3NR2A

Crystal structure of caspase-6 zymogen
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
262
structure length
233
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKVEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Crystal structures of human caspase 6 reveal a new mechanism for intramolecular cleavage self-activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 233
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nr2A00
3GJSA 1QTNA 2WDPA 2CJYA 4QUHA 2H65A 4ZVQA 4EHDA 4I1RA 4NOMA 4EHLA 2H54A 4IEFB 2J32A 5IABA 5IARA 3P4UA 4QULA 2NN3C 1RWWA 5H0IA 2FQQA 1QDUA 3KJQA 2CNNA 2QLJA 3K7EA 4QTXA 3UO8B 4N5DA 1RE1A 4N7JA 3H11A 5LU8A 1PYOA 2K7ZA 2QL9A 4NOJA 3H1PA 2XZTA 4N6GA 4IYRA 4EJFA 2AR9A 3DEIA 3V4OA 4PRYA 4EHNA 4QTYA 2HBRA 3NKFA 4D3ZA 4I1PA 4PS1A 3D6FA 4QUDA 1F9EA 3D6HA 4EHHA 4QU9A 3D6MA 3ITNA 1GQFA 4QU5A 3V6LA 3SIRA 5K20A 1RWXA 3NR2A 4JB8A 4NOLA 2XZDA 4NOKA 4NBKA 3V6MA 4PRZA 3H13A 3SIPA 1SC1A 4QU8A 4ZVRA 5IBRA 3UOAB 4N6OA 1RHJA 1RWNA 1SHLA 3PD0A 5IAJA 3V4LA 2QL7A 1SC3A 3NS7A 4QUIA 3S8EA 1KMCA 4DCPA 5IBCA 3E4CA 4ZVUA 2J30A 4JJEA 3DEKA 2H4YA 1NMQA 1RHKA 3EDRA 5I9BA 1RHUA 4JR1A 4D3YA 5LU9A 3BIJA 2H51A 3QNWA 3V3KA 1IBCA 1RWMA 4FXOA 4JJ8A 4JQYA 5IC6A 4N6NA 4QUGA 5LUBA 3RJMA 2H5IA 3R7BA 1RHRA 2CNKA 3EDQA 2HBQA 4ZVPA 1BMQA 2C2KA 1ICEA 2P2CA 3DEHA 1M72A 1RHQA 1RWPA 1F1JA 3IBCA 3IBFA 2FP3A 1RWKA 2XYGA 3DEJA 5IASA 1RWOA 1I3OA 1GFWA 3GJTA 4FEAA 2J33A 1K88A 2CDRA 4M9RA 4N7MA 4DCOA 4JQZA 1SC4A 4AWBA 4ZVTA 2HBZA 4ZVOA 4NBLA 3KJNA 4EHFA 2C2ZA 1JXQA 4QUBA 1NMEA 4JR2A 4ZVSA 3PCXA 3R7SA 4EHAA 3PD1A 5IANA 5IAEA 3R6GA 2H4WA 3H11B 1CP3A 5IAKA 2FUNB 2XYHA 4JR0A 3R5JA 4HQRA 5IAGA 3V55A 4HVAA 3GJRA 3GJQA 4QU0A 2QLBA 3H0EA 1RWVA 1I51A 4FDLA 3KJFA 2CNOA 4PS0A 1CVRA 3S70A 2C2OA 5LUAA 4AW9A 4DCJA 2CNLA 3P45A 3R6LA 2HBYA 4AWAA 4QUEA 1SHJA 3R5KA 4FGUA 4JJ7A 2Y1LA 4EHKA 4NBNA 1I4OA 2QL5A 2DKOA 2J31A 5JFTA 1I4EB 2QLFA 2Y0BA 5I9TA 1QX3A 2C1EA 5IBPA 1RHMA 2C2MA 1PAUA 2H5JA 2XYPA 3R7NA 4D3XA 1K86A 4HQ0A 4LSZA 4QUAA 4QUJA 1NW9B 1NMSA 2CJXA 3OD5A 2H48A 5IC4A
chains in the Genus database with same CATH superfamily
1G7TA 3QKWA 2GCOB 1H5QA 1KK0A 4IH1A 3WNDA 2H65A 4YAFA 3WZ2A 4EAAA 4RLQA 3EXHA 2Z9CA 1OLXA 2R48A 2JLBA 1XF9A 4L7VA 3V1YA 5JXHA 2X1VA 1EG7A 3CZAA 2DKFA 2QVBA 5EVJA 4HJRA 2EJBA 4NYIQ 1WXEA 1DZ3A 1PGOA 5TX7A 4ZMBA 4H77A 4GWGA 5E38A 1ODFA 1L6RA 4KVFA 1YRWA 4I4IA 4HDOB 4TRMA 4TVKA 5FTKA 4YT5A 5G0WA 6LDHA 2IYFA 4O29A 4RCYA 1XHFA 5LZ4A 4HFJA 1HQKA 3BXZA 4HB4A 1EXDA 3KSRA 2DFDA 4O1IA 5DMXA 2E5WA 4KFRA 1YDGA 4ENQA 1L7PA 5KNLA 1C9EA 3QUQA 5EJ4A 4M55A 1OI3A 3FI0A 4NYJR 1CDOA 1JQDA 1U5BB 3K31A 4R2XA 3HVIA 4NBKA 3UB2A 1U90A 2Z2IA 5B3JC 4N0DA 1P17A 2YTZA 5G02A 4XCXA 4Z2YA 5J2UF 4ITRC 2FMUA 1QAQA 3ZIDA 1RRCA 1M2JA 4F6LA 3C3JA 2G06A 3I0MA 2YX1A 3O93A 5CNMA 4QYXA 4L5BA 2RIRA 4PZLA 4D9GA 4MRNA 4KREA 1A1SA 5JSKA 2FZ4A 1KH1A 5CVEA 2ZUTA 4WADA 1GLVA 3GROA 4Q9HA 1DWQA 2FFQA 1N1MA 3IOBA 3TEFA 1J8DA 5HZGA 3PC3A 1OOEA 1DDIA 1L1RA 3LBYA 3LDGA 3FE2A 5IC6A 1LFDB 1U2RA 1I6WA 4FKZA 4MB0A 5AW9A 3ZY4A 4QVIA 5K4AA 3HXMA 2DFKB 4H9GA 4V0RA 3MB5A 3V8BA 1P5RA 2IEGA 4XUCA 4DSUA 5C8YA 4CMHA 4Q7MB 2YY5A 2GN8A 4RMIA 1CUHA 2ZJ6A 2X0IA 1Y0BA 2RAUA 2QN3A 4RZ3A 5L9AA 5FP0A 2HXYA 3SICE 3COPA 2OTCA 1P7PA 4IIBA 4ND3A 3UH1A 2BMJA 3ETCA 3H3FA 4L51A 3CO5A 1B43A 2GNOA 3HWX1 1ZNXA 3BN3A 4O6VA 4F8EA 2H4HA 1NFQA 2IK8A 4AP9A 3U3ZA 3LUKA 4JT4A 2EARA 2X8AA 3DULA 1YQUA 4KLZA 1R8SA 3L1UA 2Z2JA 4NATA 1GTRA 2SCUB 5A03A 4WASA 2IPXA 2IX9A 4KE8A 3HEMA 4I0WB 3E8SA 2ZS9A 4I3FA 4OKSA 3TXAA 2HJSA 3W8DA 5H8WA 4OB7A 1T5OA 2WYOA 3UVEA 3NHAA 5KOHB 5K09A 4B7CA 2A9QA 4CM5A 1KHTA 4KFUA 1TKAA 1NAHA 1OTHA 2FJPA 2PKXA 1GGJA 5SYNA 4KQMA 1IBSA 3VGPA 5CLGA 1V3VA 5B6PA 4GVPA 4XM2A 3SSNA 2QUJA 1DC8A 3QQ5A 5K51A 4M0EA 4EUFA 4L07A 4X3PA 1R0LA 4B2LA 3WGZA 2H54A 5TQ0B 3FPHA 2NVBA 1IC6A 3NNNA 2O2IA 2YYYA 3OFKA 1XLTA 4EPVA 2Q1WA 1FBNA 4B5LA 5EP1A 2F1IA 4X45A 5BWLA 3GGSA 2VG8A 3OHSX 5IHXA 1T3GA 4IXDA 3KV3O 3RS9A 4RIFA 1AKUA 5KTPA 521PA 4C2BA 1EWKA 5CM8B 1N2ZA 5B30A 4EZIA 3BDIA 3L7MA 5BW8A 4IYRA 3SC2A 2NXEA 2ZSFA 1X7ZB 4EWLA 4DV4B 2BE9A 3Q8KA 4LF6B 1BGWA 3O4HA 3CRMA 3WWCA 2P1RA 3MWGA 4L6IA 1XRMA 4O33A 4R1TA 4JYZA 3F78A 3CLSC 1BXRB 1JDNA 1Z2PX 2Q5CA 1XU7A 2FHPA 1O97C 2GGSA 3EGIA 4A03A 5JHHB 3RK4A 2ZR9A 1MX1A 5C3UA 2WJ4A 4HXEB 3BWDD 2NSHA 1RRFA 4D96A 3FTDA 1YZNA 5BWNA 4L6CA 2SKEA 1NOIA 2Q0XA 1Z07A 3LPNA 3N8IA 1EK1A 4ALJA 1UBGA 2Z98A 2UAGA 1BCRA 1I24A 1IM5A 3JRWA 4FGJA 4Q4HA 1YGPA 3NBQA 4YWJA 4K6OA 1PJQA 1PHPA 1AZLA 2QLLA 3WE7A 2HKIA 4IIYA 4ERXA 2G04A 4Q34A 4Y0NA 3NT2A 4YQYA 5T41A 3OX1A 2XIQA 1XDSA 4XQ0A 2XMZA 3AEUA 4O63O 1GQOA 1HO3A 2HNBA 3VX3A 5EWLB 1X0VA 4QDKA 1U1CA 4LC0A 4OPMA 3KUUA 1BA2A 4YRNA 3ONWA 3ETEA 1A96A 2O1SA 2WG1A 1RP1A 3SU8A 3NV9A 1YH3A 5B2FA 1JJAA 1R6TA 3GPCA 2I65A 3GLQA 3HSSA 3O91A 4MVWA 5H3HA 2CE7A 1WXGA 1QTQA 2BD0A 4C4AA 3KEMA 1XP8A 3G0GA 4MEJA 2WUGA 2CZCA 1OFIA 1AU9A 1NUTA 3AF5A 5IASA 1K63A 1JVBA 1VQ1A 3LC0A 1CULC 3TJMA 4O2AB 5SZHB 5D01A 5CEEA 5I8PA 1MFZA 1T25A 2NPIA 4G26A 4EG4A 1Q83A 3TO5A 1V1MB 2H7XA 1CUGA 2WU8A 1KFBB 5G4KB 5IAAA 3SMQA 1S02A 2HWXA 5KNCH 5HQTA 3FHTA 2D5IA 3FMIA 2A0UA 3H2JA 4RWZA 2PHZA 1NMXA 3HEBA 2ZTLA 3WDLA 3WGOA 3JQ9A 1IXSB 5ALJA 3SBXA 3Q7IA 4FS8A 3OP1A 4X66B 5EIAA 5FHQA 4NEGA 1BJRE 4LISA 1YZFA 2R6ZA 1TZCA 1KDPA 1EMDA 1QG6A 1XN1A 3FETA 1KK3A 4J43A 4BV9A 1XQYA 1SQFA 3TE7A 1Z6PA 2QE7A 1SH7A 4PPNA 3ICPA 2P7HA 4Q7LA 2BEVA 2AI3A 3WIBA 2AE1A 1M6WA 2XUZA 2FFAA 2RCNA 3G8BA 3KC2A 3NVAA 4KWIA 1P1JA 3N07A 1N3YA 1GCIA 3ZIAA 3AR9A 1F0KA 3HRKA 1K3FA 4I46A 1W4AA 4DWOA 1DSSG 1ORTA 4CCAA 3W79A 2O05A 3NHRA 3VKWA 4BVAA 1EQ2A 1G4AE 3CX6A 4P7JA 3H1GA 1NY6A 3KEGA 4H16A 3DT8A 3RYIA 2DVMA 1AZSC 4TKUB 3HXPA 4CDGA 3N6RA 3H9CA 4C0SA 5KOJA 2HYIC 1NV9A 1SC6A 3JR3A 4DV1B 4IDDA 1N8SA 2VF2A 1Z6TA 3PUVA 5BSKA 4N41A 1CJBA 2KQUA 2OBXA 4MCAA 3HFSA 3L1KA 4OYHA 3TVTA 4DPKA 2PZMA 4LBZA 1MQ8B 3GLIE 2GRUA 2R1TA 4X8OA 1XPUA 4KR6A 3CXUA 3TFOA 4OXRA 1A9XB 2Y4OA 3HWWA 4PLCA 4QUDA 4GGMX 4YBZA 3TD9A 1TJYA 1LBQA 4JUFA 2PGNA 2AOUA 2YNMA 2Z56A 5EN4A 1X1EA 3OU6A 4YFVA 3FMGA 4BBPA 4P32A 3OCUA 3SIRA 2VQDA 5TPZA 4RV9A 2YBDA 1AN0A 2BMVA 2I3GA 4KACA 4XPZA 3MCTA 4Q3NA 1T4BA 1YXMA 5CURA 3U26A 2Q49A 4K2AA 4JLJA 5IBRA 1XV5A 1SHLA 3FSRA 2XXJA 6CHYA 721PA 1AD2A 3PNQA 5E6RA 4BRUA 2AWNA 1F8GA 2BKEA 1GCGA 3AB3A 3PKJA 3SYRA 1A2QA 1SC3A 2E4AA 3L0PA 3ROZA 2KLBA 2DWCA 2O57A 4HGZA 3R23A 4UULA 3T1HB 5IYZA 2BM1A 2EATA 3WWPA 4C04A 1O94D 2B5OA 4JLAA 5CNKA 5EHZA 4CLHA 4EX6A 2BZGA 3A3OA 1ZISA 2A57A 3INYA 1SG6A 3EQ7A 2C96A 4MQFA 4A6XA 1FS5A 3RUIA 1A9ZA 1XT6A 1KFJB 2HSEA 3I3SR 1S5PA 2OHXA 4FOTA 4KWCA 2AW5A 3EZFA 4W1SA 3WY9A 4Q3AA 3ZOZA 5DB4A 5K99A 1XO1A 5BQ5A 2WRZA 3GLGE 4LGYA 4D1YA 2G70A 2VAVA 1JR6A 3VR2D 3IVCA 2JJMA 1P8AA 3JQ7B 4GW3A 4JITA 5CM2Z 5HDBB 1MQAA 1I5OA 1MT0A 1I2ZA 1XRLA 2Q1TA 3MGCA 3MT7A 4KQFA 4ND4A 1SY7A 1NOJA 1YV9A 4GT1A 4RF4A 4XR4A 3TQFA 4A27A 1QYRA 1OAOA 4KDEA 3U37A 1EG2A 2ZBDA 1USIA 3PDWA 1V8PA 4QGGA 3ZK8A 5ALEA 2JANA 4L0MA 5TJ9A 4TVSA 4FEGA 3TOCA 4UDXX 3JYOA 3JQBA 5JH7A 2DYKA 4RELA 4IMJB 5ES4B 3X1JA 1U04A 1HH4A 3UB4A 4AJNA 4YWHA 4G0UA 4JH0A 1I1QB 4OLHA 2A9JA 1W5BA 4Y1FA 1I01A 2XF8A 2JA1A 4HH0A 1GNVA 1N0HA 2Q6TA 1QFXA 3FR8A 3NOOA 3PGMA 3U1VA 3EF0A 4R7GA 3FDFA 5AH0A 3EFBA 3IDFA 2OGSA 1UPXA 2P4HX 1G18A 1AKEA 5TSDA 4RJIA 4OHUA 3AP3A 1BX0A 3ONDA 3I73A 3UATA 4U7JA 2VDNB 4Q7EA 4O2LA 3RWMB 5MF6A 1SRRA 3F4KA 4NWIA 2GEKA 3PFCA 4PO1A 4C89A 4UDOA 1Z6QA 1KVQA 3GMSA 2AYYA 4KXYA 2A8YA 3FPLA 3MW8A 1F51E 1V4VA 2TMYA 1B6RA 4KPUB 4FT2A 4GR9A 2XH8A 4OAOA 3RGWS 4BFUA 2VSOA 4CWAA 2HCJB 3B85A 4MV3A 3UAWA 3KQLA 2GJ8A 1V11B 5KU1A 1C3EA 2D7DA 3ZJVA 1VSVA 5DU2A 4PR0A 2NYRA 2PN1A 2QM0A 4ON9A 3BXXA 4Q7JB 4L95C 1SUEA 1BQEA 2Q4EA 2XNHA 1ND6A 3F1LA 3SVZA 5A9TA 4U2FA 1ORHA 2V1XA 4O8CA 4X7PA 4BZPA 1ZRHA 3CE6A 4AY4A 3ZKWB 4DPLA 5A2GA 5L8VA 2YJTD 1G2IA 2GTHA 4YJGA 3EUFA 3FCEA 1KQFA 1K0FA 2NZXA 3Q6IA 2ZJZA 3N86A 3UBMA 1ZJZA 4EL5A 5IDVA 1OH7A 2FZ5A 4QQNA 5TS2A 2Y9PB 2CJWB 1DOAA 1H23A 4G4SO 3H84A 3K4HA 5KSPA 2VFAA 1UJBA 3KXLA 1FQJA 1FRQA 1HFKA 4UBNA 1TX4B 4L9AA 4NFSA 4ETMA 2FWMX 1Z8FA 5DGTA 1KEKA 2EL9A 2J5RA 3N2LA 2O6HA 1MDBA 2Y0PA 2ZXFA 4DRYA 3L77A 2J9FA 3B89A 1Y6JA 3PIRA 1YMVA 4LJ5A 4AM8A 4C6TB 1W6UA 4ZTUB 2G9QA 2C58A 2HLHA 2BUCA 2UYOA 3R0QA 2A5FA 4IFTA 1QJ4A 3E5HA 2QUHA 5JNSA 3ESBA 2R6R1 1QO0A 1YRHA 2W2NA 3DKKA 2HSGA 4LHZA 4NNJA 5H70A 4ZGGA 3GEBA 4F93B 1NVVQ 1PT7A 1X7DA 5ALOA 4EELA 4RKWA 5HTOA 3QMWA 3VDRA 1M1ZA 2D3WA 2I54A 2PFGA 3ELWA 4EY5A 1XALA 5JNWA 4NCBA 4NICA 4I2NA 3PUXA 4C7OA 3E4CA 4BRZA 2R9VA 1YU9A 4N1AA 1RMQA 5DVZA 4TROA 5BN5B 5AQ1A 1QCZA 4YQFA 3WHPA 1V4NA 3R5FA 4HN2A 2QUZA 1Z4OA 4G6ZA 3SQOA 4X20A 3OZIA 1I80A 1VJ1A 2XIJA 3HKDB 5JRJA 3THYA 2UXBB 1C1DA 2YIDA 4E33A 1UMKA 3MGGA 5FJJA 1JYSA 3WGGA 4LY9A 2EEZA 1G6OA 4OYYA 3W8EA 4I14A 5ICMA 4L4SA 1RJ9B 3HPRA 1UMDA 1DBPA 4MJ7A 4DIOA 3SKYA 3PTAA 1CY2A 1QFJA 1OPRA 1VPVA 3F98A 3N9IA 1G0OA 3OQIA 4O0MA 5EZ6B 1ZJ6A 5EMNA 4EJMA 3ITKA 3NUGA 1D8TA 4TOIA 4CUKA 3E3AA 1X6VA 3ABSB 1PWXA 4QT0A 1SIBE 2FETA 4UCWA 4Q9LA 4BP8A 5K7SA 4G0VA 2QXYA 3KS9A 2VQSA 3JSAA 4GPBA 4ZVSA 4A73A 5ICCA 1CJTC 1UQTA 4RNDB 2WNSA 4ZV4A 1XQ1A 4E08A 4GPIB 5KC9A 1K4KA 1RZVA 2ZPAA 4BO1A 2IV3A 4JR0A 4Q4DA 5FI5A 4DBLE 4DADA 4N8DA 3F97A 5FEMA 4JBNA 3QXXA 2SKCA 1W5EA 2VNAA 4IQ4A 3RYHB 3FZNA 4Y1EA 1O0CA 2GILA 3HA3A 4LTNA 3FYCA 4X00A 5D8DA 3F7TA 3TFQA 5BVGA 1SXJD 1ZUWA 2Y4NA 1IM2A 2C2OA 3LUDA 3K0FB 4F12A 3L79A 1NZDA 2A0KA 1RC0A 1I0LA 1V5FA 2F6RA 5JXGA 1IOVA 3MSXA 3SDSA 2JGLA 1AK1A 1F0YA 4EW3A 5C8XA 4MMZB 2FE4A 2X19A 4P1ZA 5EZQA 3O8CA 1QDEA 1U0HC 3T3EA 5ENVA 2I7TA 1JU9A 5F1PA 3MQ2A 3TYXA 1ZITA 1T8RA 3TCKA 5JI3E 5HEKA 1LW6E 4O4JA 2W2XA 2R6AA 4MS3A 5EZSA 5C37A 3EARA 3MNFA 2DFNA 2OC4A 3G1UA 4J0QA 2R65A 4CQMB 5EJEA 5L53A 2CYCA 1LX6A 4NYJQ 3TNDA 3E1KA 3Q2IA 2RH8A 1D4ZA 1TA9A 2ZDGA 4J1TC 1K8RA 1RJEA 3NDRA 4BNIA 1Y5RA 4ZK2A 1SM4A 4LZOA 5LQRA 3HACA 5CX1B 1LS6A 3LXRA 2YJZA 2Z57A 2K87A 2B4TO 1JXAA 1N4DA 2CUTA 4FYYA 4WBSA 2BTEA 1AGRA 4Q9AA 1NP7A 4BO9A 2PH1A 4KAFA 3VGJA 5JMWA 5K4GA 4KN9S 4LDAA 1Q1NA 2D74A 2DSNA 5G40A 2VDUE 4G56A 5FWXA 1HMPA 3HKEA 3PNOA 1SD2A 3B5IA 4PLGA 4RAQA 3SX0A 2HSWA 5JMPA 1YBVA 3DMYA 4Y0VA 1P4GA 3RQSA 4EG6A 2E6KA 4YT2A 3DMFA 3QNMA 4JMPA 1CF9A 4FU0A 3UWKA 1GZ3A 4QU8A 4C3OB 4ESVA 1W88A 3K1JA 3QFFA 1MA3A 4HNRA 5GZ3A 1J2RA 1ZM2A 4FFVA 2ZW9A 3TL2A 4D9JA 2H08A 5IT5A 3ZQ4A 2V98A 1TMKA 1X94A 4HWKA 4M4SA 5AKJA 4YRFA 3R40A 2VJOA 4DV7B 5B1EA 2FLKA 2EZ9A 2R62A 3O1IC 4DNXA 1GPWB 4AKEA 5A0TA 4KKXB 4QOSA 1L5GB 2XGOA 4URVR 5F35A 3IAEA 1JIQA 1HE8B 2HGZA 2OV8A 5BV8A 1FVOA 1NONA 3LCRA 3MWEA 1LVUA 4IP0A 1X7WA 1OYVA 1IUOA 2C99A 2ZUUA 1DU4A 3S2EA 4BRWA 3AF1A 1QF9A 3EVNA 4YRIA 1EHIA 1HLPA 4QFDA 1SQ5A 4XVQA 2B34A 4MYCA 5C7OO 1PTJA 2OBLA 1VCOA 1GTMA 4JNCA 2VH5R 3LCJA 3LXMA 4ICIA 5DCUA 3S5JA 3ILVA 5IZCA 2BY4A 1FMCA 4ZICA 3DTNA 3W5UA 2MSEB 2HK7A 5FLKA 2QW8A 1I3MA 3DD1A 4B75A 4YRGA 1PNVA 2O3SA 1E1YA 1D2GA 3NOQA 4PLYA 3ZH2A 3V1UA 1PS9A 3O1JC 3VR0A 4BGEA 4V1CI 4RE5A 3PQ4A 4O4IA 2QLMA 7REQB 3RSCA 3U6BA 4RTSA 5CD9A 1L6IA 1ULUA 4N39A 5DCLA 2GZSA 2OAQ1 1CZKA 4PZUA 4EGJA 3OZTA 2Q5JA 1W0JA 2VJPA 1H9AA 3WHLA 4GPEA 2P9JA 4H1TA 3RUHA 1DFGA 3QW4B 1WXQA 1JX6A 1YZQA 5B4UA 3EXEA 1WF6A 4RY0A 2FQWA 3WGMA 3WISA 4A6EA 3LCMA 2RHOA 2NGRA 4C4YA 4I7EA 1NG9A 3AVUA 2IGBA 2ZRGA 3EWAA 4MS4A 4IS2A 3ZE6A 1YACA 2XMCA 3L6CA 3O0TA 1J90A 3A4YA 3KJEA 3GG2A 2O48X 3QVXA 1A7JA 2B8NA 3A6GA 3BHMA 3QVGB 4EPYA 4M1SA 3CF0A 3UHAA 3MTIA 4JGBA 1GXSB 1VP3A 4HDRB 3VBEA 2DM6A 2CYAA 1N2HA 1N2JA 4JLUA 3AI2A 1V1RB 2D1QA 3NETA 3A1TA 4LBWA 4OB6A 1XDBA 2V9CA 3OQPA 3PKZA 4P53A 3VNSA 2RARA 1L5YA 1VPTA 1R00A 4FYWA 1GGNA 3KJIA 4NENB 4E11A 2XGJA 4P3XA 2W6MA 3DXFA 3HDGA 3P0IA 3WMRA 4A5SA 5JCOC 2KJQA 3EJWA 3QITA 4QQRA 4F3TA 3GAMA 3UMRA 3O8RA 2ZRMA 2A92A 4UBOA 1UBTS 3GRZA 1EFRD 2QYTA 3N05A 1RAIA 2FPGA 3CO0S 3M6FA 4C6RA 5BV2P 4PXAA 4DLWA 3WLNA 4BVLA 5KHOC 5IT9A 3GGCA 4EBBA 1DTWB 2B5WA 1T8WA 3O8QB 1CZRA 2ZWIA 4WN9A 4ZMSA 4G67A 5I9IA 3GPLA 4KUEA 1JEQB 3CZPA 3F3YA 4AKGA 3AL0C 4NSNA 1KVRA 5ARBA 1TM1E 3HCNA 3ZV4A 2Q6LA 5B57C 1E1CB 1J0EA 3P71T 4Z9AA 1GNTA 3QQPA 5AVVA 1E3MA 4Y2SA 1J1IA 2XYVA 3UAVA 4DC9A 1MV8A 3LW7A 4HNQA 2P69A 5CIQA 1TTQB 4KITB 5LN1A 1X15A 1XVAA 3MWYW 4FS3A 4R69A 3NJ4A 5DWVA 3V4ZA 5FBLB 1Q20A 4F45A 5U4QA 3CMCO 1CRWG 4QGAA 4IJMA 1C9MA 3R5TA 5G1OA 1EFHA 3DDCA 4MAFA 4QNMA 4C1BA 5DNVA 1ORVA 2F59A 3SZOA 3RG2A 5ALTA 4MYUA 4BB6A 1Z39A 3E1SA 4OHCA 2O23A 2ZAGA 3HRIA 4CLRA 1IZYA 3WL6A 3SZUA 2N9UA 3KSUA 3NEPX 4P6VF 4BFZA 2BYTA 2Z4SA 4KBYA 1MAVA 2NQTA 3V00A 4DRXB 4M1YA 2M6KA 2H2GA 1A98A 5CHEA 1FU8A 3OX4A 3ROFA 1Y89A 4YN3A 2VS1A 3ZWAA 4E70A 3GLFE 4YP9A 5KX5B 1OLSA 2GRJA 3VUEA 4AN4A 4AZ0B 1J49A 2GD1O 4JU9A 2C1XA 4GM0A 4KK3A 1X86B 2DLNA 3K1TA 3TUIC 1LPBB 1FJHA 2ZP1A 2VNIA 4LYAA 2JIZD 1RR6A 5CCDA 4CTOA 4FILA 1IUPA 4I1OA 3AY7A 4ZDJA 3ZY5A 4K05A 4MKXA 4FLEA 2R47A 1LPOA 4RABA 2QRPA 4YDHB 4Q1EA 5HE9A 1DLJA 5H83A 3SMVA 3CUEF 3AW9A 1ISPA 1ZD2P 4FYXA 2WSSA 1UXGA 1RPTA 4OU5A 4X63A 4BMXA 2FW0A 1WE2A 5TY0A 5JYBA 5C51B 5T4EA 3GARA 1YQXA 3T94A 3V2GA 2F90A 3BSYA 3NHMA 2PX4A 1HYEA 3AKDA 5NLLA 2CV0A 1OPXA 4BMVA 2CBGA 1EVIA 1GUDA 1WXFA 3QY0A 2XKKA 3BJMA 4FZ5A 3WVNA 1RABA 5SZKB 2B0CA 2XDWA 4NCKA 3AWIA 1K5GA 4CI9A 2O3RA 1RWVA 3BXEA 2ZBQA 5A06A 2GBFA 3ZDAA 1T9CA 2VJAA 3BJZA 1BJKA 3NZEA 4IDOA 4YMIA 5MFPA 3PPXA 1Z4IA 1S3SA 1Z0KA 4M6WB 4Y6LA 1L5KA 2NIPA 2VR1A 3BQNB 1NRWA 4DR1B 1UKAA 3E8XA 1P33A 5DP2A 3BBPA 2X76A 3G13A 3E3OA 3M6UA 3RGGA 3WC4A 5AVQA 4LRSB 3GJXC 1UJ5A 1SK8A 4Q05A 4MLPA 4MO2A 4WLUA 2L69A 2KPOA 2PV0A 3EXHC 5D7NA 3RSQA 1TUBB 3EXG2 3I2KA 5CT5A 2AXPA 2Y1FA 2IHZA 3B48A 3LXXA 3ZI7A 2FVYA 2PX0A 2BFBB 2J0EA 3A4IA 3R44A 2E5FA 2OZLB 2PIDA 3G1WA 4ZAYA 4KN8A 3BTUA 4G4JA 3RNLA 4BVGA 2CLEB 1YK0A 4XGQA 2Q27A 4JI7B 3REOA 1HF3A 2FG7C 1E94E 1DXYA 1E4OA 1T8UA 2BONA 2V7GA 3NU1A 5P21A 4B09A 2F9FA 3DKVA 1Z18A 1Q7GA 4P38A 1P3Y1 2G80A 1O1YA 5KBYA 4L0DA 1WVMA 1TADA 2ZE8A 1O2DA 3N39C 1K1EA 2OK7A 4BLUA 4C0AC 2VQEB 1ZRNA 3L7IA 1OH5A 4RMJA 4DQXA 4IX1A 4F5EA 2C94A 4WNAB 4C0KA 3SG0A 2D62A 2WQ7A 3RUFA 1SXIA 3OPXA 4GI5A 5D3QA 3TIXB 3OWHA 1VHQA 5IAJA 1HDYA 2AEMA 2OAEA 3X0DA 2GTPA 1FSSA 3CUWA 3K30A 1NL3A 1UMCA 3K9FC 5FYDA 4ZO7A 3NCTA 1BD3A 4QUIA 4PTYA 1FFDA 1X19A 2IUTA 3IBTA 1IULA 1RQ7A 3CH6A 1ENZA 2J6BA 1WXXA 5BVHB 2GBLA 1D07A 1JZSA 3ZHYA 1RYYA 1TRKA 3SHWA 1UDCA 3KTOA 4E5UA 4JXZA 2JLQA 3KOMA 3K0SA 1VE1A 3TWOA 3IDSA 3UANA 4HVTA 4D4GA 4ZMRA 3DLCA 2OXFA 4RD4A 1CDDA 1Y8CA 1YZLA 4RXMA 4ZEOA 4M36A 5F9FA 1E62A 3AYXB 5HQ3B 3W5DA 2G7MC 3M1AA 4FFBA 4GI7A 3UB3A 1C1XB 4KO8A 2P0YA 3IHTA 3VO1A 4NY1A 3I4FA 3UOGA 4ARZA 2BT4A 2PBZA 1RMTA 3ZDZB 5AVWA 3RADC 4MNTA 4M76B 3BPSA 4I4TF 2FE1A 2J3HA 3OZFA 2XUQA 3E7PA 4ZVVA 1I36A 2V0NA 1QANA 4LVCA 1P9WA 2V6JA 1ZCZA 3EXHB 1KH3A 2P5UA 1OLXB 1U81A 2I2CA 3VH1A 3WGTA 3AIMA 3T35A 4PSCA 3ZU2A 4RFLA 3DBLA 4TTSA 4EHAA 1AO0A 1M0WA 4PCAA 3R7FA 2AKAB 2XD4A 2ZIAA 3ZH9B 1DQNA 4DR6B 1Y34E 3GVIA 1Q50A 4KHPB 4FE3A 3AQIA 3G2OA 3NHBA 4G37A 3M3PA 4FDMA 3L2OB 4LWOA 1XZBA 5JY6A 3HZZA 1YF3A 3HV0A 2G0TA 3F6BX 1SB8A 3JATA 1EXWA 2X0NA 1DUIA 5AI0A 4FNOA 5DTIA 4Y0AA 5K3FA 5EP2A 3WRVA 1JA0A 4C78A 3M6IA 2HBYA 4JB3A 4KR7A 4FYJA 4AS1A 1W0KA 1XKXA 2GBIA 2DUUA 2HJ9A 1WPXA 1VI6A 3H9EO 1AE1A 3OEEA 5CDSA 1SK9A 2BE7A 3WL5A 2PRZA 3NRJA 3ZWCA 1Y5NA 5AKGA 4I4CA 3V97A 1QIKA 1QHSA 1ZJ5A 5AICA 5IK2A 4KQ2A 4QUJA 2H18A 4TMYA 1A2BA 3A0UA 3ZHOA 1QTNA 3WSWA 3NAQA 5G1PA 4MGEA 4CIYA 2CXOA 1L0BA 1EGQA 3NC4A 1UBUS 3PD7A 2PD6A 1QRDA 5C32A 1R8QA 4QDOA 5JJBA 5TMEA 1FQOA 1G9SA 1USKA 3F96A 4LG1A 4Y2RA 3UFBA 3WGUA 3KQUA 5IVHA 1WZ2A 2Y2UA 2EG5A 3E9DA 2ZZMA 2JJ1D 2GYWA 1QHIA 2VJLA 2WAMA 5JALA 2C8KA 4G23A 2PD3A 4KZKA 3E9EA 5ALGA 3MCAA 2PBRA 4Z6KA 1QIDA 3GGPA 1PR9A 2PLNA 1DOHA 3VR3A 2VSYA 2QD1A 2H11A 3G2QA 1F9EA 2OB2A 4CPDA 2FEPA 4PCLA 2WWYA 3QSYA 3FMOB 4WOBA 1VE6A 1ZP6A 16PKA 2BWJA 4BQRA 2DSTA 1BRTA 1IWPB 4MGKR 5C8YB 4FKMA 1C41A 2QZ4A 1YOBA 4PG7A 3SHVA 3TX2A 1SRQA 3GC6A 4OK6A 3HZRA 1YL6A 1NVXQ 3OLQA 4EDHA 3K16A 1ITZA 1XD8A 3IAS6 3EIOA 1CCWA 4V02A 3T3HA 5JJ5A 1BZYA 2PIAA 1T0PA 3IV9A 2UYCA 3N6VA 3MT0A 3R8FA 1GNSA 3A04A 1PJ3A 4Y6RA 3NGLA 4W6ZA 1A2KC 1W581 2AHRA 2J4CA 2VWPA 3HLTA 1KFEB 2YJNA 1G38A 4OA8A 4OJKA 3MEQA 5IBCA 4ZJZA 1ZEMA 2JEOA 1Q57A 2VSQA 5EXDA 3SZRA 4JUBA 2REBA 3E2IA 5FQOA 4F4HA 2FEXA 1CY8A 1M1XB 1UJMA 3GCXA 3B1KA 3GOHA 4ZCTA 1CERA 3PHGA 1J39A 5D00A 4EDFA 3UUWA 3C7TA 1J2EA 1PDOA 3H5OA 3MUFA 4PYQA 1O8CA 3G7UA 3QOFA 4GWKA 4WXHA 4YK7A 1YRBA 5AHXA 3T1OA 3UJPA 1XXLA 2O06A 4UEQA 5KOIA 2ESRA 1E79A 1Q16A 4OM8A 4BLVA 2ZT7A 3LP5A 5F1KA 4R5MA 3AK4A 4CKBB 3OCJA 1UXHA 4BUZA 4F0JA 2DWQA 2VHWA 1CUUA 3O26A 4I99A 6PFKA 3ECAA 3MJFA 4F3RA 1CXZA 3MJVA 1JVSA 2PWPA 4CFYA 1D4AA 1FFGA 1ZYUA 2HU2A 3D8RA 1J6UA 3N8KA 5FOVA 4Z5XA 2HT1A 3JVEA 1QPBA 5EIEA 4UUNA 1AJEA 2QSUA 3BMCA 4XLTA 2EW8A 3ROTA 1WTAA 1SGWA 2PUDA 2F62A 4J9VA 1B8VA 1J1ZA 1JEOA 1WW2A 2C0CA 3ACCA 3EXIA 4HQ6A 1P1CA 2NO0A 3FPJA 2QP4A 3NHLA 1EFUA 4MCIA 2PG3A 4V0LA 3R8CA 1HNXB 1V25A 1UPUA 4IHJF 5KU7A 1X7YA 1N5MA 2WKWA 3PE6A 4H3KB 2DECA 3JQ9C 3EMKA 4GM4A 2BHTA 4JLDA 3JTEA 3ZU4A 1J8VA 1PLLA 3SC2B 3IPCA 1QS0A 3U3DA 5AVRA 2J3MA 2J07A 3DH0A 2B4QA 4YCCA 1YRYE 2OCXA 5DGDA 1DWOA 3DMPA 3M89A 3ONVA 3P9SA 3LWDA 4C4OA 2WW8A 3I6ZA 4MA0A 1I4DD 1T2CA 3SJUA 4HJXA 2SHKA 4LZZA 4XQ9A 2AMYA 2VUIB 2WSLA 4H1UA 4D6PA 2B1RA 5D3MA 1NT2A 1H6AA 3FI9A 4LJ9A 3U1TA 4B4OA 4B71A 3GYGA 1GTL1 4GI1A 3VNVA 3T52A 1G9XA 3A7EA 1VE5A 4INPA 1NMSA 4JWTA 4BQSA 1FFHA 4DKXA 1OW3B 1FA9A 1BCRB 1U1IA 5K0NA 4X1OA 4Q4HB 3GFVA 4L3OA 3UTCA 4WKCA 1T10A 2ST1A 3N0XA 4HS4A 5C5DA 3BD9A 2REOA 5ILQA 4H0NA 1PT5A 2ZULA 1JZTA 3D4PA 3ABZA 1E2NA 2IH5A 1PJCA 2NU7A 2O2EA 4M0DA 1CNMA 3RS3A 5DRTA 2AOTA 1Z5ZA 2JDIA 4ZQEA 3RRMA 4J4HA 4LZPA 4IKEA 2G88A 4HTFA 4PZPA 1Y4ZA 2IU6A 2ZETA 2GPWA 3TSWA 5HVNA 2PS0A 3VJMA 4A15A 5UKDA 4R1PA 4E03A 1JAZA 1PS8A 4GZMA 5C8DA 3IEIA 2PWZA 3M7IA 3WDMA 1PNRA 1ACLA 3B9RA 5M29A 1T5TA 1TZMA 2IEAA 2ET6A 1ISJA 2HT6A 3B13B 1H3FA 4EVRA 5ERYA 4P86A 2GEBA 2JIRA 3QUBA 5E7JA 1E2QA 4G1CA 1E89A 1L5SA 2UZAA 1UK7A 2AZTA 3OCXA 4MVCA 2P2DA 4S1PA 4DCTA 4NBTA 4ZDIA 4MVJD 1E59A 3DO8A 4PONA 2DJ5A 2GBPA 1RM3A 4NNPA 1IN6A 2ZWAA 3L6RA 4HNVA 4R9SA 2HIMA 3H9JA 4M53A 4RACA 2NQ8A 3B20A 2D59A 1GZDA 1HG1A 3IP3A 4BNLA 821PA 2G8LA 1CDZA 4ZRMA 2REXB 3W5IA 5AJYA 4DUPA 2NM0A 5FOXA 3CW9A 3AF4A 3ZTWA 3N70A 2RONA 3OE7D 1TYCA 2Y93A 1L4FA 1NVFA 2XQJA 4LY3A 1T1JA 3RJMA 2JH8A 3E7XA 3H97A 1NW3A 2BEVB 4CV0A 2EZUA 1LFAA 2H0QA 4ESEA 1T2DA 1WDMA 2MYUA 4L4RA 4DT1B 2HLPA 3NXSA 5EZYA 3TE6A 3NEAA 3P94A 3VNBA 1AQLA 3MQ4A 3RFUA 4UHKA 1MZPA 1PS0A 3KPYA 1G1MA 1PNTA 3KZMA 2O9JA 3JQBC 4R41A 4FEYA 1IOZA 3BJRA 1B0UA 1EDDA 2PGDA 3OSZA 4HC4A 3RYIB 4XUEA 3BE8A 4HAWA 1ZOPA 5KOJB 3V8MA 2D5BA 4C87A 2JB9A 1U3FA 2H4WA 1ONPA 5JS8A 2VT3A 4DUGD 1P4JA 1VB5A 5L7TA 2C7QA 2R1TB 2ZPUA 1EAYA 1XTVA 5TQVA 3T5BA 3TRIA 2D13A 3TK1A 1HYGA 3L1IA 3GW8A 3LQYA 2DT8A 1ADYA 1UDXA 2V7QA 3C0KA 3OZEA 1PV1A 5AO9A 2X5OA 1M73E 2QAJA 4RKFA 2AOUB 2HA7A 4Q37A 4UUBA 3H2BA 2G5TA 3KD2A 3OOEA 5F5NA 1DFIA 3ZGLA 4B6RA 1RCFA 1ZA2A 2VTDA 3GO4A 4FYIA 4LHEA 4J6EA 1IJFA 1KJIA 3OIUA 5FLYA 4YRLA 3A1WA 3SYTA 1EWRA 5EEGA 1K9VF 1HDRA 4JP3A 4MHTA 1VLMA 2WU4A 1EI9A 2J9ZB 2WVHA 1I32A 2XCUA 4O08A 3U4GA 3UCFA 2JL1A 1HR0B 4FXPA 2E4WA 3SEAA 1UR5A 4PLWA 5LCXA 4ZVQA 4BNFA 1NIPA 5CK5A 1E6UA 3L92A 3VSAA 4ZWNA 2IXTA 3U9LA 4F6RA 3AUFA 4TWIA 4RPJA 5AMXA 2IW1A 1N6HA 3H6GA 1OX4B 2HV9A 4YEDA 3IKLA 4KRFA 2F3RA 5I7AA 2PAAA 4Z1OA 1A9QA 2CXPA 2QM8A 3GEPA 3JWEA 3MXOA 4GYYA 4MQFB 2L2QA 4Z7JA 1U6KA 2JLVA 1SCAA 3ZNQA 4MYDA 3T95A 1SIOA 4WJKB 4BFXA 4EUHA 1MHPA 5FI1B 3MWJA 4CUZA 4EVQA 3IMKA 5DLYA 3OJLA 3AEZA 4GD3Q 2WIAA 4RTKA 2W93A 2GB4A 4IDAA 4Y2HA 4ZYYA 2XZPA 2VYVA 3MGBA 4GICA 1QB8A 2ZB2A 1E99A 3OZSA 2WHRA 3KQVA 4MGYR 4M54A 4UMVA 5TQJA 4UCQA 2OORA 3OLWA 4ER6A 3A1EA 2Y0EA 3N1UA 3DLHA 4J3FA 1UBSB 4I9HA 1BU5A 5BSWA 3OLXA 3M49A 4JFAA 1E9CA 4LGCA 3TX6A 3TM5A 3WYEA 4AIRA 5JH7B 3A1SA 4URUR 2CXTA 3IBYA 4D46A 2B6NA 5JS7A 4LOAA 3PHCA 5J4KA 3NWEA 4BKRA 5A2QA 1QQTA 4MXDA 1B1AA 1FMJA 1Z4PX 5KVCA 4HBZA 5BP7A 4CU2A 3MFQA 1E32A 3FNGA 3Q3IA 2J45A 3PXCX 3L1VA 1ZOSA 5EQTA 3T7RA 1BE8A 1G2QA 4EI7A 4YV7A 1S8OA 2ENWA 2I3BA 4LJSA 1D03A 2GM5A 4HMPA 4M0KA 5EJIA 3BM5A 3DA8A 5I3CA 2PQ0A 2VSXA 4UHBA 3D7SA 5E0OA 5EUQB 3SI7A 4LMPA 5CB4A 2CMGA 1KRXA 4E14A 1NU8A 3P2MA 4GSKA 1HOTA 1OV6A 2F3SA 5A3VA 1Z0IA 2X41A 3W4JA 1RJDA 1RKVA 4ENRA 1RVDA 3PQ2A 4IDHA 5ES3A 4FM9A 4A8JA 2NPFA 4II7A 4JQZA 1ZUD1 2GPAA 3L0OA 2AJLI 5LYJA 3ZWOA 5LPNA 5ELXA 4K9KA 4PLTA 6GPBA 3AERA 3KTFA 3L6UA 4KGDA 1KZYC 3NAGA 3CLSD 2XE7A 4UARA 2OCAA 2X58A 1O97D 4JC5A 2PUEA 3NALA 4YJGB 2Q41A 4LTDA 1J0AA 5IANA 3UGTA 5REQA 1QIEA 2ZXEA 3SC4A 3RTEA 1OFGA 1DEOA 1E2KA 2CVHA 3QLJA 1E1QD 2X42A 1KJNA 3CUVA 4IZIA 3KZ1E 5KCMA 2DEUA 4J49A 4YYZA 2MYPA 1TJ5A 1KBOA 3GJZA 2EBUA 5EJGA 1G2PA 2PYDA 4IGKA 1HT3A 1M6YA 4RZSA 2PUCA 2LW7A 3BWYA 4EFNA 5JZMA 3OIYA 4HRYA 4U7HA 3NYWA 3MHTA 4MRMA 2H7CA 4NARA 1SKAA 4MOWA 3DXXA 4YMUA 5CGQB 1ZM7A 2J9FB 4PYMA 3TAHA 5K0EA 1AQJA 3R41A 4EFMA 3WLJA 2FJUA 2QTHA 1XWFA 1LTHR 4JK3A 1QRUA 3AEXA 4FUQA 2VJBA 1NY5A 2ZSHA 3I23A 1XSEA 2JZOA 3RYTC 4Q82A 3WLFA 4F56A 3FUCA 4OLAA 3JX9A 1W9MA 2R8BA 3TFWA 3ZZ0A 4ZO9A 1L2TA 4BNJA 5J4LA 1NKVA 4YRRA 1A8UA 3WAJA 3EVZA 1PU2A 4GX1A 3O7MA 4B4VA 4C7OB 3G59A 2C2BA 3PYLA 5DWDA 4B0OA 2HPZA 3FH0A 1ZD8A 3CYFA 3N58A 4A2PA 1NYLA 1Z29A 3OO0A 3H0KA 2G6BA 2I2FA 1UMBA 2QG4A 4EY7A 2WT8A 1ZJWA 1VL5A 4N9WA 1A0OA 2DRIA 3LFTA 3QUSA 4GLOA 5K3AA 2ZYSA 3K5IA 3L18A 1K66A 4JI8B 4R2MA 1QAMA 4K86A 3OA2A 5A4FS 4X20B 3M6WA 3S0JA 1P5ZB 4R8SA 1XHLA 3THYB 3LY8A 1C1DB 3DMRA 3H1TA 4S2EA 3RIHA 3EPJA 2C4VA 3ITNA 3MINA 1Z12A 3IR6A 4ZHQF 4E5SA 1UMDB 5B4TA 4M1TA 4BATA 2PYZA 5A3QA 1GDTA 1U7UA 3OQIB 3MTJA 2KHZA 3H16A 1UXIA 2VDMB 4FHFA 3B70A 4KQIA 3CISA 3F3SA 1XJ5A 4D42A 2VXCA 2FWBA 1U3GA 4UAVA 5J4YA 2CD7A 1NNUA 3DPSA 3ND6A 3P52A 4XM1A 1TAHA 4HAVA 3S8EA 2CLOB 3HYCA 2G8NA 3MAGA 1B8OA 1K6JA 4Y67A 4DB4A 1XNQB 2WV7A 1ZUNA 2V8BA 1P5FA 2QI9F 2XKBA 2FW6A 4ENWA 5HM8A 2X40A 1PUJA 1IZZA 2XAUA 3S2UA 4B2IA 2A9VA 1QP8A 1TVKA 1YBMA 4QHTA 3HCBA 4CR6A 1E92A 3KPUA 3UV6A 1D6SA 2J3JA 3F2VA 3R7AA 1Y8RA 2QROA 5BVGB 4DIMA 2D6FA 1C0PA 1NN5A 3OZWA 4IMIB 2NP7A 4YLEA 4W9NA 3RJZA 1Q91A 2VF8A 1RZRD 1PTJC 3U7GA 3UK1A 3RYFA 1ZLYA 1QKIA 1E3IA 2WHQA 1NUUA 3JD0A 1T9KA 3R9KA 4IHQA 1X80A 2I1WA 1FTGA 3S2ZA 2VYCA 621PA 4NZOA 2EC5A 2G76A 3PLAE 5DCYA 5LDDC 1FU7A 4JYCA 3RSZA 4FOSA 1YVPA 4O4JB 2WLTA 5BPFA 1CRZA 3DBRA 4MS3B 1XZPA 1T0IA 3IP5A 2K7FA 2A1UA 4WSOA 3X1XA 1XAJA 2VRCD 4EBFA 4DDVA 5ECWA 1RPZA 4KX3A 2WA1A 5LLTA 1TLLA 2FN4A 2H1WA 2YV4A 4D3FA 5KQPA 1GNPA 1ECFA 1PR1A 1GRVA 2C5FA 2X15A 5EPOA 2I6TA 1JW9B 4YRSA 1KZ7B 1DKUA 1SUFA 1U0JA 2ZSIA 3A28A 3EWSA 3NGMA 4ND2A 5J59A 3DAGA 1G17A 4AJPA 3PQCA 4BFVA 5D3KA 1ZHHA 2YZMA 4IPTA 4P98A 2YFQA 1NKTA 4BGVA 5HKKA 1RKXA 3TAXA 3EH1A 3OUZA 5IYZF 2IOFA 3OQ6A 4PAWA 3ZDXB 3HU5A 3JAWB 3PXDA 3UAZA 3K70B 4IDFA 1ECJA 5FWXB 2VVTA 3EUWA 4TUYA 5A1TA 1UOQA 2AQHA 2NLOA 1UDBA 1FUIA 3COVA 3HKEB 3A11A 4KP7A 3BTOA 5FL7D 3SS8A 2WM2A 1YR7A 1KTIA 2CD9A 2DKOA 2G9VA 2J31A 3NVDA 5CIYA 3GVXA 3TZKA 5JSHA 2B8WA 1G8YA 3SR4A 5C8VA 2GWHA 3B36A 5KHAA 2A94A 1CUJA 1GSOA 3EEBA 4GGOA 1W88B 2ZREA 3BH6A 1EFVA 4DV3B 4EMTA 1OROA 2ZIVB 4P80A 3E15A 4I5FA 4E5PA 4J0DA 2ZI9A 3TUZC 5BW4A 1FU4A 3MGKA 4JUIA 4UE3S 5AXBA 1VRVA 2YQ4A 5H0IA 4EF5A 5CLFA 4CG2A 1Z22A 2BHLA 2B1GA 2LR0A 4HNTA 1H0KA 2PLRA 4M0CA 1GGVA 4X6XA 1DGQA 2QTGA 1UAAA 1YQ9A 5AUPB 1PQWA 3CUSA 1CK4A 3TJZA 1XL0A 3MWEB 3Q2KA 1X7WB 2IVFA 4F38A 1JR2A 2O20A 1KI3A 2IC5A 3FWKA 5ED4A 4RGYA 3HBJA 4NEQA 1QR6A 1Z6XA 4MA4A 3EEIA 1QIJA 4K5QA 1QH8A 4O4HF 5E3JA 4UMFA 2QMZA 4P54A 2NUBA 4UKDA 4CV1A 2B20A 1UXOA 2CHFA 4HWRA 3INGA 5JRDS 2C5BA 1KC3A 2ZQZA 4YJ2F 2GZ2A 2Q4DA 4PCVA 3LF2A 4FZVA 2IY9A 4DNFA 4O4IB 1H8HD 2QSJA 2R44A 2ZS8A 4PC3A 3K9WA 3PT5A 2ZG6A 2VYFA 3FXAA 2OOKA 2X23A 3L0SA 4UNRA 2CNBA 1SPBS 2RIPA 1RZ3A 1I3CA 2JD1A 2VAPA 2WJZB 4G89A 2JGFA 3EXEB 4EX7A 5LWHA 1RU3A 4R1LA 3NO4A 4HUQA 4D9CA 1PX0A 3H1BA 2XYQA 2H92A 4MS4B 4RPLA 1TM2A 2YN0A 4ZVNA 4H18A 2AZ4A 4NFYA 3STHA 1U3CA 4QQFA 4NYMR 3P19A 3UAYA 3F46A 2FMTA 5EOVA 3PP8A 3ZE9A 3ZJYA 1WWKA 3AJDA 4FMCB 4XCQA 5KJ6A 4KYIB 1ID8A 3O1HB 1Y1QA 5FUYA 1PWEA 1X8KA 1CF4A 3MIIA 4PHCA 1OASA 2JGMA 3H04A 1RZUA 1VJRA 4RF2A 5AT1A 5LIPA 3CJTA 1Y1KE 2PGJA 3M33A 1Q6YA 1E7RA 1WMEA 2FFJA 2RGWA 1ENPA 4PYLA 5JJIA 1HOXA 1T5LA 5L3SA 4A1OA 5BR1A 1L4YA 2QRLA 1S4QA 4ZZ3A 2BGRA 3SNKA 2GJ4A 2EL7A 3EVEA 3QMVA 1I7DA 1SBYA 4WLVA 1GA1A 2JC3A 3KQQA 4TV9F 5I5GA 1L4GA 4HH1A 2FPGB 4E7PA 1ANKA 1F17A 1SURA 2PQMA 4FE7A 4X41A 2WMDA 2W90A 3G9UA 4J91A 1N5DA 1G3UA 3L6BA 2ZAMA 2XODA 4P08A 4YR7A 2DPGA 5DBFA 3BSSA 2QENA 4WN9B 4WJLA 1O54A 2RGYA 1U99A 3B78A 4MVJI 1XE3A 5E2AA 1RSZA 2XTMA 4N0QA 4EG3A 5IXSA 4FJ0A 4EZBA 5GV8A 4M99A 1MRZA 3AIOA 4CQMD 1I2DA 1ZD5A 2JLAA 2P6MA 3WADA 4BHTA 1C9NA 3KG2A 2HGSA 4JBXA 4WACA 1SOWA 1UT6A 2OA0A 3LX5A 3OY7A 3HBMA 1YNOA 1VXRA 1KAOA 4DW8A 1ISFA 3EC7A 4UEOA 3W04A 1SN7A 2CJXA 2NXWA 3W5SA 4S1OA 1JWBB 4BX0A 2VQFB 1FXUA 3QU2A 4MLCA 4PYIA 5SY6A 1CQJA 2OSVA 5JZOA 3ICCA 2OMEA 4DXDA 2IX3A 3WJAA 2Z1NA 2HTEA 5CFPA 5IABA 3LC2O 1G21B 4H1WA 4IUYA 8AT1A 1XRRA 1EQUA 4C0LA 4G0XA 1KYVA 1RI5A 5DGCA 1MGPA 1JDSA 2X14A 4QIHA 1CEQA 2LWIA 1Q92A 2X7HA 4H3VA 4UTOA 4XX1A 3RHTA 3RT1A 3IGFA 3VHQA 4CLRB 5LFAA 5F21A 3U16A 3EXFA 2GDZA 4RPCA 3EZYA 5DV9A 4TYWA 3ZWMA 3NMUF 1E58A 1NI5A 3HHPA 3FNIA 1P1BA 4DA6A 3NKVA 1E4VA 2VKTA 3G2NA 4KB5A 1OLSB 2JHCA 3R7DA 3RE1A 9LDTA 2E4UA 4FWIB 1GCUA 3BXHA 3LKVA 2A59A 1U2GC 5ICEA 4CQNA 2HRCA 3ZLTA 3RS4A 2NV6A 2O14A 2IXFA 3ZG6A 1BE1A 1L7BA 1CY7A 3D2BA 2ID7A 4CKYA 4DM7A 1XCJA 3ICVA 1WXIA 3HBLA 1U8AA 4HN9A 4XD7D 3I01A 2OGTA 3NTQA 5ILOA 5K2OA 1FRZA 3AM1A 1CF2O 2DKNA 3BUSA 3RIGA 2P0EA 4DDHA 5FORA 3TNJA 2XJ9A 4NXMB 3PZRA 4LUCA 4TZ6A 2BN4A 2POQX 4H1VA 4XB2A 5AKYA 4DXAA 1ZPDA 1K06A 1EHYA 1TCUA 2BFCA 3A9UA 1O96A 5D51S 1C3OA 4E4YA 2BEKA 1GYQA 1OTXA 3CG0A 2VHUA 3K92A 1A27A 1E20A 1NDHA 1XDGA 4TXNA 4ZAVA 1XOIA 3D31A 3JWJA 1Z2CA 5BV1A 1UPFA 1YUBA 2ASVA 2GZDA 1XPJA 3UV3A 4HK4A 3U9TA 1WP9A 4BWGA 3DAPA 3VKFA 4KCGA 4Z1MD 1VKNA 1VMIA 4KLRA 3VAYA 1GZVA 2BP7A 1YKGA 4BP1A 2HREA 3TQCA 2FPUA 2HYDA 5IU6A 1Z4NA 1UZAA 2Y1CA 3UWOA 2ZLBA 1U3UA 3WMXA 1E6KA 5F12A 1PFGA 3R3XA 1L7RA 4M22A 3PCRB 1S7CA 1ZU5A 1O57A 2Q3FA 2ECKA 3GJTA 3ZHQA 2DHQA 2QAGC 4RM2A 4DCMA 4ZCIA 4OQDA 1E5VA 1AC5A 3GA0A 3U56A 2XI4A 1Z3CA 2PPVA 4FGWA 3HA7A 4RX1A 2PMFA 3VOSA 4FFDA 4RD1A 3KVNA 1GA4A 5KSWB 3G6WA 4QLAA 2HAEA 2BJHA 1G4HA 5D7BA 3S7TA 3BKWA 3UMFA 3W9UA 3WK9A 3P7MA 1TUEA 5FPYA 3AHIA 5HCUA 4BQEA 4QL3A 3GLRA 5IKOA 4ALLA 4F46A 3IDQA 1XCBA 1XMXA 1FX0A 1VKHA 2VCYA 1XWWA 3KVOA 3CEAA 3L7JA 4A4DA 1JPVA 3H0EA 3CEJA 1C9JA 4HYTA 2EBFX 3TEJA 1UAYA 2PWBA 3OIFA 1NXVA 1QOQB 2LXNA 5JANA 1UBLS 2VHVA 1G60A 2FG6C 3A25A 4WW0A 2WABA 1HZZC 1IEQA 1N0IA 2IEZA 4JOSA 4YS6A 2MCFA 1X7GA 2A67A 5JS1A 1K2WA 4EITA 3S4YA 3MJRA 3TSZA 1E6WA 3WYBA 3CLTC 2WIJA 2Y8EA 1GRQA 4DE5A 5MN6A 4A8HA 1EWTA 3ZHSA 1DAMA 1E1RD 2C57A 1Q19A 3BX1A 5J9FA 4ARSA 4IX9A 3VHXA 3PEYA 1UMCB 3WGLA 4YDQA 1YA4A 2XYRA 1SXPA 2Z3WA 2ZS7A 5WRFA 3UWSA 3VOTA 3AHDA 3IUJA 1JBQA 4BKQA 3K8ZA 2EVWX 1TK9A 2IZOA 2VBFA 4O4LA 3WTBA 1J5XA 4AMVA 1JHOA 3G5UA 3CZMA 3W4IA 4OA5A 1W36C 5ALZA 1KZ1A 1PL7A 1VPDA 2AHOA 1RI1A 4PTZA 1THZA 2XWJI 1F7VA 3ZWBA 4LV6A 1C3LA 1FL9A 2IHUA 4X1KA 2CZQA 3FUUA 1MJGA 3QIAA 1X1QA 2Q9UA 3HUTA 2H5EA 3M83A 5E6UA 2J5KA 1EZZA 3TGWA 4FFBB 3PDIA 3VH2A 4UZEA 2LPMA 3FPCA 4ZA2A 3O8OA 4ARIA 5F2NA 1IOLA 4K28A 1P9NA 5TS3A 5C7IO 3MMXA 4FFMA 3C6ZA 5A7HA 3T7DA 1EE1A 4NONA 1I33A 1PJAA 1SUAA 2C88A 2KSQA 2QAGB 3H5RA 2Y27A 2BFAA 3TQIA 2IELA 3EY4A 1OE0A 3C3BA 3JTMA 5J40A 3EPKA 1HNZB 2FSUA 2J7PA 3U13A 2DG2A 3DBLB 3I28A 3MS2A 3GUUA 1QHYA 3RABA 5LD2C 1MVNA 2IF0A 3B1WA 2GEUA 1W4BA 2X8LA 1Z0JA 1KP9A 1AF4A 2Q9CA 2QMUA 1OV4A 3IPXA 4JKOA 3RVPA 3VPAA 4Z4HA 4V1CA 3H2IA 1KVUA 4RCZA 3JATB 4IOMA 1KAGA 3MHPA 2BRUA 2VT6A 3LDHA 5K3FB 4RJ2A 3RRZA 2YFHA 3ZNPA 2VSNA 3I62A 3PHIA 1AUXA 3CVWA 3A2NA 3EDQA 1QV6A 2WUVA 2Z5GA 5F3WB 4RMNA 2FQYA 2AE2A 1T36A 5JXWA 3LF1A 3QEBZ 3SGLA 5K5EA 4LJRA 3A6FA 3DE2X 3VM6A 1P77A 3OAAD 1CV2A 3U7QA 4PINA 2W48A 2IIBA 5BMOA 1LZKA 2IOQA 4OK5A 4FD3A 1N6OA 4NV3A 2JBWA 1F6BA 4ISBA 3PE3A 4I8DA 3UG6A 5LP6A 5A7GA 2IPMA 3DO6A 1EEHA 4MEAA 3WGJA 1W36B 2X3FA 2WIFA 1E0DA 1U7DA 5LR6A 4GKVA 3UAOA 4CF5A 7ABPA 5T4FA 2V0CA 3NWOA 5LM3A 2ZWVA 5I3ZA 2VNKA 4S05A 1NWHA 4MRRA 3B3FA 4DJJA 1BFKA 3QBTA 1GQQA 3CFYA 3X1DA 4QYTA 5EJAA 5JNLA 5KYYA 3OETA 2Z30A 3PXBA 1IONA 1PE0A 2VBCA 2VPPA 3DKIA 3JWHA 4RSHA 3M1YA 4TXJA 4YCBA 4MUHA 4E2FA 5JTUA 4L4ZA 1G5FA 4RENA 4KWEA 1Z4KA 2DHCA 1VLHA 2C3UA 4TVOA 4KR9A 4B45A 1JEDA 2LDXA 3EGEA 3PC6A 1E9SA 3UCXA 4ECEA 1IAQA 4FOLA 4Z4GA 4LSZA 3BKXA 3HVHA 4QUAA 2IS6A 3UT5A 2EBHX 4LI0A 2G28A 1WY5A 3PWTA 1GPYA 1Z8HA 3T7AA 5JATA 5CXUA 1JNYA 4J76A 4LCJA 1VBKA 3B3JA 1SHUX 2J32A 3HFJA 3LFHA 4KNWA 1L4UA 5LD2B 2ZVJA 5IEJA 1WZNA 1W59A 1UZMA 1MEJA 2D1YA 3BE4A 4AMBA 3RBVA 4FR5A 3ZYCA 1YE8A 2BSXA 4RJLA 5AXDA 4CHTA 4EI8A 3D8NA 3AETA 4TL8A 4HX9A 2PUFA 3MK31 3R3VA 3GRCA 4EA9A 5BSEA 2CEKA 2ZYGA 4GMXA 1JIJA 4UM5A 4PYJA 1ZR2A 1N8TA 1U9JA 4CCYA 1OX6A 1YZKA 1GKIA 1L3BA 4KXUA 1DI0A 4DDWA 3IA2A 5AK6A 1OTYA 3DV9A 1VIMA 3FPGA 2N42A 3GUCA 1E3WA 3CNEA 4ILEA 5CA0A 3P1JA 1UBNA 4RS4A 2WIBA 1WUYA 4AJEA 1K5DA 3KR9A 4YRCA 2WWRA 5A6SA 4NQZA 4NOLA 1V45E 4C08A 1FCJA 3W5AA 4S04A 1JHMA 4KJZA 4WCFA 3TZCA 5DN6D 3PC4A 2P6NA 3IPAA 4RQBA 4JP2A 1VBNA 4ZVRA 2VL7A 4B74A 5F98A 3DZDA 4DNQA 5IM4A 3LH5A 5ESWA 3BMCB 3DDNA 2YYSA 4WKGA 1EGVB 2QM3A 4K8OA 1KU6A 3O3OB 2QLTA 1DBRA 3EXIB 4XLZA 4TMTA 5KSOA 1XTZA 4DCVA 2WR8A 3F71A 2WF6A 5JXIA 3DO5A 4PNHA 3CM0A 3DV2A 3JD3A 1X7YB 3U3RA 2P6OA 5IC5A 1ND5A 2JRCA 3WNZA 1BMFA 4R1OA 3CG4A 4YHBA 5CUQA 4WESA 5KJFA 1E6LA 4IXTA 1QS0B 3U3KA 4XYLA 5G0TA 2NZYA 4R01A 4X6YA 3KVYA 5DOZA 3PSHA 3HFGA 4FXOA 2CDNA 5HYVA 2OSBA 5HFNA 1YQEA 3QSGA 4BFTA 3OJOA 1GNRA 1VG1A 1MU0A 2IYPA 4FCWA 4W63A 1A4IA 5A71A 1YC5A 1UQUA 3L40A 2P75A 3I0NA 3WGKA 4CN8A 5MDHA 4MGIR 5D3MB 1QVZA 2VPZA 1RI4A 2OM6A 2HQSA 2HCRA 3ESAA 3MVEA 3OBIA 2PA0A 1UAGA 3LL7A 4IIVA 4WXPA 3TIFA 1VRCA 4EG0A 1ZX1A 2QZPA 4KTVE 4MQ6A 2IP2A 1O94A 2P77A 2ZB4A 3JYLA 5AVYA 2YXDA 4FGSA 1F8UA 2YQ5A 2Z5VA 1W2WB 3GT4A 4X1YA 4KPFC 4TXMA 4AJOA 1CYEA 3X2SA 1X0XA 2XA2A 1W87A 1OVMA 1RVV1 3DOOA 3NIBA 1W29A 2XA9A 3AOGA 4GFDA 4PQYA 3ZEIA 2XMGA 4YV2A 1BVYF 4PRKA 1JPJA 1G8PA 2I3AA 4P8RA 4FLFA 1BQ4A 1DAPA 1J25A 1V96A 2D2XA 2NU7B 3REGA 1S9HA 3L7NA 3P2IA 3VR2A 3VAZA 3VU1A 2COEA 2AOTB 2YHSA 3EPRA 5GONB 1PZEA 4RK0A 1O95A 4RY8A 4PS0A 4HTFB 4DCJA 1NNI1 1J0XO 4J0EA 3T61A 2DY0A 1D9ZA 1V8FA 3K9HA 2J3QA 5CXSA 1QGYA 3QLTA 2Q1XA 3D0RA 3ZDCA 1ZGJA 3THOA 2E1PA 4PZAA 2FV8A 1I2AA 4POOA 1B8UA 5IXJA 4B3IA 4P3OA 1S6YA 1XCPA 3L05A 2RGGA 5IUNC 4OQFA 4UATA 4JI3B 5AK0A 1KPIA 1OQAA 1P9OA 2GF0A 4DEYA 3GLFA 4QUHA 1WQ3A 2VNJA 2YV1A 1OC2A 4MQEA 5JAUA 2YC2C 1W8DA 1F0PA 4J7AA 1R0ZA 5FUVA 3SSOA 4AD8A 4CR8A 3CZRA 4TGLA 3ROQA 1HQCA 1QBKC 4D99A 2VT2A 3E05A 1UPAA 2H6EA 2XECA 3LAWA 4C14A 1QC5A 1XK7A 1PGJA 3O5AA 2RGUA 4RVUA 4WIAA 2V3WA 2I9PA 3GRUA 1WB6A 4NABA 4ZU6X 3GX1A 2H52A 1Y6RA 2B3DA 3OM8A 4MIYA 4QTZA 4A82A 5KKCA 1Y80A 1CSEE 3KQWA 4J0HA 3Q3JB 3ADCA 4GMHA 4IDBA 3SS7X 4B4DA 4HNAA 3E27A 3IFSA 4C03A 4JLOA 5G3ZA 4A16A 2XQGA 2HA3A 1YZHA 4C6HA 4G1MB 2UUOA 4WJZA 3IUBA 4BB0A 1AGYA 5EZYB 2J3KA 4J0KA 1E98A 1HE5A 2G36A 4CMGA 1EBBA 3JYHA 5GWXA 4AJKA 5IKEA 4NYMQ 4NI5A 1CUBA 1FYDA 4S1WA 3S27A 5HX7A 1U8ZA 4N3CA 2FX3A 5FBZA 3JVUA 4BMOB 1DHRA 3HY3A 5ALMA 3QU4A 1NSFA 2RHLA 3RS2A 3EF3A 1QP0A 3IJPA 2QMYA 4YC7A 3IUMA 4ND5A 2CSUA 5CH5A 3U61B 1GPDG 4FFRA 1YUMA 4ZOQI 1EA5A 2OO3A 4MV8A 2TMGA 4D3YA 1WZCA 3AHGA 1K6EA 2UXDB 2CE2X 2Y76A 2GF9A 2O2HA 4MINA 1HNNA 2AVDA 2HD4A 1Z83A 2HBQA 4QQ8A 4EG8A 5B6JA 3QEMA 3CCCA 4B85A 4QPPA 4PPFA 3I1YA 4X44A 4XQEA 2XA1A 4Y9SA 5DBGA 5JYDA 2V9PA 4AZ3A 1F48A 3D8TA 3WIUA 2JFOA 1O5TA 1CKEA 2Z5FA 4L85A 4N7MA 2NP6A 3DE3X 2ZUDA 3L49A 5CYFA 3CVXA 1EX7A 1Z8NA 1VIYA 1U0SY 5I7FA 1FSGA 5BV0A 1PG0A 3ELBA 2P9GA 3ND9A 5C53B 4F6RB 5DLDA 3OEYA 4M7WA 2ZJ8A 4D41A 3H5TA 1DJPA 1PR2A 2HF7A 1JR3D 4FDUA 4XTRA 4GPD1 5DTMA 3R7SA 2YXEA 3H8SA 4B8WA 2H07A 1K89A 1NLFA 2QYOA 3BWBA 3D8UA 3OQHA 4YJDA 5JDIC 3RFTA 3H4MA 3RG8A 2P9TA 4EG5A 2H1OA 1WSDA 4YMHA 4OOEA 3KR0A 4DA7A 5JOQA 4KK4A 5G0SA 1L5VA 3C1OA 4R8LA 4B3MB 3K2EA 5AWFC 4KXQA 3GFOA 3ZHZA 2JZCA 3WRWA 2CDAA 2JGEA 1Y33E 5DM60 2WE7A 3HE3A 1YNSA 3F5MA 5K8JB 2PLAA 2JG3A 4B3RB 1ZH2A 4MHSA 3URKA 5C52B 1J5EB 4FLMA 2RK3A 2PSHA 2Y05A 3CJQA 1ZVQA 3MS7A 3A9SA 3IPYA 4O2BA 2D2IA 5DWQA 1REQA 2ZUFA 3B51X 1ETHA 1FRFS 1NXTA 3KKQA 4LNHA 1VLLA 1DG1G 3PC8A 1ZL2A 2PXCA 4B7AA 1T3TA 1OF1A 2HY7A 2H4JA 3EOZA 3P4UA 1E96A 5A5VA 1SZCA 2M9MA 1EUCA 1SXJA 4WK2B 1QDUA 3EN0A 3NHZA 1LA2A 4G1BA 3F9RA 3IKJA 4EENA 4MYSA 4X60A 4JCOA 5LU8A 3FLMA 4ZI5A 5A6VA 5BUQA 2XZTA 2GZRA 4D9MA 3I53A 4EJFA 4TTJA 4ADSG 4ZOAA 4D3ZA 2G71A 2HJRA 3DLIA 3QP9A 4OAPA 4YAUA 5LOVF 2PUGA 1FJ2A 4QJ5A 3FUXA 3EZXA 3ROGA 5CB4B 2DPHA 1LSUA 1RRGA 4EKYA 1LBTA 3CF6R 1T13A 1YJ8A 5COBA 4U02A 3IIEA 2DPYA 4GR4A 4BLTA 3NWJA 2DT5A 4BCDA 1LJLA 5TV2A 1UADA 2BMFA 4A8JB 3V4VB 2CLIB 5TC4A 2DULA 5AKIA 4DWVA 2I6GA 1IPFA 3RF6A 5LYJB 1GUYA 3GYBA 1PD1A 3AERB 2FHSA 3IUSA 1AHNA 1PWYE 2IYTA 1ADJA 1HDCA 3BAZA 4NJOA 5EJ7A 4Y2TA 2VTKA 4Y2UA 5H59A 5FNVA 3TH5A 5LZ5A 3NM5A 4L5CA 3PWKA 5REQB 5AM5A 3DZKA 1CT9A 3D4IA 5CT4A 3WRXC 3QVWA 1FMTA 2QWXA 3OP4A 4QTUB 3EG5A 2ZYRA 3E2MA 1IN7A 2PUAA 1S1CA 4JD5A 3OBBA 4B3DA 4Z7NB 1W46A 2X5NA 3EGWA 1YBAA 4MRMB 5KPDA 2B98A 3D3EA 4QYIA 4OAQA 3HN6A 2ROQA 4IZHA 1DCMA 4AJ9A 1YVDA 2QMOA 2R7AA 4B87A 1I7QB 2WQ6A 1Y4AE 1XRQA 3TOVA 3HDVA 1TCBA 2YWFA 3MELA 2W9XA 2NVUA 1T2VA 1C2TA 5LXTA 1DFHA 2PR2A 4XVHA 4MA5A 2NZ2A 3TLCA 1ISRA 2YWXA 2NUTA 2C2YA 1XPRA 3BZWA 3P26A 5EAIA 4ROSA 2VWQA 1XKTA 4E1AA 1SUWA 3QVTA 2BI7A 1GTSA 1EK0A 4Z0NA 2R25B 2C84A 2BM0A 3M4XA 5DTQA 3F9CA 3SM3A 4D74A 2WIDA 3GELA 5KAPA 1IHOA 2HA6A 2ZRFA 1JMKC 2WJWA 1JJVA 1BG6A 3H42B 2DY1A 3QOYA 2AV6A 5DE3A 1UMBB 5BSVA 3CPJB 1E9EA 2NU8A 3CX4A 2RK4A 2WDZA 3KLBA 2QLBA 2O1WA 4HQOA 1ECCA 1OZGA 1MABB 2WJYA 3EOAI 1DJMA 1OUMA 4XW2A 1I3LA 3EQZA 2GHRA 1E1LA 1U8EA 4RUKA 2EG9A 3UJAA 3P45A 5CCEA 4MVYA 1XG5A 5DLQC 2V5AA 2J3IA 3LHKA 2EKQA 3B52X 1JZQA 3ENNA 2ISSD 4FJ1A 1TL7C 3MINB 4CW7A 2YMQA 3QVMA 1I4EB 4OHKA 5JAQA 4MX8A 3T7KA 3OJCA 3DOEA 5BV7A 3OD1A 1J23A 1M9NA 1P74A 4ZPJA 2B7CA 3CC8A 3HCFA 2PS3A 3IH5A 3LX6A 5KPJA 2IHJA 4XEUA 5JASA 1AGXA 3OQ1A 4K3VA 1SCIA 1N0UA 3PHBE 4DDUA 1WU8A 4Q3DA 2AT1A 5EZYF 3ZYZA 2VK4A 2P40A 3IB3A 3V46A 5F33A 1JALA 4B6QA 3G2KA 1BJTA 1ZUNB 2BBWA 3SDBA 2JAWA 4ZODA 3R24A 4NAVA 1X70A 4BFCA 4OUKX 1JLSA 1TVKB 3E0QA 2O6LA 4TL9A 1X8XA 3E7FA 3FYSA 2XJ4A 1FFWA 4L16A 2RGDA 4WV3A 1I4WA 1Y8RB 2DQKA 3IYLW 3M5CA 4LYJA 4X90A 1JDPA 3HN7A 4MKRA 3V7NA 1QRTA 1PZFA 3HJAA 3ZWDA 3EASA 2LVBA 1R18A 1NTRA 3BRWD 4BMZA 3RYFB 2X1HA 3P0FA 3RRXA 5DYNA 1E7WA 1UKEA 1YDHA 3IODA 1KSFX 3KYBA 1E4YA 1RYHA 1X80B 2TS1A 3FCOA 5BNFA 3ZD9A 5B55A 1V41E 3QV1A 4Q9JA 2B35A 4JB8A 5GAJA 3WX0A 4DBVO 1ZOIA 2OBFA 2AYXA 1B00A 2QMEA 3DBRB 3Q3HA 1XCMA 1EFRA 1DC7A 1DKMA 2GS9A 3FROA 2A1UB 2RGEA 1NQXA 1O4WA 1GG5A 4R8VA 3C3KA 3RVBA 7YASA 2JVKA 3JQQA 1V43A 2RHDA 5HGXA 5L6LB 4OATA 3Q7QA 2R0QC 3THSA 4PM4A 1QYDA 4XJTA 4DCPA 3FPBA 1ACJA 4W82A 1L5HA 1MEOA 5H16A 2WG2A 2Q7XA 4F9FA 1YIDA 4YJFA 4F92B 4MCJA 4OI4A 4I5DA 1RQNA 3K6SA 3KXDA 2I4NA 3AJEA 4ZXPA 3I9JA 3M6VA 1JWAB 1U9YA 4QJBA 4S35A 1E63A 4B3CA 4UJ3A 4TUYB 4M83A 1XA4A 4ZI7A 1QDLB 5C1IA 5JYEA 3LCVB 8LDHA 5JSUA 2JD0A 1CUYA 3B1YA 4OYLA 1MO6A 4RAOA 4LKRA 4WKNA 4CKEA 4YRZA 1IXKA 4UTXA 3ZXYA 1JI0A 1I3OA 4YREA 2OFOA 4FEAA 1YFKA 3LY7A 3AHJA 4W5WA 1UQRA 1DJQA 1Z8DA 1EFVB 1IWBB 3CJRA 4U39A 4XIIA 5IHPA 1J7JA 1VRWA 2QMHA 2LZ0A 5KTSA 1EUYA 3D3WA 4JJ4A 5IUKC 4YVFA 4YRMA 1VGRA 2G3YA 1QZZA 1T2UA 2IS2A 5JFOA 2ZUBA 3DS8A 2MYTA 1H65A 1SKYB 4MUIA 2Y9MB 1EB8A 2JGNA 1W2HA 2AOXA 3H75A 4BBJA 3RI3A 2AK2A 3P0JA 4Q47A 4GMGA 1MT3A 2VT7A 1HYHA 3Q7SA 4B33A 1H3NA 1C9KA 3RF7A 3A2MA 1Z82A 2G6TA 2WZCA 3D3NA 2EHDA 4FYPA 1BS2A 4WFJA 5K6AC 1M1YA 4J1SA 4GVLA 4UXJA 1N36B 1PR5A 1QH8B 2VDKB 3MCVA 3OOJA 4MRSA 4B9AA 3L9WA 3ETHA 5C7LO 1XTIA 4KQ9A 4G5FA 1ZN9A 2VUTA 3B1JA 1L5ZA 1T3ZA 2Q3HA 5FCDA 2FZGA 1SKBA 1OLOA 3OT1A 4L9SA 4UE6A 4X6LA 3B6ZA 5I47A 4M8SA 3L41A 4ZI2A 3LOUA 4D8YA 1WD7A 1OFUA 3IV7A 2I8CA 1QE5A 3HM2A 3QVJA 4B83A 4WLFA 3BIFA 3U4QA 3N53A 1E3QA 4LIPD 5C1BA 3PHLA 1NQAO 1W73A 2OGWA 3MS4A 4PZCA 2W2KA 2E82A 1AQUA 4FBLA 4FZRA 4U9UA 4DIFA 2GFQA 2OECA 2ABWA 1HEIA 3D1VA 1FFXA 1NX6A 4HUQB 2AD5A 2W6QA 3IAM6 3U4AA 3W2GA 4N6GA 1NBWB 3EBPA 3RT9A 4BLPA 4EYQA 5B7PA 5JC8A 1YCHA 1EGAA 4EGAA 1AO3A 1UPCA 1W75A 3IQFA 3KRTA 1ABFA 3UHFA 4F3CA 3CA8A 4QO7A 4YYEA 4ZAWA 2GOYA 3UBTA 3V2IA 5SY9A 3SBEA 1N5LA 1CY4A 4RF3A 2QVXX 3MJHA 3NXKA 4LDJA 2R11A 4ZV9A 5JCXA 2O5EA 4KGXA 4HD8A 4JQOA 1IHYA 2AW3A 4MUMA 1HFEL 4IH9A 3IP6A 4CM1A 4GKJB 3NR2A 1XZAA 4OJYA 4A92A 1BGVA 4KAAA 2WD8A 4LCEA 2IS1A 5TGZA 2RH9B 5HIAA 3PC7A 4C3ZA 3RAFC 3QF7A 3I04M 5L3SB 1NF2A 2QPLA 3T9AA 4NBUA 5IKXA 1NBAA 2QPOA 3THXA 1P4RA 3EEQA 1WBDA 3QOXA 1BO6A 2WZQA 1RC1A 4ARBA 1KO4A 2ZATA 1QYCA 5JY1A 4U3JA 1R4MA 3VI4B 3DDUA 1TEXA 4B7XA 2CNDA 1KIFA 4OMUA 4M9SA 2Q4BA 4JWKA 5JZBA 1ZMRA 5E2IA 3STTA 1KQOA 3C87A 4KTTE 4GLJA 1IBCA 1L5QA 3NCHA 1NYQA 3O75A 2D8AA 4Y3UA 1FVFA 3ADBA 5EJ9A 1AUVA 2P79A 2IYLD 4EK9A 1PCXA 3U48A 4BWFB 2GVDC 1DNPA 2HDOA 1XC7A 2G4CA 3H19A 3M5DA 4FX5A 1CQPA 1NVAA 4IS3A 2P1ZA 3IC5A 3HXOA 2QTZA 2AQIA 2ZYIA 5THKA 4CEHA 2R4UA 3LX8A 3L1HA 4MUXA 2J41A 2V6GA 3H4TA 2HA2A 3R7LA 3U3MA 1NLZA 5PNTA 4FUTA 3GFGA 4D4MA 3HJNA 4IR7A 3N0WA 5EKXA 1CUAA 5CT8A 3IALA 1CQJB 4RZQA 1GQYA 4UFOA 3T7SA 1QIMA 1JR4A 3QWAA 2IEBA 4YPOA 2GKOA 4EW1A 1IAVA 5EHXA 1GWNA 3MJEA 4IVRA 2FOIA 2IP1A 1CRQA 1XWIA 2EDCA 3K9QO 3NHYA 3VTFA 4TX1A 3ZCRA 4BCCA 5IXYA 5IZ4A 1MO5A 2AN5A 1UC5B 2G67A 4FZ3A 4PANA 4R8RA 3W8RA 2F3PA 2A0XA 4CRWB 3E23A 4IHAA 1T9BA 3T12A 3WZLA 3EXFB 3ZD7A 2ZYUX 2FZWA 2CLHB 3DHYA 4J07A 1I51A 3SY8A 4KXNA 3HJUA 5BWCA 2LE0A 5LLSA 4EPTA 1DTSA 1FP4A 3G0BA 1JT9A 1HETA 3CRQA 3INNA 4XJVA 1V7PC 3AM4A 4HPJB 3N2GA 5TARA 1O0SA 1U6JA 3ID6C 4PY2A 3O9MA 4Z7OB 4G0MA 4YUWA 3KLNA 4CMJA 3QJGA 5EE1A 3OUUA 1K6IA 4HB2A 4U8GA 5LBUA 1DBVO 4JASB 1S8FA 2D4HA 3IQDB 2QTTA 2IHKA 4H08A 5M34A 3AEQA 3HCWA 4KW7A 2QVLA 1XDZA 2CF5A 4TSFD 5EXSA 5JR3A 3ITEA 1Y9EA 2QTNA 3T3GA 4UVGA 1ORDA 2QK4A 4Q1CA 4G86A 3STWA 4ENVA 3IJEB 3BFXA 1XCLA 2FSVC 4RIEA 4WZZA 1JDUA 3IEVA 5DSTA 1XYVA 1TJPB 2EFEB 1O96B 4OFZA 1C3OB 2PGLA 4EOGA 3DFKA 2X0DA 1LS1A 1M8JA 1XK6A 1DXOA 4B43A 4LYGA 3NBZC 4P4GA 4PZEA 5EKUA 4YCLA 4BNTA 2YN4A 2ZIXA 4TKLA 3WWDA 4PRYA 3A27A 1YB4A 3BILA 1JAXA 3FTNA 4HRVA 1B74A 3CZ9A 2BH9A 5CJPA 3UMVA 5JPCA 4EW6A 4HQLA 2BP7B 3RU9A 4BNKA 5F7XA 4DV0B 4WLEA 4BDTA 3RIMA 4BVFA 1KTVA 4QLBA 2PMBA 1Z7GA 2NSYA 4BWYA 3DBHA 1DAKA 3EQ2A 5FADA 4N5IX 5HOQA 1G64A 4HNSA 2G1PA 4M1OA 3SIPA 4TV8B 3RIEA 1XPOA 4G1VA 4TWZA 2X2FA 4H4CA 1FZTA 3DB1A 2QVZX 3OZ7A 1AA9A 2ZZNA 3L7OA 1QFMA 3LK7A 2ACKA 4L72A 5EHQA 5CITA 5JPDA 5JBNA 2HV8A 3RLIA 3GJ0A 3H7IA 2IITA 3QYAA 4Q3LA 1APBA 5IH7A 3IR7A 3U5ZB 4C2TA 1GLGA 2GH1A 4KVAA 5HDQA 1FX0B 2H1VA 2QTVA 3LE8A 3AKZA 3UN1A 1DAOA 1DIGA 4P4SA 3OPYA 4BPRA 2MWMA 5DP1A 1EU1A 1FF9A 4RHUA 2Z4RA 1CUCA 4PZ9A 3VOBA 1NVDA 1Q3HA 2IBSA 2Y0CA 3OCCA 4U2GA 4CGZA 3PNBA 4PPYA 5HJ5A 1KMMA 1E5XA 2IY8A 2XMSA 4QFMA 3KQTA 1GZ4A 2OENG 5J5CA 1KXZA 1FVHA 3N8DA 3EAQA 1ZMTA 4NFLA 1Y9ZA 3EY9A 2JLRA 4FMPA 4LZAA 4RO0A 4CXMA 2I99A 1MDFA 1OB2A 1VHDA 1SC4A 1H85A 4G24A 3VHXB 1P7ZA 3ZX5A 4JCCA 2QD3A 3NBUA 5GVSA 4LWPA 1RQXA 4NHOA 2IGTA 3FWPA 5LP6C 1I13A 1WR8A 4O4LB 5AW3A 4F5WA 2INGX 3MB8A 1UBHS 3KVRA 3JQAD 4GE3A 2PVSA 2WJPA 4TLBA 5TQ2A 3W90A 3FIUA 4ZYUA 5IAGA 3TZEA 1MMFB 5KDOA 1NRXA 2FMFA 2L18A 1H6CA 2OCIA 2YWDA 3V55A 5CHYA 2ZB3A 2ZR8A 3G2IA 5A4IS 4U7DA 1IBKB 1NBEA 3N7AA 1IVYA 4X1KB 5J2TA 4H4EA 3D6NB 5KNCD 4QPNA 5E6UB 3T3MB 5JNVA 3QX8A 1JRLA 1UODA 2D7CA 1TVEA 3DE0X 3IBGA 3PDIB 3AVQA 4R2JA 3DVSX 4D97A 4GXRA 2Q5EA 3O8OB 3WYAA 1IH8A 4LXIA 5D5HA 4AUNA 5GVRA 3VMFA 3SBDA 3JU3A 1GVNB 4CDNA 4EAQA 5IPFA 1CEYA 3U49A 1I3NA 1S2GA 1YHYA 5I4BA 3EFEA 2PANA 4RDHA 4QVKA 4K9DA 3UM9A 1DMSA 4B8YA 3GPBA 3NC0C 2B61A 1BWQA 2VHYA 3GUVA 3ZX4A 4J1QA 1GA6A 4XA8A 3H86A 1ECBA 2D7JA 1DPGA 3HVKA 1OXTA 3A6KA 5DW0A 2VK2A 2IE0A 2JA2A 4RVCA 1EVZA 2VA8A 4MK4A 5IT0A 1HE1C 1P2UA 1KVSA 3DYVA 3G2JA 3AJ8A 3N0TA 3QLUC 4OXIA 3H2KA 3L9XA 1E8MA 4RJJA 4Y6QA 2RD2A 4V1CB 4OBWA 1FE8A 1WUTA 3II6X 2YJ3A 4CR7A 3FPKA 3KOOA 4I55F 5BUSA 3ZNOA 5FOQA 1N77A 4IV8A 4P81A 4LMAA 1ZZEA 3KB2A 3DCJA 2I7CA 4JV5B 1E4EA 2EQAA 1SQSA 2RG1A 4IWNA 1KYIA 2ZU0C 2Q2QA 2II6A 1CLEA 1DEAA 2WWXA 5EXXA 4ZVLA 1VLVA 1T36B 1KMNA 2FUKA 2RHJA 3SEZA 2CUZA 5KI6A 4EP1A 4CCSA 1VCHA 2QUKA 3R4VA 3PPIA 2F2TA 2Q3EA 2YVAA 4WCFC 4ZQCB 3WK4A 1JECA 1KR5A 1PQ4A 2HTFA 1E1KA 3RASA 3U7QB 3WLLA 4UEKA 5KTOA 2AJBA 1RHJA 4TTIA 2R2AA 2H1CA 2DHEA