1SPBS

Subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
264
structure length
264
Chain Sequence
SVPYGVSQIKAPALHSQGYTGSNVKVAVINSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIVSTLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN' PROSEGMENT
publication title The prosegment-subtilisin BPN' complex: crystal structure of a specific 'foldase'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Complex (serine proteinase/prosegment)
total genus 89
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1spbS00
2W2PA 2PYZA 1YJCA 2P4EA 1EGQA 5AQEA 1P8JA 2PKCA 1GTJ1 2Z57A 1ST3A 1WSDA 3LPDA 3Q40A 3DE5X 1CNMA 1GTL1 1LW6E 3LPCA 3HJRA 5SICE 2ST1A 3UNXA 2SICE 1R64A 1SCAA 1NDUA 2Z2XA 4HX2A 1GCIA 5ARDA 1Y48E 5K7SA 3DE2X 4Z2AA 4MZDA 4KB5A 1TM5E 1A2QA 1BE6A 3PRKE 2ID4A 3SICE 3GCWA 1SCBA 2ID8A 1DUIA 4CFZA 1SUCA 3LPAA 2PRKA 1PEKE 2ZRQA 3A3PA 1XF1A 3Q5GA 3F7OA 1TM1E 3DWEX 4C3VA 1ST2A 1JEAA 1WMEA 3QFHA 1R6VA 1SIBE 3DE6X 5JMOA 3VV2A 5ARCA 2E1PA 3AFGA 1AH2A 1SBTA 1AQNA 1AVTA 1AK9A 1Y9ZA 4WOBA 2Z56A 1YJBA 1P7WA 1ZVKA 4NE9A 4FONA 3OSZA 1SBNE 3DYBA 3A3OA 1SCNE 3DE3X 1Q5PA 1S2NA 4M1ZA 1BFKA 2IXTA 1GNSA 1V6CA 4RYDA 4DZTA 4KG7A 1T1IA 1BJRE 1TK2A 1KE1A 1OYVA 1SCJA 3GT3A 3WIUA 4C3UA 1BFUA 4HVLA 2WUWE 3QTLA 2QTWB 3EIFA 2WWTA 1SH7A 3EDYA 4DWWA 2WUVA 1C3LA 1MPTA 1THMA 1Y3CE 2ZWPA 4WOCA 3ZXXA 3CNQS 3DW3X 4JP8A 1YJAA 1Y3FE 5AMXA 3L1KA 4H6XA 4GI3A 3I37X 3F7MA 4KPGA 5AVKA 5B1DA 3BX1A 1S01A 1SUAA 4B5LA 3VSBA 1KDYA 2W2OA 1BE8A 3DVRX 4AKTA 1GA6A 4CFYA 2X8JB 3GCXA 2IY9A 4OMCA 3D43A 5ARBA 2B6NA 3F49S 1SCDA 3SQOA 1PFGA 2DUJA 1Y3DE 3BGOS 1T1EA 1WMFA 2Z58A 3D9QX 1Y4DE 1AU9A 3I2YX 1AF4A 3BPSA 1NDQA 3QMPA 2PWAA 1SUPA 1T1GA 1GTG1 1DBIA 1SIUA 2V8BA 4H6WA 1KDVA 5JXGA 1TM4E 2PQ2A 3TECE 3DVSX 4LVOA 1VSBA 5FAXA 1Y3BE 3I34X 3WHIA 4H6VA 1EA7A 1IAVA 4NMXB 4OV6B 5JXJA 1SBHA 1WMDA 3AJ8A 2X8JA 1GA4A 2PWBA 2Z2ZA 1SN7A 1TM3E 3DE1X 4K8RB 2G4VA 2TECE 5JXIA 3H42B 1GA1A 1GNVA 1SUEA 1IC6A 5I9SA 1C9MA 1BH6A 2PMWB 3WQBA 5CW1A 5B1EA 3DE0X 3DE4X 3PTLA 1SELA 3VYVA 3TI7A 2GKOA 1ZVJA 3ZXYA 1SUDA 1Y1KE 2SECE 1UBNA 4ZOQI 2XTJA 2DP4E 3LXUX 3VTAA 5AVJA 1PJ8A 4I0WB 4YN3A 2W2MA 1R0RE 1OYOA 1TO2E 3DE7X 2XRMA 1HT3A 2ZWOA 5JXHA 4J94A 2DQKA 4AKSA 1C9JA 1MEEA 4LVNA 1SBCA 1CSEE 1TM7E 1SUBA 4OMDA 2HPZA 1OT5A 1WVMA 1Y33E 1C9NA 1S02A 5FFNA 1TO1E 3VV3A 3P5BA 1PTKA 1SVNA 4DJ5X 1V5IA 3DW1X 1TMGE 1P7VA 4CG0A 3TI9A 1Y34E 2Z2YA 2W2NA 3DVQX 1Y4AE 4NE7A 4ZARA 2Z30A 3EE6A 3AJ9A 3I30X 3CO0S 1NLUA 1GT91 3A3NA 1AV7A 4BWGA 2WV7A 3T41A 3GT4A 1SBIA 1KDZA 1TECE 2SBTA 3VHQA 2HD4A 3WIVA 1SPBS 1SIOA 5FBZA 1YU6A 3DDZX 2SNIE 2W2QA 1KE2A
chains in the Genus database with same CATH superfamily
2XY4A 3R8XA 1X77A 2YZNA 5F33A 1KQ3A 3D3EA 3IERA 3MJEA 1M5UA 3T1OA 2YX1A 2F8SA 3KZOA 3GDWA 5EP1A 4P22A 4EFLA 2DC1A 1OBFO 1ISSA 2WINI 4JYAB 1BVHA 2KBEA 4TKLA 4B35A 1Q7TA 4M55A 2A5GA 1OU4A 1Q7RA 4KXFB 4R1PA 1UXHA 4DLUA 5DTMA 4K86A 3RRBA 3USCS 5B55A 5LVAA 1KKMA 1RKQA 2MMGA 4UU1A 3FCCA 5JSUA 3AVXA 1WSDA 5FT9A 4JP3A 2B1GA 1R4MB 2F1HA 1OIXA 2R62A 3K0FA 1KMNA 2VHJA 3VO8A 4ML3A 3TJMA 4INPA 1JG4A 1Z4IA 1YNOA 4L9RA 4W1PA 3F71A 4BCDA 3CX6A 2E9SA 1NXTA 4WKNA 4M1OA 1F17A 1C0EA 2BONA 4GQAA 3X3HA 5IAOA 5HS4A 4R3NA 4N7MA 3QW2A 4LYEA 3CRNA 4B2PA 3KL4A 4EPXA 4ZYUA 4L6AA 4P54A 5HEKA 4DUGA 4XUCA 1DRVA 2NZWA 4K88A 1ULBA 2YYSA 1JHRA 4WX2B 3R6LA 2R7MA 3GRAA 3QVOA 5AI4A 3OLZA 4GKAA 3QVGB 4MVJG 1KQNA 3QMMA 1IOZA 4MPRA 5IM5A 1Z74A 4BGVA 5JEEA 1BCRA 1HE1C 1BXRB 2HLHA 2LIPA 5KC9A 4K26A 2PXCA 4C78A 1ZX1A 4KE6A 4OJYA 5H1YA 1QFSA 1XMIA 4DA8A 3EXFB 1SKYB 3WB9A 1C29B 3E7PA 3TVYA 4YXFA 4DMMA 3R8FA 2IYLD 4U2EA 8AT1A 3VZDA 2ZTLA 1P81A 3VZQA 1VRCA 2OCGA 2WI8A 1S89A 5JZMA 3U48A 3HZRA 2Q3LA 4QELA 4EZBA 3TX6A 3I5YA 4JP5A 4RGYA 4YJ2F 2N42A 3GEGA 4R8LA 3FLEA 4IV5A 1WS6A 4ZI3A 2E5FA 2C5FA 1FMCA 3P0IA 5AJTA 1JVNA 5J4HA 5CDHA 3RS0A 1AQUA 3C8DA 4UUBA 3PKZA 4QGAA 2D2XA 4E4YA 3RIYA 3ICPA 1V4BA 4LCEA 3OUUA 1NF8A 3F7OA 1CIJA 3IR6A 1VE7A 1SCIA 2WPDA 2YZGA 3GUHA 4UBMA 1R4NB 4EKYA 3NVAA 2J45A 4M8IA 1ZDMA 1AOXA 1GZ3A 3KOYA 1YVEI 5DTIA 3IAAA 5FBRB 2NSLA 3A36A 2VUTA 4EA8A 2VYCA 2H6EA 1EVYA 4MOWA 4O3FA 1OI7A 3T5MA 2DPHA 2YOGA 3KTAA 2QQ5A 1B74A 1JB9A 2QG4A 3H8JA 3QFHA 4G9GA 4J76A 2O54A 1FP7A 3O73A 5HNKA 4RQAA 4GOMD 4CLEA 3UWPA 4Y1RA 2PUCA 4JXZA 4H16A 3D8HA 4J3FA 3VC3A 3M81A 4NV1A 2OOKA 4NZ9A 2Q49A 1J8DA 2I7XA 4ZHQF 5CB8A 1KWKA 3RHFA 4LJ9A 2DPLA 3BGIA 4FFRA 3RAFC 3EGWA 2GUWA 1Q2UA 4M9QA 4QDOA 2WK1A 1FMJA 1YFJA 2PN1A 4GEKA 1OC2A 1JXAA 2VH2A 4U9IS 3T54A 3ZUPA 4FWTA 4KIWA 1BU5A 4L7QA 4LZAA 4D81A 3S70A 2UZ0A 4N03A 4DBLE 5B6JA 1AKUA 1M1NB 2XMDA 3ESAA 2R6ZA 1G8GA 3ED5A 3OETA 3G2MA 3MTAA 4L8GA 4NLLA 3QEBZ 4YRQA 5I48A 3TTSA 1FC0A 4YRTA 3V1UA 5HR5A 1FA9A 1PBNA 2DWUA 3R2JA 1AZWA 3ZHOA 3NDIA 4AYXA 2B92A 2H5LA 4K0RA 4QQNA 3KQYA 4DNQA 1A7AA 1NKTA 1RTTA 3LVFO 3U3DA 4C7MA 4IRUB 5FXMA 3AKDA 3IPYA 2APJA 3EVFA 4ENPA 2C2ZA 3N05A 3B6MA 2RIPA 2O20A 1Z6TA 2SKDA 4G25A 2OHFA 4KACA 5EJ2A 4E5UA 1SO8A 1IRXA 2B78A 1E8NA 1N2GA 3CUSA 1ZN7A 1Z0IA 3GARA 2VJBA 4TZTA 3IAS6 3P0RA 4HWPA 1U8XX 5IC5A 4MGYR 2OXIA 1T8UA 2HLNA 3PUKA 2FHSA 1HURA 2OESA 2PGOA 4HB4A 1O54A 2ZE5A 1M2KA 3NQ41 1CEXA 4TKUB 2IYNA 3LYUA 2Y99A 3MMZA 3IOMA 4WN9B 2A6PA 3RUHA 3VMMA 4B45A 3A1TA 1RKBA 1Z25A 1PNRA 1QS0A 5CM8B 4DV1B 3PHIA 2BEVA 2CWDA 4KN9S 2R84A 5JXWA 1YS7A 1SJ9A 1NRJB 4NATA 1CD5A 1HM5A 1JQLB 5AOAA 3GT3A 2VP9A 1XTIA 4EY4A 3ONEA 3PEFA 4ZT3A 3VAYA 4F2PA 2OK7A 2WUWE 4P7BA 4W99A 4ZU6X 4YAGA 2IKQA 2ZJ0A 3GC6A 4RGQA 3WWCA 3LP5A 2CJXA 5A6SA 5F9FA 2AF3C 4RWZA 2YVKA 4DZZA 5C31A 3SBXA 3RYCA 1MPTA 2QI9C 1R6BX 4HAZA 1SA0B 1VG9B 4PHFA 1VSUA 2J0VA 1AMUA 1M7GA 1PNTA 3RD5A 3WYEA 4R05A 5AIAA 2CLCX 2AR0A 2I6GA 2ZI7A 2XZDA 3FHJA 2GFHA 2HREA 3JQFA 1C4XA 3OCVA 4HY3A 1B41A 1DQSA 3R7DA 4D4KA 2XVYA 3ZTWA 4DXHA 2Z1DA 4AROA 1WV1A 1YE3A 1AMNA 1MN6A 3T1HB 4I3FA 4BVFA 4Q4LA 4J1NA 4TT8A 2BFCA 3DZJA 3E7DA 1PG0A 3U7IA 5FH9A 1VE1A 4M1KA 1V3TA 3CW2A 1JXMA 1E2PA 3AZQA 4A0QA 2EW1A 2A5YB 4WLOA 4F5ZA 2GQ0A 5E3JA 1TGVA 4JLDA 3SM9A 5LOVB 4AO7A 1FSGA 2EW2A 4NCJA 4MW7A 1VDZA 4K1LA 3TFWA 1M2JA 2X41A 3OT1A 4ZJUA 4KEAA 1UAGA 2ZYRA 4GLFA 4QOFA 4YJGA 2XYRA 5EESA 5DNUA 1W44A 2H1WA 2OECA 2WKQA 4I5IA 1GV1A 4BASA 1P60A 2JI9A 4P53A 5IAKA 2WJ4A 1M9NA 2HNKA 2EYQA 2A9OA 4JLWA 5DTEA 4ZT5A 4K6CA 4DCVA 1JDZA 2YY6A 2FSHA 4OAPA 4QOIA 4HAVA 1DC4A 2BP7A 4IV0A 4A6PA 2YDYA 1RLTA 1XRPA 3I9NA 4KU4A 1R16A 5FV4A 3ETDA 2GGSA 1FNDA 5FF9A 2VT3A 4IGKA 3MGAA 4U8HA 4UTXA 4F86A 4CZ2A 1I5OA 4EKEA 1HI9A 2Z95A 4GOXA 4NNPA 1W5EA 2NUPA 3L84A 2A1IA 2RGGA 4FMBB 4MUNA 1NGSA 3HDTA 4YYEA 1DVRA 1NUQA 2ZVDA 1TT5B 4DYVA 3ZVKA 1ID8A 1OILA 4HGZA 2RD2A 4C43A 3ITEA 4F9TA 2DERA 2C7PA 1B3RA 4JU8A 4V0SA 2QD3A 3EXEA 1VL5A 3SS9X 5ALEA 4F4CA 4N3AA 2H31A 4CM4A 4F6RA 1MX3A 4CR6A 2VUIB 4OHYA 2JEYA 4O4IA 4OKNA 1B4DA 2GK7A 3PD0A 5TS3A 1N2OA 1W85B 3QPWA 3SF8A 3O21A 5F7XA 1S8OA 3DF9A 3F67A 3MWDB 4RXMA 3W5CA 1TLTA 4EDFA 1TTPB 2P90A 1P5FA 4WXYB 4ANFA 1FFXB 4I4TA 1KEVA 1P1KA 2GJ4A 3E3AA 4MA4A 4KOEC 3CUKA 3D7LA 2JF0A 3NUQA 2HTEA 1P6XA 4BYGA 3CPJB 3HNRA 3DD1A 1AQLA 1JR3E 1YRHA 3NO4A 1XQ1A 3NHPA 2EHJA 4FFMA 1UBTS 5FBQB 1G7TA 2R751 3C0KA 3DOFA 1E9SA 1G21B 3N8GA 1D2NA 1P1JA 4QJ5A 5FWDA 4BFLA 1MNAA 3G88A 4E6PA 4QLBA 1UJBA 4DHEA 3EGIA 3K9CA 2C3MA 3QG5A 2G6TA 1W0KA 1T6YA 5EIBD 5LB2A 5H68A 4YAIA 3L8CA 5L7YA 3DNFA 2PUBA 4BWFB 4DNFA 4CFSA 1A98A 1BIFA 3M6VA 4BNDA 3A25A 2Q6OA 1W94A 3EPKA 1C3OA 2V7GA 1QFMA 2ZW9A 3LGAA 5JNVA 1NVEA 1ISGA 3H1GA 2INGX 1JAZA 2AQHA 3A6PC 1ENYA 4D8XA 1URPA 2KSQA 3N8HA 1T2CA 1SIWA 1MO2A 3ETLA 1MC5A 3ZHYA 3ZWWA 4L22A 1LBEA 4RZ3A 1YCHA 4ZJZA 5G1PA 2XE6A 4D79A 2V98A 4LGMA 3NKLA 2P9FA 3N5KA 3ZDZB 1NDHA 1PJAA 2CNOA 1CS0A 1DTEA 2ZBDA 4IHQA 4UVDA 4CM3A 4DUZB 1CRLA 1U7UA 3DVLA 3WDSA 1R5JA 4QGBA 4DA7A 1ABEA 3U39A 2B8WA 1EDOA 2VDWA 2J9FA 5EWLA 5TT1A 3GJ0A 2WZDA 1L5SA 3FRIA 2PUEA 2FV8A 2H92A 2JPDA 3L9WA 1YMQA 1IQPA 3NJRA 1STOA 2ZI6A 4CN8A 1B8NA 1VLMA 1G6OA 5DRYA 4QWWA 3DBRA 1D2GA 1UDRA 1W34A 3VR4D 1F0NA 1FVHA 1JQBA 1EEHA 2ONYA 4P86A 16PKA 1NFQA 4BB0A 4ISBA 2ZQZA 4AFNA 1L4MA 2LD4A 1GQSA 2YWFA 4K6OA 3OKPA 2QLNA 3MMXA 3QZUA 4TWAA 4E1VA 3BCUA 4C5AA 4P7GA 3E7FA 3RBVA 3WRYA 4ID3A 2WTAA 4DW8A 4ND1A 4DUYB 4M9UA 5T4BA 1HQCA 4EMTA 2OBBA 4G07A 3TR0A 4PZYA 2NADA 3H84A 3IUJA 3ZK8A 4BQIA 3EW7A 4G6ZA 5HIJA 5LC1A 3T06B 1P7ZA 3MS2A 3WLEA 4KI7A 4MNTA 4WA7A 4DB2A 4XSHA 4O0MA 1N34B 4IGFA 4JGGA 4XQCA 1Z8NA 4U6NA 1S7GA 4DE5A 5C4MA 4RS4A 5FA8A 2OV8A 4OPMA 1GSHA 4NOLA 3F0TA 1PFUA 4R8RA 1R0RE 2FVXA 2ZXUA 5EQJB 3LP8A 1FFYA 1PFVA 3C7DB 2BFDA 3ZH9B 1UKYA 3AFOA 1Y4SA 5CLGA 1HT3A 4LZNA 3WNQA 2E2WA 2P5UA 1P5ZB 4CKBA 4L2IB 2OAEA 4QARA 2OGTA 1BN7A 2DQKA 3ILSA 3KVVA 5CJJA 3SYTA 3IPXA 2GCGA 4YRIA 2Y8EA 3QVJA 2DTEA 3ETEA 5KYVA 4X9XA 2Q7OE 1TUBA 3TLGA 3TSAA 4YY3B 1KSFX 4TM7A 3P0FA 4UC0A 1UDBA 1N1MA 2ZRPA 3BJIC 3BTOA 2JI7A 3L7CA 4MUBA 2A9QA 4RMJA 4DLLA 5KMGB 4KQJA 3OA0A 2X5JO 5AW3A 1O6FA 2H65A 1WVMA 3BH7A 3DMTC 3DV0A 5GWXA 1N6KA 1DMSA 4KFRA 3TOSA 4BLSA 5ALHA 1C9NA 3MZ0A 4HEJA 1AUQA 1OTHA 3MSCA 5EIFA 2EIXA 2XF2A 3ETNA 5DBIA 4DLZA 4E70A 2C83A 2O7SA 3G9XA 3PRHA 4N6GA 4ND5A 4Y2JA 1FDSA 2WWGA 3BDVA 1TJ4A 3BMQB 4OG2A 4BO6A 1BKDR 1X8KA 2ERXA 2QTRA 1PJRA 1T0HB 2BGIA 4V2IA 4IVNA 4BO4A 4CT0A 1N6NA 2O8DB 4DEYA 3WSTA 3ZQ6A 4A2WA 4WCDA 1NFFA 5IASA 1ZOIA 3M89A 5K6TA 3C3AA 1V2GA 2ZU6A 4L75A 3HE3A 4F4DA 3EUWA 1NBEA 2O3SA 1OI3A 3HU1A 4N8DA 1AMOA 2CB0A 2N3ZA 4R01A 5JRDS 2XEDA 4MV9A 4QEDA 2Q5OA 4HRXA 2VQ6A 4IIEA 4IHJA 1J9GA 3BWVA 4J4HA 1MZPA 2NO7A 3LX4A 4EG3A 1JKFA 2B83A 1FY2A 2WM2A 5DNWA 2ATCA 1MBZA 4RKFA 3V4FA 4YALA 4C29A 1UFQA 1EZZA 1LSUA 5JJ5A 1DX6A 2C9CA 2JI6A 2QMYA 2ZLBA 4NKRA 2QUIA 4YDHB 4RTOA 4PCVA 4FX2A 3JQAA 3H5AA 2RJ3A 2VXYA 1R37A 5KOIA 1ZU4A 3SD7A 2QMOA 3IXLA 3WIOA 3H11A 2RAFA 3GBPA 4PLZA 2RGYA 4JKYA 4LY9A 1NLUA 2X3FA 1P91A 4L85A 4NEQA 1VPTA 5HQ3B 2EW8A 5G0VA 5JAPA 3AUUA 1DUSA 1S3FA 3HCFA 2I4TA 1OFUA 1TU4A 4I7EA 2J4FA 3RSZA 3SIRA 5K8VA 3G82C 5KQSA 1KARA 3A14A 4X7PA 2RHJA 3B2NA 3KQSA 4KN8A 5B1YA 3WWOA 4BRSA 1AS3A 4HGOA 1UXIA 3PHCA 1GADO 4LXUA 2DOKA 4PVCA 3VSAA 2EL9A 1ITZA 1I1OA 3BHNA 4EG7A 1FSFA 4KYUA 3A27A 2HJRA 3HU2A 4GGOA 1QE5A 4XARA 3UMJA 4BRZA 1U8ZA 2JCVA 5E4FA 2QN7A 3LBHA 5AM2A 4CGZA 1UBFA 1G17A 5BWCA 2EQ5A 3AJAA 3UFXB 3ZQJA 3B6IA 3ADCA 2XITA 1UPTA 1P4RA 1Z34A 2YJ5A 1C0IA 1UC8A 1ZLYA 3MIZA 4KO2S 5FHRA 3D2AA 4RNCA 4Z6KA 1SIOA 4EIWA 1RWPA 1YFKA 2F4NA 2BL4A 3D7RA 1JEDA 3P2EA 4P4SA 3WXMA 1RBQA 1WZNA 5KBYA 5CVEA 3DDZX 5GONF 4B74A 5BUQA 2GYUA 3O8QA 3VC1A 1FYEA 1U2PA 5JECA 2X9GA 1C7RA 2P2SA 3D8NA 5HIMA 4DHWA 4PPQA 4X71A 2SKEA 4HKTA 2PX6A 3RIEA 3NETA 3O75A 4UUNA 1QGAA 3G3EA 1LDNA 5J59A 3SJAA 4PS1A 2P2NA 2WTMA 2K5UA 4KRGA 4R7GA 4HWRA 2HBZA 3L8GA 1Q91A 2G9QA 1SG6A 2OORC 3NS7A 3VH3A 3GLGA 2WP8J 5A71A 3I92A 4ZOAA 1B8UA 4BRUA 2I5PO 4P4NA 1W36B 4OBWA 2YIJA 1EFRD 3QBVA 1JQAA 3TLKA 2FNAA 4GWLA 4JBNA 2B8NA 4HATA 4FGKA 1YHZA 3WRWA 1X7ZB 5DBFA 1GUFA 3A1WA 3AEKA 5FCDA 4PIMA 2AGVA 5JRZA 1SXHA 4CTJA 3CMCO 3GVIA 4B6FA 3DM5A 3A6GA 5EE1A 3R77A 2VJAA 2W6MA 3DKKA 1KI6B 4D9MA 1GCIA 1CJUC 1SOAA 5DVZA 3N0WA 4GM1A 4LJ7A 2FRDC 5KB3A 5EZQA 9ABPA 5IYZF 4F1JA 3QHPA 1Y8RA 2XKBA 3P2JA 4RHTA 5EHZA 4KITB 4E09A 5ES3A 3SIPA 3AB3A 5DTJA 3EGDB 4E88A 2WPNA 1JHDA 1L5VA 1OB2A 4KMSA 3G1UA 4IXDA 1AXRA 3B7PA 4CJXA 1JDUA 4Q3NA 1COWA 1NT2A 1V7CA 4ETMA 4OXIA 1M72A 3EDRA 3DTVA 2HN9A 3A4YA 2VI5A 2PSDA 4M0EA 3TYXA 2QB5A 4GM0A 1ZICA 1QWOA 4H1VA 4U5QA 5LYJF 1BDHA 3WWPA 3B1ZA 3W5BA 1S9HA 2LCIA 3CBGA 3ISJA 3LW8A 4HH4A 4P5DA 1CB0A 1NTRA 1I6WA 1LPNA 2BVNA 2ZRLA 4RK1A 3TQCA 4TUYF 1CK4A 2R6CA 1H42A 1EG2A 3CRVA 3OVMA 5GPBA 3WLFA 1XG5A 4MROA 1CR1A 3HRKA 4DV6B 3PC8C 4YAKA 3BTSA 2YJTD 3FCEA 4L3VA 5J2TA 3K16A 2Z4TA 3E9YA 4TL9A 4ZVLA 2AI3A 4Y9TA 3O3CA 5I3CA 3FWKA 1NQVA 4I08A 4MGHA 2J6HA 4Q12A 4BTVA 1CQWA 5ALFA 4ZRMA 1WUYA 1PBTA 1G63A 1QDEA 1SUCA 1Z3CA 1M6EX 3A9VA 3I9V6 2ZRQA 3ZK9A 1FQOA 3V4RA 1EP3B 2BSXA 3DOHA 3CM0A 4EVSA 1MO6A 3P9RA 4UUMA 3FPSA 4PXSA 2IXBA 5I4BA 3IT0A 1GGMA 4CNQA 3KKNA 1T0IA 1U4NA 2IVFA 4E5PA 1KJWA 2QLBA 4CE6A 4A6EA 5I9TA 1IXSB 1V3QE 1AV6A 2C9OA 3COYA 4IYRA 4PINA 3HJTA 5T64A 5JFTA 1DQYA 1N2SA 2QW8A 1NOKA 3KEMA 5BQPA 3ZG6A 4DR2B 2AZXA 2VHTA 2DR3A 2WJWA 3SC3A 3GRVA 2R00C 4KV9A 4RKRA 2BGLA 1E2IA 1C2YA 1VE6A 2REQB 3PNQA 4L8LA 2NTVA 1U9ZA 2XMPA 4UVIA 2XD9A 4FLEA 3Q6IA 4IVQA 3D8SA 1JA1A 3C4JA 3UO8B 3L1HA 1MV5A 3VV2A 2E1PA 1KZ6A 4FS3A 2R7LA 3JPWA 1XTRA 2XZTA 4L9AA 4YP6A 1CVIA 3E2MA 4IDHA 4B3SB 3KPUA 4JC8A 3ROXA 2QORA 2Y0DA 4PLCA 3RC2A 4QSMA 4PYLA 3EYAA 1GTSA 1HLGA 5AKGA 2VDOB 1Y1RA 4NS1A 1SZPA 3L6EA 1E2FA 1FBNA 1KAOA 3WS7A 2D2IA 3BD9A 3HKBA 3M4XA 3KOWA 1V7PC 4H4DA 4U2BA 2J67A 2V4MA 3BWYA 5EJGA 1EJBA 3U4HA 4FKZA 2JFFA 2ZSDA 4DARA 4WINA 4AECA 3WDLA 2ZBPA 2CV1A 1Q0UA 1PYDA 1M2HA 4TN1A 2I99A 3DMRA 1WSWA 2QAGC 5ALMA 3IBFA 1VKRA 2XUJA 1ES9A 2BTQB 4F85A 1BD3A 3LL4A 1YJXA 2GESA 3PQ7A 1PL6A 3PPIA 1E5QA 3O3MB 1RJEA 2BAGA 4DL9A 4PTLA 4IDCA 2JGJA 3CHYA 4XKJA 2OBNA 3CE9A 1IM2A 1U65A 4B4WA 4HAIA 4QWMA 4NJMB 4RD0A 5H59A 3A6DA 5IHXA 4FIDA 1PQ4A 1RJ9A 3IS3A 3KTFA 1NWHA 1P2GA 1WNFA 1HDYA 1NXQA 1IVNA 1ZOLA 4OH1A 4ZIRB 1LRLA 2QHXA 3GA5A 1Y0BA 1PSZA 2PKEA 3B8HA 1VIAA 3DOEA 5JZOA 4GKJB 2G4CA 2ZJOA 1H5UA 1JMYA 1EK2A 1TK2A 2Z9CA 2RCNA 1HE8B 4H7DA 4YJ2A 2PMFA 1C14A 1RQNA 2VUHB 4YP1A 2W4IA 3FMFA 3FUUA 4KXQA 4OU5A 4AD8A 5C18A 1FPQA 4F7DA 2VDKB 4U5XA 1DHRA 3Q2IA 4O2AA 3EIFA 2IH5A 4D8WA 2OLEA 3E9QA 1NSFA 2FH5B 1U0NA 1H66A 2ZSBA 2CFSA 4LRSB 4FYPA 2RB5A 1V35A 5AJVB 3QE4A 2I2DA 4CL0A 5D8DA 2ETXA 4NSNA 1OH8A 2B3TA 4IFBA 2DT5A 3AUYA 1AB6A 2O8FA 3V32A 1J23A 3GFBA 1NV8A 3LQ1A 4KX5A 2HRCA 3OX4A 3FCSB 3HY6A 3JD2A 3HEAA 3TNDA 3U80A 1DXYA 4Q48A 3PJRA 3DLHA 4H4CA 2YC4C 2QTVB 2RARA 5J5AA 1FS4A 3IKVA 4DUPA 2P3LA 1R0CA 3AF2A 4CTOA 3VDMA 5HTKA 1YHNA 4Q34A 3WLNA 1UZNA 2C9ZA 2W0SA 5CXQA 3C87A 3B1YA 2VAPA 1KI1A 4UU7A 1GRVA 5EIEA 2W98A 1WP4A 2IHKA 3P2IA 1ZD1A 4ZHQA 1QKKA 2H8KA 5J58A 2BIFA 3O1LA 4Y2UA 5JD6A 1ZM3A 4TXNA 2TSYB 1W75A 2BGRA 3PQ2A 4YFVA 3VR5D 5FEUA 5IG2A 5TMPA 4M7OA 1JH8A 5EJ4A 2K7ZA 4LX8A 1WG8A 2ZIUB 5D5PA 1DC6A 3RHTA 3SC2B 5ULLA 1FQKA 1LJLA 1N2IA 4M7WA 1J1IA 2H1OA 1GTVA 1CV2A 2WG1A 4LJRA 4HGPA 1XRLA 1GDDA 3L5OA 5AHXA 3I1FA 2IPMA 2EFYA 1FNBA 4IAOA 4N5MA 4OMCA 3REOA 5K3DA 4WLVA 3C3YA 5K03A 4ARIA 3S5UA 3IP5A 2HSJA 2NYVA 2OCAA 2Z2JA 3KFLA 2ZS8A 3B9QA 4M22A 4ADSG 1PP4A 1T5TA 5GJWC 1Y3DE 4H77A 2HXYA 2XGMA 5JCPA 3GRCA 3E9MA 1P0PA 3PDCA 4E5NA 1IZ7A 4FOTA 1U2SA 1X1RA 2G7MC 2VS1A 4BMNA 5BV8A 3CVYA 5H0IA 1DAEA 4TWRA 5H3HA 3U4QB 2GYWA 2NXEA 1DCKA 2VWGA 3WKCA 5E7MA 1E0JA 1V3UA 2OZEA 3K2IA 2H63A 2V7VA 2X9VA 3GX1A 1G4AE 3PHLA 1QVZA 2PMDA 2ECQA 1ID1A 1OBVA 4U9UA 3VJLA 1JEQB 1ZOPA 2HMAA 3LDGA 4B46A 3SMVA 1KORA 1IB0A 3KJFA 5DGCA 4MPPA 3DMPA 4JB0A 3ZJ4A 1DWUA 1NZDA 3TQRA 1AKNA 2ZTHA 2MMCA 1MAWA 3VO1A 4GMFA 5LZ5A 3IT1A 2X0KA 4DIFA 2PH7A 3CRW1 1FNSA 4LW8A 5HRCA 2B30A 4QVGA 2ATEA 4R2JA 4PZPA 5A9SB 3LS2A 4DJFC 2A0XA 2XWBF 1MMFB 2WWRA 1CBUA 3LPMA 1O57A 1N8SA 2FSVA 2IYAA 2PKQP 2VNJA 1H6DA 4X95A 1Y3BE 1FFDA 1KJ9A 3OCUA 4WAUA 3VOBA 1IAVA 4PYKA 4MZXA 4NZPA 2GBCA 2WU0A 4WXPA 1KQFA 1Z9BA 3ST7A 4IKEA 4LPKA 2QE7D 3IP7A 5F2OA 4A1OA 1B16A 3FNGA 2Z8XA 1NBME 4HJRA 5CLLA 2QVLA 4TQUS 3T4XA 1RBMA 4C0JA 1TAGA 1P3Y1 2FRXA 1IAQA 2YIMA 3K1JA 3FWZA 4R9RA 1AXGA 3FYHA 2GYVA 4CBVA 3BWEA 4Q1VA 5LJLA 2C1EA 5THKA 1KZ1A 1UK9A 3GA7A 2ZSHA 1DAMA 2XUDA 4X92A 5BQ5A 1U0BB 2NXJA 2IBMA 4RSRA 2ZTSA 2AFIE 2JVIA 3HDJA 1VKHA 1Z0ZA 5F2NA 2C58A 4AF7A 3FOFC 221PA 3U9TA 1UFOA 2JH3A 3TVTA 4YT8A 1Q1AA 5BPFA 2R25B 3QOFA 5EAIA 1DGQA 5CHEA 3AOGA 2X4LA 5K05A 1O0SA 2D0IA 3KAQA 3MJRA 5D5HA 1XD8A 3TLEA 4CIVA 5ICEA 3QWIA 3ZWDA 2AFRA 4OQYA 1BS9A 1SUEA 4AVYA 1V8DA 1W93A 2P3SA 4Y6RA 4AIRA 2A58A 3CF0A 3HCNA 4HNUA 5DGDA 4RAOA 2J3DA 3STUA 2PIAA 4EQZA 1LXCA 1BTOA 1GPH1 3KZXA 3AIKA 4GMGA 2IOHA 5DJ5A 4RLQA 3VYTB 4AULA 1Y6GA 4MR9B 4K7JA 1J24A 4H31A 4MS3A 3P19A 1SXJD 3GJ5A 1FU7A 1MX9A 3TN7A 1Z45A 2WWFA 3RNOA 3VOTA 4EVRA 4JBLA 1M8PA 3DFIA 4HVCA 3ANSA 3ZZUA 4RF3A 3NEJA 1VHQA 2PD4A 2Q3DA 1XZDA 2FFAA 4WDRA 3BXOA 2OEPA 1ACJA 2WG0A 8ATCA 3F6RA 5IBPA 1K0UA 3GR6A 4L5BA 1TYBE 5G1OA 1JJFA 3CSUA 3H5RA 1Q17A 3R9WA 1C4WA 1OYOA 1SHUX 3L7DA 3FR7A 4UBKA 5KOHA 3NWBA 3PNPA 3W6ZA 5CT4A 4QUJA 4OLAA 4MR8A 2O0MA 3ZU5A 2R8XA 2ZSJA 4BIIA 1NQXA 3GP5A 4OHVA 1KTIA 2QVYX 5DYWA 3W4KA 3IBGA 2Q3MA 3TCXB 1QCDA 4PPFA 3U1VA 4Y9DA 5AI0A 4HH1A 5TF4A 4KO8A 4NOMA 3PV0A 2A5LA 1NAIA 2G5TA 4Y8VA 5A02A 2GJ9A 3THYB 1ECFA 3MQ4A 1VDMA 5C81A 1ZGBA 4LOJA 1P0CA 5CIYA 4OFXA 3DBOB 2J46A 3E82A 1RAAA 3I64A 4B6RA 3ZY3A 4DV4B 1NN1A 1PG2A 3AXTA 4RULA 2IU0A 3CUUA 4IJQA 1YA8A 4ERXA 1WDMA 2R3SA 3THYA 2R1TA 2CHEA 4AYTA 1ORWA 1WHSB 5D7BA 4A16A 9ATCA 1QGOA 5JU6A 3LT5A 4RTSA 2XUFA 3GBVA 2R4TA 2VLIA 1KVTA 4MMYB 1IYZA 5DMXA 3WYGA 2HHLA 1V8PA 3RWMB 3OAAA 3PENA 2X3UA 3Q7RA 1QHFA 1S2GA 1NJ8A 1QB8A 2P77A 4QXAA 1IEQA 4PE5B 4EJSA 3LZCA 4GI5A 3ZE6A 1N5RA 3UBMA 4IOLA 2NQ8A 1GCGA 3AVQA 4OI4A 5AJUA 5JW6A 4OA8A 2PU7A 5BNFA 1ZL2A 1KMHB 3P9IA 4LXHA 3R7SA 4AM8A 1VTKA 2O8NA 3DKVA 1I01A 3FM9A 4KTVE 3P9NA 3PDWA 2A14A 4HTFB 5KNCA 3RRYA 1KZYC 4NJOA 3H2IA 4PAMA 4RABA 1Z36A 3F5FA 4U9HS 3QK7A 4JEHA 3CUTA 4LWZA 4MLDA 5H81A 1K7CA 2DHDA 1QIKA 3K9NA 4NYJR 5DX0A 3C39A 2I1VB 3I4FA 4NTZA 1KIFA 1ZZEA 2C78A 2UVPB 4KQKA 4LC9A 4O08A 1AQJA 4DMFA 3CURA 4ZYZA 1FSZA 1X7XB 3GIDA 4ZAYA 3RADC 5JH7F 1NN5A 4EB6A 3DUFA 2FMXA 5ALUA 1TMYA 5BN5A 2AEFA 2GZSA 4FT4A 1VHDA 1AA9A 1E77A 1EFDN 1I2ZA 3EB9A 3KJHA 4FFBA 5AJWA 3RYIB 1KSJA 3SYNA 3LFTA 4CM9D 1R10A 3G2KA 5BYJA 3QOYA 3TAXA 1ENPA 3GH1A 3MD0A 2NPFA 3KAPA 4FGWA 3ROEA 3T7CA 1BHQ1 4DR1B 2WFLA 1VRWA 1P62B 1WPRA 1I80A 5T6MA 3HNOA 4MUFA 2Y1GA 4RJIA 2O5EA 3GZTB 4OJQA 4ZEVA 1HL3A 4QSHA 1SOVA 5KQMA 5KYNA 5A5EA 2VYQA 1TA9A 5M2QA 2UUPA 3DCIA 3EAQA 1NX9A 2IYPA 1CUIA 4B80A 4X1KA 1TXGA 2OBYA 4OSEA 2XA9A 4EHKA 5KYXA 2JCGA 2E18A 4YMLA 4AICA 3RFCA 1OBOA 2E87A 3QY0A 1I4WA 4LC1A 1CF9A 2C2YA 1B0PA 2IVZA 2Q21A 1WL8A 2RGXA 2XMCA 3EZ9A 4HXEB 1NVAA 1QMPA 1XYVA 2NNWB 4G1MB 4K8OA 4P58A 5ECDA 2C0PA 2ZGVA 4ID9A 2BEWA 5LBIA 1TQHA 3U4DA 5AVVA 3B9BA 5K5EA 3MTGA 3IV6A 4WZAE 4MR7B 1XQYA 4ZT6A 4BBPA 3SZLA 3FCUB 3EGEA 4C0LA 4DJTA 4K1XA 4DRYA 1T35A 4AI6A 3CT6A 4FDAA 4TVBA 4EECA 3JYNA 3BRWD 2QSZA 1CHNA 3BWCA 3L3BA 3W0LB 4QGFA 2ROQA 1W4BA 2I8CA 3OEHD 1NUAA 3A37A 5ALGA 1QZTA 1TW2A 1WZIA 1IOVA 1CZHA 1H69A 1CUGA 1FX0A 1HH4A 1OWOA 2BHSA 2JH9A 5EE3A 1L7EA 2XQGA 1ZNQO 1D6MA 2AG6A 4CI9A 1KVRA 4CMKA 1XVLA 4RETA 2GSDA 4KDRA 4BVBA 4D46A 4X63A 1O89A 3ZE1B 4L0MA 1Y7PA 1KRHA 4JI6B 4LF6B 1J21A 4ZT7A 2FZEA 4ECAA 3G85A 1Z7YA 1EFAA 4E2FA 1BA3A 5BV7A 1VMKA 1HFEL 3OU7A 4N65A 1CCWA 1GTL1 4ALNA 3NHSA 2WTBA 1HLDA 2PH3A 2VTVA 1RP7A 4RO0A 2JLBA 1Y82A 3TG8A 1GRCA 3D4NA 4TXHA 3TW4A 5DI9A 4P4UA 2O19A 3TZLA 1SCAA 1ZJ5A 1XZCA 3IAS1 3ZBUA 2HQSA 4MKRA 4RZIA 3GDGA 4UOQA 1PFQA 5JAIA 1P73A 1DKUA 4MICA 1CUBA 1XJWA 3G8YA 4O2BA 5TGDA 1KS9A 4B6JA 3HYRA 3KQTA 3NR2A 1JDPA 3AV0B 1T9GS 1P18A 1OW3B 1UZAA 4HEHA 2H3HA 5HIIA 1B15A 4H7PA 3SN6A 1RMQA 3T9CA 3T5PA 1MO5A 3H1TA 4CT5A 3PEVA 1AG9A 4CG3A 1Y7IA 4IIXA 5B6PA 3BL8A 1H2HA 1OI2A 4EI8A 1HSZA 4PTYA 2W4MA 4DQVA 5EY5B 2FW6A 2DFVA 3NKVA 1NMYA 1NJ1A 1PT8A 3MWEA 4WVFA 5CLQA 1LZKA 1E6UA 4MVJH 3E58A 4XGQA 3F6CA 2QX6A 1OWLA 2O48X 3A2NA 2LIVA 4WY2A 1GAWA 1P7YA 3DXFA 4C2TA 1E2DA 2JFYA 1NPDA 4G23A 1T8RA 3P97A 1JLKA 5E2AA 3SWWA 4UTVA 2ZRIA 1DIHA 1UDAA 3MUFA 2ZZMA 4GECA 3I5MA 4J0CA 2EDCA 2AN1A 4HGNA 1ZIXA 4EI7A 4PLPA 2FG7C 1U90A 2H16A 1G7SA 4TLBA 3PWTA 4AY3A 3H9BA 4Y2HA 3M2PA 5DI3A 4IHAA 5IN5A 4QPCA 3VSDA 1C9EA 3I9FA 4PZ0A 5HDQA 2C0CA 3KKQA 3CV3A 1M0SA 1V25A 4DBZA 3K20A 2I4NA 4I8IA 2EBWA 2VUUA 2XNDA 3AJDA 4OHZA 4HDSB 5HS6A 3ZWOA 3LHSA 1YZGA 3EFEA 4IGAA 3K1AA 2WHXA 2C42A 2RG7A 1G8FA 2FWBA 4A27A 3R5FA 4LNAA 3HKDA 5GONA 1G16A 2Q8PA 1Z0DA 4D9KA 3E9DA 4Y3UA 1QHYA 3FX2A 3FYTA 4LDNA 2Y1KA 1LDYA 5HK8A 4GWGA 2CFCA 4B4KA 5CG2A 4YRZA 3IOBA 3QWBA 3A11A 2M6SA 5K1ZA 3O5AA 4YP9A 5K0JA 1T26A 1KS2A 3GG2A 1OA1A 3D7KA 2A3RA 2IY8A 3OQJA 2VDUE 1OV6A 3O47A 4LGYA 5C34B 4BYMA 2P69A 5CK4A 1ODJA 2HPVA 2O2XA 5CT5A 2V7UA 1QB7A 3U62A 3PDIA 3RQIA 4C0XA 1QRRA 4IINA 2ZK7A 1TZ2A 3DFFA 3I39X 5AVXA 1M73E 3OEEA 2E4XA 3SHOA 3WLHA 1YR6A 1CJCA 1FUIA 3AF1A 2P27A 2NNLD 1MRZA 3HVIA 1D0SA 1MAUA 2WT9A 3P9KA 2A8YA 3JZMA 4RTJA 3U19A 4IDFA 4MCJA 5THQA 3FWPA 4NG5A 1ZXLA 2FUEA 4OHPA 2XOKD 5EKXA 2ZSFA 3ZHZA 4D0SA 4HCJA 4D0NA 3AQIA 3E3LA 4EMUA 4ALKA 3RUDA 4TWJA 1J7KA 1D6SA 1Z5VA 2Y1LA 3X2EA 1IEXA 2A4MA 4CQMA 5A1TA 4JLAA 5ERYA 1Z5NA 4E13A 5TV2A 2ZBRA 3GN2A 1W29A 1JHQA 1ZGZA 4QUEA 4YTEA 4JU9A 1J00A 2NU7A 4XE5A 4EYSA 3OFVA 5G0UA 4US2R 1J09A 3R20A 2O8EA 4C5CA 3H5VA 2OV2A 5LB4A 5TQ2B 4C2AA 2WF8A 2XUAA 2QN2A 2WM8A 3LNTA 2JBAB 4MRVA 3RBAA 2XCRB 2ZBQA 4GXTA 3T9FA 1V6CA 1DARA 2GF2A 3NT2A 4D02A 2DPGA 2H1FA 3WKAA 3CFYA 5TJHA 4EF5A 4FM9A 2J6CA 1QAMA 2AQKA 1C1YA 1LPOA 2M6RA 2BFMA 4TUYA 4BUZA 1ULTA 1RU3A 2OCDA 2YQ4A 2P4QA 3G89A 1LRKA 1R0YA 3JAWA 3QU5A 2KS6A 4HPXB 4IFIA 4KXWA 2VHVA 1QYIA 4OIMA 3TGLA 4UUAA 1MQ8B 3KE9A 2UYGA 4HVLA 1HT0A 2Y05A 1Z7EA 2PM8A 3ECSA 3FFTA 3H87A 3JWEA 4HUQA 4BBJA 2OE2A 3WLIA 1E4EA 4H35A 1V45E 5L4NA 4P2BA 1EFTA 3SR4A 2BI8A 3CLUC 3G0OA 4C03A 3A7DA 3ZWYA 3MGKA 4H7JA 4LFAB 3KL2A 4JJIA 3RFFA 3SZMA 4ZQBA 3TOCA 5CNKA 4BVKA 1BKSB 1NUHA 3DH0A 3A6EA 4FC6A 3VQTA 2CLOB 2PJUA 4LRQA 3EODA 4OQZA 1DXHA 2CXXA 4PLTA 2JDID 1N0HA 4IHJB 2QRNA 1L5FA 4JL5A 5HG0A 3MCAA 2Y4NA 3DLIA 4IEFB 1KXJA 2I6TA 3KPJA 3L1KA 3FPLA 1ORDA 5EJ9A 1PJQA 4KYVA 4J3NA 1E1QA 3Q3IA 2XXAA 3LMKA 2HK7A 1QK5A 1JR3D 2LV8A 3HXKA 3NTOA 4ZVPA 1U1EA 1USIA 1D07A 4JLBA 2BFOA 2P9GA 2W2TA 4OHCA 5CT6A 5IH3A 1YZQA 3JXEA 2IV2X 4ZTZB 1RS0A 2J0UA 4PFQA 4DXAA 3A6HA 3E03A 1X8LA 3P9SA 5AM5A 1ISMA 5FWXB 4GFDA 3EVZA 4FZRA 4RSGA 3OEWA 1QGDA 3RW9A 3W79A 3EN0A 1AUXA 1FJGB 2WSMA 2CJWA 1MX1A 4KTTE 3MJTA 4ZEMA 1G0OA 2J59A 3DVRX 2IEBA 3V4PB 2NTYC 4JP1A 3QUCA 1V95A 1ZL0A 3OJ0A 4ZVNA 1Q0RA 2R47A 2VPQA 3GCXA 3PNOA 1E59A 4I6JA 4O2RA 3MHTA 1JQKA 2ZTMA 5ITWA 3D43A 2F6RA 4M8LA 4C6TB 3OKFA 4OX9Y 3LIIA 3OT4A 3HL0A 3LG2A 4YRFA 1O4WA 4ZC8A 4FHZA 5ALJA 5F5NA 4I50B 3ANMA 4HMQA 5ELMA 1OREA 1X7WA 2D0OB 5AVOA 4BGIA 2GBLA 2EX0A 4CLXA 2LE0A 4NULA 3H6HA 4RL6A 2KW5A 5BOSB 1U94A 4P3XA 1UKVY 1A8SA 2YJZA 5IBQA 4MVJE 4BB5A 1D2MA 3E3OA 5COBA 3RRZA 4HSGA 4KPUA 1S9DA 4D56A 2DHCA 5HZMA 2BGWA 1D1SA 1WRBA 1PU2A 2NOAA 1WCXA 3H19A 1NVVQ 1V3VA 2OFOA 4QT0A 1A9OA 3VNQA 1W4LA 4O8CA 3ZUGA 4DTCA 2WWHA 2XE4A 4I5GA 4RIFA 4FEGA 1CXZA 2YNMC 4YIKA 1VCOA 5G53C 1F2TA 3T3HA 3UUWA 2F4VB 3FWNA 3BMOA 4I2VA 3TE6A 3JR3A 5GM1A 1Z83A 2A9KA 2ZUDA 2O5VA 1A88A 1QH8B 2M98A 1T5OA 3DQPA 3K4QA 4LTMA 2XUPA 5IEBA 2AB0A 3AESB 4YT5A 3OJXA 1L7NA 4MUMA 4K9QA 1T8WA 2R9VA 4DJJA 4X20B 2OB2A 1XZNA 3G2JA 3PVCA 3DL7A 4LZLA 5B1HA 5IUKC 2DCMA 2D5CA 1S2OA 4D80A 4DIDA 1KPHA 2BMWA 1HFWA 4N7RA 1ANKA 1EA7A 3FPGA 2DMRA 3M1YA 3UJBA 1SVKA 1LFDB 1EM8A 1VFNA 5B58C 1NXVA 1T0UA 2QZ9A 2O2IA 2PG3A 3C5CA 2LZ0A 3C1UA 4ER0A 2VDVE 1L5KA 4BECA 3ZCPA 4EO9A 4CIWA 1GZDA 3ANYB 3R7WA 1RPAA 2D1RA 2FUG6 3M6XA 5HUQA 5KCMA 4LCJA 4RTRA 4MQEB 2Q9UA 3CX7A 2X5KO 5C1IA 3MCUA 1AZTA 1H94A 4AN4A 1C1XB 2JLRA 5JC8A 1YQGA 2QN9A 2GCIA 4G26A 1JQEA 1YVUA 4M54A 4FYIA 1R0KA 5JO9A 1IZZA 3HA3A 5KAMA 3W8FA 3CVVA 3HZHA 1ETHA 2O50A 4XD7A 5B2FA 2CL6X 2W90A 5KYUA 4BMPB 1H2RS 3ECAA 3ELYA 4R83A 3H4TA 4XX0A 4MWOA 3UKOA 1YZTA 3QMVA 2IKSA 4EGSA 1SMKA 4GPIB 3ADDA 2ID7A 5A0TA 1GGJA 2W71A 4AKIA 1WX1A 1U7PA 3MQFA 2P9CA 5JT1A 3JASA 1EVEA 4AY2A 4LNUB 4NIMA 2FMKA 3QPAA 1W4AA 2D0PB 2XWJI 3SSOA 5BMVA 4ONEA 3DZCA 4UUQA 3GGDA 4M0LA 2HTFA 2ZG6A 1FW8A 4WY8A 1S2LA 5IZCA 1LFAA 3S2SA 1L1RA 3D0RA 3S55A 1RXVA 4FX5A 2HB6A 5JVDF 1B14A 5HJ5A 1A1VA 3OCJA 5IJ0A 4L6IA 4NAVA 4ZT4A 1FTYA 5HFAA 6NULA 5CBPA 5EJIA 3F8WA 2NTNA 2Y76A 1DKOA 3RPEA 2PUWA 1BMFD 4ITVA 1YT5A 4JQYA 4EO4A 4EYKA 5M34A 5D6OA 1CLEA 4URYR 1UK7A 4MYDA 4PLFA 4RM3A 4RV9A 1XTTA 1DC5A 4W1QA 5HBRA 1QIHA 4AJLA 3KD2A 5U4XA 5A0FA 2WF6A 3ESXA 4UQOA 4F04A 1B23P 2QNIA 3E9CA 3O2NA 1IRIA 3Q1KA 2E4YA 3H2SA 3R44A 3OO1A 2GOYA 3FKSD 3BIOA 4PYRA 4ZN6A 1G4UR 2CDBA 1JG3A 1RCUA 4PXYA 5K8IA 4XM2A 2QJRA 1S4QA 5J4YA 1QCZA 3C1AA 4Z0HO 3ZQKA 5MHTA 4HN9A 3C3WA 3HR8A 2OHVA 3JQGB 3R3JA 2JZCA 1Z6PA 4QU8A 2DECA 1OZFA 3KT8A 4M1YA 1ABBA 1M34B 2O3UA 4MQ5A 3C8HA 4M36A 1LD3A 1XK6A 1BYIA 1GQFA 5CH3A 1RJGA 2YN0A 3AG6A 3IUBA 1JLHA 3A31A 3UMRA 3IVGA 1K9SA 1L4LA 5FFFA 2XECA 2F62A 1CQIB 1SCUB 1OLSB 1GKLA 1DEOA 1QIJA 1JX6A 2D5IA 2NVBA 3OE1A 3V33A 5BNIA 5GQSA 3H0CA 5CA1B 5CD9A 2RE8A 3LCVB 3PKJA 4BLTA 3MRVA 4MH0R 1PQPA 4Q1DA 1PQYA 1TYZA 5LZ9A 4BP9A 3BZBA 1ZHHA 3DLPX 4LMAA 1PT6A 3U4MA 3R76A 2F90A 2OBLA 3CNHA 4DSUA 1RZVA 5A03A 3X44A 1RD4A 1WIWA 2IYSA 1RLUA 2SHKA 2W2VA 1IBRA 5ALNA 1TFRA 3JD4A 1BDJA 2SKCA 4HOYA 2PAAA 1N6HA 2DVMA 2Z2YA 3HZOA 2NXNA 4F5WA 1ZBQA 4J2TA 2BF7A 3GNTA 4E5KA 1J06A 2QK4A 2RCYA 4KBFA 2OHIA 3EA4A 4UZFA 1I14A 3RK0A 3X1ZA 4OQDA 4PSKA 5BVGA 4W5OA 3F90A 5KDLA 4WZBE 3EE6A 3ET5A 4OCZA 1Q0HA 3B1WA 1DFHA 3NCTA 4LDAA 4BE7B 1UBJS 4OLFA 5IU6A 2PBRA 3RS3A 1CNFA 3RTDA 2CCJA 4C01A 3I9V1 2C92A 1XCGB 2C4NA 2G17A 2BKXA 3QENA 1M66A 4ICIA 3CUWA 1GKIA 1I7LA 1DFIA 3A3NA 4QOJA 4UARA 2IV7A 1NSYA 3BFVA 1YDEA 5B6IA 5L51A 5JJKA 4XTRA 5A3QA 2PXAA 3QUTA 1CZKA 3ZXSA 4BDSA 4YV1A 1FBTA 5FP0A 4I9NA 1D5WA 4ZOLA 3QEJA 3ND8A 3VNAA 4Q21A 3S3TA 4KXNA 2GI4A 4ZC1A 4UHKA 1XEWY 3B36A 4ZQHA 1E2BA 4TTRA 4HDMA 5H16A 4E51A 3DWIA 2V6JA 5JATA 5KYYB 2FEWB 3WQRA 4L6CA 4OBBA 4AZWA 4B6SA 4ABTA 3K6KA 1XIVA 3ROZA 1ZXXA 2IELA 1K8RA 1K6JA 1MRSA 3QY9A 4QOEA 1ACMA 1K3UB 2BZSA 3QUQA 1YQXA 3G9QA 2UXDB 1M5RA 4D9NA 5EIWA 4IJUA 1F7VA 4DC0A 2IP1A 2GO1A 3B60A 5IN4A 1ATIA 5FPHA 2ZJ2A 1QQ5A 2V3WA 4ZCQA 3VHLB 1E1CA 4Y2PA 2VKQA 2E1RA 4MPJA 5FBWB 3NZEA 4C0WA 1JS1X 3GQVA 2YXPX 4UQPA 1SHLA 2IW1A 3DEKA 2QUBA 3ENVA 1GQOA 1C81A 1VLQA 4NRDA 4R9VA 2FFHA 2AWNA 1H05A 3AVVA 2P4EA 1ONNA 1YB5A 1YQ9A 5DM0A 3SHWA 4ENRA 1MHTA 1TCVA 1JLMA 3IOYA 1H1LB 4LFCB 1MPXA 4O4JF 2AX3A 3D7MA 1RPZA 3ZJYA 1A97A 2QN8A 1R0BA 4W5NA 1EHCA 3PQ8A 2ASEA 1X7HA 3DOIA 2DUMA 1N1GA 1HDEA 1XF9A 1F8XA 2BKVA 1JBQA 3MWYW 3O3OB 2W8ZA 4RZQA 1ST3A 1ZCZA 2H11A 4AO8A 4F8EA 3KOXA 1GPYA 5BSFA 1A8HA 4FD2A 2XTNA 3H17A 3U7EB 2RK3A 3VC7A 4Q0MA 4PWZA 3QVLA 1LLFA 4UNQA 1NI4B 1R6DA 2ZT8A 3IPLA 1OAAA 2HWYA 5BN1A 2ZOSA 1QE3A 4CETA 4B09A 2V6FA 3LM8A 1B1CA 5AW6A 1U7DA 3LVRE 1NVMB 1IATA 1A7JA 2NX2A 4ALLA 3QMWA 4RY2A 4XWYA 2GM9A 3F73A 1UQUA 2C2HA 1CETA 3CPHA 4IIFA 1L2TA 4GI7A 4F38A 4Q39A 3L0CA 2ZS9A 3O31A 3MINB 4ZZIA 2GZHA 3A70A 1FF9A 2B35A 3KKKA 4FS8A 1G18A 4NXMB 2NZXA 1XNGA 2C5BA 1OLXB 3FRJA 1CJTC 4FYMA 3AFMA 5AM1A 4B3GA 5TPZD 2ZQYA 5HHTA 1SAYA 4M1MA 3VGPA 1X86B 4KJZA 4NJEA 4A0GA 4H1WA 2VPTA 1MJGA 1SUSA 2QD4A 2QVGA 2CEKA 3PDUA 3PYXA 1K9VF 4KK3A 2ECOA 4MINA 3W8DA 4BO9A 2PUGA 2EYUA 1LLUA 4FN5A 3KKLA 4JXXA 4GDFA 1ZWKA 4ZVSA 2WVJA 1JHPA 3ZX5A 4S05A 1KZGB 2XLCA 1DL5A 2I4OA 3ILHA 2H7YA 2P65A 4OHUA 1G2IA 1X6VA 4NR0A 3G6WA 2WJVA 4FMCF 4GM4A 4TS4A 2IEYA 4D5GA 4URXR 1ISIA 1C80A 1E7QA 1DJQA 1ZNZA 1CLUA 1TIKA 1W46A 2JD2A 3AYZB 4CIYA 3M0EA 3GU3A 4I46A 5HYVA 3KJNA 1VJTA 1GNTA 3AU8A 3B6KA 5I7AA 2CD9A 1X38A 1NF2A 2IZZA 4RDXA 1BX0A 1H0SA 3KSZO 5FKJA 1GPMA 2ZJZA 1BMTA 3LLVA 3NJ4A 2MU1A 3FCAA 4Q9AA 1SKBA 4Q9DA 3O2QB 4IF4A 1DU4A 1R27A 4MP8A 4TRMA 1ZW1A 3L8DA 4TV8F 4EB0A 1N9GB 4C30A 4OHXA 3RJ5A 1R5NA 4TKZA 3EIUA 1HG0A 1PT5A 2FVYA 2I54A 3GP3A 5D3MA 3VJMA 2CUNA 1N2CA 4NZZA 3FZQA 2HUNA 3K4PA 3GRUA 3I09A 3GYBA 4BN4A 5A4DA 1PNQA 4WOJA 2DY0A 2LR0A 3SNKA 2XHZA 3ROMA 3WLSA 2CVPA 4B85A 5BRAA 4OB6A 1P9WA 3LDHA 5I51A 4X5OA 2AKAB 2WIDA 2W2KA 1F51E 2V97A 4K9KA 1WCIA 4R31A 2JEOA 1VGRA 5KNLA 3N0VA 1W87A 3R1IA 3P9CA 1UFRA 3PICA 1PZFA 5TMEA 4C2BA 5H4GA 3ZDBA 3ELWA 1VCMA 1APBA 4QVIA 3U44B 3HVKA 3T7TA 5AO9A 1OFUX 2Z56A 4WEOA 4DIKA 2G5GX 2GZRA 3K9BA 2UDPA 3EARA 3GJ7A 2YIDA 2VO1A 2P2GA 3JSXA 1OR8A 1PV1A 3FBTA 1SBZA 4BVEA 2QTMA 4J0EA 2OZVA 2QD5A 4G0QA 1NNUA 4X41A 2E5WA 1BAPA 3G0DA 2BI7A 4NL4H 3RS8A 3WGZA 5JDCA 2OG1A 3B89A 2G8NA 1MABB 2GJ8A 2POCA 3DDUA 4B3JA 1RACA 1KI3A 4X60A 1NN3A 5KOHB 4NH0A 4QZVA 1KC1A 4FR2A 3TW8B 4C4TA 1CUSA 4EQ6B 4GX1A 1WQ1R 2DFDA 3K9FC 2G08A 1GILA 4G1BA 3GEEA 3V34A 3BIWA 1IVSA 1M34E 1Q5PA 2H7VA 2UAGA 3L0PA 4KQ2A 4A8JB 1MH9A 4CR7A 5A9RA 3L7JA 5AH0A 4ZP1A 4BO7A 2JFOA 1H3NA 2J7PA 3UWSA 4KXUA 5LP6B 1OH7A 5CA1F 1HZZA 3DZHA 3I6QA 4U7TB 1MXHA 3R5SA 1KDRA 4FMPA 2QTAA 2GASA 4IZHA 3RRFA 4BP3A 4UM9B 5KTNA 4BQRA 4O3MA 1R0SA 5KVQA 2NIPA 1E7RA 2OUIA 4Y9UA 1TQDA 3LNCA 3OF5A 5JE8A 2IXEA 5BNWA 5BYAA 2VYVD 4LHZA 2PGLA 1YBVA 2YH2A 3E18A 4HQOA 2R68A 1CW2B 2O06A 3HKCB 5LU8A 4B2IA 5HMLA 1YZKA 2A92A 3FSJX 4F2HA 1TQ4A 4YJHB 3NBFA 1EINA 1QIGA 3AKYA 4XEHA 5JR3A 4NCIA 4PSVA 5L3QB 1E9DA 1EWRA 2QRVA 4L74A 2PMBA 4HWGA 4J2OA 4FP9A 4KR6A 1VE9A 1L6IA 3HSYA 1XELA 4FGLA 5KIAA 1UEXC 3IT3A 4JP8A 1ESEA 4BV3A 2VVTA 1PWHA 1Z6XA 1CY6A 2FPRA 4KXXA 3H9QA 3VISA 5HKLA 3SVLA 2XGOA 4PSCA 4KCGA 4EBBA 3J81k 4HG2A 4XLLA 3GLSA 4NS4A 1U2DA 4XQGA 4N41A 4TXJA 3CCFA 1QIEA 1RKUA 3I3OA 1V4VA 1YBFA 2M6LA 3R8CA 5MFPA 2H52A 2LKDA 3F7MA 1ZRNA 4BMYA 5F1KA 1V96A 1TVEA 4OOFA 2Q1TA 1CB7A 2H57A 5FA5A 4D3FA 3VR4A 5MF6A 1S1CA 3PGMA 1YVDA 1Z2PX 3FB1A 5CLHA 5IKPA 4HDNB 3OX3A 1Z8FA 2FZLA 1NLYA 2JJ8A 4EHAA 1MW8X 4PWYA 5C7LO 1K7XB 5MDHA 1L3IA 3DEIA 2ZUWA 2FPUA 4JN6B 3MMSA 4E2WA 1XLTA 4QQRA 1D2AA 1KDYA 3I2HA 4MV4A 1FFAA 3PITA 4YWHA 1FP6A 3CR7A 2FEXA 5L7WA 1G8PA 1X7GA 4P3OA 1A8IA 2GEKA 4QAJA 2C4VA 1BQEA 1QYWA 5CTAA 4EM6A 4D41A 1F4PA 3D8RA 4DVGA 4FB5A 1KYZA 1QM5A 2GXSA 3C74A 3WLPA 3EQ9A 3KHUA 3OZBA 1CRQA 2DWPA 2AFHA 4MUEA 3I2JA 1E69A 1A3CA 1P9NA 1RC0A 4LIPD 2HYDA 2ISQA 3MMNA 2FOLA 3RU2A 1BE0A 1XRJA 4TVKA 1DAFA 4K2AA 4ZVOA 2VUSA 1RXIA 1TJYA 4YFYA 5AVRA 4PR0A 3PUIA 5C53B 1GFIA 4M9ZA 4AJIA 3B85A 5HKKD 3ABSB 3WYFA 2ZUSA 4KAFA 1K1EA 2IYYA 1W5BA 1Z4PX 4Z9XA 5FI1B 4Q9LA 3SYRA 1US8B 3MB8A 4BNVA 3CONA 4TXLA 5JHGB 3WO0A 4CLRA 1WEHA 2ZTUA 2QUKA 2P2YA 2ZEJA 3AINA 1OMOA 1RZRD 3G0HA 2OLJA 4MUXA 1RHUA 1L5YA 3RFXA 4F3NA 1YL7A 1IXRC 3RG8A 5IJXA 2JLQA 4RBNA 4ND8B 2PE5A 4I99A 4CEIA 1VI6A 4X93A 3SVTA 5DOZA 4KSYA 1GU1A 4MQFB 1Z5ZA 5DWDA 4DSZA 3ILXA 4BMDA 4ZCMA 4ZICA 4RVFA 1KH1A 5E6SA 2O8BB 1RT9A 4IH1A 4ZI7F 2ZRGA 4B75A 3CX8A 4EJFA 1WCYA 1T2FA 2F3RA 1TK3A 3H2GA 4BFUA 2G9ZA 1WB4A 1CNEA 2PPLA 2ZVQX 5K8LA 4R68A 3UCFA 1IG3A 2WIBA 3ZZMA 1E1KA 3ONFA 2JCYA 1USVA 2I87A 2JJYA 2QG9A 3DVSX 4K46A 4RVGA 5JNWA 2QRMA 1ZH2A 4QBHA 3RVJA 4ES6A 5BQOA 1EWVA 4OV6B 3A4MA 3IMFA 4FYKA 1SBHA 4O5OA 2BM8A 3AJ8A 4X7MA 1S0UA 1Y1LA 1J25A 4JJAA 2YYZA 3ZKWA 1J5PA 1QQBA 1D1QA 3UKDA 4ZAVA 4ZZ1A 5K0GA 3KVRA 2G1AA 1O5OA 1PDWA 1TQ6A 2J5RA 2J3MA 1E0SA 5AJYA 1M8FA 4E5YA 3VOAA 3JTEA 1XLUA 1Y1SA 1XBTA 4J7XA 4YJ3B 1D7AA 5LL6P 5JAUA 4OK3A 4NARA 2FWRA 2GBFA 2AL7A 3QVKA 4H60A 2EQAA 4J6EA 1M6NA 4RDIA 1RQ7A 3RVLA 3BWXA 1IY1A 2XMSA 2H7XA 3KOZA 3OOWA 4G0ZA 2DFTA 4OO3A 4Q9JA 5AW5A 3EMKA 5LN1A 2RB4A 3GPIA 1CUJA 2YS7A 2EV9A 3PF8A 2PLFA 1VYVA 2QM7A 2CLSA 4R3WA 3NATA 1KXZA 3BFKA 3N8IA 2WD7A 1W52X 3JYLA 3GFSA 3FNHA 3OPVA 1L5OA 4MV0A 1KZHA 3C15C 1BGWA 3A6JA 3IP1A 5AHWA 4RJKA 2FSVC 3D3NA 3OM1A 3WQBA 1RI1A 2ZWAA 2PNJA 1SOWA 3T99A 4Y2QA 5THXA 5AM3A 3EMDA 1C0LA 5BR7A 2IF2A 1BW9A 3SS8A 4HDRB 1QHHA 3TZQA 3TI7A 1K97A 2H5EA 3THSA 2PQ0A 2RGEA 4QFCA 2YWCA 1DELA 1LBIA 2FQ1A 3HDHA 2W9XA 4N49A 4TKVB 3GFPA 1XCLA 2B4TO 1U0SY 3GNSA 4MAAA 4QUGA 4A15A 3W5VA 1SVWA 1AF7A 1ZRHA 3OTHA 1ML4A 5ESXA 2DP4E 2AZMA 2FA9A 1J4AA 4H0FA 4Q4HA 3KJGA 4Q4JB 3VX4A 2OAP1 4HMOA 1H3EA 3BHMA 1U8CB 5KYWA 1XXHB 1YA6A 1KAGA 5B4VA 3FDXA 4BVAA 2JIQA 4TM8A 2H2HA 6LDHA 5IT0A 4EL5A 1IHOA 3QLJA 2VDMB 2FK8A 3RBZA 4M8SA 5EMNA 1JF8A 3VU9B 2C8LA 3O82A 3DOCA 3WLAA 4BAUA 1FP4B 3GRPA 2ZWOA 3EXIA 3AVWA 1GAJA 3NAMA 4JGBA 1JXQA 2VP0A 1XT6A 3INGA 4YB8A 1R1DA 4YMWA 2I22A 1JW9B 4D9EA 3AEUA 5IT5A 2DEUA 1BN6A 2G0NA 1SBCA 3HZZA 3JYPA 1CDOA 1ODSA 3JQBA 2QNBA 1J8VA 1GLVA 4IFTA 1XLWA 2FFQA 4OMDA 1GDHA 3PE4A 4KQMA 4EZIA 1Y33E 3BA6A 2CXTA 2O8CA 1EFRA 1BU8A 3IULA 3PCXA 4FQ8A 3EVAA 1I8TA 1T3GA 2YJNA 2WBLC 3H9UA 4PX5A 1U0OC 5IM4F 3NP7A 4PQFA 2IITA 3FOEC 1E3QA 1NG9A 1WB9A 4IQGA 1G1AA 1V1MA 4G5SA 2HA0A 1SXGA 1OWPA 4H3VA 3I32A 4YMIA 4ZEWA 5MGNA 1FYVA 2HNBA 4N7JA 2WYVA 3F3YA 4RCYA 4W9MC 4F9EA 3QLEA 3O95A 4RD6A 4XGIA 2VK8A 3S1AB 4DJ5X 2IX3A 2JLZA 3F9RA 3DL2A 5IYZB 3C7AA 4E1AA 1TB4A 3DOUA 1SHJA 1Z28A 5LMUB 5IVHA 3LCUA 4YO8A 5K8TA 2O14A 1CEEA 3H86A 1G64A 1YCFA 2NZJA 3FTCA 4NHOA 4UE2A 4RF2A 1T0JB 4MVJM 3TMKA 2NU8B 1XVAA 1SPXA 5JBQA 1GJRA 2X8AA 3HR7A 2VHYA 4QASA 2OVFA 3IALA 4Q7JB 3FMPB 3UJ9A 2XWSA 4POOA 4Z4FA 3WBFA 1RABA 4A8JC 1A7KA 2F1RA 1P74A 3L04A 3II6X 1ZI8A 2DFPA 1S4MA 3TTYA 2TMGA 2ZP1A 4Y7DA 4G5FA 5LYJB 1XKXA 1W59A 2CXRA 4P81A 2Q1WA 1E96A 2N46A 3GZNB 5HF5A 3AM3A 1UOPA 4DR6B 4AY4A 3HYCA 3A8TA 1JDTA 4HFRA 5DGTA 2DT8A 5A4MS 5IBCA 3LWBA 4DKXA 3K1YA 4M89A 5JPCA 3G0GA 4RY0A 1YJ5A 1BD4A 5B53A 3WB2A 2PSFA 1N1DA 2IEIA 4MEAA 2OCYC 4L51A 5CGZA 1QCCA 2FY8A 4LXQA 5KOJB 2AC2A 5AXDA 4FFSA 1INLA 3O94A 5ALOA 2WRZA 4ETIA 1EQ2A 2O2DA 4ZA2A 3LQQA 4EJSC 2VEDA 5B57C 3A06A 4EKGA 3GO4A 4R1MA 1QGZA 2I4LA 1QZXA 1RWMA 1X2EA 1D5CA 3D0QA 3O1JC 1E58A 1TPYA 2ERYA 3PRJA 4P6VF 5JAQA 3SCZA 1OD6A 4N3BA 1EDEA 3FMGA 5IEJA 4DY4A 4LKOA 1RWOA 1OF1A 4PRLA 1QRTA 4MLCA 4UW9A 1AGPA 2ZJ6A 2VJKA 2ZJAA 3JZIA 2C4MA 2WZBA 2WSIA 4LZPA 2J3IA 4FCVA 5H3LA 3TDNA 4ZI5A 1A2BA 2I2XB 2DLCX 3EG5A 2JH8A 1IWBB 3OUZA 2SBTA 2M2IA 1GEEA 1ZD4A 2R6AA 3Q9LA 1FZTA 1P2FA 5JCJD 2PD3A 2P30A 1A2KC 1L4KA 3AW8A 3E5HA 2F7SA 4IH4A 3TQQA 3V9PA 3ZWQA 1SPBS 4CEJA 1FFWA 2L42A 3CZRA 3PFHA 4TMYA 2XPCA 4UHHA 3DVAB 4QJBA 2ZI5A 3CZAA 4JUIA 5ITSA 4PG4A 3WIBA 1MIOB 4JZKA 4WFKA 4HQNA 2GJAA 1JQDA 3T38A 3LVBA 1IXKA 5GP1A 5JMPA 3UA4A 4ZDWA 3GPCA 3LQ4A 2CMFA 2EDAA 3QX8A 4HXFB 1FFGA 3AY0A 4TLLB 5CVCA 5IW8A 2BI4A 2NVOA 4EL0A 3MGCA 4G85A 4KIGA 3RJZA 2OZLA 4BQSA 2VJPA 2VRWA 1OB5A 3BE8A 4HAUA 1D3AA 1CIPA 5I4IA 2BGJA 1HF3A 2EZUA 2XUIA 4E3WA 2A9JA 2JLWA 3RKUA 3OF3A 1X8XA 3KZCA 2JAQA 1N3IA 3RUEA 4DEVA 1U8YA 4YXWA 2XUZA 1NJ6A 3LK7A 3VJKA 4PN3A 1G3MA 4YRAA 3SY8A 3GA0A 1ONPA 3GRKA 1QKJA 3FLBA 3ETJA 3FF4A 5J2UF 1WLSA 1VI2A 4GI2A 4BFCA 3DPSA 4XDYA 3ZE9A 3W7VA 1RSZA 1RYMA 3DMDA 4J0JA 3IDSA 3LUCA 3ZTTA 5A6VA 4E03A 3THXA 1Y5RA 3UMCA 4ZMSA 1X7YB 2IDJA 3RANA 5D00A 5ESRA 3LBFA 1G291 1LJ8A 5J40A 4YMSA 4DJAA 4DQUA 3QPDA 3UAZA 4N3CA 4RLSA 4BFYA 4KR7A 1WUHS 3QLVA 3EXHB 3DMGA 4ZRDA 3EW9A 3KXLA 2WPDD 3R3UA 3E3NA 1UEJA 5DMHA 2DLDA 2C7GA 3STWA 1NQAO 2VJOA 1QYDA 1QWSA 2BC9A 2Z4SA 1PHRA 2AOWA 3PRKE 3RFVA 2G4LA 1VIYA 2JCBA 2FR8C 1R9JA 1Y5IA 4WBXC 2GEUA 3A4LA 3KOOA 1KU0A 3I1JA 5AI8A 3TJZA 1UMDA 2C97A 3H5TA 3AI1A 3Q9NA 2GR9A 3GPBA 3H2BA 5H4HA 4GSLA 3ZU6A 4OJTA 4BEVA 1KNQA 1Z68A 2GHRA 4HSEA 4ROTA 1X3SA 4XIFA 3L1UA 1W88A 2XZLA 1ADYA 4DCCA 1E5LA 2ZE6A 3P96A 5E4JA 5HZKA 4IUDS 5FBHA 4N8SA 2HJGA 3TKAA 1OC4A 1XRNA 4PZEA 3K9LA 4MS1B 2MINB 4WIAA 3MPOA 2D7CA 2E6KA 2R6JA 2J3QA 3HJHA 4F0JA 1UT8A 3GLHE 3MBIA 2W43A 3Q5GA 4RHXA 3M6FA 4W9NA 4UZEA 1YR2A 1QSGA 2ZIZA 3LE8A 3PTAA 3BFPA 1U81A 1Y7TA 4CGYA 3WKDA 2G0TA 1IUNA 1Y4UA 2PZJA 4MV7A 4F2GA 4JYCA 2K6GA 4WK2B 4IDNA 2FMHA 3K0SA 1WXEA 4R71A 3IE2A 4RSMA 3U16A 5EPEA 4YUVA 4LE1A 2DXIA 3CLUD 4EFNA 5C7YA 4XYLA 3KYCA 3G5MA 3DB1A 1PJ4A 1SIBE 2IZ7A 2YFHA 3MWJA 3SE7A 3DE6X 4NK4A 3VR5A 4QEKA 1IOLA 2B7CA 3PGLA 4RENA 3T7JA 1JT2A 2ZRHA 1O6GA 2UZ1B 3A04A 2X2FA 4E33A 5I8WA 1DRKA 1S5PA 3THWA 4G9EA 4PZUA 2IYUA 3NRJA 4JL6A 3ROTA 4UAGA 4DILA 2PTHA 4OOEA 3OE7D 1G2OA 5JIBA 1JYSA 4JS0A 1N78A 2X7HA 3NAGA 4Z7QB 1E5XA 1RXWA 4KPFC 3T3NA 4LZJA 1O87A 1FDWA 4NVRA 1HZJA 5E6RA 4CV2A 4DCTA 2I7VA 4XYBA 1M2EA 3KXPA 3T5BA 3UXHA 1J2UA 3WBBA 4JV5B 1K66A 1G1MA 1ZK2A 1MZVA 1ZI9A 2ANCA 2I65A 2I7TA 3MA0A 3WWZA 2QM3A 2CXHA 5GVSA 1OPRA 1CE8A 4X61A 3CX3A 5CFLA 1WOMA 1O96A 1V43A 2DPYA 2BFBA 2QV7A 1VPLA 4L5YA 4HB0A 1QH1B 3G2IA 4JASB 1AKYA 4ACAA 1DHTA 3QVWA 1OJLA 1QO9A 4JK3A 5K8CA 2PK3A 1NU6A 5IDYA 4KV7A 2C1XA 5CX1B 2FU5C 3DPIA 4AZ0B 4TWBA 4KQIA 4Z9FA 3IVCA 1U2GC 3I5AA 1BJTA 1ZUNB 3M6IA 2AG5A 4TZKA 3ESZA 1XPRA 2IOFA 2CSUA 3TEFA 3WK8A 3TLBA 5TGZA 4B71A 3I1YA 4BEBA 4YMGA 2YRXA 5CYFA 1Q1EA 1Q1QA 1A5SB 2R85A 1E92A 4KBYA 3ROKA 4U2KA 3T5CA 3GJTA 2QWXA 1DWOA 3UG7A 1G6KA 1M8KA 1QG0A 1QK4A 2Z2KA 1Y7HA 2C4HA 4Q5IA 3CF4G 1F4VA 2CKMA 3BXPA 1BXZA 4D6PA 2DZDA 1W581 2IUEA 1RRKA 2FUG1 1SRQA 1P80A 2FZKA 2R7AA 2Q07A 4CN9A 1DCTA 1MB4A 1CRZA 2VHEA 1K8QA 5J4KA 4OL0A 2NSHA 2WUVA 2QBYA 2E4AA 4ND7A 3H9CA 3TD2A 3H5OA 4E07A 1YF3A 4Z53A 2YNMD 4TMKA 3TOVA 3GRZA 4FYWA 4RA9A 4ZT2A 4ZZ0A 1NNI1 1WXQA 4AX8A 3G2NA 1L4YA 2R6R1 4XZ3A 1OZ0A 1VKNA 1ZSYA 4M9CA 1LU9A 4ZO6A 3L79A 4F56A 1T1JA 2G88A 2G63A 2JLAA 4M1EA 2QP4A 1HYHA 1EK1A 1JP7A 4W6ZA 4BBAA 2QX9A 2A94A 5LJIA 1YJAA 3KHTA 1V41E 3OIVA 4UCFA 1PF7E 3LVQE 1NLFA 1E9CA 1GRRA 4XD2A 5HCNA 2OO7A 1T3HA 1NW5A 4J3JA 4CRWB 4TRJA 4E32A 3O8CA 2UZ4A 3OFKA 2Y1FA 4QPNA 1KJYA 3L4JA 1XP5A 3K70B 3P8ZA 4KQEA 1REQA 1C3EA 1XVVA 3M83A 4NF2A 5B1SA 1SHZA 1Y9AA 5FL7D 4BTEA 1VCIA 5BYKA 1XTKA 2FE1A 3RTGA 3NM4A 2GETA 3INTA 1OASA 2ZI3A 2Q4RA 1PN3A 1ZEJA 1ONBA 1GU0A 2VBGA 3QLUA 3N2GA 5DYTA 2YRWA 2J5XA 1SXJA 3DMHA 4YRJA 2WJ3A 2B98A 4CFYA 3HKEA 3CWCA 2HSEA 3K8OE 4YQZA 2CXNA 4QM7A 2EF0A 1Y80A 1XDGA 1KK3A 2BD0A 3I6IA 3KT6A 1DKLA 1Q7CA 4I4LA 1SVMA 1Z35A 2C9DA 3WFIA 3DOJA 4FW9A 1H23A 2PVCA 1DG1G 5AYVA 2LGJA 2R44A 1E2JA 3QELA 3WL5A 4YAUA 3HCRA 1ZOSA 2JLXA 3ZBPA 3FZNA 5ED4A 2GERA 1A2OA 1FRQA 1W0KD 2F59A 2XH8A 1RFGE 4KQGA 2XDAA 3WK4A 3TNJA 3ESBA 4RVUA 3QE9Y 3ENNA 3GH3A 4GMHA 5T6BA 2JFUA 1P0FA 3ELBA 5C4GB 3I73A 1XRQA 2W22A 3SR3A 3CKMA 3JR7A 1OX4A 4HWTA 2CLKB 3PUZA 4MVCA 4OKIA 2Y6UA 4WY5A 4S12A 3LKZA 3L6RA 3W9YA 2JC3A 1I4OA 3PR2B 4AJKA 2JRCA 4DANA 1MO4A 4I4NA 3VA7A 1KPIA 9LDTA 4V1CA 4DCPA 1DJNA 1HXHA 1XZGA 4HJXA 1XN4A 1RWWA 4Q7LA 1R7RA 2X3YA 1DBIA 1SIUA 4E7PA 4QFBA 2V8BA 2ZPUA 3JQRA 1MAAA 1PEYA 3GGSA 4G8BA 4RADA 4CKWB 4DF3A 5JG7A 2B1QA 121PA 5B1IA 4Z9BA 4KKVA 4YDRA 3ZHQA 4BAGA 3TECE 2HA7A 3IURA 4G9BA 4A2PA 5LUBA 4G81A 2VATA 2D2EA 4J16A 4AT1A 4DADA 1YOBA 2JK0A 1FRVA 3I9KA 3MILA 3IPRA 3QTBA 4RELA 4UE3S 2DQZA 2HW8A 3IELA 4C4XA 1MOZA 4F46A 5KJ6A 1L7VC 4JY7A 5I9NA 4DR4B 4ESEA 1RQXA 1JSCA 2PRSA 1CJMA 1KDOA 2GBLC 4E30A 4NONA 1LB1B 1UBOS 4JYZA 1E3DA 5FOUA 2CHFA 3A9CA 1NE7A 4WLEA 2BUAA 4B5KA 1N9KA 2FWAA 2A1TR 3C24A 3IAHA 4ZPJA 4P3YA 1AK2A 4G86A 4QBFA 4EJMA 4M88A 4ESVA 5JH7B 2UXBB 3RT9A 2C31A 2ZJBA 3EBPA 3FYUB 3EXHC 2FPOA 4J03A 4PSUA 1VZ3A 3R6GA 1Z7GA 2HHHB 1ESZA 1P3DA 3LI2A 3OFSA 1FMFA 1IBMB 1FJ2A 4DV2B 5KVVA 3E22A 1SG0A 3DDOA 1QO0A 4NQRA 4HP8A 1WXDA 2COEA 2GNAA 1HR0B 5CB0A 4X7RA 3KIPA 3AQ4A 2OCBA 3WMWA 5JPDA 4FOSA 4B3RB 4CM9A 2WA2A 4ZCTA 1PKXA 3H04A 3EAFA 2G28A 3LBAA 1CULC 3JWPA 4PU0A 3BSWA 3VH1A 4OI1A 3GPLA 1RWNA 1HRDA 1TNDA 2AXQA 1QYRA 2VC2B 3FGNA 5F35A 1XROA 4EA9A 4D92A 4F12A 3PTLA 4IXNA 3RTAA 3DLTA 1FXWA 1XTUA 2DQ4A 2WU1A 2B3DA 4MJ3A 2E85A 4GX5A 2FDRA 4KUGA 4DM4A 4Z54A 3GLFB 1YGYA 2ZDGA 1D0VA 2YHSA 2YV2A 3VC2A 2DAPA 3RF6A 1JWLA 1ADJA 2HWUA 3IHTA 4XWKA 3OZAA 2Q7XA 3QFSA 3MNFA 5EWMA 5C5EA 4Z7JA 2MYNA 3FPAA 3DAYA 3B3AA 1HO3A 3Q7PA 8OHMA 2C9YA 4H6PA 5C8YB 1M8JA 2VJDA 4AZ3B 2AOTA 2MYUA 1SVOA 4NEGA 1FSSA 1RQ2A 2A0KA 5AVJA 4B8ZA 4BLQA 4WOPA 1Y9JA 4YV2A 3NVKI 2FXIA 4X84A 5HQTA 5IDXA 4AP6A 1QIMA 2VTDA 1G20B 2NYRA 4Q3DA 5JARA 1GGKA 1XO1A 3CGGA 3HY4A 3LUJA 3AVUA 4JI1B 4PRKA 3M1IA 3O83A 5DO9A 5ITZA 2N0SA 4O63O 1YL6A 2PUJA 2VRCA 3OEHA 1FRFS 3E53A 4PQYA 1AQYA 4FGJA 4FHEA 3T9AA 4F6LA 1W1IA 3SM3A 2HRDA 3KR2A 5LWHA 2ZAYA 3ZQUA 1Q3HA 1J2TA 1AT1A 2KHZA 4AKSA 1ZJYA 1SVIA 2QVBA 4YMUA 2CFOA 5BSHA 5ALRA 1MEEA 2V0NA 4LVNA 2D59A 4PGGA 1C9YA 1LS6A 4M0KA 2P6MA 4X90A 4MQLA 2WV9A 1TM7E 5TC4A 3NGMA 3PFFA 1SUBA 4RZHA 1YK1A 5CXXA 1ARZA 1NU8A 3R24A 1WHTB 3RJMA 1U63A 2PA0A 1YIAA 5SZKB 1YDMA 5AK0A 2DSTA 5IZCC 4GVLA 4YHBA 4QYMA 3TLYA 4YJDA 1CDZA 3UM9A 2B1JA 3BE5A 2AN4A 3UT0A 4BNJA 1RVV1 2JGFA 2KB0A 2ZYAA 3R75A 1SRRA 4XUGB 1W96A 3BIJA 5CVTA 2I2CA 1ZCBA 4NZNA 2QY9A 3PR3A 5JD3A 6ADHA 1K4MA 1UQRA 5BSWA 4DSOA 1NF3A 2VJQA 3AH8A 1RHJA 2H54A 3ON5A 1V47A 3UN1A 4O1MA 3UOAB 4B4UA 4CLOA 1TUIA 2G9UA 1SQSA 1XZPA 2EWVA 4O4LB 1KYVA 4PYIA 5EYPA 1LZLA 2PCLA 3SGLA 4K05A 4O5AA 5B7QA 2NG1A 1XCMA 4MW4A 1J1ZA 1UT6A 1ZUHA 2Y9PB 1SUFA 1PK8A 2HCJB 1EX1A 2QRPA 1ORVA 3BULA 3MJSA 2CGEA 1HC7A 2XMZA 1PGJA 2CK3D 1FYXA 1Y34E 4P8RA 4WBNA 5CVVA 5BSGA 4BGDA 3AVPA 1V11A 2WUFA 4CQJA 2IS1A 4K9LA 4IIJB 2LBPA 3EWNA 2XF8A 3W5HA 1BEZA 2XXJA 3W77A 1MFZA 3A1VA 3GZ4A 4ZARA 4L02A 3EMBA 2YVQA 1FTQA 1P75A 1PQUA 3CMMA 1OXUA 4O8ZA 4PCLA 1SFRA 1XX6A 1UMBA 2CLFB 2NO0A 1ZEMA 3DLAA 2DFNA 3UK0A 3WLOA 2WYUA 3GBSA 3DC2A 2QW0X 5DHQA 4KQ9A 2FMFA 1IWOA 4AUMA 4U7FA 3KVNA 1JIXA 2B8TA 3IUPA 1ESNA 5CYOA 2WD8A 2XIQA 3GT4A 3KK0A 5KAPA 4CDGA 3A58B 3BORA 4Q4AB 3ILYA 3GJYA 1XHFA 1YB7A 4ZRNA 1WJGA 3BEOA 5E9QA 4B82A 4MGIR 4ZV7A 2HU5A 3J81A 1GGNA 3DFMA 1CUFA 2FHPA 3HBAA 2WQZA 1J0BA 4QUDA 2AMYA 4LHEA 5K09A 1U0EA 4JJ6A 4UCWA 1UBSB 5EWLB 3EVCA 4LJ4A 3E3MA 4L5IA 2JFNA 2IU6A 3E27A 2C8VA 2DJ5A 1JG7A 4EBFA 4TZ6A 1HDRA 4J4TA 3S44A 4CQLA 1FFEA 2R5WA 3RUIA 3K70C 3SJCA 5I01A 4QIHA 3W5SA 1K3FA 2B69A 4XWOA 4X8OA 3H2YA 2D5AA 4RFLA 3RU9A 1EDZA 4Q7QA 4BO5A 4EW1A 3NBQA 4GPZA 4O4HA 2JKYA 5JLJA 3GN1A 2EWWA 3L9XA 4I55B 2PJDA