1RXCA

E. coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
246
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 85
structure length 246
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxcA00
3BL6A 4YNBA 4EARA 5ETJA 3FUCA 4QAQA 3FNQA 3TL6A 4NS1A 3T94A 3OOHA 3FWPA 1YRYE 3PHBE 4WKPA 1V41E 3EUEA 2BSXA 3PNPA 4F2WA 4DAOA 3BJEA 4OEHA 4QASA 1OTYA 2AC7A 5KB3A 3ENZA 4TTJA 2ISCA 3F8WA 5F78A 1ULAA 5B7QA 2AI2A 1N3IA 4EB8A 3LA8A 3O6VA 4NY1A 4BMYA 4DA7A 1VFNA 4JWTA 5F7OA 2GUWA 1B8NA 3FOWA 1JPVA 1QE5A 3LBAA 3EEIA 1K3FA 3FB1A 1PR6A 4I2VA 1LX7A 5CCEA 4L5CA 1B8OA 5I3CA 3BSFA 1TD1A 1Z36A 4E1VA 1A9SA 4LNHA 4DARA 4DA8A 1M73E 2IQ5A 4K6OA 3FAZA 4DA0A 1Y6QA 2HSWA 1OTXA 1OV6A 1RXSA 3NM5A 2A0XA 1RSZA 2QSUA 4L5YA 4DABA 1PR2A 1YQUA 5F7ZA 1Z39A 2ON6A 1RCTE 1I80A 3NBQA 2I8AA 1ODJA 1VHJA 2RJ3A 4F3KA 1ECPA 3DJFA 1TGVA 4R31A 4TXJA 5EUBA 1TGYA 3O4VA 3SCZA 2A0YA 1JDUA 4TS9A 1U1CA 3UAVA 5FAKA 1ODKA 4WKBA 4LNAA 1T8SA 2OXFA 4M1EA 3QPBA 4YJKA 1Q1GA 1OVGA 1CG6A 2B94A 4OJTA 4F2PA 4WKOA 3OZBA 4D9HA 4D98A 5CCDA 3UAWA 3OOEA 2P4SA 1Y1QA 4QARA 1PK9A 4LZWA 4D8XA 1U1GA 3IEXA 1JP7A 2Q7OE 4MCIA 2I4TA 4WKNA 5B7NA 4TS3A 1T8YA 3KVVA 1SD1A 1U1EA 4L0MA 1XE3A 4GMHA 5CYGA 3KUKA 1PK7A 1PKEA 1K27A 4LDNA 1NW4A 2PGAA 2OC9A 4GLJA 2H8GA 1PR0A 3DDOA 3P0FA 1JDVA 2QTTA 3GGSA 4GLFA 4P54A 4F3CA 3K8QA 1ODIA 1ZOSA 4TXHA 1RXYA 4TTAA 5B7PA 2XRFA 1JYSA 4M3NA 3KVRA 3D1VA 3PHCA 4G89A 3IOMA 5CXSA 1A69A 4U2KA 1OU4A 1WTAA 1Z5OA 1G2OA 4DA6A 4QEZA 4BMZA 1LV8A 5F7XA 1Z5PA 2HWUA 1Y1SA 1A9OA 1JDTA 4L5AA 5F77A 3NM4A 5B7GA 1Y1TA 4L6IA 4BN0A 1RYZA 1TCUA 2QDKA 3ODGA 1T0UA 3PNSA 3UT6A 4YO8A 1RXUA 4X24A 4YMLA 3UAYA 4IP0A 1PF7E 1V48A 1YR3A 5CXQA 4G41A 1C3XA 4WKCA 1JDSA 3OCCA 4LKRA 1JDZA 4PR3A 1ULBA 5EFOA 1OUMA 1RFGE 3C74A 3LGSA 1TCVA 4KN5A 5IFKA 3E0QA 1A9TA 3KVYA 4DANA 1YBFA 4D8YA 1ZL2A 4M7WA 1JE0A 3P0EA 3GB9A 1Z34A 4FFSA 5EPUA 1A9QA 2HN9A 4TTIA 3K8OE 1V4NA 3DF9A 2OECA 4JP5A 1U1DA 2AI3A 4OY3A 3E9RA 3OZCA 1RR6A 3U40A 1YQQA 3OPVA 3UAZA 5F7JA 3OZEA 3ONVA 4R2XA 4TXNA 4BMXA 1V2HE 5CYFA 1U1FA 1Z5NA 2A0WA 4UC0A 2QPLA 3DPSA 4R2WA 1A9RA 4TXMA 4OF4A 1Z35A 2A8YA 5C80A 1PBNA 1ODLA 1VMKA 4PNPA 1SQ6A 1Z37A 3KU4A 3UAXA 2QTGA 4OGKA 1PR4A 4MARA 4NSNA 5IU6A 4JOSA 1Z33A 1Z38A 4H1TA 4G8JA 1PR5A 1Y1RA 4TXLA 1LVUA 1A9PA 5DK6A 1RXCA 4TYMA 2OC4A 1CB0A 1NC3A 5F73A 3DP9A 4GKAA 1RT9A 1JE1A 1PWYE 3EMVA 1SD2A 4QFBA 2HRDA 3MMSA 3OF3A 1PW7A 3NM6B 1FXUA 5JPCA 2AI1A 4OGLA 1SJ9A 1V45E 1T8WA 1PR1A 4RJ2A 5F76A 3KHSA 1V3QE 1VHWA 4F1WA 4ECEA 4D8VA 1T8RA 3EUFA 5K1ZA 3BGSA 4MCHA 4QATA 1K9SA 1Y6RA 1NC1A 4DAEA 3E9ZA 3INYA 3OZDA 3MB8A
chains in the Genus database with same CATH superfamily
3OEHA 3N2KB 1XZLA 2GN4A 4OB6A 3O3OB 4XPIB 3EZ2A 3HBJA 2OFWA 4BO8A 4ND5A 1L7DA 2BVNA 2YN2A 1T6ZA 2ZDQA 1HTTA 3DAPA 3PGXA 3DOUA 4HDNA 2DGDA 3ITDA 2GNOA 4I1VA 5J2UB 3THXA 3DE6X 4NG4A 3B9RA 4XLTA 3BFKA 1N7HA 3QIAA 5DBGA 2BKVA 4G0XA 1E9VA 2QN2A 4E30A 5DTMA 1V41E 2OGSA 3HCAA 1NP7A 1PD0A 3ONWA 1TMGE 4G1CA 4RVNA 4WEQA 4HYYA 3ZZUA 4DL9A 4N3AA 2PX2A 4FDMA 4TWZA 3L6DA 3CR8A 1LBQA 1P4RA 1XTVA 3FTDA 5IFLA 4FGUA 4N8EA 4DILA 2LVBA 1T3GA 4IH4A 3D6AA 2ACEA 3KELA 2ISCA 5L7TA 4AZ3B 2AX3A 4ZOLB 2MCFA 3I9V6 3A6HA 4XLZA 1Z5UA 2A9RA 2C2KA 3IUPA 3WJAA 4D82A 2J9XB 3COZA 1E3QA 3BXOA 2PBZA 1ZJ4A 4OQDA 1BDHA 3EXFB 2NSHA 1BHJA 1CRWG 3NUGA 4KK4A 1EFHA 1T0PA 1ULZA 2PL9A 4ZQEA 3T5GA 1JAXA 4D3FA 4R1LA 4FFVA 3HN6A 2H6EA 2Q6TA 4N49A 3U4CA 2LP4Y 3MCWA 1DKPA 1QV6A 5DVZA 2IGTA 5U9CA 3UOGA 4U3JA 2VAVA 3MM4A 3DZDA 4JL6A 3Q10A 2QRQA 1W7AA 1D5WA 4X91A 3AVYA 1UDCA 2B8NA 1REQA 4J7CA 3P45A 1E1DA 5SYAA 1ZJWA 5KNBH 4Q03A 4Z3KA 3CLSD 2OZKA 4W7SA 4Y9RA 2GKSA 4J03A 4A36A 1U5BA 3AEQB 3G2MA 3VZSA 3S2GA 1K3TA 3D8SA 4EELA 2H3HA 4RFSB 3QPCA 1KQ3A 4OSEA 5AI5A 3FNBA 3D4PA 1UFOA 1SKYE 2ROQA 3AWIA 2JLQA 3IT0A 1H69A 1JZQA 4PBSA 3ZK9A 4B76A 4IXDA 3U37A 3DE0X 2XZLA 2EWVA 1D3AA 1RWOA 1WVIA 1XF1A 4A7PA 1XRJA 4KGXA 3AIOA 2B83A 4R5HA 4JOBA 2KI5A 2V4ZA 4PPFA 4Z0HO 1X1RA 3LPLA 2R8EA 1EMDA 4CFSA 5IDQA 4RJJA 4DR2B 1MQ9A 3QBJA 1D09A 4BEJA 4PC6A 2A9KA 1LC3A 1RSZA 1AGPA 3NUZA 4CV0A 3EZXA 2W7TA 1QCZA 4OHWA 4YRQA 2F43A 2MSEB 2PSHA 3K4PA 1C30A 3DL0A 5D1HA 4Y2RA 1UFRA 3GW8A 1AHHA 2JZOA 5AKZA 3C5WP 1RRMA 4KODA 1DINA 1S01A 3SC3A 3LCCA 1U0SY 4PSKA 4C88A 3TO5A 2H3EA 2UUOA 3B7GA 3IPLA 2HW8A 4XYEA 3MQ4A 3BULA 1B1CA 2A35A 3D3WB 3LT2A 2R6FA 3PQFA 4RS4A 1UBUS 2BGNA 2EATA 2QN3A 1C1XB 4UD6A 4ER6A 1SEVA 5JS2A 2XVXA 5JNLA 3KBOA 4LE1A 3DUFA 3DMTA 1A97A 1PJTA 1Z26A 1KL7A 3C1TA 1E8DA 1MJFA 2PAFA 2WIFA 2XMSA 3L4SO 2ZXEA 3NT2A 4KMOA 5CDHA 1U80A 4MMZB 5B1HA 2WABA 5A4AA 3RPEA 4BVHA 3U1TA 1VG0B 5L7YA 3PHGA 2QPTA 3RSQA 3HLYA 1PVVA 4D3YA 5K05A 4FFPA 5DMXA 3P9QA 5JZOA 3HKDA 2XNSA 2VHEA 4RJKA 1SKMA 2A84A 1KU0A 4LBZA 3BGWA 3V1KA 4KBFA 1NT4A 2FW7A 3Q15C 1NI3A 3HSSA 2FCRA 2VHCA 2XQKA 3GH3A 3Q9NA 5DCWA 2FPSA 4X90A 2X1VA 3FX2A 3GRYA 5FP0A 2QR5A 3ACDA 1GPKA 1OVGA 1NZFA 1Y5IA 2WNSA 2J46A 2G9UA 3V4VB 3LF2A 2B94A 4Z9FA 5EEGA 5D7BA 4EJFA 4F3NA 3T0FA 4QREA 2XI4A 5FPTA 1JIKA 3VDQA 1W4RA 2YJNA 4FQ8A 5AQEA 1JDJA 1UL1X 2I9KA 3PYMA 2ZB8A 4RK6A 2EARA 3WHIA 1OGIA 1U2DA 4DC9A 4EG1A 4LF7B 5D01A 5CG1A 2WJHA 2RHCA 2M6RA 3W8FA 1UJ2A 1YFKA 1YS4A 3BFXA 3LT4A 4AY4A 4JR0A 4L76A 1E7WA 2YC2C 3QVUA 5FI3A 3G0IA 4MWZA 2PO7A 5JEDA 3HU2A 5CM2Z 3QG5A 4GMHA 3LKVA 4ZO9A 4PZPA 2O0LA 3OQIA 3AM4A 3ZJ5A 4N54A 4DV0B 5T8KC 4BUZA 2Q3MA 1CFZA 1EP2B 4XR9A 2P2LA 4X63A 2D3TA 2YWFA 4KPEC 3LUPA 3T4UA 1YFLA 3LU1A 1CDZA 5JBNA 1L7AA 3KKNA 5HF5A 1AUOA 4TMYA 2JIZD 1GFIA 2GPYA 4O0LA 1O95C 2KLHA 4B3GA 2VAPA 1N2JA 3ASUA 3KE8A 1AZTA 4R83A 3RRXA 2YYZA 4F3CA 3GFRA 1UBNA 1Q15A 1SUFA 1V16B 1IAVA 3RVRA 3MUOA 4D9BA 2X0JA 1N6HA 3KXDA 4Q37A 3EIHA 4IGEA 3HYTA 4Q01A 1T6NA 3MAJA 4F21A 3ESRA 3PZBA 2H29A 3K30A 1VDMA 1YCGA 3ABRB 4B7XA 3KK0A 5JJKA 2C5EA 2VTKA 1I36A 1FFSA 4QDJA 1OC2A 4A9AA 4C5BA 1V0JA 3L8MA 5KQSA 3Q85A 5JBQA 5JD5A 2B21A 4HLQB 4WBNA 1AS2A 3T7EA 2CHGA 1LDYA 3LH5A 5K0LA 1Y63A 4R01A 1X8KA 3TLAA 1Y8ZA 4NHOA 1TK2A 1L4YA 4EHNA 4WCDA 3KJHA 2NO9A 1TO2E 2Z1DA 1A7UA 1HTWA 1TIKA 4B48A 4BN4A 1GZUA 1R6UA 2DTXA 1OZAA 2JLAA 2WF7A 1DDOA 1TVKA 2WV9A 4ZEXA 3TG2A 4B3RB 1MIOA 1IG0A 3E27A 2FUEA 4CWAA 4DMMA 4YLYA 4B6SA 1ZR2A 5KAMA 1JEAA 2VYND 3PA6A 4GWKA 4EX7A 2OCPA 2BH2A 1V1MB 1EGHA 1LNZA 2YQZA 2XYPA 2NMVA 4BYGA 3F6SA 1ZOOA 5K9ZA 2PKRA 3HJGA 4LJYA 1W87A 2ZYHA 2GASA 3KPUA 1GILA 5FUWA 1LDEA 4K7JA 2DMRA 4KVAA 2QDKA 1C0LA 3W9YA 1PJQA 1U1IA 3L5KA 3SF8A 4HUJA 4REMA 4OX9B 2XE7A 5TQVA 3RAGA 1XI2A 2I7CA 2WPDA 3B36A 3BCUA 3EFBA 3PC7A 4DG8A 2WG2A 2HF9A 1GXSB 1ATIA 3I3OA 3LDAA 4MKZA 4UCQA 4DHWA 2ZE6A 2XTNA 3CKLA 1Y8QB 4EKEA 4KRFA 1IM5A 2VAMA 3F2IA 3U3DA 5FH9A 3GT4A 4WN9B 2FPWA 3QXHA 3UKJA 4ZU1X 4DB4A 2AK2A 5JISA 4GQIA 3TEMA 5MF6A 2YUTA 2W0MA 1IXRC 3DHEA 4ZOBA 4YFYA 2CXTA 2FKNA 4BP9A 1O6GA 2CBXA 2BWJA 3S7ZA 3PDJA 3SJBA 3KUDA 3I32A 2ZVQX 3QMMA 1UP7A 2ZUCA 3QEMA 3TSAA 3OKFA 2UUAB 1JKJA 2FMTA 5HF9A 2OV4A 1JLHA 3JTMA 4EYSA 2I2CA 2YRXA 1LPBB 4UEQA 3SLRA 4YWJA 3NJRA 4E5KA 4DSNA 1H2EA 1PZGA 2ORWA 2AKEA 3AEXA 1SXJD 3CVUA 3TLMA 3JATA 1M5UA 1MUUA 2WIAA 5LXTA 1UXIA 5LBUA 1XD2A 2AOUA 1V1RB 3TW8A 4GKKB 2WIDA 1W5FA 1N1GA 2QY9A 1GNVA 4ZYLA 4UBNA 5ENDA 3U19A 4IHJB 4FONA 4PXAA 1GQFA 5A5DA 1ULHA 4MS1B 1EFRA 1O87A 4P33A 2G83A 2O06A 3UOAB 1BU8A 4AIRA 1RRCA 1FMTA 1PS0A 3UJHA 3CVVA 3EA5A 1JIXA 3BXHA 1U7TA 5FCDA 3NIWA 5JOQA 1RM0A 4HAIA 4EJ0A 2O2GA 4DIBA 1YDEA 2RI1A 4A6EA 1SUDA 3OIFA 1V11B 1G21B 4MQ5A 4JSRA 3HI6A 1CW2B 3PGLA 2X0NA 4P9NA 1UBHS 2PH5A 4HO1X 2YXBA 4KLZA 4TTIA 5AUNB 2GN8A 3M2PA 4QUJA 2VZLA 1Q7CA 1PGPA 1JHRA 3BQ9A 4Q1BA 3AB7A 3B52X 4F72A 2RKOA 4GI1A 2SBTA 4RY2A 3DXZA 3AF2A 4RANA 1W34A 2GLXA 3IJ5A 4QBHA 2YXDA 3WKCA 2C94A 1KMHA 2I3GA 4HGOA 5CIQA 1HV8A 1UEJA 3V48A 3I4CA 3S2SA 4YJ2B 1F2VA 1OJ7A 1JNYA 3AJ8A 4MO9A 1T4CB 3LC2O 1L4MA 1ZKMA 4TSKA 4YRTA 2WILA 4ZTBA 4MW9A 3LFUA 2RK6A 1I33A 4KMMA 3RBZA 3T54A 4AUMA 3T3IA 2JANA 1WP9A 1VL6A 5H4HA 1M1ZA 1ZNWA 4ENRA 1IEXA 3WRYC 2Q9CA 3NWEA 1BQEA 1M1XB 4MUNA 4Q3DA 2DPGA 5JCZA 5JH7A 5K03A 3DKRA 1U3WA 5DSTA 1SBIA 4PZEA 2ONCA 3DH0A 1JSCA 3RRZA 3P9KA 4FNGA 4CIDA 3VYWA 2CUKA 2I4RA 2RBKA 1K0FA 1WX1A 1II0A 1BC5A 3AVQA 3QFHA 1ZDMA 3BX1A 3NHWA 4TXMA 3UV7A 2B6HA 3VZCA 5C35A 2YINC 3S1LA 4RTJA 4ETIA 3WWEA 2C8KA 3CNQS 4DA9A 4AMYA 1BIFA 3K9WA 3G0GA 4MUMA 4NAUA 5CEFA 4GBGA 1G41A 3Q41A 1J0CA 2QP4A 4WH0A 5B4TA 3E7DA 4CLOA 3KU4A 1QKJA 3ZY5A 3KS9A 5K5EA 2Z98A 3F9CA 2C2GA 3NFRA 1IC6A 3DLIA 4CL3A 2P1ZA 3VSEA 3C5CA 5JS7A 4RTNA 3DG9A 2EZ8A 3WYGA 2WG0A 5KOIA 3OZSA 2AN1A 3LWNA 2GZMA 1US8A 4HMQA 5EMHA 4YMVA 5K09A 3E8XA 4L9RA 5F1OA 4OO3A 1OBHA 5C8DA 4CDNA 3ND6A 3AFOA 1XDDA 1MAWA 1H5UA 3FE2A 2DHCA 4WLOA 3H2GA 2IF2A 4EG4A 5C4GB 3EPLA 1NYRA 3QELB 1VI2A 3V55A 2HTFA 1YZHA 4L74A 5IAJA 4WVFA 2ZTHA 4Y9TA 4B84A 4CM8B 2M6KA 1LPMA 2JJ8A 2BEUA 1ZFNA 4GKJB 4DDTA 4BLTA 3MFYA 1KFCB 2NU9A 1SQGA 2ADMA 4ARVA 3SEZA 2L18A 3FAKA 3OQJA 1YIAA 1PX2A 1XYVA 5HZHA 3DO5A 2IY8A 3DE1X 4PHCA 3ROPA 3CINA 1GRVA 4GKAA 3GLTA 3CZAA 4FI3C 1CRQA 1E5TA 2OESA 5GONA 1XTPA 3RRFA 3VOBA 5AW7A 5T57A 4IWXA 3PGMA 2HDNB 3RJZA 1GV1A 2HXGA 5A3QA 1XZIA 1ULUA 2JFOA 4HBGA 3TOVA 1BDIA 3QH4A 3NM6B 5KTPA 2B1GA 3L8FA 2VSYA 2RAVA 1P0IA 2QRVA 2RK3A 4LYEA 3V4LA 3LO5A 4I7EA 3UANA 2AJLI 4JJ4A 2MDTA 5EIAA 1OLXB 5GZ1A 5JAOA 4DWVA 5EJAA 3OQVA 4MR9B 1EK2A 3AR8A 1I3OA 3IEVA 3JALA 3DMRA 3EVBA 4JX8A 3A7EA 1T43A 3KHSA 1FS4A 2VJCA 1H1LB 4JP3A 2R6GA 2FUNB 4UFOA 2GN0A 3U62A 4BV9A 2MHCA 1C3OA 4IY1A 2BMFA 1E60A 3RK4A 3W3AH 2P6OA 3P0JA 4PG4A 3LCRA 2IS4A 2GBLA 2YWEA 4B6FA 2R4QA 3O93A 1JSLA 1QDEA 3F1KA 4MQLA 4DPLA 4ARZB 4QGGA 2KBFA 2XNDA 3AFHA 5FTWA 3VYRB 2E0IA 3ZTWA 1NATA 4HDSB 5AK4A 4HNRA 1DIRA 3KKKA 2E18A 4GPBA 4FGKA 5EZ6B 1L1FA 3R41A 2EW1A 1FVFA 3JQ7A 3WQSB 2HJHA 1C5KA 1P9NA 1N6OA 3IHKA 3PQ4A 4KXXA 3ZEAA 3SSNA 2PRJA 5PGMA 2VDMB 4K6GA 3SKXA 5EY5B 1SVWA 4PTYA 3NV7A 4TT3A 3OQMA 4XSGA 4Y6QA 3DBOB 3T94A 1HNZB 3HXQA 4LZOA 2AMVA 5FA6A 2XHEA 5LU9A 3Q8LA 3RQSA 4CMAA 3ERCA 1KDPA 4WKPA 4IDNA 4UHEA 3AJDA 3O4GA 3T7IA 3PV0A 3EUEA 1CJSA 3GAAA 4MV6A 2VP5A 1C80A 2WTMA 2C2XA 4OBBA 2QLTA 2PDAA 1R6DA 4NYMR 4EGSA 3E6AA 4FK8A 3QXGA 4CCWA 1Y81A 4COOA 5CFRA 4Z4GA 2GEVA 3N70A 1IBRA 1BFKA 1HDEA 3C7CB 2HSZA 4KLAA 2N1MA 1HOXA 3L6EA 1TQHA 1T3HA 2Q8NA 4PYLA 4WGGA 4C4AA 5C8YF 2CYBA 2LW7A 3LBHA 2EL7A 1BXZA 1Y3AA 2XKJE 3GPDG 2ZJAA 4GG1A 4KRXA 3ZCQA 3R3HA 4CTJA 3TD9A 1LRLA 3H05A 4R1PA 4ZIRB 4W7HA 5DHTA 3T5CA 4FFBA 4DOMA 4N9QA 4I55B 5I01A 2N9UA 2AZ4A 5HGJA 4E3WA 1R0BA 3FFWA 2DX7A 2CXHA 2X5JO 2GEDA 4KQHA 1XPRA 2XUHA 4RK1A 1LGYA 4PW0A 2DPLA 3W2EA 1YOVB 3VR4H 4TYQA 2QQGA 4GI7A 4RETA 3DZCA 3NEAA 4I9HA 1PVDA 3IR6A 3RYHB 2H4JA 3LBAA 3SBXA 4EQ6A 1AQNA 1VMDA 5F4ZA 5KAPA 4PSUA 1QP4A 4FEYA 1LCIA 1XMSA 2OP0A 2B92A 3RV4A 4DUYB 2RGRA 1U2EA 1CQJB 4Y0VA 1PZEA 3VPXA 4NMMA 1MD9A 1RHUA 2W2QA 2X8LA 5B1EA 1K7SN 3W90A 3PCTA 3OWHA 2YXNA 1IIRA 1X8JA 3RTCA 1PT8A 1C8LA 2ZS9A 2B1JA 3FY4A 5AVOA 3SEAA 3ZU2A 3ESCA 1HQCA 3F96A 4UUAA 5EE3A 4OGFA 1PG2A 1VSBA 2YVUA 3WQBA 2W90A 5CK4A 1Z36A 4AMBA 1XJ0A 1NJ1A 4U39A 1WJGA 1A9SA 3DFKA 3RC3A 3DTVA 2TRSB 3C3CA 2G1KA 4G9EA 4RV4A 2YXPX 1SFRA 4HVAA 1N9KA 1PFUA 4ZJYA 2O3TA 2R25B 2VSNA 4DA0A 3H0EA 1QANA 3S99A 4BLWA 4EX6A 2KSQA 2OVBA 4BX3A 4TLEA 4S1NA 3I9FA 1DAEA 3K1ZA 5K0EA 1RHKA 3ZDBA 2I2WA 3VC1A 3E4DA 4JQOA 4UBLA 4XM1A 1DC7A 4ME6A 1J56A 4B75A 4GWGA 4JI4B 3R23A 1G21E 1HE5A 2B9EA 2HU8A 1RM5A 2R6CA 2NUTA 1UFVA 2WYOA 3AF0A 3FYUB 4WE3A 5EESA 4D5GA 1V8ZA 3D3QA 2HF8A 1E0AA 4O29A 1P8AA 1Y4ZA 1LPAB 3COSA 3VPDA 4F6CA 5IVPA 1MV5A 3SJAA 1LH0A 1XRMA 3CKMA 1PHPA 3ZIAD 2DE0X 3A2MA 5C52B 2AMYA 4BX8A 4BTEA 4RD0A 2BRUC 2P4HX 3QKSA 1WZNA 2FPIB 2I8AA 3ZCUA 1VHJA 1ZJZA 5KPJA 1FX0A 1M0TA 1CUYA 1S6YA 3C87A 4G5SA 5HMLA 4F3KA 1L5YA 5IJ0A 2CUZA 3AHDA 2I6GA 4EDFA 5JHHB 1TLFA 4CKCB 1KI6A 2RAFA 1BYIA 1AN0A 2DYKA 3G59A 5EWLA 4K2AA 1Y9EA 4M0CA 3VYUB 2O1XA 2C3YA 4NDZA 2WUGA 2CBGA 3BMCB 5JWHA 2OM2A 4NVRA 5LQUA 3HYRA 2Q2OA 2ZB3A 2Q99A 1TJ4A 3FVRA 4FZRA 4XWGA 3H97A 5IYZA 3Q7EA 4JROA 1ZXLA 2OZVA 4URZR 1VHDA 1IOZA 1ZC3A 2ZJ2A 3DE2X 2WMOB 4R1TA 1HDYA 5FBHA 3TOCA 3P9IA 4YJ3B 2EKBA 2ZYUX 3B1JA 5JZ9A 5IWAB 1T8SA 4OVKA 3E9QA 4JITA 2O5EA 2Z4SA 3VH2A 3BTVA 2ZI7A 2J6CA 4C0AC 4DQUA 3CX6A 4IS2A 2WUVA 3S0JA 3ZWCA 4JKIA 4QM6A 4DF3A 4DC1A 1E9BA 4ZPXA 3KPWA 1P1BA 1KDZA 1U5AA 5BP7A 1K4YA 1GCUA 2J9ZB 3PQCA 4K86A 3SQOA 4I08A 4BNTA 2P4SA 4CMBA 3D1LA 4JBWA 3I23A 4QA9A 3GPCA 2H63A 2RIRA 2OCAA 2WWFA 3BIFA 4L9SA 5T6BA 4D8XA 2A59A 2PYIA 2I71A 3G0BA 3N2EA 4YRFA 1ZONA 4C7KA 1YA6A 5L3QA 1HH4A 5B7NA 3UUEA 2VOJA 2RBGA 5HF6A 4JJGA 1TF2A 2RH8A 1OT5A 3WNQA 2ECFA 3CVJA 1URPA 4BECA 4XRGA 5KYWB 1BROA 1VKJA 2OK7A 2VHZA 1O03A 3DSRA 2IP2A 3ZI4A 3J80A 3BGOS 1ADFA 1J8FA 2V74B 4PYQA 5LB4A 3REQB 1DX4A 2J3EA 1YR2A 3WLKX 4C3OB 4YLGA 1JVSA 1CJTC 3GJZA 3KTFA 3NBXX 5F12A 4GR5A 5ALQA 4AJ1A 2QYOA 2GCOB 2ZU6A 3MD9A 4L7VA 1MW9X 2G25A 4XYBA 4RK5A 2E85A 3FVVA 3ZU3A 3M34A 2ONZA 2E1RA 3DUWA 3FJYA 1YMVA 4GLJA 2J6IA 3RU2A 1HKHA 1I5OA 2ZRAA 2IHYA 1ZICA 1CQIA 4CF7A 4HSGA 2WMDA 3HVKA 4BAUA 2ODQA 3QVJA 3TF5A 3OQOA 2PXAA 4MUAA 3VR4A 1TW3A 4ACAA 4AIIA 4RK7A 4UE2A 1NY6A 3SP1A 2RG7A 2PVPA 3N59A 5A4MS 1UC9A 5F33A 2OQVA 2PIDA 1TM3E 1P2UA 3G8CA 3NG1A 3SIWA 1YNSA 2F1JA 1HZJA 2D4AA 3HBFA 4H9GA 5CFPA 2V3WA 1AOXA 3HV0A 4ZV9A 4ZO8A 4EGQA 3MUNA 3CT6A 4CV2A 4KOAA 4CMEC 1VL0A 1EA7A 3GEHA 1KIMA 3KVRA 1F6BA 2F59A 5HZMA 2VDWB 5AM4A 4D0SA 1U8AA 3ECCA 5BYJA 5TY0A 3EAQA 4KOEC 2BM1A 1GCOA 1NBIA 2EFJA 3R3ZA 3FCSB 2Y66A 3GRPA 4YK7A 4YV7A 2IH5A 4I1IA 1ISGA 1BWSA 5UKDA 4CLDA 1HM5A 5BNWA 1H3FA 5FHRA 5EC8A 4FFOA 1RI3A 3SXJA 5AJWA 5KSYA 3OZVA 3GRZA 3I9MA 1QK4A 3IRVA 3IDAA 3KYDB 3SLKA 2FN9A 3IBGA 2CV0A 2G67A 2A7QA 1SUPA 3PSAA 3ILXA 4NBRA 2WAXA 4DRZA 4YMLA 1ZGHA 2PNFA 3CV3A 3F5SA 2O50A 4N82A 5AH0A 3NDIA 3ZLUA 5KQMA 2QIOA 4HAZA 1WKVA 3R09A 4X71A 3AUYA 3EZNA 2CC2A 5LQNA 1PAUA 1U8CB 1X7GA 1CNFA 4N6NA 3HB9A 4P08A 3EPKA 2VTVA 4D25A 1I3CA 3I0MA 1MOZA 2N0SA 3LQ1A 1GG2A 1Q2UA 5D85A 4EB0A 4Z1OA 1E1RD 2V96A 3U4MA 1B41A 4PU0A 1NN5A 1SHZA 4DLLA 4M60A 4ZD6A 1KZ1A 3QVTA 2VHXA 5A7GA 1MJHA 5U4XA 5GWXA 4G1FA 2A1TS 1FDWA 3U60B 1SXIA 2GHQA 4WJLA 4Z4CA 4MGIR 4X24A 2XLCA 1E9RA 3QBEA 5LR6A 3UAYA 1YRBA 2ZIXA 2L42A 2PY6A 3ABIA 1XQVA 2OENG 5BPFA 1AF7A 1JF8A 1SIBE 2VTBA 4QXOA 4AJPA 1YR3A 1QRUA 4QUIA 2I22A 3GD7A 2VO1A 1YJCA 2V7PA 2XCLA 5KKAA 2VWGA 3NTRA 5B1DA 1SXHA 5CURA 4EB6B 4V38A 4AD8A 4IQGA 1UPFA 2P5UA 1JHXA 1NF9A 1YACA 1MAUA 5JEEA 3JYPA 4US0R 4PQGA 2AMLA 4A91A 4FYKA 4P98A 4ATNA 1YDHA 4ZMBA 5CB4F 4JNKA 2ZYWX 5LOVF 2BYTA 2HAEA 2WVJA 2ZYIA 3C7AA 4JVOA 1NNLA 3HJFA 3C43A 1G5HA 2XD4A 4WEOA 2XWSA 2C31A 3ZGYA 2A14A 4JB8A 3WGUA 1UKYA 4Z3OA 2GM3A 4KSBA 1CJVC 4QQRA 2KQUA 3D0QA 4KTVE 5DGHA 2J9FA 3N0RA 4ZTUB 1Y5RA 3GP3A 1G16A 2BD0A 2VPWA 4IRMA 3ZHUA 1QH1B 5CA1F 2WHEA 4D5EA 1HF3A 1VCNA 2HHHB 1T24A 3CRVA 1E7YA 3TQTA 1CLUA 3GIWA 4ZC1A 1W9MA 1S2NA 2P1DA 2ZUSA 4HF7A 1IVNA 3FH0A 2C4TA 3IUMA 3UA4A 1N7GA 2J30A 5LM3A 1UJMA 2E82A 3BJIC 3ONNA 4G1UC 4MAFA 5FBRB 1SEPA 2C5FA 1FVHA 2ZYGA 4JBIA 3ETCA 4P5EA 4RPJA 1L3IA 1NE2A 3E61A 1EJ6A 3L7NA 2QZZA 4MR8A 2WHYA 1KEVA 3CX8A 3A6FA 3QNWA 3R7DA 5K3EA 4E15A 4LBVA 4LEIA 4XIGS 1X86B 1NASA 1WD7A 2ISSD 2ZRDA 3E7FA 4F5YA 3P97A 4QGAA 3VU1A 1UUFA 1U6IA 3L0YA 1KVSA 2GOYA 5K3DA 5BMVA 1ZN8A 2NPFA 2H0RA 4NF2A 2BE7A 4PNZA 1RFLA 3IPAA 4BS9A 3NIFB 1UP6A 3LUJA 4EHJA 3BHIA 2HCJB 4PAOA 4LSGA 4S04A 4OY3A 3VO1A 5C3MA 1K7XB 1U2PA 4LX8A 3DONA 3UATA 4CF3A 1R4AA 5BUCA 3LIIA 1FLNA 2QAJA 1W0JA 3H8JA 3OP4A 4E5UA 2QTCA 5TQ0B 4UCXA 3ORHA 4RNCA 3AESB 3ONFA 4JDUA 2JJQA 5F5LA 4KNVA 3Q7IA 4B6PA 3QKUA 4C4TA 3NS7A 3NONA 1KDYA 1WNTA 1WHTB 2FW8A 2HGZA 3M8KA 3CRRA 2RHLA 1NQVA 2ZB4A 4P86A 3SZOA 4R2XA 1WZUA 1XAGA 4DLBA 4EENA 2F1RA 2FXIA 3SHTA 4F8JA 3GZNB 5KUTA 1XXHB 4CM6A 3L4BA 1X7ZB 2X22A 3AR6A 3EXIA 3I04A 4PAQA 2YNMD 1H2BA 4BKOA 4H17A 4FNOA 1JWLA 1ENZA 1CDEA 1KSFX 3SYNA 2VXCA 4COKA 2QJRA 4IGKA 3K70D 3RI3A 1NUSA 3FMVA 4Q39A 3AB8A 3NRCA 2A8YA 1WMEA 3L0BA 3O8OB 5JI2E 2QV0A 1LVGA 2OE2A 1RQXA 3RS2A 1N0HA 1XWWA 5F5NA 2P8JA 4B33A 1ZNQO 5A3VA 4TV9B 5EHIA 1WQ1R 2Y2VA 1PRYA 3EQ2A 3B3JA 4OAPA 1ISMA 5C5EA 4QDXA 2QHXA 2DXIA 3JYOA 1FPQA 4Z7NB 2L17A 4MEAA 2C2HA 1PR4A 3C70A 4EI2A 1DEXA 4Z4EA 1U0HC 3F74A 1X6VA 3UJPA 2B6NA 2WYUA 1TA4A 4KKXB 3EEQA 5F4BA 2XT6A 3W6NA 1AC5A 3K1JA 1Y3BE 2Z57A 4H4EA 3PBKA 5I9BA 2G5CA 2ONKA 1K7YA 1RWBA 3G2HA 2YN0A 4L0QA 4QUEA 3U7EB 3WG9A 1KEKA 3ICVA 3L1VA 1GZDA 2GXAA 5K6AA 3HLKA 2HU7A 3JZDA 3PPXA 2CJWA 4R7ZA 4Y9DA 5COQA 3IP9A 1Y3FE 2IXAA 3DEFA 4HDNB 5AKHA 1CQXA 3UHAA 2H2FA 5EINA 3EW9A 2OV2A 4M0EA 5EQTA 3UYKA 1U9IA 5KYYA 4AF8A 4BVKA 4QJIA 2IDMA 5AM0A 1JTEA 2D7JA 3G5AA 4ZQCB 1U94A 4OREX 2QV7A 1NRWA 3DLTA 5CLFA 1X80A 2WM9B 4G4SP 4XWOA 1ADGA 4LWPA 4ZYZA 2F9MA 5JY1A 1FU4A 3FZYA 3BWBA 4B31A 2VPPA 5CEEA 3BZWA 1UPUA 3DMTC 1QO9A 2WYVA 3ME5A 1DS6A 3TPCA 1OWPA 2BM0A 4S24A 1DZIA 3B89A 4UTRA 4INOA 1SULA 5T4BA 5KYNA 1Y7TA 3VNVA 2EX1A 1C3EA 3Q5GA 5AKEA 1XDSA 4CCAA 1Q6ZA 4EG7A 4NJOA 3OJCA 1QLJA 3A58B 3C48A 1ZHOA 2POQX 4GSLA 2X4DA 4LDQA 1RLIA 5DM4A 4Z5XA 4W5NA 4O5AA 2ZXFA 3LD9A 3VMMA 3TCXB 3BT7A 3ICOA 4YRKA 1D07A 4ECEA 3C1UA 4LTNA 5THKA 1L0BA 4MPDA 4XDHA 1U8UA 3DLPX 2HYIC 3EY9A 1RPZA 1QJCA 2Q5EA 2ZETA 4KUHA 4LYAA 1DAGA 4WI1A 1RHJA 3IALA 4IJWA 4FHZA 3TI9A 3C45A 2VHJA 3WO1A 1JHUA 4FC7A 2X2EA 1QH8A 4GVXA 5C1IA 1QG6A 3TQRA 1XP8A 3AF4A 1NUHA 2Q6KA 5DXAA 1T9AA 1O08A 4ZN6A 1REQB 3WK8A 4HMPA 4K9RA 3W7AA 5BWMA 3O4HA 3GLIA 3JY6A 3U48A 2YV2A 1NUTA 4ZVKA 2AYZA 1H9BA 1NU8A 1PSZA 2AW5A 2QMEA 3JYQA 1MOSA 1W36C 1XPUA 4LPKA 4J0EA 1S1CA 1X1QA 4QQ8A 2HR1A 4RKRA 5JYDA 1Z6GA 3FRHA 1QFZA 3H4VA 1KGDA 1P72A 3C0KA 4GNRA 4DUGD 1MJ5A 5EWMA 2BZ0A 4L8WB 4UUBA 5HF8A 3PA8A 4RF3A 3P26A 3GNTA 2PKEA 4QFCA 5B2ZA 1N1EA 4UOEA 4ZOQI 2AJTA 3KB2A 3OHPA 3RAEC 4GI3A 4MR7A 3LP5A 4AAYA 1L7PA 3VPBA 4AS2A 2GI4A 2CZCA 5BNZA 5HDBB 2ZUVA 2DJIA 3TTWA 4UU7A 4U6SA 5F5XA 4AS3A 2ETVA 4UBMA 3MT9A 4RPKA 4BU0A 3E2PA 2W6OA 5FULA 5A9TA 1RHMA 3V7YA 1B2RA 3OPYI 3T06B 3F5QA 3W5CA 1Z29A 1W73A 2F43B 1ETUA 4IIEA 1C7EA 1C30B 1AXEA 1PJCA 3EF0A 4PSAA 5E4YA 2OHIA 621PA 2Z9BA 5CNIA 4R81A 1N2IA 2VXOA 1BS9A 1E58A 4ITUA 2RB5A 2NX2A 1NFFA 1STOA 3MINA 4B6EA 2PEZA 2ZBQA 1KYWA 1QIHA 1CV2A 2IPNA 2DPXA 1EX6A 1JU3A 1Y89A 2ZRGA 4FOSA 4F4UA 5F3WB 3E84A 3DUFB 4S0XA 3A9RA 3AY3A 2RJOA 5CG2A 3HNOA 2J3LA 5H68A 5BSRA 3UGJA 2VNIA 2MSWA 1NR7A 1EE1A 3R5XA 1O9GA 4KQWA 5I3ZA 3A9CA 2XODA 4FOTA 3KUUA 5ELLA 1EXWA 3HKDB 4URYR 3U3ZA 2VRCA 5FTKA 1U4SA 2GM9A 4U2BA 5HFJA 3RUIA 2VAXA 2ATIA 2J9GA 3UAGA 4CQMD 3N8DA 4P38A 1DFHA 4D8UA 4JY7A 4R8MA 1KBZA 1TU4A 1SKAA 5YASA 5KSPA 4MS4A 4MZDA 1P6QA 3F4KA 1Z4PX 5HQ3A 1FTSA 4ACBA 2P6NA 3KDAA 2Q5LA 1KDOA 4QPJC 2D7CA 3JWJA 4BL5A 5EXDA 4LJSA 2Y6VA 4BEWA 1CUXA 2HHJA 1NKVA 2VF4X 4M1SA 1UKEA 1GPDG 4RFLA 1F5SA 5LB2A 4QWWA 3WGTA 2G17A 1AQJA 1G3QA 2FE1A 3K73O 3GFVA 1CY8A 2YIJA 1LW6E 3B8HA 1Z2PX 4KIWA 3CCBA 4L5JA 4PLTA 5JD3A 3WWPA 3G7NA 4QGFA 3BK2A 3A6GA 1AS3A 1TEVA 3WMFA 1P80A 1TZCA 4PSDA 5DWQA 3EW7A 1RKXA 3R24A 5SZJA 4FN5A 4DABA 4DT1A 2BFCB 2PUVA 4EOGA 4CCYB 4L78A 3HEMA 5B3JA 4XRRA 1FJGB 1RCTE 4DV6B 1P45A 3UNXA 4B8ZA 1NMSA 3OQIB 1E9FA 4RVGA 4X00A 2OGWA 5A7FA 4MVCA 4K9KA 3GDWA 1T6XA 5H3LA 4DMGA 1G6Q1 2QT0A 1ZIYA 2VCHA 4B7UA 3ZWBA 3C7DB 3M6IA 1VPTA 4R31A 3R6DA 3STTA 4QZVA 1ZISA 2W9XA 1P2DA 4JA2A 4OYRA 1W44A 2NTYC 5DBEX 1TGYA 4J0KA 2EKDA 5I9SA 3Q8WA 4JT9A 5JADA 3CVOA 2A1UA 4Y9SA 3ZDXB 2I62A 4NYJR 3TSCA 1XXHE 1VL1A 1Q0SA 4Q3KA 1TI7A 4HYTA 4MRMA 3T7RA 1V5FA 4N5DA 2PPVA 3GA0A 4J2OA 1KZHA 1HDRA 3VHXB 3HU1A 4YJKA 3SHFA 1A7JA 1NZDA 2Y1OA 1MR3F 1I32A 1QMPA 2AE2A 3MJVA 4RMIA 3X1KA 5JCXA 3OJ0A 2VDNB 4G8BA 5ELXA 1R5JA 3EHEA 4FD3A 4LJRA 3H9EO 4MGZR 4L85A 3WGNA 2GK6A 4FM9A 3LY7A 1Q14A 1CF4A 1V26A 4A16A 3D7KA 3LVFO 3V42A 2X58A 4AMUA 3RDPA 3OOJA 2NZUG 3KFXA 4NENA 5TE9A 4QARA 5CB4A 5LFAA 3LE8A 4NLLA 2VL7A 2YVLA 1IRXA 2RHMA 4QHSA 2PQ2A 1MAVA 3PUJA 5DWDA 1MHPA 1E6EA 4II2A 2IZ5A 4MRSA 3D6NB 5HKLA 3RVQA 1SD1A 2HHCA 4QYIA 1WP4A 3M2TA 3OD1A 4I50A 5JNUA 2CLKB 2WP0A 1GSAA 1UPCA 1TVKB 1MIOB 1RLMA 2J31A 4Q7LA 2PSSA 3CH5A 1QDUA 2Y1WA 5C9ZA 7YASA 3KUKA 5CA1A 4RPGA 5LMCA 4RHTA 5CA0F 3S55A 2Y1XA 3DA8A 4FP9A 3L4KA 2JEYA 4Z99A 4QICA 2AKAB 1J0DA 4XWWA 3TAXA 3CZRA 5JAPA 1SC3A 4PCLA 4PIVA 3EDYA 4M0UA 2XE4A 2H1OA 2W22A 3B78A 2OC9A 2AE1A 1DPGA 2FOIA 4O8CA 5FTMA 5IXYA 4PINA 1Q12A 4IZOA 3X1JA 1PL0A 1QFYA 3SF8B 3AL0C 2OV6A 4N5HX 1LBIA 1HNWB 4UVDA 2HCFA 4NZOA 1H2AS 2QTTA 4Y2QA 2GDZA 2QN1A 1DWPA 1JVBA 4MV1A 1KPHA 4E5PA 1JW9B 2P9GA 3FYDA 2DBYA 3WDMA 1LTKA 5ESXA 5TGTA 3WGKA 5JJ5A 3UJBA 3ZE9A 4INAA 4MJXA 5IANA 1BXKA 1Z2CA 3UPTA 2ICAA 3OCYA 4S1PA 1R8QA 4G0QA 4C2BA 1RRVA 2ZR0A 4EY4A 2YHAA 3BBLA 4DV4B 1JH9A 4GICA 4LN1A 1QIJA 1ACLA 5J63A 3LQYA 4HS9A 3ROEA 2QA5A 4GYYA 3LRPA 3W5AA 3UXYA 5TVKA 1JI3A 3F71A 3OG9A 3TUZC 1DIHA 1RPNA 2B61A 5BRNA 3E53A 1AQ6A 4FGZA 2GFQA 3ELBA 4KVGA 5AJZA 1RAEA 2IKQA 3NNSA 3AI1A 3N86A 4BZWA 3AUXA 3QEJA 4XIYA 3RC1A 5LP6F 3NTLA 2XCTB 1F0NA 4QTUB 3NC0C 1LZKA 3QMVA 4GKVA 5E7MA 4B3SB 1SIOA 1Z83A 1IE3A 1T4BA 1BCRA 3ZVLA 2COKA 4FHFA 4V0MA 3IERA 1MRZA 2IE0A 5IDYA 1U2QA 3JATB 5FBZA 1XQYA 3EWAA 1XRRA 4KGDA 1XD2B 1Z4NA 1OKKD 2AOUB 5BWOA 3JWHA 4QT0A 4IRXA 1ETHA 4R84A 3TW8B 1TYBE 3X1DA 1DO0A 2HWUA 5BYAA 1IJFA 2IZ1A 3EGCA 3TKYA 4D9JA 2IEDA 4G0YA 5FR2A 1JXOA 3EXG2 5ILOA 2BL4A 4WCFA 1LC0A 1J8QA 3KOMA 4KC0A 2YBEA 4I3HA 4BBPA 4WOJA 2QAIA 1Z0AA 3P0IA 4G67A 3HHEA 4UQPA 2ZRBA 2CVHA 1MB9A 3OQNA 1SKUA 1T0UA 5HRUA 1KSHA 3G8YA 4B09A 5ITVA 1JFVA 1PV4A 4MUEA 1PE0A 3CPSA 4JC4A 1I1QB 4TWIA 4K6FA 4ZZ1A 4BQEA 4CM9D 2M32A 1NXXA 2VJKA 5AK0A 3FIJA 2H2HA 2Q6OA 2Q4RA 4BKMA 4QUGA 5FEMA 1XGKA 4E0BA 4W5JA 4D4GA 2HJVA 4JU9A 3D6MA 4R69A 4Q9JA 1YQXA 3KEGA 2ZR7A 1WXDA 3QHAA 3V5NA 1J0AA 1ZI8A 2QM0A 4YUXA 4M1YA 1ZYUA 1JDZA 3GLFA 3IKJA 2O1SA 5D3QA 4QTTB 1PGOA 2HMWA 3M81A 2Y1EA 1JXAA 1YUMA 3AHFA 2OB2A 4F6RA 1MMFB 1XAIA 3BAZA 3BL8A 3SVZA 3VV2A 2EKPA 1V6AA 2GBLC 5JHGB 4ZARA 3B1YA 5JXWA 5EJ8A 4RKYA 1UM9B 2CMGA 3T7SA 5A6VA 3WNBA 2B4QA 4A73A 1U8XX 3AR4A 2WAAA 2PMBA 4WVLA 5JH7B 3DEJA 2HV9A 3EZYA 4QX6A 2X8JA 3O90A 1QFJA 4RZXA 4X1YA 2ONYA 3CX4A 1UT5A 3RRNA 1KVTA 4PWZA 2R4TA 3TLCA 3W2IA 1CIPA 2IJGX 4NE7A 5TPWB 1G9SA 4C6SA 4D0RA 5AI9A 1DZ3A 1CYEA 1QIFA 3MYYA 5DWVA 1TJ5A 1S7CA 3LP8A 1CQPA 3WL8A 4EY6A 2DCUA 1GTVA 4CLOB 1OPRA 3FWZA 2R6DA 3JZAA 2WFMA 1GRNA 4QXMA 3NEPX 4C4XA 2R1TA 5C7LO 2XDQB 3JRWA 4LZLA 2MMCA 5LLSA 2CLMB 5MN6A 1AK2A 1F48A 3G0DA 2LGJA 1DQZA 1ANKA 3HI4A 1E4EB 2A0UA 3DDSA 4KFUA 4WDQA 3IV9A 3V2GA 5JWRA 1RQGA 3AVXA 2HIAA 4QFMA 2HQSA 1OW3B 4DE5A 2CHQA 5FV7A 2AI3A 1A9XA 1US8B 3CR7A 3SHOA 1MXFA 1UANA 2NO4A 5BR8B 3L8CA 1ZZEA 3GLGA 2QN7A 4TSFA 1XHLA 2I7DA 3RHZA 1MTZA 4CUJA 1HLDA 2O9JA 5E7JA 4I3GA 1FY2A 3KSZO 3MWGA 3QKRB 4NR0A 3S6JA 2OV3A 4IDHA 2J6BA 4QKQA 1MRNA 5BW4A 2ECQA 5LYJF 3DV2A 2BV3A 2WIBA 2GXSA 4TPKA 4JD5A 3CM0A 2G8LA 3OPVA 1CUEA 3QENA 5EKDA 1X7HA 3X1MA 4OI4A 1EP1B 2B1RA 2NU9B 1KPIA 1QP8A 1RWQA 2C5LA 3H5VA 2FMKA 4IX1A 5CHEA 5CPFA 3FF1A 1CRLA 1HMYA 6Q21A 3JSAA 3CJRA 5ICFA 4L4RA 3SHWA 2A0WA 4ZC8A 3RS3A 2PSFA 2XUQA 4GGMX 4KAJA 3DBRA 1ZP6A 4UC0A 1J8DA 5KNCH 4BBJA 1LI7A 3UCFA 4R2WA 5ARBA 1TCBA 1SU4A 1N6KA 2QRVB 3EEFA 1GN9A 1E79A 2PL3A 1KJZA 1EUZA 1A04A 4F97A 5AKIA 1VMKA 3TNJA 5ADVA 2PQ0A 3I2JA 3MTDA 2UYCA 3JALB 4KQKA 4OQNA 1M75A 2WJ6A 2WB2A 1HXHA 1HE1C 2OMKA 4M9SA 2WNIA 1JSRA 1D1SA 4QUDA 2QTGA 3FVQA 3R75A 4ABYA 1PFWA 4QUHA 3O8DA 4BLSA 4JI7B 2F9LA 2GD1O 3NT5A 4JB3A 3TMAA 1FP4B 3KOZA 4FQ5A 4GP6A 3OFVA 4D6YA 1N3YA 1VQ1A 1ORTA 1ORRA 2O05A 1KQFA 1A1SA 4UTVA 2H57A 5KEIA 4LYFA 1HGXA 3OLZA 3HADA 1Z38A 3GCGA 1UXKA 4G8JA 2WWXA 4LECA 3CE6A 5EIBD 5CAEA 2PX0A 1J07A 2XUDA 4PZZA 3OIWA 3TYXA 1UZLA 2ZJ0A 3BMOA 8AT1A 3ZQUA 4JLUA 4KLNA 1T8TA 3T3EA 1T1GA 1UK9A 2GPAA 2H9AA 1AHNA 3DMNA 4A0QA 3ZVMA 4TYMA 4TRMA 4LMAA 2EJTA 1RADA 3WLFA 3PDHA 2J0UB 2ACWA 3EGIA 1G8JA 4OB7A 1HI9A 4C3ZA 1JR3A 3U16A 1IXSB 2XF8A 2HHAA 4UDNA 4UHDA 1E3SA 2CL5A 1A9ZA 2Q3DA 4UARA 3VOSA 2I8LA 4Y0AA 1S8FA 1IY2A 1WDWB 2V55B 3KJEA 1P2GA 3NWOA 4FU0A 4INZA 2XOKD 4U7WA 3DYIA 3PRKE 5TEVA 5AVWA 2Q1XA 1B73A 1N3LA 1ZJJA 3BE5A 3NHRA 3VGJA 1W5TA 4Q4AA 3SBOA 1PR1A 3RU3A 4RJ2A 3M0EA 2XSZD 4FE7A 3KYJB 1GQRA 4M1TA 4WOCA 4UZFA 2OAP1 4FKBA 3GAFA 3DMYA 4NDNE 4EKGA 2KB0A 1A7KA 1U9ZA 1NN0A 5L95A 2D0IA 3GEIA 2ZIVB 4KWCA 3CZQA 5KX5F 2CKMA 4LCJA 5DIFA 4YH1A 2QP9X 1LB1B 4WNCA 1H1DA 3ABSB 4UHKA 1Q21A 1XU9A 2ZM5A 3U39A 4TGLA 4UPVA 4E88A 1M2NA 2VJMB 4R1SA 1IAQA 1E2EA 1ZUHA 5C7YA 3QG1A 3M3HA 4OQYA 4B3CA 4CQNA 3IXMA 1Z73A 1FQOA 3F46A 4MW5A 3PXUA 4Q7KA 4EQ6B 1N25A 3DOOA 3P9RA 2XVMA 2CXXA 2WT8A 4UMFA 4E1AA 1DWOA 2CF6A 4LXYA 5ETJA 1ZK1A 4UW9A 3N8HA 2R6JA 4KCGA 4N0PA 5KYGA 2PT9A 2PQ6A 3QPWA 3PSHA 4LOJA 3GP8A 4MAAA 2CWDA 3NHKA 2IYLD 1OXKB 1UWCA 3W7VA 3EUAA 1U3GA 4MWGA 4JOCA 4JKOA 1U9JA 3K9NA 1DTWB 1GRQA 1OWNA 4ILEA 4M8KA 4MKXA 4Y3UA 5F1YA 1WUHS 2H7CA 3IULA 4JWKA 4KXMA 3FKSA 3O94A 3Q4GA 1LD3A 1ADBA 4WQMA 3VZDA 7AT1A 4DAOA 1IZZA 1K68A 1DC5A 4MROA 3DTVB 4GH5A 1D4OA 4OEHA 1XCGB 4QASA 4D44A 2KW5A 3KZOA 3SM9A 1AK9A 1TM5E 4M98A 1P39A 1FSFA 3V1UA 1VDZA 1G60A 2ZULA 2YKGA 3FSGD 4G0UA 4YPFA 3FFBA 4YXWA 3FJ1A 3BH0A 3B7WA 3RVPA 5JSUA 3QVKA 2UAGA 4YT5A 3NBFA 1N3IA 2I7XA 3DL7A 3ZWYA 1GGNA 3NCTA 1FQJA 4D79A 1JJAA 3LA8A 1GLGA 1IULA 4TUYF 2DQ4A 3ICQB 4HC4A 2VK1A 1E7SA 2NUTB 2ZBFA 4HQ0A 1PV1A 1ZD3A 4OBWA 4UBOA 5DLEA 3RODA 3RQIA 4YJDA 4B4KA 4GDFA 1J49A 3E4CA 2FU5C 2ZQZA 5CJJA 3RKSA 1Q11A 1ZVQA 5KNCA 4WN3A 4JEIA 2A88A 5TRTA 4EITA 1YI0A 3OURA 4V2UA 2DP4E 1I8TA 2YZ7A 2ZWOA 2ZBVA 3JQCA 2FQQA 1FX0B 4MI6A 4RULA 1UDRA 4XB2A 5GZ3A 1X14A 3FPCA 5IJ0B 5CA0A 1K3FA 2OK8A 3F49S 1FFHA 2FX5A 3BE8A 3SC2A 3TBKA 4CI9A 5G4KA 4TYWA 2CXUA 3WTBA 2X41A 3JPYA 2IXEA 3D81A 3KB8A 3KEFA 5TQ2A 2ZJ3A 4B34A 5K8UA 4HQ6A 1BYUA 5CCEA 2QR3A 1KY5A 1VCOA 2LNDA 4FEGA 2JG3A 3T61A 4C6RA 1QQBA 4CT0A 3LHSA 1C4WA 2LBPA 3H6HA 3R6LA 3RFFA 2CXSA 2PL1A 4IDCA 3O75A 4GPAA 1KJYA 1VJDA 2FFBA 2Z3WA 2CHFA 3RYIA 5FHQA 2BT4A 2EBFX 1NA5A 4K9MA 3KLNA 2RJNA 2Y1CA 3LC1O 4IV0A 4J76A 4P34A 4TQAA 2X0IA 5CXXA 1U5CA 3DE4X 2WM3A 4DARA 5D86A 5C1BA 2VI5A 1K08A 1FFXA 5KC9A 4RIEA 4MUJA 4BLRA 5BW5A 5BV0A 4DSAA 1RCFA 3DZKA 1QZXA 2TS1A 3IRUA 3TZEA 3LPMA 1VLQA 2WJYA 1LPOA 5FFFA 3TZHA 3IXLA 1OTXA 3VTKA 3TR5A 1XZDA 2CL0X 3FFAA 4ZQGA 2QSUA 3W2GA 3AVWA 3ZR4B 3GUCA 1PWHA 2BGKA 3MCAA 3O4FA 1XKXA 5L3QB 4YDRA 5LP6A 1JYFA 3EPPA 2DT8A 3ZQKA 2XYHA 2V97A 6PFKA 2RCNA 4PQEA 1QOPB 5KS2A 1QK5A 4I4CA 2C7GA 1F17A 2EZTA 2GPJA 4OLJA 3RT1A 1WZCA 3BXGA 1IXYA 3IB6A 3G7UA 3R76A 3Q7PA 4OQLA 5DNAA 3BGVA 4PFSA 5KVAA 3UMRA 4QUKA 2RJ3A 3DAHA 1QRAA 4KQFA 1XU7A 2PZEA 4C7XA 1NP3A 2WTBA 4YECA 3F1LA 1TGVA 2QL6A 4GYKA 3WMRA 3NV9A 1D8AA 3CMCO 4PVDA 5EUBA 4QG7A 5DX0A 3EVCA 3G2QA 1Z5WA 1JDUA 3Q7SA 2O1WA 1UPTA 1CQIB 2JBWA 3RK0A 4TZ6A 2PZAA 3RVDA 1XFAA 4L2IB 2DFTA 3E2MA 2I4IA 3FGZA 4WKBA 1Z6ZA 3CRNA 4NCXA 1IMJA 1II9A 3VRHA 2P11A 5KWVA 2GUGA 1EJ0A 5DLQC 3Q88A 4G1MB 4X44A 1CNMA 1E9DA 4IDBA 4TV8A 1JG4A 1L5MA 3WIEA 1WOYA 3OF2A 2R5FA 1AB5A 1M5TA 4RVUA 3TR0A 1L7NA 4PXSA 5DEIA 1K5HA 5C2JB 4KLRA 3LC7O 4NC9A 1NOJA 2NW6A 1Z2EA 2VPTA 4LYJA 2F3SA 4M1KA 4QLAA 4KR2A 5DGIA 1ZRNA 2X77A 4YT4A 2DSTA 2P6PA 3UAWA 1NJFA 1QO0D 3VYTB 3D2BA 3OA2A 5AM3A 1ITZA 1JHAA 4NJMA 3BS4A 5IC5A 3RSCA 4TZKA 1B6RA 4FCCA 1NDQA 2XT0A 2PYDA 3E48A 1T8YA 3OE1A 4M0LA 1QOZA 4H7EA 4OP1A 5ALYA 2ZS7A 4ZVPA 4CL8A 3FB4A 2QLJA 4BC0A 4TRRA 4M6WA 2ZJ4A 4EYEA 4ARAA 1ZBDA 4TLBA 2WD8A 1WQ3A 1BMFD 2IUYA 1EP9A 1DFIA 3D7NA 5JC1A 2YYSA 2IY7A 4C3VA 2C5GA 3COVA 3TFOA 3HL0A 5CLQA 2VHVA 3A25A 2BFBA 3GLRA 4GBJA 4E08A 3G2KA 2AR0A 3D5EA 3PEFA 2OORA 1P5ZB 4CKYA 3CZ4A 2QD1A 1WXHA 2VYQA 4MVYA 4WZAA 2GO7A 1J22A 3QE4A 1ZWLA 4EECA 2AJCA 1FRNA 5DM70 2YY5A 2PLFA 3ND5A 1BE0A 4JZKA 3UM9A 1ECJA 5JANA 4RIFA 2BFEA 4CNBA 3WMWA 3I4FA 4YHHB 3LYHA 4P4NA 1KYXA 5M2QA 5GJBA 3D7LA 5JS6A 4MDYA 1UF9A 2CNBA 4M9RA 5ILGA 3BK7A 4C08A 5HR5A 1Z06A 3OVMA 4P81A 1X7XA 3KO8A 4GPEA 3JVDA 4KDEA 4CFYA 3Q72A 5FQOA 4LNUA 1N5JA 4S0ZA 1AZLA 4U9IS 3ZS8A 4EDHA 1OLUA 2WOJA 4IV8A 2BF4A 1QC5A 1E5QA 4G5XA 3ZWWA 1ODIA 1VC2A 3L4BC 3QFRA 3ZS9A 2ZIXB 2EOAA 2ZZKA 1JG2A 1PYDA 4ZCPA 4AYTA 4DSZA 2VTBB 2Z58A 1XLWA 3D6FA 3ZY4A 1QXSA 4JMPA 2FCAA 3HKBB 1Y3HA 5D5PA 1W1WA 2IF0A 3FFXA 3DFIA 1I94B 1NBMD 3ORQA 3RO7A 1GAWA 2AG0A 4U2DA 4QVKA 2E6KA 1G5TA 1RRFA 2IIBA 2OO7A 3LJKA 3PB3A 4NRDA 4OHBA 5A03A 3RV3A 5FUMA 4N8DA 4JJ6A 4AN1A 5CDFE 1L9KA 1N5DA 1XVAA 1YQDA 1E9AA 2VZ0A 1LX6A 2GWRA 2D2XA 3IP1A 3P8ZA 4PO3X 4WNYA 3WHKA 4EUEA 5JW6A 4UVGA 3GOHA 5EL0A 2JIRA 2AKYA 2PA3A 3E35A 1F3OA 1KRWA 4R2MA 2V6GA 5DN6D 1XB2A 2H2WA 1KEWA 1D6SA 4FMCB 2G9QA 3L6CA 4KGVA 3W8DA 4AY6A 4AS1A 3HGTA 4AFNA 1ZUNA 2J9FB 1Z0JA 2I6SA 1ZUD1 1JIUA 3AGPA 3U4QA 4XD7A 4WDRA 2Z83A 5JV5A 4QECA 1L5GB 4KR7A 4LKOA 4IUCS 1QFXA 1GZ5A 3OJEA 5BSEA 1C9EA 1PJAA 4KYTA 3BFVA 3ESAA 3S5UA 4LFAB 1ACMA 3QEOA 5D51S 2XUZA 4MV4A 2PX6A 3N9IA 1EI9A 1T9GS 3HLTA 1RXIA 3MW8A 4OJMX 3JZMA 4NYIR 5BT9A 3Q1LA 1TA0A 1Z88A 2RHJA 3TDNA 3U9LA 2Z9CA 4HPJB 4CG0A 4YRAA 3L4JA 3H5IA 3E3OA 5JO0A 5LU8A 1U9IC 3GDGA 4D9MA 3UT6A 1PQUA 7GPBA 2B5VA 2D0DA 4ENPA 4HAVA 3TPZA 1N0VC 2DQYA 3NB0A 3JW8A 5IBQA 2ZUUA 5HKAA 4QBTA 5E38A 1NG9A 3DMHA 3PKZA 4J7UA 4K6CA 4O2AF 5EWJA 2JI8A 4KV7A 4LCBA 1X3SA 1E6UA 1LEHA 4MCAA 1G8SA 1HWYA 4B9AA 2CL7X 1U2GA 3OLYA 3UG7A 1UMCB 2XB9A 3DL4A 3GVPA 3OJWA 4WKCA 5DOZA 1XD9A 3WDLA 3OWXA 2XVYA 4GRAA 1WV0A 1D0SA 1RWWA 3OFND 3CLRC 4M49A 5KJFA 2PR7A 4OI1A 2GCIA 4Y1GA 3TD2A 4J6EA 4PR3A 3ZGXA 1JKMA 1UT8A 2X4GA 3MJHA 4HRYA 4Q4JA 5TR9A 1G8AA 2XPCA 4B46A 4EVQA 1C1YA 3VVBA 1PDOA 3NHAA 3RGGA 4V02A 1CIVA 4JUDX 4D9FA 4EI9A 3T3OA 3BRWA 1EIWA 1OUMA 2OP1A 2Q28A 1DX6A 5HQJA 2OBNA 4A0FA 4RTQA 5ERGB 3SSMA 1GUFA 4IJ6A 4QNRA 1GWNA 4GE3A 4AX8A 4HAOA 1AGXA 1R6XA 2WBLC 2QGFA 4M8NE 4BYMA 1FDTA 5K4HA 2Q3EA 1TE2A 3EXIB 3L1UA 4H6PA 4OP2A 3U17A 3MK31 3QHPA 4BLVA 3BWCA 2BGMA 1LLUA 2NVWA 2R87A 2HH9A 3BSWA 3H9UA 4DANA 4F12A 4GOLD 3CZ9A 2VPZA 4LVOA 1S8OA 3FTPA 3RG2A 3IQGX 5GIPE 2EWMA 1EZ1A 1R12A 2FWRA 5EI5A 1GEEA 1DAFA 2OCBA 1XTTA 1I3LA 1R9NA 1T2VA 4CW7A 3JCZA 3HZOA 1G8HA 2C1ZA 1VKZA 1WXQA 3JZIA 1P2BA 1XQ6A 3BRQA 3DKVA 3E9MA 5E7QA 1WKCA 5FNVA 4B3IA 1NXPA 1J90A 4CM4A 1VYTA 2C04A 2EF0A 1SCIA 5CU7A 2NOAA 4XCQA 1IB0A 3ZG6A 4AY2A 5JLJA 3T4EA 3WA6A 3WBJA 2WU4A 3A3OA 3GJ7A 4H60A 4PS1A 5ARCA 3PEVA 1UBFA 3RBXA 2ZS8A 1PTJA 1J39A 2XADA 2A6PA 4F5DA 4Q05A 3UHJA 2WRZA 4N6GA 1XR3A 4UHJA 1I6KA 1ZMTA 3DF9A 2ODPA 1U1DA 2R751 4V24A 4LBYA 2C1XA 1DCMA 2QU8A 4C2AA 5KJCA 3X2EA 1T4DA 3NYIA 1YDWA 4KE7A 4OQEA 2C84A 4D3SA 2H7YA 2JAPA 3NLLA 4M55A 3OX1A 4CI0B 1TZBA 4CU5A 2KHZA 4WHMA 3BM5A 3HB5X 2DEUA 4YRMA 5ALUA 4HY3A 4NKRA 2XBUA 4M9ZA 1KOFA 1AUVA 4YAOA 1YHYA 5CP8A 3WL7A 3IOYA 5KYYB 1XNRB 1XMVA 2AD5A 1CY2A 3DZFA 3HU5A 2OXCA 3HCPA 3U26A 4CLEA 4W8OA 2PUAA 1WDKA 4BX0A 4CNQA 4QPCA 421PA 1LBEA 1X80B 2E4WA 1J2EA 4G1EB 1Q92A 3F4BA 4GOMD 4B2LA 1MB3A 1YVEI 4X95A 1L1EA 2MIIA 2MT9A 3M6FA 3AM3A 4HQFA 4KAAA 1FRFS 2JGNA 1BZYA 3A6DA 3ZIDA 1F7UA 5B3KA 3A3PA 3QX8A 2QWXA 2FPOA 2FEWB 4PNEA 3F6CA 1M10A 2JIBA 4GMDA 4MHOA 1ZU5A 2QX9A 3FCXA 1PBNA 2JD2A 4ZCQA 3FUTA 1EEXB 4DIKA 5JFGA 3JAKA 3USZA 3WDKA 1FSZA 3HJUA 1E2PA 1RXEA 3KL4A 5J4LA 5KTTA 3GK3A 1H6DA 2FN7A 3QFSA 2DLNA 3TH5A 1ZINA 4GVPA 4EP1A 3UAXA 4JEMA 1ZHHA 4KLCA 4DV1B 1E4OA 5E9QA 4IZIA 3I6QA 3OT1A 4YYEA 3KV3O 4FHCA 3L7LA 4MINA 1BEUB 4MARA 4DLRA 1T2AA 4MTLA 2WA1A 3TZ6A 3EGEA 1B3BA 1K6XA 3PXXA 2NP7A 3EIEA 5ICCA 3HP7A 1XK6A 2GPWA 3OM8A 4DMLA 3KLBA 1F4VA 3V4PB 1H0HA 3D7SA 2XUOA 1QH8B 2FI1A 3LVRE 2CZQA 2IXGA 3QOXA 4CU2A 3QLTA 1QUFA 4WBSA 3T1QA 4BGIA 4Q7MB 1KAEA 1IHYA 3TGWA 4BIMA 1HC7A 1OGJA 2B98A 3C3YA 4MKHA 3GLIB 1NRJB 1XBTA 2ZUFA 1TM7E 2BLNA 1G0NA 3IAXA 3H2YA 4DNOA 2I2DA 2IZ7A 4NE9A 3VKVA 1P7ZA 3AU9A 1SIUA 1VTKA 1SUIA 3DDZX 3HDTA 4IILA 1YC5A 1EX9A 1ZJYA 3KR0A 5B3JC 2QK4A 3OTOB 1SXPA 1EDDA 6REQB 3DHWC 1KYTA 2VNJA 4LSZA 4O8ZA 4KR0A 5BVHB 5HIIA 3JD2A 5BW8A 3GL9A 4PCAA 5AI0A 2A57A 2YL2A 1Y3DE 4HWRA 1YB6A 4MR7B 4C04A 4OBXA 2B4RO 3ZDDA 2Z8YM 3CNHA 1RI5A 4OYHA 1I6LA 4MYCA 1A95A 3RS8A 2O2XA 1TC1A 3JD0A 4B6JA 1N33B 3H3XA 1L8XA 1MO6A 2W2VA 2A9OA 4R9VA 1IPEA 2D13A 2MSCB 4LZAA 2XR1A 4U7FA 1HDZA 1M1NA 3SOPA 1GZHB 3IT3A 3EZ6A 1JR4A 4Q5IA 4HG2A 2GSWA 3ZY3A 3KJIA 4YMHA 1T8RA 1UDWA 5FWNA 3K16A 3AVTA 3IUEA 3CWQA 1XEXA 2EKLA 3BGSA 3MINB 3PD7A 3QVWA 1G4UR 4LCEA 1Y6RA 1QG2A 2UZ4A 2E55A 3MHPA 4QD3A 4ZT6A 5SZHB 3ROZA 4YV2A 2XX3A 2QRLA 4DGSA 1UBMS 1B16A 4HN9A 4RHFA 4EARA 2HPHA 1R0ZA 3DDWA 4A5SA 1EUQA 1GGFA 1JFFB 4JELA 3CSDA 4HWSA 2OOKA 2FMXA 1UDXA 4DBVO 2P0AA 5BNFA 2R84A 2JLYA 3ENVA 1E4YA 1UBLS 3G9UA 4LOHA 5F2EA 3OTGA 1ESZA 2BDTA 4DREA 3R3WA 1ZMRA 1KF0A 3F7MA 1H8HA 3RUEA 4F92B 4PRYA 2R6AA 3HDQA 4ER0A 3U7IA 4UM9D 2I6UA 2CW5A 4J75A 2QYHA 3LWZA 5FT9A 1G63A 5ER9A 2Y1DA 3ESDA 1QRTA 4I1RA 3NGLA 1I1OA 4MS4B 4S3MA 5FUYA 3EVEA 3HKCA 1N77A 1CY1A 3KRTA 2X5XA 4ED9A 4B74A 5HQ3B 1R7RA 3COYA 3GGOA 3JVVA 2QI9F 4WKGA 4Z1MA 4O2BF 3B53X 3C6XA 1L4HA 5KNDA 1DT5A 1NG1A 1PSDA 3CUVA 1JBKA 4K9NA 5F78A 4JYAB 3O1LA 1JLRA 3IC5A 1X9HA 4HYEA 4NJEA 4NOKA 4FLEA 3EGXA 3AOEA 2ADOA 3GC6A 2PXCA 3AKCA 4M7OA 1DJPA 3SMQA 4IUDS 1ZY2A 3WL5A 1O5TA 4CUZA 3VAAA 1JH8A 2YIVX 3O6VA 5TMDA 3JVUA 3KTAA 5ERXA 1D9XA 3TPFA 4E4TA 4EPWA 4IDPA 1T2UA 1TB4A 1TM2A 2GH1A 2R7KA 3AW9A 4MICA 4OXKA 5T67A 3COJA 1Z45A 1O3YA 4LBWA 1DRJA 5IG2A 1C0PA 1E59A 1QFSA 2P3LA 1QV7A 3PHLA 3QA9A 4MO2A 4KR9A 3ADDA 1DLIA 1KXZA 4YIHA 5HIJA 3H13A 2GPSA 4GMKA 4ENQA 4M22A 3WIBA 2WJJA 4GWLA 4O1IA 3G0OA 3BUSA 5AFSA 1RKUA 2P2GA 4R9SA 2O3QA 1H0KA 2FP3A 2GR9A 3E03A 2E49A 3LUHA 2NWQA 2P78A 2PLRA 2Q4OA 3OY7A 5EXPA 3A7DA 5C3UA 3UMCA 4DVGA 3B8EA 1NFRA 2DBRA 4OG2A 2X2PA 4XB1A 2W42A 3QEBZ 3CRW1 3F2VA 1S2DA 1OVMA 4FFMA 4XZ3A 5EA2A 1EAYA 1RWKA 3RTEA 2AQ8A 1NI5A 2W93A 4GOOD 5CTAA 2VA8A 1FQKA 3K1YA 4O4LA 4V3BA 3Q9UA 2D1SA 1E69A 2A1UB 1Z6XA 2UVPA 3INNA 4LE2A 2WLSA 3R5SA 4NFHA 2G9NA 3SHVA 2C58A 2OCGA 3QXJA 1H5NA 1LI4A 1NSFA 1R4MA 2NZXA 2PT6A 1EP3B 3AY7A 3HCNA 3L8EA 1DWUA 1ORVA 1WBJB 2JJYA 3MTGA 4MRMB 4BNMA 4EHAA 2R86A 3FOBA 3HACA 2XT9A 1V5EA 4IKEA 1KTVA 3LX6A 3K4QA 5A71A 2HA2A 1GAJA 2J5XA 2OKGA 2XTJA 2WE8A 3ZDAA 3PQ5A 1HQDA 2UYYA 4YV1A 5C51B 4WCFC 4ZJUA 5IT4A 5FOQA 5WRFA 1YK1A 2JS7A 2RHRA 3CF4A 5GVRA 1Z0ZA 4ARBA 5KHOC 4CV3A 1Q84A 2HSWA 4O1MA 2V58A 2IFTA 2VT6A 2NU7A 4NFLA 1HY3A 4RY8A 2ZK7A 4TVSA 5JDIA 2KMLA 5CB4B 3L6RA 1G6OA 2H4YA 1NVWQ 3RSSA 3WP0A 5LOVB 4ISCA 1GZ6A 3V3TA 4JT2A 1Z7GA 4M89A 3UMMA 3TG8A 1BD3A 4HH1A 5TT1A 1KETA 4YEDA 4AJKA 2V9ZA 5JVDF 3MCZA 1DSSG 2HNBA 13PKA 4FZJA 4DJTA 5GJWC 1XYGA 5I8ZA 5G0SA 2PBLA 2DQZA 3GUHA 1NN1A 5AKJA 3W5HA 1EFUA 2HLHA 1SBYA 2ZG6A 5CA1B 3JQFA 3U9TA 2CNWA 4YGYA 2CXRA 5EZYF 4BMVA 3GGPA 1PSWA 4MB2A 5CTJA 4TWBA 3B3QA 2QM7A 5I8PA 4I1YA 5B3LA 3WLHA 5GY7A 4W9MC 1D2HA 1VJ0A 3L7CA 4ZAWA 4WK2B 2A0YA 3ZH9B 4ZDIA 2NYRA 2VDUE 1P1RA 2C5AA 4US2R 2XVZA 3AEKA 3ROTA 3TLZA 3T3MB 4RPHA 1I3MA 2CCJA 2HOQA 4BBZA 4HKTA 3DQZA 2J3IA 5JYEA 3QOWA 1YR1A 3I8OA 2WE7A 4YUVA 5TGZA 3BWYA 2J5RA 3ZLBA 4A1OA 4UHHA 2PU7A 3LAWA 4XW2A 2QUIA 3CT4A 1ZIXA 3ETLA 4F1JA 4E31A 4DEVA 3L43A 1I5RA 3SBEA 1VG8A 1PR9A 2RHGB 4II7A 1UBGA 2Y93A 3AXTA 1NQ5A 1KAMA 2Q27A 3L8ZA 3I61A 4EPXA 4LZWA 4TMKA 1IEWA 3IEXA 2Z3ZA 1D6NA 4R1QA 1KI3A 4X64B 2O8BA 2NXJA 2VLIA 1W4BA 5IF9A 3PYXA 4KQIA 3N58A 2YOFA 1ZGCA 5EKUA 1EXVA 1GA6A 1JQ3A 3QWBA 1BCRB 4URFA 3D5TA 4P0PB 1G6HA 3CR3C 3P4XA 4GBMA 1KI1A 4U8HA 4WUTA 5IPFA 2LE0A 3IHLA 4LJ4A 4WUVA 1N9GA 3PI6A 3UV3A 4ITRC 2RE8A 4L73A 2ZITA 2P9HA 1L5SA 2YW2A 2AL7A 1EU1A 3BCHA 4L75A 3RYFA 4B6GA 1YU9A 1CD5A 1LBHA 2VFAA 4FJ0A 3KAJA 3A3KA 4IDDA 4RD6A 4G9GA 4OHOA 4GXQA 4WCFB 1EVQA 5ALDA 3IB3A 3GLIE 2UU9B 1M1YE 1UZUA 1TO6A 1T2DA 1W96A 2OGZA 2YZKA 3LO8A 4JH0A 4L22A 1Z8DA 2X14A 4PC1A 5EP4A 3PJFA 3MWEB 1O2DA 3UENA 2VP6A 2IH2A 1FFWA 3FN4A 4R0MA 2ST1A 3G5LA 4OHXA 1V6SA 1SGWA 4KXLA 4KQ2A 3TLEA 2DUUA 2FPLA 5CFOA 2HIGA 3HUTA 2JH3A 1XNQB 3VJKA 1W88A 5FBQB 1VE3A 1LFAA 2NO0A 1XLTA 2SNIE 4KJZA 3CB2A 3TOXA 2B3DA 1TUGA 2XRFA 1IH8A 3AEUB 2ZRIA 4GL4A 1LQUA 5AVZA 2YCBA 5KU7A 5HUJA 2VNHA 3LT1A 5HK8A 1BD4A 4D9GA 5JXHA 1WM1A 1IWOA 4G89A 1ESNA 1GPUA 1G291 1KI4A 4P3KA 3FHCB 3JRXA 2V7QD 2FFJA 4RENA 5D7NA 1LSOA 3GLFB 1MGOA 1RBZA 4OGWA 1JHYA 4OPMA 4CFZA 3MG9A 1BXGB 3IIKA 1NBAA 4BKQA 3RWBA 4YAIA 2ZPTX 1M5RA 5LC1A 2VNKA 3ZLVA 1AUQA 1NUUA 4F6RB 3OC0A 4BB0A 5I5EA 2KLBA 2ANBA 3LBYA 2PMCA 3AERA 4U7TB 2JGFA 4CEHA 2QLLA 3CXRA 1E6KA 2B7LA 1GPMA 2I99A 5EJIA 2UZ0A 4JLPA 3RCBA 1K98A 3MRTA 4UDXX 3WX0A 4RLSA 1YQTA 4J9VA 2X8JB 1BNCA 4X1YB 2ATEA 2FPMA 1E3EA 5CJPA 1YZTA 2JCSA 3AUTA 3DB1A 3RTDA 3OM0A 1XVLA 3BN3A 3LPDA 4H7JA 1BRTA 5J9FA 3KFVA 4EZEA 2GYWA 4UHCA 1POXA 4BO5A 3V2UA 1KVUA 3I73A 4ZDWA 2EYUA 1TJ3A 2BFNA 4J49A 4D6PA 3SF0A 2JDID 1DFGA 2GFHA 3RJTA 4DPMA 1ZD1A 3LCVB 3O2JA 5JQGA 1ZBQA 1I13A 1YQEA 1FTWA 2R1TB 4JFRA 1Q1QA 1J00A 1U0GA 5KINB 1AKWA 5FUXA 4EF6A 3GLUA 2C5HA 1KAOA 1USIA 2IHVA 2L0XA 3ITEA 5G1PA 4BVBA 4C0SA 2Q07A 3F6YA 1DIBA 1A9XB 4YRNA 3IVCA 3FA2A 1GGMA 4AROA 2EGUA 4ZV7A 4DQLA 1IYZA 1R74A 4UZSA 2ZSHA 3ER9A 5CLIA 2A30A 3TW0A 1FC0A 1IMOA 2JJ1D 4NABA 4TKVA 1W0KA 3ZE8A 4AKHA 1L8AA 1CUCA 2PTHA 5SICE 4EEZA 1XELA 2HC9A 4IYRA 1MZPA 5KIAA 3MT8A 3IVRA 4RMNA 3ROXA 3ROQA 3RTGA 1P2SA 4QQFA 3UJ6A 3NAMA 2P27A 1X9GA 5F21A 4RYDA 3N2NA 1RIFA 2WT9A 3B5JA 4GXRA 4PZLA 4XWYA 5IFKA 1A5BB 1BMTA 2ILVA 3IAS1 4TVOA 5JG7A 1T5HX 1B0PA 1HSZA 5HCNA 3S5JA 2BSAA 4JJFA 2VAWA 2II6A 3BTOA 5FTJA 4PFQA 3T5DA 3WFIA 1TM4E 3QW2A 1NGSA 4JCCA 4EMTA 4WXMA 1FFBA 3HR7A 4JSYA 4PLYA 4ZAGA 3WLJA 3WVNA 2EBWA 2G08A 4CHTA 1JFTA 5IJ9B 4CKWA 1F2DA 2HMUA 1D8TA 2G70A 1L6RA 5NLLA 4DQKA 4JP2A 1X94A 1ZAYA 1PNRA 2QVGA 4KMSA 5FI1B 4C4OA 5K20A 1R1DA 1G4AE 2Q3CA 2XMQA 1SXJB 3KUXA 3VTZA 1XPOA 3FTNA 4HUQA 4N5LA 3ZY2A 2EHDA 3WIDA 3IBSA 3NNDA 2I2FA 1VLLA 2CK3A 3STWA 3QXSA 2ZSBA 4LUCA 1PWZA 4MVJM 2I67A 1JQDA 1X74A 3A6JA 5E6UB 1CU1A 4N76A 1SD5A 3Q11A 1CY6A 5DGCA 3VR6D 4E1BA 1DG1G 1GFWA 1R3DA 3SE0A 2R8RA 1G8FA 2EJWA 1SK8A 3C3DA 3KL2A 2R60A 4ZMSA 2RHBA 3I6BA 2NUPA 4CMHA 3G82C 2QRUA 3D4IA 2VJAA 1A27A 1CX9B 5HIMA 3QBDA 5CAEB 2UYQA 4P7GA 3U40A 1ISFA 2H1FA 4MQUA 4XVHA 4O1HA 2QX8A 2WWGA 1FLVA 3BMOB 3PPIA 2FSSA 4HLCA 4RESA 2C1EA 4LSMA 1W8DA 3DMFA 1DP4A 4EIWA 2FK8A 1KJQA 3CE9A 1UBOS 1CR6A 2PU5A 3ZHCA 1B8VA 3FPSA 3OZEA 5J1SB 4LF6B 1ZOPA 3Q6MA 2ZRPA 1B0ZA 1RE1A 3KKMA 1U7PA 4LGVA 1U2TA 1U1FA 4MUFA 4RU1A 4TXNA 1J21A 4GU5A 2C4VA 5DYTA 1Q17A 5BYBA 3TTYA 1CEEA 1KK2A 2B0JA 4E2YA 4OUKX 1TTHA 1Y0BA 2IWHA 2GZAA 4NBLA 3RFTA 2YJ5A 2H0QA 3DPSA 1G18A 2H11A 2AIRA 2PLNA 5CLGA 5H83A 1OB2A 1HEIA 3NDBB 5DYGA 3QBVA 4U63A 1B2LA 2E7ZA 4O2BA 3ZXYA 3PJDA 4Q4AB 1ODLA 1TJPB 4CZ2A 1CXZA 5F2KA 1Z2OX 3UMBA 2YTZA 2FQYA 1H3NA 2QGNA 4HDQB 3LLMA 3H1FA 4IJQA 4P4SA 4QVIA 2LRHA 4XAQA 4LRTB 4ASUD 4BLPA 3GARA 2C2MA 1XEWX 2G40A 3CUWA 4L4ZA 1XHEA 4NECA 4RKEA 1QHYA 3L02A 4KX5A 3ZV4A 4B3HA 4C78A 1U8YA 4LK3A 3QMPA 3PUKA 1LDBA 1V7PC 1Z74A 3HH8A 3N0XA 1HLFA 4POAA 4XI9A 3CF0A 3L6BA 3PZRA 2G4VA 3BEDA 1GKKA 3FOAA 5FPHA 5JBIA 3OO1A 4RA9A 3ROKA 1T3LA 5JNTA 4RPCA 1VCHA 1CR0A 3GFOA 2JLVA 2JLBA 4R8SA 4I3FA 4X92A 1FDSA 4EUSA 1S4MA 3O03A 4ETMA 3OU6A 2ARKA 2WAYA 3AR2A 3LUCA 2VJLA 3G9XA 1DBPA 4FN4A 4YGXB 4OFXA 2OCDA 2LXNA 4TMZA 1LK0A 2C0QA 3ICCA 1UZMA 1J8VA 2BGIA 4ZCIA 1JG3A 1IZ9A 1TEZA 2HDOA 4OI2A 1MT0A 4DMHA 1BEEA 4AZ3A 2ODNA 1IRIA 1ECLA 1UOQA 2D5CA 2HEGA 3EE6A 2W2TA 5KC8A 1GNRA 5LP6C 3BXPA 2M2IA 4A2WA 4ZCTA 2QTHA 4IG4A 2QUAA 4IWNA 2HRCA 5FBLB 2AZTA 3WRVA 1EGQA 4QDOA 3EVDA 3UXHA 4ADSG 4UTOA 3U7QB 4DN6A 1R8SA 3GJ4A 1XEAA 3D7MA 3N2YA 1NYLA 4KAFA 4RD4A 2X2FA 2OXIA 3I2HA 4DCOA 2C2OA 1G3IA 5AQ1A 1Q0HA 1N2HA 1Z8NA 3DXFA 3WSTA 1KZ9A 1M2OA 5JAZA 3O47A 5IHXA 1FXUA 1IZ0A 4MVWA 4HH3C 2AI1A 4OGLA 2Z1MA 1U99A 1D5CA 3WLQA 2JLSA 3PFHA 4MWOA 3R7NA 2WYIA 3GCXA 2R1VB 1PG0A 3FCUB 3ROFA 3IAFA 1W9HA 1F0YA 3IIEA 4MGKR 1NF2A 2BFAA 4GR9A 4GO1A 4IXWA 4KQMA 3VBEA 3R3VA 4L57A 3IURA 1ZK0A 1SK9A 2IZZA 1D2NA 1DB3A 2FETA 1W8IA 2J3HA 4WWHA 3PYLA 5JPIA 1UOEA 4WSOA 1SVIA 2ONJA 5LKAA 4AB1A 4B40A 2EP5A 3KVNA 4GC9A 4RAQA 4ZEMA 1FUUA 4XE5A 5KVVA 5LQRA 5DXFA 2QJWA 3KKLA 2CXPA 3ODPA 4GZMA 2XUIA 5KREA 2X5OA 5K3BA 3MJFA 4LJ6A 1JUDA 5IBCA 4RZ3A 1RYMA 2O07A 1BVUA 2GQ0A 1C2TA 2XYGA 3MPOA 3OE4A 3KPYA 3MB8A 5LMZA 3GLFE 5CA0B 4DM3A 2PL5A 3Q3JB 1DVRA 4YJFA 3H17A 3SC2B 3E1SA 5G4KB 5DLPA 4HNHA 1WSDA 3FNQA 4G0ZA 2OR3A 1O5OA 3CG0A 3FWPA 2BI7A 4J1QA 3V4RA 1TA9A 4TL8A 1A98A 5FL7A 3BA6A 3PHBE 4FX5A 4WBXC 1VLZA 1WPRA 4W9NA 4LV8B 4TS1A 3D2CA 2XUAA 4BWFB 3PS9A 5E1MA 3RYIB 4BEVA 5CVUA 5U1PA 4ENTA 5B2EA 1IUNA 2JJ2A 3PNPA 4E5SA 4YP7A 3ESZA 4F2WA 4PX3A 1M6VA 1SRRA 2WKQA 4G09A 1TJYA 3WB9A 5DBHX 1VKHA 4M1ZA 1FFXB 4FWIB 3GUUA 5CDYA 2IEBA 4F0JA 1W0KD 5JDCA 3H3FA 1QKKA 1INLA 3OCUA 4XFKA 3SOZA 3Q2IA 3GLKA 3LGAA 3FW1A 2W6PA 3NHFA 4Q9AA 3RS9A 3TZKA 4GM1A 3WDSA 3PL5A 3KQVA 4PQRA 3PKJA 1TUBB 4EA7A