3U7RA 1OXTA 4G0UA 3PXUA 1ZCBA 2YYSA 3HDQA 2V7QD 4DFDA 2POCA 4QZVA 1KE1A 4TYYA 2HPAA 1GYRA 3FI0A 1T43A 1EG7A 1Y3HA 4PVCA 4JK3A 4BDSA 1UFKA 2QR3A 4EL5A 1XA4A 3NORA 4YMVA 2FPGA 1J0CA 3CF6R 3G0BA 4DV5B 1USWA 1GTL1 3ZIAA 4U2GA 3L8GA 2YVQA 2YWXA 1I32A 3ZHVA 2AXPA 3P9PA 3IVCA 3EMVA 3PFHA 4HRYA 1KI7A 4TL9A 4YAOA 5T8KA 4RH1A 1R6TA 3ICEA 1JT9A 4GBGA 1ZH2A 3HVKA 1YZHA 4MDFA 1EG2A 1UP6A 1UJCA 3URKA 1M2OB 3ZWQA 2LRHA 3BH0A 4NE2A 1MDBA 3NRCA 2XQIA 1Q12A 2GM9A 1DQZA 3FCXA 3IJPA 3LWDA 5D86A 2NSLA 4D92A 3KOZA 1V7CA 4LVUA 2GD2A 4ETIA 2XAAA 3TRJA 2ZRHA 5LQAA 4WNYA 5IASA 2A94A 2AH5A 3INNA 3KD2A 2XOKA 3EIQA 2DEUA 3L9XA 3D2AA 1C41A 4V02A 2Q45A 2JKZA 4ZJPA 3PDCA 4X1IA 2IDKA 1YV9A 3WGUA 1IATA 4C07A 1BAPA 4W1SA 2QWXA 5DMHA 3DTVA 1R6BX 1M6NA 2CLEB 4CLHA 3VNRA 3GBSA 2XKJE 4YRIA 4M9UA 5JYEA 1WX1A 4Y2PA 2FPIA 4H0CA 4HAYA 4YLYA 1YVUA 4UXJA 2FRDC 1DTWA 4F0JA 5LOVB 4E4YA 4MWEA 2WG0A 3SBXA 1Q0LA 3JQFC 3PQ6A 2IDMA 5IMBA 3QV1A 1D8AA 3DKPA 2EZ8A 5J2TB 3CR8A 4AKTA 1PR1A 5CYFA 1OU0A 2HFJA 2JIRA 3I2IA 5JS8A 2XEXA 3B1JA 3BERA 4B47A 3KWLA 4M8LA 4DCNA 2OFWA 1AURA 3JWGA 2NLOA 1HNWB 8OHMA 5HWSA 2GZ1A 1T2AA 4PRZA 2OD2A 4HTFA 4AO8A 4HMPA 1KARA 1TIPA 5MGBA 4FILA 2ZJ5A 4MV0A 1NG1A 4F6CA 3ESBA 1ZUHA 4H2DA 2AJBA 2VQ6A 2XBUA 3C85A 1USKA 3KXKA 3BDVA 4TYNA 1DT5A 1DRWA 5HZMA 2IU3A 2I9PA 1DC3A 3AUXA 3AMVA 1I0IA 5K4GA 1JHVA 4RZ2A 5DK4A 3FZQA 1EJ0A 1MXFA 2QX4A 3FYSA 1T4MA 4E2FA 2ODTX 3QVOA 4EY3A 5TT0A 1CQJA 3GQVA 3STHA 1ZRMA 2OBBA 4O2RA 5BVHA 4CMKA 2ES4A 3ZVLA 1Y3AA 2AN1A 2G4VA 2XNDD 2Z95A 3ZI4A 2Q6KA 3B1WA 3GVPA 5IDWA 1GTRA 4MUGA 1F38A 3DXXA 5BSUA 2GDJA 3CA8A 1TQ8A 2OMKA 3VHLB 1BDMA 3ZDDA 1W4RA 2DR3A 1VKNA 5EPOA 5CA1B 1A9SA 4KBFA 1XVTA 4EG5A 1SBYA 4G5QA 1ACJA 1NXSA 4ND1A 1JDUA 3TD6A 2UYCA 3LLSA 2C9YA 1CB0A 5GGYA 5THQA 4NBUA 4C1NA 1Z29A 2Q3HA 1NQUA 3KPYA 5DOZA 1QFXA 4OXIA 2HJSA 4BB5A 2I1WA 1WUHS 4B3IA 2YYAA 2V0NA 2NU9B 4CQLB 2HA4A 1TAQA 1YZVA 4MIEA 1M2WA 2DKFA 3PFIA 4CL8A 4YXWA 4A5OA 3QVUA 2E82A 5CT5A 2CDBA 4C3VA 3SEQA 3GLIE 1AH2A 1BA3A 1W4BA 2WA2A 5FA6A 4KIWA 1Y81A 3L06A 5HCIA 2H48A 1DZIA 4Q4HB 2VT2A 2J45A 3CZ9A 5H0IA 5KYWB 3ANLA 2EKPA 1KI4A 1R0XA 3ZVMA 3DWFA 1JL3A 2BFDB 2QU7A 4NG4A 3K9CA 4NMMA 4B2LA 4BGIA 1L7BA 1P0QA 3F8WA 4TUYF 4PG7A 2C00A 2I80A 4DCSA 4K0KB 4DKJA 2PKQP 1XZMA 3DB2A 1OW3B 3VR4A 4CM4B 4F4JA 1C9MA 1TU0A 2XOXA 1E1QA 5AJWA 4MYHA 3GT0A 1V16B 4GI1A 2GPWA 1PR0A 4FOOA 3UMBA 2WABA 1K4MA 4R0VA 1LPMA 1UBRS 1E9SA 1WQ3A 1TO2E 1U2GC 3BFJA 3ESZA 1GNPA 1U3DA 3H9JA 4I8IA 3LDFA 2VWGA 4YCBA 7ADHA 4B40A 5LM3A 5JNTA 4TUYA 3CCFA 3AG6A 4D57A 4E94A 1M5TA 3FSGD 3JQ6A 4KDRA 2WHYA 2PK3A 1C4WA 1S4MA 3C6QA 4D3FA 1IAVA 1GNRA 1SZJG 5KQPA 2WE8A 3C3CA 1B8PA 1DWPA 3PGMA 3VSEA 3K5IA 4J3FA 3IP1A 2QR5A 3UXEA 1WD5A 2XGSA 3AV3A 2D6FA 3FCSB 1CP2A 2OKGA 3HS3A 4UNNA 4AIIA 1TM1E 1Y33E 2WF8A 2DPMA 4CTMA 1BTOA 4XQCA 1TCCA 2WD7A 3BMOA 1E62A 2ZQ5A 3VPBA 4Q02A 5FUBA 4IIXA 4JWKA 5T3YA 4Q3CA 4JNKA 2C84A 4R68A 4KC0A 1TA0A 2HRBA 4V0SA 3UC5A 4UTNA 5FQOA 1SXJE 4BO1A 2WJAA 1Y3CE 1F0YA 3AH8A 1MC1A 3I0NA 1SKBA 1TJ5A 1RYZA 3NBKA 4FDVA 1DP4A 3H8VA 3ZQJA 2G9QA 2P6NA 5D3ZA 3TD9A 4DIMA 4Y1GA 1YB7A 3BWMA 3D8BA 5TVKA 3IQXA 2SCUB 4N82A 1EGAA 4I4TF 4YB8A 1P4JA 1LJLA 4F9FA 1T91A 4WLOA 2OM2A 3EC7A 1JEYB 1VLJA 1RXSA 2PCLA 4GW3A 2OP1A 2Q5JA 2IZ7A 4DV4B 1MGPA 1B14A 2E37A 2FSVA 2JA1A 4KQJA 4HQOA 1CVIA 3R6DA 4J1TC 2OP0A 1NVAA 2XI4A 2H1LA 4M9ZA 2I62A 4MV4A 5AK6A 1ZH6A 5GJCA 4R3UC 4TQUS 4DUGA 5LMZA 4LYDA 3ZNPA 4RD6A 4UNIA 2UVPA 2WZCA 4OREX 2VPWA 4LHVA 3UG7A 4DIFA 5ENVA 1NE2A 1W87A 3RWMB 4BVJA 2XYPA 3DAFA 4OHXA 3KQLA 4I4TA 4ZU6X 3WWYA 5BRJA 4BRWA 3ZCSA 5ITZB 3KVYA 2Z2KA 3GGSA 5ICSA 1SEVA 1BS1A 1O95D 1OI7A 1H0SA 2BKVA 5IUJC 3KSDO 4UUNA 3E0XA 2ZUBA 2XT9A 3UXMA 4F4HA 5LZ2A 1DWOA 1F1BA 4HEA6 1SCUB 4Z3DA 1UEJA 1P5RA 1SBIA 1TF5A 2P67A 3GI1A 1TTPB 4PZ0A 2RI0A 5EMNA 1H2ZA 3WBJA 5GINE 2UVDA 1U28C 1KIAA 2Y1DA 1NVVR 1GGMA 1GV1A 2VPQA 1G3IA 1V3UA 3R24A 3DP9A 1RRCA 2M9MA 3GRVA 3OCJA 5I7FA 3UEOA 3K6SB 1MAWA 4RVUA 2EYQA 2XYQA 1DXYA 1HY3A 1T5LA 5ALDA 2O1EA 5G1NA 2ALJA 2V0CA 2YNMA 1Y4SA 3KXDA 3T4UA 3CCBA 1MA3A 1ESEA 2G7ZA 4A03A 4D4IA 4ZGBA 1PNTA 2XQVA 4GZMA 5G0WA 2WE7A 4ZOCA 2QUZA 4QYTA 4W6QA 1XWIA 2R62A 1GQOA 1OILA 1Z36A 1Z4QA 2WNHA 2ZPUA 3B2NA 3MJHA 5DXAA 4JVNA 3ZDRA 4BFWA 4BNZA 3CNEA 4PR0A 4RL6A 3OWXA 5L53A 2EBWA 4M89A 3BHJA 3OSZA 1VPDA 3K5PA 3OU7A 3S5JA 4TVSA 3D8HA 1U9IA 4XYEA 1KZ7B 1T0UA 5J2UB 4ZN6A 4FM9A 2QEQA 2QRQA 4ZAFA 4F72A 3MEQA 3UMRA 1W0KD 2C5FA 1GPUA 1ACLA 1YAHA 2LIPA 5DTIA 3UQYS 4M0EA 3NR2A 4IDNA 2PVPA 4GYKA 1RVV1 2HRRA 3R0VA 3IPCA 1BQ4A 1I7NA 2CD7A 4J43A 4KVZA 3TLXA 3R6WA 2X58A 4DEYA 1N34B 3E8SA 4TZ6A 5JDIC 4Q4CA 1IZYA 4EECA 3CVUA 3C8ZA 4ACAA 1LK5A 2IZOA 2PR7A 3FH0A 3IMCA 4TWAA 5C1IA 1VE1A 2DRIA 1XT6A 5IT0A 1CQZA 1RAAA 4F21A 1P1CA 1CY6A 1IJFA 2PBRA 2PDAA 4IGEA 1UODA 3FMGA 3ZTTA 4B44A 5JFOA 1UDWA 1PWZA 2WDPA 3SIPA 1KIMA 1HGXA 1RSZA 2ZIAA 5CX4A 3TEMA 2BKUA 2PD6A 1E1KA 1UFQA 5KREA 3QUQA 4AF8A 2VRCD 3CRMA 2QOEA 1N2BA 3EIUA 3HFGA 5C8ZA 3MPUA 1N9KA 4PO1A 2BD0A 3A6JA 3WYFA 2ZIEA 1CJBA 4IJWA 4MEJA 3ITEA 3OQJA 3H7IA 1SQGA 4ZVLA 4CT5A 3QF4B 1ODIA 1THGA 4II7A 4P4LA 3FPHA 1K7SN 4QTTB 3V8VA 4EHHA 1NF9A 2QYTA 4B6RA 1ZN8A 1OZGA 3VBEA 4E1AA 5KYUA 2VHCA 4CN8A 2ZM6B 5C7IO 2PUWA 4KFTA 4MAAA 4ZVUA 3BXFA 1OXSC 2R96A 2X9NA 3TMKA 1QZ3A 1EVKA 1XJWA 5F21A 3RYFA 3A9TA 5KINB 1K7XB 4K81B 2ZRNA 3GRUA 3W05A 1PFYA 3NKLA 1ZGAA 3JRNA 1YCHA 1YR1A 4RMIA 1A2BA 1L4KA 3SYNA 1CY4A 3RK4A 2I2AA 3L8MA 3F2VA 1KY4A 4ZC8A 5K8LA 3RHZA 5H02A 1AQLA 3LDHA 4XM2A 4EUEA 5CA0B 2IYYA 3GVIA 4ZHQB 4E3WA 4QXQA 2VI5A 3S1SA 1CQIA 3UFXA 5GWXA 1QTQA 2O8DB 2HXSA 3E05A 2HCJB 2OFPA 2ZR0A 1JGTA 5G3YA 1PKXA 3LBIA 2A67A 2FHPA 1XD2B 3IKMB 2QXUA 2VDVE 3RD5A 5KSZA 5LDHA 1DBPA 3NBQA 4DDUA 1EB8A 1GGJA 2EARA 5GOTA 4ZCPA 2Y0PA 3HUEA 3LGSA 1XRJA 4JVSB 3RKRA 5KQSA 4QWMA 1GQRA 3OZ7A 4NYIR 4Z4IA 1PS9A 4AICA 1XXLA 4R51A 5K0SA 4LF7B 3TTXA 3VAZA 3WLEA 2CWDA 3SQDA 4S0XA 5KKNB 2A2ZA 1PIWA 2P6PA 2O3SA 1TECE 5IUNC 2VDWA 3MWLA 4K3VA 2EGUA 4NMXB 2GBGA 4KRGA 5JEEA 2QG9A 1FJXA 4IOMA 3O8DA 2H18A 1IU9A 1ECFA 1IQUA 1XRLA 3MGBA 4WBNA 1ELOA 1O6GA 4Z9AA 1YMVA 3Q8KA 2GYUA 5FJIA 3SEFA 2UZ0A 2X5NA 2VP0A 5EKXA 2XNKA 1WEKA 3JQPA 3I5MA 2X19A 2WTBA 3CGWA 1GGHA 2FUNB 1T9AA 3E1KA 3NH6A 2BPOA 4WERA 3ZZNA 5KC9A 3GZTB 5KZMB 3PDWA 3EAFA 1DMSA 4LF8B 3SKVA 2H1IA 1ULHA 1TM4E 2DERA 1P39A 3NBMA 5H59A 2GCNA 2Z58A 3KQTA 4HN4B 4ETWA 4K9KA 2GPBA 1V1RA 4CIYA 5D3KA 3BKWA 1QGDA 4AJ9A 1NZDA 3CSDA 1U8ZA 1BCSA 3JVVA 1M2VB 4JOCA 4OV6B 4O25A 2PS3A 2Q3DA 2ZRCA 2WUGA 3I1FA 3T3EA 3WRYC 4TV9F 2QM3A 2OCKA 3RS0A 2BCEA 1WZIA 1XEFA 4KXLA 4XH9B 2GT1A 2I29A 2V65A 1J00A 5DN6A 5K20A 4EYSA 3LOQA 1A9ZA 3NHBA 3MTIA 1ISGA 4XEHA 3V4FA 2VEOA 2BTQB 3K31A 3VO2A 1BQ3A 3FUTA 3Q6MA 2R44A 1A8HA 3DEKA 1M6HA 2AWNA 5H68A 2OCLA 4TXHA 3P94A 3V1NA 3VZRA 5SZKB 1PTJA 1M0TA 4JUCA 5K0EA 1GM5A 2BC9A 4JFRA 1WAMA 4LHXA 5A7HA 2O1XA 1L5YA 3HYTA 3CEHA 1XDGA 4TV9A 3QLJA 5DTJA 1G8PA 2WW8A 2ZJAA 1QR2A 3BX1A 5HFNA 1I7DA 2HPVA 3K8ZA 1OLSB 1CWUA 2II6A 4LXHA 3BIWA 2JJ1A 1G17A 3COZA 4QECA 2OBNA 4CW7A 4ZZ3A 2C2GA 3ELDA 5KJ6A 4ENQA 1LPBB 1EK0A 2YH2A 1FFCA 3C3YA 3LK7A 3LRXA 4HY3A 4OHPA 5ALNA 5BNFA 3S8MA 3VR5A 5A5GA 4P7KA 4CKCA 2RK6A 1UJ5A 1EVIA 4DJJA 1YDWA 2E4XA 3ECAA 3LP5A 3IKJA 2WLSA 1EFUA 1L7OA 1V4NA 3AKCA 1WL8A 4O4HB 1SCKA 1XZBA 3EXFB 3W77A 4EEZA 5MN5A 4M2LA 2FPOA 5K3BA 1FVOA 1E3JA 2F6RA 2GJKA 3KYDA 2IBSA 4PC3A 1EAYA 2JARA 1AT1A 3O9VA 4LOLA 3QBEA 2FPKA 1NBMD 1NXVA 4HP8A 3H2KA 3QBDA 1DC7A 4HZUA 2YBEA 1L5NA 1GN8A 3W2TA 5DBHX 1L4FA 4UNRA 2D74A 4NYJQ 5MGNA 3SZGA 4D9GA 3IOCA 3OZCA 1RMTA 4LE1A 3ER8A 5EZYB 4PZAA 2P2YA 4RHUA 4S1WA 3MRVA 3JR3A 3JAMA 1T0IA 3TDKA 3FWNA 4IILA 2CVQA 4AN4A 5KYXB 4QO8A 1BGXT 2J0UA 1CY1A 4RY2A 3JARA 1AKMA 2H7VA 4YONB 3TCNA 1KZHA 3Q7TA 3F6SA 4OQZA 5TQJA 4BV3A 3RNLA 5JH7F 3IPXA 2B1JA 3R7WA 2XZTA 1BN7A 2OHVA 4TKUA 1XZGA 7YASA 2QPTA 1D1QA 1XK6A 1KO7A 1JWAB 1C1DB 1MIOA 2OCAA 2PRSA 1DX4A 2WHQA 3GF4A 3K9NA 1KEZA 4YRPA 3AR9A 1VLHA 3KO8A 4MVJF 4PZZA 2JFOA 4B84A 2FGJA 1VQ1A 5JSHA 3FVRA 1N3BA 2CNLA 1EJ6A 1MEEA 2ZJ3A 4ZCSA 4BATA 4EABA 5FWYA 3T5CA 2JAWA 4WLFA 3T9CA 1D6JA 1KI8A 3LQ1A 3IAS6 2W93A 5JH7A 4JLOA 3DZHA 1WXEA 1A5TA 4CLOB 3WFZA 3STTA 1BRMA 3HBMA 2J3DA 4OXYA 4CFYA 3LT5A 3GLRA 4E03A 4E5KA 5L95A 5IZCC 2X2EA 1EXWA 3CRVA 3U3OA 1QE5A 2FPRA 2YDXA 5GZ1A 2BGKA 3EGEA 2BL4A 3BH7A 4LSZA 3IEPA 4MVJA 2GZSA 3TZBA 5JW6A 4B3FX 2NUBA 4CTJA 4WXMA 2FE4A 1GUZA 2GM3A 4MWSA 2WYVA 2JDIA 2JS7A 4PLVA 2C1EA 1CR1A 1R6XA 3LC7O 2GZAA 1Z2OX 3WC4A 2HHJA 3X2FA 3F4LA 3L46A 5K6TA 1DEAA 2I1LA 1UAAA 4R2JA 3VPCA 4YV7A 3VKHA 1VSVA 2GAIA 5BSKA 3NHPA 4HWOA 3FKSA 2EF0A 3A10A 4L76A 3I8OA 4OYLA 3PPYA 3ZS9A 2I6XA 1SU6A 2WWIA 1F2UA 2P7IA 3TLKA 1T4CA 4P5DA 2BM0A 2C04A 4KO4S 1X77A 4OBWA 3E9YA 3LXRA 4AECA 1G7SA 4JB2A 4MNTA 4TLLB 1FUEA 3I6ZA 3LSTA 4S1PA 5ILOA 3H2SA 5A9SB 1NBEA 2ZIZA 4C76A 2PXXA 4DMLA 5JR3A 4TZ0A 3RIXA 5JDCA 3A1EA 1TF7A 3SR0A 3D3EA 5ALUA 4UBMA 3FY4A 2COKA 1KQOA 1QYRA 1KA9H 1KYXA 4WX2B 2FZVA 2BEWA 4GE3A 3ASUA 1QMGA 2V8BA 3URMA 2A0YA 2I2DA 2Y1FA 3T8YA 4ENVA 3B1FA 1OFUA 3U49A 4YDRA 4AK9A 4QDKA 2PGNA 1KRXA 2GFQA 3I05A 1Y5MA 3Q7EA 4ZZ2A 5D7BA 1RPNA 3GJYA 5JXGA 2DR2A 2JASA 1Z0DA 2AJTA 2O3UA 1RZ3A 3M4JA 1X8KA 4HQRA 2J33A 3O4VA 3ASZA 3Q9LA 4LHWA 4C2BA 3AT1A 2JVKA 3OZFA 1LI4A 4HNAB 5F1YA 3DO6A 3R8CA 2C2XA 3UJAA 4G5HA 5JATA 2VA9A 3QPBA 4B6GA 2CYBA 4ZI7B 1JLHA 3RK0A 3UFBA 1G5PA 1L9XA 2JH8A 4EYKA 1VJGA 4JI6B 5AW3A 1HFKA 4EG7A 3PPIA 1M10A 1FRNA 3I6YA 5GONF 1MP0A 3TSCA 1G8GA 3KTDA 1TFUA 2XUDA 3JS5A 4U6SA 3V55A 4C03A 4PN7A 3BMNA 2W2XA 4INAA 4G24A 1TCUA 1XAGA 4CM6A 1T15A 1G7TA 1AY0A 2Y9MB 3IVRA 4XUEA 3GLGE 1UPXA 2AJDA 3AM5A 3DZFA 3NBXX 3UHAA 1XQ1A 1RXVA 2D3TA 3IKVA 1XV5A 3GD7A 2E1PA 2NX2A 4NZ9A 4F6RA 4KWHA 5KSPA 4MXDA 3OU6A 5JS2A 2NAFA 5JANA 3IS3A 3E7PA 2I9KA 4Z51A 3CE9A 1NU8A 3UCXA 1P60A 3H17A 1KSGA 1TK2A 1Z28A 4Q7EA 4CPDA 2G88A 5F1PA 5GONA 4FZ5A 2ADFA 1R9NA 2FP4A 4P4TA 2WKWA 3QU4A 3U2QA 2ZREA 1EUQA 3GLVA 4KUEA 1ZGBA 4G2TA 3RUCA 2AG1A 4D3DA 2VSYA 3GX1A 4HNGA 4EGJA 4EKGA 5FBLB 1E6CA 5DHAA 2GCIA 3TQQA 2J6IA 2YC2C 3R3HA 3BPSA 3E70C 2XUKA 3V4VB 2JLVA 2RHRA 1X0VA 5H3HA 2ZWPA 3HCRA 3ADOA 3DZKA 1BJTA 1NMZA 4KNYA 1S89A 2GLTA 1TYAE 4I5IA 1HYGA 3LTNC 1T9KA 2CDAA 3AONB 1LKZA 3Q87B 4F96A 3TUJC 4ND4A 1TVKA 5LIRA 5IAEA 3DOOA 3N8KA 4BNMA 2EDAA 3CX6A 4QUEA 3IUYA 5CLQA 4WNIA 1IEQA 4HH0A 3DNFA 3CFYA 5CB4B 4N47A 1WZ2A 1YMUA 4K8RB 3FPGA 2ZR7A 3CLTD 5TF0A 5LU8A 2JVIA 5TSDA 2KE5A 4FFNA 1OAKA 2OFFA 4BFXA 1V4VA 1BWPA 4G0QA 4YLGA 2YUIA 3T5BA 5CYGA 1I33A 1MGOA 2CLLB 2GRUA 4U2EA 1BDIA 1K6MA 4WN9B 5EJIA 3CRQA 1NUSA 1FFGA 2X14A 4H31A 4RZ3A 1HDZA 3DYIA 4I9FA 4RAOA 3W6NA 3GVHA 3HGMA 4OHCA 2APJA 2GYYA 4NFLA 5AKKA 2X5KO 3I5AA 3HB9A 2GJ9A 2HEGA 2W2TA 5EHIA 1G0OA 1KMQA 1QK3A 3C39A 3DP7A 4S1NA 4X7RA 3UWKA 4RVNA 3ZY4A 4EFNA 1AF4A 3G2NA 4AXXA 4IV0A 3T1YB 1RQXA 4EFMA 1AGPA 5CH3A 3Q0EA 2JFPA 3WG9A 1LX7A 3CPSA 3NO4A 3RABA 2HF7A 2JEYA 2VSXA 3OZXA 1EIWA 3MCZA 3RWOA 4W7IA 5DI9A 1BCRB 1ECPA 2RGUA 4HG2A 2G1AA 4DSNA 4CLRA 4E6PA 3R0QA 4W5RA 3HMQA 2VXCA 3GNSA 3MGCA 4HAWA 2VP2A 4J94A 4KQ1A 1TZKA 3DXFA 3OFJA 4NCHA 3VTFA 4BBPA 2H52A 3BSFA 2WU1A 4QBKA 2PWAA 4EJ6A 1JHYA 2EL7A 3CR3C 3ZJTA 2HJHA 3PQ4A 2Z8ZA 1TM3E 2WPDA 5JQWA 3A58B 4E30A 3TNLA 4IIHA 3KJFA 2VO1A 5IDVA 4CGYA 3EEBA 3ZWWA 4ENTA 1E5TA 3H3XA 4EPXA 1HTTA 1TCBA 1A69A 3OVMA 1YQXA 1I6KA 3N2GA 4AQDA 1U80A 2IYWA 4EW3A 4N8DA 5CEEA 2EX1A 2IHVA 3EGIA 3NHUA 3SF8B 1KPHA 2C83A 2W0MA 4G0XA 4N6GA 4ZYLA 3MPOA 1XTTA 2OLEA 5DPMA 4CKWA 2XCOA 3PI6A 1Q22A 4HXEB 1GN9A 1EFKA 3BK7A 4YRGA 4C20A 3X1ZA 3DQZA 1YR6A 1SULA 3M9WA 4UM5A 4UU0A 3V7NA 4I50F 2OV4A 2R6HA 4R9RA 2VCYA 1WXQA 4MEAA 1HE8B 1E3WB 4JLNA 4IH9A 1UMCB 3BJZA 4ECEA 2DY1A 3MTJA 1CUSA 2DHCA 3B3QA 2JAQA 2AC7A 4LMBA 4ON9A 3VNVA 3ZW9A 4BJ6A 2H4FA 4NHOA 2ONZA 4DR6B 2OCIA 1T0JB 2XXAA 1HQKA 1FQKA 2B8NA 2H7CA 2IITA 1T6NA 3B60A 4JC4A 5BSEA 4WW0A 4H0FA 3LZCA 3RUHA 5JSQA 4N1AA 3B9BA 5AOBA 2ZRBA 3A4MA 3SXUB 2V03A 2ZZNA 3AKYA 1TUGA 3CNHA 2P9GA 2VTVA 2XD4A 3U6BA 2FWNA 3EZ6A 1MX9A 2O2EA 2WI8A 2ON6A 3N2EA 3BB4A 5HP4A 5CDHA 3JPYA 2WYUA 3ESAA 5IN5A 3P2YA 1S2MA 3D8SA 1XNHA 5JZMA 4J90A 3UV7A 4AMYA 2BGRA 1BD4A 3NALA 2QS9A 3WQHA 3WA6A 1CS0B 3U09A 3NIBA 3O1HB 3VR1A 1QGUB 4IHJB 2CDNA 1RI5A 4JUBA 4RLFA 4AY5A 3KL4A 3LG2A 5DE3A 1P73A 2F1RA 2H2IA 1SKYB 1W4ZA 1R9GA 2GJSA 2P2CA 2JZNA 2YHUA 3C8DA 3DNMA 3HZRA 4JC8A 4MV3A 5HYVA 3MTQA 2OD9A 3PLNA 4PTLA 4XCXA 5KHOC 3EYAA 3H3JA 3PQ7A 1R8YA 1L7AA 1S7GA 4DLSA 2I76A 3SXJA 3JAKB 5TB5A 5HUHA 1O5TA 1EQUA 4FFDA 4L08A 3T34A 2I3ZA 1DMRA 2DCMA 4JQYA 4PGAA 1NMYA 3KVOA 4J6FA 3D0QA 3HB4X 1IYZA 2FE1A 5AKGA 4G4IA 1NW3A 3ZE7A 3D5TA 4CM7A 1NFQA 5GIPE 3RHFA 2DUJA 5HBRA 4QBHA 4BEBA 5B7NA 3B82A 4TPKA 3KOOA 2HR1A 3D54D 3KU1A 2V3VA 2E4VA 2OV3A 3KPVA 2C8JA 2DHQA 3CWCA 3Q6IA 4UXHA 2XNHA 3QU2A 3L7YA 3H75A 3R6GA 1ETHA 3BXGA 3GGPA 4KXVA 1HO3A 2B2XA 2VPPA 2XTJA 3RLFA 4D5EA 1TC2A 1GUAA 2GFHA 1GDDA 4BUJA 2VZ0A 3IIEA 4K1LA 4ZJUA 2CYCA 3WK7A 4AS3A 5TS3A 2W6JD 4POAA 2P2GA 4DJ5X 4MW4A 3WWDA 4M0DA 2ZIUB 2NG1A 1N1GA 2ZI7A 5EE5B 2YZ2A 1RLIA 4M7RA 3T9FA 2JK0A 1KO1A 2QG6A 3GMSA 4FHCA 3QKTA 4XRRA 4MUIA 1PT5A 4G5SA 5HS4A 5DXFA 3PENA 3AFOA 5AH0A 3FKQA 4A36A 4P2GA 5HEKA 4B9AA 4ISBA 2XT6A 3O2SB 1U2SA 4HH4A 2FNAA 2UZ3A 3TIVA 2R1TA 2G83A 3C74A 2C4VA 3KYCA 1WMDA 3MG9A 3UKOA 4MV6A 3DVQX 3GJZA 3PRHA 3OX3A 4XTCS 2FZGA 3IIKA 4BJ5A 1NW6A 2AFRA 4RLQA 1E2GA 1NYQA 1IOZA 2Q6LA 3KHKA 3QZUA 4R41A 4AJKA 4B85A 1IXYA 2Y1OA 2JGLA 1UKAA 3ZHTA 5COBA 1IMJA 4GLJA 4D8WA 2ONCA 1IY1A 3Q15C 1M2NA 2EX0A 3G5MA 4PX5A 4UEWA 4A4DA 4BGVA 4CMIB 5LQUA 1U8AA 3C6ZA 1PZMA 1WM1A 1XCGB 2CEAA 3U16A 2NUAB 1WXWA 1KEEB 2FX3A 2FCAA 3DXZA 4R98A 1JJAA 5LDDC 2H1WA 3ONVA 3ZI7A 2Y1GA 4EUSA 5BMVF 4QBTA 3A25A 5SY9A 3H9CA 2CZGA 1ZMXA 2VUUA 1U0FA 5JJIA 1EFVA 4F7WA 2C5EA 1DBVO 4DZTA 1YS6A 3ZX5A 1QV7A 2HREA 3OPXA 1IPFA 2IXAA 1EFRA 2JLAA 1SUSA 3EE6A 4OJKA 2FZ5A 1T24A 2PUAA 2Y1WA 1PJTA 3ZHXA 3PIIA 4H7HA 1LDBA 2ZJ8A 3DM9B 3G02A 5HIAA 5JFGA 2OC9A 3NWJA 4KV9A 1HLFA 3GZNB 4BLQA 2W11A 2X6TA 5DNUA 2OZPA 3AUUA 1SXQA 5BMVA 3IKTA 4UHHA 2A3RA 2MYPA 1MA0A 2CVOA 4JLVA 1Q7TA 3KYIB 2X4LA 3KFLA 1E58A 4QU5A 3W79A 2CD9A 3V8PA 4TV8A 3WB2A 3TEFA 1PQ4A 3KQKA 1X7ZA 1NUTA 1ZOLA 1KORA 3NBYC 2B9EA 4P2BA 3LPCA 1R4NB 1XZDA 4MS4A 3VHXB 4I3GA 3N59A 4EMTA 1R37A 3DEFA 4J16A 3LY8A 2GAAA 3T54A 3W2FA 2G4LA 3HCEA 4KE8A 3OQHA 4D3ZA 4ZFNA 4W82A 3QX3A 3GA7A 3CRRA 3HJBA 4DMMA 5IYZA 3K7EA 4TS4A 2RHGB 5TDHA 3LU1A 3VVBA 4M53A 1YZYA 5IM5A 2FDCA 3IDSA 3RE1A 4GUDA 1E2KA 3RARA 2CXRA 5BSWA 5K3OA 1BO6A 1QV9A 4NABA 4EG0A 4CWAA 2OE2A 4Y0NA 2WK1A 4B5KA 1Z6ZA 3NT2A 4CMCA 1HC7A 1G98A 2O6HA 1ZK4A 3A8TA 2V9ZA 3CJRA 3ETCA 3L6DA 4PBTA 1NN1A 3PWSA 3VKGA 3DHYA 4DQVA 4CIWA 4Y2RA 5HF9A 3CPJB 3R5KA 1AKUA 4W5NA 4Z1MA 1KFEB 2ZT6A 1UPAA 3E9CA 3OZVA 3WLSA 3BFPA 3D4BA 3EJWA 3A1CA 2QNRA 2JFNA 1QQ6A 4TOIA 1PWEA 3R7FA 4PX3A 3W3AH 4JDUA 4CQMA 2ACKA 1C29B 1KL7A 2ONKA 5IXSA 1QK4A 1KYTA 4NE9A 2J59A 3HE3A 3OM8A 5FHQA 1DDOA 1N0IA 5CPFA 4X8LA 1KMHA 2BGLA 3ZWVA 4ARZB 3AOEA 3PCTA 4Q0MA 4BGDA 5I01A 4M9SA 3EIHA 1P2BA 3MLBA 3U7IA 4YALA 1F8GA 4AMGA 1MVOA 1SGWA 1AOXA 2XJ4A 4FFBA 3U3DA 1XXHA 1WABA 2XVZA 3ITDA 4D6XA 1ZN7A 5AVZA 4LSWA 1S7CA 2QAGB 3CXRA 2IPLA 4ARVA 1J33A 2XQJA 3GIDA 4H7FA 3HG7A 2JLYA 3DMNA 4UXIA 2HBQA 2BDUA 4Y6GB 3RG2A 2ZCJA 3HRIA 3TPZA 4P4GA 3EXEA 1NMXA 2IYQA 5KTYA 3NTXA 4CM3A 3Q3GE 2IYTA 3FOWA 3GRCA 1X9IA 3DE3X 1WE2A 3SC2B 4X7PA 1MO4A 2WFLA 1NVKA 5CFLA 3L4JA 3AR7A 3OEYA 2D5AA 3BWYA 1V11B 3ZXSA 4S24A 2RHMA 4LRXA 1YNOA 1GSIA 4ZT2A 5CXQA 3PJRA 5CNIA 5ALVA 4QGHA 1L9KA 1Z7WA 3C8UA 4WNAA 3FYUA 3K73O 3PUIA 4UBNA 1VHLA 4BMVA 1QC5B 3JQ8B 5ECWA 3THRA 2D06A 4KWEA 1E2MA 3SLKA 3R0IA 2WMYA 3LPMA 1ZMRA 1MXHA 2ACWA 1BYIA 2E4YA 2HQSA 1E6MA 2AD1A 3H5AA 4X1KA 4O8CA 5CVCA 4BBJA 2RK4A 9LDTA 3ABOB 3O3OB 5CDFA 4ZEOA 5BVGB 2C9ZA 4D97A 2QKYA 2OESA 2VFAA 3TQOA 4O4JF 2SKDA 3LL7A 4YI3A 4YMTA 3M2TA 1VSTA 4B09A 4YUWA 1N6NA 1KO5A 2CXPA 3OOHA 4R8LA 2P9BA 1T6YA 3FHOA 1ICIA 1SBZA 2O3RA 1JVSA 3HDHA 1NLYA 3HLYA 4WV3A 3SKYA 2IIBA 1RXCA 3WHPA 4AJLA 3BQ9A 4C14A 1A8UA 1NP3A 5AM1A 4EUFA 4EW6A 1MO2A 3C3AA 3TBHA 1FVFA 3MBOA 1EM8A 1NVUQ 2IE0A 3I04A 1RPAA 4FGJA 3V34A 4ALMA 4CNBA 1HKHA 2HBRA 2Q4DA 1RQ7A 2W8BA 5JY6A 2X8AA 3NEAA 5EP4A 4QDZA 5BV7A 3EOBI 1RKUA 5LSAA 3IDZA 2O8BB 4RTJA 1ESNA 4N0DA 4O4JA 4WECA 4RCYA 4GRAA 3AL0C 2QJRA 2HJGA 5LUBA 5AJYA 5EWMB 4WACA 5AW4A 4MQ6A 3CKMA 1LI7A 3H2ZA 3TQCA 4G0OA 4BKPA 3OJ0A 2XRFA 3L4SO 1P74A 2Z09A 1J2YA 3Q7QA 3I5UA 3QPWA 4DCUA 1DUSA 2J9ZB 4QGFA 1X1SA 3FNEA 3PXXA 4YCCA 3I2HA 3EVBA 2OWEA 3MB8A 3LXUX 5IVPA 1K6IA 5EVJA 3MINA 1W75A 4MPTA 1XTZA 2IELA 3IQDB 4JS0A 1L3BA 3B9QA 5HF8A 5KHAA 4A8JA 2DLDA 3D7MA 2RGWA 1I36A 2JLXA 4CG2A 2ZTVA 1AE1A 1GYQA 1GTVA 2O6LA 1Q0QA 1LLDA 2X2FA 1EQ2A 4KO1S 4JI1B 3TQRA 1Q50A 3E3NA 3AEKA 3SOZA 1V25A 3STXA 2HXYA 2ORYA 5FFNA 1DJMA 1FVXA 1QM5A 3E03A 3UA4A 1M34B 3OHMA 4TQGA 1B73A 2ID7A 3WB1A 3PHLA 1RE0A 1RJEA 2FSIA 4AXBA 3RYIB 4I9NA 5BY2A 4WRRA 1QIDA 2ZIFA 2AFIA 4BZQA 1U1FA 2JATA 1CJUC 3BF8A 3VU1A 4HNQA 1S01A 3WJ1A 2FY8A 3C2QA 2XUJA 5DNEA 2LDXA 4JYAB 4K6OA 1NP6A 5EP2A 3WGMA 1RCUA 2MDTA 1I4OA 2JI9A 1F2TA 3NI2A 2C3OA 4HADA 1SQSA 1O8CA 1I3NA 1JG6A 2D54A 2XTAA 3LLMA 1LFDB 4NFYA 1L5HA 4S3MA 4BQFA 5DP1A 3DKKA 3U39A 4JXKA 4HVAA 2B1GA 4KWIA 1TVMA 3P26A 1YS2X 4OA8A 4TWJA 4C7KA 2FN9A 2FSFA 1U2TA 2J3QA 2XNJA 1AN0A 2CHEA 4LI0A 2ACEA 4CHGA 1CERA 3GMIA 4QGBA 3MBIA 4OI1A 2JLZA 1LBEA 1U9YA 3ND7A 1PQUA 4YFVA 3EZNA 5DTEA 2D5BA 3U7QA 5CBPA 4R8MA 3QMVA 2FW6A 4IM7A 5CVDA 3KK0A 3JWPA 3KZKA 1KQNA 3GLFA 4HLCA 4YPFA 5DTMA 3FNFA 4L3WA 5L40A 4FFMA 2GBFA 4DPKA 3HL4A 1P9OA 1R0KA 2WF7A 3IC5A 5E1OA 4H3HB 4LYJA 4TLMB 3T7EA 3OFNA 4OJYA 3OKFA 4H1VA 4I6GA 2D62A 5IAOA 2C77A 1NQ5A 4MIYA 1PBTA 1TW2A 2CL0X 3ZE6A 4RKQA 2FWJA 4D4JA 3RS5A 3VVMA 4L8YA 1ZNWA 4MROA 1IVYA 3BE4A 5FULA 1WB9A 1NVWQ 2YY7A 5TIIA 4LTMA 5AW2A 5F4ZA 3QVKA 4PYQA 4HEJA 1VB3A 3NDBB 3MK31 3HDGA 1ONPA 5AHKA 2UAGA 1GKUB 4KGXA 1UM8A 4IYJA 3LCUA 4BZPA 2V7BA 3I9V6 3LWBA 2AI2A 2J87A 2YUTA 4ZV7A 2FPPB 3VV2A 3M70A 1GT6A 3SR3A 3GLHB 3K1AA 5EXEA 2V4ZA 1TXGA 5IU6A 2D59A 4OJMX 4DR7B 2C4NA 3RS7A 2MINB 2DWPA 1GCGA 3RBAA 3V8QA 5LC1A 3KD3A 3FXAA 2AF3C 2YJ5A 1Z4NA 4QUIA 4PG6A 4Q82A 2BZGA 4S0ZA 3R7SA 3HNOA 3B8EA 5FNVF 1QB7A 1NW7A 3NHRA 1C3EA 2XBLA 2XIQA 3H8SA 4JLDA 5AXDA 3S6JA 2WMDA 3UWOA 4KR6A 1KDZA 1Z45A 2ZU6A 3CS3A 2HKIA 3S2IA 2R6FA 1EZ4A 1E4EA 4XWAA 3RSFA 4DV6B 1QORA 2I55A 4Q37A 4OQQA 1N2OA 4BVHA 2O4UX 2ZRPA 2O2XA 1KOLA 1LDMA 1YFKA 4EPTA 3FSRA 5A9RA 1B3BA 1NRIA 4YFYA 3VH4A 2MTBA 3TI7A 1E3QA 3QFRA 4X61A 3D3QA 2G28A 2JNWA 2A9VA 3TR6A 3QEAZ 1GP2A 1CSEE 5FNVA 3EODA 1FE8A 3CF0A 5EIOA 3PF8A 3GZ4A 1TNDA 2NYVA 4P7BA 5GGXA 3P9YA 3WKDA 3TW8B 3UAXA 1TQ2A 3OA0A 3FAKA 1QNLA 3ZV4A 3WGTA 3AFIA 3WE7A 1VE9A 1EDBA 1SC9A 4QOIA 1ULZA 3OTGA 2Q5CA 5COAA 2HDNB 3LRPA 4M8IA 5LP1A 4JI2B 3BDAA 1E0AA 1E20A 3FGZA 5E9QA 5EJEA 2FJPA 4F2GA 3ST7A 2F59A 4TS3A 1EPUA 3KUKA 2ZXEA 1A2OA 1AHHA 1KNQA 3KKEA 1EVLA 2GM5A 1AB6A 1UMBB 5IVKA 1I9GA 2VH2A 1Y9DA 3H04A 4E70A 4PSDA 3VPHA 2GUWA 5ED0A 1YH3A 2POQX 2I6FA 1E2IA 3DZJA 2QHXA 3KHSA 2WHPA 4LNHA 5EQDA 4MVJE 3NV7A 1U3UA 2DQ4A 4MB2A 1A0OA 4OQPA 2IHKA 2SECE 2HU2A 4REQB 1R3DA 4YT2A 3HEMA 3PEVA 1OFHA 4OQDA 4BXOB 4B75A 3TSAA 3PX3A 1VHDA 1YIAA 3DD1A 5FV7A 4YHHB 2DQKA 3KQQA 3KR0A 4JUFA 3HU3A 6AT1A 4GOJA 1TA4A 3EFBA 4IDAA 1K08A 1PJLA 1OXVA 1U7ZA 3EXG1 1JHZA 2ATXA 3KHUA 3MJFA 4DWOA 4W1RA 4AS1A 4XLTA 3DMRA 2PX3A 3U44A 2B25A 4MUAA 1V3TA 1L8AA 1WDTA 2VHTA 1NXPA 2E21A 2Y1KA 1O96A 3QHQA 1H2BA 5KU1A 2Z2JA 4AQYB 3SX2A 2CUTA 3DAGA 3ZCXA 3IBSA 1XMVA 2NNWB 1Y0BA 5HE8A 2JCYA 2VYFA 4YVFA 4A0HA 4I5EA 5JCOA 3NBAA 3FPBA 4X8OA 2QN3A 1Z08A 2OORA 3H2BA 1LLUA 1LLFA 1XSEA 3HDVA 1MR3F 3B1XA 3EMDA 4MW7A 4F4FA 5KTOA 1UKCA 3SQMA 3I6MA 5JMOA 4F85A 3EARA 3I72A 3KTFA 4M1MA 1BDHA 2QBYB 4DARA 2C4WA 4YRLA 1THTA 1PK9A 3O73A 1VFNA 1D1TA 2Z8YA 3ZKAA 5GTDA 3A2NA 1TZMA 3IR6A 4ZVMA 2CHVA 2XADA 1JH8A 1OASA 2GN8A 3WK9A 4OP3A 4UDNA 2JLQA 4BWGA 4DRYA 4BMSA 4TXJA 3HEAA 3IVMA 4Y7CA 3WNQA 3KPWA 3IPYA 5FYQA 4FUTA 5HM6A 2GMWA 2R7MA 3FNHA 1QG4A 2HIMA 2IV7A 4AP9A 1O5OA 3E15A 4G07A 1XQVA 1HMYA 4C7XA 1YS4A 2IW1A 1DV2A 1TQ6A 4FOLA 4OBBA 3GWZA 4Z9BA 3RW9A 5JCXA 1QTIA 5CK4A 4EKEA 3CH4B 2A9JA 3KJGA 2FW9A 4Y2SA 4CV2A 2JD0A 2PSEA 4HWSA 1HYEA 1W30A 2XODA 5HS6A 4AZ3A 4EELA 1R3UA 4HNRA 1JIQA 2NZVG 4P7GA 2WJZB 1R10A 5L3ZA 4LGCA 1M33A 2ZSIA 2F67A 4KQKA 4QDOA 3SLGA 4E4RA 1IZ8A 3DCJA 2G80A 3VR3A 3OIWA 5DHRA 3V6LA 5B4TA 1WB4A 1ZPDA 5KJ1A 1XMJA 1FNMA 4EAAA 4RUKA 2CNNA 1NG9A 2AW5A 4JASB 4YO8A 3FUVA 4GNRA 2ZS7A 3DWGA 1WOYA 2PO5A 4G3XA 4ZYWA 3A6GA 2XWPA 3P4XA 1SCJA 3DZBA 3GDFA 4IDEA 3B70A 1ZR4A 3D1VA 3HPRA 2LE0A 3BH6A 1V39A 5AJUA 3QKIA 3IAEA 1N2SA 4S05A 1Q19A 2N1BA 1I4LD 3H9EO 2B78A 4Q4AA 4MQMA 1LY1A 1NIPA 3CLKA 3VJMA 1GRVA 3NX4A 3ICCA 2B83A 1NZFA 2CLSA 1L5QA 2JIQA 3RT9A 4DADA 5JS7A 1GDTA 1ZW6A 3VZBA 2VHJA 3RVRA 4U7DA 2HMWA 3HKEA 4HLUC 3WLFA 3L4EA 4RVOA 3OC0A 4EVSA 5I4IA 1NW5A 2WOJA 3L1JA 4KH1A 2NTEA 4RORA 4KREA 1XRPA 2A5YB 3DGEC 5DGCA 3TOSA 2PXAA 3G8CA 4R05A 2FQQA 2PT7A 2QRVA 1JSRA 3HHEA 3ZWDA 4XR4A 2W6ID 2REXB 1K2VN 5H16A 4QT4A 1YDGA 4PHGA 2BM1A 2VUSA 2A1UA 2X13A 1QYXA 1E1NA 4PCAA 5KI6A 3OE5A 5IXJA 1WU7A 2GZDA 2IY7A 3JWHA 4N5MA 1A4RA 3ZWAA 3H16A 5FIUA 1EFHA 5JNLA 3L0OA 4N65A 4YR7A 4B4OA 3KEQA 5LB2A 2CUNA 5K0NA 5AVOA 4BO5A 1FDOA 2YJ4A 4I4CA 1DJLA 2IXBA 2N42A 3OC6A 1Y1PA 4AKHA 3U3ZA 2KWIA 2ZB2A 4MB6A 5GIOE 4MRMB 1T8UA 5HFJA 3QY0A 4G4JA 3EA0A 3N76A 4HVLA 1Y7IA 4O29A 3TWOA 4AY3A 4RV9A 2I2XB 3SN6A 2G04A 3AVPA 1LVUA 4B76A 4P3NA 2VDJA 1ZD2P 1EUZA 3I37X 3UMGA 2VQEB 1P1IA 1YMQA 3IQHX 3AJRA 5KNCD 2V7PA 1WBBA 3JD3A 5A4MS 5B3JC 1GZ6A 1TMKA 1QDLB 1O4VA 1M0EA 1E1LA 4BC1A 3CB2A 4EW1A 2OLKA 2MWMA 1O08A 3W3ZB 4IPTA 3R3WA 4DJFC 4AMBA 4O3FA 3DOIA 4W5WA 4EGFA 1Z07A 3C4QA 2ZRFA 1L5WA 1GU1A 4FFOA 4PXSA 4ASUA 5KNBA 4B81A 2ZE5A 1KPGA 1L6IA 2DPHA 2NU6A 3U4QA 1II0A 1WXGA 1HURA 3KT3A 1WCWA 4FHDA 4X20A 4CMAA 5DRYA 4H6VA 3ZR4B 3OQIB 5B55A 3BWEA 1VYUA 1VTKA 2R86A 5C18A 4JL8A 1E1RD 1BMTA 1VHQA 4K2AA 3WMGA 2Y8EA 1QFYA 3ZE8A 1YGYA 2NADA 1V95A 1X0XA 3KVVA 4KYIB 5HW0A 3ACBA 7GPBA 1VLLA 1JDVA 3LKDA 1GFZA 1P33A 1V0JA 1QVWA 2NT4A 3A36A 3IPRA 1V8PA 4OMFG 3V8RA 3VPFA 4EYEA 1RCFA 1JILA 1MOPA 2DBVO 4ZP1A 4QEKA 4TT3D 5DM0A 2X0KA 5K0FA 3O8QB 4YN3A 1WCIA 5DW0A 2RH5A 3CZAA 1KI9A 2VHXA 2VP5A 3U31A 1SUDA 4ITRC 1K7YA 4P6VF 2AQKA 3CX8A 1V5EA 4FZRA 3H19A 5LMNB 4ND8A 4I9UA 3EXHC 3KYJB 4EVIA 5HZKA 2P4SA 5FPTA 3MYYA 3UOGA 1JEAA 1L8LA 1ADBA 2HMVA 4MCJA 4CNQA 1E92A 1WZEA 1JJBA 1H85A 1N1DA 1E3TA 2OXFA 2AMLA 4WKGA 3ZLUA 4BY9E 2IWRA 4YRAA 5ALZA 1GRNA 5FL3A 3WQBA 3CUUA 1IBRA 1ONSA 1ZY2A 2Q4BA 1F48A 1E6EA 5JU6A 2H0QA 3IVGA 3OIYA 2EWVA 3L0CA 3TGPA 3ROQA 3WGGA 2I6QA 2QUJA 1O2DA 2C0PA 3G2IA 1KYWA 2KBFA 3GEDA 4L50A 1IXSB 2DFTA 3UB4A 3X1WA 5CXUA 3DL2A 4BVFA 1J2TA 1SVKA 5TGTA 1LV7A 1QDUA 2BGNA 4FEAA 3OZGA 4IQGA 3A4TA 4YHBA 1RE1A 1NI4B 5I9TA 3OZAA 4WLVA 3DFFA 4R1TA 4HUQB 2FZCA 4Q21A 4N6OA 3CG0A 3SDBA 4YMGA 2CL5A 2VBGA 3DOHA 2H1SA 2RHTA 4KQ6A 5BMOA 3HJAA 4Q7LA 1Q1GA 2VJLA 2VL7A 4H7JA 3FFAA 4INZA 5TR9A 4ID3A 4K7JA 4OFXA 5KMGA 2WD9A 2W6OA 2QTFA 1VKZA 3NLLA 4P80A 1JFRA 1VJ1A 2DECA 5A4KA 2H2DA 2PGLA 2QYHA 3DA8A 3FJYA 3NAQA 3ONDA 2IUYA 3PQCA 3GFOA 4IQ8A 4PFQA 5H83A 1PWXA 3TJMA 1ECCA 1RWVA 2FUEA 5FOTA 3GCWA 4F3CA 3BKXA 1YIDA 3OIUA 5LKRA 4C6TA 1M6YA 1TM2A 4HAIA 3B2EA 4G1MB 3GUUA 3ADBA 3DR5A 1PJBA 4BBAA 3AVQA 1UBOS 3K9HA 4WBSA 4OIMA 1YGPA 3V1LA 3WZ2A 4BZWA 1G8FA 3STUA 2WD8A 4KW7A 3K1YA 1T4BA 1UH5A 2XHZA 4KOEC 4LV5B 5JHHB 4J2TA 1XRQA 5CP8A 3WYGA 4IR7A 2ZSAA 3HKDB 1II8A 4EY5A 1KDRA 2PL5A 3ETNA 3WBFA 3RQSA 3THXA 3HTXA 2P0YA 3ORQA 5LQMA 4UARA 2VWHA 3WLIA 4NKRA 3FIJA 3GUCA 1M1NB 2BIFA 3VUEA 4D3SA 3EY9A 3LP8A 3AV0B 2ZPTX 4YT4A 3KQHA 2OGSA 1ADGA 3HH8A 4KYVA 4OGKA 5HQJA 2C3MA 3F1KA 1QCCA 2OFOA 2FV8A 2ZSDA 3G9UA 4YRQA 4LMPA 2HSZA 2QE6A 2ZPAA 2Z6VA 4NJEB 2ZTMA 4CT0A 1Z5NA 3DZCA 5C52B 1UM9B 2E6UX 7ABPA 1QWSA 1MJHA 5HPYB 1LGYA 3QOXA 3PC7A 3IE1A 1N2ZA 2C82A 4LHYA 3RUFA 3ZLBA 3JQEA 1TJPB 5CTAA 2HZ7A 4CTNA 2E2WA 5JPIA 1QZUA 3EJ6A 4XLZA 4O2BB 1M2OA 2HC9A 2VJPA 4ECAA 2EZUA 2JFUA 3W5HA 2C7RA 5LOVF 2ZULA 4DCVA 2KSQA 4F38A 1JH9A 2P77A 3KUUA 4XARA 1K1EA 1P9WA 1H8EA 1ZG3A 4OXRA 3L0YA 2FB9A 4OP2A 2P65A 4Y2GA 3H2YA 2CKMA 5J2TF 2DFKB 1PGNA 3EWAA 5CAEB 4B6EA 5GZ6A 3D59A 3E4DA 3H4IA 1E5LA 2P9ZA 4MVJP 3QFSA 2V7QA 2YOFA 2WWFA 4L74A 3BSSA 3IYLW 4G5FA 4EX6A 5EIFA 4CIAA 4QJBA 2I3DA 2O9JA 2OHGA 3EIEA 1DIAA 3EZLA 1V6SA 1EA7A 1M5UA 2YXNA 3T1NA 4B31A 4DBVO 3L04A 1OXXK 4B3XA 4R2MA 1Q7GA 1YTLA 4GM1A 4FB5A 4HVCA 1HM5A 5EESA 3WJ7A 5B4VA 4RTRA 2FQWA 2GPSA 2PTHA 1G7RA 2LIVA 3BRWD 1TKRA 3OZIA 1QFSA 4MUHA 5J2TA 3LX6A 1E7RA 3ABIA 1DIOB 1UPUA 1WEHA 4TTIA 4U7JA 3P9KA 4FQ7A 2NN3C 3ZGXA 3IEVA 1PAUA 4GAEA 3DE2X 3AI2A 4A27A 3O4RA 4X1YB 3FJOA 5BN5A 3OO1A 4C08A 2Q9AA 3OU2A 2ZBGA 4X85A 1E0SA 4DQ0A 2KM1A 1UK6A 3PD0A 4E32A 1PZGA 1FFDA 3PKIA 4WESB 4KPUB 4FLMA 2CZQA 4RENA 3WRWA 4NU5A 1YR2A 3W5DA 4OSEA 1LA2A 3RYHA 3DDUA 3T9BA 1N9ZA 2AQ8A 1W25A 5JVDB 3T7KA 1JXMA 3N8HA 4Q05A 2XMPA 3UWPA 3WK5A 3IMFA 2JAOA 4N39A 5CA1F 1ZN9A 3AJDA 2F3SA 3RC1A 4YTEA 1WXHA 3E81A 2XCIA 5IAAA 1VL0A 3KUDA 1DWUA 2VATA 1PFQA 1S3IA 3QIVA 2P9TA 2C59A 3NHKA 4G97A 4UDXX 2OVFA 2VF2A 1S3GA 2HO4A 2L42A 2O50A 1P61B 1EWRA 2QGFA 4PGHA 1J21A 3NTLA 5EG5A 4R3WA 1DRVA 3DDNA 4GU5A 5DCUA 4W9RA 2D2VA 4OQMA 4MLPA 2CNBA 1DG9A 4C4ZA 1TYEB 3VR5H 1IHPA 2GHIA 2WB4A 2PAFA 4IOJA 4NU6A 3SHOA 3AU8A 5CA1A 2Z04A 3A4YA 3DDOA 3MM4A 4GOOD 2VUIB 2R68A 3PSAA 1GT91 3L6UA 2OXEA 4IY1A 4KHZA 1SHZA 3TL3A 2OY0A 1BX3A 3OJEA 4GM0A 1ZWKA 4RHXA 2CFRA 1Y5LA 3EWNA 2QN6A 3DLIA 4WUTA 8LDHA 4DV2B 1NF3A 3LIIA 4B7AA 4TWIA 4V0LA 3PC8C 2AC4A 1NUUA 2NU9A 3CRZA 4CQLA 4QPZA 3HVJA 5IT5A 5F3DA 1XZJA 1WG8A 5JAMA 1PT6A 3Q85A 3CVWA 2DSNA 3NQ41 2QL9A 2N47A 1BRTA 1G6OA 1NRXA 1ZL2A 4KUGA 1YZ3A 3O0DA 3D2BA 1ZGHA 5ITWA 5HFAA 1SOVA 2I6TA 2XNDA 4ZVVA 4RACA 2K5UA 2BFDA 2B5WA 1NVEA 2BKEA 1U90A 3A4LA 3ELWA 4KE7A 1XXHE 2G7MC 1A8SA 1EVQA 1S8OA 1W73A 3REQB 4FFWA 2CGEA 4B45A 3JZMA 1KGDA 1U2PA 1GPDG 1NBAA 1DCMA 3FUCA 2ECOA 4QQRA 4FYVA 3VDMA 1ML3A 3D5QA 1M76A 3CYFA 2XCSB 1J1ZA 4GXTA 3C3PA 4XE5A 3W7BA 4F3RA 4XSHA 4JZKA 4MI1A 2GS9A 3C7DB 2VG8A 3FR7A 5CDYA 5AFSA 1QE3A 1HL7A 2CNDA 4DA8A 4QVIA 1UBKS 1FZTA 3KZMA 3HKDA 4GP9A 4BFVA 5HA5A 5EHQA 5LN1A 3BT7A 2OZLB 4MOWA 3RVMA 4MKIA 5DOVA 2HA5A 4BDTA 5B12A 3G2OA 4XWKA 4YRCA 5JAUA 1KH2A 4NL4H 3I30X 3QEMA 3G7UA 4L2IA 3V8MA 5CFPA 2H63A 3P32A 1GKYA 4Z2YA 4G8JA 1FMJA 1C7FA 1L1RA 3M1AA 2FMIA 4ZV4A 3KV1A 3IOYA 4MVJH 5HIKA 1LH0A 1LK0A 2QLLA 1UF9A 1X8LA 2J3IA 3KM0A 2GN2A 1W35A 4BPRA 1ZUWA 4JLPA 1T1SA 4IUDS 4AMZA 3LHFA 4EUHA 2I4RA 3CY6A 3LUBA 4KRYA 5CR9A 4B6PA 5AVVA 4FS3A 1ZJ6A 4XX1A 3FPLA 2X8JB 1ZISA 3B9RA 5BWCA 4UTPA 4D98A 5KQGA 2DE0X 1XZIA 3O4IA 1AGYA 4GF5A 5JSFA 2CJFA 1J9GA 4RK1A 1SXPA 1G6KA 1WCV1 2VQDA 3WO1A 2DWCA 4D81A 2AKEA 2P7HA 1JDNA 1M8KA 1PUJA 1XVUA 2OCBA 3PWZA 2SCUA 2RFLA 3S7TA 3ZBPA 1QHGA 1JEYA 5FLXA 1Z39A 3R0ZA 2HW8A 3PKJA 2ZAOA 3IRVA 3DR3A 5DNYB 2EERA 3FSGA 2X9GA 3UWDA 2X5JO 1S3FA 4MO2A 5IJXA 5J4VA 3T9AA 1O97C 4F45A 1FMTA 1TMOA 3FBGA 1OYVA 4MPJA 3EYWA 4BMNA 1JLLB 4UQPA 3OPYA 1T9GR 2DMRA 2I78A 2VSNA 1U65A 3DD5A 3VPGA 5CH8A 4ARIA 2ZYTX 2QZZA 2RK3A 1U2ZA 4MGHA 5ECGC 2HA7A 5IJAA 3AIOA 5AVWA 2GPNA 2B6HA 1DXHA 2P2DA 2DULA 3ZHSA 1UXIA 3G9XA 2PXHA 5MF6A 2H1FA 3ISTA 5T6BA 5KQRA 1T2DA 3P9NA 4V0RA 4PM4A 4B17A 4GMGA 3L07A 4RSMA 5ITZA 5IWCA 3ASYA 4G8DA 3SX4A 3ZDCA 4PZDA 1Y3IA 4YUAA 1URPA 2V6IA 2EHJA 2UV8A 3HM2A 1E9VA 1SVSA 3NP9A 2G07A 2AV6A 4MRPA 1DXQA 1W9HA 1BGWA 1SCUA 2HU5A 2W4IA 3F90A 4TMWA 4F3KA 2FPMA 1PJ8A 2FRXA 2AX3A 1XTQA 2C4MA 5A4IS 1LTHR 1N7HA 3CKLA 3QU9A 1F17A 3CGGA 3EPKA 3EG9B 2VH5R 3PHGA 3W04A 4QPCA 2JI6A 3K6SA 3LF1A 1GEEA 3DO8A 3G0GA 5LP6B 1NKSA 3LIPA 1INLA 1KMCA 1QKIA 3H0CA 1KC3A 2GEJA 5AI0A 1FP4B 3X2EA 5J2UF 5F98A 1YZNA 3VKFA 2WT9A 4V39A 2G77B 3NV9A 4MULA 3PQFA 4L4UA 3WHKA 2WVAA 2A7QA 4BNLA 3ICQB 3OT1B 2ODPA 4F86A 1W46A 3JQ7B 3DUFA 2V96A 4H6PA 2NZYA 4HEHA 3NYWA 4YDHB 3R5FA 1SCIA 4ZREA 2DBYA 3RTCA 2AFIE 1RAFA 1REQB 4LRUA 5E0OA 1F9AA 4DA4A 1KI2A 2FH5B 3RLIA 3E1SA 4D4HA 3P7MA 3GCXA 4KK4A 3ZU3A 4BZZA 3NM6B 4EPVA 3LBAA 3KRTA 1O95C 4GX1A 5J2UA 5BXYA 3F96A 1LSSA 4EHIA 1WDWB 1CDEA 2ABWA 2VHEA 2VP4A 2G40A 1VI5A 3OT5A 3PHHA 5B6JA 1PG2A 3MS2A 4C0LA 3GPCA 5EYPB 4U0KA 3QEBZ 2XH8A 1K5DA 2X0RA 3IQIX 4F3NA 1FRZA 2AOVA 1YUBA 4L5YA 3OCYA 3WICA 4X91A 4UQOA 4N5NA 5LZ8A 1SBQA 3U26A 4GDFA 3RU9A 4BNHA 2FI1A 4U3JA 3TQHA 2ISSD 3QW2A 3JVUA 3KSMA 5KB3A 2V6MA 2BE9A 2LV8A 1MHTA 3WLLA 1RYDA 1N32B 2QN1A 1XALA 5KYKA 2WG2A 1GZSA 1G2OA 4JSRA 5A2GA 3GLFE 3NAGA 4B3SB 4C6RA 4PSKA 2K2QB 3EQ7A 4UAVA 1TYZA 1QIEA 1P44A 3H4VA 2BH2A 2WSSD 2NQTA 4JOBA 3VTAA 3KE9A 4FSXA 1D03A 3E9RA 1R5JA 3L7MA 1M3SA 3RO7A 4JI0B 2L18A 1LNSA 4QOHA 2G5GX 2D0PB 3NU1A 3HKCB 3BMQB 3EISA 4LSMA 3V7UA 4UU1A 2C5BA 3FGOA 1XEAA 5AK0A 2XYRA 4GGPA 5CA0F 3QI2A 4LPKA 3EZFA 3HWSA 4HAXA 2MIIA 3ZDFA 1JR3D 4UAGA 2RAVA 4RTPA 1GLVA 1YCFA 3CN7A 1ZQ9A 1E5XA 1KIFA 2BFCA 2MMCA 5DB4A 5BR8B 4RE6A 2XLBA 4OYYA 1CZUA 2ZDQA 3PJFA 3SS7X 4G09A 4BMDA 4QG7A 4HFRA 3P27A 2M6LA 4YXFA 3T5TA