1RXCA

E. coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
246
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 246
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxcA00
4DA8A 1V45E 4X24A 4MARA 3OZDA 3P0FA 1Z39A 1Y6RA 1Z38A 5F7XA 2HN9A 2OXFA 3U40A 4R31A 4TTIA 4OGKA 3PHCA 3TL6A 1Y1SA 4OGLA 3BL6A 1I80A 1V4NA 3KUKA 5C80A 3EUEA 1T0UA 4OJTA 1T8YA 4F3CA 1PR0A 1WTAA 2OC9A 3E0QA 1RXUA 1ODJA 4OF4A 1K27A 4TTAA 4QAQA 1U1CA 3SCZA 1LV8A 4MCHA 4M1EA 1JDUA 1CG6A 1M73E 1JYSA 3ODGA 1V3QE 1VMKA 1V41E 3PNSA 3DF9A 1VHWA 4NY1A 1RXSA 1JDTA 1Z36A 1Z5PA 1PR6A 1Y6QA 3QPBA 3OOHA 4M7WA 5F7ZA 4WKCA 1Q1GA 4WKOA 4DANA 4F2PA 4DA6A 1RR6A 4TXJA 4BMYA 3GGSA 1TD1A 1SD1A 3MB8A 4G41A 1ULBA 1VFNA 1NC1A 1T8SA 4E1VA 2H8GA 3UAVA 4OEHA 3KHSA 5CYGA 1U1FA 4GLFA 4D98A 1U1EA 3OZCA 1JPVA 1JDZA 1C3XA 4U2KA 4TXHA 1K9SA 4K6OA 1Z5NA 5B7GA 2QTGA 5EUBA 4QEZA 1PR2A 1RXCA 4TXLA 1PW7A 5EPUA 5ETJA 4L5AA 3E9RA 3PHBE 4I2VA 4LKRA 2HRDA 4GMHA 3DPSA 3NM5A 2A0XA 4DA7A 4TS3A 4PR3A 1PF7E 1OVGA 2XRFA 5IFKA 3ENZA 5DK6A 1A9PA 5F78A 1PWYE 5IU6A 5I3CA 1B8NA 2I8AA 1K3FA 1YRYE 1PBNA 5FAKA 5B7PA 1JE1A 1OTYA 5B7QA 1V2HE 1Y1TA 4D9HA 3F8WA 4TXMA 3IOMA 1Z37A 5F7JA 1YQQA 2I4TA 1A9SA 2P4SA 2QTTA 1ODKA 1SQ6A 4LNAA 1A9OA 1A9TA 5EFOA 1OU4A 2AI2A 4YJKA 1OV6A 4R2XA 3NBQA 1ULAA 5F76A 1A69A 4YO8A 4TTJA 4DA0A 5CCEA 2QSUA 2ON6A 4DAEA 4LDNA 3C74A 1OUMA 3LGSA 4H1TA 4GLJA 1PK7A 3OOEA 2IQ5A 4JWTA 4WKPA 1PR4A 4G89A 3OZEA 3OF3A 2ISCA 4G8JA 1PR1A 4QATA 3LBAA 4YNBA 3UAYA 3MMSA 2HWUA 4MCIA 4LZWA 4WKBA 3ONVA 4D8XA 3LA8A 4RJ2A 4WKNA 1ZL2A 4ECEA 2OECA 3BGSA 2AI3A 1RYZA 4EB8A 5F77A 4QFBA 1TCVA 3IEXA 1TGVA 1SJ9A 3UAZA 2A8YA 5F7OA 1OTXA 1T8RA 5CXQA 1RCTE 3PNPA 2AI1A 3T94A 1RSZA 1YBFA 4YMLA 4BMXA 4OY3A 3FNQA 3OZBA 1N3IA 2QPLA 3K8OE 4JP5A 4DABA 3NM4A 1JE0A 4D8YA 1ODIA 3KVRA 4FFSA 3OCCA 3FAZA 4F1WA 1ODLA 1U1DA 4TS9A 3DP9A 2Q7OE 3O4VA 1Y1QA 1NC3A 5CCDA 3UAWA 4DARA 1PK9A 3BSFA 3INYA 4L6IA 4LNHA 4L5CA 3FB1A 4F2WA 1YR3A 1TGYA 3GB9A 3FOWA 1Y1RA 3FUCA 3EMVA 5CYFA 2PGAA 1YQUA 1JDSA 4BN0A 3EUFA 2GUWA 1LX7A 1RFGE 1A9RA 1TCUA 5F73A 1XE3A 3K8QA 5K1ZA 4PNPA 4F3KA 1ZOSA 1PKEA 5CXSA 4DAOA 4EARA 3EEIA 1VHJA 1A9QA 3UT6A 1JP7A 3BJEA 1T8WA 5KB3A 1Z34A 2A0WA 4D8VA 4UC0A 4L5YA 3NM6B 4JOSA 4M3NA 3DJFA 2QDKA 3P0EA 3DDOA 5JPCA 1RT9A 4BMZA 4NS1A 3KU4A 1Z33A 2B94A 1Z5OA 4QARA 1FXUA 1B8OA 4GKAA 1LVUA 4TYMA 1Z35A 1JDVA 2RJ3A 3D1VA 1ECPA 4P54A 5B7NA 3KVYA 1QE5A 3O6VA 4L0MA 3E9ZA 1PR5A 2OC4A 4TXNA 2HSWA 4IP0A 3FWPA 4R2WA 1NW4A 1RXYA 2BSXA 1SD2A 4KN5A 1CB0A 1U1GA 3UAXA 3KVVA 3OPVA 1V48A 4QASA 2AC7A 2A0YA 4NSNA 1G2OA
chains in the Genus database with same CATH superfamily
4WIAA 3C15C 4Q9KA 1P31A 1D6JA 4WLEA 1X3SA 3KKZA 1X80A 1VCMA 3T5GA 3RUEA 1MEEA 1AKEA 1PV2A 2R60A 4IIEA 2GAFA 2CJPA 4MARA 4UE3S 2FZKA 4QGSA 4G5OA 2C95A 4FYPA 4OHZA 4Q24A 2WNIA 3I2IA 1YB1A 2WAOA 4WBSA 5KHOC 5GPBA 3NIGB 1ESNA 4MLPA 1Y33E 3QXSA 4ZCPA 3KL2A 1N0IA 2NU7B 1CS4C 4EWLA 3H8JA 2DH6A 1FNMA 2AFVA 1E2JA 3N2KB 1JW9B 1PVVA 4WXPA 2FZCA 5CH8A 1RZRA 2VQ6A 1G3IA 3DB1A 2G6TA 3TDMA 2XLCA 1H4TA 2VDMB 2QP9X 4HP8A 3THWB 1A97A 1Z4PX 5H02A 4JJAA 4FGLA 4DTIA 5IH7A 4XXHA 2VK4A 4I9NA 2WK1A 2ZR7A 5G4KB 3UCXA 3VAZA 1JEYB 3PHJA 4OGLA 4C6TB 4LMAA 1U02A 2Z56A 1V4NA 2QD1A 4HN4B 4M0EA 6ABPA 5EKTA 3EUEA 3IHKA 4HX5A 1QR6A 2GASA 3HCCA 2X3UA 1CEYA 2OHJA 3E35A 4PTLA 4ZQHA 1RWOA 3BD6A 4UAUA 5DYWA 2NPFA 3VDXA 4D9IA 421PA 2J07A 2DWQA 1T8YA 3LRTA 4G9GA 1L9XA 3U3KA 2SICE 4EYQA 3BUSA 4WBNA 3DA8A 1CKEA 1YZGA 3U80A 1FSGA 3D3WA 1F9EA 1MFZA 1ZCJA 3CX4A 1E20A 3QVWA 5JAMA 4ZCRA 3EA5A 4RM3A 5IDVA 2X7JA 3OF5A 3PXEA 5TQ0B 1GQYA 4YRLA 2W2MA 2VLBA 3G1UA 1ELOA 3U5ZB 3GJ0A 2G1AA 4QFDA 1PD1A 2IV7A 3TM4A 3TQCA 1JR3D 2HFKA 3SCZA 3T7EA 3EHEA 4YP9A 1HDOA 2XE6A 5BORA 4CRWB 4URZR 1GUBA 2JIQA 4IWNA 4QIHA 4UCWA 5AM5A 4WVFA 5AMXA 1MV8A 3ENNA 3HP4A 4IRUB 4L27A 4MLCA 1B43A 1JYSA 4BNGA 1NR5A 2GWHA 3ID6C 4RDHA 2Q8QA 4UU7A 4XUGB 4W8GA 1X9IA 3HKCA 4US1R 4G3XA 3WVNA 1GZ3A 1ZG3A 1FS4A 4N9QA 3RTGA 2V0GA 4IDNA 2Z2KA 3JQAB 1JDTA 3DFMA 1E5XA 3GLRA 4OQDA 4OQ4A 3T5PA 3SHQA 3GP3A 1Q0QA 1DRJA 1Y5IA 3C3MA 4JJ6A 4CM5A 2ZZNA 3PT5A 4LYJA 5DN6A 5F3DA 3BWBA 3DTVD 2ZZKA 4RIEA 3TL3A 4LF6B 1WL8A 1NQTA 2A5DA 1RBMA 2ZS8A 4DA6A 3K0EA 1WV0A 4M60A 1U90A 2I4RA 3L07A 2VYVA 4YACA 2OESA 1OXBB 3ECAA 4RF4A 4WK0B 2OD7A 2KS6A 1ZH0A 1ZBQA 2NGRA 1KVQA 3B1JA 4H3SA 4J16C 4LJSA 2GB4A 4KW7A 2ZI4A 5IJ9B 2BYTA 1RCUA 3G9TA 1XXHB 2I3AA 2O2YA 4LDAA 4ZTZB 3OE5A 3ZHQA 1KF0A 3H2KA 1NVVR 2OFOA 1DV2A 1LX6A 3J80A 1IPHA 4JUAA 1SCQA 4E22A 2QSJA 1GGMA 2I54A 2C9OA 2Q5EA 4L9RA 5JFTA 3Q98A 3KYDA 4U2KA 1DBQA 2Q62A 1NYTA 1QDLB 3PNVA 2AKAB 3RJ9A 1QU2A 4E5UA 4LSGA 1DGQA 3WGJA 5EUBA 2YMQA 1E1CA 2KHZA 3ORSA 2JBAB 2IITA 2P8SA 4B84A 3O3NB 5FDFA 2RD2A 1GU7A 1P4GA 3ZBPA 1TAGA 1M2VA 1PW7A 5IVPA 5C1PA 4JKOA 4AY6A 4ZI7A 4Z9FA 4M0PA 1ADJA 3PEYA 3ZXYA 4RHXA 4RH3A 5IEBA 2UYYA 1U8ZA 1FTYA 5CH3A 4U7TB 3W2IA 5F98A 2UYQA 1Z2OX 4FWTA 3KR2A 1LSUA 3PFFA 1NJFA 2E6KA 1TNDA 4BNZA 7MHTA 1QHXA 2ORVA 1G20B 3CS3A 1PNTA 3R3VA 3O82A 2M6LA 5LZ5A 2Q46A 3CN7A 5ALDA 3BCUA 4RIHA 5AHOA 4C06A 4DUPA 3RR2A 3CLVA 3RYFB 3COVA 3OLYA 1Z12A 3L9WA 2I3BA 4R9NA 3E5NA 3WWYA 4X7MA 1L8QA 2PUVA 1G6Q1 3LHKA 4MR8A 4M1OA 2RI6A 3PVCA 2O3QA 4KPYA 1KYZA 4KE9A 3ST7A 3K6SA 4X00A 1G38A 1CZLA 1CBUA 2OM6A 3E84A 5LDHA 4QGGA 1E4EA 2Z1NA 5FPPA 4LF4B 3OCYA 4WN9A 1ZR4A 1ECCA 4O4HA 1A7KA 2MDTA 4PIMA 1G2QA 2VBFA 5D3MA 1DOHA 1SGWA 3I37X 2OM2A 4QU0A 3RVJA 3EGEA 1T0JB 2ZR0A 1ZFNA 3EVAA 1W30A 2VJPA 2PUGA 4JL8A 4UD2A 2O8BA 2PZ8A 1IHYA 3TKLA 2JK0A 2QTCA 5JXJA 5KREA 1RJFA 4GPZA 4DV7B 1YJBA 1D2AA 2CDBA 3IKMB 3WLTA 4DWVA 3U4QB 5EERA 4ZYLA 2XQGA 2Z8YM 1EQ2A 4HAIA 1F38A 1O0BA 1YQDA 2PBFA 3OQ6A 3DKVA 2GD6A 5DPMA 4ETNA 3F8WA 2HPZA 2P69A 3AGPA 5AJTA 5DGTA 2XNHA 2J5XA 2FXVA 4JSYA 4NZ9A 4N8EA 2JI7A 2BF7A 3TZCA 5K45A 4KR7A 1R10A 4H18A 3H11A 4BJ3A 4EHIA 2I4TA 4DLPA 1WXHA 5JQWA 1UP4A 4UEWA 3RSQA 2HGZA 4I3HA 1JN0A 3VYUB 1QMGA 4Z6KA 2OO3A 3M6IA 1CTQA 2VHCA 3L46A 1BD4A 4PSCA 1SXJE 4I7EA 4TT3D 2W5UA 3OM0A 4R1UA 4B9AA 4OHFA 3OM8A 3S7TA 3VQTA 3PQ3A 4JVNA 2OT3B 3MJSA 3WS7A 3T3DA 2VT3A 4NDNE 2MSKA 4RD1A 1YZ3A 3CIOA 3GGOA 3HWX1 1A7JA 5EIBD 1M72A 2VG8A 3ADOA 2QLBA 2QVGA 4GG1A 3HO6A 4MGZR 4CL0A 2VCEA 3HN6A 1OE0A 4OMFG 4Q47A 4IIGA 2QLTA 2WJGA 4YO8A 4C7JA 2ATIA 3DFZA 1J0CA 3LT5A 3TPFA 2NV2B 3Q7TA 3ZNPA 4D56A 4ZANA 5BVGB 5J4HA 2Q4EA 2A7QA 2VQSA 5CCEA 2AH5A 2VZEA 4P31A 1Y98A 4Q4JA 4E5SA 2WTEA 3MYYA 4R54A 4UBNA 5E1BA 3RUHA 1HTWA 3LGSA 3TWOA 4CIVA 1R0SA 2ZTLA 1Z88A 1J1ZA 3TO5A 1Q7GA 1GZ6A 1DRKA 1V16A 1WCIB 4PSUA 2GETA 1ZCZA 4PYLA 2XGOA 3RU7A 1UPAA 2HB6A 2ENUA 1Z7YA 3L92A 3O26A 4IBOA 4KVGA 2NG1A 5DBEX 3P2JA 4YLEA 3DDZX 4DCPA 3ZCVA 2CL5A 1NKSA 4QHSA 3RV4A 1QKIA 2CXUA 3BGOS 2HWYA 2COKA 5ECYA 4D9CA 5KQSA 1DKRA 3G2PA 1PFYA 4D1YA 4G0WA 4BQIA 4G8JA 1MB4A 3U3DA 3V4FA 2FPXA 1HNWB 1P2VA 1G6KA 1M2NA 2WWTA 2WHPB 2YJ6A 2I2XB 3HVKA 1PS0A 2W8BB 1AU9A 4YCBA 5AUOB 1BMFA 1UBMS 3U1VA 5BW4A 2ZS7A 2ZYTX 3MMPA 4FE4A 4H17A 3ZGVA 4D7AA 2OO5A 4FDMA 4Z1MD 3A3YA 3DFKA 1T5DX 1UIRA 1K66A 3KEFA 5JVDA 3DBLB 2ZXEA 4BJ5A 4DR4B 5DBGA 2HO5A 4XCQA 3AUJB 2B1QA 3H97A 5K9ZA 4CM8B 3VU9B 2CB9A 3OTQA 2QTWB 3GR6A 3MD9A 3TZHA 2OQVA 4DCGA 3FTPA 3M1YA 4PPQA 3Q7PA 3RAJA 2ZSAA 4HQRA 4OH7A 4KRXA 4U7WA 4WE3A 2A5LA 1FFYA 3LDHA 4F11A 2BP7B 4AJOA 5BWNA 3CLSC 4HLUC 4TYQA 3ISTA 3M6WA 3W3ZB 2V7PA 4I99A 2N1BA 4ND8B 4AG6A 3C2QA 3DNPA 5EE1A 1Z0JA 4A0GA 3PC4A 1IB0A 2OQRA 1XBTA 3ABQB 4YRJA 2QYHA 4B35A 5F7OA 4MW6A 1JR3E 5K8VA 2P6PA 3OIYA 5EKUA 3VA7A 4JLVA 4DV6B 2YJGA 3P9SA 3NJ4A 4YP1A 2D5AA 3BHIA 2X3FA 4QA9A 2FFQA 4KR9A 4YECA 3ICPA 4UUPA 1M83A 1KP3A 2GEVA 2WSBA 3EOZA 4ERXA 3FMOB 1Z83A 1BQ4A 2XZPA 1YVUA 4O33A 2O2XA 2NU8A 1J24A 1QK4A 2A84A 5BWCA 4D46A 1PZNA 3FNQA 4DA9A 3AHHA 3PLAE 3SLRA 3GY0A 1E96A 2Z09A 2D8MA 1JZSA 2EJCA 2F1JA 3K8OE 3A2MA 4JP5A 3V1KA 1R9GA 1G4AE 4IXTA 3W4IA 3ZQJA 4YJ2F 2P0EA 2Y92A 2V0NA 4JLMA 4X60A 4DABA 3LU1A 4JUDX 3COSA 4MPJA 2FP3A 2HIAA 3X3HA 3P0JA 1FJXA 3MJCA 2WDPA 4OQQA 2ID9A 1PDOA 1XHFA 1N0HA 1U2GA 2GGSA 2Q9BA 2F90A 1FFGA 3QVVA 1CLEA 5JTUA 2R65A 1H4QA 2IUSA 4EX6A 3PWTA 4L4RA 5FNVA 1OREA 5KTRA 4FNGA 3AZOA 4L7QA 1CZUA 3OLQA 4BNLA 3JYQA 5L40A 1DO8A 1HZJA 2EJUA 2VXBA 3HN7A 3MMZA 2G04A 4Y9RA 4NFLA 4X1YA 3W2HA 1QFSA 1QRDA 1K08A 1TT5B 2EF0A 4C4ZA 3VU0A 3WGVA 3IA2A 2DC1A 1ZUNB 3QYFA 4FR0A 4M1MA 5E4JA 3PNKA 2XF8A 4F3TA 4Q18A 4DSTA 1EJ0A 4L3VA 3Q1LA 3E9MA 4DCMA 1EHYA 1B8VA 1QYCA 2WWFA 3W3AD 3I5MA 1UAGA 1FDIA 4MLZA 1V1MB 3TH5A 2YVAA 3IPCA 5JCPA 1W7AA 3K3PA 4B3CA 1KJIA 3OIDA 1D2EA 2C2BA 2OHIA 2B5VA 3CPSA 4Z0PA 3RTBA 5I4BA 1SZCA 2GD0A 2WUWE 3UA3A 2XCTB 2QL5A 3AFIA 3CF6R 2G76A 2G7ZA 4IG4A 4IIHA 4D44A 2NYRA 3VR4H 1QG4A 3E9NA 4CEHA 3LQFA 3B13B 2W6ZA 4US0R 1BKYA 1F6DA 5BR4A 3P9NA 3T7KA 5L7WA 3V8QA 1LDBA 4CT5A 1P1RA 1SC1A 3AUYA 3I2FA 4G9BA 4A6EA 5C4IA 1LX7A 2PL1A 3C6BA 5JWRA 1FU4A 2YHSA 2VJMB 1P1HA 2XMQA 5E1OA 1W75A 4MPDA 4IIVA 4QU5A 1LTHR 2Y4OA 5CXSA 3WL7A 3MXTA 1FP7A 4EKYA 2AZXA 2I91A 4DLNA 2D3TA 2GFIA 5HM8A 4KH0A 3BSYA 1IZ9A 4NABA 3TSYA 5D85A 4YLYA 4LSZA 1A9QA 3PP8A 4GM0A 5GVSA 3H8VA 3PIDA 1JP7A 2ODAA 3NHWA 3WICA 4V1CA 1T8WA 4JYBA 4BLWA 2REBA 4AMVA 2DWUA 2BJHA 4LWQA 2O0JA 3NWJA 3GFPA 1M2EA 1TM2A 4UC0A 3MJEA 2NUBA 1JVNA 4JFAA 5AHRA 5DNAA 1E4OA 3AUFA 2XA9A 3K6KA 2P9BA 3E3LA 1GDHA 1YVEI 2Q5JA 1EP9A 3QFCA 2HIMA 3ET5A 5JADA 2PE5A 1OJLA 3CISA 3EBLA 1NLMA 4QYTA 1H0HA 5EWMB 3WLFA 2A9JA 2PA0A 4B1FA 3K1AA 1JKMA 1U2EA 3MYRA 3IUBA 1ZQ9A 3JVDA 3R7BA 3BA6A 1TU3A 5AXCA 3H6GA 3L7BA 3L6DA 1YFLA 4HEHA 2C5GA 2H00A 1AQJA 4JYZA 3IKVA 3UUEA 4DLXA 3GT4A 3ND8A 2A1UA 2QU8A 3IAHA 1KI4A 1U3WA 3ZHCA 4EA9A 4KO4S 2XX3A 1N5JA 5K3CA 4EIWA 4H1VA 2XDQB 1Q44A 3JU3A 5G40A 5M5BA 3A1UA 1J2UA 1DBWA 4HWSA 4YT8A 2HJSA 2Z98A 5HS6A 2AWNA 5FUXA 4JP3A 1MDFA 2F8LA 2JW5A 4XIFA 3M4XA 1YR9A 2Y93A 2ZTUA 3GYGA 3T7TA 5C8DA 4XX0B 2WF8A 1ISPA 3JQPA 2FN3A 5HG0A 5B3AA 2WTAA 5TGTA 2I4IA 3AERA 1M7GA 1SIBE 4FMBB 1MD9A 4QXAA 1RU3A 3UMVA 2ZYDA 4KBYA 3DE2X 4TXNA 3QE4A 1ZNYA 4JP8A 3U26A 2AMYA 1PUXA 3H4VA 4X3OA 2PS9A 3SR0A 3V8BA 4BP8A 1XN4A 2DY0A 3SYMA 2ZG6A 3EXIB 1DZ3A 3PUZA 1WBBA 4HC4A 1EWYA 1D09A 1UBSB 1CB0A 5TPWA 4AWBA 5ARBA 1JSRA 2B78A 2B82A 3CNEA 3VV3A 1HH4A 1B15A 3Q3VA 4XYLA 4KQWA 1HXHA 5EIHA 4C0SA 2AC7A 2VXYA 2DM6A 4J9UE 4XQGA 3FZEA 4IIYA 3ZWVA 2VDWA 3GLTA 4EUKA 1BA2A 3ZWQA 1CP3A 3DR3A 8ATCA 4Z53A 1M74A 4LNUA 1OBCA 1SXJA 3VOAA 3ILHA 4HDRA 1J8FA 2W22A 1W52X 2G1UA 2OTCA 1WO8A 4I9GA 3ZKAA 3HUFA 2APJA 4AIIA 1K7FB 2GK3A 3GLFA 3ZU4A 1ZH4A 1UT6A 5LMCA 4K6GA 3PX7A 3BILA 1I4OA 1L8OA 2LUOA 1EFLA 2ID4A 2NO9A 2P2CA 3C5VA 4WY2A 3TRDA 1U4SA 3UMSA 3CSUA 2WWRA 3TQRA 5IM5A 1R0RE 2VF5X 1E1LA 5G02A 4A26A 1QG6A 4BTEA 5GWXA 4NFHA 2A14A 3M9WA 3O4FA 3QUAA 5I7AA 3RGWS 4CNQA 4BZXA 3CRRA 2G1PA 4I9FA 1ZEMA 2ONZA 4KMOA 2OCBA 5LIPA 2HA6A 4RZXA 4NOKA 4J0JA 5K3SA 3LUKA 1II0A 4UBKA 1NKVA 3CLTC 4M9SA 4F7DA 2AW5A 4MMXB 3MQ2A 4PO3X 5IM4A 1OI4A 2HA0A 3G1WA 5C9ZA 1M76A 1NBEA 3CG0A 1WDWB 2YJNA 3D5QA 1I80A 3OQPA 3E53A 2I76A 4IDOA 4XEHA 2FGJA 5GAJA 1TA9A 2IUUA 1GXSA 2OOKA 2TSYB 1Z2PX 3RFCA 2P4EA 4C43A 2RHCA 1YO6A 2F3PA 2AQIA 2QTBA 1P3DA 3ESCA 2VK2A 4R84A 4M55A 2XSZD 2JKYA 3I42A 2WT4A 3LP5A 4B85A 3SLKA 1YIAA 4JQOA 5EQTA 4CLEA 5KJ6A 5AKZA 4PRZA 3BFVA 1L2TA 1LPBB 2IOFK 4U00A 5ANRB 1I01A 2PPLA 1QHEA 5BUQA 4I55F 2XZOA 4Q9JA 3Q3GE 1N0UA 1ISFA 2R7KA 5H7XA 3CRMA 1QM5A 3CX7A 1N92A 2ZRKA 1ZK0A 1E3SA 1NV9A 1WCWA 4BASA 2Q1UA 2DECA 3GNLA 1KNQA 3LPNA 4HSEA 2V65A 4ETMA 2JLBA 2ZJ2A 1PGQA 4RKRA 1BC5A 4RPCA 4ZA2A 1NIPA 3OC0A 3TNFA 3DLHA 4BVGA 3LL7A 4JR0A 1E9CA 5FQOA 4WTOA 1KE1A 3RS0A 3MZ0A 2VJLA 1DQRA 2QA5A 4HZGA 4WLVA 3VJMA 3WGYA 4DSUA 5CXUA 1Z5PA 1BVYF 1Z6PA 2GN8A 2PLWA 4AJ2A 4B17A 4HYEA 1RJEA 1JR3A 1L5ZA 3GZ4A 4OQLA 1RKUA 1Z4KA 5G0UA 3FWYA 3Q8XB 5E3IA 5IAEA 1GQ2A 1VKNA 2BR3A 1PX0A 2YQ4A 3QKRB 4NJMB 1VLMA 4QEKA 1NV8A 4MKHA 1VCHA 5F5NA 3PXGA 3HKBB 2KB0A 4F5WA 4XWOA 3DE7X 1XRPA 3OX4A 3IMEA 4UJ5A 3NYIA 2EFCB 4RSGA 2H8GA 1PJLA 1GA1A 3UAVA 1FFAA 3QNMA 3BBLA 2C54A 2FSVA 4D98A 1A50B 2GQ0A 1ZJJA 3WDKA 1JR4A 3MILA 4ISCA 1Y1PA 2V1XA 2WZQA 3H05A 1KAOA 5CDSA 1C3XA 5IMBA 1NF8A 3RASA 4J0GA 3DMFA 2V8BA 3FCUB 3ZCTA 2X6RA 4EJ0A 2IGTA 3CO0S 1HETA 3OFND 2N1MA 1NJ5A 1O97D 1PNVA 1PR3A 1QHHA 3U4IA 4HRXA 4IGKA 4IIXA 3RWMB 2JCBA 5K0SA 2PKRA 3R4VA 1RXEA 5BWBA 4CTOA 4JOQA 1RZVA 1O6CA 3A58B 2HWWA 1T2FA 3NR2A 4IGAA 4R0NA 3W6NA 3T1HB 1VPTA 5MGBA 2JGFA 1U5BA 2PBZA 5CNIA 4WJLA 3LE8A 4N39A 2QMHA 2CVPA 2IW3A 4ZQEA 3ZQ4A 2LTAA 1GTZA 2WWGA 1KJWA 1N6KA 4FHZA 2OCKA 4WXHA 3KK0A 2F9FA 4X7BA 4GYKA 2ZYAA 3A9SA 1O94D 2DPXA 1GNLA 2YYYA 2BFAA 2WW8A 3OU6A 2ZRFA 2Q6KA 1QGED 1M6HA 3C7CB 5I51A 1JMKC 2QQEA 4PXAA 4QOJA 4HADA 2C7BA 3AR7A 4KL8S 4OV6B 4D0SA 1DUVG 4YRRA 1B0AA 1IHDA 1RWPA 2OA0A 2GAJA 1UR5A 2GPJA 2VP6A 1X77A 3DW3X 2C2WA 5EHNA 1G98A 4OHBA 221PA 4G8DA 1SQ5A 1Z5ZA 4B76A 3RKUA 3DZBA 3X1KA 2W6JD 3Q0TA 1SVKA 2O8FB 3KUDA 4EI9A 3LG2A 5F35A 2BEUA 1BHQ1 3UATA 3WQQA 5JBIA 3W9BA 3FUVA 3A8TA 5FTNA 4XH9B 5C46F 3U48A 3SZMA 1YB2A 2FEOA 4BNMA 3E22A 1M8JA 4DSZA 2ATEA 3ER8A 2ZGVA 4JR2A 4NG5A 2CNKA 3DTTA 2VDLB 3KWLA 5CLIA 2H2AA 5AJHA 3SXJA 2RGRA 4UZEA 3JQ9C 1LD3A 1URPA 4O0MA 1YMQA 5K8CA 1WSWA 2EQAA 1NW9B 1R3DA 2WJAA 4RBNA 4LDQA 4UM7A 1RYNA 3MLBA 4NCXA 4CG1A 1I1HA 1KQOA 2RHTA 4G4GA 4DYDA 5DP1A 1F7VA 4LJRA 1KK2A 2JPDA 2GF0A 3K9WA 4NE7A 1D3AA 1HYQA 1Q84A 5KYVA 3FMFA 3HU1A 4M0DA 3SFZA 3JD1A 1LBQA 1TZKA 3D7SA 4MV4A 1TZBA 1NPYA 5KYUB 1Z37A 4FGJA 1NOKA 2C83A 3O0DA 3UGQA 1R4NB 3ENWA 2A9VA 3FGOA 2VPXA 1XMPA 1YR8A 2YWDA 3HKEB 1Z26A 2F48A 4LY3A 4M88A 5JMTA 1CJKC 1RP1A 1SQ6A 1M33A 2FW1A 2YWRA 1IH8A 2P2LA 1JQAA 3IQXA 3N2LA 1Q19A 2JVKA 3DWGA 4NU0A 4U9IS 4L4ZA 3ZU3A 4BRUA 2H5EA 4HUQA 3HZHA 2QN9A 2AI2A 4IV5A 8OHMA 4PRKA 4BKQA 2XIJA 3C70A 4D9GA 3GEPA 1FSPA 3F3MA 2V9ZA 3H9UA 3GJ4A 1QNLA 2IC5A 2IU3A 3AEQB 3PQEA 2BKVA 5GJCA 1CWUA 1KAQA 3BGVA 4A8PA 3HP1A 4ZVSA 4QLBA 2JGDA 1UWLA 2B5OA 2H1VA 1IE3A 1QWOA 4W63A 1MC1A 3ZJUA 2UZ3A 4F6LA 5A1TA 3GU3A 5SYNA 1KIMA 1T36A 2YWBA 4JI1B 1C4KA 1ZNWA 4L95C 4A23A 3F8SA 5HF5A 5KWSA 3I09A 1L1RA 3FGNA 4BPBA 4DNQA 4EO7A 3W78A 3KBOA 3INGA 3LXUX 1O87A 3NKVA 3QKUA 4FLMA 3QVUA 1DKUA 5EJ2A 4DCCA 2V6GA 4CUZA 1OXXK 4WX2B 2AOUA 3ANLA 3FI9A 1H9CA 3RBVA 1E9AA 2PS0A 4OFXA 5AI6A 1XZGA 1NE2A 4OVKA 5P21A 2BFDB 1XJCA 3CWQA 2VP4A 4XQEA 1G7TA 4KXFB 4BLTA 1MPTA 1R5JA 3PWZA 2QRJA 1D9ZA 3R0JA 4E2ZA 2QP4A 4TMZA 5AKLA 3B53X 4HK4A 3M8KA 4H1WA 1CR1A 1N7IA 4GZ6A 3I92A 2HNAA 4TX1A 3K94A 2JIOA 3CH4B 3G2JA 3LY5A 1PFGA 4KQHA 1HNXB 1QH8B 4MVJP 1E2QA 4J6EA 1N8KA 2WF6A 4KE6A 1USIA 4YLGA 2X4LA 4LKOA 2VSQA 1M1XB 1QOZA 3QSGA 4J0EA 4C04A 4ZHSA 3MM4A 5T64A 3A3NA 1ZVVA 1W48A 1UXOA 2QZ4A 4TSKA 3WWZA 4FW9A 4MW0A 4LCJA 4KG7A 1E9DA 4KYIB 5A4JA 5B4UA 3UMFA 5TGZA 4RZ2A 3O8OB 5KSWB 1S1MA 4CIBA 3QFRA 2I4LA 3GFFA 4PLGA 3RSLA 1W93A 5GJVC 3ZXXA 1TCVA 4TUYF 1F7UA 4KRFA 1MIOA 1WZCA 3T41A 3JQ6A 2VI5A 5FUVA 2FHSA 4N01A 3OQOA 3GFGA 1P7VA 4CGZA 2QZPA 1BH2A 4GR5A 4FXOA 2PRYA 1XV5A 4KE7A 5DM2A 3GJXC 1GEGA 4UBIA 1DINA 1ZJZA 1LDMA 2AI1A 2QYTA 2BEVA 2IXGA 3BGWA 4RSMA 5GGYA 1BEEA 1Z5GA 5F12A 2A88A 2EWVA 2RHLA 5K3AA 4P3NA 3SG0A 5ICMA 2GF2A 2W9XA 5JISA 1II8A 5LQKA 1WW8A 2C2ZA 2HLDA 3OJXA 2ZE7A 4Z3DA 1TVEA 3OUZA 4PC2A 3OFVA 5A3RA 4IH4A 3V6MA 4AMBA 2G09A 4BUJA 1P80A 2RHJA 1DAIA 2W2NA 2X76A 5JZ9A 3DMNA 2XHEA 2A4KA 1ENYA 3U3XA 1DC8A 4HFMA 4YUXA 2OV3A 3TQIA 3E58A 2G4LA 3IUSA 3PQCA 1ONBA 1HFEL 1UMDA 1JTFA 2IYFA 1CS0A 4QPPA 4Y3UA 2C5HA 3NTRA 3F1KA 2D54A 3QE2A 1M1UA 1XQ1A 1OH7A 3W1VA 2Q0XA 2QGNA 2VDOB 3C3CA 3EF3A 3MWKA 2C4WA 2NU9B 4PICA 1PV4A 3V55A 4KBGA 4DQLA 1AQIA 3GHHA 3HH8A 2E49A 3WK5A 4FCCA 4A8JB 5A5EA 1HQCA 4ER3A 2J09A 3CT6A 3ZDBA 2Z83A 1Y5NA 5FTMA 4IKEA 1A4XA 1ZS9A 3C5WP 3BMNB 5BQPA 5JATA 1RD4A 1Z73A 3QUCA 5DNWA 2IEDA 4BECA 2VYNA 1K3UB 2WT9A 3NNNA 4TLEA 2Y77A 3SS9X 3INRA 2BBWA 3TSCA 2R751 5DNCA 3M33A 3INYA 4I8DA 3AR8A 1DO0A 2XMGA 1VLZA 2PGNA 1UL1X 2Q50A 3AYXB 1Z18A 3F6EX 3PWSA 1EB8A 1CX9B 3OJLA 1RVDA 1USVA 2EF1A 1VI2A 2X42A 1ZGCA 3AG5A 4RK6A 4ZDIA 1GLVA 1UM9A 1VE1A 2PJDA 1JDBC 3VHXA 3GAAA 4DDUA 4YJ3A 2XVMA 3WSWA 1EINA 5CX4A 4FINA 5A5VA 4NYMQ 1XAIA 3SE7A 2C8VA 2O0KA 5DTRA 2ZVPX 4KKVA 4JEIA 3T5BA 3NVMB 4JBNA 5EL0A 4RD0A 1F8UA 4V0KA 2GFQA 3CUVA 3MUNA 1BKDR 5A5FA 4JV5B 5DF1A 4MDFA 2GZRA 2P11A 3ZNOA 4CV1A 4KACA 3PXUA 1WOMA 3UQYS 2EWWA 1XZQA 5CXXA 1MQAA 4QYWA 4N0DA 2J0EA 2ZI6A 1JQ3A 1KETA 2CLDX 3UKOA 1X8JA 2H4WA 4LJ8A 1XAGA 1EWRA 1JHMA 2D2XA 1GTL1 1Q7BA 3DE6X 4O08A 4EENA 5AOCA 3LC0A 5LOVA 5DSTA 1ZCAA 4JP2A 2CHEA 3M5WA 4IMIB 2XNSA 3JXEA 3DMTA 5LQRA 1U9JA 3GQVA 2PS3A 3RLFA 2QTHA 3SD7A 4BLUA 4B3GA 4K9RA 4L76A 1D0SA 4D80A 3CZ9A 5KOJB 3KQUA 1R6UA 1A98A 4DZZA 1NFFA 2F00A 2YYAA 9ABPA 2CHFA 4Y2GA 4ZT6A 1CR2A 1UJ6A 2ECFA 4X6UA 3DO8A 3B70A 3REQA 1Z34A 3WNZA 1JFVA 1K4MA 1XYGA 2NZUG 3SOPA 4X7PA 4D8VA 2A33A 1C1XB 2WF7A 4PYRA 3DC7A 4ARBA 1CZRA 4Z4QA 4UW9A 1CJUC 2MINB 3P0EA 1YE5A 3COZA 8GPBA 3NH6A 4QODA 1Z8NA 5JIBA 4R9SA 1MMFB 3RU9A 4UULA 1RPZA 1Z33A 3F6CA 2B94A 1LF5A 2P7IA 3WRWA 3CPHA 3DZKA 3BE6A 5HE9A 3PR3A 3RVNA 1DAOA 1HM5A 4IR7A 3PXDA 1MQ9A 1J6UA 5E6RB 2IWRA 3L8MA 1YZUA 3JRNA 1XZMA 5LB4A 3SDZA 2WIFA 4FYKA 4CKZA 1LVUA 3KG2A 3HEAA 1MB0A 1T4GA 2WVHA 3GO4A 1Z62A 3CLKA 1WD5A 1YZVA 1SQSA 3DJYA 3OA0A 3OX1A 2IDKA 4R1QA 1FTGA 1KJYA 1C3OA 1TJ4A 2HJHA 2W71A 1QIFA 1N3LA 1ZGZA 4G0NA 5SY9A 3Q6IA 4MW2A 3RC7A 4EGCB 1E1MA 5CFOA 2QTFA 1D6SA 1RLJA 2QL6A 2H1IA 4Q3DA 4XCXA 3L8EA 2JAPA 4Q7MB 3MK31 5TMDA 3TEJA 1A04A 3ZW9A 4FBLA 3KZKA 4IFEA 4C0WA 3HB4X 1PL8A 4RY2A 1HWYA 3ZS9A 3ASVA 5F52A 2ST1A 2AJCA 4Z86A 1IBRA 1X0XA 2ZJYA 2J08A 2VUIB 1OLSA 1IM5A 1R0WA 1TECE 2QUJA 1U1IA 1MVOA 4DR2B 1PR9A 2G6BA 3FOFC 4PPGA 1W85B 3MA0A 3ENVA 4IDPA 4G1UC 1FPMA 1E64A 1F8YA 3SC2A 4RESA 1XCGB 3ZLVA 5KSOA 4U7DA 3NUQA 5ICFA 4Q37A 4WT7A 3U7JA 3FPKA 1DIOB 1H1LA 2JFZA 4GVPA 4NAHA 1HDRA 4NG4A 4QRHA 3TLEA 1IBCA 4GLLA 3SZLA 3H6HA 1W5EA 1QFYA 3G8BA 3LCJA 1QH1B 3CF0A 2VDNB 2CLEB 3AG6A 3EVNA 2WJPA 4W82A 1I0IA 1XXLA 3H9EO 2AR9A 1XEXA 4FYYA 2G72A 5LP6A 4YFYA 1T1RA 3NCHA 4IV0A 4UUNA 3QZUA 3OZDA 2HDNB 4ZO6A 4GI1A 5KKCA 1SBHA 3VU3A 4B40A 4PX9A 4X71A 3TZLA 3HXQA 3TE6A 3ZLJA 1YH3A 2C4UA 1SC6A 3PGVA 1NXXA 2EIHA 3VO2A 4G8BA 3ZXIA 4DSAA 1DOAA 1IU9A 1Z5WA 5E7MA 2FRXA 3CEHA 3PDIA 1JR2A 1AZWA 1P0QA 4GX5A 4RPHA 5JOQA 2Z2ZA 1YF3A 1KZ9A 1J1UA 4ZYYA 3AEUB 1XWIA 2ZWAA 3VGJA 3LWNA 3KSZO 3UBTA 4YUVA 4M8SA 4QL3A 3FRJA 1EJ2A 1SXPA 5D5QA 1HL3A 2A2ZA 2X0DA 4FSDA 5KSPA 1KYQA 1NM5C 5C7IO 3HBFA 5HVNA 1ZUIA 1MC8A 2LXNA 3OPYI 3SX2A 1E3JA 2GJKA 3GEGA 3BL6A 2HF2A 4TROA 4UARA 5FUBA 3N86A 1OFGA 3SM9A 5C5IA 4IIJF 2H0QA 1LRKA 4XUDA 1OV4A 4G65A 2QG4A 5LQSA 1U2RA 1PQUA 5B3JC 1I33A 5JY6A 1Q7CA 1Z4OA 4G36A 4YK7A 4XOUA 4MUBA 1A5TA 3C24A 3M3HA 4Y1RB 2O7SA 8ADHA 4WCFB 2OV6A 2W6OA 4RANA 5GY7A 1NQWA 1YU6A 2O05A 3AY3A 3N6XA 4JMLA 1PGNA 4Q15A 3SP1A 2ZTMA 2YFYA 4TTRA 5JSQA 4CEIB 3SPXA 1IC6A 3AF1A 3KYIB 2D5CA 1CJVC 1K27A 1KTVA 2RHWA 5L3QA 5HRCA 4RTOA 1I94B 3JASA 1U1CA 3PRJA 4FNAA 1IEWA 1BJRE 1W1UA 3ANNA 1YQEA 2EQBA 1JDUA 2VH2A 2WQZA 4S1PA 3NX4A 4HWPA 5MFPA 4M0UA 2JLYA 2GXQA 4D9MA 3GLHB 1M73E 3NZEA 3VR4A 4IOJA 2P7HA 1WBDA 1SXIA 3R44A 1C9NA 4K88A 3BAFA 2ZRLA 4DC0A 3PNQA 4HDQB 5BSVA 5MF6A 3ODPA 1NP6A 4N7MA 2CDCA 1YQWA 4MKXA 2ZW9A 2OPHA 5KCZA 2NZJA 1AF4A 4B46A 1EFDN 1HNNA 4H7JA 4P5PA 3K9HA 4XAQA 4NXNB 5IKMA 2C2YA 4FFMA 3LT2A 2M1XA 3SJAA 2IHVA 3ESAA 5J2UA 3I3OA 4F3YA 4U2DA 2O8CA 3IMKA 1I14A 2IY7A 4F2PA 5I7VA 4KPFC 4OJMX 3WB2A 3C6ZA 4ENSA 3U09A 1Z4JA 4J0IA 2VJBA 2GTIA 4WZ6A 2HSDA 2QX7A 2YY7A 4QWWA 5ALFA 2GI4A 1TD1A 4OJQA 3H1AA 4XLTA 5EWJA 4W1SA 2BL4A 3EDRA 4HFNA 3FI0A 3SC3A 4JD5A 1U2DA 2D74A 2EATA 4R98A 2ZYIA 4ISBA 2COUA 3W0LB 4P53A 4F4UA 5IC4A 1BGWA 2J3LA 4MEBA 3UMJA 4CUJA 4R6WA 3OWXA 2C2MA 2XB6A 3VOTA 2C1EA 4BLQA 1WZNA 2ZSUA 3PYMA 1DC6A 1NRWA 3NWOA 5G0WA 2DTDA 2GKSA 4NS4A 4HLDA 3EF0A 4D96A 1F0YA 2C3YA 1S96A 3OZTA 4HWOA 4CL2A 1DMSA 2HF9A 4JQZA 3CVUA 1DSSG 3K8YA 3TAHA 3DUFA 1O0SA 4Q7EA 3QBJA 1RXCA 1YE8A 3TIGA 3TG2A 2C3PA 1N3YA 2NAFA 3HFSA 2W98A 3WGTA 1TI7A 2TYSB 4IJKA 1V8PA 4NPCA 2Q2QA 3JQGA 1OYVA 4L5AA 3ANYB 2OV2A 4B43A 1AMOA 1ML4A 2GK7A 3RHTA 1D8TA 1EDBA 1XXHE 1JG2A 2GZAA 4EB3A 2H0AA 3I1FA 3VFDA 4GZLA 4NR0A 3B78A 4DA7A 4RVUA 2D0OB 1ENOA 5BY2A 1P4JA 5FTKA 1N2ZA 3T3NA 1QQ5A 2GTPA 2WFZA 4PHGA 4MJLA 5D01A 2QTRA 1DEKA 1Y7IA 1PWXA 1YL6A 4JX9A 3IUNA 3ZZMA 2A5YB 3C3XA 5L6MB 5TMPA 1UKCA 4ZAZA 3OF2A 3B6MA 3VTAA 4E3WA 1SVUA 1ZSVA 3ZUPA 2R66A 1FFSA 3L8HA 4DCTA 4UTVA 4MNTA 2CV0A 1SVLA 2AK2A 2DHQA 3ENZA 5EIWA 5EXPA 4LQ4A 5HFJA 1X7YB 5K5EA 1V6SA 1D8AA 2VQFB 2FMTA 3WZ2A 5IYZB 1O94A 3D3NA 4TKMA 4ZYTA 4UCQA 2A9FA 2PV0A 2V0CA 3AHDA 1E3IA 1HI9A 3S3TA 1XCOA 2GPSA 3AKDA 3LL4A 3UQZA 2DQZA 4EDHA 3AX6A 2XOXA 3Q9LA 3HU5A 4M8NE 3LIIA 4XVRA 1K3FA 1YRYE 4J43A 4MRNA 4ND3A 4B3XA 1PBNA 3DXYA 3VPSA 5BPHA 3WNVA 3SC6A 1EUCA 3R0QA 2O19A 4KN8A 5ED4A 3TVYA 4G0MA 2OKGA 3DKRA 1RLTA 3FG9A 2W6JA 4JEHA 5B7QA 2H17A 1S8NA 2UKDA 4OKNA 2CHQA 3GI1A 1PTJA 1GNPA 5LXTB 2QN2A 3W5JA 2AFIA 2ZIXB 4E4RA 4YUZA 3FOZA 4RADA 2DY1A 1LS1A 4MVCA 1YU9A 1VPEA 2X22A 3UJ6A 4LFBB 4BNIA 1WDTA 2KBFA 4N5LA 4WI1A 2ZVQX 3I0ZA 3NRBA 4JKYA 4M38A 4O2AF 2REXB 5HFNA 1YQQA 3KYBA 4H3HB 3ZY6A 1RRCA 3REFA 4KGZA 3GJRA 3KR0A 2YFKA 1R6VA 3K0AB 1KSJA 3HN2A 2P5SA 1P5FA 3M82A 4ZVVA 3RYIA 5AVXA 4Z2YA 3MBIA 1NDQA 1PJ4A 3QKIA 4J0CA 4RO0A 4R1MA 1ZGAA 2QNBA 3W05A 1SAYA 1KBOA 2GDZA 1DIGA 2J3DA 2FVXA 4IOKA 3ZDAA 2WMNB 1SOMA 1W5BA 1CZHA 1A69A 3UJ3X 3RIYA 4CMHA 3N5KA 1Q74A 1F2UB 1GG9A 4A8HA 3UPUA 1CRQA 1IXRC 2ONKA 2YOFA 4MI3A 4CTMA 1PI3A 2G8LA 4BB5A 2EFEB 2Q7DA 3ETLA 3TBHA 2ZQYA 1CZNA 2CWWA 3UCEA 1QYXA 4N82A 2Q28A 2AC4A 1CW2B 3ZR4B 4DDVA 1XSEA 1CU1A 3ZD8A 5FULA 1YBMA 3O38A 3K0BA 1P2GA 3LK7A 5F2NA 5F1OA 4OJKA 4EDFA 3PSAA 3KSAC 3G2LA 4HNUA 1EHCA 2CUKA 1EUDB 3G9UA 5DCWA 2WYUA 4I9HA 2AYZA 2FGKA 5FUQA 1GYRA 3SWWA 5K4AA 1F8XA 2PRZA 4RD4A 3Q8WA 4FMCB 5FUYA 5HMMA 3UWPA 1BSVA 2HV8A 2JATA 3T9CA 3TTXA 2B34A 5B1IA 3TAXA 3N8IA 1Q2XA 3EIEA 2VTEA 1Q1EA 1NX6A 1SCKA 3VX4A 1E2NA 2N46A 3MJVA 4UCXA 5HQTA 5I48A 3L04A 3DM5A 3F5FA 3A6HA 2B7LA 4WCVA 3IUQA 4YV2A 3UMYA 3V4VB 2WSIA 4YIHA 3R8FA 1RYBA 5A0TA 1EWTA 2DPLA 1E1QA 1N3BA 1Y42X 5BURA 2RGXA 1WEKA 5DXJA 3U2QA 4WGGA 1VCOA 2GZ1A 2IXEA 1GPYA 2ZSJA 6YASA 5I9LA 1OU0A 2QAGB 2IYNA 4WWHA 4GZ3A 1U7TA 3HRHA 3HSKA 1O9BA 5COAA 4LHSA 4UZFA 1ZVMA 2FJ0A 2R6DA 3FD8A 1WB4A 3D31A 2FE4A 1HLFA 4Z49A 2YVUA 1PZHA 4IDHA 4NU8X 5KX5F 1HT0A 2RMKA 1GD1O 2DPYA 2HREA 4GX2A 4K8RB 3AJEA 4EJ6A 1TGVA 3RUPA 5KYGA 1Z6QA 3AUAA 2BH9A 3N58A 3PR2B 4ZXPA 3WK4A 4KRGA 3WBKA 1ZIOA 1RYHA 1T8RA 2A57A 4AK9A 5BN3A 3T3EA 5CXQA 3UEOA 1CQXA 2W6CX 2JF0A 3PNPA 4S1TA 4FFOA 3FCCA 3H5WA 3ZDRA 3F49S 1KZGB 4XYGA 5IDXA 3FDXA 2GPNA 3RIXA 4DKJA 2WOJA 1CT9A 1JG1A 3TQFA 1JALA 5I7UA 4UVGA 3F6SA 4JXJA 4BYMA 1MDBA 3H5NA 2DBRA 4XM1A 5EZ6B 3GVHA 1KKUA 3E18A 1DLIA 1ATIA 4MWGA 5FWDA 2RHDA 2X41A 3TOZA 3SN6A 5DEOA 1W34A 2VIIA 4FYIA 4GXTA 4KIUA 2VLIA 4RZIA 2F55A 2XADA 4UATA 1L5HA 2XYVA 3GJYA 3TKYA 4R41A 3U3ZA 2DOKA 2LGJA 1ODIA 3MWJA 4HS4A 3N2KA 2QPTA 4UTRA 3X1ZA 4O2BF 3PGMA 3JQ8A 1KMIY 4K2HA 4OLAA 3LWBA 1M8FA 1MVLA 2KWIA 4KMMA 3V7UA 3FNGA 2QUKA 2VN8A 4DLSA 5EJEA 2VHQA 2BTQB 2VO1A 1VE9A 4C0LA 5EJGA 3EXFB 1GR0A 1JEYA 2UAGA 1WM1A 2XCIA 3CE9A 3HXLA 4RHUA 4YPFA 4C6TA 1QK3A 3RJ5A 5KTYA 4TS9A 3A3PA 3P19A 5FQNA 1XCJA 4KODA 3QUSA 2OCLA 4EJSC 4HN9A 1JH8A 2R1TB 2X8BA 3JZDA 3ECCA 1NC3A 4PO9A 3KQPA 4DDTA 4JI7B 1AN0A 4IGIA 3CSSA 4IUBS 2HY7A 4K9QA 4EAQA 2FSIA 3O74A 2ZRMA 2Q3DA 2JFBA 1N6IA 4JJIA 1GVNB 2Z0MA 2G8NA 2OZKA 1NYRA 4UHCA 3OTGA 2XQIA 4UUBA 1TUEA 1OI2A 3M4NA 2RH8A 2PSHA 4HDNB 3O8QA 2XBMA 3FZQA 2AG8A 3FB1A 3ECSA 1Y8AA 1KZHA 5CGZA 3DOOA 3BYZA 2R9VA 2C9BA 2NAPA 3K4HA 3MTAA 5EUCA 3SR3A 1T25A 1ZH6A 3H9QA 3OZRA 4U63A 2W58A 1KWGA 1WP9A 2J85A 4JFRA 1K06A 5K4HA 2BGRA 3ZTYA 4YHHB 2UUBB 2E0IA 4H35A 2B8NA 2VF2A 5BRNA 2AKYA 5DYNA 1YQUA 3EA4A 1ZI9A 3VSDA 2X15A 1VYHA 1R9MA 1PJQA 2GHTA 2X0FA 3FMPB 1SOUA 1XTPA 4FNOA 1QFXA 1TCUA 4IQGA 4J7XA 4MGYR 1RYFA 1A1SA 3EGDB 1JIUA 7REQA 3NDJA 5CHEA 4ESHA 5T4FA 5C8YA 1DBIA 2VSOA 4HDSB 5JAZA 4F4IA 4RK5A 5THXA 4DBLC 1MP0A 1TU4A 3TX6A 4AP5A 4EG5A 4G4IA 4FOPA 3RRJA 1U81A 3WYAA 1MHPA 3EVFA 5DI3A 3KIPA 3WKDA 1YRWA 5AI8A 1JJVA 4LBYA 1ZI8A 3CNHA 1IRIA 4NBNA 5F23A 4WLNA 4Q3KA 2WLSA 2VPWA 2W37A 5HK9A 4BO2A 3KD3A 4RLHA 4Y2PA 5JZOA 5C5EA 1AF7A 4BMCA 3IEMA 2OBNA 3ABIA 1TXGA 1BXRB 4JASB 4CG2A 3AQ4A 2I65A 5KS2A 2Y9MB 1APBA 1UEIA 1OI3A 1TA0A 1XXHA 3IP5A 3HUDA 3IXMA 4PLZA 5CUQA 1CK4A 1XTSA 2A92A 4BU1A 2F7SA 4MS1B 1BOOA 1WQ3A 2JBWA 4YJGA 1DQYA 4YMGA 3BJIC 3CBQA 3OKCA 4RA9B 2H4HA 5KOIA 5KTKA 4R8MA 4KQFA 3UHFA 5KQMA 3QX7A 1J00A 2ZVDA 3IC5A 3DFFA 3NDIA 4OLFA 4BQFA 1RC1A 3CKYA 1FYEA 5LCXA 1Z3CA 4LZOA 2H3HA 2BHLA 4M86A 3M5CA 1S2NA 4LISA 1EFVB 1N7HA 1NQVA 4EO9A 1EA5A 2GJSA 1UP6A 2VT6A 3R3YA 2C2KA 1O95A 3T5DA 4C7BA 3QVKA 3NDRA 4JQCA 1ZRNA 2XT6A 4RVCA 1FMJA 4HPJB 3UHPA 1IM8A 5EC8A 1Z8DA 2JBAA 1JFTA 2OG1A 1HY3A 2PRSA 2CCGA 3P9XA 4GI3A 1PLLA 3FMVA 3H1FA 3WRXC 3EC2A 1R66A 2VWHA 3FLAA 3LVBA 1EGVB 3NTQA 3E9ZA 3FOEC 3KZ1E 2UVQA 3T1NA 4UQLA 2BTEA 2C7VA 2YS7A 4LXXA 3SZRA 4ITUA 1PJBA 4ZARA 2HSWA 4IP0A 5JWOA 4RK1A 3M6VA 5CH5A 3ZWAA 4OX9B 5K8UA 3H4MA 2XMSA 4XTCS 4BQQA 1CRWG 1G20A 4UHHA 1NLUA 4IDAA 2B7CA 4JXXA 4DE5A 5AUQA 1FNSA 4OL9A 3Q6NA 2XCQA 5CA0B 3NBMA 4YB8A 4QBTA 1DQNA 4AJJA 2O14A 3JQDA 2AZ4A 3E5HA 3EY9A 2XE7A 3I5UA 2FMUA 4H6VA 1CY6A 2ZUVA 3F5DA 3P9CA 3TR6A 4L72A 3D8UA 3RC8A 1WHTA 4U0KA 1FY2A 2GEDA 4ALMA 4N47A 2H63A 1Z9BA 2ADOA 4LGMA 3WQHA 3ZVLA 4MUNA 5ISMA 3DVLA 3E5MA 4E21A 2Z2YA 3HU2A 4B32A 5DYTA 4QDTA 1I3LA 3KTFA 3OLXA 1VKHA 3IRVA 4IOMA 4DLUA 1ZINA 1BQEA 1GAWA 5FWYB 3TSOA 3VVCA 3MTDA 1M54A 2ZWPA 2MMGA 3O4HA 3P0FA 1FL9A 4O59O 5ERYA 3E9YA 4IS2A 3N0TA 2AB0A 3TOSA 3U4QA 3QVLA 2XKKA 1MAHA 2ZREA 2Q5IA 3EC1A 3MFYA 3M3DA 3V8RA 4XWTA 1GZUA 2VP9A 2HAEA 5JQGA 2IYVA 3DV0B 2PX4A 1L5KA 3TFWA 1M8PA 3SC4A 1TT7A 2QRLA 2QUIA 3LLVA 3U17A 1RQNA 3OE7A 4PLHA 2YZ7A 1IN7A 3LCCA 2GHIA 2QVYX 3RUDA 4HWTA 2XEDA 4MVJF 3I9JA 2GZDA 1PT6A 1SCUA 3ITKA 2P2SA 3TD9A 5JSYA 1U8TA 4FC7A 1WXGA 1PJ2A 5IXJA 2ZBDA 3PI7A 2G9NA 5B30A 1YHNA 2ZBFA 1T4DA 1KAMA 3PIIA 4FSXA 4J76A 1X6VA 4RU1A 3C3PA 4OJTA 4RKEA 3UWKA 2VDQB 5JC8A 3W1EA 4K9MA 5JU6A 6REQA 2WPDD 3BFXA 1Z6ZA 4HNAB 3X0DA 2AF3C 4MCAA 5CP8A 4KAXA 3ZGOA 3QFSA 1JKFA 1FJGB 1CZOA 3IV6A 2C78A 3M83A 2C8LA 4L15A 4CQNA 5EMHA 1HRDA 1LQ2A 3B89A 3F6RA 4GNKA 1KP9A 4YGXB 2E82A 4FYVA 1ZQ1A 5IXYA 1Z08A 1YA4A 3TLGB 4DRYA 3QMPA 1FSFA 3QG5A 3JAWB 5CJPA 1IL0A 5E6UB 1ZA2A 4ABTA 2YL2A 1E9VA 1TTPB 3IVXA 4FOOA 3ORQA 2XD9A 1OW3B 1EK1A 5CIQA 3OCVA 3W90A 3MT9A 3OSUA 2YHUA 3PGJA 2V7EA 3N5CA 3NHBA 4ND2A 4E33A 5JWHA 1JAIA 1N1DA 1S01A 1OBVA 1Z36A 2B4TO 2Q3MA 1GTSA 2QRPA 4A03A 1PR6A 2WHPA 4MRPA 2PVSA 4NQRA 3W5HA 2W8BA 4MWZA 3OOHA 3EVBA 4BFSA 4G1VA 2SECE 2VJAA 4IYJA 4UVDA 4Y67A 4G5RA 3TGWA 3EJ6A 4CNBA 5JEEA 4AY2A 3H5AA 1UBLS 1DFIA 2NO1A 2V6BA 4MPPA 3IE1A 5K0NA 3G2KA 4F3NA 2FSHA 1UBTS 1ZGBA 1GITA 1RLUA 1WPRA 2FZ4A 1ZM3A 5DHUA 4DIUA 2W6QA 4U02A 3HA2A 2OWEA 2H1SA 3ROEA 2FK8A 1H93A 1UT5A 2FP4B 4HMOA 5F4ZA 3VU9A 4UBOA 4CM8A 4DCOA 1NLFA 4FHFA 3ZCQA 3O1IC 1QAMA 5B58C 4M37A 2ZDQA 1OVMA 2RI0A 4Q16A 1XPOA 5EN4A 3G2HA 2JA1A 2VF7A 4KLNA 3PJFA 2HDWA 4N0MA 3R3WA 4BCCA 3I0NA 3KHKA 2I7VA 2DTEA 2YW9A 4WESB 4ZWNA 5CYGA 4GLFA 4FS8A 1K4YA 1XZLA 5DHSA 3T1TA 4ADSG 2I6TA 3KKLA 4FW8A 4AW9A 4KZKA 2I29A 1N4DA 3A1VA 1G0OA 4D4MA 3H86A 1SUBA 3LX8A 3Q3EA 3S2EA 1KDRA 5I7SA 1KQGA 4OA8A 1J0EA 3BK2A 1QPBA 4DREA 2FG7C 2C07A 4MYCA 2HCRA 4N8DA 4P81A 4YRQA 3WGKA 4UM5A 2BR4A 1OFIA 4RSHA 3R9XB 1SXGA 4HTAA 4GICA 4TMTA 1QZTA 3QKSB 3RSSA 1ZEJA 3FPHA 4GRAA 4YRSA 5LZ9A 4GNRA 5ETJA 3E9RA 3F0TA 2OSVA 1S0UA 1NXSA 2GLTA 2HRDA 2W2XA 3EN0A 3EIFA 1YQ9A 2CNBA 3KWJA 2OCDA 1JKXA 4NCNA 1OXSC 3PJEA 3DHYA 3RYHB 4HX2A 5DZSA 3K2IA 1OX6A 3HTXA 1XNJA 3GD7A 4HKTA 2OO5C 2JJYA 4DPLA 1US8B 4RORA 2I7XA 5KQRA 1ZJWA 4Q9IA 2JGNA 1DV1A 4CE6A 4WLUA 5JFOA 2CZGA 4ARZB 4D02A 2RGGA 3CX6A 3H4IA 3RYCB 4IHJB 4BJHB 1LEHA 3VNQA 1UODA 2VAVA 5DK6A 5J1TB 1D1PA 4P34A 1ISHA 1P6QA 2JIRA 2GNPA 5MN4A 2CD9A 1NUAA 5F78A 4PFKA 2I6UA 3AIKA 4G97A 4KB5A 4Z4HA 4I4IA 3FZNA 1XF1A 3HDGA 4K86A 2I8AA 5HZGA 2H1FA 1UUFA 1ZUNA 1G2PA 2QVCA 2FETA 1XMXA 5FP0A 1CQJB 3FPJA 5CA1B 1ZOOA 4BATA 1RZUA 4ENPA 3HB5X 1E92A 4DV3B 4S0ZA 4D0NA 3FYUA 1ATZA 1VE7A 3FW1A 4NZPA 4E2WA 3Q0EA 1JE1A 5A5DA 5BRJA 1OAKA 1V1MA 4Z99A 5B2EA 1GTRA 5BQOA 1NZDA 1UC9A 5GOZA 4GXRA 2WG0A 5AXBA 4DIDA 5LKAA 2I1QA 4L85A 4DYVA 1IQ0A 1KI6B 3SNKA 4AJPA 4RACA 2CFRA 1GRRA 4ZQIA 5FPTA 4I50B 3WA6A 3AVOA 3S1SA 5B64A 4L16A 3HDYA 3LCRA 5F7JA 2XT9A 3B3JA 1OAOA 1WDLA 1RRKA 4MP3A 5A06A 1YJ5A 3FH0A 2FPSA 2HTFA 2O2HA 4ZV4A 3D4LA 2EC5A 4M99A 1ODKA 2QT1A 4LVOA 3VR6H 2R97A 3ADCA 2OEPA 2VJMA 2WBLC 2XF2A 1KH3A 3FJOA 4GR9A 4YI3A 4C4RA 1PFQA 3OICA 4YDHB 4JI2B 2EAUA 2REQB 1XB2A 4AM8A 3PZBA 1GPDG 2FUKA 4UHEA 1GRCA 1H0RA 1PQYA 4NDZA 1U2GC 3D6FA 4BY9E 1MOSA 2R96A 1I2CA 2PK3A 3LXMA 2R85A 3ER6A 1ID1A 1N2IA 4EAAA 3C16C 5F76A 2F8MA 4OK6A 5ALGA 2WTMA 3VZCA 5D3QA 4DOMA 1EXDA 1B23P 1FMFA 1ZKMA 1WP4A 4NDAA 4WPGA 4WW0A 4YRPA 2C96A 4QSHA 3ZYZA 4IDFA 5C4MA 2RHGB 5H80A 2PJRA 3OCXA 2XB9A 3QLJA 2Z57A 4H7FA 5LQJA 2W11A 3FFXA 2O9JA 3VR1A 3HEMA 1R8QA 1SNYA 3PGLA 3AF2A 3H5IA 1I9GA 1U5CA 2FFAA 4GLJA 1E2MA 5TV2A 4BXOB 2V98A 5JEDA 3WA7A 3ZHZA 3D7MA 2IQ5A 1Q1NA 2HMAA 4FD3A 3VR5D 1E99A 3P2MA 4DG8A 5EWMA 1E94E 3AHGA 4N5NA 3OPXA 3R5HA 4NMXB 2X9NA 1NT2A 1FNCA 1G6HA 4H6XA 1NVDA 4KMSA 4CBVA 3PC8A 3SVLA 1OIWA 2XOEA 3E8SA 5IZCA 2PKQO 3CO5A 1M1YE 4Z7QB 4WK6A 3S2GA 1BKSB 2QQGA 4R7GA 1YAJA 2EFDB 2QXTA 1CSEE 1IJBA 1DJOA 5U4QA 5CFMA 4IEFB 5A3JA 4KJZA 1EXVA 2I7DA 3KELA 3QQ5A 5HJ5A 4INOA 1PLKA 3VAAA 1RIFA 1SUCA 1EUZA 1UOPA 2FDRA 2J6IA 2ZB3A 4LC1A 4O4JA 2OP1A 5CK4A 3TLMA 4BVHA 2H11A 4LWPA 4ZEVA 5TIIA 4C07A 4XX0A 2Q1TA 1ZL2A 4I36A 1QOQB 4PLTA 1T2CA 1SPXA 3ITNA 1UFQA 1C0KA 2B1IA 3U16A 1KI1A 2H4XA 2XYRA 2LR0A 1WU7A 1KMNA 1CUZA 2DKFA 1R0YA 2ODQA 2HGSA 3BG5A 2Q1YA 2RJOA 4AZWA 1U2SA 3R09A 1UWCA 4MRMA 5JJBA 5K0BA 2FQYA 4QRIA 5K6AA 3S55A 5DW3A 1ABFA 1PGOA 3EZGA 1Q22A 1M34E 1CV2A 3EXIA 4LHZA 2EEZA 4AB1A 3AOEA 3R6WA 1PWZA 3P0IA 4KE8A 4L07A 3KLBA 1AO0A 1RHRA 1TAUA 1R00A 2II6A 1NXOA 2ISQA 2EKQA 2OBMA 1EE1A 3BH0A 2PXCA 3OO0A 4YC7A 5JD4A 3HJHA 1XT6A 1U3DA 5B55A 3TEFA 1VCNA 1EKXA 2Y68A 3N2GB 4IIBA 4ESEA 2ZJ7A 3MOGA 1E1KA 4KQXA 3ZWMA 5ELXA 1OT3A 1KXZA 2X2EA 4OLBA 5I45A 4QDZA 5LYYA 1R0XA 1IY2A 1ST2A 4OY3A 2RC6A 2B69A 4I1OA 2Q4DA 3S1LA 1OX4B 3PC6A 3STXA 2Q6TA 4GUDA 3SX4A 4DQKA 5EHZA 5EIAA 5DLEA 4ZMBA 1KVRA 3H3FA 5LYJA 2QPLA 1C9KA 1Z7GA 3WWOA 1AQNA 1JVSA 2CXRA 4Q0MA 3BEDA 1FXWF 1PZFA 2OZVA 1JHAA 3EBPA 1NFQA 3IBSA 2O1EA 4LTMA 4MWDA 3ROFA 1FLNA 1MH9A 5BUCA 1T2EA 2EKDA 1WABA 3OLZA 4L0QA 4D9KA 4XVUA 5C35A 2QGFA 1RPJA 4Q7LA 1SU4A 3UPDA 1R6TA 4Q7KA 1VGRA 3FPLA 1HA3A 1QG0A 2AJDA 3UXMA 5JS8A 3AUTA 3TIIA 5LMUB 2HT6A 3C85A 3GJ7A 4DJJA 3L0BA 2E1RA 1MC5A 4LRQA 4Q4HB 5BMVA 4A6DA 4OGFA 4G0ZA 3B8EA 1NW7A 3V4ZA 2EDCA 4EBFA 5D8DA 5IJWA 1RKQA 2R8YA 4YCAA 2JH9A 5IT0A 1KOFA 2UZ1B 1HE5A 3RU2A 4A2QA 3HL4A 4QGHA 1I8TA 2IK8A 3EB9A 2H07A 4NBSA 5DJ5A 3KYCA 3AL0C 3T3MB 4RIFA 4LF8B 1VKZA 3EZFA 4HO1X 2RGNC 4QJ5A 1QCDA 2X9LA 4C30A 2Q2OA 4BN5A 5FPKA 2D7DA 4WA8A 2WKWA 1TKCA 1AHNA 2DLNA 2X1HA 3IGFA 2JLSA 3B5EA 5BWOA 4JJ4A 2L69A 3GBVA 4NATA 1NJGA 2XRZA 3C8HA 3FCOA 3B85A 2YHBA 1CE8A 3DDUA 3P4UA 2ET6A 5EY5B 4E51A 2DWOA 1AKUA 3AK4A 2WD7B 4H31A 4CR7A 2O8EB 4W5QA 1SXJC 4PZEA 1P5RA 3B1YA 4JIGA 3LDAA 4WZAB 2HU7A 3CH5A 2ZCJA 1MT0A 1ZC4A 4EHJA 4OXRA 1MA0A 3W77A 3ZHUA 3VO9A 3CY6A 3IT3A 4EM6A 1R9NA 3RVDA 3QG1A 3TLJA 1PHRA 2XNDD 1DO2A 3IOBA 4KLZA 3R5TA 1XA0A 2O5VA 3R3UA 5G1PA 2NVUB 4D4JA 5IAAA 5ECGC 3GZJA 4LSWA 1NOIA 4X3PA 4PNPA 4PE5B 4WZBE 5DISB 5HZKA 1MEOA 2B4QA 2J9FB 4J07A 3OEED 3V4LA 2OG2A 4XM0A 1AGPA 2B4YA 1AN9A 5CT9A 5DVZA 4AKTA 5I6DA 1VHJA 1QHNA 2GK6A 2IHTA 3NTLA 4JSTA 4F2HA 5CJJA 4ENQA 1KP2A 4JI3B 1NMSA 1E7SA 3HKDB 2NSDA 4TLCA 2AQKA 1B4DA 4F5ZA 1CUWA 3BXHA 3IYLW 2RCNA 1MGOA 1KVTA 1JNYA 1V5IA 2DT8A 4LI3X 4DBVO 5BWMA 3G68A 4WXYB 2A0WA 4L5JA 4CEJB 1YJ8A 1MNAA 4BUZA 4HEA1 2NYVA 1H2ZA 2IW1A 4JOSA 4ZDKA 2IZ0A 3ZCUA 2PCJA 2MWMA 1Z74A 3S70A 5H4GA 2X5XA 2PMBA 2P9GA 5JC1A 3UHAA 1E3EA 2YWFA 5CM8B 3KU4A 1XDZA 3F7TA 1GZHB 2QLNA 2V4MA 2EFHB 5K3OA 3KKOA 5HSGA 2GTHA 2QLLA 3GLKA 1VG1A 1MLDA 2V4UA 4LJ7A 3R74A 4CFSA 4EG8A 1LU9A 1P7PA 4IMPA 5A2GA 3AVYA 1IAVA 1ZMOA 1GYQA 5IAGA 1N2CB 3GXBA 4PSVA 4EGSA 1GKUB 5HE8A 2ZU6A 4DIBA 4JJGA 1NVXQ 4WSOA 5CVDA 4FHGA 2QMUA 1WCYA 4MGEA 1KEEA 1V43A 2RG1A 3CHYA 1IY0A 3HCRA 3RSZA 4UUMA 2FPMA 1BDJA 1XU9A 1GG2A 2JKVA 1I36A 2QJTA 2XB2A 3O6VA 1KEVA 1Z07A 2W00A 3I76A 4ID3A 3RUFA 4M83A 3AEXA 4P5EA 4CM3A 1ZVKA 3NC0C 1B3BA 2JJ2A 2K2QB 3CLTD 1POXA 3O84A 4U2FA 4NZNA 4V03A 1BROA 3PQDA 5DLQC 4Y9TA 1PO7A 3VU8A 4XYMA 5C7LO 3K09A 5IJ0B 2ZBVA 3LC1O 3LXXA 3AWIA 2PXHA 4M1KA 5EXEA 1ML3A 3EH1A 1YGPA 2PD3A 3FWPA 2IIBA 2PGXA 5CG1A 2NU6B 1TEXA 2VC2B 3TQOA 1E63A 3SS7X 5HILA 1M10A 5FFMA 4CDRA 5DBOA 2D8AA 4P83A 4P32A 3UJNA 1RDFA 2JJ8A 3ZK7A 1YFZA 2ZB8A 5HZHA 1T2DA 4TYWA 5BN4B 2XXAB 2ZIAA 3FZGA 6NULA 3UMRA 4D42A 3X43A 3HMQA 1V48A 1N6PA 2VNHA 2WJYA 4XSHA 4U9HS 4BLPA 4TKVB 3LTEA 3MVEA 2VT2A 5J47A 2O8FA 4O0LA 4IVRA 1L1EA 5M2QA 4YQEA 1VXRA 3IT1A 4N7JA 5IBRA 4AKIA 4NARA 1XLVA 1GFIA 3H2ZA 4BP1A 3DVAB 3VR2D 1AUXA 1XRQA 3C4JA 2H7YA 5DOVA 1GNVA 1FRFS 1VB5A 1Z8HA 2WAXA 2FUCA 4KI0A 2FJUA 4MUHA 4CMBA 2ZFUA 3ROTA 1K4KA 2QX4A 3E4CA 1ZITA 3PXBA 1O7JA 3WOHA 2FSVC 1SOAA 5F3RA 3WAKA 4MUFA 5K3DA 2IBTA 1WW3A 3NVKI 3JCZA 4QAJA 4RV4A 1XZCA 2ZT5A 4TS4A 3NAMA 5JPIA 5FH9A 1KGSA 4BL5A 4MUMA 3AB7A 1SRQA 1J9EA 4Q3LA 1Q83A 2BF4A 4JJ8A 3WL8A 1VRWA 3IQGX 1R8JA 4IPTA 1IWPB 2JRCA 2HN9A 2DERA 4JITA 2OXFA 3LUHA 3U40A 3CC8A 4JLWA 3K9FC 4HNTA 3WB9A 4DJAA 4EP1A 5KYUA 1ZGGA 3A6DA 3HVIA 2WMYA 4IF4A 3LHSA 4FBGA 4I0WB 2BH2A 3AQIA 1R4NA 2W6IA 4PV7A 2CJXA 2G5GX 3TL6A 5AR1A 2ZAOA 4IO1A 4ZT4A 4I4TB 5GM1A 4KDFA 3TIFA 4MUGA 2O57A 1XJQA 2Q6VA 2GLUA 3OQVA 3S1AB 1PNQA 3CCBA 1BFUA 4LRXA 5ALRA 4C4TA 2VF4X 3UHJA 1N2BA 3DMRA 1JEOA 1WUKS 1FRQA 1HF3A 1JVBA 2PKXA 3HFRA 1U98A 1M1YA 1Y6ZA 4X92A 3ETDA 3GLSA 4ENUA 1IUNA 1V6CA 3QELB 4BFUA 2P75A 4QZVA 3EXHC 2XCRB 2DR3A 3HR7A 3ZGLA 2QRZA 4CJXA 1Q3KA 1TOAA 3LQKA 3R4CA 4NOMA 2BFNA 4CTKA 3DAGA 2CXQA 3C7DB 1T2AA 1QHGA 5FV7A 2NTVA 4UTPA 2NZXA 2C7PA 5FWAA 1S3IA 4K6KA 3BIFA 4LXHA 2YWXA 5JUWA 3WLAA 2E4WA 4CW7A 5F3WB 4MCHA 5CVCA 3DTNA 2RKBA 4J91A 4EG0A 2HXGA 3A6GA 2WPDA 3IMCA 4NMWA 1OYYA 2HYDA 5LLTA 3DULA 1KDZA 2BM8A 1JIKA 4YRNA 1F0NA 4RMNA 1VZ2A 2J5RA 1M34A 4A73A 3KTAB 5FADA 1NNSA 2Z3WA 5FI0B 1S89A 2NSYA 3OLCX 2NUTA 5EXDA 4Z7OB 2CFCA 1EESA 1PIWA 1ZY2A 2PM8A 2HOQA 1YRHA 3CPEA 3FNBA 3WJ1A 4OQYA 3LGXA 3ZJYA 3DLIA 2CKDA 3GH1A 1KEWA 4CTJA 3OO1A 1KJJA 1UJBA 5B4TA 4WKCA 3U4CA 5BNTA 1AKQA 1RQGA 1SUAA 1FP4B 3IQFA 2NLOA 1QH8A 2OILA 1L7RA 4UDNA 4RETA 5AJZA 1K7SN 3RRBA 2V45A 4JBHA 3AVPA 4EPTA 2X58A 4FS3A 4B2IA 2ISSD 3R40A 2GT1A 3B1FA 3LBIA 4ASUA 2SCUB 3TKAA 2OENG 1W0KA 1R27A 2D2IA 1P3Y1 1DELA 1V9LA 1CHNA 2GZHA 2NO5A 3KP1A 1EXMA 3O8OA 4Q3AA 1ORWA 4TS1A 4WKGA 5ER9A 5GV7A 3ZQKA 4EOGA 3UW3A 9ATCA 4PG4A 2BGUA 3H04A 5FORA 2CXSA 3OEYA 5LKRA 2VHYA 3SDSA 5B36A 1U1EA 2GBFA 3O0TA 2JB9A 1Z47A 3D4BA 5TVKA 4X1IB 4P4GA 4NIMA 1NVMB 3MT7A 4J0QA 4U7GA 4E30A 1CFJA 2VRWA 3HBNA 1EX1A 2LIPA 1BA3A 1VBFA 1YS1X 5TS3A 5JSUA 1Q7EA 4YEDA 4YAUA 2DFNA 4NCJA 2WP0A 1JBEA 1XALA 4BFZA 3OM1A 4TVKA 1DKNA 3I45A 1KK0A 3BHJA 5EIBC 1NVVQ 3RSHA 3QUTA 5IK2D 3DR5A 3B5JA 3KZMA 2DMRA 4IXNA 3KOUA 4I3FA 1NAIA 2WZDA 2XUDA 4PCUA 3RVQA 4C4SA 4E31A 4UTZA 4ZT5A 3SQOA 1P77A 5DU2A 5KNBH 4N12A 3G3EA 4XDZA 2CB0A 4PRYA 4BJ1A 5J5VA 3NM5A 4OP1A 1HPLA 1R18A 3PYXA 3ZW8A 1AS3A 4RLFA 5DSXA 3W5AA 4FB4A 3D8NA 4CM4A 1ACLA 4NFYA 2L0XA 3TAUA 2PQ6A 4D92A 3HB1A 2SHKA 4EQ6B 3GLGB 3LCUA 1EAMA 1P9LA 5P8WA 1JXQA 3UB4A 2GAAA 4YJ3F 5E2AA 5F1KA 5G0SA 1MRNA 1YIOA 2V7QD 2QG9A 2C9ZA 1JQ5A 4MHTA 1V4BA 1N25A 1SKUA 3CW2A 1W46A 3S8EA 4WADA 1TF5A 3IDAA 2JLRA 2AG5A 5FO0A 4PG5A 1YUBA 4EJMA 5C2JB 3R8XA 4ECAA 3F71A 2R2AA 1QCZA 4C0AC 2D3WA 5A5GA 2QGZA 2FLKA 2IXBA 4H7EA 4Q1AA 1VSQA 1UANA 2B83A 2Q2VA 4UFOA 4JYPA 4XEUA 5EG5A 3SSAA 2JFOA 1RMQA 2G82A 1N9GB 3RG8A 1G3UA 1UWKA 2Q9AA 1ZX1A 3L93A 1EP2B 3LBYA 1TQ2A 2Q3EA 2DH5A 4HEQA 4KZPA 4OM8A 1VG0B 1UQTA 3AESA 4OK3A 5BWLA 4R81A 1Z0UA 2Y1FA 4D26A 5AOAA 1W2GA 3I9V1 1O89A 3GRKA 4DRXA 3C8UA 3H13A 4LCEA 3B36A 2VTVA 4Q7QA 3AP1A 2CNWA 4MV5A 4HB2A 4ZC1A 3TNDA 2WU0A 2YASA 3L7AA 1BCSB 3DKIA 3L1VA 2NZ8A 4FC6A 1EVJA 1EDOA 4M49A 4D9HA 2IXFA 5JLJA 2IY9A 2X8LA 2XXJA 2ZUBA 4D3XA 1V8DA 1YNOA 2GILA 3W79A 2M6SA 4HDMB 2YKGA 1HURA 3FPGA 4U0JA 2FQQA 3HL0A 4DRZA 3G2OA 3WMWA 3D7NA 2H7VA 5JYCA 3OFJA 1GAJA 4EPVA 2NADA 1SCJA 4D6XA 5EYPA 2Q3BA 4KAJA 4I6GA 4A0QA 4B8ZA 2B20A 5I7EA 4BMVA 1UKEA 5JRZA 3P71T 2E4VA 3W1WA 2DYKA 1ZZEA 3QPVA 3EZ2A 4HBZA 4YRMA 5K01A 4DA4A 1A9TA 1KKLA 3U13A 1IVNA 1XQ6A 1KFJB 4MR7A 4IRMA 1OTHA 3EXG2 3ESRA 1U8XX 4OU4A 4MJXA 4WNAA 4C7KA 3NBQA 5FWXB 1CQIB 3NLLA 4GPIB 1G5HA 2ZYGA 2F2TA 4UREA 5FJJA 3WTCA 3ZWXA 2FPLA 2DFLA 3U6BA 1XWFA 4LOLA 4TRNA 2WAYA 3FOCA 4ZAXA 1TMGE 4EHBA 5AM3A 4KKXB 1XEFA 4Q48A 1L3CA 2FPGA 5A4IS 2ON6A 2XTMA 1AK1A 2VPPA 3EFBA 2FEKA 1C1XA 3FN4A 1MG5A 1P72A 1XZAA 4XB1A 3PF8A 5IC6A 1YI1A 2PBRA 2IJGX 3E61A 1E1RA 2KW5A 3NEPX 2LRHA 1GUZA 2I1WA 1H2WA 1NJ6A 2VJNA 3KQHA 3B1WA 2PKYX 3PS9A 3S5UA 5DT9A 4II2A 3L7YA 3QQPA 2XRYA 4C7OB 3OEHD 3LPLA 4Q1CA 1SCAA 4NBVA 4FJ0A 1JQDA 3SHVA 5J4YA 5E6RA 3GH3A 1OXUA 1DB3A 3LYLA 1NMYA 4MW1A 1QPZA 3EGXB 1UJMA 4LJAA 4QATA 4QC2A 3ZDYB 2C5SA 3W2TA 4BX3A 1GUYA 5A03A 2J0UA 3W2GA 2I9PA 2POCA 3BE4A 3RUAA 4MPRA 1PFKA 3C6XA 2VCHA 3QPUA 3EZ9A 4AS1A 3GGJA 1W4AA 1GZVA 1HT2E 4GVXA 4UEJA 4XA8A 3IIJA 2ZRGA 1O58A 4LJ4A 3VHRA 2XIQA 4NFSA 2BELA 4MS4B 4ZEXA 1NXQA 2B1GA 3IVGA 3DNFA 3W5DA 5LP6F 2GAIA 2X6TA 3PQ4A 2K2WA 4NF2A 4B2PA 5HIKA 3BGSA 3KQTA 1ZHOA 5T5QA 4BTLA 2WV9A 1L3IA 2P2GA 1MN6A 1IY8A 1IDN1 3SF0A 3WQRA 1BMDA 1ZCBA 4R5HA 3WK7A 4C7VA 3RARA 3ONWA 4B2YA 1V5FA 3I9LA 4L5BA 1Z25A 1PT7A 3QYPA 5EQJB 4UU1A 3U4GA 1W85A 1H2AS 2AHRA 3GJ8A 4CCAA 1CQPA 1IZ0A 4YH1A 1LC0A 2QMEA 5K09A 1JJFA 1HDXA 1SHZA 4RY8A 1S8FA 3KT8A 1LK7A 3KD2A 4BJ6A 5JNSA 4EEXA 4L8WB 2V1UA 1SULA 1UAYA 1XDWA 2PMDA 3D6TB 3OQIA 5E6SB 5JAQA 1LQUA 3STWA 5JW6A 1K7XB 2QXUA 1KO7A 4U1RA 4WRRA 2JJ1A 1B00A 5KINB 1LBEA 1QH1A 2Y4NA 2GR9A 3AVXA 2BE9A 1L5RA 4PS0A 1JV2B 4K05A 1BIFA 3DCNA 3A10A 3A9WA 3M9LA 3F3SA 5MN6A 4TWJA 4P33A 2ZRAA 4HGOA 3T5TA 2JAXA 5FHQA 2H9YA 5HHTA 2YN0A 5I4IA 1BX1A 1BX3A 3QVSA 3VH1A 5TQVA 1I7PA 1NUUA 4DM7A 4AQYB 1FP2A 3VR3D 4KDEA 3VMMA 4LF9B 3ZLUA 4L8FA 3DTYA 4FOSA 3WJ7A 2PJZA 4X8LA 2BOVA 2J6HA 2UYGA 2YXNA 3FSEA 4V0MA 2AR7A 1ICIA 1O3YA 2M98A 4QPDA 4XWYA 5FF9A 1G8YA 4BNKA 2PKQP 3KVRA 2MT9A 4RVFA 5IAOA 3ETHA 2G77B 3A4NA 4C0HA 1W5FA 4M22A 4V0QA 2V7TA 2VJYA 2ANBA 3AC0A 5GJWC 3DBRB 1E98A 4MV7A 1QYWA 2C4MA 2W2KB 3THRA 3BKWA 2FZ5A 2NTEA 1U7DA 1Y1QA 3PPIA 4GMDA 3KM0A 3P2KA 4J1TA 3T9EA 1LI4A 3M5PA 4M6WB 4ZO4A 3BF7A 4GOLD 5TXGA 3MINB 5HPYB 1RQXA 1YS4A 1OPXA 1QE3A 3HCBA 3QLUC 4M0CA 2CHUA 4Y1RA 1SM4A 2ESRA 4E88A 3G59A 4L5CA 5ES4B 2BUCA 3ITEA 4RVOA 4WCFA 4BIMA 1DFGA 1F1BA 1W87A 2WC1A 1WSDA 3CRVA 3VVBA 4EW1A 5C51B 2EW2A 2ZE8A 3HG7A 3HXKA 3L4EA 4HJXA 2O52A 4UU8A 1TLFA 1XL1A 1P1FA 1VCIA 1K8RA 3LXRA 4BB6A 2ZB2A 3ZOZA 3QY0A 1SCDA 2O4UX 3GB9A 5ALQA 1D7OA 1WPXA 4P9NA 1HQYE 3ICWA 3LUFA 3I9NA 2C3OA 4BMSA 2UVPB 1QHFA 2A59A 2QPAA 1JZQA 1LS6A 1QIHA 5LP6C 3PUYA 2OVBA 3FLMA 2W6PA 1YI8A 2R6R1 3LY9A 4OU5A 1ZI6A 3IP3A 1XKLA 4Q12A 5AJYA 3TINA 1Z06A 2C82A 3L4JA 6Q21A 2X1MA 1IEXA 4R2KA 1G5IA 1LSOA 3FY4A 3GLHA 4BNTA 4OX9Y 2JFNA 5J5AA 1N9KA 4ETIA 2VP5A 4DHWA 4FB5A 3ORRA 5NLLA 1NY6A 4WERA 3EQ9A 4G56A 4LWZA 4AU1A 1KI3A 3O1JC 1C4WA 4HZIA 3TM5A 2YY6A 1FIUA 2HA3A 3VR6A 2ORED 5CURA 3CV3A 4Z4GA 1EFRD 1GARA 1M2KA 5CEFA 1AKRA 4AS3A 2R8PA 4LQLA 3O2JA 4GP6A 4OATA 1EE2A 2JJMA 3BX1A 1NQAO 2H2DA 2R7NA 1SVSA 1A76A 2MTBA 3COWA 3FETA 4IZHA 2NTJA 1RLMA 5C5DA 2CF5A 3JVEA 4O8ZA 2XNDA 2Z3VA 4FCTA 4S0XA 5HA5A 1P2BA 2FI1A 2VZLA 3FVTA 4RY0A 2HC9A 5AK3A 4P35A 2R84A 3R7NA 4DLKA 3E7WA 3I61A 1E89A 2C98A 3KYJB 4E5NA 2P1ZA 1S2IA 1EU1A 4HMPA 3VZQA 4CMIB 2I99A 3LWZA 4CKBB 4K5QA 5JDCA 1KK1A 3O90A 1P91A 2GCOA 3PKZA 2MSEB 4MQEA 3NT5A 3Q8KA 1P19A 4Y8VA 1HFWA 4V2IA 4PGFA 4WAUA 2JL1A 4O1HA 3HBLA 4R3NA 3RWOA 3ZLTA 4RE5A 2ZRIA 3KKMA 3T38A 2EU8A 1LNQA 2FX2A 3BICA 2GFHA 4IJ5A 3OMXA 2R8OA 3G8YA 2IYRA 4L2IB 3T9DA 4BAGA 5J4VA 3Q5GA 3FSGA 2WTXA 3L77A 1F2DA 1TB4A 1V8BA 2RJ3A 4E2FA 3VUFA 1J0AA 5A4FS 1QTRA 3V1LA 3EVTA 1POWA 5JNUA 2IYTA 2VEDA 1FP1D 1I2ZA 2X6QA 3PGA1 1I2MA 1W36B 1Z2CA 2DGDA 3KPWA 4XGIA 2IBSA 2PZKA 3IR7A 4C01A 3D8HA 4YQZA 3CUTA 1NMQA 2DRIA 2VDPB 5AI0A 4L4UA 4BC0A 3JD0A 4PBRA 5ERGB 2RK6A 3GZNB 4MWEA 2WAAA 3F8TA 3LOPA