4L2IA

Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
NTKGLKTGNEKDLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAKDVPSKLIARGADLVYVCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGLCADCTILDAEEDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGEVINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPFVCSGGRGMKAKENFSLLYDLAHALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCINKDPDAPMFEISKYGIVGDALKILPLLTAKIKAFKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein alpha subunit
publication title Studies on the Mechanism of Electron Bifurcation Catalyzed by Electron Transferring Flavoprotein (Etf) and Butyryl-CoA Dehydrogenase (Bcd) of Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Electron transport
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4l2iA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4l2iA02
2PZBA 4R0NA 1HZZC 4WNYA 1ULHA 2OV4A 3HFJA 4JFAA 5TEWA 4E1AA 1I6MA 1M2HA 2Q5LA 3AG6A 3DV2A 5KWVA 3IAEA 1EXDA 2HZ7A 3HMQA 4ZCQA 1H3EA 2VK1A 4DDHA 3G5AA 4MWBA 5KHAA 2A4MA 3G6KA 1NM5C 1U0BB 1NUSA 3CLRD 3JR3A 4MPJA 1M2GA 1GPMA 1PFWA 3GLRA 1ILEA 2CYCA 3CLUC 2VBGA 3D7KA 5J5AA 4HDAA 2UZ1A 4V1CA 3OE1A 2H2IA 2DPLA 4K03A 3RBAA 1NUUA 3SYTA 2PANA 3U31A 2A84A 5TGTA 5DEIA 1PYDA 4DNXA 3TZEA 2QJOA 2HMAA 3ZXIA 2QUHA 2FRDC 2DXIA 2JLAA 4MAFA 3IMGA 1ZJWA 4JU8A 5H16A 3SEQA 2Q27A 1PT9A 4QPZA 3K35A 5K0SA 4GRIA 4IF6A 4P2BA 1NUTA 1F7VA 3ZXSA 1Y42X 5FYQA 3E27A 4ND7A 1NUQA 4RPIA 3TQIA 4RMIA 2HGZA 2O8VA 4MUFA 4BVEA 3PNYA 1WOYA 4OJMX 2JI8A 4MPRA 4NATA 4WSOA 1TYAE 4QBTA 3RFFA 4I6GA 1MA3A 2RD2A 3U1VA 4X3OA 4TS1A 4R2LA 2A88A 1IRXA 3UY4A 4D5GA 1PO7A 1JIIA 3Q4GA 1TEZA 4ZT5A 2AG6A 4HK4A 1SZCA 1GLNA 4A91A 2VBIA 3F6BX 1WXFA 5MFPA 2Z3VA 4EG7A 3IOEA 3RJZA 2WB2A 4O8ZA 4AS1A 1PTJC 3QE4A 3BL5A 1J1ZA 4QQ8A 2A1TS 1YNOA 4MUJA 3UOWA 4G5YA 4MW2A 3PKIA 1KQPA 3HWX1 3PNBA 2X0KA 3ZJTA 3QTTA 1O97D 4BN4A 4MW7A 3VRHA 3ILVA 3KT8A 2JAXA 1QPBA 3A4IA 5DGDA 3CLSC 2Z09A 5H7XA 1DJLA 2E21A 2O5RA 1DNPA 4Y6OA 4ZT6A 2E18A 3IMEA 5BWOA 1KQOA 3RIYA 5LM3A 4FZJA 4EG8A 1KP2A 3NBKA 4CQNA 3ZJUA 4EFKA 4MUIA 1IQUA 2H2GA 3CVXA 3MUEA 2AKEA 2C31A 2UZ1B 1GN8A 1ICIA 4YBRA 3FG9A 4NX2A 1WJGA 2OO5C 1M2KA 1G8FA 4BV3A 1JIJA 1BS2A 3SEZA 1EFVB 2IHUA 4HJRA 2J07A 3ZIUA 4V1CI 1G8GA 1J21A 1U7DA 4KPUA 4F4UA 2H4HA 1MJHA 1KH3A 2Z08A 1N3LA 2JANA 3COVA 1NURA 2IJGX 3CLTD 3TNJA 1GTRA 3D6UA 1U7XA 4MUEA 3SDBA 1P7PA 4MVXA 4YP5A 4NAHA 4ZP1A 2ZUFA 2I1LA 1GTSA 3ZG6A 4KR9A 1PVDA 1POWA 1COZA 2VXOA 1IVSA 2WQ6A 2BYTA 3U3DA 3EY9A 3KT0A 4MULA 4C7BA 5LFAA 3LCJA 1QRTA 4J16C 3RHSA 4L2IB 3UC5A 1J09A 4K9LA 1VBMA 1X6VA 4UUBA 1IH8A 5K0TA 1U2GC 1YHYA 1NP7A 3ND6A 3COWA 3ZJVA 3IOBA 2QTRA 3CVYA 4ND6A 2DEUA 3FZNA 1JEDA 3FHJA 4DJAA 1UPBA 1QJCA 1KQNA 4GM0A 3IODA 1Q17A 3PKJA 4G6ZA 4UUAA 2PG3A 1O95C 2QTMA 5HUHA 2OORC 2EZUA 3FSJX 4J1TC 5EJAA 3P0HA 4MUNA 4JT9A 1A8HA 1H3FA 5HG0A 2H2AA 2OD7A 1Q19A 3IMCA 1M8FA 3JXEA 3H05A 3IUEA 3PNVA 4EG6A 1RQGA 5TEVA 2CUZA 2DR2A 1JIKA 2IHTA 4JZYA 4BVGA 3TS1A 2NZ2A 2B4YA 1O6BA 1J1UA 2H2DA 4MUKA 4S1OA 5EKDA 3ELBA 3NBAA 2QUIA 3FOCA 4MQ5A 3GLTA 1N0HA 4GG1A 5BWNA 1JHDA 4MW5A 1PG2A 2FN3A 1OZGA 1WY5A 4OUDA 4UZEA 1K4MA 1O96B 3ZGOA 4ZCPA 1T6ZA 1JSCA 2PFSA 1UPAA 4NDAA 2D54A 4J75A 1N2EA 1N75A 3KT6A 1IQ0A 2JI9A 4KPUB 2QQFA 1YULA 2A86A 2JLCA 1I6KA 1N2OA 3P0IA 1YHZA 1TYBE 4MPPA 4XSVA 2J08A 4ARIA 4RJKA 4ZT4A 4D5EA 4GM1A 1WQ4A 4JD5A 4EG4A 2CYAA 3DPIA 2A1UA 2QJTA 4HPWA 2PGNA 4G1CA 5LLTA 1SURA 3COYA 4YMIA 1YIAA 1U28C 2EZ8A 1OBHA 2PXHA 1R6XA 2YWBA 3JWPA 2VJYA 2GKSA 4X0EA 3D4BA 3E9YA 4JT8A 5DASA 4FVTA 1NUPA 1OVMA 1ZPDA 4K9QA 1OWMA 4UTRA 5J58A 2DJIA 1IHOA 3A2KA 1V8FA 4RJJA 4U63A 3H97A 1IQRA 4PY2A 4F3RA 2DETA 1Z8NA 3S3TA 1M83A 2VTBB 4JUCA 1N77A 3MMXA 1MBZA 1X8XA 2VK4A 4BWVA 4J76A 1N2BA 4JXZA 3EA4A 5AHKA 1G8HA 3RK1A 2Q29A 1MAWA 1I6LA 1OWOA 3A04A 4UZFA 4JXXA 4R8MA 3VU8A 3FI0A 1Y9DA 1YTLA 3RIGA 1H1TA 1VBKA 1N2HA 5DK4A 1D2RA 3A05A 2EL7A 4ZCTA 2IHVA 5FEMA 3ZGVA 4EG5A 2Q5QA 4UTXA 4I5IA 4BVBA 1POXA 1NZJA 2HJHA 1V47A 3GLSA 1SZDA 5K6RA 1VBNA 3N2YA 1GAXA 1Q15A 2AZXA 4V1CB 4ZCSA 2VBFA 3F6EX 3AL0C 1YUNA 4ZZIA 1YBHA 5IHXA 3ND5A 3EYAA 3GLUA 4CT0A 4F4HA 4CDNA 1F9AA 5J59A 1NYLA 5DEOA 4UTVA 4UTZA 1KAMA 4CDMA 4Q9DA 4JSRA 3ZUGA 4C78A 5EJ5A 2FSVC 4U8HA 3K9WA 4DDMA 3CF4G 2EJCA 1O95D 1JILA 2YWCA 3COZA 4DLPA 1Q1AA 3L93A 5TS2A 3RK0A 4MWEA 3GLVA 2X3FA 4PBTA 1KKUA 1LI7A 4TWIA 1T9GR 1JZQA 3AFHA 1VLHA 1WXGA 3IH5A 4IAOA 4JUDX 3HWWA 4YP6A 3UMVA 4ARCA 4FEEA 4RMGA 1TFUA 4K9MA 4DDKA 4RMJA 1U31A 4EG3A 2YY5A 2Q5OA 1TYDE 2CT8A 4BUZA 2H29A 1WXIA 1NSYA 4QRDA 2JI7A 1KH1A 4HJXA 4MW9A 1QNFA 2CYBA 2W93A 1JMVA 5IJXA 3SP1A 4R2MA 2OD9A 2EZ9A 3LOQA 4MQ6A 1MB2A 1YI1A 3OTWA 2QUKA 5DGTA 3X1KA 1WQ3A 1EUQA 2NYRA 1GZUA 3PDHA 1OWPA 1MAUA 1QRSA 1Q14A 2QUJA 1MCZA 2VK8A 3FH0A 4MUHA 2QQGA 4FZ3A 2H4FA 3CLUD 1N2IA 2YXNA 2DLCX 3LQ1A 3QTBA 2GM3A 1O94C 2D13A 4QREA 5IMSA 1OZHA 4K0RA 2WVHA 1T9DA 1OBCA 3H99A 2CV0A 4FEGA 4XFJA 1MRZA 3X1JA 1HYBA 1FYDA 3FIUA 3HV0A 1YC2A 5DB4A 5F23A 3H9BA 1M8JA 4COKA 1N2GA 1XJQA 3DLAA 1LW7A 3AIIA 1J20A 2CSXA 1J70A 3FLMA 4MW0A 4MVCA 3L92A 2OD2A 1NI5A 5K3SA 2EZ4A 2GOYA 1U2DC 2H4JA 4Q93A 4KGDA 4I6JA 5BNZA 3AKZA 4MZXA 4PBSA 1ZUNA 3CR8A 4KR7A 5EJMA 1R6UA 1PNOA 4JUAA 1LI5A 1EJ2A 1MC1A 3FNRA 3ND7A 3P0JA 1N2JA 1QRUA 2IP1A 3KT3A 1M2NA 1WKBA 2R5WA 1M8KA 2A1TR 2Q28A 5EJ6A 1U3CA 3OP1A 3SZ3A 3UK2A 1JECA 1EFPA 1KORA 1WZ2A 4IG9A 2QTNA 3CLSD 1Q11A 3N05A 3FY4A 1O5TA 5JBNA 3DO8A 1YIDA 3Q12A 4RMHA 4ZCRA 2C5SA 5HUJA 4JU9A 3F3MA 1EFVA 3IOCA 5BWLA 3D6VA 4MW4A 4MWDA 4KR6A 4EF6A 2H2HA 3MXTA 1ZH0A 4ZT2A 1S5PA 4K9PA 2E89A 2NXWA 1IFXA 3TQOA 2X1LA 2DUMA 2RE8A 3CLRC 2H59A 2PZ8A 3K32A 5AHWA 4EG1A 2WVAA 4X3PA 4Q16A 1J8FA 5MF6A 3LE8A 2AG1A 4UU7A 1VL2A 3IUBA 4OUDB 3FWKA 4MLPA 4ZT7A 5FO1A 4L2IA 2OQ2A 1H3NA 4H3SA 2WQ7A 2ZP1A 2V0CA 4EGAA 1QTQA 2XRYA 1K97A 2DERA 4JUFA 4L3OA 4QELA 3ZGZA 4BV2A 4MW6A 1UFVA 3GUZA 3SZGA 1XNGA 4Y6LA 4MUGA 3FDXA 1PI3A 2PZAA 4UTNA 1K4KA 3IVXA 2PGOA 2H2FA 2TS1A 2XRZA 4DE5A 1ZH6A 2NSYA 4NAUA 1E3TA 4K9NA 3C8ZA 4U7JA 1S4MA 2QJFA 1PNQA 3N9IA 4MVWA 3HL4A 4TWJA 2FR8C 2A1UB 4I6EA 2AG0A 1XNJA 3P52A 3H9CA 1F4LA 5EJ7A 4MW1A 1XNHA 1M8PA 3IDFA 3MLAA 2JIBA 2CV2A 1V5GA 1PFUA 2FWNA 1K92A 4RJIA 1OWNA 2ZUEA 1N78A 1YC5A 3GMIA 4XFDA 4MVYA 1JZSA 3PRHA 1UPCA 5K2OA 4K9KA 2A7XA 2J09A 3FETA 2G36A 1EFPB 4MWCA 1FFYA 3CVUA 1T9AA 1TYCA 2CV1A 2V0GA 1O96A 2BRUC 3CVWA 4F56A 1EE1A 1JGTA 1WXEA 1O0CA 2IELA 1Q77A 5FNZA 4JYZA 5FO0A 1T9BA 1M2JA 1MB9A 2Q5JA 5KCMA 1O97C 3IAFA 3PXUA 3AG5A 3N8HA 2V3WA 5MFZA 1PG0A 1O94D 3IVCA 3Q10A 1CT9A 1KH2A 2PIDA 1EUYA 4BN5A 1Q6ZA 2EZTA 1TQ8A 5K6TA 1PFVA 1T6YA 1T9CA 3INNA 4UU8A 3NV7A 3VGJA 1QU2A 1YI0A 4KXQA 1JEEA 4BVFA 1M8GA 1S7GA 3X1MA 4Y6QA 2X7JA 1YI8A 3MLBA 3CVVA 2WVGA 1M1ZA 1KP3A 3G59A 3TZLA 1BFDA 1XLTC 4K9OA 2J5BA 2D5BA 1D4OA 1N1DA 4PBRA 1R6TA 3HZRA 4KKVA 4GM4A 1PFYA 1U3DA 1MOPA 2E0IA 5D7NA 4BVHA 2WSIA 4NZPA 4YP7A 1F7UA 3I05A 1YUMA 2X1MA 2JI6A 5EJ4A 3CLTC 2BTEA 1KR2A 4JUBA 5MGNA 4HD8A 4G5FA 5EJ9A 1O0BA 1T9GS 4GPEA 2JA2A 1I2DA 1G59A 1QU3A 1B6TA 2CFOA 4RUKA 2J4DA 3HGMA 2VTBA 1OZFA 1QQTA 4GU5A 5EJ8A 3CA8A 1WXHA 3D81A 4AQ7A 3KFLA 4ZT3A 1OWLA 1V5EA 1KAQA 3IVGA 1V5FA 3ISJA 3M5WA 1OD6A 1T6XA 4GP9A 2B7LA
chains in the Genus database with same CATH superfamily
4L8VA 4ZQCB 3RGGA 1ZK2A 3A2MA 1PTKA 4MRSA 2B21A 2XQGA 1JN0A 2EL9A 2FRDA 2PTGA 1X7YA 1QG4A 2ZZKA 3AG6A 4MJLA 2WWGA 4RNDB 4RHFA 3PUZA 3SJ7A 4BKQA 3HLKA 1NIPA 2GYVA 2J41A 5DNEA 3V80A 2GB4A 1NM5C 1E7SA 2ATVA 3W7VA 1Q2UA 2ZTSA 4TLDA 2G70A 5ILGA 1GPMA 3B1VA 2YY6A 3ZHQA 1FDOA 3JZDA 2CLDX 2ZYVX 4JA0A 5EGSA 3MS4A 1I3KA 1R3UA 2H5JA 2PANA 4OK3A 5EIAA 3N6XA 2L18A 3R5TA 1HDXA 4RVNA 2MR6A 5IFLA 2PCJA 3H8JA 4XRRA 4ZQHA 2RIRA 3K6JA 4EELA 1JX6A 2CNOA 4FZVA 4MAFA 2WJJA 2H7YA 2VUSA 4RAOA 5LNK6 3EVCA 4DPMA 3JQAD 1YACA 2Z2JA 4LHVA 1U81A 2EOAA 4P2BA 4Q15A 4RIEA 2GN2A 4R98A 4PGHA 4RE6A 2HNKA 2CLMB 4QSHA 4O5AA 3DAYA 3RVBA 4IWNA 4P34A 3UF0A 3D43A 3GEEA 2JNWA 4GGPA 3EX7C 1YRAA 1XZFA 2KJQA 2NSJA 3H5IA 4KWCA 4OJMX 3PZRA 1H6DA 3KLNA 3IAUA 3TSYA 2B30A 4CG3A 4D5GA 5L7WA 3UY4A 5HWSA 4Z5XA 2HWUA 2B7BA 2P2LA 1RKXA 5DO9A 5BSMA 2X4DA 2AG6A 1SZCA 3D7SA 4IGFA 5EXTA 3RH0A 2BFDB 4TQUS 1UPFA 3NWEA 4RJLA 4BLRA 1PTJC 1U7UA 1XBTA 1ZGCA 1XAGA 2G6BA 2P6PA 3GGSA 4ZPJA 3RAJA 3KCQA 4CV0A 1CWUA 1XQ6A 5EXXA 4B8ZA 5HOQA 1OTHA 2C03A 3LPDA 4EMUA 3ADDA 3OA0A 1GITA 2R62A 4BB9A 1JEYA 1TOAA 4LTDA 4RSRA 1X3LA 2GEKA 3HEBA 2EJBA 3AESB 4AX4A 3H2JA 3CW8X 2EYQA 2VYND 3A9CA 3KT8A 4HXGA 4JA2A 1SD1A 1L5OA 4CCYB 5CXXA 5TIIA 4NV1A 1SKAA 3PFBA 2AR0A 3MD0A 2AR7A 3GZJA 1GILA 4ETNA 1RLIA 4ZOBA 2BLLA 3HCBA 5JEEA 3ZW8A 4AAYA 3I6YA 2PKQO 5EYPA 4DR5B 1DPFA 2G5PA 4ZI7F 1ZN9A 3TKLA 3DZKA 1GZ6A 4CBVA 5B4TA 4NFHA 2UXDB 3ZEIA 2TSYB 1X9GA 2ZAGA 2OO5C 2P1RA 4HDSA 3EG9A 4ND2A 1RC8A 5IC4A 2C3PA 4F84A 4JR2A 2ZIVB 1JVBA 1VKZA 3PQCA 4LMAA 5I8WA 5CDFE 3B5EA 1NJ5A 2XDWA 3E61A 3MSCA 3GRVA 4NBRA 4QFCA 3GAZA 1WMAA 1T5LA 5FOVA 1G2IA 2OK7A 2PHZA 3FAZA 1CR4A 4MYDA 4I4TA 2FX3A 4R1TA 4URHA 1W2WB 2XZPA 3SYLA 4MYUA 1TO6A 2HU7A 3OJCA 4P3PA 4XDYA 4L4SA 3DMTA 2GO7A 1SKQA 1RQ7A 4WUTA 1HDGO 4UMEA 5JT1A 4MQFB 2Z3WA 4Z9YA 4EJ6A 3LCJA 5C5EA 1WSDA 4DEYA 3Q3EA 4E6PA 4CLXA 2HK9A 1QIEA 2X3YA 4WBSA 2JBAA 1HG0A 4IKOA 4M0PA 5CFZA 3R20A 1TAQA 1N2CA 2WBLC 4UUQA 3D4NA 3FHJA 5K3EA 2OHFA 1TZMA 2X9NA 3T9AA 2G82A 1HA3A 2PG3A 4BVAA 2CLHB 1D2MA 1U1DA 2P0YA 3TW8A 1SVUA 5TGZA 4KSBA 4DV2B 4ITRC 3ACBA 5KKCA 5HTKA 1BOOA 4JLNA 3ZW9A 3VYRB 3CJTA 1RQGA 5FWAA 1COWA 1GCIA 2IYOA 2ZJ6A 1IN7A 1CF9A 1TQDA 1OR8A 4I55F 4JMLA 4OQFA 4P3OA 1H9BA 2PLNA 4YAEA 1O6BA 3VVLA 3EFEA 2P67A 4K88A 2AYXA 2D1TA 1Q3HA 4GXQA 3OF5A 5FFFA 1W29A 2PUWA 1KY2A 1F6WA 1IZ9A 3X0DA 2Y9PB 1O96B 3OFJA 1KBZA 1O57A 2F3TA 1ECGA 1YRHA 4P3NA 1C4XA 3LCVB 2D54A 1IULA 4DVGA 4RZ2A 3K1YA 2PH1A 4GH5A 1II8A 2EC5A 4QDTA 2D0PB 4B84A 5I7FA 1EJ6A 2RGWA 3UUFA 4QOJA 3W6NA 2W2XA 2FZLA 1KA9H 3RAPR 5IH7A 4BU0A 2ONZA 4AF8A 5CYFA 3BWXA 3QVXA 1T5OA 3NC1C 4TLLB 3M34A 3TTYA 5KYUB 5GM1A 4X1KA 4XIFA 1R15A 1ZW1A 2CVFA 1VL0A 5HA5A 1YJ8A 5E3JA 3KRTA 4DWJA 3I5AA 3GT7A 3Q0IA 1ZN8A 5H3HA 3CW2A 3H8WA 4OM7A 1Z26A 1Z45A 3WDMA 3CLKA 3B3GA 3V32A 3PCTA 1SN7A 4QX6A 5E7QA 1CEEA 3IAHA 2MDTA 5DNDA 1UDAA 3ZS8A 1OBVA 2XKBA 4U6SA 3AI2A 4EPXA 1CE8A 3TUJC 3KL4A 4XX0A 1RYEA 4EB0A 1RLUA 2AD5A 1F2VA 1F12A 5JDCC 3V1LA 4MV3A 4F2PA 4Q05A 1EM6A 2NU7A 1L0BA 2P2DA 3ANTA 4MKRA 1G8YA 4YCAA 4BKUA 4D9HA 1IOZA 1M10A 4NC9A 5K03A 3QVOA 1KYZA 3EK2A 2B36A 4WKNA 4WBNF 1KYTA 4OM8A 4YNBA 4INJA 4IUBS 4CM5A 3EGOA 4UVHA 5CDHA 3C4JA 1VLJA 1G8SA 2RGCA 1X38A 2Q29A 3C8MA 3G2LA 3MZ0A 1FDWA 1MAWA 1WZUA 4G5OA 4NBWA 5CA0A 2GXUA 1PQPA 4OMDA 2I9KA 1FDUA 4LHZA 3FI0A 1WD7A 3OLYA 1G2PA 1BS1A 3KYDB 4GOJA 4XKJA 5AD1A 5C0OE 4A8TA 3HG7A 4KDRA 2HBYA 4S24A 2ECOA 5IBPA 1D2RA 1W8IA 1YQ9A 2WMYA 3A05A 4TTAA 5AP9A 4ESOA 4ZCTA 1VIAA 2XA2A 3WTCA 1VYTA 1IY8A 1Y1SA 2FMKA 4KQ1A 5AJVB 2A0KA 3NHPA 3THWB 2O7RA 2ZIUB 2ECKA 3KEGA 5JWHA 3BN3A 3GVCA 1Y6RA 1UKAA 3KVOA 5BQ3A 5J1TB 2ZETA 4YR7A 2IDMA 4DC9A 1D2GA 2IF0A 1ZXBA 3GLUA 4GOOD 2OV1A 1UOOA 4CDNA 2VYVD 2KS6A 1TLLA 2XQIA 1UXOA 1TK9A 4W4TA 7REQB 4UNIA 4IHJF 4L15A 5KSZA 1QQAA 2JW5A 3WL7A 4BFCA 4U0KA 1X7ZB 4C78A 2FW6A 1E92A 1ELOA 1NF3A 1QGUA 4O4JB 2UUAB 4ZDWA 1DJQA 3MCZA 1DTEA 2VRWA 3GGJA 2WUWE 3COZA 3OLVA 4QTXA 4QKQA 1AS3A 3L93A 1JQAA 4P32A 2H9AA 5D6NA 4GAEA 4C0KA 4TWIA 2I34A 2ZYHA 1TVKA 1T4DA 2QG9A 2X0JA 1J9EA 2FETA 1KP9A 2WG0A 1GYQA 2XGGA 2QMQA 2C82A 3LF2A 5AVRA 1K88A 5C37A 4RM2A 3H0KA 1ZD2P 3MQFA 3UMVA 4B44A 1T1JA 5DHUA 3SVLA 5DHTA 5DT9A 5JQGB 4KV9A 3LI2A 3TH5A 1SZJG 5IVKA 2OMKA 2CYBA 3EZGA 4DBLC 3D8TA 1F0YA 4X84A 3OQHA 3LPNA 1HXHA 3GJ6A 4R2MA 5FPTA 1XKXA 3C8HA 4MLCA 4HT3B 1K2WA 3HS3A 2JEYA 4P31A 3UIEA 3DOJA 1RFLA 3FPCA 1OLSB 4CMEC 2PV0A 2XKJE 2YVLA 2H8GA 4FLEA 3V8BA 3NBXX 1WABA 2PMCA 3AEKB 4PYIA 5CXQA 5P21A 3UFBA 1GPAA 3DP9A 3H1TA 3LUKA 2ZPTX 1WXXA 2PGAA 2PVSA 3BOSA 3NP9A 4GEKA 4P35A 3NT4A 3JALB 4ZANA 1Q0UA 3A11A 3OQIB 4CNBA 1I1NA 3PHJA 3S1SA 3SIXA 4HYQA 2ZTLA 3HUUA 2HU8A 3C3WA 5C46F 4JASB 3WWEA 1FFEA 1YOBA 2GPBA 3Q7EA 4R9UC 4H15A 5KHLB 1WSAA 4CL2A 2EIHA 1RAIA 3KVVA 1QG6A 1LNSA 2G9VA 3MJCA 5FBKA 2G80A 1F60A 1DEAA 5UKDA 5CXUA 2X42A 3PC3A 1P0QA 5GONF 4N9WA 1QYDA 4NCBA 5L95A 1N2GA 3ORFA 1XJQA 2C20A 3Q7QA 3MLEA 2FVXA 4II3A 4WACA 3VH4A 4EPRA 5HF5A 5I9LA 4AKTA 1VL8A 2JH9A 3CBQA 3H5TA 1EVJA 4RTNA 1IIRA 4QGAA 3IILA 3K72B 4L6IA 1S9HA 1VB3A 1BW9A 3L92A 4TL6A 2BBTA 1DJMA 1D4FA 2X7HA 4TMXA 3F71A 2HA7A 4UHCA 5JSZB 5I8ZA 1ZN2A 4B76A 4DDUA 1Z74A 1RD4A 1S2DA 4ARAA 1NJSA 3ILYA 2OBBA 2ZIXA 1N2JA 3KKKA 5DV9A 4EHJA 4LTNA 1LSOA 2Q28A 2R5WA 4M76B 3O2SB 2ID4A 3Q6IA 4B31A 4FWBA 1ODSA 2W2MA 2ZPAA 2QTVB 3A1UA 4GHWA 3TIGA 1HRKA 4HRXA 221PA 1U6KA 3ZI0A 3BF7A 4ED9A 4HUQA 1CFZA 3OCCA 2P9JA 2FZWA 5CD9A 5KOYA 4QICA 4HOYA 3F4KA 3ZDEA 1K5GA 4KFTA 1J1UA 2NO6A 4FFPA 1OF1A 2GEDA 2HNAA 3PQ5A 1CKEA 2PT9A 4BRZA 4EAAA 4EO9A 5JSUA 4XJVA 1O77A 5FL7A 3TCXB 3FNFA 3FBWA 4F8EA 4JI1B 4PAOA 4DIUA 2ENWA 3DUWA 4KPGA 1GA6A 1EUCA 1RWVA 2E89A 1TKAA 1Z0JA 1RHMA 5I7SA 1QFZA 3COJA 3CLRC 4GDFA 1CY0A 2B9EA 3NATA 5C81A 2P1DA 3IELA 4CDRA 5ABPA 1K0FA 3ZHOA 2PO5A 4BS9A 5C8YB 3O9ZA 2IX3A 5ARCA 3PXCX 3CWCA 3M9LA 2BOVA 3R23A 5H4HA 3RRFA 4DQXA 3SYNA 2LPMA 2MSEB 2Y3IA 5D5HA 3V2HA 2XRYA 3FUVA 1GNVA 4H7HA 2HT6A 2NZWA 1D5CA 3SZGA 2IOYA 4F4IA 5KX5A 3ZVMA 1D5WA 4MPTA 4BAGA 1ONNA 2ORIA 2GN6A 4FUTA 5EKSA 3TBKA 4C0WA 3TBHA 5AKXA 3BUSA 3EZYA 4ZDJA 1VSTA 2AXQA 1B93A 1J5XA 3IE2A 4J1SA 1B41A 4K2HA 2ON6A 2V97A 3IQIX 4O1HA 4BZXA 3K31A 2VT3A 2JLVA 4I6EA 4ZYYA 4QATA 5ERGB 5F77A 2I6SA 4H0CA 3IDFA 2ZI3A 1UR5A 2OV8A 4OL0A 1XNQB 2WMDA 3A6DA 3TQQA 3UQZA 4FBGA 3ICEA 2AOTA 1G9XA 3OKAA 3RUAA 4Q9KA 5M34A 1RJGA 3BGOS 5GJCA 5COBA 1ULTA 1RAAA 2GD1O 1EEHA 4ZXFA 3C7KA 2A7XA 2ZT8A 1ZD4A 3IQFA 3CEJA 1H2HA 4BFWA 1A4XA 2DUUA 2G36A 2PGXA 1G4UR 2JFQA 2X86A 3MJVA 5FPKA 3WY9A 3LPLA 3TKYA 1QZXA 1T3TA 2X13A 1CF2O 3UATA 1K98A 2A59A 2PKCA 3BH7A 2JC3A 3C1UA 1ACMA 4D6XA 3RUEA 3GPIA 4PINA 1S2OA 3N3BC 4NMLA 3T41A 4CM9D 3R9WA 1SXJC 1XC7A 2FSFA 1IUNA 3HACA 3HB5X 2O5VA 3OFNA 1GEEA 4YROA 1LDEA 2CFCA 5DP1A 5H9VA 1A27A 4LOIA 4E03A 4J0IA 1QU2A 5CT8A 2AJBA 2FPGB 3ZHVA 3GLQA 3NFYA 4K7JA 4TOIA 4M55A 4AFNA 5I45A 4RVUA 2QUAA 2H6EA 1GZ4A 5A6SA 4IUYA 2V59A 2PU7A 1E1CB 3ENQA 4UBKA 4PO1A 4DHEA 4NBSA 3RDPA 3OQVA 5CRIA 5JJCA 2BFFB 1H6AA 4HX9A 2E0IA 3PRKE 1GADO 2BKLA 4RHTA 4H6XA 3DDOA 1WSBA 1F7UA 1VHQA 4KACA 2VQDA 4IO1A 1XEAA 4R31A 2G8LA 3JZMA 4JUBA 4DCNA 3P9ZA 1I7LA 1A9TA 2YVKA 3BK2A 4A5SA 2W6NA 3FFXA 1KJZA 1R4AA 3GEMA 1G19A 4KIFA 1F8GA 4R8KA 5B2FA 3L4SO 1P9OA 3LPMA 4TMFA 5AKKA 3U16A 1B6TA 2EJWA 3NOOA 1AKMA 5CPBA 1CVRA 1QQTA 2L82A 1SOMA 2Q3BA 1C9MA 1IRIA 2I0FA 4RV5A 3OE5A 2G40A 1WWKA 4C3UA 3IVGA 4Y8VA 5DBIA 2AF4C 1UOQA 3WKEA 3BT7A 4II2A 4RDXA 1NU6A 1X7DA 1ZM7A 3USES 1C7JA 2PMEA 3N1UA 3E9MA 1U9ZA 4Q9HA 3IHWA 3DDHA 4RCYA 3LKZA 4GUDA 3KSUA 2PKEA 4FXPA 3PGMA 3N07A 4TLMB 1XHLA 2XADA 5L6MB 3WIUA 2NG1A 3MAAC 1JYFA 3G23A 1QDEA 3IE0A 1EXDA 3SS7X 1PSDA 4E4TA 4Z54A 4AN0A 1G20E 5CM9C 1CS0B 1B15A 4BX3A 3WFZA 2XZDA 3CEHA 1EVEA 4QASA 4CIVA 2QTTA 1A9ZA 2JJYA 1NRXA 3ICVA 4INOA 1CIJA 2XVAA 3JR3A 4NYIR 1U0BB 3TNFA 1XHFA 3AO0B 4WECA 1EP3B 1R0XA 2PS3A 4J1NA 3KLOA 4I9HA 2IZZA 3B9QA 3R3JA 3KV1A 5DEIA 1FBTA 4YHBA 4B45A 1A04A 2AI2A 2VTVA 4E5VA 1XPRA 2A5JA 2O50A 2AEJA 1NOIA 1DKOA 1NP3A 3P9QA 3V2GA 4A2WA 1KMIY 4DA0A 3DOFA 5EY5B 2JLAA 3GJ4A 2ARKA 1ENYA 1VB5A 3FWNA 2CNLA 4QPPA 4U02A 4DYVA 2XWBF 5CHEA 1QVAA 4YJ2A 3TXXA 4E2WA 4F85A 2ASVA 5DNCA 3N70A 1XDUA 2ZAOA 1M1YE 2IYWA 5CH8A 3P7MA 3HYRA 1ZS9A 3PT5A 1L7PA 4BMSA 5DWVA 5AI6A 2XEXA 5TSDA 5FV7A 2WJ6A 2C5BA 4HADA 1UWLA 3IQXA 4ARZA 1KO4A 4YR9A 3B9BA 2PXAA 2NUAA 4D4LA 4HXFB 3O8RA 3NHFA 3KPUA 1JEQA 4TKUB 1WXFA 4N6NA 5A6VA 2XB6A 1LRJA 2AT1A 2ID9A 1E7QA 1N6RA 2V7XA 3EE6A 4Y7CA 4EHAA 4AS1A 3LPCA 4FR5A 1RZUA 4EG5A 2HI0A 1ISIA 3L1UA 4ZVRA 3LNTA 2QPAA 2O59A 4KCGA 2W58A 2W2LA 4MO9A 5KTSA 4FFNA 4LWOA 1ZGBA 5LDGA 1RPTA 4TKLA 3T4EA 3JR7A 1EE9A 3ABRB 4E32A 3T3PB 2VHTA 1Z13A 2I6FA 4Z0NA 3IP8A 1JI0A 3ET4A 2IUEA 2QVGA 2WE7A 3D1JA 3IMEA 3P32A 4NK5A 4J29A 1V95A 3DHYA 3UA3A 1XQXA 3GFVA 5DCYA 1TD9A 3T4XA 1FL9A 2F6RA 1QF7A 3C7CB 4N5IX 5EMKA 1ZC3A 1NMEA 2PZEA 2Q4EA 5BMVA 2PUHA 5CEJA 3HJFA 3P2EA 3RVQA 2XTNA 1S01A 5KJ1A 4KREA 5T5QA 1ANKA 2R8EA 2J30A 2G5TA 2I4NA 1P0CA 4GBED 1JKIA 4JT4A 3DKKA 1TA4A 4PZZA 1Z2NX 2ZRIA 4OUKX 3KHSA 4RH1A 3ETNA 4MV8A 1JHMA 4ZEOA 3CN7A 3BSWA 4MUEA 1M6VA 4CQLB 4NAHA 1HFJA 1OHHD 4Y2UA 1U63A 3T94A 2JIQA 4X45A 1V1MA 1UXKA 2GLXA 2GVNA 2QD1A 2CHUA 2FSUA 1YASA 4HQFA 4J16C 2IU0A 1XJWA 3A1VA 1Z4JA 4XASA 1S2MA 1B73A 3UMFA 4XUEA 3AR3A 1WRBA 3RSOA 1AUQA 4GBJA 2D8AA 1QIMA 2HWYA 4MMZB 3L9XA 1B0UA 4AIIA 1YKGA 1YVRA 2W2VA 5KWIA 2QMYA 2XGOA 4YWHA 2C94A 1Q17A 3KSRA 1O95C 1DJPA 2C1EA 4LXTA 2HSDA 3BKWA 1ITZA 1D2CA 5BT9A 1ZNQO 1VE9A 2Q5HA 4ZI7A 5AIAA 3T1OA 1C30B 3BL8A 1GGJA 4KN8A 3IUEA 1DAKA 4Z99A 5LSAA 2CJPA 2NP7A 2CUZA 3P4UA 3KXKA 1JIKA 1T36A 4Q18A 4UM5A 2G09A 3ZJ4A 4BDTA 1ZMTA 2TMGA 3EUEA 3QQ5A 2H2DA 4CEHB 4CCSA 1OH5A 1P6XA 4JL6A 5KUTA 3SEFA 1C3XA 4GG1A 4FJ2A 1ZXLA 1WY5A 1HDYA 3EUFA 3F6YA 1W5AA 3FJ1A 3O82A 3TRJA 3W5VA 2DP4E 1MP0A 3ZGOA 3RVJA 1YWGO 4M38A 5ITZA 2ZSIA 3L82B 5BYAA 3IL2A 1NY5A 3K09C 1A7UA 4RVDA 3Q98A 3OTOB 3PTLA 1GPWB 1N2EA 2YWXA 3L8DA 3KT6A 1RLTA 1IQ0A 4MDHA 4TSFA 3N8NA 4RTMA 4C06A 3HBAA 4NENB 2VYQA 3QLUA 4LYEA 6CHYA 1YCHA 3QOFA 2VT7A 3NS7A 4AF7A 5LDDC 1I6KA 1N2OA 3RS2A 4G1FA 5I9NA 3CWZA 3I01M 4JKIA 1FJXA 4AZVA 4Q3OA 3WWYA 4ZT4A 2OBFA 2P40A 1F17A 1JKJA 2MSLA 1B6SA 3G8AA 4PSUA 3VR0A 4C2AA 5KINB 1WBBA 1MLDA 2X4LA 3GDWA 3HXPA 4V0NA 2WIAA 4MGKR 5LZ7A 3V4LA 1XAIA 3RYCB 3B36A 1QP4A 3DSRA 1UMCA 4X64B 5K8LA 2YWFA 4BE9A 3O84A 4TTQA 3UXMA 2OFFA 2JLYA 4W5TA 2OBXA 2YJTD 4ZXPA 3O8DA 2CBGA 1NNLA 3WHKA 4ETWA 1HO3A 1YBFA 1O58A 3IB3A 4RTJA 1OVMA 4D3ZA 2IU6A 3Q3CA 4G09A 4MX8A 3WYBA 3KVYA 4IGKA 5BP7A 3SPXA 3PL5A 1Q57A 4C4PA 2VI5A 5A3QA 4DIFA 3K94A 4F3RA 5BXQC 3KYCA 3E8MA 1U0EA 1YZKA 3GJ5A 5IJ0B 2JAQA 2X5KO 1EDDA 3STUA 4DTIA 4EA8A 3L0BA 1JFLA 1U8EA 3MC1A 4CJXA 5DHRA 1R4MA 3F5FA 2PRZA 4N8EA 4WI1A 2K2QB 1R0WA 5AW5A 4YT8A 4IG4A 2J9YB 5DXAA 5H81A 1XPOA 2CL6X 4EEXA 3YASA 1SD5A 1PJ2A 3OTIA 1PFQA 5IBQA 2H85A 1Z56C 3QZUA 5CFQA 3NM5A 1EH5A 1YL5A 3RIGA 1U11A 1H1TA 2IXDA 1UEJA 3ICPA 5CURA 3QRWA 5CA0F 6REQB 1ADYA 3E3MA 2Z43A 1XFAA 3DT9A 1WPRA 1L4YA 1LJ8A 2G17A 4P4SB 1W7AA 4AJHA 3PV0A 1YZQA 2Y1CA 1V47A 2C1ZA 2JLBA 3U2QA 1KK1A 1OXKB 1S4QA 3GLSA 3OTQA 2ZR9A 3KR2A 1LLUA 2I6TA 3QKUA 3OE4A 2GN9A 4J2OA 1ZAKA 3WV4A 1YUNA 2FPIB 2DC1A 3EIWA 4HLNA 3BTUA 3CRW1 2ADOA 2ODQA 3VI3B 4F4CA 4BJHB 1A4IA 3EZLA 3HN2A 3TGPA 1T3HA 4HAZA 3UMJA 4Q7JB 1U02A 4D9NA 1WKCA 3SMVA 3OX3A 4V38A 1GZ7A 2CXQA 3SFTA 1MJNA 2XMRA 5FFNA 3TAHA 1JFFA 3Q3JB 4BXOB 3LXMA 4M9ZA 2EJCA 3FOZA 1J0DA 5I4IA 1E6EA 3K20A 2QQEA 3L9WA 1DAIA 1XD2B 3K1AA 4B34A 5AQ1A 1US8B 1HURA 1HORA 3I9KA 3PPIA 4YK7A 4ZOLA 5TPWB 4B2PA 1WNTA 2ZSHA 2W6MA 1BROA 2C2KA 3E70C 4B2IA 4EY3A 4KHPB 4KN5A 1I7PA 1Q7BA 4AZTA 1FDIA 2WWFA 4TKVB 3JWIA 2OCKA 2R87A 4I3FA 3OTHA 4NCIA 4CQMA 2PL5A 3PSAA 2H31A 2HC9A 3QKSA 2DOKA 4P2GA 3Q1KA 2VJMB 1AB5A 2VDJA 3ECCA 4GXNA 3DVAB 3MRSA 3C5WP 2O5CA 2B92A 1CUCA 2NU9A 4GNKA 4DR2B 4FFSA 1NN0A 1WB6A 5FOSA 1I3OA 1QIGA 2FQQA 3FGZA 4RY9A 4B8YA 2BCGY 1WU7A 2NYRA 3HCFA 2C4UA 1C3LA 3HUDA 3LO8A 4H18A 5E2AA 5DBGA 1JUDA 3IRUA 4EFLA 2O8EA 1K4YA 4ZQEA 1FSZA 4QECA 4HQ0A 4KFCA 3E2PA 2OMEA 3DKVA 4P3XA 1I13A 3FFTA 2QW0X 4I5EA 2NU6B 3IVAA 3HDYA 4JL8A 3VM6A 5COQA 3B9RA 3OI7A 4CHGA 2FEAA 1DBSA 1KO8A 1NLMA 5KX5B 3V8PA 1ZI8A 3R6LA 1OYYA 1EMDA 1JJBA 4KZPA 1MN6A 1QRAA 1SVLA 2Y4NA 3E9DA 4HWPA 4JP3A 5EOVA 4V0RA 2Q2QA 5H70A 2RHTA 3EFOB 1MG5A 2WUDA 3WJ7A 5KTOA 4Q9LA 5I9BA 2L42A 3JU3A 1W52X 2RHRA 4XYMA 5ALRA 2M2IA 3KXIA 2GF2A 3DLAA 4LNUA 1HDCA 4WOKA 3BG5A 2BLNA 3VX4A 3KQHA 2PMFA 4C2BA 1H2EA 4ZVOA 3R6DA 4MW0A 2NSDA 4MVCA 4Q3EA 3AJ8A 2CLLB 2XYRA 3V6MA 2Z4TA 4LDQA 3UMYA 4A73A 1YS7A 5BWBA 3CBGA 3SOZA 3RVPA 1JG2A 4Q93A 4D41A 3IV7A 2RJOA 3CR3C 1SK8A 1QVVA 3AQIA 1XAJA 3R3UA 1H2BA 2AWOA 2IGBA 2H7VA 2QN8A 2YV3A 3LQYA 2ST1A 3PJGA 4WY2A 3VSCA 4B6OA 4I08A 1H4TA 3RCBA 4KXYA 3IC5A 3WBBA 3CE6A 4B33A 1W88A 5ICCA 3VR2A 1N36B 2A1TR 3RBXA 2VHQA 3QOXA 2IWRA 2JCYA 3DAPA 3MCTA 1F8YA 1KOJA 5I4CA 2Q6LA 3VOSA 1JECA 1EFPA 1XCLA 4ZAFA 5JNWA 3I9V1 3EC1A 1XN1A 2JAHA 3EHDA 3JZIA 2ODTX 2W8BB 4KUHA 5A5GA 4DL9A 2BEUB 4P4LA 5KNBA 3H19A 3BBLA 3P2MA 3TBFA 2OOSA 1JLRA 1YIDA 5C9ZA 4IFTA 5F73A 5ETJA 3AR7A 5CM2Z 4DUZB 3PRYA 1EFVA 1YR1A 2QKYA 5DMXA 4LZLA 5LU9A 3BVPA 5B4UA 2X2EA 4X1IA 5DJ5A 3FCYA 3AETB 5FTLA 5KNCH 5FT9A 4KSYA 2DKNA 3AY0A 3KR9A 4ZT2A 1XOIA 1J99A 2R1UA 4YO8A 4UCXA 2OC9A 2H59A 4FS8A 3BTSA 3N2EA 2ZG6A 1GGMA 1XVLA 2R1TA 1DUVG 4MMYB 4L0MA 1EBUA 1HK7A 4OUDB 4D0LB 4JOBA 2RI6A 3EXG2 1H3NA 4H3SA 4K81B 4HB2A 1M33A 2A0UA 4FQ7A 4L3OA 3ANSA 4D96A 4EABA 2X6RA 4LEIA 1GU7A 4RVHA 3RANA 1ZJ4A 1WLYA 3MWYW 1EP2B 5K8IA 3HCEA 1IVYA 2AJTA 1W5TA 2GMWA 1VBFA 1PI3A 4RD0A 1P0IA 4JFRA 3ZWCA 2H2FA 5EZ6B 1NBMD 2JJ2A 5EHQA 3WSWA 3RV4A 2IXAA 1AVTA 5FTWA 3VH2A 4K9NA 3GYGA 3ZIDA 5JHHB 5KX5F 5IHPA 2A9PA 4QBFA 2IV2X 2WKQA 4CM3A 4U2EA 4NBTA 1C3OB 4TWRA 3E9RA 1LLDA 3PFGA 3IA2A 5FLKA 1CRLA 3P52A 4E51A 5G1OA 3P9RA 1PL6A 2ZIFA 3K2QA 5ESDA 1E61A 3TR5A 5LU8A 4GKJB 2EDCA 1GUYA 5DYWA 3UNXA 5BW6B 1J8QA 2C9YA 2KM1A 1CZHA 1BHQ1 3H5WA 4MVYA 5JSFA 2BPOA 4GPD1 4CN9A 1UPCA 4OP2A 4QXAA 4DMLA 1YVUA 5J63A 3F6CA 4RTOA 4AK9A 3QH4A 3V1NA 3PC6A 4FLFA 2GILA 4FOPA 4HX2A 2OLEA 1PL8A 5JAHA 2ZROA 2QAIA 3O94A 5I7UA 1N0VC 5CG2A 1YONA 2I29A 1WPQA 2JCSA 4DZZA 4KPYA 1E2JA 4LX8A 2ANBA 1HNXB 1PX2A 2WHPB 1NI4A 1XJ0A 2O1WA 3T7CA 4LY3A 2DZDA 1KH2A 2PY6A 4KXVA 2BFOA 2GFQA 4O59O 4YAFA 5BW8A 1G0NA 2BMEA 2V5UA 2E37A 3DB2A 2EZTA 3SHVA 3FUCA 1TCCA 1SUSA 3AJEA 1CNMA 4LYAA 5JVDB 3PD0A 4L9SA 2H0AA 3VGJA 5KNDD 3RTDA 1IZ8A 2BUCA 2ZRDA 3RUFA 1UK8A 4BNDB 4BO2A 5JY1A 1N5DA 1M5TA 4HTAA 1JF8A 3PD7A 1SBIA 1J22A 1ETUA 1QGAA 2DTDA 3QVGA 4LQDA 5B37A 4ENSA 5K0JA 3ND9A 1USIA 2BFCA 4R2KA 4F3TA 3PLNA 4XGQA 1Y8AA 1C7EA 4MB2A 4FDUA 4I4CA 4D9IA 2HFJA 4RWZA 1QHHB 3KUXA 4D4JA 4XLLA 5IC5A 2BSQA 4X8OA 5L3QA 5E9JA 3PUHA 4IV0A 1PJ3A 4B8WA 2BFBA 2I4MA 1Z4OA 4TMYA 4E0BA 1V7ZA 3NYQA 2CFOA 4RQBA 2YIJA 3H2HA 4FFWA 4EYSA 4E22A 4LJ9A 4JKOA 3ZGXA 3ER8A 1N6PA 1EJ0A 2ZVPX 1A2OA 4Q3KA 2VP4A 4AS2A 3RU7A 3ZGYA 3LX6A 5BSWA 2D74A 3M5WA 3P5SA 5DP2A 5LD2C 4HWKA 4JDPA 3C70A 3BD6A 1EBFA 2PFKA 2H7CA 3K9FC 1GFIA 3RROA 1XQVA 2AFIB 3PR1A 5DHAA 3ZJ5A 3ZI4A 5U9CA 2ICAA 4RD4A 4PQYA 5LQRA 3ZU3A 1I6MA 1YGPA 1OBFO 2E6KA 5JJLA 1CB7A 1Q0HA 1E3QA 5B3JA 3LMKA 1UKBA 4P7BA 1NUHA 3UJHA 4R1QA 3V8QA 2V6FA 4FNOA 1P91A 3VU9A 1R5NA 4BNVA 2XUQA 4XCXA 3HTXA 4H08A 4M53A 4R1MA 2GASA 1PV2A 1NMSA 3N2GA 3GCDA 2WIDA 3TLYA 5KTMA 1XLVA 5IAAA 4HLQB 4ZGWA 1TJ4A 3ZE1B 2C7GA 2P6MA 1VRCA 4GBMA 3U31A 5HIAA 3SDSA 4ZVMA 3HI4A 4EFMA 1U2PA 4OYHA 4DNXA 1UF9A 4D9GA 3GLGE 3A9TA 3K0CA 2PEYA 4CI9A 4TTIA 1HTWA 4INAA 4ROTA 3L7BA 3SZMA 3NORA 3TAXA 3CUKA 2OC4A 2OEPA 2Q8QA 4AZ3A 1UBOS 1YU6A 5ALOA 4ER0A 4QUAA 1DAPA 1GFWA 2BDUA 2YBDA 3LUPA 4OREX 4W7HA 4YJ2F 4YQFA 1TIBA 1JWLA 4QGHA 1S6YA 3CRMA 4NJMB 1WOYA 3TZBA 5BV7A 1L7DA 5IK2A 3LBYA 4FC7A 3TSOA 1Q16A 3AEZA 1G3UA 2WJPA 1VLZA 4B3DA 3HO1A 3VC3A 1TYZA 2E1RA 2PMKA 4IDCA 4UQOA 4CZ2A 5CIYA 4LG1A 1M34E 3GUUA 3L0DA 4HEJA 4PYMA 2X58A 3VUEA 2NUBA 4OI2A 4RK6A 1Z29A 5KQLA 1R66A 5DYGA 1DV2A 1ML4A 1U3FA 3Q8XB 1JJFA 2BF4A 4WEQA 3BULA 5CNJA 4DTCA 1XRQA 3IP5A 4PFQA 4Y2YA 2JIMA 2Z4SA 5ALYA 5BNIA 3HXMA 1J0CA 1AKUA 2Q6OA 4FSDA 2V7QA 3ORHA 3DD1A 3QTTA 4QLOA 3FFAA 4FX5A 4HNQA 4AKHA 1M1NB 2FUNB 4IDAA 4RY8A 4ZZ0A 1YJ5A 3DW3X 3F4BA 2R2AA 2JKVA 4JH0A 1IBRA 2O5RA 3EOBI 4A26A 1T2CA 4ZZ1A 1U3WA 1H8HA 4FEYA 4ZV9A 4I8XA 1R37A 3CTMA 4MCJA 4EWLA 1U6JA 4CQNA 4HDNA 5IJAA 3OHSX 4EFKA 1EVLA 3G0IA 2Y67A 4IX9A 5G1NA 1P0FA 4EHDA 2IS1A 4ZRDA 4QA9A 2VPXA 1G9SA 3ZCVA 3W5AA 4ZQBA 2FW7A 1NVWQ 3WLFA 2X77A 1B2RA 2HWKA 2ZJOA 3OLWA 2GRUA 1A8QA 1UZAA 2E3JA 3AJAA 3QSYA 2H63A 4JJKA 2R6ZA 4F60A 4H3VA 4C7MA 5A62A 1IBSA 1KH3A 4U2FA 5HW0A 3AI7A 3WO0A 1E6KA 1EQ2A 4HTFA 1MV5A 4AX8A 3BRWA 4IQ0A 1VECA 4M0FA 3RRXA 4TYMA 4D92A 5E3IA 4E15A 4D3XA 2WP8J 3N0XA 1E2EA 2PUBA 5CA1B 3RBZA 1CQJA 2J9FB 2JA1A 5GZ6A 3SQDA 2P8SA 2ZAIA 2O8DB 2GA9A 3VO2A 2LE0A 2WU8A 3O4FA 4MS1A 3UC5A 3R0QA 5DNYB 4BLWA 1U2GC 4GVLA 1L7OA 3VR6A 1GQOA 3NVDA 4PTLA 2HJRA 2CNWA 1Z4MA 2O23A 3ABQB 3F7OA 3KOXA 5B6IA 3DBRB 1ZD3A 1FLAA 1HTBA 3ODPA 2JF0A 4PRKA 4BRSA 1QJCA 4HGPA 1A9XA 2YFKA 1UFQA 4WGGA 4G6ZA 1XMXA 3VI4B 1H2WA 3C39A 1PZHA 4KLAA 4RF5A 3VR5H 2Q1WA 4N76A 4DQ0A 4FWTA 2CDCA 1LF5A 4EDFA 2UXCB 1T1RA 1BXKA 3E48A 1NAIA 1OI3A 4O29A 1VLLA 2ETXA 1AKWA 3R7AA 5IJZA 4LXYA 4MA0A 5A5EA 1Q91A 4KITB 4MUKA 4IDEA 3NBAA 3W9SA 1I2ZA 2VDRB 3LQ4A 2ZSKA 4KQCA 3PGLA 1WA5A 3LW8A 5FBWB 2LGJA 4XWOA 1YZLA 2G9ZA 2PX2A 3FHOA 3M6MD 4QVGA 4RSMA 4GMDA 5KOJB 3OZGA 3EGIA 2VJOA 2ZBPA 2Q0QA 2GGSA 5KBYA 3LP5A 1NVUQ 4J75A 1XP5A 1T2VA 3ZV4A 2W71A 4PLPA 4XRGA 5B58T 4QYTA 1PW7A 1I9GA 1YULA 1Z16A 4W9RA 4WJZA 2WD7B 2XNDD 2VLIA 4C43A 1CUZA 4MPPA 2AL7A 1EX6A 3IJRA 4LUCA 5T3YA 4K0KB 1SVNA 1R3DA 2WWTA 1YXMA 3I9V6 3EJWA 4WZAB 4RFVA 2WWXA 5EPEA 1W0KD 3ZIAD 2JIPA 2JGDB 2OB2A 4Y9DA 1K0UA 3E3NA 1GYPA 4OYRA 5CR9A 2DULA 3R5FA 3H6KA 5FIUA 2XWPA 5LVAA 1GDTA 4HV4A 2ZB2A 4BC1A 3BMNB 2E6UX 1QZUA 4KNWA 4QBKA 1FDSA 1P7WA 3LYUA 3WP0A 2XYHA 4TUYA 4B35A 4YS6A 2NP6A 1E5QA 2F55A 1Q0TA 1JMKC 3FW1A 3JWPA 4OY3A 4ZOEA 3P2IA 4X0EA 4JT8A 1KMHB 2EG9A 2BMVA 1XL0A 1XXLA 1GTVA 1ZPDA 2QJRA 1QYCA 1K3UB 1OWMA 3EF1A 3GIWA 3JQ6A 1YOVB 3MPUA 3EXEB 4FWIB 2CHEA 3B6JA 3JYPA 1MB3A 5H80A 1ZCBA 1ZAYA 4PY2A 1KPGA 2W43A 2OXCA 5LJLA 5SY6A 2O06A 3EC2A 4JUCA 4UULA 2VPTA 3UT0A 3ACDA 3ZWKA 5CB4B 2VOJA 2AV6A 3GU3A 4M87A 3SC2A 1YHNA 5HRCA 4LK2A 1G38A 1SBQA 2R6CA 2W6JD 3GNTA 4JX8A 4V0MA 3ACCA 2ZBVA 5LLSA 3AUFA 3OJEA 4UE2A 3U0VA 4FGZA 3QNWA 3NBMA 3SHWA 1MKYA 4R8MA 2A58A 2HXYA 5IN4A 2H07A 1VBKA 1E0JA 4D79A 3BE4A 4MR7B 2RK4A 3GNSA 4RKYA 3NCHA 1RRPA 4F4DA 1CDDA 1HFWA 4BIIA 4EHIA 3KOZA 4NHOA 3H7AA 4HGRA 3TR6A 4YV2A 2R2GA 4DT1B 5HQ3B 1C1DB 1G66A 3BRCA 1JSRA 3LL7A 5K0EA 1FYWA 2CVHA 1R8JA 4N65A 3V1TC 1I30A 4ZCSA 3UN1A 1CDOA 5IVIA 4IVQA 1EP1B 2ZQZA 3PDWA 2Z83A 1K9VF 4JJ6A 2WABA 2TMYA 4YJFB 1KBOA 1FYEA 4ZU6X 3RW9A 2GO1A 3EIQA 2WLSA 3LNCA 2VF8A 4KJXA 3ORYA 4AZ0B 3CB2A 4EFNA 2IK8A 3PE3A 4WJLA 5AVTA 5GJBA 3G0GA 3QBVA 1HT1E 2IZ6A 4RTLA 5I5GA 4A9AA 3ZUGA 1XLUA 4BB5A 5KI6A 1RBYA 2DFDA 3IDZA 1N5LA 3CZRA 4MUYA 2W2KA 4IX1A 3MA0A 4LSZA 4HNAA 1NXVA 3PDUA 4OATA 3K8YA 1E1RA 3HFRA 1E2HA 2B78A 3M4JA 3T7RA 1MQAA 3G49A 5J5CA 1ZBDA 1JZQA 5KWJA 1VLHA 4ZODA 3G5LA 5DGXA 1K5HA 5BWMA 4RPLA 1RDFA 4OQPA 4YP6A 3T9DA 4B85A 5KYNA 4RMJA 2YIMA 4LYYA 2GWHA 4KGXA 2X8WA 4ZOLF 5JS8A 2YHIB 5HOEA 1IN6A 2I8LA 3RUCA 1F4VA 3TD2A 3A7EA 3F8SA 3C98A 3I53A 4E3ZA 3Q8LA 4JITA 1ETHA 3LWDA 4Y0AA 5HS6A 1Y5RA 4QDXA 2RKBA 3IB6A 3FOBA 2NSHA 3K2IA 5ELXA 1U4SA 1VIMA 1W8DA 2I7VA 3N3AC 4YJGB 3H2ZA 4OFWA 1QRSA 2QUJA 3O47A 3SXJA 1COWD 1MCZA 4UEQA 1U0TA 2NO9A 3AERB 2LWIA 2OUIA 5COAA 3RIEA 1MRNA 4TMTA 3ZU5A 1TM2A 4ZIRA 5EKXA 3WK6A 3ZD6A 1G8MA 4AQDA 2JKZA 3VNAA 4Z9FA 2WV7A 2APJA 1JLKA 2O8CA 1TLFA 2IYNA 1GQYA 1OZHA 1GD1O 3BHMA 1SOVA 4JOSA 5DN6A 4A10A 1S02A 1NMYA 5FJIA 1VPEA 5KU7A 1J0BA 4YRZA 3X1JA 1WG8A 1XWFA 3I42A 3FIUA 3OBIA 5BV1A 2ZU6A 1I8TA 2R9VA 4DIBA 5J40A 6GPBA 3MHPA 1WUJS 4XR4A 2DCUA 1Z5PA 4S1TA 2I33A 3H3FA 3H0EA 4CF5A 4FJ1A 1ODIA 4EEKA 2PS0A 5D3QA 3VJRA 3MT8A 2CE7A 2FKAA 1YZHA 4RCZA 4M1EA 1PRYA 4EUEA 2Y71A 1U1IA 4OGKA 2WIGA 4FDMA 3FYUC 5J9FA 4A27A 4B6GA 3WRVA 4IJMA 4D3SA 4KR7A 5EZ5A 3ZWYA 1Y8RB 2FN7A 9ATCA 4BFVA 4OJTA 2OT3B 3GI1A 3GT3A 1EFKA 1QFXA 3K05A 4UD2A 4FI3F 3RR2A 3K5IA 5ECYA 4LI3X 4JYMA 3ZCPA 4W5RA 4K87A 4LZJA 1VSVA 1H1LB 4FDLA 1D9XA 1LPBB 1JP7A 1M67A 5FOQA 1KORA 5G4KB 1SKBA 2WZCA 1E6CA 1WZ2A 2WHRA 3GQBB 4AROA 1AT1A 3MELA 4ND8A 3N05A 3R09A 4WNCA 2VHEA 5EMLA 4B71A 4GDMA 2DBQA 1GG5A 1Z36A 3NHWA 4BLOA 3FKQA 3HCNA 5JSQA 1LW6E 2QU8A 3T7SA 3DULA 2DQZA 8GPBA 2Q0HA 1KWGA 3RRBA 4O4IA 4HCJA 1N8NA 4IDNA 4YTEA 1KKMA 4BKRA 1JAXA 1TAHA 5FXMA 2LBPA 4O3MA 5EIOA 3NNDA 2AFHE 1S5PA 3BGWA 3R40A 5K4GA 4Y30A 2HEIA 2YVAA 2WVJA 4BNJA 2GF0A 3T3OA 4HWRA 3FTEA 5EHIA 2QVLA 3DCNA 5MF6A 1O9HA 4ZI3A 1TJ3A 2PU5A 3LK7A 3FWKA 5JAMA 2BV3A 2F8MA 1CS4C 1WBJB 1XG5A 3SJCA 2NX2A 3DPUA 3QVKA 3KE9A 1XTTA 4PSVA 4WNAB 2R8XA 1NXPA 3LFUA 1E1KA 3K15A 3KWJA 3PHHA 1BA2A 1QDLB 1F3OA 1OYWA 1W4LA 3MB5A 1RNLA 2HRBA 3CGWA 2PJZA 3BK1A 4DG5A 4AUKA 5IJ9B 3BFPA 3QUBA 4DCVA 5TMPA 1A9QA 5ULLA 4DAOA 1ZH6A 3WIBA 1RXWA 5IT0A 4FLMA 3MB8A 3BFJA 2ONKA 1E2FA 1GU0A 1QTRA 2GHIA 4D3FA 1NZDA 2V03A 1X7XB 4J0DA 4QE3A 4US1R 4AY6A 3NI2A 4QC2A 2FKNA 4NOJA 5IYZB 2BBOA 3ND8A 1XNHA 3P71T 3V00A 3CURA 2Y0EA 4HHEA 1P7VA 3LDFA 1PP4A 4FQ8A 2HF9A 4YGXB 5G0TA 1K92A 3HU3A 3ENWA 4R68A 3ZH9B 2JARA 1N6OA 2OFWA 4XYEA 4RW0A 4G0ZA 1NBIA 2DUJA 2P78A 4TROA 1LQTA 1QKKA 1W5SA 3QMPA 1TYCA 3V4ZA 3OZUA 1H0SA 3FOAA 4WCFA 4IXMA 4FONA 1YFKA 5KMGB 4FHZA 3FPBA 3DDZX 1TX4B 1F6BA 5JNSA 3C1OA 2X5OA 3GL9A 4RK1A 3AG5A 3HM9A 2C84A 4ILEA 3CSSA 4R69A 2CNDA 2V3VA 1FX0B 1XDSA 3IVCA 5CCDA 3WK8A 2FWPA 4KYUA 2HTEA 4R2IA 3MJHA 3N0RA 1KZGB 2XMCA 1CJMA 4BOYA 4OIMA 2IP2A 5AVSA 1FVOA 4EARA 2YMPA 3NV7A 2I3ZA 5TVKA 1TT5A 1K75A 1C81A 2ZATA 4DSUA 3IXMA 1YI8A 2QU7A 3B8HA 3PNQA 4QBIA 1KP3A 4FK8A 1Q50A 1WZIA 4Z3OA 2NU8B 2HOQA 3OE7D 5GQSA 4IIXA 3O0DA 1TF5A 4X97A 1N1DA 2PS1A 1D1SA 1IOWA 1MOPA 1DKRA 5D7NA 3OOSA 3D3QA 3MTAA 2VRCA 4BVHA 2PR2A 3GZNB 4ASUA 4D98A 4CIDA 1YUMA 1L4HA 3GVIA 4MRAA 5LXTA 1OFUX 4OQDA 2FLVA 2CXPA 5MGNA 2FMXA 1UBFA 3DFKA 3ML1A 4U9HS 1T9GS 2PUEA 1N2SA 2LDXA 3I8XA 5HKBA 1QONA 1BU8A 3BQMB 2ZUVA 4MKHA 1EBBA 1P1KA 1ZRMA 2WYUA 4A16A 4CLRB 4LHSA 4QYWA 1L9XA 1XLWA 3U3XA 2VP5A 3HCAA 4AQ7A 1E5XA 4FDTA 3TPCA 2ZRNA 2C3MA 3GGCA 3QJ5A 4LOKA 4KQJA 1UKVY 4C03A 3VPXA 3CSUA 3L1VA 1QZTA 3QVWA 4KPEC 4D46A 4PX2A 2Z8ZA 4KWEA 3CF2A 5AKYA 3RYHB 4DMMA 3R8CA 3PDIB 3JQ8B 1Q7CA 4CKXA 2VVTA 5AOAA 1G21E 3HYLA 4EL5A 2RGRA 1EQUA 2KMLA 2NWQA 4QOGA 2A0YA 1CERA 1GZVA 1OFGA 2AVNA 3RS8A 1QQBA 2QENA 5HILA 4Y2SA 2BL4A 3CINA 4NLLA 3U44A 4EJSC 2PX4A 2XT6A 3A4NA 3PJEA 1PK8A 4GPBA 5EMJA 3ZU2A 3JD3A 3D7KA 3ENVA 3ZYCA 3NHAA 3OE1A 1Y8ZA 3LXRA 5FYDA 1Z08A 1Y7PA 1NUUA 3RBAA 4BBPA 4BUCA 4B81A 1DRUA 2DWOA 3K9HA 3O3OB 3PXGA 4R1PA 3R77A 4ANFA 2QUHA 5DBOA 3DWFA 2CMGA 4C0QC 5BPFA 1XRRA 3GLFA 5FL7D 4LQCA 1ZJWA 3C3XA 5DYIA 4OU5A 4H6WA 4OXNA 4A6EA 2W0MA 4ENQA 1HEYA 4MQEA 2P2NA 2CMDA 4IDOA 1V26A 4BTEA 4L5JA 4K8RB 1HI9A 2Q7XA 3LOUA 3E8SA 4RBNA 1DIGA 4QQKA 3MW8A 2WWVD 4V0QA 4FCWA 1I0LA 4O4HA 2CCJA 5E8JA 2RD2A 4ALLA 1FXWA 2A88A 4OGLA 4TL9A 2PKWA 4JLMA 4O2LA 4REMA 1PZNA 3M4XA 1YQWA 1JRLA 1Y0BA 3O9VA 1R12A 5HKOA 3TDKA 5TNXA 5AVKA 3N2IA 4K9DA 1FP2A 3Q40A 1XCOA 4BFYA 3DL7A 3Q9UA 3OPVA 1E1DA 1FP4B 1LWOA 2Q3FA 2CZGA 2EWVA 1J39A 2VHVA 2PUFA 1WUTA 2QLMA 3R3YA 4OLHA 4PNPA 5JNLA 1W6RA 3LUCA 5T4FA 4GKVA 3IVMA 2Q2NA 4IV8A 3UHPA 5EP1A 3GXOA 1NLFA 1RYFA 1L7XA 4WDRA 1XEWX 5CH3A 4YUAA 1EI9A 3SHOA 1OLXA 2JDIA 2Z09A 4YH1A 3JS5A 1RI5A 3LKBA 1DJLA 1LSSA 4Y98A 3TVYA 1V9CA 1UXJA 3S1LA 3TECE 2YCBA 4HXEB 2XUAA 1DAFA 3GD7A 4FZJA 5HRAA 4J4TA 3DFMA 3A3YA 4XOUA 1NWHA 3G79A 4L75A 3RLIA 4EBBA 2F9MA 1IQUA 3RAFC 3DT6A 4BO5A 4YO7A 4B43A 2UZIR 2V45A 1X15A 1PS0A 4TLBA 2AR9A 4NX2A 1WJGA 3N8IA 2Y93A 2ZULA 2PYZA 1M75A 4MEJA 2HIMA 2ZT5A 2ZJ2A 3SEZA 5IPFA 1H8EA 5JI2E 2M32A 2IT1A 1EFUA 1J21A 2BUAA 2CJXA 3AKYA 4RV9A 5JAPA 1ZBQA 5DHQA 5FF9A 2C8VA 2VEDA 2WM9B 3KELA 3MINB 3D6UA 3DKPA 3DEYX 5AO9A 3LUGA 4RMNA 2OGZA 3OOHA 2HPZA 2C5FA 1LVGA 1WETA 1BVYF 3B6EA 5C5CA 3M2TA 2XJ4A 4RPJA 3AUSA 4WLNA 2R7KA 3LBIA 2WFZA 1OFHA 3CU5A 4WINA 2FEWB 9LDBA 4GLLA 1TCAA 4PAMA 4IL5A 1SKYE 4B9EA 4G24A 1I3CA 2FRVA 4GX2A 2W00A 1C0PA 4Q24A 2GARA 4N6OA 3IOBA 4DV4B 5EIBD 1YR7A 4ESVA 3VKFA 2R68A 2BGWA 4DJAA 1NXSA 4DUYB 5DCUA 1J8VA 1WZEA 5LWHA 4MB0A 1TF2A 2OORC 2HSWA 2EATA 3I2GA 3BCRA 2KHZA 1EFLA 3S2GA 3AEUA 2ACKA 2HDHA 1SXIA 2QI9F 1ZNWA 4BKPA 3CFYA 4UCWA 3KYJB 2VQ6A 4OYYA 1PV4A 1SWVA 3M4NA 5DXFA 3PNVA 3PUWA 4Z7NB 5C3UA 3TLBA 1L5ZA 1ZITA 1G63A 1MTOA 4RXUA 3VSEA 4PPNA 1QC5A 1E98A 1TVMA 2VZEA 4G8CA 4TXMA 1U9CA 1M3SA 2IOFA 5T8KA 2OA0A 3STVA 3NHMA 1GJRA 4ONEA 3OWOA 3E5HA 4AI6A 1IWOA 1GARA 1UBHS 3KDAA 3I62A 1BQEA 2O8FB 1V3VA 2NAPA 5SZHB 2VXYA 2G72A 1E3LA 2G07A 1U8YA 2FN3A 1OZGA 3A06A 3CCFA 4TV9F 4DLWA 4F96A 4BP1A 1QPZA 2Z98A 2Q46A 3B1XA 3KAJA 1JL3A 4N54A 1P4RA 4UAGA 2QVXX 4Z7QB 3GRRA 4M0CA 4UM7A 3JQEA 5JH7B 2HV8A 4IYRA 1JNXX 3F2IA 4WXYB 1Z83A 2PXCA 1HLGA 3PEYA 3WL5A 5EINA 1DT5A 2A86A 1NBEA 1YJBA 1J42A 2UZ4A 2HHLA 1TQ2A 3P0IA 1OUMA 1RXIA 2J67A 4Y67A 4INPA 4LIPD 2OBMA 2Y1EA 1BEZA 1E20A 2J0UA 2WPNA 2VPIA 3DE5X 5B1SA 3MTEA 1XYGA 1E6UA 1T6NA 2R4UA 3AHHA 4KXUA 4HLUA 4L9WA 2DQYA 3R4CA 4OGWA 1HKHA 3FTNA 2GZSA 2BGUA 2WWRA 3RVDA 1TUBB 3G6WA 521PA 5WRFA 2KI5A 4JUIA 4AUNA 1FRZA 4J0CA 1XMOB 3COYA 4YMIA 1IOLA 3N5CA 3TL2A 3LLVA 3NHJA 1KEKA 3BA1A 3NUZA 4A03A 1IXYA 3R5HA 1R6XA 2WWYA 1EG2A 2V5VA 1NW4A 3SBOA 3QSGA 1LBIA 4HQKA 1NRJB 3ZLBA 3N8GA 4BNFA 1QH0A 4R54A 3LHSA 4DEVA 1RI4A 1GEGA 3IQHX 3A2KA 3IV9A 4F6RB 1PJQA 1Z4PX 5A5VA 2J3JA 3F6RA 3P19A 1MJ5A 3KZMA 4JLUA 5GINE 2C29D 3H11B 4GNRA 4HXYA 2IBTA 1CLUA 1SOWA 1QLJA 1EP9A 3G5MA 3EOZA 4URVR 1VLQA 4BWVA 3BWDD 2UVDA 3H8SA 4OB7A 5KKNB 4DG9A 1G8HA 3GFQA 2BMFA 2OQVA 1CUIA 1RAGA 2W2LD 1CP3A 1I6LA 1M2EA 2YZ2A 3CQ9A 5IN5A 1VE1A 3A04A 5ALNA 3BSSA 4CODB 3QXCA 5KWVA 4RORA 4TGLA 1W2GA 4Y2RA 4C20A 2B6NA 2XMPA 5FADA 3QITA 1EWYA 3CNOA 4UUNA 2J87A 4C7JA 2FR8A 1N2HA 1S89A 4LXXA 4I9UA 2D62A 1SXJD 4XPIA 4YMHA 1N2XA 4UEJA 1P6UA 1HLFA 2AN1A 2PMBA 3DNFA 4KBFA 5EFOA 4C6HA 4E5MA 2HJHA 1SO8A 3O8NA 4W6QA 2VJDA 5DM1A 3QXGA 4BO7A 1Q15A 3V1KA 3M49A 5IEBA 4YYZA 5J4YA 4IEEA 3VMFA 4ZA2A 2SCUA 4RD3A 5J2TB 3A6HA 3WZMA 4LX0A 1U0SY 1F9AA 3ELWA 4X20A 5AVXA 1FFGA 4BASA 3N2LA 3JAWB 1BTOA 1RE0A 3A6FA 4JSRA 2D1RA 1BRMA 5EJ5A 1LF0A 2HN9A 4FMBB 3RVSA 3CF4G 2IXTA 4RTQA 4F3CA 1TUGA 3LQRA 4QDJA 3LDUA 3QYFA 2FW9A 3DVLA 1WW3A 4B47A 1DCMA 1LI7A 1XRLA 3KZNA 4I2VA 1P5HA 1FMFA 4GR4A 4KQGA 3B1JA 4Q7MB 2OHIA 2RARA 1WXGA 2HA0A 3SS8A 5JYCA 2A0FA 5AHOA 1SCUA 4QQFA 4ARBA 3EWAA 1G20A 1RR6A 2D5IA 2QGZA 3DB1A 1TYDE 3ZY4A 3C3MA 4Y9RA 5FA8A 1DEXA 3KS9A 2J3DA 3REOA 2P9FA 2BGMA 3V2UA 4DMKA 2F1HA 4HJXA 3IP1A 1QNFA 3SICE 3CN9A 3T7AA 2C7PA 2W11A 4NFSA 4EBFA 2LNDA 2UVPA 3ZVKA 1JLSA 2PPLA 1II0A 5TT1A 2QTCA 4DM7A 4LDJA 1U1CA 1UK6A 1UFRA 4O4LB 3FYCA 4QBGB 2AOVA 2QL5A 4MQMA 2DRIA 1E4OA 3BFKA 1XIVA 4BO8A 1P29A 4O2BA 2NTVA 1RLOA 5A4FS 4PSAA 1N7IA 2XODA 1KPIA 2O05A 1FSPA 3PTAA 1OGIA 4PLVA 2JBHA 2H51A 2Q1YA 3SM9A 4TYWA 2AQ8A 1L7EA 1SXGA 1E9FA 1GKUB 3GAMA 3KR1A 4K86A 4S0XA 3S28A 3AEQB 3X2FA 3CHYA 3WV5A 2DLCX 2W6QA 3PGVA 1Z35A 4Q48A 3EGEA 4FCTA 4ZKEA 5AW6A 2X40A 1MOZA 1V41E 4XM1A 4BQNA 3K9BA 1CLEA 1JTEA 1NBME 2INGX 5FUWA 4FEGA 4EKNB 1JEJA 1OI4A 3OD5A 1MRZA 3LUJA 2O2SA 4WLEA 3HB9A 1USKA 4GP7A 4K2AA 3CZQA 3PKZA 3LIIA 4CIAA 2LKCA 5DCWA 4QBHA 3RABA 3GUVA 2QP9X 3FLEA 3V9AA 5JS7A 2BSAA 2D5CA 1RWMA 1GOTA 1NQOA 2I6UA 2K7ZA 3PYMA 4D4IA 1T15A 3H1GA 4YJ3B 3VFDA 3RFTA 4XQGA 3AFMA 1GQ2A 3AIIA 4B80A 5FWXA 5BMOA 3U6BA 2FG6C 3GQVA 3OPYA 3OO1A 1L5VA 2XCOA 4U1RA 4YRQA 1LEHA 1FTNA 5CIWA 3X3HA 1EVQA 4DIDA 2Q1UA 1H0RA 2XMZA 1REQB 4TRJA 4O1MA 3Q2IA 4DGQA 2GWRA 5LZ8A 5JXWA 1VHTA 1X19A 3DNMA 3PF9A 4DSTA 1X7HA 4IQGA 4QYIB 3N0TA 1PNOA 1T10A 2ZXFA 3OETA 3RYIB 3WIVA 1DX9A 4ZHQA 1PNRA 2J3EA 1M2NA 3KEFA 1DOZA 4GMGA 1WEKA 4F38A 5K8JB 4A36A 1YQTA 5BV8A 1LV8A 2A7QA 1DEKA 2EFJA 2GSWA 4H7DA 4S05A 1AA9A 1S8OA 4LVUA 3D3EA 2DHDA 5EJIA 4KK4A 3M5CA 4FZRA 2BEJA 4IG9A 2SNIE 4FFOA 3S8EA 1Q11A 3W2FA 1RKVA 3IFSA 1XVIA 3JATB 5CK5A 3GLIB 3DMYA 2OAQ1 1MPTA 2M1ZA 2RC5A 1BCRB 2AXNA 4UCQA 3K0AA 3NH6A 5LIPA 3L0OA 2W5UA 3D6VA 4ZOAA 4I19A 3WLHA 4B3GA 2BHNA 4YCMA 1FFWA 1QE0A 3MXTA 1RM3A 2B94A 1SB8A 1SHLA 1YB2A 4KN6A 1ABFA 4PLYA 4YLGA 3L79A 2FUKA 2P6NA 3RIXA 3G7SA 2D0IA 4O4IF 1E4EB 5EZYA 5AM2A 2D1YA 5AHWA 4EG1A 4OFXA 5ALZA 2XGSA 2AG1A 2YWGA 4HAWA 5KVCA 3FDIA 2HQOA 2IW3A 1GUFA 4I3HA 3E7XA 2OQ2A 2VSFA 3PXEA 4HNTA 2WQ7A 5B1YA 1QTQA 1W94A 3THXA 3LVBA 3W5UA 2ACWA 4EH1A 1XR3A 4U2CA 3GUZA 3C3PA 3LTEA 3MGKA 3F5SA 2ZOSA 4C4AA 5GZ1A 1C7FA 1JBEA 2J3KA 3CGGA 4FFVA 1RXSA 3F96A 2AFRA 3MMNA 2B6HA 4QEZA 1J2EA 3M89A 3OCYA 2KQUA 5EQJB 3UUWA 4BLTA 2FOIA 1JFVA 1LC3A 3D6TB 4H2DA 4L8WB 4JEUA 4C7KA 3D4IA 4M0MA 4PHGA 4UXIA 4ZTUB 1SG6A 3BMOB 4XQCA 1QK5A 1L5QA 2C3OA 2ZIZA 5LCXA 2JIZA 1RRGA 3KLBA 3LW7A 2ZSEA 4GMHA 3EWNA 3UCEA 4FHFA 1QG2A 2XSZA 4PCLA 2OG2A 4KYTA 1K3TA 1XQ1A 2YX1A 3PRHA 5EEGA 4L4UA 1ORIA 3BWVA 5I8PA 3DUFA 2GM9A 3DBVO 2WT4A 4K1XA 3JVIA 4PG7A 2BRUC 4PR0A 1ORTA 3CVWA 2PBZA 1O0CA 2C2OA 2JVJA 4IH9A 2V8OA 4EIWA 1B8VA 5FNZA 2G9UA 3RC2A 1PHRA 5ESXA 3GFOA 1CD5A 1QP7A 4H31A 3C74A 2FR1A 5DSZA 2BHRA 4IDBA 1TMKA 1X1RA 3GV0A 2JK1A 3DMHA 4FT2A 1G1MA 2MOKA 2Y1GA 2YS7A 4GECA 2UVQA 3TNYA 3TOZA 1Q84A 5AUOB 3LT0A 5L3RA 1P45A 3ZGLA 3NQ41 5GJWC 3EEBA 4DANA 3MLBA 2VBCA 2E5LB 1NXTA 4NVRA 3I6BA 2IQIA 3GYBA 4MEBA 3ICQB 2G9QA 2JLRA 4FGLA 1R6TA 2PSDA 4GM4A 2WAOA 3A9VA 1KFKB 1CY4A 2AEMA 4LVOA 1F0NA 1AURA 1ISMA 4MKXA 5DIFA 1QO0A 2C59A 2VXBA 1HMYA 3PE6A 4RY2A 1Y98A 1KZ7B 4AMYA 5C1PA 1KDTA 2OFXA 4B9AA 3KHKA 3CH5A 5IAJA 4CEJB 1L7NA 3GROA 3ORQA 2JGMA 2ODAA 1MB4A 3D6NB 5BN5A 5A7GA 1UJMA 2C8KA 2BFDA 4GU5A 4IFIA 3CA8A 4NCKA 1ABBA 4EY8A 4QG3A 4RQTA 3AFIA 2RGXA 4Q9AA 4A6DA 1FXUA 3JAMA 4JJIA 1PT6A 3EY4A 3TOCA 3WL6A 3OECA 4Y2PA 3VMMA 3NC4A 4G67A 1RIFA 2PSJA 3SR3A 1Y5IA 4KNYA 3RTCA 4RESA 3KAKA 3C3CA 1Z73A 5FBRB 1HQCA 1YL6A 2QMHA 3VOAA 4DZRA 2W70A 3HY4A 4CCYA 1UJCA 3NWPA 3JQ9A 3K0EA 2FTKE 5JO9A 3NG1A 3VR2D 3G5AA 1EWRA 4HKTA 3W34A 4FYJA 4CGYA 2A4MA 4NQRA 2GPAA 1WTAA 3S99A 3DMNA 4Q00A 2HJ9A 4JXJA 2R0QC 4US2R 1OA0A 2C5LA 1AKNA 1P72A 2WJAA 4RNCA 3TK1A 5F7OA 5IZ4A 4WZBE 3B20A 2FDRA 3S44A 2FNAA 3ZKWA 5F1PA 1YUBA 1ZGGA 2JD1A 1PGJA 4XB6B 2HYIC 4QYXA 2AKYA 5BQ5A 1KC3A 1CETA 1GPDG 3A6KA 3QHPA 1OI2A 4N0DA 3SY8A 1E3SA 4EI9A 5CBPB 2QGFA 2CHGA 3HGTA 2XV1A 3EGVA 5JMOA 4K6GA 3WGNA 4IF6A 3BD9A 1ECPA 4A92A 1P3Y1 3NALA 1R0SA 1OFUA 3P96A 3P9CA 1KBQA 3R1IA 4RENA 3UJ7A 2EP8A 2R6DA 3C6ZA 4RMIA 3VHLB 2QMOA 3RSQA 3RI3A 3OZ7A 1XX6A 1NJ2A 4X9XA 4YV1A 2PGIA 1MNAA 3FB4A 3CO0S 3M3HA 3Q5EA 4MQFA 3UJ9A 4URWR 3N59A 2GEFA 4L02A 3A25A 5LP6A 4M36A 1EA7A 2LKDA 3C6BA 5LQKA 2WU3A 2HQ1A 1QH8B 2WP0A 1KRHA 1ZZGA 4TSKA 4RZIA 1EFRA 2FJUA 4DLKA 1ST2A 2A5DA 4O4HF 4QGBA 4CMCA 2F7SA 1QANA 4R3UC 1EHCA 2YHSA 4P53A 4TL7A 2WJYA 1D3AA 2JJ2D 4MLZA 1Z6AA 4OU4A 1ZP6A 4AJ9A 1GGNA 1AA6A 5HNKA 1PWYE 1UADA 3ESZA 3KBBA 4G5XA 4Q1FA 4ERNA 3ILXA 3FDFA 3IX7A 4GVPA 1PLLA 4E2YA 4OHVA 2Q1TA 4YI3A 4ZAXA 2QG4A 3SX4A 4I1SA 5EJEA 4EZIA 1O97D 1A7KA 1T25A 1TIKA 1RJDA 4YMGA 2BGRA 5DGDA 1QAQA 1IJFA 5JE8A 5JAUA 3OQJA 1RKBA 3D5EA 1UZLA 4UBOA 1Q0RA 4C6TB 4WFKA 3CLHA 1D07A 3NHRA 1LD3A 4RK0A 5FOXA 3KKZA 5TARA 1Z4QA 2NVUA 4UMDA 3T1NA 2C0CA 2VKTA 1MO4A 4JGGA 4Y9UA 2UV8A 1UBMS 2W2QA 4M46A 2AE2A 2B25A 1RC0A 2DU8A 2XOKA 2Z56A 3A1SA 4QEKA 2BGTA 3A0RB 1ICIA 3QFCA 4JDUA 1H6BA 2NZ8A 3SLRA 3BMQA 3ZLJA 5BW4A 3ZI7A 5TDHA 4M9QA 4MUMA 2OCGA 4G2TA 4HJRA 3PT9A 2ACVA 2P3SA 4KRGA 2VUHB 5CVTA 5KQRA 1QF6A 4YRLA 4PPFA 2HK7A 3O74A 4PTYA 3ME5A 2XRFA 1NUAA 4BO4A 1RPNA 2AUNA 3GJSA 5EP4A 1DXQA 3HDQA 1S9DA 1GAWA 5KYUA 1FK8A 3ZG6A 1N8SA 1FQWA 1COZA 3AU9A 2H9IA 3F73A 1X1DA 4IILA 5AH0A 3KTOA 3ZNNA 1YB1A 5CXSA 2A9VA 3G0BA 4B7ZA 4KW7A 2HIHA 3ESDA 5AW2A 3JQGB 2E4XA 4UUBA 1DTWA 1YHYA 4AN1A 1Z0SA 3GLHE 1RYDA 2YHBA 2C2HA 1JZTA 3IT0A 3OEYA 5J2UA 2F00A 1E2IA 4U2DA 1UPBA 2O2CA 2DLNA 3O2QB 4QNNA 2JJMA 2NZXA 2WWHA 1ZIYA 4IZOA 4UUAA 2QTMA 4K05A 5J3JA 3AR2A 2R8PA 2WHYA 1GRNA 3EARA 1XVUA 4UQPA 5BUQA 2A5GA 2CHFA 1QTNA 3T7DA 4UM9D 1E9SA 1DWQA 2MSCB 2EU8A 2OUKA 2QJWA 3BK7A 3CXRA 5DHSA 2A67A 2DR2A 1XTBA 4AO6A 3A37A 1HM5A 2GK4A 2Z0MA 5TQVA 4E3WA 4X7MA 5JAZA 4UDOA 1ST3A 3FOCA 4Q7KA 1N0HA 4DR1B 3UWDA 3PB3A 4YRAA 1NW5A 1UL1X 2W37A 4QU9A 3KYDA 3FPGA 4DXHA 1MX9A 2CJFA 4UZEA 5EWMB 3QEJA 3QJGA 4JBHA 3INGA 2JZCA 3HZZA 1WCV1 2RBGA 3R3HA 1UPAA 5HCUA 3T0GA 1WVGA 1JXQA 1S2IA 2V7TA 1PR0A 1JAIA 4NJEB 4Z9BA 2OZPA 1GPKA 1WF6A 3QLVC 4GEGA 1CR6A 2ZANA 4DMGA 2JI9A 1CYDA 1TVEA 2X15A 3THWA 1UDRA 4BATA 4EJFA 5JCPA 2MSKA 3OICA 4MHSA 1HC7A 2ZZMA 5KDLA 4ARIA 2ZSDA 4OX9B 1UXHA 3WGGA 3B60A 1M6EX 3P94A 1TEHA 2J59A 1TJYA 1PYGA 2CVPA 2OP1A 4JD5A 2WK1A 3D64A 3FUUA 7REQA 2A1UA 5EQTA 3ULKA 4DIOA 5JBQA 2B4TO 4GZ6A 1J25A 1AF4A 1K8QA 3G5UA 4G81A 5B3JC 3D0QA 1X7ZA 3FOFC 3G3EA 1DQRA 1LTKA 3RG2A 1Y1QA 2I4OA 2VAWA 4UAVA 2AMFA 4UARA 4WLOA 1KJ9A 3UWSA 1NVEA 1N2CE 1U28C 1Z62A 4TV8B 4YT5A 4ALNA 1L1QA 4UDNA 4PYQA 1T8TA 2YWBA 5IK2D 3E9YA 1OJLA 4YV7A 1SUAA 2LIPA 2I4TA 5DASA 5LA6F 3SC4A 4A0GA 3JARA 2IKQA 5FEUA 1TL7C 3MQ4A 1Q3TA 2WSYB 4L9AA 3TI7A 3UW3A 3TZQA 4BAZA 1P8JA 3NAQA 2BKAA 1P5FA 2CCKA 2JCBA 2VJQA 4LJ6A 4MWSA 2FP3A 5JQGA 2VTBB 2COKA 1KNQA 1YZFA 1V8OA 3PL1A 4M22A 1L8XA 1ZISA 1MIOB 5F1KA 3AGPA 3T12A 4HUTA 2PQ6A 4DZTA 1RPJA 1JKFA 2CKMA 4TYPA 3UWOA 3UUEA 4F04A 1X1CA 5U1PA 1SCBA 4YCLA 4J91A 1DXOA 1XDWA 2V7QD 3IUPA 3G89A 4QAJA 5ITVA 4CEIB 4P92A 5F78A 1BMTA 2GK3A 4W8HA 4YXWD 5IF3A 3WIEA 5M04A 3UJ3X 4GOND 3K5PA 3RARA 3A9WA 1H8HD 5FEMA 1DKUA 1J2JA 2OKCA 2H52A 2CK3A 3C3AA 3HCRA 1L5YA 3HVJA 4ESHA 1QVZA 4QUGA 3GRUA 1U94A 4KLCA 1SUFA 4UU0A 3NGLA 1IG3A 1QORA 4URZR 4B73A 1QIKA 2G4CA 4P7FA 4C07A 3N7AA 4ZZIA 4BZPA 1L7VC 1I4DD 3UK7A 4XR9A 2RHMA 2AIRA 3UJDA 1JLLB 3M4ZA 4CUKA 1ZR4A 1CUUA 1NQW