3NR2A

Crystal structure of caspase-6 zymogen
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
262
structure length
233
Chain Sequence
b'FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKVEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVGKKQVPCFASMLTKKLHFFPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Crystal structures of human caspase 6 reveal a new mechanism for intramolecular cleavage self-activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 233
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nr2A00
1SC1A 4EHFA 3EDRA 5IANA 3BIJA 1I4OA 3H0EA 4FDLA 5K20A 1SC3A 2P2CA 3R6GA 4QUGA 1GQFA 1RHJA 3UOAB 3S8EA 3R6LA 1RHRA 3R5JA 2C2KA 2K7ZA 1F1JA 3ITNA 5I9BA 1KMCA 4NBLA 2J33A 2H48A 5LUBA 2H5IA 4HQRA 3IBCA 1SHLA 3V3KA 4N7MA 1RWKA 4JR1A 3V4LA 1F9EA 4AWAA 1RHUA 2H54A 4QUAA 4EHHA 4HVAA 2NN3C 3P45A 1QX3A 3V55A 4NOLA 4QU5A 2QL5A 4QU8A 4N6OA 2HBZA 4JQYA 4JJEA 5IAGA 4N6GA 2J32A 2QLBA 4QU0A 3D6HA 2CJXA 2H4WA 5IC6A 4I1PA 1RHQA 4QUEA 1NMSA 4FXOA 1SC4A 2XYPA 4ZVPA 3DEHA 1RHKA 1RWXA 1PYOA 1K88A 3V6MA 3P4UA 4JR0A 4NBKA 4NOJA 1I51A 4QUIA 3R7BA 2QL7A 3NR2A 1RWPA 4QUHA 3D6MA 2QLFA 4NBNA 5IBCA 4QUDA 2FP3A 3GJQA 3DEIA 3OD5A 4D3XA 1NW9B 1CP3A 4LSZA 4QTXA 3GJRA 3H11B 4HQ0A 4ZVSA 4DCPA 4EHNA 1BMQA 1RWWA 3KJNA 3H1PA 3D6FA 3PD0A 4PRYA 5IAKA 5JFTA 3S70A 3GJSA 2XZTA 2CNLA 1QDUA 2DKOA 3NS7A 4AW9A 4EHAA 1RWMA 4QUBA 4EHKA 3UO8B 2C2OA 2CNNA 2C2MA 1K86A 4AWBA 1JXQA 5LU8A 2C2ZA 3IBFA 2HBYA 2HBRA 1CVRA 4EHDA 4PS0A 5LUAA 3R7SA 4N6NA 5IABA 4ZVTA 2QL9A 2H51A 3E4CA 3RJMA 4FGUA 4JB8A 2AR9A 4QU9A 1RHMA 2CNOA 4PRZA 2Y0BA 4IEFB 1NMQA 3DEJA 4NOMA 3V6LA 2QLJA 5IBPA 5LU9A 1I3OA 2FUNB 3SIPA 4IYRA 2XZDA 4JJ8A 3KJQA 4D3ZA 4FEAA 1M72A 5IARA 3H11A 4QTYA 1SHJA 3DEKA 2CNKA 2J31A 3V4OA 4I1RA 4EHLA 3R7NA 2C1EA 4ZVQA 2XYGA 3H13A 4EJFA 2CDRA 5IC4A 1RWOA 3PD1A 4D3YA 2J30A 5IAEA 1RWNA 1NMEA 1RE1A 4JQZA 1QTNA 1I4EB 2XYHA 4ZVOA 4QULA 3KJFA 4DCJA 1ICEA 2CJYA 4ZVRA 2H5JA 5IBRA 1RWVA 4ZVUA 3R5KA 3GJTA 2H4YA 2H65A 4NOKA 4N7JA 5IASA 5I9TA 4JR2A 1GFWA 3K7EA 1PAUA 4M9RA 4DCOA 5H0IA 3PCXA 2FQQA 2Y1LA 5IAJA 3NKFA 4N5DA 1IBCA 4PS1A 3QNWA 2WDPA 4QUJA 3SIRA 3EDQA 2HBQA 4JJ7A
chains in the Genus database with same CATH superfamily
2JFYA 1F9AA 3ID6C 2HNKA 2VPPA 4NZZA 4XXHA 2VF5X 3U5ZB 1VI5A 2VJLA 1GSIA 3ZCXA 4AF8A 4HJRA 4TQUS 2BGGA 3GFOA 1DZ3A 2C2HA 3AU8A 3DM9B 3IAAA 4X41A 1KDVA 1QO9A 2JA1A 3UMYA 2N1MA 2WUGA 3L07A 3HXLA 2GF0A 4L8GA 4TMKA 4AU1A 4FCWA 2PKQO 4EA8A 4YCBA 1QK3A 4GMKA 3C1TA 4EBBA 1NYRA 2EZTA 4KXLA 1OX6A 3W2GA 1XRMA 4B4KA 2G5CA 4UBKA 3TRDA 2Q3LA 4QLOA 3FDZB 1N77A 2ZI3A 3KRTA 3QENA 4AJJA 2C7RA 3R9XB 3T94A 5AJWA 3RUAA 2BBSA 4RGYA 4N3GA 3FYUC 4NU0A 1KI7A 3OLXA 4F12A 2WWWA 4EJ0A 1JFTA 4YJ3B 2W2TA 3I5AA 4BV2A 1IZ9A 2X23A 4J1SA 1LBQA 1OE0A 3SS9X 4TV8B 5EJGA 3V4PB 1TGVA 5BWNA 4B80A 5BR7A 1MCZA 4AMYA 2HMYB 4GMGA 4GRAA 4BO1A 1KVSA 4M87A 2C5HA 2HPVA 1DIOB 4OGGA 4Q34A 4FM9A 4OQYA 2QMYA 1A50B 3PVSA 2IEZA 1O95D 2PS1A 2YNMC 1R5NA 1IMJA 3WKAA 1EEXB 3I9V1 4H27A 4QGHA 1T4MA 5DYYA 4BNKA 2FPMA 1UP4A 1G16A 4DLVA 1GAEO 2P78A 3KKKA 1WMAA 4CIBA 2CVHA 2HSZA 1L8AA 1SEPA 2Q5OA 1E9FA 3LC2O 5CNJA 2JIOA 2LW7A 1FJ2A 1IXSB 3W9YA 4E2YA 4NG4A 1OJ7A 1XLVA 4HDKB 3OZTA 1V71A 2VIIA 3NHSA 3UM9A 2C4UA 2VWGA 4WNIA 1QUEA 3H84A 1RYBA 1Y1PA 4GC9A 4GUAA 4ZT5A 4KN6A 3FOWA 5A2GA 1KIFA 1B14A 3PI7A 1EFTA 4YGYA 1Z4MA 1M75A 2QI9C 1MPXA 3CS3A 3PUVA 5HJEA 2OA0A 2A8YA 3KM0A 1B1CA 1TZJA 1BWQA 2ZE8A 3KQVA 1OWOA 1DX9A 5HMLA 4QTYA 1Z8FA 3RBXA 2IHYA 4S0ZA 4NC9A 5JAUA 4XWWA 1EE2A 4I4TB 3H1AA 1GGNA 3DVAA 4QX6A 4YWHA 4JLAA 3A4IA 1K89A 4HS4A 3QXJA 1LC3A 3SPXA 1BDIA 3PUZA 2ZBVA 3L8YA 4Q9NA 1UZNA 1RZRA 3L4BA 1D5CA 1T8UA 1V2HE 2QTHA 1N5JA 1TU0A 3C24A 1DAMA 1OUMA 1YHZA 2CYAA 2LTAA 2DFPA 3HJBA 4YAWA 4KAFA 5DYGA 1CEQA 3UXMA 1N34B 2M9MA 1GGFA 1EK2A 3EGDB 3LCRA 5LKAA 4PNEA 1N5MA 1ONPA 1Y8CA 1ZUIA 3O5AA 3RUPA 2JB9A 3AW8A 1MEEA 1SBIA 2G40A 4JWKA 1Q1GA 3QEKA 4DIFA 2EYQA 4TYQA 3GVXA 1AUXA 5K3SA 1AGXA 1USWA 2H85A 4AKGA 3ZJVA 1POXA 3BCSA 4JCCA 4R2HA 2OUKA 3EG5A 1RJDA 1WR8A 4R3WA 2UXBB 2P6UA 1SC1A 2OZLA 1MC5A 4TX1A 4WLEA 5G4KB 4PAOA 5TEWA 3BILA 4GKKB 1UXHA 1WULS 4EUSA 1J5PA 1YBAA 3KOOA 3MFYA 3T7CA 1YUMA 2X8LA 3IAM1 4DJTA 3ASUA 2QGFA 4MLPA 2OC4A 5LLSA 1IJEA 1KMCA 4WK0B 4S1OA 2CXRA 4GS5A 5H4GA 2HA0A 2XUIA 4FBLA 4GRDA 2GASA 5JCXA 3L4KA 4UTRA 4R05A 1F7UA 4JLDA 4ZPJA 2X0IA 2HZBA 3IAM6 3QUSA 1K27A 2RE8A 3WB9A 4JQSA 1MB4A 3W5BA 1EM6A 5E8RA 3RANA 2LXNA 5C32A 2V7EA 3FCAA 1NUAA 5D6NA 3U39A 2VNKA 1E6EA 1RC1A 3MCUA 421PA 3DLBA 3R3YA 1ZOPA 1NF8A 1FJXA 4UCWA 4A8PA 3MVEA 4PAQA 1U02A 1ADYA 2XGGA 4Q6WA 3W34A 4HGOA 1N0VC 3E7WA 4EGJA 5CG1A 4Z0NA 3N75A 1N25A 3JQGA 3NTLA 3A6ZA 1IG0A 5L40A 4UFPA 3ERCA 1OLUB 3TF5A 2O19A 1XEAA 3U81A 1E60A 1SQSA 4JOCA 4NLLA 1O89A 4YDQA 4UNPA 2P0AA 1BN6A 3AR4A 3M70A 4WK4B 4MWEA 2COEA 3KL4A 4O4IB 4N5MA 3TOXA 3WVNA 4DT1B 3DV9A 4WZZA 5IYZB 4UPDA 5ESRA 2XNDA 1FS5A 3SC2A 3LXUX 2C8JA 4ID3A 2ISQA 1OBVA 2HLNA 5EGNA 1AK9A 4V0SA 5JCZA 2W42A 3C5HA 3HBNA 5AKYA 2VT7A 4CETA 1AKWA 4Q18A 5JVDA 4RD0A 5ILGA 4JL8A 2WMOB 3DFIA 3KYIB 1R4NB 4DG9A 4YAKA 3WKCA 4DREA 1Y80A 1D7OA 3GX1A 4FFVA 4B3RB 1SBHA 2X9NA 1T9BA 1RM3A 1FDWA 4FEEA 2MJLA 3NYIA 1KHHA 5M2QA 3L0ZA 4TM7A 4YJHB 3U7QB 4G01B 3FVRA 4G5OA 4L5IA 4FE4A 2D6FA 1GT91 4IMJB 5FH9A 2KW5A 1N6OA 1SKAA 2Q7DA 1IWBB 2VJMA 1I8TA 1VPDA 2D3WA 2MINB 1X3LA 3MJHA 1K75A 4JP2A 5KYXB 1GZDA 2CVZA 5M29A 2LNDA 1J7KA 1JHPA 1QAMA 4JVLA 4L75A 3I5YA 5IJXA 4LZLA 3RTDA 5KTNA 2ZFUA 2C42A 1G5RA 4ZC1A 1KO5A 2BI8A 4H1HA 5IDYA 5J4KA 1L5FA 2QTTA 2WR8A 3PHBE 5DBHX 3UJ9A 3EIFA 2D3TA 1RXCA 3RT1A 2FCRA 2X77A 3OY7A 1DCMA 2XYHA 4XVUA 4BN5A 2PJRA 3LBAA 4ARCA 2BM8A 5MGBA 4IGKA 4N5IX 2AOVA 3H75A 3AVWA 5FUBA 3MGAA 4FDTA 6LDHA 1C1DB 4CPDA 4BVKA 3EGEA 3OZWA 1SR8A 3KCQA 3COVA 4U0KA 3PL1A 1YJ5A 4WOBA 2QRPA 4PYJA 4J2OA 1Y6JA 1MO5A 1TUEA 1YVPA 2JGKA 1F3OA 3SE7A 4KDEA 5EXSA 3FPHA 3NWOA 4K6KA 4RHXA 4OI0A 5D84A 1NF3A 2AEMA 3L93A 4XKJA 2JHGA 5H80A 3X1WA 3SX2A 4B3BA 1WB6A 3MCVA 1MH1A 1XLUA 2GPBA 2JAWA 3G9ZA 3P0JA 4W5WA 5FTNA 3T0IA 3FGOA 5HIKA 4DF3A 1QYRA 3BXFA 3R0QA 3R3WA 1L7AA 4I0WB 2OO7A 2CNWA 4U0JA 4YDHB 5DX1A 1DB3A 1ODSA 5E3IA 5IT9A 3RWOA 3AEYA 1XQ9A 4XD7A 3D8RA 2W4IA 1KDPA 1C3OA 3VTAA 3RTGA 1QRSA 3AVTA 4W5OA 4N7MA 4JP5A 4BASA 3AUUA 3ZZMA 4IDDA 4ENVA 5BYBA 5JANA 2I67A 3IQEA 5BW5A 2G6TA 3JD1A 3OPYI 2ZCUA 3FSJX 2UZAA 5U1PA 1DXOA 3CZAA 2FSUA 2XF2A 3SYKA 1Q21A 2XOKA 3RRBA 3P9KA 5IAGA 3BT7A 2NZUG 1KEPA 2Q4EA 1S3SA 1Q77A 4MEBA 3ZD6A 1JDSA 1U2GA 2WU0A 3PQEA 2Q45A 3GFRA 2OQ2A 1XGKA 3QELA 4MUHA 4NMWA 3ZD9A 1N78A 2J59A 3VR4D 2Z2ZA 4KXXA 4O3MA 1ZOIA 3SDBA 3AP1A 3FPLA 2FVXA 3RS9A 1OZFA 4B4DA 3PNKA 2WYIA 3WP0A 4HR7A 3E48A 1FJGB 2OYCA 4UULA 4ZQEA 3BM5A 5DTEA 3ZBTA 1FSSA 1S2NA 1ZZEA 2APJA 4L7QA 1F2VA 4JKOA 5C35A 3NYRA 3RARA 1CUWA 5CD9A 1JFSA 4E4YA 3HVJA 3RRXA 2DHEA 4DLKA 3LBYA 1VLJA 4G26A 4G5FA 4I14A 4V39A 2GNOA 5ED0A 4O33A 2HT1A 2I80A 4CMKA 4ON9A 1RTTA 4C0BA 4NX2A 3OZGA 4EG4A 3IDOA 3K70C 5KWEA 4BMYA 5K05A 1TEZA 2IYZA 1KKUA 3BL6A 1XAGA 4JI7B 2CWDA 4E09A 1TVKB 3DBOB 3NC1C 1Q7TA 3EIQA 4MQ6A 2R8BA 3HLKA 2CSXA 1S3GA 1EINA 5DISB 1XEWX 3LS2A 2DB3A 2IT1A 2HTEA 4DCTA 2GVDC 1WPGA 4GXRA 3H2GA 5FADA 2ZDGA 3MIIA 3PD7A 5F5LA 3F78A 4YWJA 1R4MA 1BS1A 4KJXA 4CM1A 2GBIA 5C5EA 1W59A 3E82A 3M5PA 3OIGA 3TZQA 1RRVA 5K8VA 3ESZA 4D46A 4ZVLA 4MUNA 4IYJA 2BR5A 2R751 3E2PA 1TMGE 1V11A 3HUDA 3CVUA 1RQRA 1N3BA 2O0MA 4P7JA 4FGSA 4N3CA 1KI3A 3VJRA 2AQIA 4JIGA 1WCWA 2EWWA 5REQA 3RC8A 4CFSA 4BFWA 2CLKB 3KKOA 3QTLA 1T5OA 1V8PA 5IBRA 1H3NA 2VK4A 3SJAA 4YJGB 5DMXA 4KWCA 4XVCA 3IEPA 4WZ6A 4FX2A 2HDWA 2VNHA 1SWVA 2OXEA 4ZEOA 3OJEA 4DE5A 3U61B 1W2HA 5HCIA 1I94B 2JZOA 4PYRA 4BLUA 2HQBA 4X85A 1PEYA 3VDXA 3CRVA 3CCFA 3L92A 1B26A 3AESB 2GN6A 1N3IA 4XIFA 1HQCA 5JH7B 1NSFA 2DBVO 3KT8A 4AMZA 4DKXA 4DRXB 2IX3A 1N2GA 1OYVA 3OUZA 4AJ9A 2A86A 3VH1A 1Y3HA 1X7GA 2HSDA 4MS3B 1SVWA 1P19A 3QF4A 2J7KA 3T7SA 3EYAA 4LOKA 4EUKA 5CM8B 1OWLA 2YFKA 5E2IA 5DIZA 4B17A 4KMMA 2P8JA 3CIFA 2ZIWB 3IPCA 2IKQA 2A78A 4TWRA 5BP7A 4CW7A 4D4GA 1NRJB 3HJGA 5THQA 1QX3A 1RSZA 1XO1A 4QICA 4JASB 3IAUA 2I6FA 4H2DA 2BF4A 1UKCA 4N6OA 4JWTA 4EL0A 5I45A 3H3JA 4MICA 3UIEA 3UJ8A 1MQ9A 4S1NA 3A2NA 4U9IS 1WX1A 1M2EA 3RT7A 1VSBA 1Y1RA 1XAJA 1OTXA 1I1HA 1XAIA 1U8FO 1PL0A 3F49S 2IPXA 4H6VA 2IPLA 4PF1A 3F4LA 4CLRA 3WC4A 1XXHB 1TT5A 3BX1A 5LCXA 2Q0SA 5EZYA 1OXMA 1ZL0A 5EEHA 4JCOA 2I6TA 1SNYA 3VPDA 1IL0A 2UZ4A 4BQNA 3SVZA 1DCFA 2VATA 2PX0A 4E5NA 3OEWA 3TDNA 2PMWB 3UAVA 5DT2A 3OOEA 4NYMR 2Z8YA 3EXHC 4HLDA 3OBBA 4C5BA 2GR9A 1XMPA 3SQOA 1JEEA 3UICA 5LQJA 5DOZA 3C0KA 4Z8XA 5IAKA 4W1RA 3R6DA 3TXAA 1JKJA 3UBMA 3V4SA 1BX0A 2EYUA 4RZUA 5H4HA 3UHAA 4DEVA 4RIHA 1O8CA 1PLKA 3HN6A 4KPUB 5G02A 4LRUA 4KMRA 5K4GA 2AFIE 2VAPA 1C81A 4C22A 1N8TA 2H00A 3U3XA 5AXBA 4CWAA 3O73A 1Z6QA 4ICIA 4IFTA 2N9UA 1TM5E 2SNIE 4P6VF 2R1UA 4ZT6A 1L5GB 3D4PA 1V1MA 1ZGCA 2WJJA 1U3DA 2ZSJA 1MVNA 2CHFA 3NBMA 1Z07A 3VKVA 3DLHA 5L6LB 1SUCA 1YKFA 2HCRA 3Q7EA 1DJNA 2WD7A 3EVEA 4NOMA 3E4DA 1R6XA 2QVBA 3B38A 4NECA 1S01A 4F2WA 1CVIA 2Q1XA 3LPAA 3C98A 1PQPA 1Q95A 4H1TA 4OXRA 3AOEC 1V35A 1ZBDA 1FRNA 3FNEA 4UOEA 4BAZA 3LUPA 2IXEA 4HF7A 5KKNB 1Y8QB 3TFOA 3L7OA 2NT4A 2PX4A 4F3CA 3IKJA 4HJXA 2OBBA 4ZZ2A 1MIOB 1XKLA 2MYPA 5AK5A 5JWHA 4Q82A 5TQJA 3CZ9A 5DYNA 4Q1BA 5AIBA 4FOLA 4MGIR 1G3UA 3H9GA 2IYTA 2YN4A 1SK9A 2VP5A 3DYIA 2ECKA 2ZWMA 3JASB 3MGKA 2R00C 2ZUDA 3ABQB 2HA7A 3ZI4A 3MAJA 1N2CA 1YS7A 4C0AC 1L0BA 4YV1A 3ZJYA 2X2PA 4MW4A 3TW8A 1V2GA 2BKLA 1TCUA 2VAMA 4AG6A 3PHHA 4PQGA 4DG5A 5KQPA 4MS1A 4KREA 4WAUA 3ROEA 2ZE5A 3IAEA 4NESA 4MRNA 3CKLA 4G0ZA 4HATA 2IGTA 2WG0A 1KQ3A 5TJHA 1NATA 4MGZR 1FTQA 1XZNA 1EFVA 5IAJA 2HRBA 2O5RA 3U9TA 1MX5A 2HF9A 2WM9B 2DY1A 4PXSA 3T9BA 2B69A 1U1DA 1AGPA 2AZDA 4GMXA 3FVQA 3I4FA 5BQPA 4EJ2A 4KRGA 1K8RA 3NCTA 1L5YA 1X15A 2PZGA 4COKA 3HR8A 2R8YA 3GW8A 3QFHA 5M04A 4HGYA 3G2OA 3EWAA 1KO4A 3ADPA 3BD9A 1BCSB 3WNBA 3EW7A 3PFWO 4UD2A 1F4LA 1MT3A 2E4XA 2VDQB 3OKFA 5C8YB 2JPDA 4HX2A 5I9BA 3QVMA 1JAZA 1HEUA 4IO0A 3CF6R 3UV6A 4L8WB 1A5BB 1DIAA 3O2JA 3HUUA 4GR5A 4MQ5A 4DR6B 3EFHA 2JI8A 1B3RA 2I62A 1QOZA 3KVYA 3PEUA 4NV1A 1Y9ZA 4IIJF 3AKZA 3SY8A 3OMXA 3AX6A 4UMEA 2H2IA 3V8EA 1NRWA 1DJLA 4OJTA 5D8DA 4BVFA 3ORSA 1H1DA 1G0NA 4R9UC 1QIHA 3BWEA 3DE2X 2W2LA 2NUTA 3HA5A 4HNAA 2VJOA 1DOZA 1P2DA 2WTXA 2WAXA 3LUJA 4IFEA 4KC0A 4U6NA 1M83A 4BMOB 2WILA 3F47A 3PIDA 5H3CA 3L9WA 2EX4A 3EIWA 3GH3A 2J07A 1AUOA 5CX1A 3R7AA 4ZPXA 2G9ZA 3PENA 3PZRA 4IGEA 4L85A 1Y9JA 3WLLA 5TF4A 2VJCA 5BVGB 4EW2A 1N9KA 5BT8A 3SQDA 2EC5A 1W4ZA 2C4VA 2H2HA 5IUJC 2QVLA 1BROA 1VTKA 2VDWB 1ISGA 4Y7CA 3WYFA 4ALMA 2HA3A 1IN4A 2FPWA 4EATA 4EX6A 3AF6A 3FBTA 2BCJQ 1BXRA 1ZMTA 3HNOA 1E9CA 2BN4A 3F98A 3FNIA 4TTTS 2JRLA 4DILA 1T24A 2RKOA 3TGLA 3RAPR 4YX9A 4RZIA 4E51A 4C6TB 4UHCA 2TMKA 1DX4A 3R4VA 1KO8A 4K9NA 5ER9A 3OHSX 5JMPA 1WB9A 3PGKA 4O4JF 4CMIB 5H9VA 2DSNA 1O0BA 1ZM2A 1P17A 1V37A 1VC2A 3DAOA 2FRXA 3MPOA 5JZOA 1RQGA 4IUCS 3EHDA 4LJ8A 4LXGA 3W2TA 1HX7A 3OLVA 3FVTA 2E49A 2GLTA 3BXOA 3U4IA 3R7LA 4BP8A 4ZTUB 1GM5A 2FP4A 4DLSA 2W8ZA 2KWIA 2ODAA 5DGDA 5IVHA 4ML3A 2X13A 4ZU1X 1H8HD 4YMWA 5L3QA 1PL6A 4BFUA 4B3IA 3MINA 5BV2P 4MTCA 1DWOA 2BFDB 2X1HA 1EE1A 1PHPA 2P75A 4H7EA 4XQEA 3NAQA 4Y1RA 2J30A 3RVLA 1M2OA 4H7JA 1YVEI 5CT6A 5IEBA 2JFPA 1TYZA 4JELA 1RE1A 4FZ5A 3KSRA 3UWMA 3ZY2A 1AQUA 3GNSA 3WK8A 3ND6A 3GUCA 3KJFA 2WWTA 1NR1A 4IZHA 1NU6A 4U2BA 1N6NA 2HSJA 2HWWA 3CBGA 1GG2A 1ZEJA 4OJNA 5GMOA 7REQA 5JO9A 3PHJA 3RYFA 1NVMB 1SBZA 1WHTA 1SXJA 1Y8AA 3X1JA 5HKKA 3EPKA 3DDOA 4MKGA 2QYSA 3KZKA 5KNBA 2PUBA 1SIWA 2C9ZA 4M1TA 3QMPA 3MGBA 4C7BA 2I7CA 3ANYB 1DT3A 3PQ7A 2Q2WA 3CSSA 3W79A 1RXUA 5H70A 2CV1A 3MUOA 4R5MA 4UJ3A 2EQAA 1KYQA 2XNSA 2H9IA 3HZZA 2FN7A 2O1XA 4FYHA 1CNMA 1US8A 3LK6A 3RDPA 5C1DA 2OZVA 1CUAA 4TLEA 2BC9A 3CX7A 2BVNA 1XB2A 2DXIA 5A1TA 4US2R 4ZYYA 1SCNE 2PT6A 3F5SA 1RXVA 5FA6A 4AY5A 4MRSA 2Q0QA 2I0FA 1YOVA 2P3LA 3CEHA 4KQIA 1KEWA 3FWNA 3ZY4A 4S1WA 5DGHA 3C7AA 4QRHA 1QYXA 2E0IA 1UKZA 2AYXA 4GX2A 4RVUA 1CCWA 5NLLA 5LZ9A 3RF7A 1PYDA 1YRWA 3P52A 3VTFA 1UAGA 4M2LA 2NWQA 2C2BA 2R6DA 2X6TA 2Y9MB 4LRSB 2WSSD 4I5IA 1BKSB 3MB5A 4RZHA 4FMPA 4KXYA 4KQHA 5CDTA 4IVRA 3H4TA 2HMAA 2RGNC 1T0HB 1TUBB 4IRUB 1JR3D 3IT0A 2HMSA 4YLEA 2Z2KA 3KQTA 4LCEA 3VO2A 4CTJA 4Q9IA 2EEZA 3YASA 1J0AA 3U6BA 3O74A 1P2GA 1GR1A 3D1VA 4FFWA 3TLXA 1GRVA 5B1SA 3K0KA 3BBLA 4N5LA 3GLGA 4CNQA 5DEOA 5IJAA 4I55B 4M7WA 1WCXA 2R66A 3DXZA 3CRRA 4K8RB 4A3SA 2XHZA 2XY4A 3UNXA 3WO1A 3U7RA 5LU8A 3TEFA 4LBWA 1U0NA 1FTSA 2IA5A 1OLSA 4BNYA 4IS3A 2AN1A 2YV3A 1BHSA 2WYUA 5JPCA 2WSLA 4I50A 3FHLA 4M99A 2X0NA 4BQSA 4RJ2A 2YJGA 2M1XA 3FPGA 1Q7EA 3ECSA 3G2PA 2EW8A 1H3FA 3C14C 1WMEA 5DNWA 3BWDD 3REQB 3ZD8A 5LU9A 1DFGA 1P2TA 1L7PA 4UHFA 1U9CA 3NBZC 4JJ8A 1T3TA 2RGYA 2Z4SA 2EJWA 4BO8A 3MS7A 1KF0A 3UMGA 3LC0A 3CUUA 4YQFA 2F3TA 4MR9A 3AR7A 1YS4A 1OA1A 3M4XA 4F92B 3ROMA 1CQJA 2W6JA 3TMYA 2VVTA 1YD7A 2YWRA 4X3CA 4HWPA 2D2EA 3V34A 4QXQA 4MWCA 1I0ZA 3EA5A 2B5WA 1ZKDA 4OFZA 4Z7QB 2FJPA 2GJ4A 4MWZA 3KYBA 4FFNA 1X1DA 3NH9A 4P5EA 4UAUA 3N2IA 2EDCA 2ZB4A 3PSHA 4J0DA 4MVJD 4O0MA 2X4IA 3KUDA 1Y98A 2CXPA 1Y5IA 4JR2A 4YYEA 4FEGA 4WXHA 3T61A 1SIBE 3NOVA 4Q3AA 3I30X 4FDUA 2WA1A 4H77A 4I1UA 6CHYA 3U37A 4F6CA 1SVOA 2QSUA 3KT3A 4MUBA 2GILA 2W7TA 4W4TA 4M0CA 2C5BA 1ISPA 2J8ZA 1BVRA 1FRZA 4GL2A 3DXXA 1VJ1A 2YIDA 1GZ6A 4GDMA 2P2CA 4M1QA 1BZYA 2ZIEA 4O5AA 4P3OA 3A25A 1BYIA 4QO8A 4A6PA 4D0LB 3ADOA 3RV3A 3HP4A 1K6XA 4UUPA 3O9ZA 5A4MS 1UC4B 4S04A 1VIYA 1G7CA 2QD3A 5LP6C 3GLIA 2VF7A 3CB2A 4N47A 2OFFA 4GOKA 4UVGA 5DBIA 3H8SA 1PGPA 3L49A 3BJRA 2ZKIA 3GDWA 4ND8B 3V48A 1K5HA 3VVLA 4UEKA 4MYTA 3WL6A 5B2FA 4ENRA 1J1IA 5FA5A 4EYEA 3JWJA 1HORA 2QUJA 4OQLA 3KXKA 5AK4A 3L8MA 4BB5A 4D3DA 2BOVA 1FVHA 2IYYA 3MWLA 2H5LA 1NUQA 3L7DA 3PWZA 4OQDA 2IDJA 3Q7SA 1Z0FA 1TTHA 3G0IA 2WIFA 2WKPA 1ILEA 4EPYA 1E3EA 1YL5A 1AG9A 3EB9A 4KR9A 1GD1O 1LDNA 1ZRHA 1XK7A 2QX9A 3LKZA 2HAEA 3Q2KA 1I3LA 2XUQA 4FXOA 4XX0B 4UM9D 4JT2A 1N5DA 1YNOA 1FJHA 1STOA 2RHHA 5HQJA 1H2FA 1LK0A 1CWUA 4QBHA 3ZNQA 2VPWA 2CZQA 1BIFA 1NQXA 4S3MA 1ZISA 3DT6A 3DDUA 4XYGA 5BSHA 4O4IF 3KQLA 1QDLB 3D64A 5IYZF 4IZ6A 2NVWA 3SNKA 1DKQA 1QP4A 1IDOA 5SY6A 2QM7A 4I7EA 1RYNA 2XV1A 1X8LA 4MA4A 3ZDDA 4R2WA 4UU7A 1Z75A 2JLBA 2G5TA 4EG3A 2HRQA 4LOAA 1EGVB 3MMZA 4YP1A 2BM1A 1A98A 2PX8A 1EDOA 3MF4A 4Q3NA 4O29A 3P27A 3GLQA 3PE3A 4GI3A 5EE0A 2QN3A 3QMMA 5IVPA 4CGZA 1JNXX 2JH8A 4RL4A 4WIAA 5KDOA 2V7BA 2HQ1A 1TJ4A 4C2AA 2OD9A 5HFAA 4DEYA 4XOUA 4ZCMA 3R3XA 5KMGA 1C3VA 1QU3A 3NC0C 1DKNA 4LPKA 2B4YA 4Q3CA 3NRCA 3O3MB 4V0OA 1FFXB 1BXGA 5ADUS 3BXPA 1Q44A 2VEDA 2NO4A 4IMRA 1NQUA 4IVPA 3OTIA 2JF0A 4PO9A 4AICA 1J8QA 2O2GA 4AUMA 1GKKA 4OB7A 1TAQA 1ML3A 4ZK2A 1DKMA 3TPFA 1CQIB 4LRQA 5JDIA 2R6CA 4RLFA 1FYEA 2MHCA 1QLHA 2Z5VA 2OCPA 2V0NA 3VR4H 3CJTA 3C6QA 1T3LA 2XYQA 3EG9B 1MG5A 3FSGA 3JAKA 3T3OA 1L9XA 2H8KA 2YQ5A 3K0FA 3L04A 4C03A 3H2YA 4EARA 3EZXA 2X42A 4I6EA 1ULZA 3ZBQA 3TW6A 2O6HA 4HY3A 1IU9A 5BNIA 4WBNA 1FFGA 1XEXA 1UM9B 4B32A 2FK7A 5IK2A 5DCLA 2IW3A 3PLRA 3L1KA 1SKMA 3LUDA 2JBWA 2B7CA 5EWJB 4CHGA 4GPIB 4YCLA 1DHTA 2F9LA 1GLNA 2V6MA 4RMNA 3NWPA 1G21E 1YRHA 1KJQA 3B51X 3EUWA 3FGPA 2VUIB 1F6BA 1NRIA 3NBYC 1CD5A 4H7DA 5C7YA 6REQB 5K99A 2HFJA 4REQA 1DI0A 1E0DA 4P3XA 3TTXA 3FNQA 4H3HB 3U09A 5FWAA 1ISFA 3TM5A 3PGXA 2JJ2D 4NDAA 4QQNA 4D96A 4PM4A 2FEKA 4PRKA 1ZMBA 4IDPA 2Z4TA 1QPZA 4C2UA 3VGPA 4X44A 4AC9A 4FDLA 5AFSA 2KS6A 1CRLA 3PUHA 4F3YA 3JZFA 4RJJA 3A70A 3Q3CA 4FT2A 3BORA 5C7IO 2BWJA 1EI9A 3LNTA 2G8NA 4H0CA 3PTAA 1R5BA 1X77A 2V5AA 1ISJA 1XZCA 4XM1A 5D1HA 1LVUA 2PYZA 3GA5A 3E8XA 1DAHA 3MGGA 4IQGA 3SQMA 4F4HA 4N3BA 2HADA 3TLZA 3TQFA 1D1QA 4ES6A 1L8LA 3DVLA 1G3RA 4LNAA 4PCVA 3WL3A 1OLXB 2QV7A 2R6ZA 2RAVA 2VA9A 4POAA 2C3UA 4QFCA 4DUGA 1NDUA 4RKRA 5IHPA 1L5WA 1VBNA 1N9GA 3M8KA 4TZKA 3BD6A 3NHBA 3HFSA 1T5BA 1WZUA 2LP4Y 4Q37A 3AI3A 3GXOA 4X20B 5HGJA 2I3AA 3N8IA 3KHKA 2VLBA 4BZQA 4DHWA 2BMWA 3WLEA 4RM3A 4G4GA 4BBPA 5FYDA 3HPRA 4F8JA 1TO6A 2QE7A 2QR3A 1JB9A 2VXOA 3K0AB 2HNBA 1NJ8A 5JQGA 1KU6A 1SULA 1GL6A 3UATA 3GOHA 1CUZA 3IOEA 3QU5A 4RD4A 1UM8A 5JSZB 1BRMA 3C4QA 3NU1A 3M81A 5CB0A 4B40A 2Q1TA 4C78A 2WK1A 4X66B 4ZRDA 3NRBA 5C8DA 4M36A 2ZS9A 4MYSA 4DV2B 5BURA 5GP1A 1T8SA 4MW2A 1XTBA 3HCOA 1V6CA 4IGIA 4LDJA 1UZLA 2H1RA 1LWNA 4DMCA 4US1R 3WGZA 4EO7A 4IS2A 4GWKA 2BM9A 3OU7A 4RANA 2ZB2A 1NLMA 4O2LA 2AQHA 4RYLA 3GZNA 3A58B 3HJHA 2QJOA 3MS2A 4KIJA 2QL9A 4O4LB 4TXHA 4D9GA 4DMLA 1J5XA 5HEKA 1E3TA 1KAMA 4MIOA 1SVIA 4DQLA 1GPJA 4PICA 3QLTA 2FLWA 3GEEA 3MTBA 4QO7A 3UMSA 4A27A 2X8AA 4BHTA 3JAWB 3UJ3X 2HWUA 4DYHA 1C8KA 1KQFA 3ZK9A 1WQ3A 4QODA 3KEMA 4C87A 5C80A 2FE4A 2O48X 5AW6A 1KGSA 2PHZA 4X8LA 3PFBA 1ZH2A 1DWUA 4IOJA 3DYBA 1JN0A 3CJQA 2PMDA 2CNKA 4JJZA 1DDOA 2R6AA 4LX8A 3R41A 1M1UA 4IFBA 3T7TA 1TKRA 1YL7A 4NJMA 5GZ3A 3ZZUA 1ECCA 2HDNB 1J56A 5TT1A 1DCTA 1QE0A 2XRMA 4MVWA 4IQ8A 5SYMA 1NFFA 1QHEA 2RI0A 3CBQA 3OESA 5J3JA 1V3UA 2ERXA 2IEIA 4RA9B 2BGKA 1KJYA 1ENZA 1UQRA 2CBXA 3ESDA 3GK3A 5HF6A 1VJDA 1ZNYA 2H0AA 2ZI7A 3WK6A 5M7EA 1M2HA 3WLQA 4Q1CA 2QAGA 4RD2A 2CFTA 2WM2A 3Q9LA 4RXMA 5B6JA 2PYDA 2FWJA 3TR0A 3V80A 4W5RA 2DWQA 3ZGVA 2ZIXA 4M1SA 3ZZ0A 4BB9A 5KYWA 1SBTA 3A7DA 4JXKA 2DZDA 4GLBA 3UWDA 4POOA 2PUDA 4D0RA 1EIWA 4WKNA 3LT0A 2ZBEA 1J09A 2A92A 4K81B 3T52A 1E5DA 2X7XA 3VR3A 4CG3A 4PS1A 1G3MA 1ZMRA 5JH7F 5I8PA 5IM4F 4BO6A 1VG1A 4JJ7A 1YGYA 3L0DA 3TX2A 1MOSA 4D9EA 1J0BA 1QRTA 3BULA 3H0EA 3OQPA 4MGKR 4R8SA 1GG5A 5LZ8A 2PSDA 4LE0A 3LF2A 2ZYTX 3PXUA 4PEVA 4DSZA 1W0KD 2VKQA 2LUOA 3ZQ4A 2VXCA 3L7CA 3E35A 3ITNA 1UXJA 2PH5A 2PS9A 1A1SA 2B20A 2G9VA 3Q5GA 3P5BA 1VE9A 4YPOA 2J33A 1AQNA 4KE8A 3TTWA 4QTTB 1EKXA 3A0RB 2YHBA 4F38A 1J06A 1E7RA 3KQHA 1EFKA 1XXLA 3EJ6A 3GDHA 4FFSA 2VJPA 1E6CA 3KEQA 3KFXA 4ZYWA 4JUFA 1OH8A 1JX6A 3OJWA 1MOQA 1TQ4A 1UOEA 3VPFA 1OZAA 4MIYA 3O8DA 2HO5A 2QVZX 3LLUA 7ABPA 3D3QA 1TZ2A 1KWGA 2FMKA 2Q9AA 4JIMA 2FZWA 5CGZA 4CTKA 3SQLA 2YWHA 3OD1A 4Q66C 1KAQA 2HJ9A 5FAKA 1T10A 2XCQA 1QFJA 3AM4A 2VP4A 3K6SB 3BMNA 4OF4A 4P4UA 1EFLA 4KQJA 4RTSA 4QG3A 4FGJA 1W85B 1SMKA 4OJKA 2ZB7A 3MCWA 1Z8NA 4PGFA 2BSAA 3IDQA 2AXEA 4TMFA 1YCDA 3UV3A 1T6ZA 4DLAA 5FOWA 2AIRA 4Z4IA 3E5RA 5HE8A 1EP2B 2YHSA 4L5CA 4PQRA 1TA9A 4DSUA 1TF2A 4M37A 3TL6A 1B8VA 4WX2B 4OK5A 3W2EA 4C08A 3VNVA 1O87A 1OC2A 3NXSA 2FAXA 2ZWIA 2JDIA 4DADA 4ER6A 1E5TA 4MQEB 3ON5A 4Q3LA 4QYIA 5KJ6A 1XHLA 3NB0A 2V7QD 5DOVA 4PPGA 3M1AA 2I03A 4Z4CA 1JMVA 1KERA 1R1DA 1IZ8A 2ZT8A 1YB7A 5BUZA 4CUKA 3OE7D 4RIIA 4OHRA 1VGVA 2GQ0A 2BFMA 3H2HA 3FRIA 5BOSA 3IDAA 1EQUA 3KR9A 2KYRA 4K26A 1NJ5A 4U7HA 2D00A 3Q3GE 5I3CA 3S8MA 1CUYA 1WABA 3BKXA 5LB2A 5KOYA 4ENUA 2V4ZA 2X2OA 5H5JA 3X0DA 1JQ3A 3GXBA 3ACDA 1ZN2A 3KKNA 3QVGA 3VVBA 3F71A 4FFLA 4EZBA 1XRSB 5BPHA 5JBIA 1E1KA 3WDMA 4QHSA 4PQFA 5C3UA 4IQ0A 4DMKA 5CIQA 5E0OA 1HQKA 2ATIA 5K6TA 3H3FA 4ZVQA 5JXWA 1G59A 4BY9E 2J3DA 3JQRA 2EJCA 4HWTA 4PHGA 1FQJA 4AG5A 2GI4A 3HBJA 1E7YA 1B1AA 2GCIA 1YH3A 2HIAA 1IUNA 2N46A 1HLGA 3CR3C 1CVLA 3GEIA 2GHTA 2IYOA 1P62B 1ZVQA 1DAKA 1XDBA 2Z98A 3KL2A 1I14A 4W9NC 1CUEA 1E98A 1GDHA 3ZWQA 3JALA 3TINA 4NXNB 3KFVA 1UWKA 5I9MA 3ZDEA 3MTEA 1CY8A 3OEEA 2QS9A 4A8HA 2B37A 3DYVA 5CHEA 1KZ4A 4MV9A 3VPHA 2LPMA 4L5YA 4LI3X 1D6NA 2V6GA 3F67A 3VZCA 4N0QA 4MW0A 5EJ6A 3QVKA 2E55A 3AR6A 3CNNA 4IUYA 5BN3A 3L02A 4CKEB 1RQNA 5LQSA 4WZBE 2AFIB 3NBKA 2OESA 3ST7A 1NTOA 1NI4A 3AUJB 1N92A 3OO0A 4BRSA 4C04A 2ZYRA 2PH1A 3VSBA 4O2BB 4F9EA 5T57A 5C8YF 4HYEA 1YFKA 3VR0A 3VR5D 4ZJUA 3I62A 3DVRX 4AECA 2C2KA 2YHUA 1XTPA 3K1AA 3GIWA 2WZBA 4RWEA 1NLYA 2XCSB 5JAZA 3MG9A 3U3JA 3IL2A 4OHBA 2JKYA 2ZIAA 1FNNA 3ABIA 1M34E 4REOA 5CCDA 4QGGA 1PGNA 3AUXA 3F5DA 4HXYA 4YAGA 3RS0A 3M9XA 1AIPA 4DR2B 4DSTA 4YR7A 3GAFA 4TN5A 3C3XA 3D6JA 1R8QA 3I2JA 1AQLA 5C0OE 1E2NA 1SG0A 1PCXA 3LPMA 3TL3A 3ZVLA 2GESA 2PKXA 2ZBDA 3B6MA 3WL8A 2BIFA 3GROA 5HKLA 2ZZMA 2QD5A 4FD2A 3H9EO 5B55A 2I71A 3TLYA 1Z56C 2OGZA 1UMKA 1U3UA 1VSTA 3ITKA 2YX1A 3K05A 4JKYA 2QB5A 5L7WA 5CG2A 3MWYW 4X6LA 1PSDA 3U3OA 4EMTA 5IBCA 2Y6VA 1NNUA 4YJFA 1EA5A 4BVJA 4CN9A 4FHZA 4ZO8A 2XNHA 2Z8ZA 1PS9A 1Y4ZA 1UPBA 1X39A 2BFWA 3SZLA 4EGCB 2G08A 3OLQA 3IKMB 5L8VA 5LSAA 1M1ZA 2HKIA 4LQDA 3BZBA 3EXFB 3NXKA 4MVJG 4C0XA 3D7NA 3PNMA 4PSUA 1PJLA 1Y5MA 4ZD6A 1ZHFA 2XAAA 5IXSA 3M3HA 1ZGZA 4CG0A 3BGWA 3MYRA 4WV3A 3INRA 1F06A 2ONKA 3ECAA 3EQ2A 4M21A 4YLGA 4CM3A 5LQDA 1WG8A 4XWGA 1ZM7A 1E64A 3IV6A 1FSZA 4E1AA 2CHUA 1K97A 4QDXA 2RHLA 3DEJA 3N2EA 1OFGA 2VI5A 3SDSA 4ZAFA 5JJ5A 2JCBA 3LTEA 3V8RA 9LDTA 3QVJA 1N6HA 4F3RA 1XEFA 3G9QA 1N0HA 3HDGA 4AIRA 2JS7A 4KQWA 4QEDA 3AQ4A 2VZ8A 3O1LA 4GZLA 4ITVA 4QQFA 4BIIA 1QKJA 1RIFA 4B84A 1WJGA 3OCVA 1BRTA 1PW5A 4KVFA 2XNJA 1PSWA 4KUHA 3CISA 4RSRA 2G07A 4PVDA 1GL9B 1JSLA 3ETGA 2VJYA 3N3BC 1JFFB 4NYJQ 4P4SA 5KSOA 2BEVB 3GDOA 1M3SA 3O26A 2H5JA 3BA6A 3T6KA 2DVMA 3WIVA 5E6UA 1P1FA 2ZRLA 1UOPA 5DHFA 5A7GA 5K6AC 1U8CB 4ENSA 4M89A 2BRUC 4ECEA 1G38A 1XMIA 2WDPA 3IVXA 2FV8A 4RWZA 2VYCA 3G7NA 3K7EA 7AT1A 3RWMB 2EXXA 3SGLA 2EX1A 3DKIA 4DS3A 4US0R 3GH1A 2GYUA 3PWSA 3HSYA 2Q3DA 3FHJA 1XD2A 4MB6A 4URZR 2ORVA 3ZV7A 1HDIA 1N7HA 5LN1A 3W9BA 3BIJA 4ZYXA 3MTAA 2JH3A 1PFGA 3AFHA 4ENPA 4I8IA 1FW6A 5EXDA 3DHNA 4KZPA 3Q6IA 2V6FA 5AKKA 1N36B 2I55A 3ONVA 5E9JA 2DCUA 4NENA 4TQ9A 4UUOA 2NUBA 3IIIA 3IHLA 3KDAA 5IW8A 2D06A 2JI6A 2WFLB 3BRWD 2QLTA 3HSKA 3PNBA 4HK4A 4QRDA 3IBCA 2CHQA 2H54A 2O0LA 5EE3A 2NTYC 1Q7GA 2OZEA 2CXOA 3EZ7A 1PJ4A 1U1IA 3QUTA 1A8HA 2VSFA 3PCTA 4HNSA 2F9FA 2AG5A 5G1PA 3OE5A 1A2OA 3S2GA 4UCXA 2CLMB 4QXAA 2OV3A 1II8A 3KKEA 4EQ6A 3Q9NA 1G8YA 4IIHA 2GHIA 4K3VA 4LZOA 2H5EA 1M6HA 4EG6A 1OH7A 4X63A 5FEUA 5HKAA 4MVJH 1S2GA 2W11A 2C29D 1GVHA 4P38A 2IWRA 2ODWA 1E32A 1WW8A 3TO5A 1NQAO 1V8OA 3DBHA 5C34B 6AT1A 1JMYA 2J3EA 4OOFA 8GPBA 4R2MA 1J20A 3C43A 3FLAA 4QUDA 2V7GA 2FSVC 4Q1FA 4QEKA 4R83A 5AUPB 5CB4A 2JCVA 4MV3A 4N40A 5HRUA 2I7TA 3C39A 2OK8A 1EUYA 1O5TA 7MDHA 1C8BA 2CLLB 1T6YA 2QZZA 1MMFB 1KZ6A 3COYA 4LXQA 4U7FA 3WR5A 5JNVA 5C18A 2XZTA 3MD0A 3NEPX 1FL9A 1LFDB 1XRNA 4L51A 5BMVF 4PFQA 1G19A 1R50A 2XWPA 1MNQA 1H85A 3B2NA 3EXHA 1NZFA 3CWZA 3BFPA 3RROA 2C99A 2PMCA 4RQTA 4BFZA 2XA2A 2Q5HA 4DCVA 2PXXA 4BBAA 1JJAA 1ONBA 4BE4A 3L4EA 3PDIA 2O8BB 1XDSA 1UDXA 4Q9AA 2NU8B 3WNVA 3WLKX 1QBKC 1Z08A 2OPBA 2WZQA 3K35A 2NO7A 3BE8A 3DDCA 3U80A 3DWFA 5G0VA 1C5KA 5JRDS 1EZ1A 5HHTA 4PHTA 3M9LA 2FW1A 3OF5A 5C1OA 1A8UA 2PLWA 2BLNA 3A4NA 4HX9A 4DCMA 3CX6A 1VHLA 3ELDA 3ER6A 3HCNA 4D4HA 2WHPA 1JDBB 3G85A 3KVRA 3OICA 2JD1A 3MWDB 3DR5A 4QPPA 1F17A 1UJMA 3AINA 3KUCA 3MZ0A 3ACBA 1Q1EA 2CMFA 5ULLA 3RYIB 2I2BA 3L7AA 3WRVA 5AESA 5LLDA 3ZVKA 1FS4A 1VDZA 4NFYA 2QY9A 5GJWC 5SZIA 4MAMA 3LXXA 5JSFA 2OLJA 3PDUA 4IIYA 2H18A 4F4UA 3D0QA 3KDSE 1BWPA 2QRVA 3GBSA 3R5KA 5A6SA 5TY0A 1AUPA 2JFVA 3EULA 3F5QA 1F38A 5I9TA 2CL0X 5BUSA 1UC5B 3S1AA 1EZ4A 4BNTA 1QE3A 4DIUA 3KSDO 4PO3X 1H93A 3QTBA 3QW2A 5LIPA 1U28C 2CWWA 1IBCA 2WDZA 2BF7A 1JU9A 2IIBA 5LMZA 3VYTB 3T5PA 3Q40A 3NHUA 3I39X 1GL7A 3HGQA 4DSNA 1XOIA 4IG4A 4B3CA 3ZXSA 3G8YA 2MSNA 4QNRA 3I2HA 4M6WB 4L74A 4CLDA 3TNDA 5DM4A 3ADDA 5T67A 2PGDA 2K2WA 1WV0A 3AUTA 1W46A 4J03A 1QFSA 4NK5A 1MENA 4H7HA 2PVCA 2BGTA 1GGMA 4MPRA 4FWIB 5EIOA 3AXSA 2RBEA 2JIMA 1XL0A 1PG0A 4RF2A 1YI0A 2NXEA 4LWPA 3V3KA 2C2YA 1GKYA 2VYNA 3D4IA 3FFAA 4RPJA 3VAZA 4IKOA 1F9EA 4U3JB 5FLKA 3S99A 2IH2A 1EXNA 1EP1B 4FC7A 1HL3A 3DAFA 4M8LA 3A26A 2FU5C 4OFBA 1JQAA 3CR7A 3WWDA 1HT3A 4H08A 1NNLA 1RT9A 2XTMA 1Y1LA 2ZTHA 4QD3A 4NCBA 4G65A 1H6CA 3RC3A 2HEIA 3M5WA 1MJFA 5FXMA 3HVRA 5I48A 3ISJA 1YR1A 2CK3A 2WYOA 3GVHA 3H1BA 1X8XA 3NDJA 4XJXA 5LXTB 3N0TA 4QYXA 1J9GA 2QN8A 3PC2A 3K0SA 3IEUA 3BFKA 4YAOA 1HV8A 4YEDA 3RABA 3WK7A 2D0PB 4AULA 4YT8A 4TLMB 3Q8LA 1O94D 2IP1A 4IY1A 5BNZA 2QW0X 1PF7E 2DUJA 4UBIA 4L16A 2GPNA 3KQNA 4QTXA 1ANKA 3GEBA 1ZYUA 2ET6A 2XCTB 2HSEA 4RACA 2ODNA 3O2QB 4PG5A 4QM6A 4D0SA 3IRVA 4U2CA 1Q1QA 5IG2A 3UAWA 3GL9A 5A3JA 5E6RA 1RTKA 5JNUA 1U8XX 1UK7A 1LPNA 2W00A 1W0JD 1AM4D 1V3QE 2NV6A 3JVVA 4F5ZA 4M1YA 3THYA 1RQLA 4MYDA 4EPXA 2P11A 1XQVA 4WADA 2VBFA 5IH3A 4DBLE 4UU0A 1UOOA 5GIOE 2HA4A 1KQPA 5K0ZA 3R20A 1K2VN 4X1IB 4G81A 3R8FA 2L82A 5DYWA 3V7YA 4ED9A 4RTLA 4IAOA 5JC1A 1N2JA 2A9KA 3KUUA 4MUKA 3O7WA 1Z29A 1OFUA 2HOQA 3D8HA 4QQ8A 3KYCA 3SZUA 1AHPA 2DP4E 1FSFA 2BDTA 2ZJ2A 3HVHA 4TSFD 4NFLA 5AOCA 1AB5A 5AUNB 4TMTA 2XUHA 1PK9A 1U4OA 2PQ6A 2G1JA 1MZVA 3CUTA 3H13A 3T7JA 3H6KA 3PCRB 1IONA 3GJ3A 1GCOA 4RIFA 3TRIA 5T5QA 1Z0JA 2BGMA 3HP1A 1ESEA 1UBEA 3P2KA 1JHQA 3D3EA 2Q3FA 4ZIRB 4Z2YA 3ODPA 3AEUB 5A03A 4UAJA 4W9RA 4BBZA 5HOQA 3S2SA 4MWGA 4W5JA 4ND7A 3TUZC 3IC5A 5BVHB 3GJTA 4BOYA 4QECA 3HDJA 1Z0SA 4MCJA 1Q1ZA 3IELA 2W8BB 221PA 3DD5A 5LYJB 2ZU0C 4FOTA 1O95A 1G42A 3WNCA 4CM4A 4WN9B 4NBRA 2O5VA 1HNNA 2C31A 5DLYA 3VJLA 3FTFA 3WGYA 3L1IA 2B9EA 3PRHA 4EMUA 3FOAA 3NYWA 2GZRA 2WD8A 2KE5A 5CMLA 4HDOB 1TF7A 1X42A 4FFBB 1KY5A 3C5CA 5EWLB 2X7JA 4OI2A 5TJ9A 3UCFA 1VRVA 5KX5F 1K6JA 2YVAA 5ALLA 4BFCA 4ZKDA 1DZIA 3WKBA 3KFLA 1QMGA 3EXIB 1CRWG 3U4DA 4P32A 4A5OA 5LUBA 1GUFA 2OO5A 4GXNA 3V8QA 2DT8A 3H9JA 3K6JA 1JDPA 3BERA 2Z1MA 4PSCA 2PV0A 1ARZA 1ZCJA 3EDYA 4QNNA 3PDCA 2Q6LA 4UPEA 3E8MA 4ZYUA 1OWPA 3K4HA 4JYPA 2C97A 3OJLA 1ZIYA 1FVOA 3OPVA 4Y18A 3V9PA 1DL5A 3W9UA 1M7HA 3NBXX 3Q9SA 2GSDA 3VV3A 4LHSA 4NCIA 1ZZGA 4Q3BA 4W63A 5ALDA 5HF5A 3MLAA 3M1IA 4J0CA 3LDAA 2A5FA 2JA2A 3M33A 4YMGA 1W49A 3I1IA 4LXUA 1NC3A 3HY6A 4RXUA 2Q49A 2M1ZA 4IH9A 5KWJA 2WMNB 3L6EA 5CK5A 3R75A 4YCAA 1KOJA 4XWAA 1RI5A 1L5HB 1PLLA 2VCEA 1H2HA 2WP0A 1DOHA 1CJUC 3EEQA 3ICWA 4X92A 4BQIA 2AZXA 1Z4JA 1XELA 5DHQA 1XLWA 3G2QA 1XZ8A 4L07A 4Z1MD 1VJTA 4YB8A 4F0JA 1G21B 3HXOA 3C74A 1CFJA 5IDWA 1QONA 3A1CA 1TOAA 2PTHA 1JPVA 4KQKA 4RLSA 3CLUC 4P0TA 4NMXB 5IKXA 2HD4A 3PNPA 1K92A 3KQSA 2QDXA 3OQIA 2GTIA 3EASA 5LC1A 1A2KC 1Y8RA 3B85A 2J3MA 1E7WA 1FFDA 1LX6A 3MJSA 4OQ4A 3BGSA 4DC9A 5CBPA 5HNKA 3SZGA 4AKIA 1GLGA 5L9AA 2SKCA 2KMLA 2R9VA 4ZK6A 1QS0B 4GZMA 1LRKA 1U5BB 4G9BA 4KYTA 3TR6A 2BD0A 3ZE1B 3EUAA 2F1RA 2JFQA 4EUNA 3H8JA 4F3KA 3EMVA 4RQBA 2BKVA 2RHOA 1RAHA 1SZCA 1VLZA 3LA8A 4GEGA 1Q11A 2A14A 4DA6A 5I6DA 3U7EB 3AEKB 3K73O 1VPVA 1L5NA 3FCCA 2J5RA 2IDKA 1FW8A 2OLKA 2W6PA 3ELWA 2GPAA 3HKBB 2C2GA 4FS3A 3DMGA 4EKGA 4L95C 4CCAA 5KS2A 3DNPA 2HPHA 3BXXA 3Q72A 2A9OA 3LOUA 3N59A 5E3JA 4IIDA 3SEAA 3TSCA 2XUJA 3OZAA 1QZZA 4PYKA 1IM8A 4BNJA 4JI1B 1V7PC 1KK1A 4F91B 2A84A 4RCVA 4PCLA 1YCFA 2XIQA 3WY9A 1E5XA 1SBYA 2YHIB 3DL2A 2J87A 3FN4A 3ISTA 3ZEAA 5K7SA 4KIUA 4QULA 1J5EB 5SZJA 1X8KA 5K3AA 1RBQA 9ABPA 1CJTC 4JHXA 5F7ZA 5FCDA 3KKMA 2XT9A 4F45A 1F12A 1FBTA 3R3UA 5AXAA 2ZXUA 3G0HA 2WOJA 1HG0A 2I2WA 3C85A 3N7UA 1DCKA 4I36A 4A0GA 2DUMA 3OX4A 4Q4CA 2AQKA 3BGOS 4RH0A 3K09C 1QV6A 3S2IA 5FIUA 3DLCA 1I1NA 1U6IA 2VYVD 4B4WA 3LTNC 1SA0B 1MB9A 4QREA 1C4XA 3ZU6A 5FP0A 3F46A 5JHGB 4WLOA 4GBED 2IVZA 5T8KC 1M2KA 2OCDA 1UR5A 2IIQA 2UZ3A 3DOFA 2Z6VA 2VSYA 5SICE 4DIMA 4ER3A 2EHDA 1P18A 1X7XA 4UZSA 1GIAA 3DEFA 3EOAI 3U3KA 5HZGA 1N2CE 3N0VA 2GK3A 3ZPXA 1XQ1A 3PQ8A 1KSJA 1DAPA 1YO6A 4LHVA 4FK8A 4L73A 3FBGA 1R74A 5DCUA 3BH6A 1T2NA 1U4NA 1RD4A 4EHHA 3JQ7B 4P31A 1NBHA 2QUHA 4Q39A 4TXNA 4BP1A 1GU1A 1M6WA 1W4CA 1YQTA 3HKCB 5EP1A 2UZIR 3EVCA 3BIFA 2XMGA 1G2QA 2RMKA 4M86A 3DBIA 2BI7A 3EXAA 3PJDA 4K6GA 3QWAA 3B8EA 4FR2A 3ZVRA 1L3BA 3LYLA 2UUCB 3E2MA 1CZNA 2Q6OA 1GTSA 2ZWAA 2CHGA 4H4DA 5EQTA 4HDRB 1NJ6A 1BCRB 5KOIA 4CUZA 2R86A 3ZNOA 2P7HA 1RRFA 2DPLA 3LOQA 5IKPA 1Z2AA 3UT0A 5KO2A 4G25A 3V6MA 2ZIUB 4JD5A 3L8CA 4W5HA 4AS2A 3TJMA 4YUAA 2ZYHA 4MHSA 2XLBA 3SC4A 1GZSA 4UE2A 2QLFA 1A9QA 1JAHA 2XT0A 4KFRA 1AY0A 1G7TA 4X7PA 3OZRA 3ZG6A 3BAZA 4LZPA 4CT4B 5KQMA 2PRIA 4PAGA 3AL0C 4G09A 5C81A 2C96A 5HF9A 2IHVA 3CW9A 2X5NA 3CR8A 3WLTA 1YJCA 2BGLA 4LXXA 3WOHA 1Z15A 3BCUA 1SD2A 1ENOA 1IN1A 2WSIA 4L57A 2CJWA 1R0WA 3KNZA 4QUBA 1A3CA 2NQ2C 3UO8B 2BYTA 1DFIA 3VR5H 2QVGA 1X9GA 4URUR 5AM4A 1BN7A 1Z0IA 4C0LA 2RGRA 1QQ6A 2LIVA 3V4RA 2Q5IA 4GL4A 1YQEA 1OXBB 5CH3A 2C00A 2ZXEA 2HF8A 4X61A 4CR8A 3G0OA 1ZGBA 4OAPA 2G82A 3PJEA 4LJAA 2I8AA 4RVCA 5CAEB 1QHHA 1SBCA 1BDHA 4WFQA 2Y1GA 5AVZA 1F0PA 1NU8A 2G4LA 1XF1A 4X94A 5AKIA 4ZZ3A 4MRMB 3ME5A 2YJ6A 1VECA 4HGQA 1KY4A 2JIZD 5NULA 3MWGA 3QXCA 2FEPA 1XD9A 5ERXA 2RH9B 1YU6A 5JYCA 2JIPA 5C4GB 1PE0A 1ZPDA 2PU5A 3INTA 3W90A 1AKMA 4IIFA 1S2MA 4AJEA 3T38A 3VR4A 4M9XA 2RONA 4MWBA 3KEOA 4EJSC 5C8VA 4A8JC 3AETA 3KYJB 3FPAA 2R6FA 3UMBA 1TAUA 2AG0A 2R3SA 4BYMA 1M2VA 3CVWA 3SEZA 1Z6AA 1HLDA 1VYVA 2DR2A 3VU1A 3RBZA 4BEBA 4RA6A 3GVPA 4MUXA 4TL8A 1FXWA 5AICA 2JAUA 1E8DA 4G1CA 3VO1A 4ESHA 1NURA 1L4HA 1G1AA 4E70A 5MDHA 1SUDA 3PFCA 2CLEB 4HLUA 3ZKWB 1RPAA 4YPVA 1G291 1GT6A 4PZDA 5BQ5A 2DECA 1O3YA 2C88A 2YJ4A 1VPTA 3FE2A 4O2BF 4QARA 1WTCA 3UJBA 3URMA 1FOEB 3ZE8A 1CY0A 2HHAA 3W8RA 1AT1A 2REQB 1BE8A 3ZW8A 4ZJZA 4KHPB 2V3WA 3UW3A 4P81A 3M2PA 3UW1A 3GDFA 2OCLA 3VDNB 2W90A 4D8UA 1OIXA 1FMLA 1UMDA 5ICMA 1SN7A 1B3BA 1GWNA 4LC1A 2H9AA 3IR6A 4YRZA 1QBGA 1E63A 3HM9A 1V4NA 1H1LA 3QX9A 3IVCA 2M2IA 1SXJE 4RZ2A 1XCBA 2JIRA 4BL5A 3DL0A 1TQHA 2H3EA 3L0CA 1MO6A 4KDRA 4HRYA 4Y9SA 1JTFA 2W2KB 1DSSG 4DNFA 4JB2A 1G8SA 1LBEA 1FNMA 1U5AA 1LLUA 1HL7A 3EAFA 3N0XA 5FHQA 3F6CA 4K6HA 2YDXA 4P80A 5BPFA 1MW9X 3PR1A 4TTSA 4NH0A 2ZBGA 1OVMA 2FWMX 1R0BA 2WHYA 5BWMA 5C4MA 4D6XA 1KMHB 3KXLA 3GMIA 2JG3A 3SFZA 2FQXA 4GR4A 3K6RA 1EK1A 3ICEA 3R09A 2AJDA 1UAYA 4AJLA 1YS1X 1PQ4A 3KZ1E 1WZ2A 2ZAMA 3VYVA 3W06A 1H2YA 1MXFA 1X7HA 2Z30A 4FGZA 4WL0A 1NUPA 1GN9A 1IEXA 2DKFA 2IEBA 3W6UA 4I1IA 3T5BA 1Z28A 4M9SA 3U19A 3RFVA 4RJTA 4D99A 3TCXB 1LI5A 5EHXA 3KLOA 2B4AA 1XX6A 2LBPA 3GPCA 3RI3A 1M2WA 4JYAB 2ZSFA 4WZBB 1RXWA 3AF4A 1U0LA 4C0QC 2GN0A 2Y9PB 1L1EA 1R8SA 2YWDA 2XQVA 2YY6A 4CI9A 5A4IS 3X1ZA 3STWA 1QPBA 1NVGA 4BNHA 1JIXA 2FFAA 4ENTA 1T4CA 2VWPA 3MFQA 1TIBA 2OAP1 4ZTZB 1A9XB 3RS7A 1PNTA 4ZO9A 1ZJ5A 1BA2A 1JG2A 2J0VA 4Q00A 2CT8A 3OFSA 1OI3A 4DM4A 1BFUA 2BHTA 2DBRA 1HC7A 2YBEA 4F85A 4ERXA 3FUWA 1M34B 4P3KA 1NPDA 4Q1DA 1D2NA 4ZQBA 2ECFA 3LYUA 2PQ2A 1KJ9A 3H17A 5A4DA 1S6YA 3O0DA 5LDDC 5BV7A 4OB6A 3BVPA 3NT4A 4AZWA 2JLUA 1SVUA 4RORA 3GLGE 1C14A 4PG4A 2FQWA 3CZQA 2IPMA 1JNYA 2JHPA 2Y27A 3EA4A 1AXEA 3IAHA 5DO9A 1OFVA 4X8OA 1B6SA 3WE7A 3AERA 1JRLA 1N9ZA 3GRUA 4HBGA 3C3EA 3MRSA 2YYSA 3BAFA 3M4YA 4QWWA 4Q16A 4BGEA 1E3IA 4AJ1A 2AK2A 1A7KA 1MRZA 4QOSA 3T4PA 3V33A 3JTMA 2AR0A 1RPZA 3DDSA 5BW6B 3EUEA 3P9ZA 2XE7A 4NQZA 4NMLA 3UY4A 4D0GA 6PFKA 4RSGA 2CVQA 1PP4A 1J2UA 4YREA 3WLHA 4FT4A 4KFCA 2NTVA 3MT7A 4G1MB 2ZUUA 4TS9A 1RFLA 2WJIA 1XVTA 2IF2A 4ZXPA 2OV2A 3KD3A 3TEMA 3W05A 3GFVA 4CIYA 3HSSA 1PT7A 3I92A 3FPKA 4F4IA 2OFWA 3RJ9A 3D8TA 1HYQA 3EDQA 4V0QA 1NTRA 3CRMA 1Y82A 2GZMA 2XR1A 3C3YA 1P7CA 1PFQA 3KPYA 4MI3A 5CJJA 5IP5A 3GAZA 1P29A 3JQEA 4AKSA 5EHGA 5I4KA 3HHEA 1UKAA 4ZI7F 5B5SA 4V03A 1ID1A 2IOHA 4UAVA 2RBKA 2P2NA 4GPTA 4JMPA 4O2AA 4RZSA 3IAXA 3N0WA 3VGJA 1VSUA 4KQFA 4TZTA 4HQNA 2QJRA 3P20A 5B58T 3TECE 3UQZA 3INGA 4E94A 2ODTX 1NVWQ 4GWGA 6NULA 1KSHA 2QPAA 1QHNA 4FZRA 3RSOA 3ZQKA 3O4FA 4WBXC 4BNIA 1NZJA 2PKYX 3NH6A 1LXCA 3QHQA 1G5QA 1QIDA 4JI8B 3SCZA 2HBZA 2JFZA 1H9BA 4JA2A 3QA9A 4RE5A 5AXCA 4YRNA 3BFJA 4FPXA 1R16A 2ERYA 4GOMD 1E20A 1MBZA 3TSZA 1UZUA 3C48A 4NU8X 1JYSA 5GONA 3TOZA 4XYEA 4NVRA 5K0FA 1ABFA 4AZ0A 4LQCA 4HH1A 4P92A 1VJRA 4BNVA 4KI0A 3PQ4A 1TNDA 4UASA 4P83A 3CIOA 1NP7A 3OQ1A 3TVYA 1OBOA 4RZXA 4LQ4A 1E6WA 4QQRA 5ES3A 5KU7A 4AY2A 1GPUA 3EGVA 5AW0A 2UUPA 3OT4A 1Z3IX 3QKTA 1LRLA 4FONA 2C4NA 4ZVSA 2OEPA 5BY2A 2H52A 3ZXUB 4ND6A 3HXQA 1NHWA 1PUXA 4Q21A 3R0XA 3TS1A 2ZRHA 3TLEA 5HTOA 2IS2A 3N9IA 1FNCA 1Y81A 2BEWA 2QYOA 3GLUA 3TVDA 3OCCA 2GF2A 2QIPA 3A6KA 3OJ0A 4C4AA 1A72A 1CVRA 1VLMA 3CXRA 2IX9A 1GQOA 3FI0A 3H5RA 2FQ1A 1I0LA 2FFRA 2ONYA 2PZKA 2PDAA 4OGKA 4NZMA 3VJKA 3DFKA 2HZ7A 4RQUA 3ZWBA 3HGMA 4FYXA 5DE3A 4QU9A 4UUMA 2J9ZB 4CU2A 3SYNA 3ZWWA 4O63O 3PUYA 1U2DC 1TJ3A 5EUQB 1GPBA 1VCNA 2I2FA 5JSUA 4TSKA 3CZMA 3P9PA 4B35A 4B85A 1Z6XA 4DLYA 5EJ9A 3GWZA 3R0VA 4MW6A 1XDUA 2QT0A 1O94C 1UDWA 3IV9A 3JWIA 5BR8B 2OZLB 4UBMA 5IBQA 2WIDA 5AVQA 3GHYA 3QEMB 1YDEA 4HDCA 4JLWA 4QXOA 3T7KA 1U99A 4XRRA 4X6XA 4D74A 4QLBA 2QUIA 2OSVA 5B1DA 4C0SA 3GG2A 3H9BA 2WYHA 1Z7YA 3N86A 2P1RA 1R5JA 3R5TA 4O0LA 4ZN6A 4M54A 2DOKA 5PNTA 4DM3A 5TR9A 3P0IA 3CNLA 1U90A 4B6JA 3WYAA 1UT6A 2Z09A 2VHWA 2ZRMA 3GFGA 1OX5A 5E9WA 4EB6B 3U49A 2HU8A 4ZOQI 2H4YA 2VBGA 2GXAA 5HWSA 1HK7A 4W9MC 3C41J 4E3ZA 1XKQA 1RRPA 2ZR0A 2CMKA 1P5RA 4F2DA 3KX2A 4HQOA 4W9NA 2ZSEA 3FCSB 1BMTA 2NVOA 1QYDA 2IYAA 2PUCA 2BH2A 3KWLA 3DHEA 2GCNA 3KPVA 3T4UA 1NL3A 3LBIA 5BRNA 1CB7A 4C14A 1SXHA 3V00A 3Q87B 2B4TO 2IHBA 1HTTA 3FPJA 3JQGB 4G5HA 2R7NA 4V0NA 5EIEA 5COBA 2GJ8A 4DQ0A 1XHFA 5ITVA 5KTMA 1MB3A 2XD4A 1Q17A 3VZBA 4BTLA 3AV3A 4NEHB 4DMRA 5JG7A 2ATCA 1ADJA 1G20E 4FLEA 3Q2OA 4DR4B 1NT4A 2OOSA 1DFHA 2D5IA 4MUGA 4JSTA 1WP4A 3VZQA 1Y48E 1H8HA 2NXCA 4CV1A 4ERNA 1G8AA 3RYHA 3TD2A 1D8TA 1EWQA 5KC9A 1QXSA 1ZN8A 2GBCA 2WM3A 2PUVA 3QWFA 4NMHA 3WGVA 1WP9A 1P3DA 1HFJA 1ZD5A 3EGOA 4I2NA 1ZNWA 2NTNA 5JVDB 3M0EA 3RV4A 5KKCA 1D1TA 4MQBA 4Z0TA 2A9RA 3IPAA 2C59A 2F1OA 1WETA 3CZ5A 4C7VA 5KHLB 4EP1A 4B73A 2NP7A 5LXTF 4AM8A 5AHRA 2JJQA 3HB9A 3MOIA 4NH4A 4BO2A 5LQAA 3LECA 5TQ0B 4E3WA 1ZJ6A 3BMCA 3ONDA 2QJWA 2B3TA 3L8DA 1BDMA 2JJMA 3OJOA 1RBMA 1T35A 2VJMB 5B4TA 2DERA 1IC6A 4C1BA 1GGHA 3JRXA 4HMOA 1P60A 1NYQA 4YECA 1FXUA 2FPGB 3TNJA 2IU3A 4WK2B 3UMJA 3E3LA 4B75A 3HXKA 4F4DA 1J0XO 1C7EA 2XUGA 3DOOA 4EHAA 3RH0A 1YDMA 2YZGA 3QOFA 2ZB8A 2ZT7A 1SD1A 1A7JA 1HH4A 1Z5VA 3WNDA 1YKGA 4OYHA 5CVCA 3PDJA 2Q3CA 2WPDD 4N5NA 3VOAA 1SXPA 2H4JA 3JTEA 1P7WA 4KPFC 1NZDA 2YL2A 2BR4A 2UYCA 4I5GA 4QOGA 3GJ0A 4RPCA 2RI6A 4OPMA 4LV5B 2P3SA 3FUXA 4OSEA 4QVGA 3PL5A 4B87A 1OXTA 3DE5X 2RC6A 4NZ9A 4WOPA 3AC0A 1IG3A 3WIDA 3MIZA 4XSVA 2EW1A 1DBWA 4Y2HA 2DC1A 5ENDA 2FMXA 4IGFA 5ARBA 2XDAA 1B43A 2FOXA 3QGMA 1DIRA 4IJUA 1SPBS 2NUPA 2XGMA 2GK6A 4QYSA 4ZAGA 2C1EA 1MJ5A 3SBXA 1H6DA 3KPWA 3MMNA 3WJ2A 3AP2A 3EC1A 3AIOA 3KQWA 4ASUD 3VRHA 1LW7A 1JBEA 2GZ2A 2PMKA 1T4DA 2P62A 3C3PA 1C3OB 1JR3A 5AW9A 5E6SA 2IU0A 4EF4A 4PYLA 4B2LA 4V0RA 2C94A 2KQUA 2ZJ3A 4DIDA 2XMQA 5DNYB 2JFUA 2QMOA 1ZR2A 1CNEA 4HMPA 2ZVPX 3O8CA 3T8YA 3SJUA 1ZLXA 2C82A 5LYJF 4FYYA 3RGWS 4J16C 3W6NA 4WXYB 2EU8A 1KVUA 4GNKA 4RESA 1OH6A 5D5QA 4Y2VA 1U7WA 2C5FA 2HJSA 4HB4A 3WK9A 4EKIA 1EEHA 1LS1A 5K6AA 3F8TA 3SIRA 3LKBA 4WZAA 1P0QA 4AUKA 3M4NA 4G8CA 2DTEA 4ZALA 4JL6A 3GVIA 2D54A 3NVDA 1IWOA 3QPVA 3N8DA 4XAQA 4E1VA 1UBLS 4RZ3A 3W5CA 1RPTA 4RPHA 1KTVA 2QW1A 2QSJA 3V46A 1ORTA 1V9CA 4RPKA 5JS2A 2GN8A 4NEGA 3DMTC 4UTVA 5BV0A 2ZAGA 3OQ6A 3FUUA 1WUTA 4TUYA 1O1YA 4LSGA 4HNHA 3VYRB 3JYLA 4XUEA 3I45A 2A9VA 1XJWA 3DV2A 3CPJB 4JJ4A 4QOJA 4JC5A 5JFOA 5GJVC 4MQMA 4NRDA 3N2KA 3NGLA 5EINA 3GAAA 4XWTA 5HQTA 4PV7A 1VL2A 4MAAA 1DO8A 1NRXA 3FPFA 4HQLA 4A2QA 5IZCC 2XRYA 1S02A 2AL7A 3GN2A 4OQFA 4PYNA 1B42A 5EPUA 4OXQA 3T7DA 2C8LA 2WJHA 5H16A 3KSZO 4GIBA 4OUDB 1Y6ZA 3T15A 1L4NA 4GQAA 4NULA 2OILA 4MVJA 3QY0A 4QDKA 2OAGA 3RC9A 1D4ZA 2FSPA 2JIDA 4KP7A 1R4MB 1W4RA 1N5RA 4E08A 1PFWA 3OPNA 2E3JA 3STTA 3E9DA 1GCIA 3CNHA 1SC6A 2HN9A 2YHAA 3L46A 3NAMA 4F1JA 1V11B 5EJMA 3VHXB 4ARSA 2NU7B 3TLJA 5KTRA 1PS0A 3QIAA 3RSSA 1RQPA 4AW9A 3EPLA 1SKYE 2WZDA 4L7VA 1T0IA 3LVRE 1Q15A 2G70A 2FSVA 2QTFA 2XCIA 2YZ2A 3GNQA 2FUKA 4WNAA 3IBFA 5B64A 3R5XA 3PC8C 4Y2QA 1CV2A 3CLRD 5EPEA 4RCYA 3EFEA 3PX7A 4PSKA 2ZREA 2YQ4A 4EYGA 1O9GA 1I4TD 1V8BA 2DR3A 5MN5A 1XNHA 3RRMA 1R7RA 2QW8A 5CLQA 1R27A 4EO9A 4R7TA 1QB7A 5HK9A 3LO8A 821PA 3AP3A 3T34A 4I1YA 2V65A 1AHIA 3KQPA 1X1RA 1UUFA 2MYTA 2WLTA 3PT9A 4IIEA 3UKJA 5FL7D 3W04A 1N3YA 4CKCA 3PUXA 4B2IA 2W6MA 1NQOA 3F8SA 1WAMA 3UMRA 4D6PA 4RL6A 2HV8A 4ZVVA 4Z4HA 3UJNA 4ZOBA 5A9SA 1J2TA 2A3RA 4EHJA 1Q0ZA 4M1EA 2AC7A 3NQ41 3K9WA 3QF4B 4TL6A 3V2IA 1Z7WA 1X0VA 5L53A 1NVXQ 1SVMA 3SR0A 1K3TA 3W1WA 3VXKA 1CZLA 3L6OO 5ALSA 4FHDA 4UEJA 1V3TA 4J7CA 4ZA2A 2B0JA 2R8OA 1OI7A 2MR6A 2OP1A 2NXWA 5I5EA 3I5MA 2W37A 3ELYA 1XWIA 5HDQA 2VH5R 3OUUA 4KVAA 4WD3A 1PJCA 4D57A 3LWBA 3R1IA 1Q0HA 3A1EA 3L2OB 3AKYA 5EE5B 4ARUA 2C58A 2WF8A 2R85A 3MEQA 2XQJA 2OHFA 4TXMA 1FY2A 4CLRB 1C9YA 2H3HA 1F3LA 3I6BA 3AJ9A 4LOIA 4MUYA 3HM2A 2I1VB 3DQQA 5INTA 2R1VA 4TM8A 1R9NA 1S7CA 3F7MA 3QKUA 4LWOA 5EZYB 1B8PA 3WO0A 5IN4A 2XB2A 4R71A 4HSGA 4AX8A 1PGQA 3ETDA 4FFRA 3ZNPA 1TCBA 4PSVA 4YP5A 1TK3A 5ALTA 4ZI3A 1LLDA 1AS3A 1DO2A 2FW9A 2IP2A 2YVQA 3I9LA 1S2DA 4MWTA 2B4RO 2BHRA 2QUAA 5CLHA 1L7QA 2Y93A 2ZLBA 3LT2A 4MIEA 2AX3A 4DWWA 4OL9A 1OPXA 1N1MA 4PLTA 3QKSA 5J59A 2AEFA 2D7DA 2IV7A 2NNLD 4RM2A 3EQ7A 3W5DA 2DMRA 4JMLA 2MYUA 4LDNA 1GGEA 2XSZD 4OH7A 3K2BA 5FOQA 1VKZA 1NXOA 2Z0MA 3D43A 1F2DA 2Y05A 3QXSA 1CKEA 1V1MB 1IIRA 2QF7A 2VUHB 2H08A 1JWBB 1TMKA 2Y71A 3H87A 3LT5A 3A3OA 4U1RA 4GX1A 1C50A 1MN6A 1OA0A 1GSAA 1P0IA 4PYMA 5HA5A 3KT6A 4PCAA 4B7ZA 4F1WA 1L4KA 2VG8A 2FN3A 4BLWA 1E1NA 3OZUA 4TLDA 2FFJA 4JVSB 1MT0A 4WWHA 4KQMA 1B2LA 3E3NA 5EXEA 4MUIA 1F14A 4L6CA 3SF8A 3WIBA 1XTVA 2PLNA 2RAUA 7GPBA 1VPEA 3R6TA 2IS1A 4CDNA 1JQJC 1PX2A 1RE0A 1TL7C 4OQMA 4XA8A 1XSEA 2JJ2A 4B31A 2C3OA 3HQ4O 2CD9A 4J1TC 4R6WA 3ZH2A 1PVDA 3CN9A 2O1SA 3O21A 4CV3A 1VLLA 4F3TA 1Y34E 3BQNB 2BFFA 4ACBA 3ZLUA 3H3XA 2IJGX 3CX3A 3KLMX 4C4TA 5GINE 1OWNA 3MMXA 3NHAA 1N2CB 3IERA 3AG5A 4ZZ0A 4CIXA 5LWHA 1SXQA 1JVSA 1II0A 3FUVA 1Q1AA 3TW8B 3ZDAA 1BGVA 1T1SA 3OA2A 4KQGA 4MS1B 3JQ8A 2UVPA 4YUYA 1DC8A 1DPFA 1PS8A 1IB6A 2B7BA 1JLLB 1P1IA 3ZCRA 1T8PA 3CEPB 3PEVA 2VF8A 4K46A 3FSEA 3K6KA 4E2XA 2Q0XA 2DHQA 5FV7A 5B3KA 1XLTA 1T2CA 1MHPA 1Z2CA 3DV0B 3HMKA 4KAJA 4XLZA 2RHWA 5EN4A 1FUKA 2P9HA 4KTVE 1Y63A 2VDKB 1N1EA 4AKEA 1MG0A 1Z8DA 1PFKA 1F2TA 3CSUA 5FBLB 4D3YA 3B1YA 3RFFA 4NZPA 4MZDA 1AH2A 2X5KO 1AA6A 2VNSA 1P2BA 1HYBA 4Q4JA 1FE8A 4I4CA 3BWCA 2ZBFA 2CUKA 2HHCA 2DWCA 4B43A 4EYQA 4ZZIA 3GLHE 4OHKA 2I7VA 2O57A 2VCYA 2E1RA 2OP0A 2P4UA 3UMVA 3FROA 1H4TA 3NDIA 1QG4A 4WVLA 5KVSA 2DAPA 4R51A 4UU1A 3VAYA 3PLNA 3ORQA 5JT1A 3QBTA 2NUTB 1LBSA 3BWXA 3GARA 1C4WA 3F5MA 4AJNA 2SICE 1BVHA 2AF3C 2GBPA 2MMCA 3I72A 3NJ4A 3PEYA 1W581 4PYOA 3FDIA 1FRVA 4D4LA 2FR8C 2HBQA 2A59A 3RRNA 4AJ4A 4HMQA 3RS5A 4LFAB 2ZM6B 4HNUA 1YZNA 1UBGA 5SYAA 3WIEA 1XMQB 1I10A 1U0OC 2P68A 3I01M 4HSEA 5F76A 3ROGA 3IMKA 3DKPA 3QUQA 3PQ5A 4BWVA 3WRYA 3ZHTA 3E81A 4R1NA 4BJ1A 5KSZA 4XR9A 1ULHA 1KP3A 5AYVA 1ENYA 3AW9A 3EEOA 1R88A 2FGJA 3OFND 4P7KA 3WWOA 1WQ1R 5KUTA 1HO3A 1T2FA 1JG6A 1K9VF 2WJWA 2XQGA 3R8CA 4NARA 9LDBA 3BCHA 5FHRA 1YJAA 2C54A 5TARA 2YXPX 1GN8A 3UJHA 3ZDQA 3PK0A 1DIHA 4MLCA 4CM9A 5HJ7A 4NP6A 1J00A 3C4JA 4MV4A 4YRFA 2XWBF 2FFHA 3LZDA 3M82A 3Q9UA 3SP1A 3V7FA 3T1HB 5KSPA 4N76A 2ENUA 3IULA 2AN5A 3RM3A 4UOZA 1YR9A 1K7XB 2DUUA 4Q93A 1QHSA 1E99A 1FPQA 1TJ5A 4RHFA 5FDFA 1BYUA 2CBZA 3T5DA 1H8ED 2E85A 2OHXA 1IPEA 1EQ2A 1GEEA 2FMUA 2EFGA 3GZ4A 5B1HA 3FNBA 2WWRA 4Q4HB 3DE1X 2PUFA 3QJGA 1A97A 1RWPA 5LDGA 4B34A 3OFVA 2BHNA 2FP4B 3B13B 1ESCA 4LK3A 4AUEA 5JD6A 4EKEA 2OZKA 5L3QB 3E27A 4DNXA 2HMTA 3LPCA 4QBKA 7ADHA 4PRYA 1E1CB 3GD7A 3SZ3A 3ZGYA 2EP5A 2ZM5A 1QWOA 2PD3A 3GJSA 3RNOA 4R1PA 4BEVA 3B9QA 3ER9A 4Y1RB 5KYGA 3GBPA 4DB2A 2FXVA 3HP7A 4N7BA 3NGMA 1W0KA 5LQRA 1EJ6A 2OV8A 2XMSA 2QTRA 2Q9BA 1M8KA 4GQBA 1GQQA 1RI3A 1GTJ1 1KYWA 1WF3A 3GJXC 3IJPA 3R0IA 2O9JA 3BIOA 4V1CI 5EMHA 2VH2A 2F3UA 3CNQS 3M6AA 4LGCA 5JATA 1XCLA 4HFRA 4OP1A 5F3DA 1EUZA 4K2AA 4P08A 3SHFA 2XMRA 1PR3A 1JIKA 1OMOA 3RYFB 5K9ZA 1P8AA 1SXJB 4TTRA 2WIAA 1SBNE 5EUCA 3N2ZB 4U39A 4E11A 3L6RA 2J9YB 1YZKA 1D03A 1D3AA 5I4BA 5AW8A 1ISHA 3OPYA 4FFMA 3RC2A 1J49A 3LPNA 4OV6B 2NXJA 3C5VA 3HKEA 2FJUA 3G8AA 2PKWA 1V5EA 3KTFA 2ZDQA 4QT0A 4BFVA 5C52B 5GM2A 3IP8A 4GI1A 4LZNA 1W4LA 3W5UA 5CW1A 1US8B 3Q8XB 2AEEA 1J24A 1G18A 2IEYA 2Q2VA 3E84A 3PPVA 4DARA 4RUKA 1FP2A 1TLLA 3BHJA 1MF7A 3EPRA 1H4QA 4CF6A 5CVVA 3TQRA 4HHEA 2WJGA 4FNAA 4TV9F 5CHYA 1XF9A 1T3SA 4YFYA 2HRDA 3DG9A 1UKBA 3AI2A 1E2EA 5EVCA 5B57C 3IVAA 1YOVB 4GEKA 2IZ7A 3HWRA 3IEXA 1PJZA 2FTKE 1ODFA 3C3JA 3F73A 5AP9A 1ZCZA 4K7JA 4EAQA 2V7QA 1OREA 1KIAA 1YJ8A 3PICA 1Z34A 1R4ZA 3OE7A 4F9TA 1KH1A 3H1GA 3L6UA 4N03A 4B6PA 1E2UA 1LLCA 1S7GA 2YUIA 4ZO4A 1EJ0A 5IAAA 4D25A 521PA 2GPTA 1RI2A 2WVHA 4QUGA 3BRCA 3D6UA 3K09A 3ND5A 1Z5GA 5JYDA 2HRZA 1MX3A 1PJSA 2D5AA 1QRUA 3RD5A 2QR2A 2WWVD 4GE3A 2VDMB 3DOIA 1B8NA 3IA2A 3L0BA 1I32A 4DXHA 1IAQA 2X8JA 1OR8A 1QH8A 2Q0HA 3PA8A 1MQ8B 4R2KA 4MW9A 4G37A 4BFXA 1PQUA 4CFZA 1VMKA 1YZFA 1G3QA 2V3CC 1I3CA 2VRCD 3GCDA 3M6XA 3WB2A 4BX9A 1K66A 4YP6A 3IOBA 3S7ZA 5JHHB 1Y4SA 3G8BA 1I7NA 3P9YA 2XJ4A 2A7XA 1XKXA 4E14A 1G6Q1 1L7RA 4CIAA 1T6NA 3LXMA 4AXBA 2XODA 4DEXA 1AXGA 1GZVA 5DX8A 4KFTA 1OLSB 4CLOA 2PL3A 5H68A 1Z73A 2PT7A 4DCCA 5FLXA 2VDLB 1ZONA 4OB8A 5FUMA 1UBHS 1YR8A 3I4CA 4DGSA 2QM8A 4K6MA 4E5UA 4F8YA 5ALOA 2JW5A 4LVOA 1LF0A 2PN1A 4FGWA 5J2UF 1E1YA 3R7WA 1T25A 4MP6A 2PZAA 1NC1A 4NFHA 4EG7A 4XDGA 4Q1EA 5JD3A 2WHEA 4KACA 2ZSHA 1HOTA 1Q14A 2D5BA 2X41A 3HL0A 2NVUA 4KWTA 3TFWA 3W4JA 2B8TA 3ZHSA 5ETJA 2V3VA 2W70A 3G0GA 3PGLA 4ZODA 4YDRA 1UP7A 2RHTA 3TOSA 1OILA 1ULBA 1SELA 1E79D 3EZFA 3CZRA 4OBEA 1CQJB 4CKBA 3M6FA 4YBZA 5HUQA 2GYWA 2PWAA 3A3PA 4LV6A 5ICSA 3MJVA 4NATA 5JD5A 1QF6A 2COUA 4Y1GA 2IKSA 3FAKA 1PJQA 1X87A 5BN4A 2CVOA 3VR5A 4WBSA 3S27A 2GEVA 4LJ6A 1RRMA 2OSBA 1PJ8A