4L2IA

Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
NTKGLKTGNEKDLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAKDVPSKLIARGADLVYVCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGLCADCTILDAEEDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGEVINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPFVCSGGRGMKAKENFSLLYDLAHALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCINKDPDAPMFEISKYGIVGDALKILPLLTAKIKAFKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies on the Mechanism of Electron Bifurcation Catalyzed by Electron Transferring Flavoprotein (Etf) and Butyryl-CoA Dehydrogenase (Bcd) of Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein alpha subunit
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4l2iA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4l2iA02
1PVDA 1PFVA 3ZXIA 2V3WA 4JUDX 3ZGZA 2VBGA 5K6RA 2YY5A 2FWNA 2QJOA 3COYA 3GLRA 4CT0A 2EZ4A 1OWNA 5EKDA 1PI3A 4JXZA 1UPCA 5J5AA 1UPBA 2VXOA 4BUZA 5TS2A 1NP7A 5DK4A 2JAXA 4GPEA 3IUEA 4O8ZA 3IH5A 4AS1A 4R8MA 4MUHA 1T9BA 4GM4A 1OVMA 4JUAA 4MZXA 4BVFA 1YIAA 2IHUA 4MW4A 2Q29A 2AG1A 4X3PA 5DGDA 3QTTA 4HK4A 2H2FA 3GUZA 4HDAA 2EZ9A 5EJ7A 4L2IA 1V8FA 4ZCQA 3OE1A 1I6KA 1EUYA 2FSVC 3SDBA 2DR2A 2A4MA 4MUKA 3SZGA 2WQ7A 4DDHA 1R6TA 5IHXA 1KH3A 5BWOA 2QUJA 2VBFA 3CVVA 5FYQA 1KH1A 5FO0A 3Q4GA 1YTLA 3IODA 2VK8A 3TNJA 2WVGA 2CYCA 4JSRA 1G8GA 3G59A 1IVSA 4EG6A 1PYDA 2PZ8A 1X6VA 1H3NA 1JIKA 4DLPA 1EFVA 4E1AA 5BWNA 3F6EX 2PXHA 1EE1A 4Q93A 5EJ9A 4EG4A 1OD6A 4AQ7A 2GOYA 2IJGX 3EYAA 4GM1A 4RJIA 4R0NA 1QNFA 1UFVA 5LM3A 2PGNA 1Q11A 2CV1A 4YP7A 4IG9A 4F4UA 1MAWA 1YNOA 2AKEA 2VTBB 3FOCA 3FZNA 4UU8A 4ZT3A 2H2DA 4KGDA 1KH2A 2X1MA 3KT3A 4G5YA 1H3EA 3CLRC 1J8FA 2Q5QA 5EJ5A 2CV0A 4K9KA 2ZP1A 1B6TA 4UTRA 2FRDC 1N2IA 1O96A 4BV2A 2QTRA 4DDMA 1EFPB 3NV7A 2CYAA 3HGMA 1T6YA 3IDFA 5J58A 5MFPA 3DO8A 4Y6OA 1FYDA 2HMAA 2CSXA 4MVWA 1S5PA 1SZDA 1YHZA 2VK4A 4JUFA 4EG1A 3GLVA 1WXEA 1N78A 1Y42X 3L92A 3S3TA 4JUCA 2NYRA 2C5SA 4IAOA 1N2JA 4COKA 1PFYA 5LLTA 3JWPA 4Q16A 3CVYA 3KT6A 1IRXA 3IAEA 3PRHA 3FI0A 4KPUB 4MW7A 1IQ0A 2E89A 3CLUC 1U2GC 2IHTA 3IUBA 1BS2A 1Q77A 2H59A 1MBZA 2VK1A 1GTSA 1PNQA 5K0TA 1QQTA 1YC5A 4MUJA 4U7JA 4F3RA 1N3LA 2AG6A 2H4HA 2A1UA 2A1TR 3CVWA 3TS1A 1WXIA 1TYDE 2FN3A 2H2IA 5FNZA 4BN5A 5HG0A 4GP9A 1ZUNA 1O97D 2J5BA 3M5WA 4Y6LA 3HV0A 2NSYA 4JYZA 3CVXA 1PFWA 1U2DC 3CLRD 3P0IA 4G1CA 2QTMA 4ZZIA 4XFJA 4G5FA 4K0RA 2V0GA 1FFYA 2X1LA 3HZRA 3F3MA 3BL5A 3TZEA 4OUDB 4EF6A 2J4DA 3AG5A 3KT0A 5K2OA 4MW6A 2I1LA 4GM0A 2VJYA 4MWBA 3EY9A 1TFUA 4MPJA 2DETA 3H97A 3P52A 2Z3VA 1NZJA 1R6UA 2E21A 4L2IB 5JBNA 1M2KA 1ZJWA 3NBKA 5K3SA 4TWJA 3CA8A 4RJJA 3PNBA 1JECA 1LW7A 3F6BX 3FNRA 1U3DA 4YBRA 1SURA 4BN4A 3CLSC 3HMQA 3X1MA 1PNOA 1PG2A 4ZT6A 1J1UA 2EL7A 3L93A 3A05A 3U1VA 4C7BA 3CLTC 2JANA 3JR3A 3FY4A 3LE8A 2DXIA 5F23A 2XRZA 2WB2A 4EG7A 1EUQA 1OBHA 1J1ZA 3IVGA 5DASA 2YWCA 2FR8C 1GPMA 3A04A 2CUZA 3PNYA 3Q12A 4WSOA 3AG6A 2BTEA 4XFDA 1T9GR 1I6LA 4YP5A 3FLMA 1O96B 1WQ4A 4I6EA 5HUJA 4D5EA 4HD8A 1ZH0A 3KT8A 4JUBA 4H3SA 4TS1A 1J21A 3ND6A 1M2JA 1N0HA 2UZ1B 4ZCSA 5H16A 2BYTA 2VBIA 1T9DA 4J1TC 2B7LA 5EJ4A 4NDAA 3A2KA 4MAFA 2Q5JA 2Z08A 1M2HA 1KORA 1MC1A 2QUIA 4C78A 1O0CA 2QTNA 4KR9A 1U28C 3IOCA 3HWWA 1H1TA 5AHKA 1PG0A 1ZPDA 3G5AA 3ZGOA 4EG8A 4MPPA 4ZT2A 2A1TS 3MXTA 3IVCA 3QTBA 1M2GA 1X8XA 2D54A 3H99A 3N8HA 4EFKA 2OORC 1V5EA 3D6UA 3ZJUA 2BRUC 2J08A 1Q1AA 2A1UB 4PBTA 4QBTA 3ZJVA 2A88A 1YULA 1F7UA 3FH0A 1O94D 4K03A 4P2BA 4ZT4A 2RE8A 1UPAA 4JU9A 4K9LA 4X0EA 5MGNA 4CQNA 3UMVA 4MPRA 3ND7A 5D7NA 4MUGA 3FSJX 2O5RA 1D2RA 1QU3A 1TYBE 4Y6QA 1OZHA 3FDXA 2CV2A 1F4LA 2DUMA 2OV4A 5AHWA 2IELA 3VU8A 2QJFA 1OWPA 3ZG6A 1Y9DA 3SEQA 3U3DA 1NUQA 3GLSA 1Q6ZA 4NAHA 2OD7A 1WJGA 3PXUA 1GTRA 1O95C 3K32A 3MUEA 1VBMA 1NURA 4F56A 2NZ2A 1JZSA 2DEUA 4ZCRA 4IF6A 5FEMA 4MUNA 2X0KA 2J09A 4BWVA 5J59A 1QRUA 2HJHA 2PG3A 4J16C 1O5TA 3IMEA 4EGAA 2V0CA 1MB9A 3TQOA 1IFXA 4GG1A 4QREA 3N05A 1NI5A 3PKJA 4JT8A 1JZQA 2PZBA 4MVCA 5MFZA 3CLSD 4QPZA 5EJ8A 1QTQA 4G6ZA 1JGTA 1JIIA 3ISJA 1N2GA 1ILEA 4MW9A 1O95D 3QE4A 3FETA 3VRHA 1BFDA 1POXA 4RMJA 4R2MA 1COZA 2DERA 1IQRA 1OWMA 2CFOA 3TQIA 3LOQA 1QPBA 3ZGVA 3TZLA 2JI7A 1N2BA 3IOEA 2JI9A 1G8HA 5HUHA 3RJZA 4K9NA 2H29A 4OUDA 3MLAA 2H2HA 1YBHA 1WKBA 3H9BA 1XLTC 3CVUA 4J76A 1S7GA 5IMSA 1O97C 3COZA 4HJXA 1JILA 1WXFA 3COVA 1YUNA 4A91A 1CT9A 2H2AA 4DE5A 1Q19A 1U7XA 4KR7A 1I2DA 3AIIA 4YMIA 1YI1A 2G36A 4U8HA 3K9WA 1MA3A 1WZ2A 3U31A 1U3CA 3UY4A 3CR8A 1DNPA 2H2GA 2GKSA 1T9GS 2RD2A 1NUUA 1N2OA 1VBKA 4MQ5A 4KXQA 4L3OA 3ZIUA 2A86A 3FG9A 2PFSA 3IMGA 4EG5A 1WXGA 1F9AA 1QU2A 1WXHA 1YHYA 4UTNA 4MW2A 2TS1A 1YIDA 1Q14A 1R6XA 5DEIA 5MF6A 4QRDA 4ARCA 1PT9A 3RFFA 1LI5A 1QRSA 4Q9DA 3SP1A 4I6GA 2XRYA 1N2EA 1ZH6A 1V5GA 2JIBA 2PGOA 1HZZC 3IAFA 1OZGA 1O0BA 2CT8A 1EXDA 4FEEA 1RQGA 1N75A 4RUKA 3ZXSA 1F7VA 2UZ1A 4MWEA 4S1OA 4RMGA 4ZP1A 2PANA 3FIUA 2H4FA 3GMIA 2Q27A 2OD9A 3ND5A 3MMXA 5EJAA 1VBNA 1KQOA 1TQ8A 1M8PA 3D81A 4TWIA 1V5FA 3HWX1 4ZT7A 3RBAA 3DLAA 2EZUA 1QJCA 4MLPA 1VLHA 2B4YA 4RPIA 5DEOA 1U0BB 4WNYA 4ZCPA 2EZTA 4NX2A 4K9OA 1IHOA 1IH8A 4R2LA 4YP6A 2YXNA 2OD2A 3P0JA 4JXXA 4KKVA 4DJAA 1SZCA 4UTVA 4ZCTA 4PBSA 2J07A 1TEZA 1JIJA 5H7XA 1G8FA 1J09A 2HGZA 1Z8NA 2C31A 2OO5C 2QQGA 4RJKA 2O8VA 1M8FA 2E0IA 1YUMA 1KP3A 4J75A 1ICIA 2ZUFA 5K0SA 3PDHA 1N2HA 3IOBA 3HFJA 1KP2A 1O6BA 1M83A 1YC2A 1ULHA 5TEWA 1WOYA 1K97A 3UOWA 3AFHA 3IMCA 1XNHA 2Q28A 1K4KA 1OBCA 4NATA 2AG0A 3N9IA 4BVGA 3MLBA 2HZ7A 4NZPA 1TYCA 1PFUA 4JZYA 4CDNA 2JI6A 2WVAA 3E27A 3RHSA 1NUPA 5BNZA 4UU7A 1XJQA 1G59A 4MWDA 4MQ6A 4JT9A 1K4MA 4F4HA 3JXEA 4JU8A 1LI7A 4EG3A 4OJMX 3ELBA 1J20A 2QUHA 3G6KA 4MVYA 1I6MA 4KR6A 2EZ8A 3GLTA 2AZXA 4FVTA 3IVXA 4V1CB 3CLTD 4DNXA 2DJIA 1MOPA 1P7PA 1XNJA 3EA4A 4K9PA 3INNA 3D7KA 3LCJA 1N77A 2IP1A 4PBRA 5DGTA 4BVBA 2JI8A 2WVHA 1KR2A 4FZ3A 3I05A 4MUIA 3AL0C 2Q5LA 1JEEA 3OP1A 2D5BA 3ZJTA 1MAUA 2IHVA 4GRIA 1A8HA 4HJRA 2VTBA 3CLUD 4DDKA 1T9CA 3RIYA 3CF4G 3FWKA 3PNVA 4CDMA 1DJLA 1YI0A 4GU5A 2E18A 3SZ3A 2A84A 5EJ6A 3E9YA 3K35A 1K92A 5IJXA 2QUKA 4UTZA 1EFPA 1JEDA 1XNGA 4FZJA 4ND6A 1GZUA 2WSIA 2NXWA 1Q17A 4MWCA 1NSYA 4MW5A 1NM5C 1V47A 4RMIA 4QQ8A 3Q10A 4D5GA 1PTJC 1KQPA 3X1KA 1HYBA 5LFAA 1T9AA 1YI8A 3X1JA 2X3FA 1NUTA 4ND7A 1VL2A 3UC5A 3RIGA 3FHJA 1PO7A 3SYTA 1WQ3A 4HPWA 3H9CA 4RMHA 1U31A 2QQFA 1H3FA 4KPUA 2DLCX 4BVHA 1IQUA 4V1CI 1MJHA 5KCMA 3RK0A 3VGJA 2WQ6A 1N1DA 4UZFA 1GAXA 1MCZA 3D4BA 5EJMA 4MW0A 1EFVB 2YWBA 4UZEA 1KQNA 1D4OA 1POWA 4FEGA 2D13A 3HL4A 4BVEA 1MB2A 1O94C 1M8JA 2PZAA 3DPIA 2Q5OA 5BWLA 4X3OA 2OQ2A 1EJ2A 4XSVA 3SEZA 4PY2A 2CYBA 3P0HA 1KAMA 2A7XA 3N2YA 1OWOA 4UUAA 1T6XA 2Z09A 2R5WA 2JA2A 2EJCA 1Q15A 1JSCA 3UK2A 2JLAA 1QRTA 3ILVA 4NAUA 2ZUEA 3DV2A 3C8ZA 1JMVA 4MUFA 4MVXA 1NUSA 1WY5A 5TEVA 2H4JA 1M8GA 1KAQA 1M1ZA 2W93A 1J70A 4I6JA 1MRZA 4MUEA 4I5IA 3H05A 1OWLA 1S4MA 3KFLA 4ZT5A 3NBAA 4MULA 5KHAA 4UUBA 5K6TA 1NYLA 4ARIA 2X7JA 3D6VA 3ZUGA 4BV3A 1GLNA 3GLUA 1KKUA 4MW1A 3AKZA 4JD5A 2PIDA 2JLCA 1JHDA 1TYAE 5KWVA 4K9MA 3OTWA 5TGTA 3COWA 3LQ1A 2QJTA 5DB4A 3PKIA 4U63A 2GM3A 4V1CA 1T6ZA 4K9QA 4JFAA 1M2NA 4QELA 5FO1A 1E3TA 4UTXA 1M8KA 1OZFA 1GN8A 3RK1A 2DPLA 3A4IA 1U7DA
chains in the Genus database with same CATH superfamily
5FLYA 3K2QA 4NYJQ 4QXQA 1ZY2A 2QJOA 2AEEA 2ZJBA 3DS8A 4HXGA 4P7KA 2RARA 4FOSA 3ESZA 4AZTA 1LBSA 1R64A 2W22A 5JNTA 1UUFA 1GR0A 4ZVMA 1IJBA 1NATA 4P1ZA 1DBRA 4DBVO 3P0FA 3FTCA 3JYQA 2YWRA 4NV1A 3WE7A 1EFHA 4C04A 2WKRA 3HNRA 4B3IA 3BGOS 3L7BA 1PEDA 2GAIA 4CLRA 3WGJA 1NR1A 2Q29A 4O8CA 1U6JA 3RH0A 4ENUA 1KZ4A 5A5VA 4P32A 1YR3A 4MNTA 3GUZA 4HUQA 3I09A 2OHFA 4MVJE 4ZCQA 1B14A 1EUYA 4RDIA 1D1TA 4US2R 2A4MA 1WMBA 4KYVA 4GR9A 3SZGA 4ZGBA 1E0AA 1K68A 3C70A 3P9XA 2FR1A 1FTQA 1P2VA 3GF4A 1F0PA 1O9GA 4OPMA 2BGGA 4NDZA 3NVAA 3R3SA 2BTQA 5H68A 2XOXA 1RT9A 2C2KA 3V9PA 4L4UA 1LZLA 3HV2A 5I4KA 2I5PO 3GFBA 3ZY3A 3NHPA 1WO8A 2BN4A 1EE1A 1ZSNA 3BQ9A 4ENSA 4W5QA 3AX6A 4NV0A 4R0NA 2R00A 1USKA 1MFZA 5JRZA 2M98A 5DW3A 4E03A 1I7LA 1VHDA 3OOJA 1DUIA 2YHAA 3JR7A 2EC5A 4JBWA 5IDVA 3EGEA 6ABPA 4YB8A 1JALA 2OV8A 4BQOA 4RKFA 4XJSA 4CRWB 1FTSA 1AT1A 1WHSA 3UBTA 3HBLA 4E15A 1AURA 3LGSA 2B25A 2FRDC 2QEQA 4NBVA 4DDMA 1Y8RA 3M34A 1SXJD 4URHA 1O0CA 1ZSYA 5DN9A 1J2EA 1VIDA 1YHZA 2CEAA 1D1PA 4XWYA 1MAAA 2NWQA 1QE3A 2RKBA 4COKA 4IIJB 5E6SB 2YL2A 1R6BX 4TYQA 4MYRA 4DB2A 4A6PA 2XUFA 3LNTA 1HQDA 4MW7A 4B31A 3IDOA 2QN7A 3MZ0A 3JD3A 3UWMA 3ZWNA 2ZAIA 1V8OA 1O5OA 5JSQA 1ZEMA 1WVIA 3WR5A 4DV3B 4MCIA 3QP9A 3UF0A 3Q87B 2EOAA 4BN0A 3WYAA 1QQTA 1GPUA 1RZRD 4OQQA 4KN8A 3RUFA 3AHHA 4S12A 3BMXA 1JLKA 2IIPA 4NPCA 2Y1EA 3RBXA 2CN1A 2H2IA 5EMKA 3TAHA 2Y6UA 5M2QA 3OUTA 3VNUA 4WDQA 2E5FA 1ZCBA 3V42A 2KPOA 4U2DA 1T9KA 3L5KA 5K2MA 1NW9B 4G1CA 1DQNA 4HQNA 2LR0A 2P7HA 4DMGA 1AQUA 2B35A 1P39A 2WIKA 3JYPA 4EF6A 5HRAA 1AK9A 2XGJA 2Y6VA 1FSZA 3FYDA 3QWBA 2VO1A 3MJVA 1ECLA 2HADA 1IYZA 3K8ZA 4HC4A 3H97A 2ISQA 1ECBA 1NZJA 2B2XA 2P9JA 3F3KA 1KMIY 4HZGA 3CKMA 4L9RA 1FFAA 5EKXA 3O8QA 1UKCA 3JQEA 1LQTA 4P4SB 1XTUA 1M74A 2GJ4A 3ZGNA 1T8SA 2ECKA 5A7GA 4HDRB 1DOZA 2XQIA 1DG3A 1L7DA 3BGIA 1Z0IA 5DTEA 3SIXA 4ETIA 3QNUA 5CB4B 1B2LA 3TAUA 1YFLA 3FKQA 2GA8A 3U1VA 4ENRA 2VJNA 2P3LA 3H84A 1T8UA 2QE6A 3BL8A 1M34E 4G36A 4ZEOA 2MOKA 3SS7X 1QZTA 3AUJB 1HK7A 3U5TA 1H1LA 5BW6B 2DULA 1SR8A 4LRXA 2FETA 3DE1X 4IWXA 2RHWA 2YWCA 3I2FA 1GPMA 1D2HA 3QQPA 1D5WA 3WSTA 3E6AA 4WBNA 4UBIA 1P5HA 3D5QA 2OK7A 4GPAA 4TV8B 5HZKA 4HNGA 5J1SB 5BSMA 4YRZA 2O14A 5AHRA 3L0CA 1U2EA 1GNVA 1F6WA 1I13A 3RSZA 3RVQA 3UATA 1H1DA 4YRQA 1FYFA 2ES4A 1HQKA 1A9ZA 2NZUG 2OQIA 2ZBRA 3EIOA 3PEYA 1QGAA 5CBPB 2C4UA 1O87A 1KQGA 1CSEE 2MMGA 3U81A 1DDOA 1SOVA 1XKXA 3KZMA 4XW2A 4DCOA 3ADCA 4TKZA 4AT1A 4CODB 3IPYA 3TR6A 1QDLB 3WAJA 3PFFA 4B82A 1T5BA 1EX9A 5AESA 1QGOA 1TCVA 4J9UE 3K0SA 3HWWA 3IOCA 3CZAA 4MUBA 4XIJA 3ICVA 5AHKA 1TVMA 3S0JA 5B6PA 1JEQA 3E9ZA 4H77A 3O91A 2F9MA 2XDWA 5FFNA 4ZI5A 4DMUB 3RYHA 3QTBA 2IPNA 4H3HB 5JS7A 1RR6A 4FFDA 1GTZA 1TA9A 2IPOA 4ID9A 2PUDA 3D3JA 4GLLA 1N6LA 2WFAA 1G38A 1MNQA 4BRWA 3TECE 1JQEA 1O94D 1DT3A 4QPJC 2YQ4A 5JT1A 4BO4A 2OOSA 3IUQA 1H85A 1QIIA 2J41A 3CX4A 3IRUA 4I1RA 1APBA 3LS2A 3NH9A 5E3JA 5HEKA 3CNHA 3UMVA 1BRTA 4RVHA 2ORYA 2XA9A 1L5OA 1XMSA 3U3XA 3MQ2A 2ERXA 4Y0NA 5ARCA 4EHFA 5K8CA 2YZ7A 3EZLA 1KZ6A 1V9LA 1YS1X 4MGZR 2GK4A 4O59O 4IHJB 5B12A 3DUFA 1DPFA 3FOEC 1QVZA 2ZRMA 1Q6ZA 3DD1A 3R3XA 2ZDHA 3EIXA 1NVXQ 1VE1A 1O95C 4CG2A 1IHPA 5CA0F 2OK8A 5CLFA 2PQ0A 2NZ2A 3BD6A 3SLRA 4EUNA 4AC9A 2YJNA 5ILGA 1RTTA 3T5BA 3WHPA 3ILXA 4EGAA 1FJXA 2ECFA 3C6ZA 3NGXA 3E0XA 1MB9A 1XTBA 4UBOA 5DULA 1NQ5A 4M1ZA 4DIMA 4AJNA 3JASB 4WHMA 5K0FA 3FNIA 5TR9A 2QRNA 4MCHA 1L6RA 3A1CA 3DZBA 3H13A 4QGHA 5JATA 1ULSA 4Y2TA 4NCBA 2PSJA 3PUJA 4BNJA 1TLFA 2UV8A 5AKLA 1J0CA 1O3YA 3B9PA 3QVVA 3CWZA 2RK3A 3N6XA 4YMWA 1ZD2P 4RPHA 1JLHA 2HRDA 5KB3A 5HX7A 4LTNA 4FB4A 4FD3A 3O3OB 4F12A 1WG8A 3IKVA 2AKAB 3KXDA 4PGGA 2OXTA 4GXNA 5BO5A 5HSGA 3R40A 2GBCA 1A9YA 1ZIXA 3CNEA 2JI9A 3JWGA 4YH1A 1V43A 2GM4A 3GAZA 4RZUA 3RS3A 2E2WA 4WBNF 2XVYA 1X9GA 3AKYA 3IAM6 1BQEA 2YHIB 3IIKA 2EIHA 4NVRA 3EDMA 2NG1A 1G20A 1K6JA 3CVUA 2DECA 1W9MA 2Y8EA 3ADPA 2FH5B 2BE7A 2OB2A 2CFCA 3QNMA 2WPNA 3EVNA 3NXKA 4OP3A 4QXOA 5BV1A 3MTGA 4RJ2A 1W93A 3HCWA 1AQYA 2V6GA 3O26A 2GBPA 3PX3A 4JP5A 4XWTA 3WFJA 4MH0R 3O8RA 1XHLA 3RU7A 4OXIA 3BA6A 1VPLA 2B8EA 2PZFA 4Q15A 1T4GA 3S7ZA 2OM2A 2WU3A 1I2DA 1NPYA 3M6IA 4E5MA 1Q16A 4YRTA 4D4GA 3P9YA 4KVGA 5CJPA 2ZIXA 2ZRDA 1LB1B 4Y2RA 1YFZA 4EJ2A 5K4GA 1T9GS 3A1UA 2ATXA 1N2OA 5DI3A 2P6NA 3NLLA 2PWZA 1RI3A 4CM7A 2J7KA 4Q4CA 2V58A 2RGAA 2ZSHA 3D6MA 2VHWA 3LO8A 3NHBA 4IV8A 5JI3E 4MW2A 1OAOA 2I2BA 3L40A 3RYIA 4CHGA 3GAAA 5MF6A 1RM3A 5TIIA 4ZOAA 1Y9JA 3RC3A 4BQIA 1D6JA 3O9VA 5COAA 2G5CA 2WSLA 3N8DA 5ENVA 1LI4A 1Q0TA 1F9EA 2CFTA 2VT6A 1FS4A 2YWGA 4N8SA 1HZZC 5T6MA 3D64A 4KJZA 3H2JA 4PHFA 5CLLA 2LBPA 5CM2Z 2X19A 1VL1A 3SGLA 1D4AA 2WAXA 1S02A 1ADCA 1MJGA 3ONFA 1KMCA 1NP6A 3G2MA 3NBZC 5BR7A 1A4UA 3ZGLA 1P4AA 1VBNA 2IW3A 2DJ5A 4MXDA 1YRWA 3QKRA 4DAEA 4GVPA 1G6HA 3D8SA 2QRGA 2OBFA 4WN9B 2XDQA 3I28A 2ZT6A 5EIBC 4TS9A 1RABA 4LXXA 5JNVA 3BM5A 4PQEA 3WQRA 3ZE6A 4EI2A 3DV0B 3ZWXA 3QYJA 3PD7A 1HQCA 3JRWA 1E9BA 2PTHA 1I2CA 3PNQA 3QUQA 4X85A 5F1PA 4P81A 1MORA 3PICA 1GARA 1WTCA 3VU1A 1MD9A 4KAAA 3JAMA 2ZUFA 3E3LA 2ZB2A 3THSA 2DTDA 2QPLA 1XJ0A 3HU2A 4A26A 4D41A 5C81A 3GNLA 2H0QA 5JARA 3SCZA 4F46A 4CCSA 4IPTA 4TRNA 5B58T 1RRKA 2FPIB 2NXNA 1BN7A 3IMCA 3OTHA 1IZ9A 4EKIA 5TVKA 1NUHA 1JFFB 1NU6A 4FSHA 4RVFA 3L8ZA 2BT4A 1AKTA 2BM8A 4FFBA 3IOYA 3N2IA 1TLTA 4IOKA 3HVJA 1G21A 2HHLA 3TBFA 1WF3A 4GBGA 4A1OA 4JC8A 3RRJA 3RADC 1NT2A 2DWUA 3IGFA 1GA1A 4Q0MA 5BNZA 2R8XA 2ZIWB 3GUHA 3O2SB 3RJ5A 1TAGA 3R09A 4L8GA 4LJ7A 2ZR0A 3AEKA 1NVGA 4G9EA 5FULA 4DCMA 3RT1A 1NBMD 4GZMA 5ALDA 2AZXA 5F52A 4G86A 4V1CB 3IAS1 4Y2SA 2C84A 4UVIA 4DZZA 4YR7A 1XDSA 2OECA 2YCBA 4Y1GA 4FOLA 4R5MA 3ZU5A 4PO8A 5CFRA 5K8TA 5JNWA 3BWDD 1VJ5A 4OJTA 3KOZA 4QLOA 1SXJE 3PPWA 5TMDA 2O8BB 2H18A 1QB8A 3C6XA 3MK31 1QDUA 2A1IA 3ZJTA 2ERYA 3ECCA 5D1HA 3H2KA 1W94A 3Q3IA 4IO1A 2C95A 3FWKA 5JY1A 1YI0A 3LP8A 4GU5A 4MV0A 1XA0A 1CUJA 2EFEB 2ERCA 4L95C 1TMKA 1SQ6A 3MCVA 3RQIA 1J0XO 2QUKA 5JR3A 4Q4LA 3UMCA 1VDMA 1PD0A 3ORFA 4LJKA 4CF4A 3AF6A 2XE4A 3ERCA 4Z9BA 4ARBA 2GXSA 2ZI4A 2G7MC 3OM9A 5L95A 3QKSA 4EF4A 2OO5A 4C05A 4IRUB 4CF3A 4Q4DA 1ISPA 2POCA 1FDTA 4WXEA 3SR0A 3V1YA 4JDUA 3SDSA 2IODA 4H1UA 2PT9A 5LKRA 4RHYA 4HSGA 2XBMA 3LLSA 4WLOA 5CPBA 2XYQA 3RBZA 4ED9A 1I5EA 3DC7A 2YWDA 1KJNA 1W5FA 3D4BA 3DW1X 3L1VA 4M83A 5KYWB 1IN5A 1EFVB 1JRLA 1E3QA 5CIQA 1NF2A 2JCVA 4O08A 2D13A 4OIMA 3ZNOA 3OE7D 4OM8A 3U48A 2EP7A 4N3AA 1HBJA 2O0JA 5ALLA 4FMDF 4ZEXA 3X43A 4PXAA 1J2RA 1KC3A 2XB9A 4FK8A 4XVRA 4GX2A 3SBDA 3SC6A 2CYBA 2H0AA 1C7ZA 2PXCA 4QUJA 5LP6C 4NFLA 3TPCA 3V33A 3KR2A 3RAPR 1ZUNB 3R3UA 2A59A 4H1VA 4H6PA 2Y05A 5CVCA 1V9SA 3DDUA 3FCAA 3UG6A 3W1VA 5CG1A 5KIAA 1Y37A 1JZTA 5KJ6A 1UJMA 2HWWA 3AUYA 3OZFA 5EE1A 1D9ZA 3LLCA 3OIVA 1SU8A 4IVNA 4N39A 3BT7A 5BWBA 4MVXA 5IYZB 1XCMA 2GCEA 2QZ4A 1NVVR 3FLBA 3SBEA 2JCBA 3EPKA 3EYWA 3VZBA 1J70A 2JGDA 4V3CA 5GM2A 1MRZA 3W5AA 3DTYA 5BVHB 3OKAA 3NGMA 1Z5PA 4EGFA 4ZVLA 5JW6A 5K6TA 4FR0A 2QLMA 1O77A 1IK4A 2PUCA 1CZRA 4ZJZA 2JIMA 3MSXA 2OENG 1KKUA 2V59A 1DL5A 2WOJA 2YJZA 3GJQA 3FZEA 3FOZA 3G79A 5E2BA 1OXBB 3M9LA 4HR7A 4F4FA 2KE5A 1XTSA 3ESDA 1Z13A 1NXOA 2CJWB 3EULA 4DC9A 3AUFA 3RF7A 2AR0A 4RY2A 4U63A 4YT4A 5JLAA 4BTLA 2W2MA 3WRVA 3L9WA 4JFAA 5TQ0B 1U7TA 1W73A 2XAUA 1AK1A 3PS9A 2MHCA 4ESVA 1R15A 1WAMA 2B94A 4GE0A 1CRPA 4XUEA 2X1HA 3CX7A 5D2CA 5BT9A 7REQB 2B5VA 2IYTA 2Y0PA 2CNOA 1VL6A 2V3WA 3GGSA 4JQZA 2VBGA 2QF7A 4R9UC 1YB7A 1DBWA 1I3LA 3COYA 1Q5PA 3EZ7A 1EWYA 4JXZA 4DG9A 1QK4A 2FOIA 3A2NA 1LK0A 1KY4A 2GF9A 2FCRA 3DZDA 1HDCA 3MELA 3R5TA 3UAGA 1YUBA 4YMTA 2R00C 4JJZA 2IUEA 4MV3A 4IHKA 2FG6C 3RREA 3GFRA 1ZGZA 1QCDA 3WNQA 1YZLA 3U3ZA 1P4HA 2I6QA 3JWJA 5DNDA 3KR1A 4UM5A 4AN0A 2VSYA 4C4ZA 2I4OA 4V38A 1EINA 2QL7A 4EUFA 5L4SA 4KPEC 3A4MA 1HWYA 1WM1A 2RGRA 3IPLA 4LF5B 2NO4A 2PQ6A 4FGKA 2HFKA 1R0RE 2WQ7A 1Y4SA 2VAPA 1QIMA 3FYCA 1GUYA 4NZNA 3FYSA 4JJ4A 1A7AA 2Y1FA 1V1MA 4RPJA 5JYDA 1WNTA 1YTLA 4JC5A 4XRRA 5EI5A 3RE1A 3SXPA 3MIZA 4NZZA 2X8JA 3WB9A 3N2KB 2ZYAA 5FRDA 5BQPA 4R1MA 1IVSA 2HQSA 4NY1A 4X5OA 4A6EA 3ZW8A 2VSQA 3KC2A 4EJSA 4QU9A 2CL6X 3HH8A 4LN1A 1OFIA 4UHCA 4D45A 3F6EX 4NULA 1DEOA 1M0TA 3I2YX 3IPRA 1E2PA 3LA8A 5EIAA 4C5AA 3FPLA 4PZLA 1R5OA 4FYKA 3KZKA 4Q1CA 2X3YA 4DW8A 3ASUA 3SQXA 3LQQA 3H9GA 4LJ5A 4NMXB 4FMBB 1NBMA 3ZLUA 3GLFE 5FNVF 3IAUA 1DFIA 5A9SA 3ZWWA 1FX0B 4OAOA 3T41A 3ZH9B 3OLQA 2G5PA 4BV2A 3FSGA 3KQPA 4FC6A 2OCAA 4ROSA 1EFPB 4PCLA 3HGMA 5AW2A 1E6CA 4ZMSA 3TM5A 4R7GA 3IBGA 3EDRA 1E1LA 2F1HA 3A1TA 3H83A 1H23A 3M4NA 2RC6A 1NQTA 5E6RB 1Y42X 3PPXA 3HA7A 1YRYE 2C5SA 4FWIB 3DP9A 5JPCA 5AVYA 1RXIA 2O59A 5JZVA 1XUOA 3D3KA 1U8TA 4MPTA 4GMGA 4E88A 4Q16A 4RAQA 2XVXA 1AZWA 1NC1A 1OKKD 3EGIA 4F9TA 1OLXA 3VNSA 5HQ3B 3EH1A 2ZWOA 3CNOA 4DWJA 1ZC4A 4PS1A 4RIEA 4EJ0A 1TJ5A 4KX5A 3ZKWB 2VK1A 4C2TA 4M49A 4BXOB 5BQXA 4Q1EA 3QYPA 4GLFA 3UOAB 1ZG3A 2K5UA 3O94A 2DFLA 1N0WA 3H4MA 3JQGB 4JOQA 1WD5A 4UUOA 2FN3A 4R2WA 3R7AA 4E46A 3B13B 3LG2A 3K09C 5HG0A 3OZXA 1ZOLA 4GP9A 4R4JA 4RWZA 1B74A 4YNBA 3UGKA 2QRVB 3ZE0B 2A7QA 1ULZA 3K5HA 4IJMA 4M53A 4P22A 4Z1MA 4ITRC 1M0EA 1RRMA 1V11A 4LDZA 4D6YA 3PZBA 2F64A 1F3LA 1RYYA 3KFXA 2ZSBA 3BL6A 4HDNA 1FUUA 3ACCA 4G5FA 1V41E 1FXUA 2NADA 3N1UA 2V0GA 1P9LA 3QPDA 3HCPA 3KT0A 2Q2WA 2QXTA 2W0MA 3QX9A 4BEBA 1TIKA 4A16A 3RVNA 3ZCPA 3CX8A 1SVUA 2WZBA 5MN5A 2WG0A 5CFMA 1R6UA 5JBNA 2ZRQA 1GFWA 1G4AE 1H2ZA 3RFVA 4MQUA 2D2EA 3M1IA 4LZJA 3T15A 1GGMA 4M7RA 1UT5A 4LX0A 3NTQA 4L16A 1Q0QA 2JBAA 4YHBA 2DOKA 2QA5A 2P2SA 4AK9A 2C29D 2UYYA 3X1MA 3FUXA 2HBYA 2Q5FA 4Q7JB 3PA6A 2C4MA 4UU0A 5IC5A 2OYCA 2IZ6A 4ABYA 3M6WA 1P9WA 3NEPX 3VPDA 1XEWY 5JHHB 3GV0A 2AH5A 3E9DA 2PJUA 5FTLA 2CHQA 1LBEA 1MX3A 1EB9A 1QORA 1QR2A 1WDMA 2O2EA 2VF7A 3A04A 1ZL2A 2VUIB 4FMCB 3E7PA 5CXSA 1W30A 4X45A 1SIWA 1I3CA 4NJMA 4YP0A 4BLQA 4GKJB 4YRMA 4PG5A 2MINB 4HMPA 1PQ4A 3O31A 4LHYA 3U4CA 4R05A 3DZCA 3QWAA 1E5XA 4H3SA 3NXSA 4N3GA 5LBUA 4J4TA 4C07A 1XPOA 4BNKA 3EDYA 3WLIA 2V8BA 4N41A 4ZV7A 1TL7C 4ZCSA 5JPIA 1FQKA 1T9DA 2HWXA 3ZLVA 4KXFB 2XUPA 3TMKA 1VL0A 1J0EA 2WV9A 1I10A 5D6OA 3U7RA 3IV7A 3PEWA 4HAWA 2YZKA 3T34A 2IPLA 1KORA 4E32A 4CTOA 3E35A 3NOOA 3DLCA 3WX0A 5F9HA 2XJ4A 3SF8B 5J2TF 3Q88A 4U5XA 1RYZA 4U2CA 3WK5A 1SG9A 3N7AA 5KHOC 4YQFA 3H9JA 2Q45A 3MFYA 3P9CA 4CFZA 3ITEA 2QT9A 5CAEA 2F4VB 4N6NA 4FR2A 5T57A 3ZI0A 3DYIA 4F96A 1P77A 3FLAA 4Y2QA 4O2RA 4DT1A 4Z7OB 1JLLB 1K9VF 4GYWA 4RVDA 4C14A 2ZR7A 2CDRA 4B46A 3VR0A 3MD0A 4J4BA 2WOOA 4B33A 2QL9A 1C41A 1C14A 4YCLA 5CNIA 3ZWPA 2QP3A 4CQNA 1H5NA 3ZYCA 3FVWA 1I4TD 3K2IA 1V0JA 1FU7A 2ZTUA 1D2RA 2CBGA 1DIGA 2ZSIA 3IQWA 2VF2A 1F4LA 1AGNA 1RQ7A 3JVUA 2PL1A 2IELA 4YRFA 3KZNA 3EPHA 3EOZA 3T7JA 2QD2A 2GAOA 3WG9A 3F7MA 3GI1A 1WW8A 5BPHA 1DWOA 4LAFA 3QVTA 4TSRA 4ZVQA 2BAGA 4ZCRA 1KK1A 1EFRD 1FTWA 4B2YA 5BYKA 1AF4A 3UK0A 4ZVKA 2BP7B 3K9LA 3VPAA 3HQ4O 1UBSB 2C94A 1GQOA 4GG1A 1K3FA 4QREA 2R0QC 3DE3X 1YJ8A 1JAHA 5SY6A 1QIHA 2HLHA 2V6IA 3CLSD 3RWMB 5F5LA 2X14A 2JCXA 1U6IA 4ENQA 4UAGA 3CKYA 1VGRA 3HO1A 3FNEA 1XZDA 4EHHA 2D7DA 2FN9A 2HRBA 1VPVA 4RFSB 4QLAA 3RF6A 2FDCA 4U2FA 1CY4A 4FN4A 3RTCA 1VP9A 4LHVA 1AZTA 3VRHA 5BN5A 5LMCA 2QN1A 1MVNA 2A8YA 4E6PA 1NQWA 3L46A 3MLEA 2J9FB 4PYIA 5FL3A 1IEVA 1DARA 1XMPA 2W2OA 3TD6A 3T9CA 5EE9A 2XWQA 3A1DA 1Z5VA 1EWKA 2Q9CA 2ARKA 1Y1LA 3BS4A 1P8AA 4FC7A 3W2HA 3UXMA 1DSSG 1LC0A 3OZUA 2FE4A 1PQWA 3K72B 8AT1A 4FKZA 2QPOA 2LXNA 1SVMA 1XLWA 2Q3DA 2FZ5A 2D7JA 4BO8A 4JLOA 2B3TA 2RSLA 3KYIB 3NEYA 2XLCA 1SUBA 4EJSC 4WESA 3U17A 3K16A 1XCBA 1GQ2A 4Z1MD 3B5EA 1SC1A 1LVGA 4JS0A 4OBEA 2GZSA 5C0OE 4KPYA 2NVBA 2XCIA 4MKXA 5GGYA 1H4VB 3KLBA 1F06A 2CC2A 2PMDA 1BD4A 1X7WB 2JD2A 3AF2A 4E11A 1E94E 2W42A 2VJCA 1ADYA 1Z47A 5FBRB 1C8BA 5DNYB 4GNKA 2PUGA 1Z5GA 5THQA 1DMSA 4DHEA 4L3OA 1QDEA 2SKEA 3EEBA 4Q12A 4BO5A 4OHYA 1K86A 1H1LB 4RK4A 2PUEA 3EDOA 1ONNA 1Z8FA 3PI7A 4IJVA 4XYMA 4YUWA 1XJ5A 3O4VA 5B30A 1HETA 2OXIA 2QTHA 1P1CA 3QRWA 4NG5A 3WDLA 2PT5A 2ONYA 3GEEA 3T3MB 1ECCA 3EVTA 4IFIA 2V9ZA 4DLNA 2PZJA 2WTAA 1QRSA 1RPTA 3P71T 3LUPA 4GZ6A 4OK6A 5CDUA 2CXTA 3IAFA 2OCLA 2QTZA 4IQ8A 1LV7A 3RFCA 1O0BA 1IHYA 4ZP1A 1HDGO 4MI9A 2ZIEA 2CGEA 3EQ2A 3A1FA 5FOXA 3M3DA 1JEYB 1J7KA 1KSFX 3GMIA 1E5DA 1FMJA 3FXAA 3G5TA 4XFKA 3ZZNA 1UDAA 1LTKA 2YOGA 4U1RA 4DGQA 2OXRA 4M0DA 3C5WP 2VJPA 4CL3A 1M7HA 1D5CA 3IO5A 2EF1A 1BKSB 1WB9A 5TMPA 2A9OA 1GP2A 3WL6A 1E58A 1YOBA 4TMWA 3GYGA 4ZCPA 2J46A 4K9OA 3R41A 3CC8A 3TBKA 2KQUA 4D42A 1GNTA 5ARDA 2R7MA 4EITA 1DQRA 4TXJA 1FFHA 2J07A 4YUXA 3FB4A 2DCMA 1G291 4DLKA 3RUPA 2C31A 1M66A 5EIFA 4BRSA 4KXYA 4UASA 4B8ZA 3W6NA 3DMRA 1ICIA 3DLBA 1BA2A 3DPUA 1WSWA 3REQB 2JLYA 2R9VA 4GMFA 2DY1A 2FUCA 4PSAA 2XCSB 4L5JA 4ZANA 3G2KA 2X4DA 3UOWA 4DIUA 4MQMA 3TWOA 4M98A 2AG0A 3DYVA 3F7OA 1NW7A 4EZIA 2EDCA 2QAGA 1F38A 4G0NA 2DUNA 2PKCA 3G0GA 3V4VB 1XPRA 2FU5C 4NZPA 2OP1A 3WICA 2XDAA 3ZS8A 1ZA1A 3CIFA 1P2BA 2EYUA 3E27A 5CBKA 1NRIA 1SBTA 1YL5A 2QD1A 4BJ3A 2QU7A 1YRQA 1RJEA 2TECE 2VATA 4HG2A 2EGHA 3H6KA 4HLUC 2NZ8A 1HORA 4K88A 2LRHA 4QYSA 4D9CA 1ZIPA 4N65A 4C01A 3PDUA 1AQIA 3SXUA 5KSYA 5AKKA 4H3VA 4KNWA 3L1UA 2DG2A 4LY6A 1I7SB 4HAYA 1J20A 2YYAA 4EW2A 4YDHB 2QRQA 3CLTD 5GJBA 1UMCA 4KO8A 1DC7A 4LQ4A 1JNXX 2J0EA 3S1AA 1UWKA 4G24A 4LYAA 4RPCA 4Z86A 4PU0A 3BEDA 3LQ4A 1LEHA 3R6WA 4ITVA 4KSBA 3I5YA 2XVZA 2PLRA 3PR1A 1B93A 5G3YA 4DUZB 3FHCB 4OH7A 3T3IA 1C0IA 3L1KA 621PA 5JAUA 4I50B 2VOEA 4OQLA 3QITA 3HEAA 3KD2A 4GT1A 4CHTA 3T5AA 1DJLA 4V0NA 4L51A 2DU8A 3EAGA 1VYHA 5G0TA 2R5NA 3P0EA 4ZFNA 4UDXX 1G5FA 3V6MA 4ZODA 4TROA 4K40A 5IKOA 1II8B 3L7AA 3WV5A 1YQGA 3TIXB 2WHRA 4CMIB 2WICA 1UBRS 4B4WA 4HH3C 4AU1A 1KPGA 1ULBA 2J9ZB 3GJXC 1V16B 3U7QA 1CUFA 3D59A 1EBBA 2A78A 2XYHA 2O8FA 5LR6A 4HAOA 2Z56A 7ABPA 3H3XA 1PJ2A 5IEBA 4UD6A 5L3QA 4KPUA 2CF6A 4KU4A 1CDZA 1KEUA 2EBFX 1SBIA 2QJRA 4M8KA 2CVFA 1ABEA 1N2CE 1PJRA 3WNDA 2A3NA 4E7PA 5AVZA 5LJLA 2FJUA 3WJ1A 1UBJS 3WY9A 8GPBA 3GJ6A 1DAOA 1DBPA 2R8PA 3O8CA 2NPIA 1D0SA 1F51E 1JL3A 4KLAA 2FY8A 3EAQA 4QRHA 4XSVA 2F59A 4O5OA 2CUKA 1UM9B 1XQ1A 3T99A 4ZMBA 1HE3A 3QFFA 1X70A 4BX2A 3HJFA 2G3YA 4N5NA 3WLRA 2IIQA 1Z3IX 3DM5A 2PSHA 4PM4A 1RRVA 3WL4A 4RXMA 3HZHA 3SIWA 3VC7A 5DX0A 4QFCA 2CCGA 3PEEA 4EJMA 3F73A 1NSTA 1IZ8A 3I9LA 1XZMA 1JT9A 4S2UA 3OO1A 4O63O 4EQ6B 1IBKB 4U3JA 4JH0A 4FHFA 3H1GA 2BMAA 4IX9A 3IVRA 3L6CA 4K87A 4XB6B 3TQTA 3LX5A 2BZ0A 4ZAVA 2DVMA 2IW1A 1RCUA 2F1RA 1NI4B 3G1UA 3NNSA 1BXRA 4GKBA 5F76A 3CBQA 4TV9A 3H11B 1FUYB 2PX2A 4UQOA 4V2UA 4TLMB 4Y1RB 5LDGA 5KWJA 5AKIA 5IK2D 1T0PA 2A9QA 2HQBA 3R5JA 4AI6A 2QJTA 1CQPA 2HCFA 1AO3A 5EJFA 2GM3A 2RAFA 2AF4C 1F5SA 5B57C 1T6ZA 4QDUA 1M2NA 3HDJA 1G5QA 4QGGA 1E9DA 4MTLA 3HZZA 3GNSA 2QR5A 4KODA 3H1BA 3K94A 1XVAA 4BE7B 2GHIA 4AMYA 3GLGA 3L8MA 4GP7A 2ZYUX 4DNOA 5JFOA 5E3HA 2EBUA 3MRVA 3A1SA 3GEGA 3ESXA 2OFPA 1ZCAA 2QORA 5EMJA 1D6SA 1DJNA 1ORRA 1EK0A 3FWHA 4CZ2A 3EARA 2FEOA 2FPIA 5TY0A 4F71A 1ZLYA 2G7ZA 5LL6P 1SCQA 2HLDA 4O8ZA 3GFPA 2B21A 3L9XA 3RLIA 3BUSA 1CZNA 4BVKA 1P3JA 1UP4A 1V45E 1ZMRA 3CCFA 3I6IA 3TRIA 4EYKA 3GRVA 1G8YA 2I2CA 3ISTA 4X00A 4MW4A 1X9IA 3OCWA 2AG1A 4X3PA 1NKVA 4MEAA 3TGPA 4K9RA 4MTCA 4GKKB 3E3MA 2EFHB 4RHFA 4F2WA 1OJLA 1PQPA 4RZ3A 1E5TA 1SUWA 3RSGA 4B3XA 3GDGA 3AK4A 5I7EA 2IRWA 2QQ5A 4H17A 1ORVA 2DP4E 2R62A 4OGGA 1R50A 4EJFA 2J3LA 3EXAA 2C9ZA 5FYQA 3CVVA 3V4ZA 4WZAA 4RA6B 3HPQA 2YY7A 1RI1A 1YH3A 4J90A 2V6MA 4KP7A 5LBTA 4ZKEA 4Z4HA 1EVKA 2P9CA 2IZZA 3PQ7A 3T0IA 4QGSA 3S2EA 5DXFA 3F98A 2G40A 1MGPA 2PLNA 3I6QA 1EVZA 3L7LA 3ILSA 4RQAA 4RD4A 3L82B 4M8IA 2M32A 1OLOA 3UM9A 4QODA 2VDPB 3W79A 4F5EA 4WK2B 2I6TA 3U1BA 3JS5A 1NVBA 3CUKA 3R5SA 4G1BA 3KAKA 5U4XA 4C06A 5C1BA 1U0FA 8LDHA 3K0BA 4P3PA 3ER8A 2I2FA 3ADBA 1RXEA 1JU3A 4FONA 5BRJA 1S2NA 2ZBPA 1LJ8A 3DMPA 5J58A 3AJRA 3OPNA 2HHAA 3GFGA 4A8HA 3MCTA 1T26A 4M3NA 2QRJA 1MIOA 2IYLD 2R1VB 1Z5WA 1KEEB 3Q0TA 3QFHA 4ZCLA 4Z3OA 5EUBA 2G71A 5A0VA 2EATA 3BRCA 4ZGGA 3R6LA 3GRAA 3FROA 2EERA 3C8HA 4XQ9A 3PIDA 4P08A 2O1EA 5JSYA 3T7RA 3W4IA 5L4NA 1BMTA 4AF7A 1Q84A 3CUVA 2PX4A 4ZRNA 2RH4A 2EG5A 4K5QA 2ZBDA 3LY8A 3TVTA 1RAFA 3LFHA 2F67A 2HU5A 1Z2AA 2AOVA 2JARA 4K7JA 4AYTA 4XWOA 3WRXA 3UTDA 1AN9A 2FUKA 2ZGVA 3R3ZA 1FZTA 4DOMA 2B1RA 5B4TA 2H3HA 1BWRA 1WV1A 1O0SA 2WQZA 4C30A 2YXLA 3FNFA 3JCZA 3NRBA 2KI5A 3LUBA 4JX8A 5G0WA 2ANCA 5AVOA 5TVGA 4AKHA 4WASA 2AG6A 2A1UA 2NU7B 3SU8A 1AUPA 1II0A 4GOKA 3GRRA 1XVTA 1GL3A 2Q50A 1XKQA 4RK0A 5JQGF 3C5VA 1YRBA 4BN5A 4I55A 2FGJA 3TNYA 2ZIFA 1XGKA 4O4LA 3HCNA 3C3KA 1P61B 1Q7BA 3LVFO 1PGJA 4GC9A 1QAMA 4EUKA 5CEJA 3T7DA 2RIPA 2FEPA 3I32A 5D8DA 3VYWA 2QTMA 2GRUA 3JQAA 2BGWA 3ELWA 2ID4A 4RH1A 1IBRA 3LY5A 4IQGA 2TMGA 4INAA 1RC1A 3O8DA 2VJYA 3PI6A 1LCIA 3M6LA 3UCEA 3VHXB 3D4LA 5BVHA 3HB5X 4F91B 4P58A 2X0JA 3KE8A 3PWTA 1LFDB 3IPCA 2OESA 3KE9A 4QGBA 5E9AA 3VKFA 5EQTA 4HEHA 4TGLA 4YUZA 3DA8A 1KI6A 3OOWA 4B71A 3HY6A 1N8SA 1KIFA 4JKOA 2BSXA 3NBKA 3V1UA 5KNBH 4R1UA 3PA8A 2FW8A 2GFIA 4F2GA 4R1NA 3VHLB 1NVVQ 2C59A 1QH1A 2NNLD 2GCPA 2IVZA 1ZOIA 1CB7A 1I8TA 1E6KA 1PNOA 1FDUA 1SXHA 2FPLA 4R8SA 4B48A 4CM5A 5M5BA 2CVZA 4LY3A 2O2IA 3ET4A 2VPZA 1T2VA 5FJIA 3PEUA 3A4NA 1C0PA 1U9CA 2VF4X 2PL5A 3MMPA 5ERYA 4Q4AA 1CJBA 4EW6A 4DUYB 1B23P 1XR3A 3JPYA 5K6AC 2IDJA 1J07A 1YR1A 4FLFA 1SU4A 2G5GX 4J0JA 4QHTA 3UAWA 1XU7A 2BFCB 3ETLA 4RZIA 2FR8C 3ADDA 3J7TA 4IR7A 1A71A 1BRMA 4R69A 2ZWPA 3I9V6 3EEQA 3IC5A 3USCS 1EU1A 4JEIA 3BXFA 4X1IA 2OZPA 4E12A 3K53A 1G2PA 5LZ5A 3RYCA 121PA 1W34A 4D5EA 2AMFA 3TNFA 2AJDA 3HB7A 4QBIA 2VDUE 4N6GA 2HHJA 1M0WA 5ESDA 4NE7A 1WABA 2YINC 2PMBA 5A04A 1M2HA 4URZR 1PD1A 4B6EA 4JROA 1CB0A 2PNFA 4JOSA 3EXEA 4KR9A 3KPWA 5FTWA 5LB2A 2HIMA 3T0GA 2W9XA 3UG7A 4XDGA 3PFKA 1RPNA 4N54A 5K7SA 3ROXA 4P3NA 4FFMA 3UBMA 2NSHA 2D8AA 3PHBE 1SC4A 4RGVA 2HIAA 3NPMA 4FIDA 1BGVA 1NIJA 2ONJA 3GFQA 3K30A 4ZQCB 5HMMA 5G1NA 3LKDA 3I61A 2OZLB 3MYRA 4JU9A 4C3OB 3FX2A 4PZYA 2Z57A 1M76A 3VOTA 4ZQIA 4CKEA 3R0ZA 2G6TA 3VVLA 4LDNA 3OFSA 2GPYA 4RENA 5D7NA 2XUOA 1G7CA 2IK8A 3FWNA 2APJA 1D2EA 4FHGA 4YUVA 4W5RA 3K70C 4OYYA 1F17A 3OZCA 5KSWB 5F98A 3EXFB 1TECE 1Y5NA 4B1FA 2ZBVA 3CB2A 3D6JA 5BVGB 4FYMA 4ND2A 3EGDB 3NW9A 1TTHA 4FYWA 3KPYA 4AY5A 3GARA 2KLBA 4AMBA 3CN7A 1U28A 3CRMA 3PXUA 5CMLA 1SQGA 4RTLA 2YV1A 1TUIA 4KLRA 2WC1A 2DEUA 5LD2C 1OGIA 3L1HA 1HT0A 2E4XA 5IVKA 3NTRA 1FFSA 4GI3A 4ZDKA 4TTJA 4B8WA 1HNXB 1XLTA 3CE6A 1QB7A 3ORYA 3O9MA 4PG8A 2O3TA 5DT2A 5DNAA 1CD5A 1UOPA 3DB2A 3LGXA 4NF2A 1S1MA 4BXOA 4BQFA 1QRAA 3STVA 3G1TA 4MEJA 2CKMA 2VLBA 4G6ZA 4XQCA 4Q7EA 3AJDA 5ADUS 5EMMA 5BQ5A 2GSWA 4E5SA 4IGEA 2W4QA 2QZZA 3K6SA 4WDRA 2WWYA 1PCXA 3O74A 3QE4A 2IEBA 1JIQA 1GG5A 4ZU3A 4BFSA 2VYND 1XROA 2QLNA 4OBBA 1TA0A 2IHYA 3KWFA 2ZULA 4IJKA 5DPMA 1DGQA 1CJKC 4KYUA 3DWGA 2W6MA 1UK7A 4DIOA 2F8LA 3TZLA 4Z4QA 2K4MA 3PQ6A 1V11B 2QAIA 4WT7A 2X2EA 3FZYA 5G3ZA 2PWPA 5JD3A 2OQVA 2CCJA 5KI6A 4B44A 4RNDB 5HUHA 3TSZA 3KSAC 1EUDB 1S2IA 2JBHA 3G85A 2FDRA 3GAFA 3SOZA 1ZHHA 1DVRA 1WKBA 4IV0A 2R2GA 1DE0A 3X1ZA 4D9GA 1NVAA 4FILA 4PG4A 1S7GA 3G9ZA 2UU9B 3GZ4A 1Z7YA 7MDHA 4KNYA 1Z0DA 5LC1A 2CLMB 3TLYA 3NALA 4LA4A 2ZJ0A 3OUUA 1QTRA 3RKUA 2WYVA 2F3TA 1OPRA 4LNUB 4NEHB 5JALA 2TMDA 3OQPA 4DRYA 5KSPA 3L0DA 2M9MA 2EW1A 4ZTBA 2EKQA 2YC2C 1UDWA 4HB4A 4E70A 1U3CA 2K87A 2WABA 1Z08A 2VDWB 3KR9A 3H04A 5JS2A 1NZFA 1TJYA 1UK8A 1C30A 2F2TA 3FYUA 4ZVVA 3THOA 2A6PA 3CBGA 1J8MF 3KXLA 3DVLA 2PDAA 1EX1A 5LYYA 1JTFA 3L8FA 3HRKA 3RC8A 1ZQ1A 5BR4A 1KF0A 2HNKA 1DXQA 4BMOB 1IXSB 1E77A 1M6WA 1II9A 1YHYA 1L8AA 4WKBA 4MARA 1PJTA 4HB0A 4TS4A 1VQ1A 3THWA 5DEIA 1EFAA 4N01A 3STTA 4A1FA 4L5YA 4EPVA 2OGSA 3RABA 4UTOA 2B4AA 3REFA 3OMLA 4GMXA 4G4IA 4JLPA 1OUMA 4I1IA 1KS2A 1Q0UA 4CQMB 2RBKA 5DV9A 1U0GA 1JP7A 1LA2A 3W9UA 3H5LA 3PZRA 5BY2A 2WILA 2V7BA 1OAAA 1XZGA 4RMGA 3N0RA 4Y7DA 5A9TA 1NVFA 1XDZA 5AVKA 3RC7A 4F3NA 2PANA 1UDCA 2QRUA 3NZEA 3TSAA 4KWTA 3DTNA 3GEPA 4QAQA 5JSKA 1AKQA 2OG1A 3PC8C 3WYEA 2H3EA 5JV5A 1IPEA 5LA6F 1DPGA 3TMYA 1QC5B 3W5UA 4A9AA 1VFNA 1V5FA 4PQRA 1TCCA 4LOJA 1AS3A 3DZFA 4CV3A 8OHMA 2VUTA 4DV4B 1JQLB 4EI7A 3HDHA 3I62A 1E2EA 1HE4A 1YB5A 2IKQA 1IH8A 2ZJ2A 4Z0NA 4JP3A 4D8UA 5B3LA 2WE8A 4OHMA 3UFBA 1QF7A 2NSJA 3DEHA 2P62A 2W6ZA 1F0YA 3KTOA 1F2VA 3V8MA 4INPA 1JIJA 1K3UB 1U8UA 3QJGA 2PZGA 3GD5A 4C7OA 2ZI6A 4LK2A 4RJKA 3MOIA 2M6KA 2IE0A 4BIIA 2FVXA 1UFQA 4DVGA 1KP3A 2Y4NA 2Q3BA 4HWSA 2P77A 1B1CA 3O0TA 4BP8A 1M83A 4ESOA 4KGZA 5TEWA 3DE6X 3QPBA 4ZVUA 2AK2A 2ZB7A 4BJ1A 2GZ2A 4Q7LA 1DZIA 1EE9A 4LF4B 1DP4A 1SA0B 4FDTA 3C6BA 3P1JA 4RBNA 4AP5A 1AH2A 1F3OA 5D5HA 5CDGA 1YCHA 5EPEA 4P31A 3ONNA 1KE1A 4YLYA 3WL8A 4LVUA 4BBJA 1S8NA 1UMDB 3V1LA 1Z5UA 3S2YA 1OGYA 3AJ8A 5I9TA 3AVQA 1UBKS 2NYAA 2EW8A 5CR9A 5EUCA 2IXBA 3MN1A 1TW3A 3QENA 3VXKA 4NJEB 4QDZA 4BO1A 1BOFA 4XPIA 5T6BA 2FMTA 1ZM4A 2HWYA 4L07A 2CUNA 3AM3A 4KR6A 1C8VB 1QIEA 3R6GA 4H7IA 1PT7A 1YR7A 1ZNZA 2B8WA 2PYIA 2FSPA 3IVXA 3MJCA 1N5IA 3EA4A 4ALNA 4F97A 5FPKA 5IK2A 1JJAA 2JA1A 1T4DA 3CT4A 3UHFA 2UUOA 1EJ0A 2QLFA 4WXMA 4ZAWA 2NO5A 4BFCA 4B3TB 4CF6A 4DKXA 1SQFA 2WHPA 2I99A 4PW0A 1ZI9A 3DEJA 4PHTA 5EESA 5A4IS 4Q9IA 2P6RA 2Z1NA 3I9JA 2D5BA 4D44A 5C8YF 3FTFA 1VB5A 4OQDA 5L53A 1XA4A 4HUTA 1OLSA 4NHOA 1UPFA 5LQMA 4CDMA 3DEYX 4MIEA 3DEIA 2PE5A 4KQJA 1SD5A 2QRPA 1C3EA 1NI3A 3ZC3A 3N5KA 5ITSA 1DTSA 2Q6KA 3MWKA 1RBYA 1UK9A 1Y3HA 3T6KA 4I3FA 3C4VA 4HNSA 4BX3A 4MWCA 4A73A 4O4JB 3RPEA 4OJNA 2FXIA 1N9ZA 1USWA 4WESB 4MDYA 4L5BA 1KQPA 4HQLA 3FR7A 1WPQA 2B8JA 2OHHA 1JDPA 2VCEA 4ZYYA 5BUQA 1YVDA 1EG7A 1VL2A 1UDRA 3KBOA 1K75A 4QYTA 4WACA 3IKLA 3PXCX 2AUTA 4Q3DA 3RUHA 4OLBA 3EWIA 4PR0A 4IY1A 4RKQA 5CUQA 5HBGA 3KL4A 1C7JA 1X7WA 1XO1A 1FRFS 1JKIA 2FW6A 2YVUA 3M8KA 3OPQA 4J2OA 4RTNA 2V7PA 4YACA 3ZVMA 1AIPA 5JIBA 1RLTA 2EFGA 2EKZA 4KQCA 4LE0A 3ROPA 3ZCTA 2X5OA 1G5IA 1CDEA 1XZQA 3JQPA 1WMAA 3VBCA 1VKRA 3M6AA 1Z5NA 4QG7A 3U4DA 1Q0ZA 1HEUA 3GYBA 1KYIA 1A2BA 2YWHA 4OLJA 3TZQA 2BHNA 2HMYB 2AFHB 2MR6A 5CW2A 4HDCA 3UN1A 2J3EA 4PC3A 1C2YA 4CFSA 4F5WA 4IG4A 3PUKA 4HWPA 3GLGE 3N2YA 3RTGA 4BLVA 2DB3A 4REQB 1I24A 1OX4B 3CQ9A 1XEXB 3WGHA 3T1VA 1I2AA 5DHSA 2LKCA 4MS1A 4WY8A 4CLDA 3ILVA 5CVTA 4LXYA 3ZXUB 3DV2A 3NHRA 4QD3A 3CCBA 4YWHA 2H4JA 2FG5A 1DU4A 3CEHA 4YEDA 1ECJA 5EXEA 5KVQA 2WV7A 2WWWA 4W7IA 5E9JA 5ESXA 3G49A 4JSTA 5AKJA 5FADA 3O84A 1NNEA 3VAAA 1T0BA 4IHAA 4HRYA 1F6DA 4Y8VA 4RY8A 1Z8HA 1KDTA 3PIIA 4EATA 3NBAA 1BGXT 1TKCA 3CGWA 3QVGB 4DLUA 3NM5A 1J06A 1VI5A 1N6KA 3TE6A 1QFYA 3V8QA 1ARZA 3FHTA 3D7MA 1JX6A 3NVMB 3U44A 4FYIA 4ZOEA 3AI3A 2ABWA 3HKCA 2D1QA 4NU8X 3PKIA 2HBRA 1KMHA 5EJEA 1RVV1 5I7AA 3OEHA 1JPJA 4PAQA 4CCWA 1UWCA 3GUVA 1OZFA 1XF9A 2RG1A 3LUDA 4P35A 1D7OA 5F51A 5AW1A 3IUYA 4LI3X 4BLRA 1TC1A 2MSNA 1NUAA 3PXAA 1SAYA 1GV0A 4C4TA 4D98A 2FQWA 4PLFA 4FFSA 2FLKA 5IJ0A 2BGLA 3HNPA 4N3BA 3UYLA 1HNZB 3C6KA 1ODCA 4KFSA 1S9DA 1PI3A 3U7IA 5J5AA 3R7LA 3AF3A 2LV8A 2QMHA 5TS2A 2D5LA 2QTGA 4ARZB 5CFZA 3DTVB 5LU8A 4OJQA 1QQBA 5LVAA 3ICOA 721PA 1BE0A 3O9ZA 2R6CA 2DTXA 3PD1A 3DF7A 4FR5A 4MYDA 2Q3LA 4MZXA 5CVJA 2OSBA 3LOPA 3JQAD 1GQRA 4F2HA 1Z4NA 3GUYA 3IEUA 5C35A 1YIOA 4MINA 5I9SA 1RJGA 3L6RA 1MHPA 4QPPA 1EB8A 2FSVC 1INLA 1FFEA 3ENNA 3MSCA 5KKCA 2JFXA 3T1QA 2FN7A 4DLZA 2ZYHA 1ZVVA 1LDNA 4EY4A 1P19A 3TTVA 3E5MA 2LP4Y 2VBFA 5U1PA 3B2QA 2CNBA 4JDPA 2P9QA 3TNJA 1O8CA 1O6FA 1S89A 5J40A 4D9IA 1JXAA 4O5AA 1D3AA 5EQJB 4PC7A 1X6VA 1YZFA 3EBOA 3GGGA 3FKSD 4KBFA 5ALKA 1H3NA 3KWLA 3IUPA 4WBXC 2Z4TA 1NLZA 1NNI1 3NIFB 5YASA 3U7JA 3AVVA 3R7FA 2ZE6A 4AZSA 2FZWA 1OD6A 3EN0A 2UXCB 1WMDA 1VJ1A 1QNFA 4K3UA 3IIMA 5I3ZA 3DLHA 2CLLB 3C4JA 4M1YA 2H2DA 4XGNA 1KH2A 3KT3A 1E9VA 2FJPA 5K3FA 2O48X 1J56A 1P2SA 2YJ5A 4OHRA 1MNAA 4UNIA 2Q3FA 4BNMA 1LLFA 2XECA 2V45A 1N2IA 4Y0VA 1TUGA 2NVOA 3QG5A 5HCUA 3C4QA 2I6XA 5D87A 1UODA 1QE5A 4AZ3A 3DO8A 4BAUA 1FYDA 2HMAA 3NHMA 4KGVA 2DUWA 3OO0A 4L4YA 1QKIA 1XMJA 2ZRJA 1SEPA 2V55B 4KQ2A 1G1MA 5DTQA 3ZVKA 2DLDA 2WP8J 3K70B 5K0LA 1UC9A 4C0WA 1U04A 2J3QA 2ZVQX 3H9QA 3G0BA 4I8DA 4KOAA 4EBFA 4ZHQB 1JW9B 3A06A 5I7VA 1WUYA 2H1LA 2WFLA 5EZYB 1TF5A 2ODPA 2O2SA 2OT3B 2J32A 2Q3MA 3OQIA 1N8KA 4Y2XA 4B3FX 2F8SA 1IQ0A 3QJYA 4PTLA 3GA7A 1U2GC 2O8NA 3ZJ5A 5AH0A 1JEQB 3AP1A 2Z4RA 2B34A 3OY7A 3IAS6 1XD2B 4KKXB 2FRXA 5REQB 3D43A 3AZOA 1T4BA 4TVOA 3FWPA 5HVNA 1I30A 4MUJA 4FWTA 4KO2S 3C2QA 2A1TR 2I67A 2R8BA 3FSEA 3MS2A 2D0IA 3PITA 2ZSAA 2O9JA 2NU8A 3RVJA 5HFAA 5A2QA 2BGRA 4MOWA 2W70A 2E87A 5MN4A 1O97D 1XP8A 4MVJF 3BVPA 4OLAA 4B3MB 1RLIA 5IXJA 3VC1A 2YIDA 3VPHA 3MIIA 1X0XA 1C81A 5AMXA 3PDIA 2C83A 4CPDA 1GAEO 1Y8QA 2I22A 1G41A 2JKYA 2H9IA 4YX9A 4Q1DA 5EP2A 4MQ4A 2Q5HA 4NS4A 3C3JA 4FOPA 3V4FA 2H51A 5JJBA 4MPJA 1R9MA 4BUJA 4F9EA 1X2EA 1MFPA 1Z5ZA 3EAFA 1T9ZA 2ESRA 2NVWA 3M1LA 4WLNA 2Y76A 4FMPA 3EA0A 6NULA 5L9AA 2IDKA 5BMVB 3F8SA 1BXRB 3MQFA 1FB5A 3FPGA 1NXWA 4C3VA 5G4KA 3T9EA 1LWOA 2WEKA 3OZAA 4PIVA 2OHXA 3GZJA 2QJWA 3I0NA 3JARA 4M38A 5FV4A 4NU5A 1FS5A 1IDOA 1HGXA 2QGFA 3BK1A 3E15A 2IYYA 4YBRA 5ALJA 5M29A 5CA0A 5TPZD 4P34A 4KXUA 1IM5A 1PG2A 2I34A 4FEYA 1H66A 4MQFA 1PBTA 4O0LA 4KHPB 1CE8A 3PKZA 1AZLA 4I1UA 3VZPA 1UOQA 3HLTA 4CNBA 5CX1A 1QHHB 2BM9A 1DEXA 1LTHR 2AWOA 3E4CA 2BKUA 4LJAA 1ZJ6A 4XGKA 3NUZA 2DXIA 4DBLE 3O3NB 3Q0IA 5A7HA 1UF9A 2VYFA 3BK2A 4EG7A 1A8QA 1BXZA 1K5DA 1YACA 2SICE 1CVRA 2C8LA 2J5RA 3DNFA 3IA7A 1KYTA 1WSDA 4AJ4A 3MJHA 4CM9A 1FFWA 1Z07A 2QN2A 3CW2A 3DLPX 4D4LA 4MR7A 2BTEA 2VYNA 4UCQA 1E1QD 2EX0A 1YMQA 1NF8A 1WU8A 2GCOB 1MJGM 1NPTO 1TZMA 3PGLA 1CRZA 2I3ZA 2GLUA 2UZIR 2G70A 5TC4A 3TRHA 3SVTA 3R3JA 1JDJA 3BMOA 1AXEA 3GO4A 4TS1A 4J49A 4UEJA 1AKMA 1YR8A 4MVJG 2XB2A 3Q7EA 5JJ5A 3H0KA 5DHAA 1DEAA 2JAWA 4G2NA 2HRCA 3WLOA 5DHQA 1SB8A 3TBHA 3I8OA 2CVQA 3D0RA 4ZYXA 2I78A 1AXGA 2ZU0C 1E2MA 2II6A 2XUIA 1FPMA 3QF7A 1E4EB 1K5HA 3N74A 5BOSA 2DT8A 3AWIA 3TUIC 2O0HA 3TNLA 1U28C 3BPSA 4BLSA 3R8FA 1QV6A 5D5PA 1G42A 3AFGA 4EF5A 2EARA 1R6AA 4XCVA 1QFXA 4LVOA 4QECA 4J0FA 3WDMA 4URFA 5CLGA 2VNIA 3L7IA 4P5DA 1T1JA 1JDBB 3GUCA 4XJXA 3N2LA 3UMFA 1I1NA 3JZFA 2HPVA 4OJYA 3NV9A 4W5WA 4TOIA 1F6BA 2ZIZA 1PNTA 3R0XA 4I4LA 2QD5A 4BB0A 2ZBUA 2AUNA 2NPOA 3ND7A 2PV0A 4UNNA 4FMCF 3SS9X 1NRWA 3GMTA 4P9NA 2BMWA 4D0SA 3KPUA 1TYBE 3N3AC 1G5PA 1HMPA 1H2WA 1Z4OA 4PYMA 1QYXA 3MHPA 4MR8A 2D2VA 4BNGA 5I7RA 1JEJA 1K7SN 4F84A 3FTPA 2ZWVA 3LUJA 3BSSA 2GERA 4DADA 2VPQA 1FYWA 1SKUA 1TZBA 3LVQE 4RA9A 2GWRA 2LNDA 4WUTA 5CVDA 2FWAA 1SVKA 4BYGA 3IOMA 1WTAA 5J59A 1DKMA 3K15A 2IBSA 2XT0A 1M6HA 1HFKA 2ICAA 1PUIA 3I9V1 3LX4A 3LBYA 3S29A 2LVBA 1NGSA 2V7XA 4JT8A 3SJAA 2QT1A 2HDHA 3MCZA 3DV0A 4FFOA 2E4UA 4YO7A 4D3ZA 3IR6A 2YNMD 3L43A 1A4IA 3EPJA 3AFMA 2HC9A 4N0DA 4X97A 1JG6A 3F5MA 4JVMA 5I01A 1BVRA 4NFHA 3HA3A 1LPAB 1BFDA 4KIGA 3MAGA 5ALEA 2XXAA 1E5LA 1ZCFA 4R2MA 2XMBA 5L7TA 2GUWA 2CMHA 5KKAA 3ZGVA 3URKA 3KIPA 1TQHA 1G7SA 1MT3A 2N47A 5AVSA 1JKXA 2R2AA 2FEMA 3DEZA 3B5IA 3JQAB 4TVBA 5BPFA 3PV0A 5L40A 4QUHA 1ORDA 1ZM7A 2CD9A 3ILYA 2O5VA 3LPAA 4M1KA 3MLAA 1X0VA 2XZOA 1OIXA 4ZQBA 3UYKA 1QQ5A 2BUBA 2QM8A 3BGSA 3LYAA 3PK0A 4FZ5A 4RV5A 2PSDA 4C0HA 4YECA 5DGCA 3COZA 1LD3A 3DFFA 1C1YA 4TYMA 4KWHA 3V55A 4LC9A 1DC5A 3UT5A 1TQDA 5KOJB 1OA1A 1Z45A 2JFQA 5E2AA 5F4BA 2AC2A 2H92A 4QU0A 1UMBB 2QIPA 3WVNA 2FZ4A 4BO7A 1YASA 3FLEA 2ZZKA 3L04A 5JCXA 3H9EO 3OJFA 2Z6UA 3TRFA 3RYTC 1SBZA 3K9WA 5FFMA 4DJJA 2QP9X 3U2QA 1PNVA 3HUUA 1LRKA 4MPDA 3FPJA 3LBHA 1Z34A 4FT2A 3RWOA 2R87A 3KHSA 3WO0A 4CCYA 4UQLA 4LCBA 1CF4A 5FUYA 4J0DA 4JJ6A 3OZ7A 4QU5A 3FG9A 2CHUA 3CRW1 3HP7A 4BNUA 3E2MA 4BUCA 4TLEA 3ER6A 1RMTA 3PJDA 5F3WB 1NYQA 1GZ6A 2B82A 1NJ5A 3BHMA 3C3YA 4MS3B 4UDYX 3L0PA 4YJKA 2D0OB 2FKAA 3SVZA 1RPJA 3KEOA 1QGZA 2BMDA 3R44A 5TPZA 1VECA 4S05A 5FPPA 4FI3F 4G41A 2WU0A 1MTZA 3STYA 4Z4EA 4G5QA 4X1IB 1LS6A 2BEUA 1UKBA 3NC0C 2ZWMA 4DA9A 3OFJA 4NYIQ 2UXBB 1OZGA 2PIAA 2IH4A 2B2CA 5P8WA 2AOTB 3DGEC 1KOFA 1QX3A 2WHEA 5KMGB 2YXDA 3W3ZB 5HIIA 5CRIA 3QHQA 2O1WA 3UJBA 3G89A 4CM9D 3O82A 4H2DA 1BKYA 3CUUA 2PGLA 4MVJH 5D00A 3LCMA 4P7JA 3R7NA 4Z7NB 1TQ8A 3TZKA 3RFXA 2G9VA 3I2GA 3GJ8A 4LOIA 4ZT7A 4ZO7A 5KKNB 2BI8A 4DXHA 1PX0A 2ORWA 1QJCA 1SFRA 3R8CA 4O2BB 4BNXA 1PL6A 1R37A 3WLLA 5KTOA 1NXSA 2AZ4A 3K71B 3E03A 1CG6A 3T7SA 1O95A 1IHOA 2COUA 1CQJB 3E82A 1ICEA 2YXNA 3FRIA 3SE0A 3P0JA 2PHZA 4MI3A 1W19A 1X3LA 3DAPA 3EVCA 3KUDA 3A31A 5A1TA 1Z9BA 5HK8A 3MCWA 3CPSA 5LUBA 5AVQA 5ESRA 1RYHA 3PC7A 2DBQA 1HH4A 4GPTA 3ANLA 1YUMA 2XQKA 2UUBB 5AFSA 4TTTS 4WZBB 5A6SA 2HK6A 3IOBA 2L42A 1KTVA 2XF8A 4WOCA 4DLXA 3JVIA 5FLEX 3CONA 1QPZA 1K6XA 2XCOA 2ZBFA 3RVDA 4BMNA 3UXEA 2VHQA 2VSNA 1OIVA 1XQXA 3M1YA 4ZD6A 2X6QA 2GEKA 4ETWA 2GEJA 3IB6A 1SG0A 2HZ7A 2R751 1DRJA 3ABOB 2IS6A 4OXNA 3PFIA 4JX9A 4W82A 1EPUA 1H8EA 2WVAA 4NCKA 4WXRA 5DNWA 1CW2B 4XIFA 5KYUA 3FDJA 3NC4A 3HA2A 2ZUCA 4IKPA 3KB8A 2A9FA 3IRVA 5SZKB 3E9MA 4HAZA 2EIXA 2QD4A 2DR3A 3WQBA 1FFXA 1K4MA 2HU7A 4JU8A 1TEVA 3WZMA 1YS4A 1Y9ZA 1PW7A 1VZ3A 2M1ZA 4TUYA 3ZX5A 2VTVA 3KVRA 5HPYB 2P2DA 3CX6A 3QVUA 2NXJA 4CKXA 1N36B 4DNXA 1V25A 3ONDA 2JLBA 2G72A 3RVBA 3RHZA 2BMEA 2HREA 4A8JB 3GZNB 2POQX 2VPWA 1Y63A 1IM8A 4Z9XA 1R7RA 3AI2A 1JDTA 3KQMA 2W0SA 1CF9A 1KR2A 1LGYA 1SHLA 3BMQB 4GLOA 4Q3OA 1LU9A 3WJ2A 3ZDEA 1IWPB 3I05A 4U7GA 2Q5LA 2HPHA 3WB1A 3RIYA 3A9TA 3CLUD 8ATCA 1RFGE 1RBMA 5EIWA 4DJEC 5CVEA 3OU2A 3RANA 1E3WA 1EUDA 4IDEA 1SUPA 4X41A 2IOHA 1NR7A 4HDMA 4YJGA 1KARA 4TQUS 3FVVA 2E55A 4Y1EA 4WUVA 2HSZA 2ZAMA 1FQOA 2GYUA 2VRNA 2JBWA 3K8YA 2RH8A 1NSYA 3UJHA 4NICA 1RWXA 3MERA 2SCUB 3PT9A 4HWGA 5JMTA 2RHLA 4KQFA 4NV3A 4UBLA 1P2DA 2IZ0A 3EBPA 3C98A 2AZDA 2FWBA 2OE2A 1MENA 4ZAGA 3ROZA 5HKLA 2Y0BA 3RLFA 4JLKA 3W3AD 4DM7A 2P4EA 4M0UA 5F12A 8MHTA 3PWSA 4WVFA 3DE7X 5JVDA 1X13A 5BRAA 4R1QA 2DE0X 1RKQA 1OH7A 5KEIA 4LRWA 3OWHA 3DBVO 1B2RA 3D2CA 5DTRA 5HOQA 1N7IA 1SOMA 3SHOA 1OZ0A 1U7OA 1HDEA 1S0UA 1TVKA 1LPNA 2V7GA 1POWA 1TNDA 4LYDA 4QSHA 4D97A 2EXXA 2VLIA 4G5SA 2HUNA 4KAXA 5LMZA 3AF1A 3BG5A 3T5GA 3FKSA 1YONA 4AY6A 1OX6A 2O50A 4XB1A 4F72A 2BGUA 4UDOA 2QTLA 1BE6A 2BBSA 3ZNQA 3LZ6A 1ESCA 2Q4OA 2Y9MB 3F5QA 3GQBA 3LZCA 5TPWA 2Z2ZA 3UWOA 1QCZA 4AJJA 2C8JA 3PUHA 5IM4A 3VUEA 3H2ZA 3I6ZA 5JISA 1HX7A 2Y27A 3PFNA 3AR2A 1P80A 2B1QA 1S2MA 1XDDA 2Q41A 2H4XA 2GBLC 1M8GA 3L7YA 5JAQA 4L73A 1LWNA 1V2HE 4D26A 4LJ8A 3L6EA 3BTSA 3P9IA 4OFXA 4YRBA 3W2GA 2JIPA 2BFMA 4XM1A 1QHYA 3EMVA 1M7GA 1NY5A 3IALA 3PQFA 4A0GA 3DDZX 3TW8A 4F92B 1SVSA 5I7FA 2VYQA 1ISSA 4FCCA 4BFZA 1MU0A 3WIEA 2GASA 2FPGA 2YJ4A 3DBRA 1W5TA 1W96A 3FZQA 3Q98A 4POAA 3ZK8A 3U4QA 2W43A 5TGTA 1C9EA 1VGQA 4C88A 1NJGA 1NQUA 4QOHA 3PNMA 1SVWA 2VRWA 3U0VA 4QQFA 2BFAA 1ZUWA 2I2XB 4KMRA 5T67A 1R9GA 3EW9A 3H4TA 1I0IA 1J00A 3O4GA 4OHUA 1MB4A 5ALNA 1PFVA 1Y6GA 1V3UA 2AHOA 2FP4B 4XOUA 1ZR2A 4R1SA 4PC2A 4FSXA 5A5GA 2XUQA 3HCRA 2QRVA 2O2CA 2P30A 1QANA 3BXPA 4H60A 1VRWA 4JLNA 5KTNA 3CZ5A 2FLWA 4LYJA 3F67A 1I9CA 4R7ZA 3MEQA 5DNEA 4DBZA 1DJMA 2ANBA 5IZCC 1VJ0A 1OQAA 1RZUA 4QA9A 4BKOA 2ZQYA 2J3MA 4M89A 1RCTE 2FSGA 4N3CA 3V1TC 3W77A 4PS0A 1ONBA 1G55A 1WHTB 2H2FA 4KYIB 5AM5A 2O2YA 3G8BA 2GTPA 3R74A 2NNWB 2VKQA 2I2DA 3OE1A 1Q44A 1ADFA 4P98A 3TQFA 1T25A 3HDGA 4EKDA 1P0MA 3FPSA 1R6TA 5L6MB 1KH3A 3WLMA 3F6CA 4NH4A 1G1AA 1LX7A 2HHHB 2PH1A 3B1YA 3Q9NA 4HNRA 4JSRA 3R6TA 4HSEA 2OCPA 2ZRIA 4LE1A 5EWLB 4A23A 4IMIB 1QF6A 4AKIA 3O4HA 1GFIA 3GJ4A 4C87A 2ASEA 1DKNA 3KYDB 5LLTA 1Y1TA 1UJ2A 4RZSA 2AG8A 2QDKA 4MAAA 4D0NA 3ZBQA 1XMQB 1YNOA 1K5GA 4UU8A 1YDGA 3TFOA 3REOA 1WOMA 2I66A 3QE3A 2PKQO 3QBJA 3QOWA 4PZ9A 1FSFA 4OHFA 2QMQA 1ONSA 2AEMA 4NBLA 3W8RA 4DUGA 3IDFA 2ZBGA 3LDUA 1KL7A 5JANA 5D1NA 1T2UA 4Y30A 2N1MA 3CIOA 4MVWA 3AESB 1SZDA 1VHQA 3DMTA 2XOEA 3AEZA 2RHMA 3F5SA 3WYNA 5FH9A 3WA7A 3QVXA 5ER6A 2H16A 4E4RA 5KNDD 3CLKA 5GVSA 3FW1A 3NHWA 3RAGA 5KC9A 5CITA 1HRKA 1YRLA 1ND6A 3GP3A 3NHKA 1ZI8A 3OF5A 5JBQA 4RTRA 3CVYA 3F4BA 5KYYA 4D3SA 3CLUC 1CETA 4QJBA 2C77A 1O5IA 4XYGA 1IWOA 1U2QA 4E14A 3EZ2A 3VR4D 3ODPA 1YT5A 3B8EA 1YFJA 1N3IA 2OV2A 2REOA 3GVHA 1VCHA 4JWKA 3L7DA 3A6PC 3B7GA 5GP1A 4JI5B 5K0TA 3PEVA 1E1RD 3IP3A 2R7LA 1P5JA 4F6LA 2VJMA 3KKLA 1HDOA 3GRYA 5EOVA 2AFHA 3HCCA 1LS1A 3Q0EA 4X92A 4DUPA 4KCGA 2IUUA 2ZWAA 1GTG1 2ZU6A 1DRVA 1H6AA 1XVLA 3C39A 3LHKA 1KJJA 4QDXA 4REQA 2J4FA 2DX7A 2AZMA 4H3KB 4Y2VA 4JYZA 3CUWA 2JAHA 4OY3A 4JJ7A 3CLRD 1GT6A 5BYAA 2XA2A 1C1DB 2WJYA 3JYNA 1Z4QA 5AUPB 5IVHA 3TGWA 4C4OA 5ICMA 3ZU4A 1ID8A 4OUDB 4LZOA 3M1AA 2ODQA 1G9XA 1AGYA 4QT0A 3TQRA 2J9XB 4XCQA 3PJGA 1P73A 4WTOA 3I0ZA 4QXMA 2I80A 3R4CA 5AOBA 1M1YA 1NWCA 1JLSA 4JHLA 4Q4JA 4PLHA 4RM2A 5FI3A 5KBYA 2JAUA 4FCVA 2D00A 2GUGA 4LZWA 3NTLA 4RK1A 4RW0A 4BYMA 3TJRA 1C4XA 4RJJA 2YHBA 5K09A 5L51A 5PNTA 1IJKA 2B4TO 1DQYA 4TZ0A 2O3QA 1P7CA 1UL1X 5DBOA 2LCFA 2QZPA 1AV7A 5IH3A 2EL7A 2F3PA 1RE0A 4NENA 2DQYA 3VAYA 1NXTA 1PP4A 2GK7A 1GITA 1KI8A 1TK3A 2I6SA 3IIEA 3JD1A 1ITZA 2RC5A 2VA8A 2BGKA 1JR6A 1T5IA 2SNIE 3E5HA 3MMNA 3DW3X 3ZDDA 5F23A 2HO5A 2XRZA 5GONB 2YZMA 1XZPA 3NCHA 4F9FA 1XC7A 3LXRA 1RQLA 3DBOB 3QEOA 4WCVA 1RTKA 3PNYA 3RASA 4B8YA 3MT9A 4CIDA 2WNSA 4ZICA 1Q12A 2XF2A 3UGJA 4RKEA 3S1LA 4GX5A 1PT5A 2EX4A 3NMUF 5LOVB 3LOUA 2G1AA 5EUQB 3NTUA 1FUKA 3UFXB 2FEWB 3JQQA 4FBMA 2C2WA 4RLHA 2DHCA 2X4GA 4DM3A 1ZH0A 4JUBA 4URUR 3AVYA 3CZQA 3BILA 1F0NA 3FI9A 3SJZA 3IP8A 1GAXA 2R8EA 3K92A 2NO1A 2NUAB 1D6MA 4BB5A 2VBIA 3R3VA 4HUQB 4UCWA 2FQXA 3CUEF 1H0KA 3GW8A 4B83A 2Y3IA 4V3BA 5FWYA 1MR3F 4RGBA 1B6GA 1WBJB 5G1OA 4FBLA 4RY9A 3DBLA 4JBLA 2OHVA 5EXPA 4C78A 2XJ9A 4ZU6X 2BR3A 3P2YA 3WWCA 1GSHA 1H1TA 3BJEA 2H4ZA 3EQ8A 2A9RA 4KE9A 4LRQA 4NCHA 4R2IA 4TWRA 3UMRA 5C8YB 3HY4A 4LQDA 2NZWA 1VIMA 3JAWA 1J0DA 3T7TA 3CRQA 4EFKA 4LBZA 1NFRA 2Q3HA 1TPYA 3DCNA 3QFSA 5LDDC 2HW8A 3ZHRA 1TOAA 2XEXA 4D9HA 3BXOA 3B6JA 4AULA 3FH0A 2FPOA 3E3AA 3A14A 4AN1A 2WF5A 4BFYA 4S2EA 1XZNA 5IJAA 1V71A 1KU0A 4DSUA 2D2XA 3JQFA 2H6EA 1M6EX 1W581 1KI7A 2Q21A 1C5KA 1MIHA 1NOKA 4K3VA 1DJQA 3GGJA 3INGA 4DLSA 3WQQA 1QU3A 5IKXA 1GCUA 1Y8RB 2GPSA 3FDXA 3ZXYA 1AKRA 2PX8A 1E9RA 2J3KA 2EL9A 3IBTA 4UHFA 4B17A 3QSGA 5LXTA 3K5PA 4RHCA 1TO1E 5C3UA 4TVSA 1AUVA 2R8OA 4JI6B 3GXBA 5CT8A 1XTIA 1ZN9A 1PF7E 4ZHQA 2H1FA 1I3OA 1OV4A 1E69A 1F1BA 1MJ5A 3MUEA 1JKFA 1XMIA 4IJ5A 3G17A 3ITNA 4QQRA 1ZU5A 4XTRA 4GZLA 3B3GA 3OJ0A 1IIBA 4RX1A 1YS6A 5HKKD 1AQNA 4DMKA 4J16C 4XR9A 4UFOA 2MSWA 4ZI7F 1SUDA 5DDIP 2QNIA 4ND5A 1J2TA 2FV8A 3H1AA 2VJDA 1QVRA 2QMUA 1J9ZA 4PFQA 1TCBA