3NR2A

Crystal structure of caspase-6 zymogen
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
262
structure length
233
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKVEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Caspase-6
publication title Crystal structures of human caspase 6 reveal a new mechanism for intramolecular cleavage self-activation
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 233
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nr2A00
4QU9A 1M72A 4QUIA 2J31A 3K7EA 3R6GA 4EHNA 1K88A 4I1PA 1QX3A 2QLBA 3IBCA 4JJ8A 4LSZA 2H48A 2H5JA 4HQ0A 3BIJA 1RWVA 3GJTA 2CNKA 1K86A 2CNOA 3P4UA 5IABA 3H1PA 4FGUA 2H65A 2QL9A 3R5KA 4N7MA 3R7SA 3PD0A 4FDLA 3PD1A 1RWKA 3R6LA 5IBRA 2H51A 3GJQA 4ZVTA 4JJ7A 4EJFA 5K20A 2C2ZA 2C1EA 3GJSA 2J33A 3R5JA 3DEIA 1RHJA 3KJQA 4QUHA 1GFWA 4IEFB 5IC6A 2AR9A 2NN3C 1NW9B 1BMQA 4ZVPA 4QU5A 5IAEA 4JR2A 2QLFA 5I9TA 1RHKA 4N5DA 4NOKA 1PYOA 5LUBA 1RHMA 4ZVSA 4I1RA 2HBRA 3NR2A 2XZTA 4AWBA 5IBCA 3EDQA 5IC4A 1I4OA 2CJXA 1SC4A 2K7ZA 3IBFA 1SHLA 4QUDA 4QTYA 5LU9A 4QTXA 4QU8A 3D6FA 3E4CA 2CJYA 5IARA 4IYRA 2HBZA 4ZVQA 1RHUA 1F9EA 3DEKA 4DCJA 3ITNA 5LUAA 4EHLA 4ZVOA 4D3YA 4PS1A 4M9RA 4AW9A 3S8EA 4EHFA 1QTNA 3DEHA 2H54A 2XYGA 4QUJA 5IAGA 3V3KA 4ZVUA 1I51A 1PAUA 3GJRA 2FQQA 3P45A 3S70A 1NMSA 1RE1A 4N6GA 2J32A 2H4WA 3OD5A 4PRYA 4AWAA 3PCXA 4N6OA 4EHAA 2DKOA 4PS0A 4QU0A 1RWNA 2P2CA 1KMCA 2QL5A 3R7BA 3V4LA 2C2OA 2CNLA 3EDRA 2WDPA 4FXOA 4D3XA 1RHRA 3UO8B 4D3ZA 3H13A 4NOMA 1RWOA 3H11A 5IANA 2C2MA 4DCOA 3H11B 3NKFA 4JQZA 4QUAA 5H0IA 3UOAB 2QLJA 1RWWA 1ICEA 4HQRA 3SIPA 3DEJA 4PRZA 1SC3A 2QL7A 1RWMA 4ZVRA 4HVAA 4NBLA 4JR1A 1NMQA 4NOLA 1RWPA 1RWXA 3V4OA 3R7NA 3H0EA 4N6NA 2XZDA 4JQYA 1SHJA 2FUNB 1JXQA 2XYPA 4N7JA 3NS7A 5IAJA 1QDUA 2Y0BA 3KJFA 4NBKA 5I9BA 1CVRA 1I4EB 5IAKA 1IBCA 4JJEA 4JR0A 1F1JA 2XYHA 2HBYA 3SIRA 4DCPA 1CP3A 3KJNA 4QUBA 1GQFA 3V6MA 3V6LA 2J30A 2CNNA 2H5IA 3D6MA 4EHKA 1SC1A 4NOJA 4QULA 4EHDA 1RHQA 2H4YA 2CDRA 4EHHA 5LU8A 2FP3A 5IBPA 3QNWA 4FEAA 3RJMA 4NBNA 4QUGA 5JFTA 5IASA 2Y1LA 4JB8A 2C2KA 2HBQA 3D6HA 1I3OA 1NMEA 4QUEA 3V55A
chains in the Genus database with same CATH superfamily
4H7IA 4RPJA 3N75A 3HP7A 1FBNA 4TMWA 2MSNA 4UTXA 3JATB 4DBVO 3L7KA 4GZ5A 3CX6A 4R3WA 1DAOA 2EFHB 2ECKA 1C3OA 1NW6A 4N3BA 4ZT7A 2VAVA 4QVGA 3EXHA 3Q9NA 4HNUA 5F23A 5EXTA 5DISB 2YBEA 1C3OB 3T7DA 5HWSA 4YRFA 3EXHB 3P9PA 4LK2A 4N5HX 3BRSA 5IJ9A 4C6SA 2FV8A 3PDCA 3GT3A 4E14A 4NPAA 2BT4A 3EPJA 4MQ5A 2PTGA 3B36A 1PNRA 4KI7A 4O6VA 1DEHA 3BFJA 2IU3A 2VUHB 4F9EA 1XCOA 1HO3A 2NU6B 3X1XA 1KQ3A 5JY1A 2O8DA 1G21B 4BLWA 1QHXA 2J7PA 4N3GA 3TTVA 4LXXA 4UDXX 4IINA 3SBOA 2O8DB 2QN6A 1F48A 1C4KA 4YJFA 1GDDA 3FCUB 2Z3ZA 1E2KA 3TSWA 4D25A 3ZW7A 3O4VA 4MA0A 2AFHE 2FF5A 1T6ZA 2QE7D 5JZSA 1A8SA 1JHAA 4RPIA 4C4YA 2ZJ7A 3DZJA 3QA3E 1RQPA 3FZGA 3ESZA 4ZVSA 4XQ0A 3R7FA 4ZMSA 3KYIB 1WF3A 2B8EA 2K7ZA 1Q16A 3R9XA 1HWYA 2ODQA 1B0AA 1W88A 3GJXC 1W44A 4ZCQA 5BRNA 5IYZF 5JDCA 2A9FA 5CJPA 3AO0B 4DDVA 1W88B 4MRVA 2DG2A 2HCFA 4GBJA 3WGQA 5B12A 2VVTA 1NKSA 3ILXA 3M1AA 3OCUA 3QU9A 2HJRA 3VR6H 3S8EA 1VCMA 5C2JB 1B76A 3AHGA 2XE7A 1PK7A 3T5BA 3UBMA 1CUEA 2GO1A 2YHAA 3OC6A 4FGLA 2H2FA 5J63A 2EKQA 4B7ZA 4DLNA 4DV3B 3C3AA 4O59O 2HM7A 1SBHA 5FOSA 1EZZA 3PNBA 4NH4A 3HTXA 3BIFA 3C6BA 4C6HA 4BPBA 4Y2YA 1YB6A 3VX4A 3U56A 1M1UA 2AG1A 2FW8A 3QG1A 2FG5A 2V6MA 1JW9B 2O3QA 2W6MA 1D6SA 2OK7A 3AP1A 5DK6A 4TKVA 3TRJA 4XQ9A 2JKVA 4QUAA 2OHVA 3CXRA 1LI7A 2CSUA 3EIUA 1E9CA 3IUBA 4TKVB 3QE0A 2HKIA 2BI8A 3LZDA 3O9ZA 5IAOA 2FYTA 3GFOA 4BCBA 2BMAA 2PRSA 1L5YA 3M3HA 1MR3F 2Y1FA 2PKYX 2IHYA 4C06A 2GCGA 3F2VA 5F1KA 3RVPA 2FPUA 3F1LA 4LHYA 4MOWA 6ADHA 3IDQA 5FUBA 4RD3A 4E2WA 2NXJA 1U5AA 1SWWA 4JVMA 1PK9A 3C5VA 3HVHA 4LTNA 4D6YA 4XWWA 3OQMA 5JXGA 4MW9A 4E88A 3RT1A 2VF8A 2XT6A 5EE1A 4F9TA 4I55B 3O3NB 3J80A 2XGJA 3P2EA 2GM9A 3IQGX 1AOXA 4JFRA 4KLZA 1RAGA 3V6MA 1UP7A 5AM3A 1U02A 1GD1O 3FNEA 3QLTA 4RMJA 2IBMA 2IYYA 3OKFA 3F6BX 4J07A 3WIEA 3K6KA 2R8RA 4YIKA 3OO1A 4NG4A 3D0KA 3WLIA 2GYYA 5T8KA 3CZ4A 3L4KA 3USES 1GKIA 2UYCA 1CEYA 2NXNA 1R4MB 3AG6A 3KWMA 4RDHA 2P5SA 4H0NA 1WMEA 4MUMA 5LQAA 2WYUA 5B4TA 1VPTA 2A1TS 1I3OA 3NTRA 1H2EA 1SCNE 1UBCA 3ELYA 3LFUA 4LXYA 1N6KA 3DCYA 2QD5A 3K9FC 1ZISA 3DL4A 4NYMR 1SUIA 4QOFA 3G0DA 3ER6A 1PL7A 3FWZA 3B51X 1ZDMA 2OGSA 2G25A 2WWRA 3GVPA 3UMMA 2PMBA 4I6EA 3OFJA 1SCKA 4HADA 1P5ZB 2VH1A 2HNBA 2CV2A 2V65A 2DR2A 5B55A 1HQDA 5JZ9A 1TO1E 3NVDA 1P72A 4G24A 1HQKA 4YV7A 1NVKA 5EYPB 5BN5A 5L51A 3IOCA 2C4UA 2UYGA 2E4UA 7YASA 2OBYA 2QTMA 1FJHA 1YOBA 1XK6A 2WIAA 3B6EA 3PEVA 3VTZA 3WKCA 3DPIA 2I67A 2WP8J 3FBWA 5B37A 3QKWA 3VGPA 4G1FA 3ENZA 4NFHA 2Z9DA 4Q4AB 1FS4A 3CVJA 3GT0A 4CQMD 1NTOA 1UWLA 1P81A 4QGAA 5C3UA 1BGVA 2P7HA 4Y2UA 2ASEA 3D8HA 3O82A 3PNLA 4MI3A 3ZE7A 1K7CA 4BQQA 5H02A 4AS3A 1AKUA 1DADA 4LVOA 4JXZA 4NPCA 5F5NA 1OLOA 1IJBA 1IN5A 1NBWB 5KVVA 1KAOA 4WNAA 1VGQA 3WAJA 1KRHA 2X5JO 1F0PA 3EF3A 2ZM6B 4OGKA 1LI4A 4PG7A 2RHHA 4ESVA 2O8EA 4AS1A 3DV0A 1PEYA 3PSAA 5HG0A 3N28A 2AJCA 1STOA 4XA8A 4URHA 4AKHA 4IZ6A 1UZMA 1UPFA 3CM0A 1CQIA 1GDTA 1HYGA 1J8VA 3NFYA 1W5FA 2CK3A 1CQIB 2H57A 3OJLA 2WIFA 5KKNB 2ESRA 2MDTA 3BXPA 3BWEA 2V7UA 1QXSA 3L84A 3VH3A 1FP6A 1YB2A 2Q2OA 4UTRA 5CEEA 3WTBA 2C03A 2GD2A 5BMOA 2EX0A 2MTBA 2ZE5A 3OJCA 3PT5A 5C1IA 4JYAB 5K3FA 2H59A 3RS8A 1SCJA 2CCJA 3OSZA 2XMBA 5EQFA 3VVMA 4YGYA 3HL0A 5KQRA 4EY6A 3JQAD 1G0OA 5HTOA 1XN1A 2Q6LA 1ETUA 1YJXA 4M89A 2IUYA 2A1UA 2N9UA 4CCYA 1PJ2A 3VYVA 4D9IA 1T4CA 2GBLA 1Z3CA 3QELA 5AT1A 4CCYB 3C15C 2DF8A 1XWIA 4HB3A 5CYOA 1T4CB 3ZU6A 1BGWA 3QELB 2G67A 3H5NA 4ECEA 2ZI3A 3QIAA 2UYQA 3HXPA 3MLAA 4PGMA 4BLQA 4H1TA 1NUQA 1IPHA 1CVRA 1EUDA 3NYIA 1SPBS 3QOYA 1Q7BA 1EUDB 1SG6A 2QSUA 2HLHA 3L40A 1PLKA 3C85A 3A3PA 4F9FA 4OO3A 1ESZA 1N2BA 3FY4A 2IS1A 2XUKA 4RHEA 4DYDA 4DQLA 1V5FA 3A2MA 1JKFA 1UEJA 5EIXA 4GKBA 4IDNA 3OZUA 3ZU3A 3DTVB 3P96A 2PMCA 4KN9S 3G2JA 3ID6C 3BIXA 1GWNA 3FZNA 3NX4A 2FP3A 2BYTA 2PD3A 2F8TA 2GN9A 4GUAA 4JK3A 2X9QA 5IW8A 2DBYA 1O0SA 3MS4A 4FFPA 1NR1A 3NI2A 4WLUA 4XVHA 3ZEIA 4URFA 4EAQA 4EOGA 1U3UA 4CKZA 3ECSA 1QU2A 4XE5A 2Q2NA 2IYUA 3ESAA 2G9NA 3ROXA 2PGLA 3F6YA 3JD4A 3YASA 1U9IC 2PQMA 1JDVA 2POQX 2V55B 4XCXA 1ZZGA 4KYVA 5LLSA 3JAWA 5HZMA 4DLRA 5AJUA 1WF6A 2R6GA 1N0IA 3N07A 2BONA 2DHQA 1Q1AA 3G7UA 3CSDA 3SJ7A 3SOZA 4AKEA 3VHXA 4KITB 3KWLA 1RWKA 3RGWS 4D4JA 3M6IA 1ID1A 3VNQA 4RZ2A 4E5DA 2W2KA 3KAJA 1T3SA 1IDOA 4XQCA 3BJZA 5BQOA 2W2KB 1U65A 4QYWA 2X7XA 3F5DA 4B5LA 4BMZA 1VBKA 3U60B 2CJPA 2QOEA 4CW7A 4HAZA 3DTYA 3IDOA 2EJCA 7GPBA 4NZPA 2WFAA 3RBZA 1CUWA 1WSBA 4DLZA 4QYSA 3Q5GA 3WFJA 3LGXA 4A27A 3BWCA 1YDFA 5DWVA 2WPDA 3M33A 5IC5A 3QV1A 4JEUA 3O0TA 4RACA 1KY5A 2IEYA 2JBAA 3QVOA 1TA4A 1UDXA 2JGLA 3E27A 3GVXA 3FHJA 2DPGA 4QTUB 2P62A 1SHLA 1KZ1A 3LT0A 3GH3A 3RFXA 3HMQA 1ZMTA 2CLFB 2FPRA 3K3PA 4K9KA 4EYKA 4GKAA 3IE0A 1BN7A 4Z4IA 3HDHA 1H65A 1ZL2A 2OHIA 2WJYA 3UW1A 3JZMA 1YO6A 2JAXA 3NVKI 1DINA 2OCKA 4DJEC 4U2DA 1LJ8A 2J5QA 3VQTA 4YUAA 3LDHA 4GMGA 4KQJA 4K88A 1G5PA 4ND8B 4OATA 1KO7A 3FSGA 4RVGA 3SHOA 1B41A 1FLVA 5FYDA 5KNCH 3OD5A 5TF4A 3M1LA 1OFTA 2W4IA 2X1MA 3NBQA 2VIIA 4ZEVA 3U09A 4AWXA 2VJNA 3HDVA 4DR2B 1HK7A 1H4QA 3I62A 2ZDQA 2FLKA 4NCKA 2XECA 2JI7A 5JALA 4Q39A 2Q27A 1S9HA 3OETA 1QYIA 3ZLBA 1EWTA 5ESRA 4E6EA 2ZJYA 4KQCA 1ZM3A 1CYEA 5FEUA 1PV2A 2PUBA 1JKXA 2X5OA 3SF0A 1DQNA 1TADA 5CXUA 4RLFA 3TSOA 5EJAA 1TNDA 3HCDA 4XASA 4A16A 2FKNA 5FUMA 2QAJA 1WMDA 1C7FA 1ZCFA 1PQYA 3I4CA 1N77A 1X7XA 3RF6A 1KI1A 1UBKS 2RFLA 2CMDA 1EFAA 1IHDA 2CVHA 1A2KC 3U80A 4D3DA 5A4JA 1VI6A 5FJIA 3T4XA 1PT5A 3ZLTA 1QDEA 3DBVO 3V80A 2QJRA 2RGNA 2OPHA 1BKDR 2ID9A 2ZW9A 4V3BA 5CLIA 4BHTA 3KKEA 2Z08A 3D6VA 2J6BA 3HRHA 3U4CA 2B82A 3AJEA 3D9QX 3C1OA 1HGXA 3K1YA 3NT5A 4RH0A 2HUNA 4AW9A 4BBJA 3SIRA 4PZAA 4DCPA 1BMTA 4ZOQI 4EAAA 1H3NA 3RABA 2QUZA 1W85B 3LVQE 4WK6A 2Z6QA 3ABRB 5LP6C 3KQUA 1L6RA 3LQ2A 4NOJA 1EBUA 3JQ9A 4Q9HA 1NDHA 4RXTA 2A7XA 4J16C 2BKVA 1UC9A 1CFZA 2HWUA 5DJ5A 4YRQA 1E32A 3D4BA 2G1JA 5H1YA 2IH2A 1DQYA 4JC5A 4J03A 4RVSA 1NJ1A 2XDYA 3UJ8A 4B6SA 1OH6A 3A1FA 3ZWVA 4JGGA 3QVTA 3X0DA 3T54A 1A3CA 3CVUA 2QSZA 2EU8A 2YIMA 2ECOA 3AR9A 5C81A 2C95A 5DW3A 2DB3A 5A6VA 3VDRA 1EFTA 1IB6A 4REQB 1TPYA 1UQTA 3SQNA 2X1VA 2G08A 4LSZA 2PPVA 5KQMA 4JI0B 4ETMA 4BP1A 2D5AA 3U39A 2IYOA 1CJKC 1ZIOA 1DB3A 5DASA 4ZDIA 1PVDA 4EFKA 3W5BA 1D6MA 1N0UA 2YRXA 3QVUA 4GIBA 3TMYA 1N0HA 2FZVA 4TTQA 5FPQA 5L3RA 4XVCA 4UC0A 1B8NA 3NWPA 1KZYC 2YZKA 3M2TA 1QP8A 4FOTA 5EJIA 1RQRA 3WV4A 1CUAA 3AYZB 3GLHA 1H2FA 4WZBA 1PWXA 3MGGA 5HS4A 5C4MA 1RBQA 2BP7B 2FSIA 3GLHB 1EVQA 2CC2A 3ESRA 1VMAA 3QW2A 1M8KA 4NVRA 3AVVA 4D5EA 3CWCA 4DQUA 3DSRA 1GL9B 4I50B 1Y7TA 2R85A 3A4YA 3BK1A 2WT4A 3VI4B 3SBEA 4P4SA 4B76A 1EVJA 1HDEA 2FQWA 3MCTA 1FJ2A 1JS1X 2JHGA 1UPUA 4V0KA 1QGYA 2YIJA 2HDNB 3HDYA 3O84A 3JRWA 4TWIA 1R8JA 3L4SO 2CLMB 4GM0A 1QKIA 4D0NA 3DZGA 1C3JA 1NI4A 4EB6A 1GTSA 4N0EA 4AY5A 1XX6A 5HUQA 1YXMA 1NI4B 4EB6B 3EZ6A 1RJ9A 1G9XA 1SIOA 2A8YA 3NM4A 3QVJA 3K92A 3HV2A 3L7OA 3OE4A 4H15A 1RJ9B 1I6LA 4E3WA 5HQ3B 3DWIA 4WMLA 3VYWA 4EY3A 1AV7A 1KPIA 1RI1A 2FUKA 4Y3UA 1F14A 2H9IA 3F46A 1J0XO 3DM5A 3REGA 4UHFA 4DR1B 1V4BA 3HA7A 1ENOA 3DBRA 3BQNB 4G8DA 3RI3A 2A92A 2G4CA 3DBRB 1OZGA 1BCRA 1BOOA 2GBGA 2WG0A 4K9DA 4GLJA 4TXJA 1YMUA 1OXTA 2QT1A 3H13A 2OV6A 3IJ5A 1MXHA 1EVYA 4KVAA 2YQ4A 3G79A 5BSMA 5J1TB 2OB1A 4RK5A 3TNFA 4FW9A 5FUXA 1QBKC 4KDRA 5BVGB 1C4WA 5TQJA 3UGQA 2HSJA 3DDCA 4NX2A 3CJQA 3VC7A 5FA5A 1DIBA 3KSMA 3V7NA 1M0TA 1QH0A 3FUUA 1O95D 2XZDA 2HB6A 3HY4A 3H1TA 1VDZA 5DM0A 5G3ZA 5T6BA 3ZWDA 2PZKA 1IJFA 4E70A 2ZBVA 2FMUA 3GNTA 3TPZA 5AUQA 1FFSA 5KHAA 1II8B 2G1KA 4FZVA 3MMZA 4QL3A 4IQ4A 1EFLA 1Z8HA 1KKLA 3GZJA 4N65A 1N5RA 4Z0HO 1AQIA 5EE0A 2M6RA 2GAJA 1OYWA 2C58A 2E89A 1QHNA 3PL5A 4BVEA 3MJ4A 2GHQA 1H22A 3A6PC 1SC1A 3U4QA 4LOJA 4UTNA 1OC4A 5DU2A 1J0EA 5ALKA 1JA9A 5K8TA 3EG9A 3U4QB 2ZUUA 1KJQA 2W48A 4J43A 4XCVA 1KAGA 4RKFA 3RC3A 3WGNA 1A4IA 2XUAA 3EG9B 3WQBA 5I7SA 1HKUA 4F60A 4KVFA 4R1SA 2EL9A 1I2DA 2J3HA 4XXHA 5P8WA 1UJCA 3A9RA 1ZRMA 1E6MA 3QWHA 4I5GA 1NRWA 4U6NA 4OAPA 4R5HA 3AMVA 4BLTA 1CEXA 1U4OA 4EYOA 5IT5A 5K6TA 4ASUD 4JCOA 4ENVA 4OQMA 4IV5A 3AF4A 1Q50A 4RLHA 5DRYA 4BN4A 3E7DA 4GWKA 3EEIA 2UZIR 3M6WA 2ZYUX 2XRYA 4TMFA 5LQSA 4L8YA 2BR4A 2AN9A 4NMMA 1I5OA 1Q0ZA 2XGMA 3CF0A 4FGZA 2Y93A 4DMMA 4DXDA 4WFQA 3FCEA 5JH7B 3EARA 5IM4F 3Q85A 3NUGA 4RF3A 1VKJA 1JXAA 1ADBA 2IEIA 4RFLA 3AX6A 4RPGA 3VNAA 4UCXA 1KIMA 4Q9IA 3D2BA 3W05A 5EKDA 3VYTB 1IZ9A 2R66A 4Z3DA 4MV6A 4FYIA 2MSKA 4H3KB 5G02A 1U1IA 5HCNA 1APBA 5D86A 3JQFA 5CAEA 1X86B 4ZD6A 4FILA 3LDFA 2JBWA 3BHIA 1CETA 5CAEB 1P8JA 4OB8A 2AVDA 3AEQA 5J2TA 1Q83A 5FFFA 5J2TB 3AEQB 3CUWA 5JPIA 1HNNA 4MW2A 2JGJA 2Z5FA 3SZ3A 4N0DA 2D5CA 5BSWA 1NDUA 4HTFA 1H2RS 3W9SA 1GCUA 1SM4A 1Y6QA 3DB1A 4X65B 2GZSA 4WZ6A 2YJ6A 1XKQA 2ZULA 1RM5A 2VCEA 3L0IB 1ARZA 4QXOA 5F9MA 5H81A 4E5NA 3RU9A 3A1WA 4H6VA 3TM5A 2XUOA 1A2QA 1P1HA 4TSFD 3V8RA 2WINI 1DJMA 3IKTA 1ID8A 3EQ9A 1D2HA 2QPAA 4NZNA 2GARA 1K0UA 5KJEA 1A2BA 1LC3A 2VQ3A 1RM4A 2GKGA 4YN3A 3D7SA 1YQDA 2RGWA 1NWCA 3JALB 1T9GS 1ZP6A 1YQQA 4INOA 3OLCX 3CBQA 1VBMA 5E6RA 5BXYA 1AF7A 1H85A 4ZKEA 3E05A 4QECA 2Q7XA 1PQWA 3HYSA 4OHMA 4LGYA 5D6NA 5I7UA 1PFWA 4V0MA 1JB9A 3MTGA 3TZBA 2O1XA 4FR0A 2JCGA 1II9A 2PKQP 5AHWA 3RUPA 5JU6A 1DPGA 2J9RA 3KT6A 4OP1A 5IC4A 3EDMA 4K6MA 5CLHA 4N03A 4RORA 4IJMA 1WXQA 3THWB 4YMIA 2VEDA 1RJEA 4Q05A 1RDFA 3M4JA 3PJDA 1IJEA 2FE4A 4FKMA 3ZBPA 4CIXA 4F7DA 3G59A 1NMQA 4RJIA 2BGJA 1Y5IA 4IDBA 2CDBA 4YAEA 3R0IA 3RS9A 5GJBA 1VE6A 1MO2A 1XRNA 2HWWA 4PXAA 2QD2A 2VO1A 4DJAA 4LRUA 2R65A 1FNBA 1UK7A 3RVLA 2CL7X 3SYNA 2QN1A 3LAWA 3PHCA 4DSUA 4LW8A 3Q15C 3B8HA 2B5VA 2X8BA 1T4GA 2ET6A 3AEXA 3KSDO 2J0VA 1N7JA 1PKXA 4JUFA 4UJ3A 3UWDA 2V7QA 4B48A 3DXZA 3GMSA 2GK7A 4JJZA 1AK9A 1Q7EA 1QHGA 2H4YA 3FKSA 3MJRA 3WY9A 3DP9A 4RELA 3SC2A 2Z43A 3HCBA 4CG3A 4J0GA 5BSKA 4WUVA 2D1FA 4C6TA 3UG7A 1B8VA 1J8DA 2Z30A 3R5XA 1BG6A 2GHRA 1SXPA 2GBPA 3C8UA 1BA3A 1CK4A 1XROA 4UARA 2PUDA 2JLVA 2WPNA 1JE1A 1YS9A 3L8FA 3DFZA 2BGKA 2UU9B 4XSHA 2F1JA 3AFMA 2M2IA 2GETA 3EIOA 1A5AB 5EQDA 1CC1S 1F0KA 2XLBA 2ZROA 1RE0A 1ZX1A 1GKUB 3QG5A 4IXTA 5FTKA 2AZDA 2VYQA 1P2UA 2ZJ0A 4UM9B 1M6YA 1DXYA 3PUYA 1PHRA 1RACA 4QJ3A 1JEOA 2NO7A 4DV6B 1N9GA 2FZ5A 2GN8A 2NO1A 3LNTA 3QVGA 2RKOA 3A9VA 4U0JA 1PT7A 2NYAA 4EPXA 4W9MC 1N9GB 4HD8A 3QVGB 4CDGA 5GVSA 3QE9Y 1N0WA 1RYMA 2HZBA 5K20A 2B7CA 1G5IA 1EU1A 4RMHA 1RMQA 2AWOA 3GBVA 5AI6A 2BFBA 2WU4A 2X40A 2FTKE 4GGMX 5KOJA 1CS0A 2BFBB 1H6CA 4K6KA 1BKYA 1Q2XA 3VR0A 1CS0B 2X4DA 5H9VA 4E0BA 3KXDA 4G4JA 1IN8A 1VJGA 2W2MA 1TM1E 1N5OX 1RRKA 1UFVA 1RKBA 2V1XA 3FWYA 3IQWA 1E6EA 3K5HA 3ZIUA 2VUUA 2E2WA 2PAAA 4QODA 4BNNA 2XZTA 3I39X 1EK0A 1SOAA 3GOQA 4JI4B 4K9OA 1TD9A 3QOXA 1IAVA 4E6PA 5IEBA 3L49A 2DPLA 1XRPA 3UM9A 4PAOA 1GZ3A 2QN2A 3LW8A 4RAOA 4ZQIA 5GZ1A 1RYYA 1ONOA 2V0GA 4KB5A 3GFFA 3WLOA 3GFQA 5B3LA 4YCNA 3FKQA 2YVUA 5ITSA 4MWGA 4M9CA 2BD0A 2WQ7A 5DLPA 5JZMA 1U11A 3TW0A 5AW9A 4NV3A 3IS3A 2D1SA 4LGMA 3PIDA 4ENQA 1M7GA 2OYSA 5DTQA 1QH1A 4PQFA 3ONVA 1D5WA 3HB5X 2GWHA 1Z82A 1SXHA 1V6SA 5AJXA 1AG9A 1O54A 2CNLA 1KZHA 1Z08A 4QXRA 4B6GA 1HDOA 1ZG3A 1X15A 2YASA 4WOBA 2ZFUA 3C5EA 2Q8NA 1UFOA 2JI6A 5CA0A 5HPYB 4OUDA 1TAQA 4ND6A 1ADJA 5CA0B 2QORA 2P9QA 5DSXA 1JVBA 4OUDB 1GRRA 1M2EA 2H4HA 4D2IA 5KVAA 3SMQA 4URXR 3F5QA 4M22A 4GPBA 4ER5A 4JR1A 4DSZA 1EAYA 4AJNA 1QYXA 1SVUA 2FPMA 1I0ZA 3DOFA 4QOJA 4MWEA 2QP4A 4CL8A 2J48A 2ECQA 2O5VA 4JFAA 5JD3A 3NHPA 1IXRC 3IT0A 3BRWA 3SSAA 5BYJA 1ZR2A 1ZINA 8LDHA 4TQAA 1HLFA 3HHEA 3C3BA 3GAAA 3V5NA 3A2NA 3PC6A 2DBRA 1CQJA 3NGLA 4O0MA 4L08A 5ALLA 3VAAA 3NC1C 5C9ZA 2ZTSA 2UAGA 4IL5A 4Q7MB 1CQJB 3N86A 1Z36A 1FNCA 1BFDA 3MILA 2TRSB 3DCJA 1VE7A 5CVDA 3CMCO 2DKFA 3SKXA 1LJUA 4HNTA 4YMLA 1MRNA 1WHSA 2VDLB 4HEA1 2D54A 4UHDA 1XD2B 4DMLA 2Q4BA 5KNBA 2R6R1 1ZHHA 1JDJA 2G7ZA 4V38A 4OUKX 3GRAA 1Q91A 3U44B 4H7HA 2VAPA 1KAMA 1LDBA 1VXOA 1QB7A 1IN6A 3Q3HA 1WY5A 1M74A 4MV0A 2VWGA 4G3XA 4MIOA 1LDEA 1AZWA 4I1PA 3UJNA 4LXGA 2OLKA 3KUUA 3L7JA 4YONB 1E2DA 3IQFA 1V1RB 4HQ0A 5HKOA 3RFUA 2C1XA 2XOXA 5AW4A 1JYFA 4NYJQ 2AMVA 5EFOA 3JD3A 3LFHA 4TMZA 1E79D 3BM5A 3FX2A 1QGED 4F93B 3DMTA 3CVWA 4Q3OA 3FUWA 3E0QA 2VCHA 3GRUA 5ALTA 3OHSX 3T3MB 4LQ4A 4OSPA 5JAOA 4IFTA 4A0RA 4GPZA 5EUQB 2M6LA 1VG9B 2B8TA 2BF7A 4KWHA 2P1DA 1F0YA 5ALMA 3RSSA 2HCTA 4TMVA 1UKYA 4Y6GB 3OZCA 1OGYA 1K63A 1I2MA 1QGOA 2CL5A 2IYXA 2PZ8A 4G8CA 1UIRA 4K87A 1Y8QA 3IQDB 3X1KA 3S2YA 3IHKA 2Q07A 1Y8QB 3PR2B 4GP6A 3EGCA 4B34A 1X6VA 1FVFA 1R0KA 4Z7QB 4G0XA 1NOJA 4QEKA 2R1TA 1NC3A 3HHPA 2Z58A 5DXFA 3TD9A 4HBZA 2HA3A 4MGEA 4AKTA 1W0KA 1CRPA 4QBKA 2DWQA 1U8UA 1CSEE 1NUAA 1K4MA 2HHCA 3MMPA 2G40A 3R40A 4WV3A 3W4IA 1E2NA 4YQFA 1OTXA 5KDDA 4TYYA 1EGMB 1RZUA 621PA 4F1KA 5BWBA 1D4AA 1ZJ6A 1O6GA 3CQ9A 1TVCA 2FWMX 4LYHA 4U39A 1NAHA 1YS1X 3G5UA 4BGUA 4Z0NA 4D0LB 2YJTD 3PQ2A 4WGGA 5L7YA 5KNBH 3ORQA 4NS1A 1MIOA 1GZDA 2Y92A 2BV3A 3RS4A 5IXYA 3VTAA 3C8HA 1FX0A 3BL8A 5H9WA 2D1QA 1DIAA 1FX0B 1FF9A 2NZJA 1USIA 2EERA 3LXUX 4R2JA 2ORIA 4GE3A 2JPDA 1BRTA 4A8HA 5TT1A 3WNBA 5SZHB 5DHAA 2JGKA 3ZVKA 2Y4NA 3ZU5A 1Y98A 2V6IA 3HWX1 2WKRA 4KO8A 1LQUA 3B2EA 4BTVA 2W6QA 1IHPA 2O8NA 1T5TA 5K0EA 5JXWA 2Y0CA 4XB1A 3V1MA 2NIPA 2Q41A 1RTKA 4M1EA 5HZHA 3ACBA 2OSVA 1J2UA 1Z07A 1PS9A 1PJZA 1SUEA 2QTWB 3Q3GE 3VO2A 4P3XA 1ZH6A 1RZRD 1DJOA 3DDUA 5DXAA 1MFPA 4A6DA 5AIBA 4RZQA 1SO8A 2VQDA 4OQDA 1P7YA 4F3KA 1JBKA 2D3WA 5U4XA 1KMIY 4GLOA 3BORA 2Q1WA 3HNRA 4M0FA 1FY2A 1G5RA 1QHHA 2WU0A 2X3YA 3QJ5A 3IMFA 4LC1A 2ZXEA 4B3CA 4TYNA 2DWCA 1QHHB 2Z5LA 1RYBA 1OWLA 3P0JA 2O8FB 5LYJA 1J0CA 2R7AA 4PRKA 2DSTA 2XF2A 1XDUA 2UUPA 1V96A 2Z8YM 4G36A 5G4LA 4RTQA 4U2EA 4YAJA 1UC5B 3LCCA 3I5MA 4NFYA 1HEUA 3WZ2A 1J7JA 4D9JA 2IS4A 4GEGA 5DRTA 5E9AA 3WGYA 5IM5A 2JLSA 1V1JA 3D3WA 3K1AA 1PYDA 4O4HA 3D3WB 3K1AB 1G6OA 1O7JA 3RSCA 4ECAA 1K6XA 4PLFA 2RH5A 3IQZA 4KOEC 3EFBA 3GAZA 3KIPA 2C2BA 3LHSA 3G68A 1NU6A 1TEXA 5JG7A 4A5OA 1FSFA 1N7HA 1JEQA 1KU0A 1R64A 3TMAA 2IE8A 3KAPA 1Y6FA 1YR2A 1PJSA 3UJHA 1JEQB 5FWNA 2WM2A 5HK9A 4I2VA 2EZ8A 3PJEA 4EM6A 1Z2NX 7MDHA 3DBIA 4V0NA 2WJZB 2DLCX 4OMCA 3Q8WA 1E61A 1G8FA 3K1ZA 3MQ4A 4N8EA 4ML3A 5TGZA 4BLPA 4D44A 2PH7A 4LWOA 1E0DA 2BRUC 2CBGA 2CXXA 3MCZA 3HCAA 4BQFA 2FPSA 4B6EA 4DA8A 3KJQA 1E4YA 4I1OA 2Z2ZA 4DADA 4D9HA 5IDWA 1SOWA 4RWEA 1LF0A 5I5EA 3EXG2 3KOYA 3R8XA 1Z5PA 1G59A 2WT8A 1Q7TA 4P98A 3L8DA 4CETA 1JDSA 4Z9YA 3SJUA 3SSOA 2ZAGA 2J0EA 5LOVB 2NXCA 3H5TA 3QFSA 1SAYA 1X7DA 4FEEA 2WTBA 2WVJA 4H6XA 4MYUA 5KB3A 3HEBA 4X6XA 4GPIB 1CNMA 1KI8A 1ZGJA 2WU8A 4LRWA 1QBGA 2GEJA 1JFRA 4KLNA 3E5HA 1IOZA 1G5HA 1HDCA 4A73A 4AZVA 5EINA 1PD1A 3WK6A 4YCCA 3F97A 5FORA 2KPOA 1R7RA 2I22A 4MARA 2I4NA 4RY8A 5JMPA 4KDFA 4JL5A 4RFVA 3CLRD 4DG9A 2BWJA 3VU3A 3OSUA 3FJ1A 2EBWA 3RAJA 4DLBA 2XVYA 3M82A 1AGNA 1U9CA 2QJOA 4IKPA 4J90A 3PV0A 1BVRA 3H2GA 3WYBA 1X77A 1E6LA 2YNMC 1N0VC 4QQKA 5E6SA 3ZE6A 5LN1A 3AM1A 5JCJA 4XIJA 1GPKA 2O4UX 1R0BA 5E6SB 121PA 2HRQA 4MWZA 4UVEA 3QW4B 4R7ZA 3SEQA 2C2MA 1XZGA 1LPAB 1Q44A 2F9MA 3GK3A 4U7TB 3VKVA 4CIAA 5FDFA 4EH1A 4E32A 1G2OA 3CIFA 2AI2A 4I3GA 4OJNA 1ODKA 1OT5A 1Y9EA 1GT6A 3FTQA 1BMFD 1Y5NA 4GC9A 1XTKA 3O90A 5AK0A 3X2EA 1Y3HA 3EGVA 4F6CA 5LNK6 2H2HA 1HL3A 4CV0A 1YFKA 2C78A 5BOSA 1QONA 1OBOA 1AUPA 3U3DA 2I2AA 2RC6A 3CSUA 1U8XX 3SKYA 1WMSA 3O2NA 1VJ5A 2NUTB 3W0LB 5IVPA 2YVAA 3T5GA 3A6DA 3PC4A 4E13A 4ZTUB 4C88A 2YZGA 5FHQA 3C7KA 2P9YA 2WYOA 1ZESA 5KYUA 1DKRA 5E4JA 5IUNC 5CH5A 4JB0A 1GPWB 5KYUB 2OWDA 3CNBA 5AW7A 3IV9A 4LF9B 4FYPA 4M86A 4PAWA 3F9IA 1OLSA 5LQRA 4Q7JB 4OGLA 3KB8A 5F12A 1E2JA 1OLSB 1B1CA 5G53C 4PQGA 1JAHA 3TL2A 3ZPXA 5C35A 4U2FA 3IFSA 2ZUVA 3PRHA 1Z35A 1LB1B 1RRFA 1SBIA 2F3RA 3AUXA 3H5IA 3K0AB 5JFTA 1OSNA 1FZTA 3NWOA 1M0SA 1YAJA 4EP1A 2ZIXB 3SDZA 4YEDA 4LZOA 2C2HA 1ULAA 2ZBFA 4FZRA 4OYLA 3WYDA 4ZRMA 4TYWA 4L78A 4W82A 4MHTA 1NTRA 2GSDA 3JVEA 4L3WA 4Q3EA 4U7PB 1AS2A 3ONNA 3NQ41 4KGXA 4M1QA 3IKJA 2BM8A 5HEKA 4FFVA 1BOFA 2QL9A 1OILA 1FNMA 1RC1A 2ZPAA 3KOWA 3OPMA 2PUCA 2YQZA 1D1TA 4MKGA 2XTZA 3PICA 4MPDA 4URVR 3MJHA 3O26A 3RK4A 4IBOA 1Z0JA 4ZAFA 3RVDA 3M7IA 4R54A 4IKOA 1OWOA 4L50A 2NTVA 3QHQA 2FR8C 1H66A 3F78A 4O4JB 3K5WA 1Z73A 4Y9SA 4EX7A 1UC4B 4M8NE 2PZAA 5ECDA 4G4SP 4XDZA 1XDWA 5IF3A 5C1BA 4RYDA 3GWGA 3W4KA 3OIDA 4PG5A 3MSXA 4UUQA 3GLFE 4BNWA 2WAMA 2WWWA 5BMVA 3DOIA 3C14C 3FTDA 4MVJG 5SYAA 3KKMA 2GNPA 4YBZA 5BMVB 1L7VC 3GF4A 1EE9A 3PU6A 4L7QA 5JBIA 5IXSA 4A5SA 1KYYA 3E1KA 3SQMA 1VBFA 3OIWA 4R7GA 1T2NA 2OV4A 2GOYA 1HTTA 2PZMA 4NE7A 4W63A 3GQBA 5GONA 9ABPA 1S8OA 3BGOS 1E1KA 3D7KA 3LLUA 3WQSB 5DMXA 5GONB 4EGAA 3SQWA 1ULBA 1L5HB 4EK9A 3K0HA 3SNKA 3ENQA 4IV8A 5L3VA 2HK7A 5B1EA 3PYLA 1ZMBA 3GVCA 3FMIA 1HFKA 2X2PA 3OM9A 4OFZA 5TVGA 1Y6JA 3OT4A 4JJAA 5LB4A 5A1JA 3W9YA 1S2OA 4KFCA 1ZRSA 2O05A 4HQNA 1PR5A 4YP6A 5M5BA 4F3CA 3UAWA 5HW0A 2R68A 2GEDA 1QCYA 1F2DA 2IODA 5F1YA 3Q6MA 3ENNA 4NE9A 3R7LA 1GOTA 1FNDA 2BHNA 2PTHA 3SJBA 3UOAB 5BV1A 5DX1A 2HDOA 3EVNA 2HTEA 2LDBA 3PRKE 2A9QA 5E7QA 2O19A 2A1IA 4UD6A 4JUIA 2IYSA 4XPIA 4G81A 4EUFA 1Y1SA 3F6EX 4ME6A 3PUIA 4IMIB 1QR6A 4XPIB 3O2SB 1YZLA 1ZN2A 4WXEA 1Y9JA 5BUCA 5AKYA 3TAHA 1P4AA 3NOXA 4YMWA 4FYVA 4GYWA 4LECA 4R9VA 1JHVA 1ZJYA 5F5XA 4YJ3A 3FPSA 2C3OA 2JIZA 3U9SA 2JI8A 4MQLA 4OYHA 4YJ3B 3K94A 1UP4A 4YRRA 4DQDA 3EOAI 4EQ6B 5A03A 1E1QD 3C3EA 2B7BA 3Q2OA 4HUQA 5I9SA 3SIWA 3VSBA 5FAXA 4AJEA 5JDIA 1YFJA 4HUQB 5DIZA 3H4TA 3E70C 5LU8A 4OQFA 4MROA 2I87A 3GNQA 3K0EA 1PRYA 1P2BA 4ZT3A 1F8FA 2J3KA 2RGAA 1OLUA 2P3LA 4YO8A 3QTLA 2IIPA 3RASA 3T06B 1IIBA 2A57A 1JQLB 1YDHA 4WKBA 2I9KA 1OLUB 4LSWA 2HSDA 2PXCA 3MB5A 1FDUA 1BH6A 1WXDA 2P91A 2WF5A 1V6AA 3NWJA 3H1FA 4MJ3A 1MBZA 4UVDA 5AK5A 2Y4OA 3JSXA 5I5GA 3W6PA 1X7GA 1OLXA 4K6OA 2M6KA 3ROGA 1HE2A 3W8RA 1V7ZA 4N0PA 3GGPA 5K3SA 4BQNA 2JBHA 1ZMOA 5C7LO 2HTFA 4EARA 3L92A 3LUHA 1ZJ5A 2D8AA 5G40A 5F3DA 1G6HA 3QFCA 2C61A 2X4LA 5H3CA 2R751 3QU2A 5JQWA 2EOAA 2QRZA 3CKKA 1HBJA 4QFDA 4MEAA 4KAXA 3UAOA 1GFWA 2GCIA 3LP6A 3OAAD 4F4DA 3TVDA 1E7WA 3EC1A 2F1IA 4HAIA 4IJVA 5KYYA 3FFXA 4ZGWA 1ORDA 3D1VA 2HIHA 2GN6A 4I4CA 3WFZA 5KYYB 2DSNA 2IBSA 2DQKA 3KTAA 4E3ZA 3DR3A 1RYEA 3QWFA 2VTVA 4LE2A 3N9IA 3KTAB 4L51A 1XEAA 3AEZA 2COKA 4L4RA 1VJCA 1VOTA 3FWNA 3ADPA 5CX1A 3CUUA 1U3FA 5DGDA 2D06A 4OBWA 5CX1B 2J3DA 1BWPA 2ST1A 4WBXC 3TF5A 1XNQB 1PIWA 1E1CA 4X94A 1LWOA 2DQSA 3EFOA 5FIUA 4C3OB 3JWJA 1E1CB 5K0TA 2ZZMA 4BNYA 1X8KA 3EFOB 3IT2A 4KREA 2KI5A 4ZARA 2RAPA 2TMDA 4TL7A 5MGBA 4R0NA 4ZOBA 4BPRA 4LGCA 4EG8A 2F67A 1FUUA 5HR5A 3A14A 3FPEA 5BYAA 2PMKA 2R4TA 2AW5A 3BE4A 2Y1DA 5ALYA 1FUIA 2YWHA 1QSGA 1R6TA 3TGWA 4TVOA 1E77A 4JUBA 4IO0A 1H6DA 2ZJ5A 1T2AA 2VAMA 3LCRA 5HM6A 3RRNA 2CV1A 4IVPA 4WA8A 2HU5A 3CRZA 4ALIA 3LWZA 4F2DA 1AMOA 1P7PA 1V5EA 2FF7A 4FK8A 4P86A 1WOMA 1ADFA 2QNBA 2ZAOA 4NAVA 4QNRA 2AL7A 4URWR 4DCOA 4JQZA 5LYYA 4MUIA 2ZJFA 3NBZC 2PLFA 3HEMA 4JODA 4NNJA 4EKGA 4EG6A 5KYKA 4S1OA 1GZSA 3P2YA 3ULKA 2QSYA 2HV9A 2CXUA 3HFGA 3MWDB 4L28A 1PNTA 3TPCA 3WLTA 3T6KA 4BECA 1D1SA 1ZK2A 1L5NA 2F55A 1XEFA 2WD8A 1BHQ1 1CNEA 1YS2X 4LZLA 1T36A 2D2XA 1XZQA 3ITEA 1HT0A 4IV0A 5I9BA 4AQ7A 5AVVA 4JLWA 1PR0A 2ODBA 1O95C 3DE3X 3KR0A 3PZBA 4CM9D 2RCYA 1ZVVA 3RRZA 1UJBA 3QE3A 5E3IA 1KFBB 2X23A 3QXCA 2EDCA 3G1WA 2D0DA 2ZAIA 4LC0A 1RR6A 1YI0A 4PHGA 5SZKB 3VYUB 4BV9A 2ZBPA 3HXKA 3PKZA 4BUCA 3MW8A 3TQTA 4Q02A 4H1WA 5JCXA 3N58A 5FWDA 1GZUA 3GRFA 2X7HA 2OUKA 5FEMA 5AW0A 3DP7A 4R8KA 2MSWA 1NXOA 1XD8A 1XA0A 3PFIA 4G1EB 3M6LA 4QEDA 1V8BA 4M1YA 2A0UA 1N3YA 1ZCZA 5HDBB 3WLQA 4D8VA 3FZYA 4TRNA 5I9LA 2V7BA 1U8AA 1QMPA 1JLRA 3LPCA 3SY8A 4EPRA 3BMQA 1JALA 4IPTA 3GLIE 1Z5OA 4WKOA 5H70A 5ALDA 2GPWA 5DI3A 4PCAA 1SQ0A 3B53X 1NN0A 3Q98A 3WWYA 4DCNA 1XCJA 9LDBA 4FGUA 2VC2B 3PUHA 3OCJA 4FHCA 1J97A 3GD7A 3LC7O 4NC9A 4QE3A 1NF3A 3P9ZA 3JAMA 4EF5A 4CEJA 1EHIA 2ZCVA 1E3TA 3LQQA 4CEJB 2J9YB 2VYVA 3O75A 1G7CA 4OHWA 3PQ7A 1GZHB 4JWKA 1JEJA 3MVEA 3JSAA 4KXXA 5FOVA 1UPCA 2QRJA 2FA9A 4EFDA 5CDTA 1PR4A 4TM8A 1T6NA 3OM0A 1W36B 2RIPA 2X13A 1ELOA 2X0JA 1VLJA 4ITVA 3GLGA 1GM5A 1FTWA 1RPAA 3GLGB 1T8UA 2GT1A 2OCPA 3B5EA 3CX8A 2CBZA 4LKRA 3EDQA 3TL3A 4XFJA 3PE4A 2PLAA 4L5JA 1G20E 4P84A 5DNDA 3A26A 1VCNA 1NJGA 3HB1A 1JHMA 4W5WA 5COAA 3DYIA 2EL7A 4AN4A 1Y37A 2QQFA 3TRHA 4MLCA 3FVWA 3I9MA 4LHZA 1DHRA 4XD7A 1P60A 3U7RA 4EHFA 2QR3A 4IDPA 1KYXA 2IIVA 2PLNA 2UXDB 3MTIA 4J6EA 4OAOA 3A3KA 2J32A 5EUBA 2NPOA 1AGXA 5J2TF 1YZTA 3OZSA 4WN9A 1XEWY 1L5GB 1NPDA 2C2GA 3HR4A 4K81B 2IUTA 1SC9A 2QM0A 4Q3NA 4YNBA 3VPSA 4B9EA 5LD2B 4YDRA 4YT2A 3R7AA 3KJHA 5FBVB 1ODJA 1KEKA 4O2BA 2I91A 4UUBA 1P0IA 4PZZA 3PA8A 4DPLA 1GLGA 2X0NA 1T4MA 4R1OA 3NONA 3IDSA 4M9ZA 1ONBA 4H6PA 5K0NA 1F9AA 1RQ7A 2HIMA 2JGMA 1DWOA 1FUEA 1V47A 2VK1A 3F7OA 4BO1A 4DM7A 3ONDA 1WTAA 4WKCA 3NGXA 1H3FA 2PPLA 2QLLA 3DEJA 5COBA 5H59A 5LZ5A 3AQIA 1PX0A 2FPXA 2PSDA 1JXOA 3W8NA 2P6UA 5FPHA 4ENUA 5FWYA 3K2IA 2E21A 4D45A 3AL0C 5FWYB 1NQUA 3I2KA 2Y1OA 1OAOA 2JNWA 3Q7PA 3UENA 1M67A 1QR2A 1R0WA 3GLQA 5ESXA 5IN4A 4H0FA 3EWSA 4TWRA 1DJQA 4OI4A 5HIKA 3O8QB 1N78A 4P92A 2B8WA 2OCBA 3KJEA 1KO1A 2PG3A 3L06A 4FFNA 4UTPA 1RRGA 2B2NA 2XUGA 3N70A 4UZFA 4YRTA 1HFWA 1E6KA 1P77A 2R7KA 1CLUA 4L8FA 4HNSA 4MJXA 4DIKA 1LEHA 3CEMA 1RABA 2X14A 2ZBEA 3L1UA 5EMMA 3IEXA 4DHEA 1JL3A 4W99A 3W2EA 2B9VA 2GCEA 4LPKA 2DMRA 3ANLA 1UKBA 4MIKA 3D7MA 2HA0A 1C4OA 2MSCB 1XB2A 2R6DA 3FVVA 3JYPA 3NP7A 2HN9A 3IALA 4TTIA 5IDQA 2ZIUB 4XUCA 1ZC4A 3PPWA 3S2ZA 5ALHA 5HJ7A 3ND7A 1W8IA 1GV0A 2FMFA 4YP5A 3A1VA 1VQ1A 2I2XB 4LRTB 5DO9A 2EV9A 3PXDA 3CZMA 3ZY3A 1IXSB 4GLFA 2AIRA 1NJSA 3A3YA 3F0TA 2BZ1A 4JBLA 3REQB 3ADCA 1R5OA 4JLVA 2EVWX 5KTSA 4OQNA 1PT8A 4PZUA 4OD0A 4GX2A 3UEOA 2HSZA 5DBIA 4NR0A 3FFTA 5TF0A 3O8RA 4WL0A 3ZWYA 1Z9BA 2FPGA 3PD1A 2VPYA 1B6SA 1M83A 3WJAA 1WIWA 3HWSA 5C8YA 2VS1A 1P91A 2FPGB 2FUEA 3AHIA 3GDFA 1EK5A 1L7RA 2NSHA 4G9GA 3TL6A 3UQZA 3NOVA 2P65A 1PWYE 4LJ7A 3TBKA 4JVOA 1EUZA 1FEZA 1MAVA 2Q46A 1WKBA 3E23A 3PUXA 4BFZA 2BEUA 5MN6A 1GAJA 3OZEA 1DBVO 1CCWA 2BEUB 3AQ4A 4KK4A 4QASA 1RM0A 1XEXA 3NM6B 4NYJR 4DA6A 4UNSA 3TE7A 3C24A 4U9UA 1XEXB 5CNMA 3VHQA 3EZYA 1G8PA 2WNSA 5DGHA 3VR5D 1Q11A 1BJTA 1HH4A 2FE1A 3A4IA 3E7WA 4XM1A 3WYAA 4D4IA 3NMUF 3UMSA 2NUAA 1VG0B 2VHWA 4AUNA 1FSZA 2PR2A 3PVZA 3I05A 2NUAB 3VU9A 3CXUA 4JP5A 1XVUA 1YC5A 3AKZA 4BZQA 1T10A 5A2QA 3VU9B 1SQ5A 2X22A 3TJZA 3IP1A 5L7TA 3D4NA 2I7CA 2NXEA 2JLBA 2BM1A 3EHEA 1FTYA 4QICA 5K3DA 2VDJA 4DUGD 2Y0DA 3KETA 2Q0QA 4X8OA 2Q5LA 3LKDA 4WLNA 5F9HA 1UBTS 1XKTA 2P27A 3H6KA 4U4AA 4U7FA 2R6CA 3LQFA 1K75A 4FT4A 1MKYA 4UNPA 4DKXA 4ZT6A 2P5YA 2VEOA 4HAOA 4PE5B 2PX4A 3TEJA 1WDTA 3TBFA 2FUCA 1P7VA 3EWNA 3GRPA 4IMPA 1BS1A 1TRHA 3AEUA 3M6AA 3WHPA 3IHTA 5HMMA 5JXHA 5KHLB 4IOKA 4CXMA 1U7UA 3AEUB 3C6ZA 4LV6A 1NL3A 1CUJA 4ZU6X 3DVAA 4PX9A 3TWOA 3B7WA 3QP9A 4BEVA 3DVAB 1GUZA 2PGOA 1RKXA 2XMQA 2WOJA 4JGBA 4EA8A 5CFQA 2DT5A 2ZG6A 1J42A 4NBKA 4GBED 5EZSA 3T4EA 1NNSA 4OQLA 3BPSA 3WRYA 1Z5VA 1NE7A 5EVJA 3ILHA 1LSSA 1WM1A 2QRGA 2X2EA 1I4LD 2P4UA 3IXQA 4LVCA 4WOJA 1ZKDA 1IZZA 1HSZA 1NXVA 4IUCS 4E4YA 4LOKA 3VA7A 2JK0A 1TI7A 4M7WA 2B25A 1FYWA 2MU1A 2EZ4A 1EJ6A 5AK4A 4ZXPA 1Z13A 3LS2A 2H06A 3GGSA 3NIBA 3R23A 4B9AA 1B8PA 3GEIA 2DZDA 3I53A 4Q9KA 2XB9A 3T3DA 4QXAA 5KDOA 2Q5JA 2QJFA 2QPLA 1E3QA 2FCAA 2FHSA 2BFCA 3NTVA 2G5PA 2OORA 1U28C 1AT1A 1E2IA 1GVHA 1ZCAA 1M72A 2CKDA 2BLNA 2PFGA 3QITA 4IYJA 4P7JA 3SX0A 4EYSA 2VXYA 3JQ8A 4L5AA 1DE0A 3CF6R 3CRNA 1DXHA 2PGDA 3JPYA 4ZI7B 5EEGA 2IH4A 1KR2A 1N3BA 1UF9A 3JQ8B 4KPUB 5KQPA 4X7PA 1YACA 5SY4A 4TLEA 1QGZA 3BAZA 3ESXA 3K53A 4HNGA 3MD0A 4ZYLA 4WKGA 2VSXA 4MYTA 2NU8B 4HMOA 2FSPA 4UOQA 4EFLA 3BB1A 4JYMA 5L3SA 2JFYA 5E9WA 3AILA 4MB0A 2BBWA 2HHHB 1K0FA 4JLDA 3L9WA 3LYAA 1I4TD 1Q0SA 4PY2A 2GJKA 2RD2A 2CV0A 1SD2A 1RFGE 1PJQA 3DEIA 2QRVA 2Z1MA 5FUVA 4MWDA 1K8YB 3ZW8A 2YMMA 4OXKA 4QJIA 4W5HA 1KZ6A 3BOSA 2QRVB 3H19A 4G0YA 3MJEA 4RXUA 5I4CA 5K5EA 2YYSA 1XTZA 1MB3A 4HWOA 1Z4JA 3OQ1A 4BX8A 3EPKA 2JARA 5IKOA 4OLFA 3CPJB 3JVVA 4JKYA 1KEPA 4RHXA 4C0XA 5LZ4A 4MDFA 1NP3A 2DE0X 3WKAA 2GTPA 4TVSA 3C98A 3H5VA 1K8XB 4OJMX 1GUAA 2F1OA 2GZMA 4WCVA 2VQ6A 4XDHA 3U16A 1KYTA 3BJEA 1E7YA 3NANA 2WDZA 3KQKA 3K8QA 1T1IA 1U6IA 3MA0A 1L5MA 4M88A 3U0VA 3R0XA 3K32A 4X7BA 4E1VA 1BX0A 1ZNQO 3GGJA 2DAPA 2BHLA 5EIWA 2I4LA 3GJRA 4K1XA 1AKEA 3GA0A 1H8EA 4YP9A 1NJFA 1MQSA 1WNFA 2M9MA 3BWMA 4AJLA 5LP6A 3CCCA 4UEOA 2QKYA 3F3MA 1N6HA 2B1RA 3G23A 4J16A 4CJXA 4RHTA 4I2NA 2YC2C 1U8CB 3VSAA 1XZDA 1M76A 5AI5A 1TLLA 1THMA 4ZC8A 2XMZA 4PYQA 4BY9E 2ORED 4CKYA 4D3XA 4P4NA 4ZO7A 1IHOA 3JWHA 4P22A 5F7ZA 1M0EA 3AZOA 1MNAA 3CLTD 1J49A 4X6UA 3OA0A 3R7WB 4BEBA 1FP4A 4A2QA 2BMWA 2IXGA 4GO1A 4C0SA 4D3SA 4CE6A 2WJIA 3GOHA 3IPXA 4FINA 4FOSA 1T0PA 4ZRDA 3K9QO 3SBDA 1DFGA 2DH5A 5DLDA 5FOWA 3QLEA 3QY9A 3RRYA 2GVNA 4QQ8A 3EXEA 4C22A 1WPRA 1A9ZA 5FTLA 2FRXA 4YBRA 2NSLA 1XU9A 1ZVQA 1KFCB 2Z09A 4II3A 4RGBA 2CGEA 5F35A 2AK2A 1NVBA 2C94A 2Y0BA 3X43A 2CLOB 4BEWA 1W5SA 3T7SA 5LDHA 5JNVA 1UAGA 4HXFB 3FZQA 1AX9A 2LRHA 3DMGA 4IXDA 5B6PA 4W6QA 1ECFA 5K0ZA 1CR0A 2ERCA 2JIRA 1GG2A 2VJKA 3COSA 4U1RA 3UKJA 4BYGA 3THXB 3VJRA 3H9EO 1M2VA 3HZZA 1AH2A 1C1HA 1HPLA 1R1DA 2IXAA 2GCNA 1M2VB 2RB5A 4LIPD 1O6ZA 4QNNA 5A06A 3FGOA 2IF0A 3AF6A 1L5SA 5EWJB 4N0QA 4F06A 4XWOA 4JASB 1KQGA 5CCXA 2E82A 3QNWA 4FYYA 3DW1X 3C6YA 1DJLA 4J4BA 4UBKA 1DAIA 3T9CA 3RTAA 1KYQA 3QMVA 2I7TA 5EN4A 3OP4A 1QNFA 1SU8A 1WWKA 4YPOA 4X0EA 2GVDC 3UV7A 4OG2A 4TUYA 3TLKA 3P27A 4DCVA 1X94A 2PEYA 1SQ6A 1ZUIA 1RYFA 2YJ3A 3BHMA 5AKKA 1AGRA 1QGDA 4TUYB 5HVNA 1QAMA 1EG2A 3CU5A 5IX8A 1MAHA 2R44A 5DYNA 3AESB 5T5QA 4ADSG 4Q4DA 5LYJF 1C9KA 1H0RA 2QYSA 3C4QA 2RG1A 1I1NA 3FF1A 2EP8A 2QY9A 2YXPX 5U9CA 2ZREA 4KUEA 4QG3A 2OFOA 4G5HA 1QPGA 2ZUSA 3HJAA 2F9LA 4W5QA 2ZEJA 1UK9A 5F76A 2FSSA 3SHVA 4B75A 3ZWPA 2X3UA 1V5WA 4O4HF 5CDUA 3I5AA 4JBNA 3KC2A 1H9BA 5EJ2A 1FXWA 3HJUA 1RYDA 4MRNA 2Z2IA 5EHIA 5LQCA 3K2BA 1Y3FE 2D5BA 2FFQA 3NAZA 1AQLA 5IBCA 2AG5A 2YDXA 1U8ZA 2XI4A 3FHCB 3UK2A 4DV4B 1OZFA 2IYLD 4M1KA 1KU6A 3QKIA 1ECCA 1Z7YA 2NU7B 4KJXA 3RU7A 3X2FA 1HG1A 4ZAYA 4CT4B 1RHUA 4FYHA 1Y9AA 1ZUWA 3D5TA 4G5YA 2EGHA 4GVLA 4L8GA 4KXVA 3RU3A 1J1ZA 4YMGA 5KPJA 2OZPA 5THQA 4M8LA 4S2UA 1XMJA 3E5NA 3T3IA 3WLHA 2QRQA 3LRXA 2HRDA 5J4LA 2L69A 3KJGA 3DONA 2PUFA 1NMSA 1RE1A 1ISRA 4C20A 4LCEA 2OHGA 4IQGA 1TJ5A 4NHEA 4AMYA 4BN0A 1ZW6A 5C5DA 3C3YA 3AJ8A 1GFIA 2WAOA 3VVBA 1Z4MA 2W8ZA 1L7DA 2GI4A 2RHWA 2VF5X 1A4XA 3WA6A 3NBFA 3UXHA 1G41A 2R7NA 2Y66A 1Z83A 3SBXA 2AYXA 3ORHA 4NBVA 3ZCVA 1GGKA 1SHUX 1ZJWA 2FWNA 3IE1A 1WVMA 1RXYA 1H2BA 2XWBF 3O4RA 4CTJA 1LV8A 1U9JA 3TLJA 2LVBA 3V1NA 5BUZA 4CIBA 2A3RA 3I9OA 2ZUFA 1U3GA 4GL4A 4ND3A 4EG5A 1QHIA 4XFKA 4KI0A 5CT9A 4EHHA 1RLOA 4FN4A 4LA4A 3LUDA 5I7WA 5IJZA 2ZR9A 1IEWA 2XUQA 4KH0A 4XW2A 5FPKA 1M8GA 3ASZA 2NOAA 3HBAA 3KSRA 4PNPA 1TYDE 3H2HA 3OJOA 4V0OA 1X3LA 3HL4A 2E3JA 1NXXA 3EY9A 4R9RA 3VU8A 2WSSD 2F8SA 4KSBA 1H4SA 3PD7A 3V4ZA 2ZLBA 2X6QA 1TK9A 2HLPA 3Q0IA 3PXBA 1WV0A 4I19A 4ZODA 3V9PA 4F6RA 5JAUA 1KQNA 4GE0A 5JUWA 1VGVA 4F6RB 1RI5A 4GW3A 5ALFA 3GLKA 2EF1A 4JYBA 4IO1A 2QPOA 3TH5A 1YAHA 5GY7A 4JA2A 1GYQA 1LBHA 2J3EA 2E37A 4YCLA 2H16A 4W1RA 1Q0QA 4BN5A 5H8WA 5IUKC 3JWIA 3KYDA 2VHQA 1DC7A 2G6TA 2PEZA 5TQ2B 1X80A 3JRXA 1CQPA 1YKSA 2E4AA 3T4PA 4FJ1A 5HA5A 4UHKA 4PFQA 5CD9A 2H2WA 2CHVA 3A4LA 4BMNA 5KNDD 1I94B 3M6FA 4G1BA 1UPXA 4H6WA 4DIOA 1Y82A 4DZZA 5JO0A 4X93A 1XLVA 3UMVA 5GP1A 4BMOB 4M1MA 1L7PA 3MGAA 3MLEA 1CLEA 1SG9A 2NT3A 4U7GA 4CTNA 4JBGA 4XSVA 3ROTA 1UT8A 1GQOA 1CJTC 3ZYZA 2Z56A 1VE1A 3KB1A 2VNIA 1CY4A 3CB4A 4DR5B 5TMBA 3LG2A 2O3SA 1KMNA 3IR6A 2ACVA 1QHSA 3OA2A 1BMQA 2ZXUA 2CXHA 1Y1PA 2H1WA 4XIYA 2GSWA 1LRLA 4JBIA 1PP4A 5AJVB 3UHFA 1L7XA 2I78A 4RKRA 3ZDCA 1T2UA 3B3JA 2ACWA 1Y42X 3P0FA 2CXRA 1SNYA 1M73E 1MDBA 1RYHA 2O2JA 3AEYA 4RHCA 1H2HA 2V98A 2O8VA 3A31A 2ZQYA 1GPDG 1QLWA 3Q3EA 3MBOA 4XRRA 3WSVA 4OJTA 5BWOA 1DUSA 3O9MA 3W2HA 4WBSA 5G41A 4ZVOA 3WLKX 5DBEX 4HX5A 4M4SA 3ZHCA 4DG8A 3ZCTA 1HI9A 1NPYA 2IYTA 3PHLA 3WGLA 4ZICA 2IU4A 3EGDA 2V45A 3SZRA 4XDYA 2COEA 1JKMA 3EGDB 3E4DA 4ZCLA 1ESDA 2JA2A 3HCFA 3I2FA 1ZVKA 1RM3A 1YWGO 2HEGA 4HDMA 1JIIA 2ZUDA 2P69A 3OX4A 1QFJA 4PRLA 1XDDA 1K8QA 4HDMB 1L7MA 4Q1VA 5ERXA 4GUDA 5A5VA 5IHPA 1JRLA 1FW8A 5P21A 2AN4A 4O4LA 1ZQ1A 2QR5A 3H2SA 4U9HS 1TKCA 4O4LB 4ZI2A 1NVAA 1GGVA 1ECGA 4UPEA 4M0CA 1EVEA 3H1EA 5J2UA 2QR2A 4WCDA 4CFZA 4DEXA 3GP8A 3O8DA 4MLZA 2JVIA 3OQOA 5J2UB 1Z47A 2GBIA 1OXVA 1GAEO 3ZK9A 1ESCA 3D6NB 5ARDA 10MHA 2XX3A 3AZPA 3L0YA 1OI7A 1GG5A 4MJ7A 2QXYA 4MVJH 1YBMA 1K9SA 5C8VA 2OXRA 1O8CA 3A4NA 1XZEA 1GGFA 3AV0B 4FFMA 5EL0A 4BNIA 2HR1A 3AVWA 3X1ZA 4LVUA 3BA1A 5GV7A 5J4YA 1XYYA 4NZMA 1CP3A 3WB2A 3M3PA 1BIFA 3BK2A 3UN1A 4RQTA 5DNWA 1QF6A 2WUDA 3IDFA 3CGGA 5DHRA 4YAUA 4H1VA 1VE5A 2H5EA 2H0QA 5HYVA 2QYOA 3NWBA 3ZS9A 1AKNA 1R8YA 4A0FA 2XAUA 3H1GA 1YB1A 3GFPA 4G9EA 2VA8A 2Z5VA 4NCJA 4RZXA 3TLBA 3GFTA 4A3SA 5CB6A 4KLCA 1YCHA 4I08A 1EX7A 4QLAA 5AM4A 1RJWA 2ETVA 4FU0A 4C5CA 1XHFA 1OD6A 3H9QA 1U2QA 3NAQA 2D3TA 1RMYA 4IHQA 3HABA 2VK4A 1OROA 3AY3A 2XXBA 4YJ3F 1KVQA 1E3EA 1RWVA 4Z4QA 3RB8A 4F3YA 1CDEA 4DMCA 1DAPA 2YXBA 1VSQA 3GJYA 3ZTTA 2H65A 2OYCA 1M6WA 2J9XB 3MD9A 5CDSA 4KRYA 1N33B 2NZYA 3KM0A 1XVLA 1ACMA 2VH2A 1Z5NA 4H7PA 3TR5A 1VJTA 3U37A 4EELA 1OF1A 2QM3A 3A0UA 2FVXA 4D41A 2Y68A 4B3IA 1PDVA 1WEKA 1Q84A 1G6Q1 5D01A 2ZRAA 2WM9B 3OOHA 1NBMA 1V3TA 2IYAA 1SHTX 2G1PA 1ZVJA 3K9CA 1FE8A 2IW1A 2IF2A 2KLBA 2VL7A 3AH8A 4BKMA 1E2QA 2C92A 2CNWA 3I5UA 3RPEA 4PZLA 4NOKA 3LQKA 1UM9B 3ZIAA 3Q8LA 1DWUA 3L77A 3R3VA 5A3RA 2IWRA 2PNJA 3UHOA 4XLLA 4WJLA 1F2UA 2JHCA 2NVUA 2EAUA 3S1LA 1F2UB 2X8AA 3GZ4A 2NVUB 5LXTB 2CUKA 1TUBA 1OIXA 3SF8A 3LPDA 3DOOA 3SEAA 3SF8B 1XKLA 1GNVA 2QMZA 4NONA 4ZEWA 4C0LA 3TB4A 2P9ZA 3DMFA 1DQZA 3GPIA 2NO5A 4DL9A 2IYWA 4Y7DA 4ZOCA 3RT7A 3IEPA 2AQKA 2EW1A 4TV8A 1EG7A 3HU5A 4DLWA 1ORHA 1C7JA 3PGXA 5EPEA 4DWWA 4ZU1X 3SWWA 4TV8B 3TDMA 4PS0A 5F2KA 4JU8A 4GVPA 1SXQA 4MWBA 3KQQA 1N1MA 4Q82A 1JPUA 2SBTA 3TIIA 3NNDA 4HFJA 3FRIA 2A5YB 3HUTA 1B3BA 4OSOA 4XYEA 3V4FA 4EHJA 2D0OB 3QHPA 4JBXA 2WJ6A 1ZKMA 5AP9A 4ZQEA 2WUVA 3ZDRA 2VZEA 2DH6A 1D9XA 1Z6ZA 4D02A 4DIDA 1E6WA 3K15A 4LPSA 4ID9A 2ZWPA 1B2RA 2Z2KA 4ZHSA 5CFLA 3GLFA 4R2KA 2DUMA 3BJMA 2D4HA 3IUPA 4QLOA 4Q4CA 1ATZA 1ILWA 4JU9A 4MP3A 1EUCA 1U2DC 1A27A 2IGBA 3KQOA 4C76A 3H2JA 1Z2DA 1EUCB 1GYPA 3UUGA 4XDGA 3STVA 5DMHA 2JFQA 5B1YA 1R88A 3Q8MA 3WLEA 2YXLA 3GEDA 2HBYA 1BSVA 1E9BA 4HI0E 4O2AA 1D0SA 4I4TA 4P8RA 8GPBA 2CWDA 1TQ4A 2C3YA 2VATA 1E8NA 3A36A 4CFYA 1MMFB 4Z1MD 4V0RA 1B43A 3BAFA 4G65A 1EM6A 4HP8A 2AE2A 3U5TA 1GVNB 5EIEA 1DQPA 1VM6A 3N05A 3QEBZ 3DOCA 1E89A 3W77A 5I7RA 1NUSA 2J3IA 2LV8A 2QE7A 2R4UA 3ZHBA 1NR7A 1R0CA 3TECE 5KWIA 4IR7A 1QTIA 3VC2A 1YZKA 1QCZA 2YWFA 1V8FA 3FNRA 1A9XA 3R44A 4PLZA 3AR3A 1UBRS 5C51B 2GK4A 3DC2A 2VZ9A 1A9XB 2PGJA 3S28A 1E62A 1WHTA 3VV3A 5CCEA 5AKHA 2VHTA 1DG1G 5FBRB 5JAZA 4KIJA 2HAEA 1WHTB 3BIJA 4M60A 2VHXA 3ND9A 3TLMA 1UKVY 2AF3C 2R6FA 3W5UA 2C7PA 1KO4A 3DKVA 1BYUA 3EXIB 2H1CA 1HE5A 2I6GA 2Y71A 2YIVX 3BGWA 3CWZA 5G4KA 2QTRA 5LA6B 1NE2A 4CIWA 1VCHA 5KTKA 1NU8A 5G4KB 3FW1A 1IC6A 1JU3A 1CW2B 3HXTA 4HRYA 4KP7A 4J0FA 5K05A 3AI2A 3AOEA 1CG6A 2HMUA 1YASA 1GTZA 1S3SA 3D1JA 3RHZA 1VECA 1WABA 1I3MA 3WKEA 5ECYA 3ROFA 1H69A 4H27A 3T0FA 2IHUA 4A8PA 1GU0A 1KRWA 4U6QA 1DELA 4V1CA 4B3TB 1N8NA 4WASA 1NHGA 2G9UA 2HZ7A 4V1CB 5JC1A 1KY4A 1YVUA 3USZA 4QTYA 2PWAA 1E5TA 2HA7A 1PK8A 1VG8A 1GSAA 2GK3A 2PGIA 3E53A 4Y2SA 1QC5A 1LDMA 2J09A 3M6XA 4XLTA 4D82A 4DLUA 3S44A 4CG1A 4EGJA 4Y2HA 2PUGA 1TGVA 3HYCA 2OK8A 4WZAB 5I9NA 2G04A 4MAFA 2RAVA 4KR2A 2WHXA 1M9NA 1DIOB 1QV6A 1USKA 3OPYI 2I7XA 2OAEA 1TYEB 4JOSA 1Z15A 3FGPA 4JLUA 1UPTA 2SCUB 1CJUC 1Z29A 3L7YA 4PO9A 3RAPR 1LBQA 4F5WA 4PNZA 4P4TA 1JBQA 3W5AA 4GVXA 2A3NA 5CA1F 1UOEA 1JJBA 1Y0BA 3X1WA 2JCSA 3HBMA 3QOFA 1P61B 3WBJA 1YMVA 1T8RA 2HMAA 5ADUS 3JZAA 5J9FA 1PTJC 2W6NA 2IXBA 1FSPA 4Y6OA 4K2AA 2I6UA 2B7LA 1JG1A 3OZFA 2QVCA 2EKDA 3WKBA 4GDMA 4IJWA 5EZ5A 3WYGA 1F06A 4I5EA 5KAMA 4A23A 2X7JA 1B42A 2DFTA 3FMPB 3DD1A 1SUPA 3L8CA 1Z0ZA 1RWPA 3U3XA 1EXVA 2QY6A 4C3ZA 1E5XA 4XZ3A 1EHYA 1CUUA 2BKUA 4BVHA 3DHWC 4F97A 5LKAA 3W1VA 2YN2A 4UQPA 4CM8A 2CJWA 1X8JA 3BTOA 2XDQA 2I1LA 2BRUA 4CM8B 1COZA 2CJWB 3G2OA 2XDQB 1VI2A 1T9CA 3H5RA 4HSEA 4U7DA 1VP3A 4ND5A 1OZAA 3IL2A 4O2BF 2AD5A 4CM5A 4YRKA 4RK1A 1GU1A 2Z6UA 4RENA 3NV9A 4HGOA 1I6WA 5K3AA 2I55A 3A70A 1BS2A 1CZNA 2VKTA 4G41A 3RANA 1O6BA 2D1RA 4G5XA 5ALXA 1WBJB 3DWFA 3FVTA 4PXYA 4PONA 4Y2XA 3JQ7A 1TF2A 4AN1A 3GLUA 1WG8A 4XWAA 4CQMB 3R3ZA 3E3AA 1PL0A 3JQ7B 1OFIA 5DN6A 4JIMA 4LZZA 3CZCA 4FHEA 2YICA 1E2BA 3M9LA 3IIIA 3FNFA 3G89A 5LR6A 1K97A 4OP2A 4KZPA 5AVQA 1U04A 1KYZA 2OOSA 1YUNA 2XNDD 1U5BB 5TARA 3BMXA 3KT0A 3P9KA 3Q7RA 1E2GA 2BFFA 1VXRA 3MPOA 4WPGA 3LPMA 2XF8A 5IDYA 4MKXA 1P1RA 4D96A 1HDZA 3DYVA 5A62A 1L5QA 2CXNA 2YNMA 3WL6A 3B1XA 3EXHC 1VJ1A 3DF7A 2XMRA 3GFRA 2RE8A 5ES4B 1TOAA 2X2OA 3H9BA 1U94A 2Q50A 4OXQA 1MX5A 2PCLA 3HWWA 3J81k 2AR9A 1GSHA 1DEKA 1KQOA 1SWVA 3FHLA 3EDYA 5FL3A 1Q22A 1N1EA 1XJQA 2VG8A 4MZXA 4ND1A 4CKXA 4RJ2A 2D2VA 4V03A 2A6PA 1XMQB 4H59A 4ENWA 4QBGB 1AJEA 1KDPA 5B1DA 3JQAA 3NORA 4A0SA 2AG0A 2J0QA 1I8TA 3BKXA 3ICOA 3WZMA 4DMRA 1OU0A 2R6AA 1DBQA 2FNAA 4WXRA 4ZQCB 1Q3HA 2FPPB 5A4FS 4X8LA 3IV7A 1N7GA 2ZQZA 2GJAA 3JYHA 1HQCA 3FYUC 3TTXA 2GERA 2SHKA 3CE6A 3PLRA 4FQ7A 1A8QA 3S29A 1XVAA 1KC1A 3DEFA 4DLLA 5C8YF 3OCVA 3HLKA 2JEYA 5ESDA 1QTNA 2GM3A 4ZWNA 1KHTA 4LV8B 2VNKA 1E5QA 1G9TA 3VR2D 1DUVG 2EW8A 2FDXA 1XXLA 2XWQA 5SICE 4D79A 4G0WA 3BSYA 5JDCC 2P90A 4LJAA 4FGSA 3BA6A 4D74A 5FO1A 1JQDA 5CT4A 1E4OA 4XFDA 5LMCA 1XJ5A 3R7BA 3SX2A 3QXGA 3H04A 2QZPA 4IIJF 3T15A 2VZLA 5HRCA 1JQAA 4L16A 4YO7A 3IPYA 3F73A 3VAYA 4WK4B 2VRCA 5KAPA 1W7AA 1DAEA 3CF4G 5EAIA 1RXVA 1GN8A 1RPZA 2JIDA 2V59A 4RSRA 5LNK1 2EATA 3EQ7A 2ZJZA 3ZU2A 5JRZA 1RPTA 3A6EA 5GV8A 4L27A 2ZDGA 3I32A 3VPXA 1ODFA 4PAMA 4RKYA 2JAUA 1L5ZA 4RD4A 1XZFA 4LRYA 2OLEA 5ERGB 5BP7A 3AB8A 4TTVA 1VA4A 2FSGA 1G20A 4HDSA 4BNUA 1T3GA 4A92A 2VYND 2ILVA 5JYBA 1G20B 4HDSB 2WT9A 4F0JA 3UA3A 2OKCA 4PLGA 4B7XA 1SU6A 1WCWA 1J39A 1MT0A 5JWHA 4NQRA 2EP7A 4F4CA 4DMHA 2JGRA 3AR2A 1PDOA 4GECA 4R6XA 5CXQA 3TW6A 4M36A 1IZ8A 1V7CA 2GFHA 3QFRA 3OE7D 3AI7A 4EATA 1HDXA 3LUJA 3I9LA 5G0WA 1GFSA 1V11A 1Z4LA 1ZK4A 1NYRA 3UGKA 1KAHA 3MCAA 1T5HX 3EA5A 4OREX 1MH1A 1YIAA 5AESA 3L9XA 3WNZA 2QUBA 4FN5A 3OIVA 4BZPA 1H4VB 1SIUA 4LF8B 1N3LA 2GILA 4PNHA 1KI4A 4BLSA 3KPWA 2AFVA 1EXWA 4F85A 4KODA 1TM2A 1N5MA 4TQ9A 1G42A 1GPLA 2FP4B 2VDNB 4S1PA 1X39A 3KKKA 4JP2A 1UXJA 3D0RA 4MW4A 5T8KC 5HZKA 2WSIA 3B2NA 4UZSA 3ZEAA 5AKEA 3T1VA 5KTMA 3ICQB 1TCBA 1AB5A 3A4MA 2OV3A 3PNMA 2J5XA 3DO6A 3AJ9A 4PO8A 5CFMA 2ZAYA 1DX9A 5FTNA 3RTGA 3V1KA 3ZOKA 1VLQA 2JIQA 3NETA 3TTSA 3WO1A 5B4VA 5IKEA 3LTNC 1AXEA 1P5RA 1UMCA 2E49A 3D3QA 4QATA 2XA9A 1RRMA 1K8RA 1UMCB 5AI0A 5EWLA 3QWBA 5B7PA 2C5HA 3N2IA 3E5MA 4OL0A 1ZLXA 2OG2A 2XB4A 5EWLB 2AFIA 4PBTA 4PSKA 3WLSA 1CERA 1XMVA 2FRVA 2PZGA 3ZX4A 5BT8A 4FHDA 1VGRA 1MA3A 2AFIB 2BC9A 1A8UA 2ZRPA 3OJXA 3P71T 3KLBA 2JRLA 2IW3A 4CZ2A 3AERA 4XEUA 1VIVA 3GCWA 1YBFA 4MICA 4QM6A 1V5GA 4OHBA 1V3VA 3BZWA 4Q3BA 1WL8A 4LCJA 3GZTB 2JJMA 3FOBA 2Z98A 4OHKA 4AX8A 8AT1A 2HIGA 5JI3E 3CVYA 1IULA 1VL5A 2XQIA 1SUDA 3OZAA 4KXFB 1I13A 2HV8A 1GJRA 4F56A 4J0CA 4MINA 5CBPB 4BVGA 4B3JA 4E08A 3LUKA 5NLLA 1SUFA 1D2GA 2H54A 3AB7A 3WRXC 4HQFA 1MPTA 3T99A 1SQFA 3TLEA 2FSFA 4TWBA 2UZ0A 3P45A 2BL4A 2VT2A 1S7CA 4N6GA 1W0JD 3WWEA 2NADA 5C5IA 1UWKA 3LY8A 3BZUA 3PQ3A 4G4SO 1NGSA 1Y1KE 5FV7A 2P0EA 1CD5A 2FCRA 1HYHA 2ZYDA 3IDAA 4R0VA 3ZD9A 1PDWA 1W4AA 2JFXA 2WHEA 4HJRA 4ZAXA 4KQ9A 1V9SA 5DKFA 3S4YA 2B37A 4MR7A 2C7BA 1MRZA 1GPYA 1X2EA 4ARZB 2Z57A 4HS4A 3ZKWA 3H7AA 4HLCA 4MR7B 1U0EA 1XN4A 3CN9A 2FW6A 3ZKWB 4NCBA 4B3MB 4AJHA 2ZOSA 4NQZA 5A0TA 3SGLA 3CLTC 4I8DA 3PKJA 2CYCA 1JBEA 3SIPA 1JLLA 1WSDA 3ZNQA 2WLTA 1JTVA 2BMDA 3AWIA 1KEWA 3EE6A 4FBGA 1JLLB 3Q12A 5D3MA 1DG3A 3EMKA 3ZIDA 2AMFA 1WMFA 2DJ5A 2DUJA 2NYUA 2R62A 4NHOA 5D3MB 3AW8A 1QAOA 2BKXA 2ZJBA 3FYDA 4LOIA 4LMPA 4BKUA 4Y98A 1CUFA 1CJCA 1KNQA 3B9RA 3K2EA 3Q11A 3DDZX 2VRBA 2ETXA 3LGSA 3NDJA 4C9BA 4FFLA 3GIDA 4PM4A 4PPGA 2YV4A 4FCWA 1L4BA 2Q5QA 2GXSA 4BTLA 2IX3A 3WHIA 4ARVA 3VBEA 2G88A 1V7QA 1XOIA 1ZOPA 2YN4A 3R6TA 3QSGA 2XWPA 4D4KA 1LD3A 1T4BA 2O59A 4PW0A 4GF5A 3Q6NA 4MJLA 3OT1B 2A33A 1DWPA 3BRCA 4NK4A 4ZO6A 3TOCA 1T6BY 1J06A 3WMWA 1W48A 3BH0A 3HJGA 3DLIA 3SHWA 4RD6A 2I7VA 2ATVA 1K3TA 2GVZC 3EC7A 1QWSA 4JT4A 3RG8A 3EZNA 3PUKA 3ZV4A 3UJ3X 4F9GA 4UFNA 3R6GA 1YT5A 1REQB 3VTKA 3PKIA 4F3RA 1XYVA 2H1HA 2H85A 4FEYA 5EHNA 1NULA 5ALRA 2ZI5A 3P20A 1ZIPA 3SM3A 1DHTA 1MHPA 1RAAA 1USVA 1XJCA 2WE8A 4J75A 4F7WA 1DEOA 4EI7A 2B94A 2DP4E 3QI7A 1XA4A 5EE3A 1XZIA 4EKNB 2IA5A 3H16A 2ZATA 1YNSA 1HT3A 2C84A 1PZMA 1ULZA 2C2ZA 1TGYA 2C1EA 4IP0A 4M1ZA 2ZJOA 2RONA 2YN0A 4IGFA 1M10A 4QHSA 4X1KA 3SD7A 5CFOA 4WI1A 1DBSA 4I81A 3ZHXA 3LC2O 1CF9A 4X1KB 2BKAA 2L2QA 3UKOA 4CDNA 1KI6B 2JEZA 3LX8A 3AR4A 4TZ0A 3RF7A 3AIKA 2QRLA 5CYFA 1W581 1GRCA 4ANFA 4YUXA 4Z3OA 3W2TA 3HC7A 4TUYF 1IATA 1WZCA 4JEMA 5ER9A 2V9PA 5L3QA 1NASA 1FOEB 1DV1A 1A98A 1AF4A 1EK1A 1SKYB 2CXPA 5L3QB 2QG6A 3A06A 1VMDA 2Z95A 1UFQA 1TO2E 4ARIA 3MXOA 1VCOA 4RZUA 1SA0A 5DGTA 1PL6A 1NYLA 2E4XA 1FFYA 1GKKA 1O95A 2O50A 1IRXA 1XALA 4A15A 1M2JA 4PS1A 3H4IA 3UYKA 3X1JA 1VL0A 2QZZA 2XVAA 4HH3C 4W4TA 5AI4A 4KNWA 4W5NA 2WILA 4ZRNA 3QMPA 5LWHA 4C7OA 4TTSA 4YJHA 1WUKS 4IUDS 4QOIA 4CT0A 3VBCA 1G21E 4C7OB 3RTBA 4YT4A 3ZWOA 1DKNA 2XYVA 3A0RB 4RS4A 2IK8A 4E5YA 3JARA 1YE8A 1OYYA 3FPKA 4R31A 3UTDA 5A5EA 1KTIA 2XKKA 2ZYRA 3NHAA 3OZWA 5LQJA 1M2OB 2WA2A 1BS9A 3NTLA 3EJ6A 3PNSA 5K01A 1YIOA 2PUHA 2DQYA 4RVDA 2BM0A 3M70A 1FP2A 1W47A 3IOEA 4MV1A 2WUFA 1UOOA 1OXKB 5REQB 4ASUA 2YJZA 5KO2A 1WB5A 1Z16A 3I52A 4PRZA 4D80A 3UPTA 4Q9LA 1DRKA 1E96A 1Y3BE 4WKNA 3VPFA 2F62A 2ZQ5A 1F7UA 2PVSA 1VSUA 2VLBA 3UWMA 2I6FA 2XT9A 2FWBA 2IY9A 1DKQA 4QGSA 5K8JB 4PYLA 3AF0A 1HSOA 3MNFA 4J2TA 3OIYA 2R87A 1HMYA 2WVAA 3EMDA 2FEAA 3CR7A 5JZBA 1F1JA 1S5PA 3ESDA 2C07A 3ODPA 3RS0A 3OZDA 4P3OA 5DNVA 3Q9LA 3FRJA 1JQ3A 4HFMA 4E07A 1UAYA 1NWHA 3NIGB 3OZBA 4RCVA 3OI7A 4C14A 3PB3A 2VCYA 3EG5A 2XGGA 2Z8ZA 3DF9A 3ISTA 3LZCA 1YA8A 2JD0A 1DGQA 1CPYA 3JCZA 1EDBA 3LHDA 3UHAA 3ZQJA 3OOSA 2BDEA 3R3XA 3DZIA 3R6WA 4TYMA 4U2GA 4B3DA 1AUOA 2A94A 1UWCA 2XVMA 2YR0A 3QXJA 5I3CA 3QX9A 4LY0A 3OQIA 3WKDA 2I6XA 3V55A 1XAHA 3CINA 5A4KA 3OQIB 5B6IA 4W8HA 4EEZA 4OIMA 1HE8B 1XMPA 3MOIA 4BP3A 2H5JA 1T5BA 4EG1A 3FDXA 3HM2A 4OYYA 4EGSA 4QELA 3ZZ1A 3HEAA 4TSFA 4JL8A 4UZEA 4AFNA 4GAEA 1XZPA 4Y2VA 1JIKA 5J5CA 4BJHB 4EDHA 4BVFA 1HV8A 5I4KA 2FWAA 2Q9UA 1M8FA 4RIHA 1AHIA 1NW4A 2FPLA 2WTMA 4A6EA 5EI5A 2H51A 3OG9A 2V7VA 3UCXA 3EVZA 3PDIA 1K92A 1A7AA 2V6BA 3LLMA 1ZNXA 2Q5CA 2JZOA 2R11A 1PO7A 5SYMA 3ESYA 2QLMA 3B1WA 1D2RA 1K4YA 3OHMA 4IX9A 4MRMB 1NUPA 4YRCA 5ANRB 3T7KA 1HNWB 2RHGB 3PE6A 3PNKA 3TQIA 1QZTA 4DBZA 4EYGA 3L18A 4PCUA 1I6MA 4Q1BA 5I4BA 4Q66C 5DM1A 2I4TA 3QBVA 4P32A 2Y05A 4OI0A 1EGHA 2J3JA 3BMCA 2WWIA 1NG1A 3KZKA 4UASA 5KNLA 3IHWA 3L5KA 4NNPA 3BMCB 2YJ5A 3IMKA 3LHIA 3WISA 3KR2A 4ZAVA