1SPBS

Subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
264
structure length
264
Chain Sequence
SVPYGVSQIKAPALHSQGYTGSNVKVAVINSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIVSTLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The prosegment-subtilisin BPN' complex: crystal structure of a specific 'foldase'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (serine proteinase/prosegment)
molecule keywords SUBTILISIN BPN' PROSEGMENT
total genus 89
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1spbS00
3I2YX 4KG7A 5I9SA 3D9QX 1SH7A 3A3NA 3SICE 1DUIA 1GA6A 3BPSA 1YJBA 1SIUA 1TECE 1GTG1 1S01A 3DE1X 4WOBA 1SIBE 2W2NA 2W2QA 5FAXA 3LPCA 1NDQA 3CO0S 3DDZX 3CNQS 3DE5X 3QFHA 3QTLA 1TO1E 4M1ZA 3VV3A 1V6CA 1KDZA 1SPBS 1EGQA 1BJRE 3DVRX 1CSEE 1NLUA 2WWTA 1CNMA 1SUBA 3VTAA 5K7SA 3I34X 3WQBA 1BFUA 2Z56A 3DE2X 1PJ8A 3DE4X 1SBNE 1SCAA 3A3PA 3DYBA 1EA7A 1Y9ZA 3WIUA 4RYDA 1PFGA 3AJ8A 2W2OA 3LPDA 1XF1A 1TM5E 3VSBA 4DZTA 2IY9A 4K8RB 2ZRQA 3DW3X 2SNIE 1NDUA 1C9JA 1MPTA 2QTWB 4H6VA 3D43A 1T1GA 4NE7A 3ZXYA 1PEKE 4J94A 3EIFA 1SBCA 2PWAA 1SUAA 5AVKA 4DJ5X 1SCNE 1P8JA 1R6VA 5AQEA 2Z2XA 1ZVKA 3EE6A 3LPAA 5CW1A 4CFZA 3GCWA 3TI7A 4ZARA 5B1EA 2PWBA 1ST2A 4OMCA 4KB5A 1AK9A 1DBIA 1IAVA 1HT3A 2DP4E 2PMWB 3DE6X 4LVOA 4WOCA 1YJAA 3VV2A 3L1KA 1Y3FE 1YJCA 2Z2ZA 1SN7A 2IXTA 4NMXB 1BE8A 1SCDA 1MEEA 1SVNA 2HPZA 3DVSX 3OSZA 1GA4A 1KE1A 1Q5PA 1Y4AE 5JXJA 3TECE 1Y4DE 1SUCA 2ST1A 4MZDA 3PTLA 2SICE 1OYOA 1T1IA 4YN3A 1WSDA 1SUEA 1KDYA 4CFYA 4DWWA 1GT91 3H42B 1TM7E 2V8BA 2X8JB 1Y1KE 3F7OA 3Q5GA 5AMXA 2HD4A 3F7MA 4H6XA 3WIVA 5ARBA 1TM1E 4AKTA 2WUVA 3DW1X 4I0WB 1BFKA 5FFNA 1YU6A 2PYZA 2ID4A 3SQOA 4B5LA 2DUJA 1JEAA 2XTJA 1Y3CE 2GKOA 3BX1A 1ST3A 3VYVA 1SBIA 4BWGA 4H6WA 1OT5A 3PRKE 3DE7X 1WMEA 2P4EA 1KE2A 3T41A 4CG0A 2PRKA 1SUDA 1AQNA 1T1EA 1THMA 5JXIA 2Z2YA 1TMGE 1VSBA 1R0RE 3GCXA 4Z2AA 1SBTA 1C3LA 1SCBA 1BE6A 1TM3E 1C9MA 1BH6A 5FBZA 1P7WA 1A2QA 2B6NA 1IC6A 1Y34E 1GTL1 5JXGA 1Y48E 1ZVJA 4GI3A 5AVJA 1SIOA 3WHIA 1Y33E 4JP8A 4LVNA 4HX2A 2W2MA 2SECE 2Z30A 4KPGA 2ID8A 1SBHA 3LXUX 4NE9A 2ZWOA 3F49S 1TK2A 1Y3DE 2W2PA 1GCIA 1TM4E 5ARCA 4C3UA 3UNXA 1KDVA 1WVMA 1C9NA 1R64A 1SELA 2X8JA 1AVTA 3AJ9A 1V5IA 2E1PA 3P5BA 4FONA 4OV6B 5ARDA 4C3VA 1AV7A 1P7VA 3DWEX 1GTJ1 1WMDA 2Z58A 1S2NA 3VHQA 3A3OA 2PKCA 2PQ2A 2XRMA 3HJRA 1AU9A 4ZOQI 1UBNA 5B1DA 5SICE 4AKSA 2WUWE 3DE3X 3DVQX 1GNSA 1GNVA 1PTKA 1Y3BE 3Q40A 2DQKA 1S02A 3GT4A 3ZXXA 1OYVA 3DE0X 4HVLA 2Z57A 1AH2A 5JXHA 3TI9A 1SUPA 2WV7A 1SCJA 3QMPA 5JMOA 3GT3A 1AF4A 2TECE 3EDYA 4OMDA 1GA1A 1LW6E 2G4VA 3AFGA 2SBTA 1WMFA 3BGOS 3I37X 2ZWPA 1TO2E 3I30X
chains in the Genus database with same CATH superfamily
5EGNA 1C1XA 1YZKA 4XD2A 4WESA 1FS5A 5CJ2A 2XGJA 4Q3CA 5I01A 4Q4AB 3NAQA 2WWVD 1Q22A 4DXDA 4ZQIA 3E1GA 1HOTA 1UDAA 1M2JA 1YR1A 4CG2A 1T0UA 2Y3IA 3DNPA 1G291 1LI5A 3EVFA 4YAFA 3VO2A 3VTAA 2IPXA 2XVXA 3I04M 3WB2A 2XNDD 2B78A 4WT7A 1H6BA 3KQQA 1BAPA 1FMJA 2EYQA 4FFPA 5DIFA 2Q1YA 4HN4B 3BYZA 3WBFA 4QZVA 1ZC4A 1DOHA 1PJCA 2RDMA 3LPDA 3UWKA 5ESWA 4FYVA 1QG0A 3CZ5A 1PZMA 1GQSA 1ZD1A 4DLKA 4QUDA 5BSWA 3E5MA 3OLQA 4TT8A 121PA 4LHZA 3RUIA 1I3KA 1ADJA 3EXG1 4EO9A 3THWA 2DBYA 1EFVB 2PQMA 1KZ6A 4X41A 1BHQ1 1YI1A 3HXKA 4QQRA 5CVJA 5DTJA 1UOEA 2F3QA 1A1SA 3DGFC 5I6DA 2XTMA 4WBXC 4Q1DA 3S70A 1C9KA 5CVDA 4AD8A 4JSYA 4BX9A 4IGIA 1MO5A 1ZBDA 2CN1A 1QZTA 1I51A 1QU3A 1ND6A 2WWXA 1EB9A 5DNCA 3ZK9A 2Z8ZA 2XEDA 2J7KA 2I1VB 1E96A 1POXA 1Z36A 2CBXA 2WWRA 3JAWB 4FT4A 4L4RA 4TROA 5BSGA 1V2HE 1TEXA 1VL0A 2ECQA 2WRZA 1E5QA 2YHIA 5KTPA 5E6RA 3KNZA 3SXJA 4QPZA 1Z25A 5G0TA 3ZWMA 1JKIA 1A4RA 3ITEA 1G7TA 3HRHA 3PWKA 5F2OA 5T64A 1FF9A 2B69A 4YP9A 1BIFA 1MIOA 4J2TA 4EQ6B 4OLFA 4R9NA 1YBAA 4ENVA 5GQSA 1AJEA 3LHDA 4RULA 2ID4A 1OFUA 3ZN2A 3ROZA 5DLPA 3V32A 3FPKA 2XF8A 1ETHA 4FGSA 5ESRA 1K5GA 3CCCA 3WL3A 4G5SA 5L3SA 1L7XA 4HEA6 5KYNA 4B6SA 1FTNA 1KEKA 1YB2A 1YRLA 3PQEA 2C9CA 1PFYA 2I4TA 2JVIA 4J0DA 1Z38A 4KLCA 1DX4A 2CNLA 2I6FA 1QK4A 4JLPA 3E9DA 1XTIA 4WACA 1X7WA 1XPJA 4LNHA 2QI9C 3JQ7A 4LKOA 5ALIA 5JWRA 4O6VA 3UMRA 4LV5B 2J09A 3KJGA 1BVRA 1MJNA 3MQ2A 3A6FA 4ISBA 2WG0A 4OHWA 4ZQCB 1QAOA 3N8GA 5J5CA 3TDMA 1QFXA 3T1YB 1P31A 4C0WA 3OOHA 4KVFA 3L1VA 1CIJA 2QN8A 3NS7A 3TNJA 1VI5A 2G6BA 4RO0A 3H2GA 2Q8QA 4DRXB 1AXGA 3TRKA 4HAVA 1OZ0A 3ORSA 3S8YA 4XPZA 4C3VA 2H5IA 2LVBA 2O6HA 3KDSE 1U11A 3NC1C 4YX9A 1ND5A 1QZUA 4A27A 3T0IA 2PUBA 1I13A 3ENKA 1PQYA 2JGRA 4Q9NA 2IPLA 3PEFA 1NW5A 2FZVA 2G7MC 1DG1G 1DEXA 1PGJA 4KXUA 4MV9A 3RODA 3ZE9A 3PHBE 1BKDR 4MVYA 4BATA 4UTVA 3ETDA 3DL4A 1NYLA 4FDTA 3ICEA 1U3WA 3GRYA 1RRKA 2Q1WA 4L78A 2UZIR 4QBKA 1WZ2A 1PR5A 1NC3A 4R7TA 4B80A 3GOHA 3P9CA 3OQMA 1SD1A 3RB8A 2MU1A 3QLVC 3D59A 2R8RA 3O8BA 3TGPA 1AV6A 1SQSA 2QQ0A 2B34A 4NDAA 4RTSA 1RZRD 3PLNA 4XYEA 1QKKA 1N33B 2X1MA 3GLHB 2QIOA 3OIFA 2XB8A 1UC8A 3WHPA 1AK1A 4NBKA 5EJ4A 4CLEA 1Y7LA 2R6CA 3F9CA 4B7CA 3V46A 1F8UA 3F4BA 2AOTB 4ASUA 1Y0BA 2YUTA 1UBTS 3FHJA 2OB2A 4PC7A 4BGEA 1FQOA 3EGDB 3RIHA 3DBIA 3X1MA 2FA9A 1LS6A 3UT0A 3B48A 3CUSA 3ER9A 3O38A 1VPWA 4UHHA 1O94A 5AJVB 3H4IA 1Y3AA 2ZRIA 5IJ9B 2BT4A 2O0LA 3BRSA 3VR5A 4DA7A 1SCIA 5J4KA 1OJLA 1FDRA 3HI6A 3EY4A 3OQVA 1POWA 2FLVA 2ZBQA 3MLBA 4JP2A 3LPAA 5ENVA 2J3QA 2XYVA 2H92A 4P34A 4YJFA 1W88B 2DP4E 4C0QC 4HUTA 3KZKA 4DCMA 1QCYA 3MMNA 5D5HA 4K86A 3CLRC 4LNUB 1TJNA 2CLHB 3DBHA 1KAHA 5CD9A 3VU3A 3JRNA 5KNCD 4R4JA 2NOAA 5BSMA 1EM8B 1T26A 1T91A 1Y1PA 1V16A 2HXYA 3BL6A 2XMPA 4FINA 1GT91 3FE2A 3ONFA 3W1VA 4BBZA 5E6UB 1SC6A 2HW8A 1PUIA 1TZ2A 1XNHA 5BN5A 4MXDA 3TLZA 4QDOA 1Z62A 3JQAA 1M34E 1P4HA 1YS7A 4IMPA 1SVIA 4I19A 4BE7B 1XTBA 5AW4A 3GU3A 4LY3A 2ZE6A 3FYUA 4Y1FA 2Q6VA 2COKA 4BKQA 1QH8B 4DMHA 1ZQ9A 1E2HA 1F12A 1D0VA 4HNHA 4BMDA 1SBIA 4BFWA 5FI3A 1YCDA 1DAKA 3DAFA 4L72A 5C5EA 5FV4A 4Y2UA 4B40A 4DJJA 4R9RA 4QYIA 1ZGBA 5SY9A 3VH3A 4RABA 1N9GB 3KQYA 1ZMOA 4MVJA 2PM8A 2ACWA 4RFVA 3KYCA 1D3AA 1BE6A 1US8B 1UZUA 1G63A 2GK3A 1A9TA 3AEZA 3PQ4A 1NQUA 5B37A 5I4IA 5L4SA 4ECAA 2QYOA 4B3IA 4Z53A 2P77A 5D6NA 4TZ0A 4M0UA 3D3KA 1VFPA 5KU1A 3EEQA 5DGXA 1YAHA 5CXSA 2BFCA 3D1LA 4AMUA 3V55A 3L0IB 4XTCS 4NJMB 4RGQA 2JLCA 3R5KA 4JX8A 1AVTA 4YRNA 3PJEA 1G8FA 3NUQA 1DQRA 8LDHA 5AI9A 3RU7A 2HHCA 3ZH9B 2P75A 5DFAA 5JAPA 5L95A 3HA2A 4K6FA 3VMMA 2DFVA 3OQ1A 1J8DA 1FFXA 3LC2O 4X1IB 1YZYA 3N9IA 3KTFA 5SICE 5IU6A 3KPJA 1KWKA 2G5PA 2DQKA 3JQRA 2HEIA 4P33A 4Q00A 1CEQA 4HDSA 1I5EA 5E9AA 3H7IA 1KSGA 2PY6A 5AVTA 4ZVRA 5COAA 3E5HA 5INTA 3SIPA 3INNA 3K6JA 4Q7MB 1CUEA 1T6ZA 1GSOA 3ES9A 3R0QA 1TVKB 4IEFB 2XI4A 2IBTA 3OFSA 1R4NB 1E9SA 4O5AA 1QHSA 4PSVA 3SP1A 1WSWA 4UPVA 1VC2A 1YVEI 4UE2A 4X71A 4BQFA 2AUNA 2FAXA 3NTQA 3DFUA 4AURA 3CF0A 5C8ZA 1C0IA 1PT8A 2HRRA 2JGDA 4IS2A 5D1NA 1J7JA 5IMBA 3D7MA 4DW8A 5BMVA 2G40A 4Y9TA 5CLGA 1RQGA 3TNFA 3TRHA 3M6IA 4EI9A 4FPXA 4RW0A 3QOYA 4MINA 4Y30A 1W30A 1FYDA 3GAMA 3VDMA 3ZWCA 3O8QA 3EG5A 3G9QA 3G2LA 4AY3A 4FYYA 2H8KA 4Y0VA 3HA3A 4JUIA 1N2ZA 3FPCA 3L7CA 4J0QA 4NJEA 4P38A 1PD1A 4PYKA 4HFNA 4P3YA 3EIFA 4YV1A 4WNCA 4AG5A 3IAM1 1Q0PA 1SG6A 3JY6A 4C7BA 4ENTA 1HXHA 3OJLA 5BN4A 5AW7A 1ZLYA 3H5WA 5JVDB 1UBRS 4DLUA 1PWHA 4NU6A 5JSFA 2P90A 1JX6A 1SN7A 3F97A 4MV4A 3NWPA 3KZCA 2PVSA 1HG1A 2VJCA 4Q3LA 5HQJA 2AE1A 5JZMA 1XC7A 3DL0A 1J9ZA 2RC6A 4DQ0A 4EKGA 4JI0B 1EH5A 1E1QD 1R50A 1U5CA 2Q8PA 5KDLA 3T3PB 2PHZA 4LMAA 2MMGA 4C7OB 1BC5A 3CN7A 1Z4IA 4UNIA 3BXFA 5E2AA 3ST7A 1PS9A 3H2YA 4X00A 2C2XA 2UZ4A 3TIXB 4YLYA 3T3EA 4OAPA 4PIPA 3THYB 4I7EA 2BY4A 1Y1LA 5CJPA 3TN7A 1MC4A 3Q3IA 5DYGA 2IV3A 3FZYA 4ZYLA 3SX2A 1U1GA 1YR3A 1EIWA 3COYA 1F6BA 5DNDA 3FOEC 1X0XA 4OKIA 2JVKA 1C50A 1QDUA 2GBPA 3RFXA 4OAQA 4E2ZA 1LF5A 2IOFA 3WJ7A 4ZAXA 4A0QA 1P73A 3GZNB 4CQMA 3MYYA 3VSEA 1ID8A 1PDVA 3PUVA 4V0QA 5MN5A 1NBOA 3U4QA 3FROA 3OPYA 4JOCA 2QP3A 3BL8A 3G5UA 3HVKA 5LZ7A 4ASUD 2W90A 3IC5A 4S3MA 5FD8A 2YHBA 3NVKI 4YASA 1YV9A 3D3WB 3W5DA 4GBGA 4GIBA 3OE5A 2I2CA 3DBVO 3U61B 3CZPA 3ILVA 3PRHA 1DZ3A 3S1SA 4INPA 1GAWA 4M1KA 4B8WA 3MD9A 4WLEA 4M88A 2XMZA 4LE1A 4DM4A 4RTOA 2XUAA 4V38A 4YP6A 2LXNA 3CR7A 4DY4A 1XPOA 1FCJA 3M34A 4I1UA 1F3OA 1RXSA 3PIDA 2FDRA 4G4IA 5SYAA 4GX1A 3FKQA 4RF3A 3BBLA 1ZI8A 3NANA 5BN4B 3I92A 1GNVA 2CNNA 4OP2A 4JI2B 4CGZA 1O8BA 4HVLA 5I4CA 2G9VA 3DOUA 1RMQA 2H7CA 1DFIA 1JTEA 1N5OX 2C7RA 4ZK6A 3KLOA 3LHFA 4KIWA 3ELDA 3F1KA 3FOAA 2JG3A 3TLAA 1J0XO 2JATA 1BN6A 2C9BA 1P2VA 1PJ3A 1T4MA 1X1DA 3DZHA 4QBTA 1U7ZA 3O8RA 4MW5A 3OTGA 3AKCA 4RQUA 2XX3A 4OQXA 3KOZA 3Q6NA 3LWZA 5SY6A 3HSSA 2X0DA 5KTOA 4DWJA 2J31A 4JC5A 1XCBA 4W1PA 4PHHA 3CTPA 1QLHA 3LRPA 3OH8A 3WHLA 1DC7A 4ALIA 2HJRA 3PQ7A 4E5VA 5SZIA 1SUBA 1SFRA 1PD0A 5K7SA 3S1AA 3NHBA 2AYZA 3HI4A 4HEHA 4F2WA 2Z3VA 4DR4B 1DKQA 1DJNA 1JNXX 3JCZA 3WTBA 2JFUA 3SJUA 8MHTA 4ITVA 3GAFA 4NYIQ 1R4NA 3BC1A 2LUOA 3FR7A 4QATA 4JWKA 3V80A 1NBME 1LC3A 4QQKA 4UM7A 4KN5A 1VHDA 3TL6A 5ERXA 2O2ZA 3AHCA 1AS0A 1IIBA 2GLTA 3TD9A 3EA0A 5BOVA 4HDRA 3M1AA 4HAUA 4Y2PA 3VDRA 4ZJUA 2QMHA 4A2QA 1Y6ZA 1ZM2A 3FFBA 4DMLA 4GR4A 2A78A 5DXFA 3RV3A 2BP7A 3GRCA 5FI0B 3ROMA 2GZSA 4WZZA 4L08A 1SG0A 3E48A 5D7NA 3A70A 3RH0A 1ZD5A 4WIAA 1NTOA 3KLPX 1FFXB 4X1IA 1B0UA 1VL5A 4PZDA 3V8EA 2F3PA 4DR5B 1R15A 2W2LD 3AY0A 1IBCA 4B9AA 4PO8A 3L06A 2DR2A 2P27A 4ZANA 1PL6A 5H5JA 4NJMA 2PXCA 2ZXFA 3RHTA 3KCNA 3ZVLA 4PBSA 4OSEA 3K0FB 5EJMA 3O84A 3GD5A 4RKRA 1SVUA 2I7CA 4O4LA 3E7PA 5IDVA 3D6TB 4BNZA 1IULA 1XFDA 1R18A 2PKRA 2FQYA 3AOEA 3BERA 3HHEA 4JQCA 2NU6A 2YJNA 1O9HA 4HVTA 4Y9DA 3MJHA 3JSXA 3S2GA 3WQHA 3TW0A 3N5CA 1QP7A 1QWSA 4DIFA 5AJHA 1R6XA 1EUZA 2VP5A 2O8EB 1RIIA 5A0VA 3FSGA 5ELXA 3DLHA 4IZ6A 1JJ7A 1UWVA 3E18A 4N8SA 1LZLA 2VDOB 1Z8HA 2E1RA 2A1UA 4GOND 1XRRA 1JB9A 4S1PA 1LQUA 5FAKA 1RHMA 3C6BA 3BMQB 2XCIA 1ZXXA 3QWFA 2JPDA 1L7RA 1UQTA 4M53A 2GAJA 4TMVA 3WLLA 2YXNA 3EISA 1PV4A 1UJ2A 4C6SA 4ZD6A 1VBKA 1MR3F 1E2BA 3FWZA 3NGMA 3HJCA 3LUKA 2NZ2A 4ICIA 5EXDA 3CF4G 4JBYA 5FNZA 2H4WA 4IJWA 5CT9A 1L9XA 2UAGA 4GYJA 2XZDA 3IVGA 2HAEA 1E3JA 2F7SA 2ANCA 1U02A 4QHSA 1HETA 2Y4NA 4TV9A 4KQIA 4LFBB 2W6PA 1W88A 1VPTA 3U4MA 1T34A 4PZ0A 1H8HA 1UANA 3BD9A 3BJEA 1KVSA 2RH4A 5KYWA 3G0HA 1HTBA 2RGWA 2FRDA 4DVGA 2JHAA 3MHPA 3ND5A 3UJ8A 3K1JA 5HEKA 4V1CB 3CWZA 4HQOA 3CX7A 2H2HA 3ZBPA 2HA5A 3G2QA 2BE9A 4TVOA 5D1HA 1CY4A 4AAYA 4H1HA 2HJGA 5I9SA 3FDZA 5AM5A 2ZE8A 1SVOA 2GLUA 4FBMA 5CDFA 5IZCA 1R8YA 1DUIA 4MTLA 2VWPA 3M5WA 4EOGA 5AICA 3U40A 1LA2A 3U44B 1P3Y1 2JKVA 1KDPA 4N0QA 4NAVA 2IBSA 4LJ5A 2JAQA 3ACDA 1CUDA 4UCXA 1FS6A 4WVFA 5L7YA 5A7GA 3EW9A 3N58A 3PUIA 5L8VA 2BR5A 4KCGA 3PI6A 3T9CA 3TZKA 3PR2B 4HLNA 1MAAA 1KMNA 1MJGM 1YB4A 3G5TA 1OE0A 2W2VA 1T3ZA 4JB3A 2H5LA 4PYLA 1Q0ZA 4PSUA 3R9WA 1FX0A 2B4RO 1L5OA 4MYUA 4EB0A 2QVBA 4B8ZA 3FWYA 3PYLA 3NYWA 2HLDA 2OHFA 2CSXA 1X2EA 1T36B 2A9JA 1K8ZB 1HA3A 1B0PA 1JQAA 2P9EA 1IK4A 2ZK7A 3A1EA 3OSUA 5KINB 3BDAA 4JJ4A 2ZRNA 2I6SA 1GO2A 2OPHA 2W8BA 5KJCA 2FE4A 1J5PA 2QG9A 1DJQA 2O52A 3I2KA 2IYXA 1TT5A 2Q9BA 1KOGA 3G13A 2RAPA 1QGDA 4RF4A 3VU9B 4PZUA 3OX2A 4KXQA 3MGGA 4ZEVA 3D8BA 2VUTA 3ICWA 3VKUA 1E3TA 3C5HA 3L1JA 4M8KA 2HX1A 1IY9A 4LXHA 3ZU4A 4YMVA 5KDDA 3NOQA 2N1BA 1XZNA 2V7GA 1YGPA 2Y4OA 2YBDA 2QRQA 1RAGA 3LLCA 4LZPA 4N4AA 1OYOA 2BTQA 3ZE6A 1XZPA 4CFYA 1E2DA 5B2ZA 2BEJA 3I5YA 3DR3A 3GBSA 4G0XA 2H17A 3TAUA 2WABA 2IYWA 5L9AA 1T8PA 2OGSA 4TTSA 2PL5A 4GEGA 1FNNA 1YRBA 5AHOA 5H80A 2AQIA 4TLEA 3IA7A 4UHDA 1OWMA 3OTOB 3ESZA 4R3UC 1Z22A 4UCWA 4BLTA 4KP7A 2PRYA 4DV2B 4C4SA 1ZK2A 1WEHA 1DWOA 1EDBA 1W4LA 3N39C 4M6WB 4F2DA 3GJZA 2NSHA 4R0MA 3AEKB 4D44A 1IEQA 3OHPA 5JH7A 5CNMA 2XHZA 4CDRA 3VNUA 3TLXA 4GC5A 1FVHA 2NO4A 1OAKA 4Y2RA 5AXDA 3UTDA 3AEQA 4G81A 2JLWA 1W0JA 2NX2A 1GGVA 4LJLA 3WJ2A 1PQPA 3A1NA 4MGEA 4WI1A 1QQ7A 5PGMA 1FX1A 4M4SA 2A1TS 4D3ZA 5D6OA 4XD7D 2IP2A 1PZGA 4RWZA 3RYIB 1YBFA 4DNPA 5CDHA 4TYNA 4DV1B 4B3TB 4BBJA 1W52X 4YO7A 4XZ3A 3WZLA 1TJ3A 3TBFA 4QYMA 4DILA 2P5YA 4A8JA 3D6AA 1ISMA 1TZBA 2AN3A 2VPWA 2AN9A 3OZAA 3HS3A 3A4LA 3OPYI 3HJHA 2H1LA 1JAZA 1QQ5A 2JRCA 1PWEA 3AYZB 3HXLA 1SKYE 2FZLA 2GAAA 3OM8A 3Q7SA 1Z4OA 1P1IA 2XCLA 5CLQA 3X43A 3AETA 5DM60 3ISTA 2ZSAA 1QBGA 1AA6A 1ZR4A 2BMVA 3K4HA 3KEMA 3ND9A 1W2GA 1NXQA 4Y1RB 5AK0A 4L9AA 2GPSA 4N47A 1BGXT 1SB9A 3ASVA 5EP2A 1NRIA 3TBKA 5A9RA 4QOIA 1CUCA 2H48A 2DHEA 3IJ5A 1OGJA 1UMCA 3THWB 3RCBA 1CF2O 1RYEA 4BTVA 3F8SA 4CW7A 1T6NA 1MEOA 1KP9A 1YWGO 1UQUA 2VAWA 1NMSA 3BXEA 2DSTA 1L4GA 2R00C 3DAGA 3EFHA 4NPHA 2D5BA 2GF0A 2HWUA 3D3QA 4Q15A 2BEUA 2BVNA 4D74A 4EK9A 1E4VA 1U8XX 2RK4A 5DI3A 3PDWA 4JEUA 1X92A 5FNVA 4PQGA 2UU9B 5DX8A 2RGCA 3PIIA 2WMNB 4GW3A 5B3JC 1RAEA 1XZAA 1JR3E 3DOEA 3HBMA 4FMCB 1T3HA 2NP6A 1VKZA 2IKSA 3H11B 3JZDA 4X97A 2WR8A 1CSEE 3IAAA 4LRQA 4R8RA 4EUHA 1TZKA 5HCIA 3DHEA 2ZAOA 4KE6A 1A04A 2QTZA 4RLHA 3V48A 1EDZA 3KR9A 1SBNE 1CRQA 4JP5A 4MV1A 4PFQA 1EEHA 1XK6A 4IIJB 3UMBA 2VHXA 2HQRA 4QOJA 5LZ2A 3SQMA 2Q2WA 4DCSA 2GCIA 4Q5IA 1G5HA 2I7DA 1PLLA 2IYQA 4K8RB 2YVAA 3Q0EA 4TMWA 2NVUA 3CUYA 4IG9A 4N49A 4QPPA 1ZJ6A 2VXCA 3PP8A 1JFFA 1P0PA 4WN9A 4Y1RA 3RM3A 4CG1A 5AW8A 4ZVUA 3AETB 4QXMA 5AKIA 3SN6A 5B36A 3EW7A 5KYTA 5CCXA 4XGIA 1VKRA 1CP3A 1BHO1 2C59A 5ETJA 2IQ5A 2Y1DA 4IHKA 1QE0A 5G1OA 1VE5A 3AOEC 5G1NA 1J97A 4WOCA 1BO6A 1GITA 1ACJA 5FTNA 3BB4A 2KS6A 1E2LA 1XP8A 2HNAA 5HGJA 4D25A 3N8IA 5K6AC 4LJYA 4X8LA 1YB1A 3QXCA 3PCTA 2JLZA 2E6UX 2PX6A 1ZL2A 3HNPA 2D0PB 2J4FA 3IJPA 1X3LA 2NUPB 1HLFA 1ZHFA 3HYSA 4HNAB 1I6LA 2HDOA 3GRKA 1XRQA 3OEEA 5FJIA 3SLRA 5C7LO 4DFDA 4CDGA 1RBYA 4BO1A 1OC2A 2JLQA 3QMMA 3ZKWA 1Y5LA 4DQXA 3EPHA 3TS1A 3GJRA 4LXXA 4ZZIA 1Z29A 4TN1A 2WJIA 5DW3A 2YIMA 3LC1O 2F43A 4LHSA 4X3OA 2N47A 3ELWA 1NJ5A 2FDXA 4PVDA 3V7NA 1FXWA 3JALB 3SF8B 3VUFA 3WA7A 2HMVA 1JKJB 1Z63A 1UFOA 1UPXA 4RE6A 4P32A 3K30A 4I1OA 1F4PA 7ABPA 1LVUA 3GVCA 3WIBA 3EGXA 2IF0A 4PAWA 3HU1A 4UUQA 3I1IA 4DCVA 5AM2A 4CM8A 3A1CA 3HXTA 3GFSA 2MWMA 4GVXA 1XEXA 3WNVA 1XRLA 5REQA 2BJWA 3BH0A 1B74A 3NDJA 4F7DA 1EG7A 1L5WA 3HO6A 4TLBA 3V9PA 3PPYA 4XYMA 4DJTA 1PU2A 1QHEA 1YI0A 2Q27A 2C4HA 1QHXA 1D2EA 1TT5B 2ZP1A 1BD4A 1OI3A 1THGA 3I6QA 2Y71A 1XLUA 4JKYA 4EFNA 1E6UA 2V0CA 3IQEA 3IT2A 4IW3B 4Q9JA 4F4UA 1MX1A 3KM0A 5JG7A 4BNMA 2Y2VA 3H6GA 1JA1A 1OOEA 2Q3EA 2R66A 4Q1FA 1G0OA 1KEVA 1AU9A 1SXJA 5KCMA 3VC1A 2H1CA 1Z88A 3GRZA 2DHQA 1NVXQ 4M7RA 7GPBA 4OQYA 4C7MA 3WGMA 3Q6IA 4OGLA 1TF7A 4BS9A 2GM4A 2AI3A 2QAJA 3CUUA 3GJ5A 4HVAA 3VDXA 1SUWA 3WLAA 1PT5A 1QCZA 1SUPA 2WWIA 2SCUA 2C0PA 3FNQA 2K7ZA 1GTSA 3B20A 4NEQA 2XZLA 1RYDA 5IDQA 2P9CA 1V8DA 4NMMA 4UVGA 5ALVA 2V3CC 4QELA 4BO6A 2J3DA 2CLSA 1COWD 5K8LA 3JZFA 1W4BA 2C3OA 4O4JF 4TZKA 2E5WA 3CO5A 3GEDA 3U39A 1PQ4A 3VZBA 3LXXA 1T8WA 3UG6A 1MQ9A 4EHNA 3PJRA 4FMCF 2HMUA 5TARA 1ULBA 3LBNA 4O5OA 4JI4B 1B23P 3DTVB 1RE1A 4PAQA 3IRUA 3QBTA 5ALUA 2V5AA 3OM9A 1M3SA 4QUKA 5A06A 4PG5A 1BGWA 4R69A 1E3MA 3DO6A 2Q2QA 3PGMA 1PJ4A 1WUIS 3SQWA 3FGPA 4H7FA 4OM7A 3H11A 4XR9A 3HDQA 5AOBA 3UWPA 3QVGA 3WNZA 4GLFA 3FXAA 2BHNA 3IJRA 4AP5A 1JMVA 3KFVA 4H3KB 2IY9A 4DNOA 821PA 1FZTA 2I4LA 3E9QA 4IUBS 4Q12A 1NAHA 4B35A 3OI7A 3ZD6A 4LZLA 4J0CA 1H2YA 2H3EA 4NZPA 1TYAE 2P6MA 3HY4A 2XCSB 3SVZA 3G85A 4V2UA 5CA1A 1UBOS 3NATA 3TTUA 4CMBA 3F2VA 2OEPA 2Z09A 3LX5A 5FTMA 3LHIA 4OUKX 3UFXB 2QM0A 4DCUA 1HNZB 1XDZA 2BISA 1XZCA 1AHHA 2BI4A 4K28A 4QUHA 3HB9A 2H0QA 3FWNA 4TV9F 2F17A 4FCTA 3VRHA 4MUAA 5AKHA 4CLHA 1N0WA 3SNKA 1L8QA 4JI8B 1VCOA 4MRAA 1T6XA 1E7RA 3TECE 3IEPA 3BK2A 2O05A 4L3WA 1QTNA 4TM8A 1OFVA 3BMQA 3EC7A 1QUEA 4UASA 4MK4A 2AN4A 3ZV3A 3LFTA 1W76A 4JLSA 5CGQB 1F2VA 3TQFA 5D00A 4INZA 3TKAA 2A7XA 4AICA 1C4KA 4L95C 3BAZA 1WZNA 3ICPA 4LY9A 1U94A 4D9EA 3GGSA 4RTMA 1M66A 3EVZA 4BVKA 1R88A 1LY1A 5DIZA 2HBQA 4TWJA 1JSLA 1I6MA 5KHOC 4O3MA 3H3FA 1P1JA 4FYPA 1QORA 4MAMA 1IJEA 1IBKB 4J0JA 3JVIA 2DH5A 2H2IA 3IXLA 5H1YA 3OZBA 1DDOA 1EUCB 3LFHA 4CKWA 5AVWA 4AUNA 3H97A 4L3OA 4G9EA 4LECA 4O4LF 5KKAA 1XUOA 3VZDA 1MKYA 3UGJA 4YDSA 1JHUA 3RVQA 4DYHA 2GDZA 2FMIA 3GPCA 3LA6A 3PXAA 3IUYA 2WNHA 4WN3A 3UHPA 1BXGA 4C4YA 2VRCD 5DYIA 5HKOA 3BCSA 4Y6PA 1MP0A 5AESA 1KORA 1R8SA 1BH2A 2GEJA 2OLEA 2QPAA 2VHCA 3E0XA 3OQBA 5BUZA 1D03A 2JB9A 1U8EA 5JATA 1INLA 2KBFA 4ARSA 3ZDXB 1GNQA 1NDHA 1QF7A 2AN1A 1GG8A 2EDAA 2CJXA 3DE3X 2XUQA 3FMFA 3RRXA 4IL5A 3GUHA 3QSGA 1VA4A 3I4LA 2YWBA 4URYR 4UHCA 3THXB 1WXHA 4AYTA 2O8DB 3WP1B 2WM8A 2D2VA 4H4DA 1UDXA 2JJMA 1CJUC 3PEUA 3PKIA 2J0SA 1GPLA 4P7JA 3QMWA 3SYTA 1CY0A 1FJHA 3LYAA 1N4AA 3ZIAD 1IBRA 2PH7A 3T9DA 4N39A 1VJRA 2P9JA 1C7IA 3ID6C 3SVLA 3Q41A 2H0AA 4GGPA 3SICE 1TAHA 3ZZMA 4WOBA 3MNFA 2FOLA 2Y1FA 3LPNA 1S9DA 1ZGJA 2X0JA 2OCYC 5LJLA 3WNQA 2WJGA 1B00A 4MR7A 4YCCA 4F5YA 3HFRA 1DNPA 1ZICA 3KU1A 3GLGB 2HA3A 1L4KA 2XSZD 3LI2A 1OWNA 4KU4A 1HRKA 4MV7A 2QY9A 3O83A 3RKUA 2VPTA 4ID3A 1L7PA 1Y9ZA 2IUUA 5K6TA 1NZJA 2CHQA 2NSDA 3WIUA 3CVWA 1TM5E 4H59A 4MV8A 4RSGA 5JDCA 1NSYA 4D3DA 3O5AA 3HO8A 5DKFA 5TB5A 4CTJA 1X74A 4AS1A 5AXCA 2EZ4A 2W6JA 6REQB 1JRLA 3QMVA 1YHZA 1X15A 4DEXA 1KO5A 5T57A 2B5OA 1KY4A 3JXEA 1D8TA 2ZT5A 3KZOA 3WWYA 3I05A 2PMEA 2HCTA 1XXLA 3R40A 4RA6B 1MAHA 2JGIA 1CUAA 1SOVA 1SB8A 3ENVA 1M75A 1PR6A 1CR4A 3ZWKA 2RJNA 3A4YA 4MRNA 1E2EA 1UJ6A 5E1MA 1LSSA 2QZZA 3SOPA 6ABPA 1PS8A 4TVKA 5HVNA 1G8HA 4MUEA 1H4TA 1NUQA 4V0ME 1ZM4A 3WVNA 4CXMA 3USES 1R6BX 4I8DA 4BC0A 3SHTA 1JHXA 4U7GA 3E6AA 3F7MA 5JZ9A 1P72A 3C5EA 1XYYA 2E49A 3X1XA 1V3UA 3B70A 2XYPA 3N3AC 5AXAA 5BQPA 1U7WA 4Z0NA 2VQEB 1IBLB 1NKSA 3R9XB 1FS4A 3AVVA 1ZW1A 1D2CA 1J2YA 2OV3A 1ZY2A 1ZPDA 3D4IA 3DAYA 5CPBA 2D54A 1JJAA 1NU8A 4WXRA 5G0UA 4ES6A 5BUSA 1PDOA 4N48A 2R1VA 3JQ9C 2DBZA 2IHJA 1KJZA 3W2TA 1O97C 2PR7A 4KMOA 3AP3A 2BWJA 2MCFA 3VR4A 3A1WA 4MUFA 1EVIA 5ILGA 2JCVA 1VE9A 4J9VA 1PGOA 4R9VA 4AF7A 1T6BY 3DUFA 2GVZC 5H3HA 1L7QA 2PYIA 3QWIA 3LCCA 4QRIA 2Q6LA 4K9SA 3I9OA 4Y9SA 1WP4A 4F1WA 4H18A 3TL3A 1XO1A 4PHTA 3RVDA 1U65A 1CU1A 2ARKA 4G1MB 4M0DA 4I99A 4FGZA 5TEVA 1WCWA 4UUOA 2YV5A 4WFKA 5IXJA 2MIIA 3K32A 2NU6B 2R6ZA 2HK9A 4DA8A 1OYWA 2W9XA 1T2AA 1TFRA 3ELYA 3TDNA 3TPZA 3PG5A 3BTVA 1GQYA 1NNSA 3B1FA 3WICA 1L4FA 5F7OA 2Y1LA 1AMNA 2GFHA 2RHJA 3CW2A 1LS1A 4FYJA 4Q66C 1XKLA 4IIBA 4NBUA 3EWIA 4MKRA 3JPYA 3LDFA 4QXAA 1XJQA 4GPTA 2ZAMA 3EUEA 1NW4A 4KQHA 1J5EB 2C8JA 3WMRA 3WYEA 3EA5A 1XRSB 3N2LA 4KV9A 4D9NA 2BBOA 2WB2A 3O7MA 5HQ3A 1HG0A 4Z4QA 2R9VA 4GQIA 4ENWA 1K8XB 2V9CA 5C7IO 3OAAA 1D2MA 2MYPA 3NT5A 3QKIA 1WRBA 2WFZA 4MS1B 4CMJA 2VPPA 1QYIA 3EVTA 3SQDA 5JALA 4CTOA 3PRJA 3ZVKA 4E51A 4WJLA 2AJCA 3A1UA 5AHKA 3T1QA 2F1IA 3W34A 1OU0A 4MDHA 3ECSA 4BUCA 4EF4A 4M49A 5K51A 1JEQA 4IDCA 1U2RA 3UT6A 3COVA 3LP6A 1F0KA 4LKRA 1RC0A 3TQOA 4YHHB 4E6PA 1RC1A 1LJUA 5LWHA 1VKNA 4U7FA 2HA6A 2QTTA 2REQB 2DPYA 1JA0A 1U3GA 3CBGA 3RDPA 3S1AB 3TZCA 3SE7A 4ABYA 4M0CA 4UCQA 3AJ8A 3K16A 1Z7EA 5AH0A 1EPUA 4BZZA 2BV3A 1I4LD 1E6MA 2ES4A 3KWMA 3J7TA 2J6BA 1U1DA 4NCNA 3ZH2A 3UH0A 4PYJA 3ZJTA 1EX7A 1IL0A 2CUZA 3IKMB 1AE1A 3MAGA 2C2MA 2H31A 2IYNA 1ZAYA 3NP7A 3TLMA 2HPAA 1X6VA 2R4TA 2ZRLA 3C39A 1C0EA 3BN3A 3KOMA 2PBLA 2HCFA 4KR2A 5EWJB 1AHPA 3LKZA 2BMFA 4RPJA 1RWOA 2M6RA 2DWPA 1T9DA 3ZGYA 3TIFA 1DIAA 5AHXA 2QR3A 3GZJA 3UVEA 4LFAB 1XZJA 4FOSA 4E33A 1DELA 2VYND 3EZ9A 1X7XB 3K70C 1CS4C 1IVYA 4HUQB 1RZVA 2L0XA 2V74B 1E9CA 3DWIA 1QAQA 5KYXA 3VU9A 3GVIA 1N9GA 1ESDA 1LPAB 4JYZA 3QU5A 4UXIA 3UMSA 1TUIA 1LI7A 1UM9B 4NYMR 1QH1A 3G3EA 5HZHA 1H9CA 1EHCA 5LDDC 2PL9A 1AQ6A 1JUDA 2VDRB 1E3SA 4HAZA 5ALRA 3B82A 5THQA 4BNGA 3BOSA 3NKFA 3IDZA 1NUPA 3NGXA 2B1IA 4A26A 4XW2A 4IXMA 4S04A 4BQPA 5DB4A 2JI8A 3HFJA 3DL2A 1NJGA 3AFOA 1LX7A 2B5WA 2IYYA 3MEQA 1O5IA 4RHXA 4YMUA 3S2SA 4L7QA 3P52A 3NM5A 1O87A 4DG9A 4F12A 2DAPA 1R0RE 5K4AA 3KQLA 4PNZA 1SCBA 2JEYA 2IODA 3DBOB 3VBCA 5BN3A 2EFYA 4EJFA 2VTBB 5F5NA 4KQJA 3BWVA 2PKQO 4M9UA 2IIBA 1OAOA 2EKZA 2XWBF 1GDDA 3I42A 1J0CA 3RPEA 3TNLA 1CY1A 1IPHA 1XKXA 2X7HA 4XSGA 5H70A 5J5AA 4MWBA 1NR7A 1FUKA 3WGQA 3ZY4A 1A9PA 5A3JA 1J2TA 2PH3A 2W2KB 3IP8A 3IT3A 3V4OA 4IKEA 1N5KA 4FE4A 3SJ7A 1W59A 2WB4A 5IBRA 4DHWA 1XDDA 3VHQA 1E6CA 3BBPA 4LTDA 4NBTA 2ORYA 5HJ2A 3SZUA 5C32A 4IDEA 3WO0A 3DVQX 1V9SA 4W5RA 3W3AD 3FYUC 3HCFA 3EGDA 3KKMA 5E4TA 1KDRA 2ORED 1BQ3A 3O95A 1IXKA 1P2UA 4ZO6A 3OEHA 2J6CA 1ECLA 2B98A 3GLHA 3KR2A 4I3FA 3T4PA 4QJIA 4BGIA 1S8NA 4QYSA 3JD1A 4ZU1X 3RF6A 3HVUA 4RAQA 1AKQA 1DFHA 2JBWA 1MDBA 4S2UA 1XA3A 5JJBA 2PUAA 1U99A 1UBHS 3CNNA 2P9TA 1N1MA 4TTQA 2I62A 3DFKA 4F71A 3NMUF 3CH5A 5EJFA 3AOGA 1L3IA 1NQVA 1KMQA 3IQWA 1EINA 1F51E 2XVZA 4OUDB 1PYGA 1GV1A 2OCDA 3HFGA 4MWEA 3V5NA 2VYNA 5CFZA 3ZVNA 1VL1A 4MWCA 4D5EA 2ZATA 2J0UB 1GIAA 3CZ9A 2IDJA 1VOTA 4P54A 2WM3A 2DLDA 2OLKA 3ZZTA 1UJ5A 1HKUA 1Q20A 3H75A 1DTWB 4NWIA 2QTWB 4RZIA 3U6BA 1EQUA 1RDFA 2JIQA 4HQLA 4XEHA 1EXNA 1SQFA 3D3EA 1X2BA 3PEVA 4NYMQ 3G8CA 3GQBB 1PYOA 4GXNA 4P0PB 2ADFA 3DWGA 3JQFC 1KO7A 2RGBA 1TB4A 1PK7A 3PWTA 3P27A 3IV7A 2A5DA 4HDSB 3HC7A 3UJAA 1FSFA 2OFXA 4GP6A 4ZTBA 4BNHA 1W73A 3PNPA 4H77A 2Q0QA 1H9BA 2FCRA 3RYFB 4BVGA 4OB8A 1PFKA 4RHEA 4RH3A 3ZUGA 3PC3A 3RWMB 1LB1B 3SR3A 3U7RA 1RLJA 4Q1VA 4JLKA 1YRAA 2WFAA 5KZMB 3I9KA 3ZVMA 3E58A 1ZNZA 2GBLA 3BMOA 2C8KA 1MAWA 1ELOA 1NW7A 2FK8A 1W5SA 2WD8A 2PZBA 1Y5IA 2G0AA 2I8AA 3FD8A 4I1SA 5HYVA 4IWNA 1NPDA 4OBXA 2IEBA 3F6RA 3T7RA 3UW3A 5MHTA 4D8WA 4EG1A 5A3QA 1Z9BA 1TMKA 3G17A 1VQ1A 4QPCA 2F3SA 2WSBA 4RE5A 1AMOA 3KKNA 1Z5OA 3I5MA 3SYRA 2P4EA 8AT1A 2V6MA 1EFKA 1R0KA 1MB4A 1L8AA 1SU8A 4KRXA 1I7PA 5DMXA 4NZZA 3WDKA 5KYYB 1JFVA 3RAFC 1EIZA 3BKWA 3ANYB 2PEZA 2Y93A 4IXTA 2DEUA 4N3CA 3GARA 2ZYWX 2JH8A 5DBEX 3E7DA 1LLFA 4MRMA 1NR5A 3JAWA 2AG1A 4OHOA 4GI3A 2WTEA 4XB1A 4KAAA 3KQUA 1FLVA 4XJSA 1JLLA 3WL4A 3BSWA 3FYUB 1XSEA 2PS0A 4GWLA 4I6EA 5JAIA 1VE7A 1M7HA 4RD3A 3WAGA 1GYRA 2OKCA 2YWGA 4EJ0A 4MQFB 1DLIA 4D41A 4WJKB 4E7OA 4K1LA 1II8A 3ND7A 4AZVA 2FFHA 1MH1A 1XMQB 4IEIA 3GHYA 3EH2A 3T7CA 4CKCB 4I55F 4CT5A 2V58A 2IPOA 2PX3A 3TQSA 4ZDJA 2P6RA 4QLAA 3A9UA 4UFOA 2D1RA 2I6XA 4ZP1A 1XMIA 2ZSKA 4C7JA 4LNUA 1W4AA 5HK8A 3VVCA 4CMIA 1NWHA 4Q3NA 2PX5A 4BEWA 5LXTA 2DY0A 3M6AA 1I6KA 5TV2A 2CVHA 1DRUA 2OXTA 4BNXA 4TTJA 4F3CA 3OIWA 3RIGA 1OIVA 1K3TA 2VUUA 5FWXB 4GF5A 1YFKA 3JZIA 1BXRA 3LW7A 4U6QA 2RONA 4R71A 3PX7A 5C5DA 1XAJA 1U3TA 3DQPA 3ZNNA 1GYQA 1KI4A 1NNUA 4F8YA 3N7AA 5HZMA 4IYRA 1DIGA 3BE8A 4L51A 4ZRMA 3SYKA 1DJLA 3QF7A 1JMKC 1KZ4A 2YL2A 4UHBA 5C7YA 3CR8A 3PBKA 1KNXA 3DF7A 2QG4A 2P2ZA 3C4VA 1TQ8A 3BGDA 3N74A 4MKGA 4Z8YA 4EH1A 4QT4A 3AVXA 3LT0A 4W1SA 3GUYA 3H8VA 2CNWA 5CNJA 4G0UA 2OHOA 2YV2A 3UG7A 3B6IA 3ZIDA 1SCQA 4QDXA 2PXAA 2LDXA 3BWMA 1QXSA 1SUSA 3BL5A 2IYTA 1NT4A 2P65A 1CT9A 1UBCA 2QP9X 3K8ZA 4HHEA 1JQEA 2WUGA 3L02A 3LUAA 4FS3A 1MC5A 2TMDA 3AGQA 2WY2D 3DEYX 4WA8A 3ZS8A 3ZU5A 1IZYA 3BMCA 2ZW9A 3CSDA 5AVKA 3ZCXA 2FETA 3HK2A 4C0HA 2JEZA 4BMXA 2FJPA 4O4IF 4R8MA 2CMKA 2E5FA 1E99A 1KC1A 3F5SA 1WOYA 3HWRA 1RBQA 4YROA 3PQ5A 1U7HA 3W6OA 3IQXA 4OLAA 5K3FB 1N7IA 2IYLD 2TSYB 2ZSUA 1U8TA 2GNPA 1WCIB 2YVUA 3ED1A 3NCHA 3QYJA 1F5NA 2AKYA 3HGQA 5LBTA 3L7IA 4DQVA 2TS1A 1GQRA 1NXTA 4LZAA 2J8ZA 4HB2A 3FDXA 1QIIA 4U5XA 3SKVA 4BZWA 3GLIE 1RWKA 2I1QA 2HR1A 1KK2A 1ZD3A 2GK4A 2P5SA 3TVDA 1PW7A 2OBXA 4EITA 3UUWA 9ATCA 1QYVA 1DKOA 5A4MS 1ZGGA 4XLTA 5DEIA 4Z9BA 1XEXB 1D07A 1FPQA 4LCEA 1YU6A 2CY0A 4L8FA 4WA7A 4HEJA 5T4EA 1VHLA 3LC7O 3ZNOA 5BR8B 1V0JA 5CHYA 3DZGA 4G63A 4KAXA 4B6EA 4PO3X 4B4OA 1K98A 3JYHA 4OHXA 3VPFA 1RR6A 3LKVA 5EERA 3WADA 1VLQA 4GZ3A 1NSFA 2E4ZA 4IGEA 2AB0A 4PF1A 1FNSA 4KDEA 1XZFA 4GBJA 2FPMA 1P6UA 5T4BA 1ZN9A 2BZ1A 3TR6A 4EEKA 5IC6A 1M2WA 4G1VA 1VKHA 1MXHA 1G3RA 3CEPB 1NJFA 1X8LA 2FZGA 3PYMA 4WXMA 2QU8A 4UAJA 5FO0A 4DPLA 4MB0A 4DSOA 4KBYA 4E22A 4G0ZA 1TQ2A 4JA2A 4X45A 3LY7A 3NTVA 2PH1A 3W0LB 3GLFA 1N77A 2VKTA 3R0JA 2H1OA 1JEEA 3S40A 3HWX1 3DWEX 4XH9B 4Q7EA 3A6EA 1RWPA 4ZCSA 2DU8A 4ZI2A 4PLVA 2C31A 3ZOZA 3W3AA 3V3TA 1AHNA 3GMTA 4GOOD 4ND8A 1Z13A 3W7BA 4KFRA 5IAEA 2VRNA 2J0QA 4ER7A 2VZ9A 1ZRNA 1WCXA 3AFGA 3BE6A 2CXOA 4UUBA 5AW5A 1TRHA 1GN8A 1E63A 2QUHA 3C7TA 4PQFA 1AGNA 4G09A 4HL6A 1Q7EA 4UBMA 4X94A 2JZOA 1GA6A 2FQ1A 4LBYA 5KEIA 3P32A 3PNSA 2J0EA 3WAKA 4B82A 4U2GA 3Q3VA 1PR0A 5IXSA 5B7NA 3QI7A 1RLUA 3VOTA 5TEWA 5JSYA 4N0MA 4A16A 3LVRE 2BGMA 2AVDA 3KT8A 3ZY2A 3UMVA 5B7QA 2GA9A 2Y77A 4COKA 2WK1A 1F0YA 2VR1A 3A27A 4NIMA 4RF5A 2QX4A 3C3YA 4DUGD 3CX4A 4WHMA 5KOHA 3R7BA 3EMVA 3BHIA 4V3CA 2OZPA 3TB4A 2FWNA 4X7MA 3LS2A 4NV3A 1YS2X 2Y1KA 3LQ2A 3VX4A 3T7AA 2QRZA 3AV0B 3DDSA 4L0QA 5AYVA 3DBRB 3GZTB 2R1UA 4QLOA 3R0XA 4I50B 4IZHA 3EIOA 1CYEA 4E1VA 4UQLA 2JDID 5HUQA 1KOFA 5CCEA 3RYHA 1IM8A 1PJTA 1OFTA 3E9MA 4L16A 1E69A 1MH9A 4LOHA 4E46A 2B21A 1VJCA 3DM9B 5FPKA 1K1EA 2J3EA 1KVUA 3GEGA 1WXEA 2XQGA 2QGNA 3KYDB 4LYEA 2KLBA 2P9YA 4U2KA 3ZBQA 4LOAA 4E5UA 1UZMA 5IT0A 4OI4A 4ITRC 1HYGA 2V96A 4LMBA 3UYKA 3STYA 3D6HA 5ARBA 2G71A 2Q1XA 3NNNA 1NLZA 3DW1X 3FOBA 1XQ6A 3SHWA 3QVWA 1PKXA 4JYCA 5K4HA 2XJ4A 2PLRA 3ETHA 3CW9A 5HNKA 3GPLA 3ICVA 2K2WA 2GH1A 2O50A 3GEMA 3L77A 3T0GA 2H08A 1P2SA 5EIOA 1GQOA 2FE1A 1ZA2A 3B53X 1GZUA 1XMXA 3CWCA 3KG2A 2DWUA 3ASZA 3O3OB 2FXIA 3QEJA 4KQMA 3QVOA 3FY4A 4YQEA 4JIMA 1SC9A 3CUTA 3R4VA 3KOOA 1X3SA 5C4MA 4FJ1A 1RRFA 2BEWB 2BZ0A 3R2JA 4CF3A 2L17A 1KEZA 3JYOA 3KEQA 1GUFA 2FOIA 2C4NA 3WRXA 4LBVA 1BW9A 4JQOA 4KMSA 5HE9A 4YJ3F 4MPDA 2AH5A 1BYIA 2AOVA 2JH3A 3AYXB 3OAAD 2J5QA 3SBDA 4BMOB 5BRJA 4M1EA 3GP8A 3UWSA 3GWGA 1QGUA 4BO4A 1DCKA 2RHGB 2ZCVA 3FFTA 4E15A 3QKSA 4ZI3A 4ZQHA 3K7EA 3ITDA 2WAOA 4D2IA 1IUNA 3F67A 1DQZA 2ON6A 1NX9A 2ZRMA 5E4JA 3CRZA 1B6RA 2HMTA 4LK2A 1IOWA 2YFYA 3W5CA 1F2UB 2H11A 4ZEWA 4RDXA 4DDVA 1C5KA 2C83A 5AVXA 1QRUA 3A9RA 4I9GA 4BKRA 5EIBD 3DE1X 2X6RA 3AKEA 3C6KA 3ZQ4A 4M99A 3I52A 4ND4A 4C29A 4F9TA 3KTDA 2ZRFA 1ATIA 3OIDA 2QNRA 1EX1A 4PWYA 3TOSA 2DT5A 1B15A 4DPKA 1Q50A 4K87A 3VNQA 1LSOA 4EY6A 4PRKA 4CR6A 3E9CA 3LBYA 6ADHA 1YDWA 3BF7A 1JHYA 4N41A 5TPWB 3DE4X 5CD1A 3DTYA 1UAYA 1RVDA 4I1IA 4OXXA 4GVLA 2QTMA 3PGXA 2HK8A 2FVYA 3C5WP 2D59A 3L7DA 2C1XA 3QF4A 1TYEB 4MA4A 2V6GA 4NDZA 1I7SB 3VJMA 4DRYA 1X14A 4H6VA 4NYIR 2XGSA 3S2ZA 1TVEA 3DOJA 3FBGA 5DVZA 2PGAA 2Z08A 4ZQGA 4FGKA 1NF3A 4M1TA 9ABPA 3DD1A 5F1PA 2H1RA 4M0MA 4RELA 4MI1A 1XAIA 1LDGA 3UHOA 2LNDA 3IIIA 4FU0A 4BN0A 2Y1GA 3CGWA 1ENPA 1JIVA 1L1QA 2ZSFA 4P7KA 5GAJA 2RHBA 3UHAA 1G8SA 4XX0B 3HN6A 1E7MA 3WGJA 4R8VA 4FEEA 4P0TA 1R12A 2O7SA 3FOZA 5AOVA 4HMOA 4Y9UA 4EA6A 4E70A 2EF1A 2EGUA 1H69A 5HILA 3EXG2 4HWKA 1CRZA 3ETNA 2VUHB 5IUKC 3KX2A 1NW3A 2GEDA 3CG4A 5AW0A 1P3JA 4TRJA 3HCPA 4CLRA 3IOMA 1EVYA 3ZKAA 1NV8A 3T7SA 2GHQA 3AY6A 1KQPA 4NMHA 1H05A 2ILVA 4DF3A 1MOQA 4M1SA 4XGRA 4ZEMA 1C0PA 4IX1A 5LMZA 1WF3A 4WKNA 5F7ZA 3T7JA 4G85A 1UAAA 1XGKA 5K0EA 4UKDA 3V7FA 1RBMA 1XZDA 2XMDA 5BW4A 1JEYB 1JR3A 2PVPA 3PJDA 1Z6GA 3SM9A 2DPGA 3GGCA 4A36A 2R62A 2VHUA 2X9GA 4FDLA 1WUHS 2XA9A 4V02A 2WV9A 3NWEA 4NFYA 1AO3A 4R6XA 1GD1O 3VH4A 1GR0A 5YASA 3WKAA 4GLLA 1WXXA 1YJ8A 1E0KA 3ZWYA 2XMCA 3MB8A 3UXEA 1HE1C 4TV8A 4XDZA 3AT1A 1X1CA 2OZEA 5ENZA 3EZNA 1E6LA 2Z30A 2PNFA 3OZGA 3MJVA 1JTFA 3LXUX 4RX1A 3GJ4A 2QTAA 3JQBC 2ZBGA 4TRMA 4BN5A 4JGBA 4HWOA 4OATA 4CFSA 3WYNA 3D6MA 1WUJS 3ZWNA 1G3IA 4G0VA 2W6ID 2A9VA 2JVJA 2WE7A 2Q3JA 3AHFA 3H5IA 4ROSA 5K8TA 1DVRA 4GDFA 3ZZ1A 3KR0A 4LW8A 5DGIA 1G20E 1E1YA 5IEBA 4UM5A 4ZOEA 4NE2A 3TJMA 2HI0A 3BCUA 1LTHR 3NVMB 4UREA 3KJZA 1FQWA 3PX3A 3H1PA 3JRXA 2X1HA 4BP8A 3QPCA 3QIVA 3I2GA 2PUGA 2IEGA 4X24A 1WY7A 1O4WA 3TZ6A 1T8YA 1QS0A 5AM4A 2XCRB 2C03A 4AMYA 1OMOA 3ESYA 2FMXA 3DXFA 1B73A 2OVBA 3WYDA 2Q2VA 5FBVB 2RHLA 4WBNB 1L5SA 3PC8A 1EUQA 3K9CA 4Z0HO 3ZUPA 4PX5A 4BV2A 5F4BA 2R7MA 4Z3KA 4YMIA 4LSGA 2PBZA 2X4DA 3UC9A 1PE0A 1TUBA 4G01B 3GIDA 4URUR 2I6UA 1DIBA 2QY6A 1PFVA 2YZGA 3KOUA 5DYNA 3CB4A 4X6UA 4G6ZA 1IHXA 2IT1A 4FCVA 4J7AA 4LRUA 3OBBA 2RAVA 5D3ZA 5EZYF 2NZVG 5LQSA 3H13A 1P91A 5DWQA 1JFLA 3IAS1 1I80A 3NYIA 1NV9A 4HSGA 1W93A 3SM3A 3ORFA 4DR2B 1JPVA 1GNLA 5HE8A 3U2QA 2CLKB 4BX3A 1PBTA 1T3SA 3QVTA 1A5ZA 2H63A 1J90A 3FUUA 1GKLA 5ALYA 2XNSA 4N7JA 3GLIA 4Z3DA 4I66A 4ZVNA 1ZP6A 1I3NA 1UKCA 2VH2A 3PSAA 5HJ5A 3QFTA 2BSAA 3V4RA 2EJBA 1B14A 3M1LA 1YJCA 3DTNA 1QYCA 4LCBA 5ESXA 3SKYA 4HWPA 5KMGB 4JC0A 6GPBA 2R48A 1QJ4A 1WW2A 3QENA 4HKTA 1RU3A 4PPGA 5BQ5A 3ZY5A 4C03A 4HRVA 2QUJA 2D1YA 3ZTTA 2K2QB 3AWIA 3I53A 3R8CA 2Z6QA 3LQFA 2ZPUA 4MH0R 2I33A 3VGJA 2X8JB 4Q7KA 3UH1A 1ZA1A 5L3QB 1FFWA 3G6WA 3LX6A 2WYIA 3M6WA 4ZV9A 4BFVA 1JI3A 1NQXA 5HQTA 5M5BA 4MARA 3PS9A 3G2PA 4I0WB 4MW0A 4O2RA 4Y18A 3TMYA 3F7TA 1BEUB 1RI1A 1ZCAA 1V25A 2ZIEA 1EA5A 1L5FA 2B8WA 4LPKA 1CUSA 4LBWA 4AECA 2GYWA 1NRXA 3KLMX 3MWDB 1KZHA 1JQ5A 4CCYB 4LV6A 2ZJOA 3PYXA 1KMCA 3BXZA 1TK3A 3FIUA 3PFIA 4OOEA 4EB8A 5JXIA 2NO7A 1GUZA 5F5XA 4R40A 1AKVA 3BTSA 4ZEOA 4BNJA 3S2FA 1M34A 1DG9A 1V7PC 3PGA1 1D1QA 4RGBA 3VAZA 1XTRA 4RDCA 2DULA 1A1VA 3QPBA 4MNTA 4AIIA 1T10A 1Z2DA 4QU5A 1IOZA 3VPXA 2WVAA 3FCYA 1E3QA 2WKPA 1DAOA 1EP3B 1RJ9B 1O9GA 4X54A 5LB4A 2WHQA 3IPYA 4EEXA 1XEWX 4RY9A 1Q1QA 2BGLA 4FNOA 3W5HA 2D5AA 2W4MA 3MJCA 3AR4A 3D4BA 3OY7A 1L7NA 3GPDG 3GJ6A 3R09A 1NURA 2A5FA 1P7PA 1X7YB 3T61A 1HTWA 3TXYA 5IC5A 5CB6A 1QMPA 3LUGA 2PBRA 1AV7A 2VP9A 4KYUA 4RIGA 4F4FA 4EO4A 3ZZNA 3FMPB 4FHZA 2G6TA 1RHQA 2CFTA 4PZEA 1EFHA 1JHQA 3TCXB 5A02A 3ZV7A 4XA8A 1I4EB 1C29B 3AVPA 2FR8A 4TSFA 5A4AA 3UMFA 4ACBA 3V8BA 3W4JA 1JBKA 2QRJA 4BLPA 3RGGA 1QF9A 4E1AA 3H2BA 3B1KA 3O8QB 3BWCA 3SHFA 5IK2D 3BDIA 5KCZA 3AL2A 1VLZA 4FDUA 4OL9A 3ELUA 2IOQA 3C1AA 1E18A 1ACMA 1KY3A 3NHZA 1NDQA 4ILEA 1M2KA 3AF2A 2FRDC 4RANA 2JGDB 3SC2A 2H1FA 1D1SA 2RCNA 1YMQA 3IVCA 3I8XA 2MMCA 2XD9A 1F0NA 3CZ4A 4FILA 2AWOA 4RV9A 4PO1A 1O0CA 2QTCA 2BLLA 5H3LA 2PQ6A 1EWRA 4Q39A 4F5DA 4ZJYA 3L0DA 1VLMA 2G7ZA 2FSIA 2JFPA 1J24A 1UBEA 2AC2A 3R5TA 3FCEA 3GNSA 3ED5A 4LVUA 3HG7A 3R3HA 4LI3X 5IANA 1YJQA 3GEEA 1ZG3A 2PUHA 3DT8A 1I9GA 3H9EO 3M1IA 1G6KA 2FJUA 4R84A 4WMLA 4EUKA 1FJ2A 2FPPB 4IIYA 5CVEA 1P1BA 1I7NA 3BHJA 4NBSA 1GZ5A 4I5GA 4LN1A 2V1UA 1D7AA 3A6GA 4ACAA 1OUMA 3RVKA 2VEDA 1J6UA 2ZSDA 4KH1A 3EE6A 4PCLA 2IX3A 4EA8A 3KQNA 2PLAA 1RHUA 2IL1A 3T3IA 2QPTA 3V8RA 3L82B 4B7XA 4BWVA 2VF4X 3JRWA 2BF4A 4HX9A 5TE9A 5B6JA 4W7IA 3WK9A 5FR2A 4GX0A 4DIEA 2QG6A 3NYQA 1X7ZB 2B25A 5EMMA 1FBTA 5C37A 1E9FA 4FW9A 4YJ3B 1HYBA 1CS0B 1FLAA 2KJQA 5FOQA 3ZHQA 2QLBA 4QNRA 3QW4B 3HJTA 4ZWNA 3B1ZA 2BKUA 3REFA 1YK1A 1Z8NA 2PSEA 5HKKA 2GLXA 1G4UR 2ZBDA 1OLOA 1IZ8A 1TZMA 3ESAA 3PNVA 1U2TA 4AX4A 1U28A 3L8YA 1V11A 2DFNA 1FRVA 4KDCA 5E4YA 4BKPA 5BYKA 2A33A 2AX4A 2GJAA 1DAEA 4GUDA 4PX9A 1XA4A 1ILEA 5BMVF 3O2JA 2YHSA 5I9MA 1T1JA 2CVQA 3AZQA 3IVMA 1XYVA 1KRHA 4IIUA 5HCNA 4DLRA 5A5FA 5JCZA 3C3WA 2BEVA 3T41A 4PC6A 3HPQA 2YVLA 5BNZA 4CDNA 1G3UA 3KJFA 1QP4A 4Q7LA 3PFGA 2G70A 1COZA 3WLIA 5E2BA 3EEOA 3NV7A 3Q3HA 2DHDA 1I1NA 1HFWA 4DDWA 4KREA 1MLDA 3MMXA 1GTL1 3IGFA 5J63A 2RHMA 5AVJA 3VR0A 3GLHE 5BNTA 3PE3A 2JIZA 3IKVA 1L8XA 4MVJG 4FWIB 2ZUFA 4HH1A 1EM8A 3ABZA 4EVQA 3MJ4A 1XD9A 1QO7A 2PV7A 3QZUA 3N87A 2EKPA 1YFZA 2IIVA 1R64A 1BE1A 4GGOA 3NCTA 4BNWA 2B9EA 1URPA 5FWXA 3G2IA 2CKDA 5E1OA 1NATA 5A2GA 4UDYX 1BYUA 1E6EA 4N12A 2CYCA 1AA9A 1JZTA 3ESRA 5E3IA 1IPFA 4BRWA 5KI6A 3FFWA 1JIJA 2BSQA 5E7MA 1RQNA 1JDTA 2QS9A 4BVHA 2CW5A 1KAQA 3ON5A 4UTXA 3UOGA 4A8JC 4ARVA 3IA2A 4YK7A 5I7FA 1Z5VA 1VG8A 2NXNA 3GEHA 1JP7A 2WJVA 2YFKA 2BKEA 4PIVA 4A10A 9MHTA 3EZLA 3OO0A 3QUSA 1WETA 2WYHA 1GZVA 1UBSB 4CIYA 4C4TA 4RM3A 3EGIA 4TRRA 4UC0A 2VSNA 4BLRA 5EJ5A 1CUZA 2OV2A 1HE3A 1NT2A 4TLMB 2FUEA 1FDTA 4AZSA 3D7LA 1GCGA 3CMCO 2GPJA 1RACA 4C3ZA 3DOIA 3HCAA 5DULA 3LIPA 3MTGA 4UTOA 3UCFA 2E55A 1QZXA 3REQB 5JQGB 4H0NA 2I2AA 3CS3A 2R00A 3ZEAA 1PZFA 2GI4A 2W00A 4XWYA 1L5VA 4X44A 2O1EA 1ZUD1 3MGBA 5FR1A 3SCZA 4EIWA 3PFBA 2C8LA 1TYZA 4A92A 3IXMA 1KBZA 3G6KA 4LDZA 3BEOA 1XZGA 3HMQA 9GPBA 5KYYA 1NC1A 3F7NA 4FHGA 1XDGA 4HQRA 5FIUA 1P1FA 2OFFA 1KZ9A 1E6KA 4OSOA 1ARZA 5HFNA 5C4IA 3KDAA 2A58A 1EFRD 1WV0A 3V33A 1TTTA 4JLNA 4TKMA 2IUSA 1YDFA 4JXXA 3JR3A 1MA0A 3NH6A 1CIPA 1HQKA 4MS4A 4RPHA 3WWDA 5K0CA 2QVGA 2II6A 3OWXA 4PQYA 4DSTA 3L7JA 5AI0A 4CL0A 1Z16A 2HA4A 3Q10A 4J0HA 4TL6A 2D2EA 4U9IS 3IRVA 1GADO 3E35A 1C3JA 1GCAA 1QTQA 5EHGA 5ALQA 5SZHB 4JBLA 4HQFA 2G9RA 1KYXA 3IIEA 3F5QA 4M2LA 2P1ZA 3PUKA 2CXQA 4P22A 1F1BA 1NP3A 1V1MA 5HW0A 3C16C 3HDJA 1CEXA 1Z4QA 4A4DA 1NMXA 4G5YA 5TGZA 4QU8A 1Z15A 1FOEB 2WF9A 4M89A 3Q8WA 3V1LA 1OFIA 1UXIA 2G04A 2C7BA 2QUAA 2XGGA 3FOFC 3R74A 2JD2A 3RS3A 1VIVA 4G3XA 2ONZA 2D3WA 2WPDA 3L7BA 3UCEA 2UZ1A 3ISJA 1P1HA 4N5DA 3UJPA 4Z6KA 2FKNA 3LV8A 1JQKA 2ZIGA 3RSFA 2Z98A 3HNRA 3ROPA 4JSRA 4JDUA 1J8FA 5JE8A 4ZZ1A 4INAA 5KUTA 2Q5EA 3EPJA 4E32A 2HQBA 3GMDA 2Q0HA 2FFQA 1Y81A 1N5DA 2ZOSA 3K92A 4FDVA 5CNIA 4ZQEA 1PWYE 3EOZA 5HCUA 4HNRA 2WP8J 4UU7A 4Y7DA 3LTNC 1N3YA 3AEUB 2EC5A 3HCNA 4RLFA 1ZZEA 2B83A 1UZAA 1JKFA 1HYHA 4O2AF 3QVSA 3F73A 2X0RA 3ELBA 4OXQA 4E12A 5JVDF 3PKZA 1X39A 1XL0A 5LLSA 4RLQA 3DHYA 2G28A 1AXRA 1SBHA 3Q5DA 2VDVE 1GEGA 2VJBA 2QRVA 5LSAA 1EUYA 3B51X 5DO9A 3O4RA 2IF2A 5FTWA 3FMOB 4YJHB 4N7RA 2NADA 1GGJA 2YWJA 3KWFA 5DCYA 4GOJA 4YO8A 4PAOA 2PZ8A 3NBYC 5JZVA 1N6RA 2NO0A 3FZNA 3WMWA 5EMNA 5ABPA 1UOPA 2BSXA 1H65A 4BMSA 1RAFA 3A0RB 1EFVA 2XMSA 3K8OE 3K2IA 1PZNA 1GOTA 1UDRA 3FN4A 4WY5A 2XF2A 4KK4A 5ILQA 2TECE 3RS9A 1O8CA 5D3QA 4YTEA 1AUVA 4HADA 3NHYA 3DJYA 4KQWA 1U8CB 5AO9A 4B2IA 2A0KA 3EK2A 4LHXA 1NUUA 2QUZA 3PSHA 4Z4HA 4YMHA 4D4HA 5G02A 4HZUB 3LPCA 3R5JA 4MQUA 1N2CA 3C14C 1JDBB 2GERA 1ZOSA 5LQUA 2W4QA 3R8XA 4G5RA 1UMDB 5EZYA 2K6GA 2WWTA 1TC1A 4RH1A 1UXOA 5JCJA 5GM2A 3QUCA 2H4HA 3MWDA 4EUFA 1D09A 1ONSA 1N2XA 1GTZA 1X13A 2JCSA 4O2BF 2GD1O 1WB4A 2WNIA 3IS3A 3L6CA 5FDFA 3QTTA 4RYDA 2CE7A 4FCCA 1ZKDA 3M0EA 3HE3A 1U80A 4ZN6A 4XX0A 3AR7A 1I3OA 5H7XA 3UAZA 3X2SA 3UAWA 2BGWA 1MUUA 2Q4BA 2FRVA 1Q7BA 1Z56C 1DC3A 2IUEA 4UZSA 1JT2A 3TOXA 5F5LA 1G16A 3HSYA 2P11A 2I6QA 4MDFA 1G64A 3P20A 4WGFA 4DREA 2V4ZA 3LGAA 1G3QA 4TTRA 1EQ2A 3F6BX 3NGLA 3F8TA 1RM3A 4C4XA 5GVRA 4K46A 1Z35A 1UM9A 1DBPA 1T24A 2BFEA 2UZAA 1R4ZA 3QM1A 3QQPA 4JR2A 3OQIA 3RAPR 5ADHA 3FSJX 4Y6QA 4BVJA 1CZKA 4AW9A 4UNSA 4C6TB 3RLIA 1PSWA 6REQA 2MHCA 2ZYRA 1ZJZA 4NTZA 3UAYA 2I55A 3F6YA 1JQJC 2ZI4A 3DLBA 4LOKA 2PKXA 2PMCA 3I6YA 3OHMA 4PAMA 3V4ZA 3ZY6A 4N82A 2AGVA 5ADVA 3P71T 3KAKA 4GZ5A 4JVOA 4G9BA 3ZHOA 5I7OA 5K8UA 5KJ6A 5IWAB 4CI9A 2FLWA 5H9WA 1YQWA 3HM9A 4U3JA 4UM8B 1BX0A 1U1EA 3A14A 5LC1A 2GR9A 3GLUA 4ML3A 3HXMA 2C4UA 1HNNA 3VAYA 2GZAA 4TV8F 1NFQA 1ZIOA 2C1EA 2DBVO 4HLUC 3M49A 4GSYA 4KNWA 3CLSC 1JJVA 4OLBA 5IDYA 3RSOA 2KLHA 3ROXA 4GPEA 5EHZA 2C5EA 4MRSA 1VSBA 1WG8A 4DZRA 5LXTF 2VPXA 4NJOA 3X1DA 2FWAA 2COEA 2REQA 1LK0A 1SVKA 2IITA 1O96B 4F38A 1HQCA 1E4YA 1SKUA 2O23A 2NSYA 4J0FA 4PLCA 1PL7A 2CK3A 1XMJA 3Q3CA 5EKSA 2CDNA 2QN7A 2GKGA 3UV7A 3P5SA 3TX2A 4RJLA 4DDUA 2HLPA 3CY6A 1MTZA 3LY8A 4FLMA 4XFKA 4LCJA 4GM0A 3L79A 2ZBVA 4HQNA 3UK0A 2BUBA 1H1DA 3DV2A 1CUYA 2E1PA 1MW9X 3VC3A 2WHXA 2DKFA 2O2YA 4OEHA 1J2EA 1T0PA 3UBMA 2PBFA 4LYYA 3FHOA 4ZCIA 2OR3A 1ZOLA 2D7JA 3OCJA 2RCYA 2IHNA 4B3RB 2MYNA 2I4MA 4JITA 1DXYA 5LOVA 3KPUA 1F8FA 1P7ZA 1F2TA 2QLLA 3IPRA 1OYVA 2HWWA 4A15A 2KQUA 1U1FA 1XLWA 2NV0A 4H60A 4O4JB 1EUCA 2F62A 5K3SA 3GFTA 4OIMA 3W2GA 3WLQA 1U3FA 1EWVA 1L4EA 1UC4B 2D4AA 3H1GA 2ZIXA 3GZ4A 1SQGA 2HHJA 3IEXA 1GRQA 3RJMA 4XYGA 3ZLUA 3H2KA 2OHGA 2R87A 1JE1A 5A4FS 1OBHA 1E32A 5DASA 3RKRA 3FOCA 3W79A 2BJVA 2VWGA 4A6DA 1GQQA 2Z4RA 4EHFA 3QTLA 5JDIC 5LFAA 2HZ7A 1RE0A 3LVQE 1ONPA 1Z3CA 3MWKA 1U6IA 1WZEA 1ZM3A 3LM8A 4Q1CA 1YBMA 2PUTA 1SMKA 2ZWVA 5D3KA 3T3GA 1N3IA 1NQ5A 1QRDA 1R8JA 4UNQA 4HR7A 1PJ8A 3G49A 1Q19A 1EA7A 3ENWA 2ODBA 4K6MA 3DB1A 3W77A 3IP1A 1N78A 3Q3EA 2UXCB 4JJKA 3IJEB 2PLNA 4LYAA 1ZRSA 2QUBA 1GGHA 1Z6XA 2JA1A 2H4YA 3DEIA 2HNBA 2HREA 3KUCA 1ZITA 1VI6A 2PKEA 2IXBA 2VTVA 3KV3O 3VVMA 2ZAGA 4N54A 1BWSA 4CFZA 5A9TA 4LJSA 4L74A 3U56A 3NBQA 3IULA 3AF0A 3MPUA 3M5CA 4BGDA 5K6RA 1UT6A 4A1FA 4NXMB 1K97A 4PGAA 3WFJA 2WAYA 3P0IA 4CUJA 4PM4A 3MRXA 3NHSA 4L5CA 4KXNA 5MFPA 1ULSA 2R79A 4J90A 3BA1A 4ZVMA 5DE3A 4MZDA 4WINA 1OX4A 4DKXA 3NEYA 1J39A 1A9XA 1OH8A 1BDMA 1MB2A 1RCUA 3P26A 3GG2A 3EIEA 3OTHA 5AW9A 3RIYA 3UJ3X 1BMQA 3MQFA 1Z06A 2FSFA 2G9NA 3HCBA 3CZQA 1P5ZB 1QANA 3H8WA 4G23A 5IF9A 4RA6A 4OBEA 3N8KA 3GGGA 2FW1A 1I2ZA 4L28A 4TS4A 5B1YA 1BX1A 4YB8A 4ZXFA 2OENG 4AJ1A 3KZXA 2WF7A 2YFQA 2WHEA 1Z2NX 2R751 3H9JA 5L4NA 1XZQA 1SKAA 1JFSA 3PGJA 3NTOA 4JZKA 4QGSA 2VG8A 2E2WA 4BO0A 1IATA 3RVLA 2R8OA 4EW2A 4FSXA 2C7PA 1UODA 3PDIB 4A3SA 4I9FA 4UAUA 1AHIA 4C4RA 3HABA 4L0DA 3O4IA 4F1JA 1HUQA 2XDWA 1KMIY 2F9MA 3FTPA 4HLCA 4OPMA 1XNGA 1FNDA 2G4LA 4ZGBA 2Q4OA 3CF4A 1XEFA 3COWA 3OTIA 2QXYA 3N86A 3P0EA 4QNMA 1ISRA 4P5EA 5CITA 4R7ZA 1JAIA 3GA7A 4AQDA 2FUG1 1DV1A 3QV1A 1AQJA 4ZOAA 3B13B 4PSDA 1TNDA 3SC6A 4IHAA 4HDMA 4OXRA 3ZJYA 3KL2A 4PQRA 1XTJA 2G17A 2GEUA 3EZXA 3RABA 1XHFA 2RAFA 3L0YA 1K7EB 1WMDA 1M10A 2ERXA 7ADHA 4I1YA 5IZ4A 2NUAA 2PH5A 5JIBA 1RQPA 5M34A 3OQOA 4R3WA 3KUDA 2VUIB 4MJXA 1ML3A 1SHKA 2EZTA 2QSYA 1QYDA 2WV7A 3MILA 5JAMA 1PGQA 3CHYA 4RWEA 4MUKA 1FVFA 3QY0A 1CQZA 4TMZA 3UO8B 3H84A 3IEIA 4JC4A 2NO1A 2OCIA 3ETGA 5J58A 3HR4A 3TW4A 4YUXA 5KNCH 3ER8A 3BORA 5HF5A 1M1YA 4GSLA 3PHJA 1NLMA 3DDUA 3ODGA 3T9AA 4Z1OA 1ISFA 3ILSA 1Z47A 3QXGA 4UOZA 2QW0X 3BREA 4ZYWA 5F64A 3O2SB 3UJ9A 4Z9AA 1WPGA 4DIMA 5F23A 4PR0A 5BWCA 5LIRA 1RYBA 3AC0A 4Q03A 3HJFA 3CNEA 4O4HF 1ZNYA 3GK3A 3RT7A 2W98A 4N3AA 4OKNA 2F43B 2ADOA 2JK1A 2O48X 3WSVA 4AUEA 4Q3KA 1ZI6A 4KQXA 3VHXA 5DXJA 4CV1A 3AESA 4EY5A 3NIFB 3IPCA 5L7TA 2R8YA 4OP3A 1B3RA 2JHFA 1TF5A 2DFTA 1QC5B 4XCXA 4BU0A 1AS2A 4II3A 4Y2YA 4F3KA 1WDKA 2H07A 2CJWB 4G8CA 5EZ6B 4Q02A 3OFND 5CK4A 2PWAA 4OHRA 2ZJ1A 3I4FA 4RVDA 2Q5JA 4EHHA 3ZYCA 1KKMA 5JUWA 1SRQA 4C30A 5H4HA 1LU9A 4K6HA 3W1WA 3VR6H 5C1DA 3KQHA 4UHFA 1I1OA 3CN9A 4PONA 4G4SP 4R2WA 3TLYA 4EGSA 1M6YA 4EG3A 1N2IA 4B85A 3P9KA 2W2TA 5JADA 2E4YA 4OM8A 4BVAA 1BMTA 2OB1A 3L84A 4POAA 4WN9B 2VPZA 2QD2A 4K6OA 4PN7A 4HPXB 3H04A 1IWPB 2Z83A 4RKEA 4CHGA 5KAMA 1SXJD 3NQ41 1T8SA 1QE5A 4G36A 4XDYA 3RTGA 3K31A 3CJQA 4I1PA 1EDEA 4RL6A 4AUMA 1ECJA 3EBLA 1YQGA 2QE6A 1CBUA 4TUYF 3T35A 2V6FA 1BVHA 2GTHA 1JJBA 2C97A 3JX9A 3FNFA 4M87A 4KPEC 4TZ6A 5A3RA 2A88A 4YP0A 1BXRB 4QRHA 2YZMA 3HCRA 4JSTA 1Z28A 1F48A 1JXOA 4XSVA 3B9PA 4M38A 4R98A 1V5WA 3DOFA 3F0TA 1EKXA 2QTVB 1H0HA 5I9IA 4DDTA 3AJDA 3BICA 3M4NA 4JXKA 3PFHA 1XU4A 4J43A 5DBHX 1T25A 1NMQA 1Y80A 2B61A 3TQCA 2FSHA 4MO9A 2LRHA 4BO5A 4P4TA 3A9VA 5DM70 4MVJM 1UKAA 1G5RA 3E1KA 1Y34E 3P2KA 4FI3F 4FOLA 4UU8A 2X0EA 1SIOA 3UJBA 3GMSA 5FOVA 4Z49A 3WGHA 4EUNA 5IXYA 2Y66A 4MMYB 1CHNA 2YVKA 4YJ2B 5JCOA 2AF4C 3EHDA 3J80A 4DLVA 1I36A 3MJTA 3WKBA 2UZ3A 2FX3A 4C5CA 3D8UA 5C0OE 4HDNA 2GKSA 1E89A 1C9NA 1BJTA 1S3SA 3PPWA 4YI5A 4OI1A 1T2CA 2Y6UA 3SEFA 2RGNA 3PNQA 4OHVA 4AL4A 5CDGA 4BNDB 1SHJA 4O2AB 3FVVA 2BFDA 3B1JA 3C15C 4URFA 4WOPA 2YN0A 4XFJA 3O4HA 1M74A 2BCJQ 2HRZA 1ORHA 2G5TA 1NP7A 1K7SN 3FM9A 1Z6AA 1XVAA 1KEPA 3SSAA 3T06B 4R2HA 5LZ8A 2GEKA 2OXIA 3RNOA 4B3JA 1P4AA 2AEMA 2EG5A 3H5VA 4HS9A 4E21A 1DX9A 2E0IA 2ZI5A 4JLVA 2LIPA 4A9AA 3G1TA 4BAGA 5KWIA 1D1TA 2E7ZA 2VNAA 3DCYA 1NQWA 2BFNA 5IYZF 1OLUB 3IXQA 4J0IA 2ZVJA 2VFAA 1CXZA 1EK6A 2YY5A 3A28A 3L6EA 1PJ2A 3TQHA 3CO0S 2FB9A 3QFHA 2HCJB 3BMOB 4EGCB 1CUXA 2HBZA 1DE0A 1S2LA 2BGJA 2HF9A 2XDQB 4H7IA 3T0FA 4B5KA 5BORA 1JVNA 1KYVA 3WDMA 3NXSA 3KSRA 2QLNA 5TC4A 1VRVA 1RPNA 3OKPA 3UW1A 5DSZA 3WNDA 1SA0B 4AYWA 1E79D 2AD1A 1SD5A 2CFRA 3RTDA 1G66A 1M1YB 2W2OA 4BNYA 5JY1A 4Z4IA 3Q72A 5CNKA 5FUWA 4KXXA 2QENA 2WHPB 3SJBA 2GD6A 2JLAA 4QVKA 3D1VA 2R44A 1AN9A 2EYUA 1JKJA 5BV8A 1BCSA 1SBCA 1VYTA 1K6XA 1LJLA 2H9IA 3SI7A 4MR8A 4AULA 2VATA 3A9SA 2ECKA 2VQDA 3HKDB 3R7LA 4LI0A 4B31A 5KJFA 3ESCA 2ORVA 2ZDHA 1YA6A 5HA5A 3DT6A 2NUAB 3KVNA 1NXPA 1UKEA 4IO1A 3QQ5A 1GFWA 1KTVA 1J8VA 3E03A 4RXTA 3RLFA 4B7UA 3ZJVA 2WF5A 3FFXA 4EMUA 3AFMA 2OO5C 5CFPA 2QTHA 3UC5A 4IIEA 1B3BA 1C1YA 3H7AA 1VMDA 4C20A 2RH8A 3L1IA 2GCPA 2KPOA 3GJ7A 4MUHA 2SICE 5D51S 3RIXA 3WO1A 4GZMA 3RC8A 1ZD4A 3WDSA 1FYFA 1VCMA 3BQMB 5B1IA 4BFYA 1QYRA 1W0KD 3GLSA 4Z5XA 3W2FA 4AK9A 4DB2A 1ZMRA 1WDTA 1A7AA 3ZX4A 4Q21A 1UFVA 1FIUA 3HR7A 5AUNB 4HY3A 5BT9A 2P4SA 4V0RA 1E1NA 1GKYA 1OLXB 2M1XA 4JA0A 1WX1A 4QYWA 4AXBA 2C84A 1VB3A 4L5YA 1SBZA 2GKOA 2WLSA 5IX8A 3RSHA 5HG0A 5FBRB 2PN1A 3A8TA 2W58A 7REQB 1R9GA 3QEMA 1RCTE 1B93A 4U2FA 3E27A 4H1WA 4DV7B 5T8KA 1RFGE 2P9QA 4DJEC 1XT6A 3CMMA 1IN6A 2PSHA 1C1DB 2Q3MA 1GZHB 1TM3E 1UH5A 1B0ZA 3AZOA 4AJLA 5A62A 4W5WA 3HEAA 3WL6A 1KKUA 1NPTO 1H3NA 3TJRA 2JGLA 1CZOA 5CAEA 1SG9A 4OBWA 3OJXA 2QF7A 4NONA 5JS2A 2VVTA 1Y9JA 2XUGA 3OKCA 2W2KA 1PBNA 4TXJA 3AL3A 4R6WA 3IQHX 2X2OA 4Q4CA 4E6EA 3VHLB 4ZVVA 3C4QA 2FTKE 3CCBA 3W9BA 3WJ1A 1CUBA 3KFXA 4AJ9A 4CR8A 3LJKA 4QDJA 3MSCA 2PCLA 5CPFA 2FMUA 3H83A 3MCTA 1AKYA 5ARDA 3N28A 3STXA 2ESRA 3I61A 1U2DA 2WTMA 3A05A 4K0RA 4RESA 4WLUA 4CN8A 4Z7NB 1D5CA 1HBJA 1L4NA 3E5NA 3PLRA 4FZ5A 3EXHA 4EUEA 5F73A 4DR3B 2I03A 1V8OA 2VSXA 4XTRA 1JYEA 1EFPB 2UYGA 1PTKA 1X1BA 1NXXA 2YINC 3LVBA 1P0FA 2QLTA 4BASA 4F7WA 2ZZMA 3VKHA 2Z57A 3VR4D 4Y6GB 4NYJQ 1RQ2A 2CC2A 2Y0BA 4DGQA 1MZVA 2B8TA 2FZ5A 1GAJA 1CFJA 1VSVA 2KMLA 2Q28A 3QJYA 2WKQA 4KACA 2W83A 3UHFA 3CUEF 4IXDA 1P4JA 4E7PA 1ZK3A 1FFDA 2ZBFA 1UZNA 1NYRA 2OCXA 1JHZA 4YPFA 3Q8KA 3A10A 4ZAZA 5JS8A 1Q14A 1MCZA 2HWXA 4JEMA 3C3XA 4ZT6A 3W1EA 1QH1B 1V6CA 1JSXA 4EJ2A 2V3VA 3PDHA 1NI4B 4GZ6A 1KRWA 5C52B 4ZC1A 4I6JA 2O8EA 1YRHA 4M7WA 3HCOA