1RXCA

E. coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
246
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 85
structure length 246
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxcA00
1V41E 1OTXA 1RT9A 3T94A 4TXJA 4M1EA 1TGVA 1V4NA 1Z39A 1JP7A 5F77A 3UAWA 1PBNA 2OXFA 4OF4A 3FB1A 3UAZA 4YO8A 1PR0A 4FFSA 3FOWA 5B7NA 2A0XA 1ODLA 1G2OA 1VHJA 1ZOSA 5CXSA 4JP5A 3E0QA 4GMHA 1A9OA 4YMLA 1PKEA 3ODGA 4UC0A 5F78A 3U40A 4TXNA 1A9PA 4U2KA 3NM6B 4LKRA 1C3XA 5EFOA 1JDZA 4TS9A 4KN5A 1Z5PA 4QAQA 1Z5NA 3F8WA 4OGKA 3KU4A 1ECPA 4G89A 5DK6A 5F7ZA 1QE5A 3GGSA 2RJ3A 4H1TA 4L5YA 1YQQA 1Y1SA 1Y6QA 4DABA 5I3CA 3LGSA 3KVYA 5F76A 1ULAA 1T8RA 1ODKA 1LVUA 1JPVA 1N3IA 2I4TA 4F3CA 4R31A 3UAVA 3NBQA 4IP0A 4QATA 2QDKA 3OZDA 1RXYA 4QEZA 4TTIA 4MARA 4ECEA 4YJKA 1PW7A 1NW4A 4BMXA 2AC7A 1A9QA 1U1DA 1ODIA 1Y1QA 1V48A 1PR6A 4WKCA 2BSXA 2QTGA 3P0EA 1Z5OA 1I80A 3OZCA 3DPSA 1Y1RA 4F2PA 3KVRA 1JDTA 4GLJA 1K9SA 4D9HA 2HN9A 2QPLA 1NC3A 4OGLA 5CYFA 3PNSA 4OEHA 3FUCA 3E9RA 1JDUA 4RJ2A 4MCIA 1Z33A 4JWTA 4WKBA 3FAZA 1CB0A 1Z37A 1WTAA 5B7QA 3EEIA 4L5CA 1JE1A 4MCHA 4G8JA 1Z34A 2Q7OE 5B7PA 3LA8A 4F1WA 4PNPA 3EMVA 1ULBA 3NM4A 5JPCA 3O4VA 1M73E 1V2HE 1NC1A 1PR5A 5F7JA 5IFKA 3UAXA 1LV8A 3EUFA 1XE3A 2H8GA 3BJEA 1A9RA 3UT6A 1T8YA 1RFGE 2OC9A 1U1CA 1OUMA 1YQUA 1Q1GA 4LNHA 4I2VA 4DA0A 4K6OA 1Y1TA 1JE0A 3OOHA 4BMZA 1PWYE 5IU6A 3OF3A 3KVVA 4P54A 4QASA 2ISCA 4WKPA 1PK7A 1Z38A 3LBAA 1SD1A 4LZWA 3OCCA 2OECA 4NSNA 4G41A 5B7GA 5CCEA 3BL6A 3EUEA 1PR4A 4R2XA 3PNPA 4TYMA 3DP9A 1RSZA 1RYZA 1V45E 4OJTA 4L6IA 4TTJA 3D1VA 2AI1A 2QSUA 3IEXA 1VHWA 1YBFA 3DF9A 4TXHA 1TD1A 3C74A 3KHSA 1RXSA 1U1GA 3K8OE 1Z36A 1T8SA 3K8QA 1T8WA 3ENZA 4WKNA 1VMKA 1B8OA 1TGYA 3MMSA 4D8XA 1CG6A 4EARA 5F73A 4R2WA 3PHBE 4WKOA 5CYGA 4F2WA 2XRFA 3MB8A 1SQ6A 2A0WA 1Z35A 1JDVA 1TCVA 3IOMA 4QARA 2A0YA 5F7XA 2HWUA 4M3NA 3UAYA 1T0UA 1Y6RA 3PHCA 3BGSA 5EPUA 2AI3A 1FXUA 1V3QE 4DANA 3QPBA 2OC4A 1U1FA 4L5AA 1K3FA 2B94A 2PGAA 4X24A 3E9ZA 1JDSA 4JOSA 3DDOA 4TXLA 4D98A 1ODJA 3OZBA 1RXUA 4YNBA 1PK9A 4BN0A 4DAOA 1A9TA 1TCUA 4DA6A 5C80A 1PR1A 4LNAA 4DA8A 1YR3A 4PR3A 1RCTE 4LDNA 4E1VA 3DJFA 4DAEA 5K1ZA 2I8AA 3SCZA 3OZEA 1RXCA 1K27A 2HRDA 4D8VA 1B8NA 2HSWA 4DARA 3BSFA 4GLFA 4TXMA 4D8YA 3P0FA 5F7OA 5EUBA 3GB9A 4M7WA 1RR6A 1SD2A 3O6VA 4EB8A 4QFBA 3FNQA 4GKAA 4DA7A 4TTAA 2IQ5A 5KB3A 3ONVA 1PF7E 1A69A 5ETJA 1PR2A 3OPVA 2QTTA 3KUKA 4OY3A 1VFNA 1U1EA 1ZL2A 3TL6A 1JYSA 2GUWA 4F3KA 1SJ9A 5FAKA 2ON6A 3FWPA 1LX7A 4NY1A 2P4SA 1OVGA 3INYA 3OOEA 2A8YA 5CCDA 1OU4A 1OV6A 4BMYA 4L0MA 4TS3A 1OTYA 1YRYE 4NS1A 1A9SA 5CXQA 2AI2A 3NM5A
chains in the Genus database with same CATH superfamily
2D1RA 1JKFA 1KZ6A 2O4CA 1GCAA 2RHHA 3H13A 4LTMA 2GEUA 4LJKA 1JXOA 1G41A 5H68A 4ZI5A 1C1XA 4XVHA 1N0VC 3HBNA 1D5CA 1FDWA 1FSZA 1SU6A 1TQDA 1RT9A 1ESCA 2ETVA 4WNAB 3UMSA 4AWBA 2Z3WA 5JD6A 2GK3A 1XZGA 1WL8A 4JBHA 3GAZA 1PZGA 3GJ4A 1WB6A 2HNKA 4IGAA 4AZ3B 3EZ9A 8OHMA 1UC8A 3DKIA 1JKJB 3DTNA 3FCUB 1DRKA 5FXMA 5EJ6A 5L3SB 3AL2A 4YCJA 4WXPA 1SVNA 3D4LA 1W6RA 1J70A 4GRIA 3WNZA 4LOJA 2PUTA 1QYXA 2NZJA 2ZVJA 1U3UA 3HACA 3X3HA 4EYKA 4PONA 5EJ4A 1KC3A 3HDTA 1PR0A 3H83A 1RJFA 1ZI9A 2WWGA 3AY7A 4MRMB 1Z22A 2W6ID 3N5KA 4G67A 5IMBA 2YYSA 3TD9A 2QZJA 5EGNA 3RS8A 4KOEC 2LP4Y 3LPNA 2FLVA 4KC0A 1J2UA 3NALA 4U6QA 5LB4A 2YN0A 1GSOA 4BNVA 4MCJA 5JCXA 4D0GA 4ATNA 1SKMA 2PUCA 1GA4A 1VHJA 5I5GA 3OD1A 2B7CA 1MO4A 3FCSB 2JATA 2XMRA 6GPBA 2CFCA 4AO6A 1TO1E 3OEHA 2AMYA 5DLPA 3VR3A 3L8FA 4POOA 3ZVRA 5KX5A 3O47A 3LZ6A 4MIOA 4MOWA 5LZ8A 4Q19A 3W5SA 3GP8A 3CF4G 4LVUA 4RA9A 3PGA1 1FLNA 1CLUA 1ZKDA 2JLCA 2WIGA 1A96A 1NXXA 4MAAA 4UE3S 1OXKB 4MUXA 1IXYA 5FA8A 4TXNA 1A9PA 1DAEA 1R6AA 1IATA 1N92A 2IJGX 2O57A 4IFBA 5DXAA 4N5IX 4QGHA 1E1MA 3DXZA 5AW4A 3QEKA 4KNWA 4JDPA 2OORA 2X77A 4UHFA 4KKXB 1AGYA 1QG2A 3CJRA 4Q01A 1DAFA 3QBEA 4DOMA 1T2NA 1Z26A 4BCDA 3BB3A 2H16A 2COKA 1Y3CE 3H04A 4QAQA 3HYNA 4YJ2B 3SAJA 2HEIA 3LM8A 2BE7A 3GD7A 3QBJA 2D74A 3EB9A 1BSVA 3KU4A 3DV0A 2XDYA 3BBPA 4N7JA 3D7MA 4I6GA 2VK2A 4DTIA 1XD2A 2Q5LA 4BNGA 2PWYA 1GV0A 5KKNB 1IZZA 1ZD2P 3REFA 3VZPA 2RC5A 5EJ9A 1NR7A 1VI5A 3EMKA 1MENA 5A3QA 4DABA 5I3CA 2B98A 4JBWA 1ZLYA 3GZJA 1T8UA 1DIGA 2Y1DA 4Y9RA 5EOVA 1L8XA 3W77A 1FUEA 1LDBA 2ZZKA 2J0QA 2JGDB 3UHFA 2I4TA 4X7BA 3QEJA 4KMMA 1IY1A 3RABA 4F3CA 2HW8A 1QCDA 5LR6A 3NBQA 5IMSA 2OO5A 5AW9A 4KNYA 1X1DA 2XCQA 1OH7A 3WDSA 4PVDA 2ZREA 4DV3B 4K0RA 3JQGB 2ZYHA 2R11A 1JMKC 1Z8HA 1JX6A 2DPMA 2LBPA 2GYYA 5EMKA 1KSGA 1RXYA 2DH5A 3MGCA 3NWEA 3Q0TA 3H87A 5U9CA 2A2ZA 1ISGA 3BYZA 1QP4A 2X23A 2AC7A 5DBOA 1KS9A 1LJ8A 3D2AA 1FP6A 1X6VA 5E8RA 2NTNA 4OXNA 2C3PA 3AZPA 1JJAA 3GEGA 5IRCD 1VPVA 2DWPA 3JQAA 3E7FA 5K0LA 1PL6A 1CFZA 2PM8A 3LH5A 2PGDA 1Z5OA 3ON5A 3UQZA 4A15A 4OSOA 3NU1A 3OLWA 5T6BA 2C59A 2ZKIA 3IV9A 3OF5A 3DTVB 2YZGA 5FV4A 4HX9A 4WADA 2J09A 3QFTA 1QYRA 4OXXA 1X7XA 4RTQA 2H1LA 4BBAA 5FI3A 4K6GA 3DE0X 1IBSA 4JOCA 2P2GA 3ECSA 3IVGA 5A7GA 3S2IA 4EMBA 3DSRA 4O02B 2CNBA 2ZAYA 1Z7WA 2YJ4A 3KFVA 4IBOA 4M0UA 2AFVA 5JSFA 2VBIA 3IBSA 2C58A 2JFHA 1GZVA 3FPAA 3IB6A 5BNIA 5GY7A 3ZX4A 2W8BB 3HKDB 3IV6A 3AI1A 3NHJA 3AVYA 3U44B 1ZK1A 1AX9A 2QN7A 3RAJA 1O0BA 1EBFA 2QUZA 1H65A 1C1XB 2B1JA 3HZHA 4RJ2A 5JAIA 4G5OA 5JTTA 1L9XA 3Q9NA 5L7WA 1XJQA 2YC2C 1A98A 1RWBA 2AJBA 1YQDA 3GLRA 4LXGA 1XZDA 2AG0A 2VQ6A 2ORED 4V0KA 421PA 2C5GA 2BSQA 3RUPA 4PQGA 3U9LA 3ISTA 4L07A 1V8DA 2O7QA 5TE9A 1TVEA 3B51X 3FSJX 2OYRA 4IMJB 2OHOA 2EYQA 1QGUB 4FGKA 1QRRA 3DYVA 3ZWBA 1FFXA 4CL8A 3MG9A 2MCFA 2ZWVA 1IDN1 3H0EA 2WHXA 3K1AA 4LJLA 3JAMA 3ESXA 5JTUA 2PH1A 4W7HA 1QO9A 1RHMA 2DBZA 2DQYA 3ESAA 4FXOA 1E4EA 1ELOA 1PLKA 2O5EA 3UW1A 1V5IA 1I6WA 3DEAA 3MLAA 1SBHA 2QP9X 4WNYA 4ERNA 4MJ3A 2PEYA 3CKKA 4CR6A 4NBWA 4CMEC 4ETNA 2IHVA 1C8LA 2KMLA 3E03A 4HGQA 4OFZA 5BO5A 1ZL0A 2L69A 5P21A 1F17A 1GITA 2OZKA 2Q9BA 3X43A 5K99A 3I64A 3AY0A 1T4GA 1JQKA 3ASZA 3EGWA 2FLKA 3KJXA 1RYBA 2OHJA 1WP4A 9GPBA 4ETIA 2BMEA 1USVA 1U0EA 5FTJA 1BWQA 1DTEA 1RJWA 4E5SA 4CKCA 1WHTA 5J4LA 3M3DA 3BJEA 1AGXA 5TQ2A 1A77A 1TQ2A 2IGTA 2Y2VA 3PX2A 4MQ5A 2H1WA 5E9QA 1L5GB 3WYEA 2WVJA 3OBIA 4QOGA 2DPLA 1G21B 2H4YA 1PZNA 1XZJA 3D1LA 1F8YA 2XNCA 3LOQA 4GMDA 5LKRA 4DA0A 2YWXA 1Z6ZA 2PSHA 2QW8A 4K6OA 5F33A 2XLBA 3QIAA 2NU8B 4BO6A 4IVRA 4X6LA 4UTNA 3BMCB 2GAIA 4CT4B 1I30A 4OBEA 3NNDA 3RQSA 1U2RA 1CJCA 3G82C 1FDIA 1VKRA 4N41A 3COPA 3IIKA 3M2TA 2XBUA 4WKPA 2O8DB 2M98A 3DBRA 2C4VA 3NFRA 1PGQA 4FYHA 3TOZA 5E7IA 2V45A 3MWFA 2WJJA 1A2OA 2VDRB 3SVLA 4C30A 3LBAA 3FVQA 2GR9A 4G5XA 4PLFA 4LZJA 4AICA 2G9ZA 3JRXA 3S7ZA 2Q9AA 1ZCAA 4RTOA 5KMGA 5JFTA 1VSTA 4QG7A 3W5BA 4QBIA 3HBLA 1DBIA 2IA5A 2RAVA 4OAOA 4RSMA 2KS6A 5TGTA 4DMHA 4EFDA 2UZ4A 2KM1A 4FXPA 1TMOA 1S4QA 3BPSA 4K6MA 1KYXA 3VO8A 1X87A 4FSDA 3ESQA 2QRJA 1FDRA 4FFOA 4TYMA 1G18A 4RFVA 3E1KA 4IJVA 3TW8A 2BJVA 1H5UA 4HP8A 5G4LA 3PITA 4F96A 4XZ3A 1HXHA 1DO8A 5F98A 4DR4B 4C87A 4CM9D 4CTNA 2HPVA 4NE9A 2FPLA 4MHTA 1Z5UA 1IEXA 2NYVA 3PNLA 3UGQA 3HCWA 2FF7A 3DOHA 2OAP1 5ELMA 1RC0A 2B8TA 4ZICA 2CMHA 4WZBB 2OO7A 4B34A 3H2BA 4OX9Y 1ZESA 1KY5A 1A8PA 4X45A 2ZITA 4TLLB 3SF8B 2GM4A 4H15A 3N75A 4MVJH 3TN7A 2WYIA 4FNMA 4NYMR 4U63A 4YP1A 4IUYA 4US2R 3FVTA 4Q7QA 1D0VA 1UXIA 3RUEA 4EPRA 2JZCA 2AKYA 4MP8A 4UUBA 4QZVA 5JY6A 3TMAA 4UDYX 2G40A 1KH3A 4KXWA 1CG6A 4O5AA 2CCGA 3O82A 3E9NA 4CF6A 4JLKA 2VTKA 1FRQA 1NAHA 1HTTA 5FOQA 4ZT6A 3N2GB 1YH3A 1VB3A 2NN3C 3CF6R 5F4BA 5FOXA 2BISA 4E07A 1D2CA 5DTIA 5HCUA 1UJCA 3KELA 121PA 3T7EA 4QOIA 3O92A 3ZS9A 1Y9EA 3CWCA 3D0QA 2AWNA 5EWLB 1Z63A 3ETLA 1EFTA 4WOJA 1KEEA 2P1ZA 1KFCB 1B8PA 1TVCA 1D0IA 4CHTA 4ESEA 2NW6A 4P32A 4YQZA 5FV7A 2GX6A 1Z68A 3ME5A 3NHWA 2P65A 2V58A 2FPMA 4MS3A 1KR5A 1E1QD 2HMYB 2RKBA 5CHEA 4HDRA 4PLWA 1A4XA 3GGOA 4PHFA 1C1YA 3VYSB 2DHRA 2CXPA 2Z3ZA 2ZSIA 3KXLA 4RESA 5GWXA 2EGHA 4R81A 4BWYA 3LXUX 1GTRA 3DLBA 1I4OA 2B37A 1N6LA 2ZS7A 2CNNA 1NFFA 3EG9A 4Q4HB 3K9FC 3SXJA 3OIWA 2W2VA 1U2GC 3OLZA 4L5AA 5BOSB 2W2MA 3P71T 5DRYA 3W5IA 2J32A 4XSHA 2ZB7A 1C2YA 2B94A 2NOAA 3L8HA 5BPHA 1SXJA 5IEJA 3D31A 4GKVA 4JLNA 5IKMA 2L82A 4KGVA 2PSEA 2PHZA 3JALB 1OZGA 5B1EA 2H1RA 4AZ0A 3W6UA 4X1OA 4QREA 5I9SA 2BFCB 1NQUA 2ZIAA 3N8HA 4BB0A 4RIFA 4OHFA 3HQ4O 4F2GA 1YFLA 5L3SA 4J16C 2XYHA 3DMGA 3IODA 4ICIA 4JQYA 1CUVA 1USKA 1EVIA 1E2EA 2DH6A 4Q9JA 4QDKA 4GRAA 1A2BA 4OB6A 4PGAA 3V8RA 3TIGA 2JD1A 1T3ZA 4ZU1X 3HYCA 2AF3C 1UZMA 1PR1A 2X8AA 3CZ4A 4PWYA 1TZKA 3IQFA 4YECA 5BSFA 3G8DA 3MUEA 4L4UA 2H18A 2I1WA 3TSZA 4CKXA 4LDNA 3AF3A 4M36A 2FSSA 5ALJA 3EXHC 5IJAA 2YWCA 4IZ6A 4OI0A 2PL9A 3LUJA 3IJEB 4MQFA 3BQ9A 1X3SA 2D5LA 2XZTA 4Z0TA 4TKUA 2UVPB 5COBA 1FRVA 2WMYA 1MOPA 3MPUA 3NVKI 2R2GA 3L7BA 4QNMA 1Y8RB 3BJMA 4QO8A 2PGLA 4BBJA 3ICEA 5CMLA 5I51A 2XSZA 1Y3AA 1HFJA 3TZBA 1D7AA 3NV9A 2X9NA 3FYCA 4II7A 1VKJA 1UPFA 3G1TA 5EE1A 5GONB 4RLSA 4DXDA 3S1LA 3H2HA 4P08A 1M2VA 2KBEA 1PEDA 2YHUA 2HJ9A 3DCNA 3O8QB 4QYIA 3AG6A 4XJXA 3S44A 1TCCA 3OECA 4JD5A 4A5OA 3KPJA 4O2BF 5EFZA 3P5BA 1X7XB 3BAFA 3Q9SA 3A9SA 3I83A 4FDAA 5ALSA 4O8CA 5I7VA 4RK4A 1N2IA 2B2CA 2WKPA 4YP9A 4AP6A 3B1WA 3PEVA 3PRYA 3QVVA 1M34B 3N3BC 1S02A 3W1VA 5ER9A 2DLCX 4HKTA 5KWSA 4FCVA 5BUCA 4ZOLA 4GUAA 4X3OA 1TU4A 3I01A 1U8UA 3PXXA 1MJNA 1XU7A 4FGSA 3IXMA 4CM8A 3UZUA 4P53A 1LX6A 1XTRA 1YI0A 4MQFB 3TLJA 1CCWA 1Y8QA 3FDZA 3OOSA 4LSWA 3FWKA 4BB5A 4Q66C 4HRXA 4KACA 3NBAA 4Q16A 5E8JA 1NJ1A 3P19A 4V0LA 5BWCA 4N49A 3NPAA 4ND5A 2DVMA 2PA0A 1RQ7A 3GH1A 2MWMA 3STVA 3H4IA 2ZVPX 1QH1A 1VFNA 5DOVA 4WK4B 2WI8A 4XD2A 1SOAA 1NVDA 2PKQO 2ATIA 3Q10A 5EHQA 4BMPB 9ABPA 5DWDA 1B3BA 4W5RA 4TZKA 3WJ1A 1O5OA 1QAQA 3S1AB 1YF3A 4XWGA 3EYAA 4QRIA 5FNVA 4XOUA 4JUIA 4UDNA 1YDFA 2EFHB 4GGOA 5EMLA 3MHPA 1FNBA 3PI7A 3X2SA 4X1KB 3JY6A 1LDMA 3DDUA 4FTWA 2NPFA 3PJRA 3I04M 2VJPA 1VYUA 1Z4MA 3EXHA 4JBLA 3DL2A 1XDGA 1F3OA 1U6JA 4XIJA 3DEJA 1BD4A 4Q4AB 1AH2A 1ZCFA 2HHHB 4FUTA 1QX3A 4O2LA 1FP1D 3AINA 1JWAB 3TM4A 3PSHA 3H18A 4NY1A 4OHCA 4FC6A 5CBPB 1KYWA 1JNXX 1ZJ5A 3OQ1A 2O2JA 3VJKA 4JBYA 4ZVKA 4AZTA 2ZTSA 1VZ3A 3GRFA 4RACA 3ASVA 5TRTA 3R75A 4K81B 1XEFA 2HJVA 3U3ZA 1K8RA 3WWDA 3RB8A 3AFOA 2JHFA 4C6TB 5JD5A 4RETA 3R4CA 4E5DA 1OI3A 4L27A 2WIAA 2C83A 3OKCA 1MNQA 2GVNA 4A8TA 5E38A 4NHOA 2WAMA 3EGDA 2W98A 2E4UA 1W0KA 1PJRA 4M6WB 4UM8B 4ZYVA 3EDMA 3H97A 3QI7A 4W6QA 3UJBA 3B7PA 1JFVA 3P9ZA 5F2OA 3AZQA 5CDYA 2G72A 1HURA 2PPVA 1JHQA 1MFZA 3EDQA 4XAQA 2JAPA 3F2IA 1SVOA 2AOTB 2ZZMA 4YRZA 5KX5F 7MHTA 1D1PA 4AL4A 1H1LB 4F6CA 3CVJA 3O1HB 3S81A 2NACA 2ET6A 2EW1A 3DMPA 3ZE8A 3HLYA 1LPOA 4N3AA 2FW8A 3FI0A 2YJ5A 1D6SA 2C5HA 3ZCTA 3ELYA 5JBIA 1R4NB 3HCRA 3PPIA 4MEAA 4MP3A 3WI7A 2V7VA 5DSXA 5C0OE 1FU4A 4F8EA 4KV9A 4UQPA 4EY5A 4BGDA 1J0BA 3MOSA 2E4YA 1ML3A 4PSDA 5CNMA 5BWOA 1CF4A 2I1LA 2IEIA 4QJ4A 3WP0A 1J21A 4DWJA 2XXAA 2FMFA 2NMVA 1PR9A 4WESB 3C4JA 4MO2A 4YLYA 2C0CA 3PKZA 3Q40A 4RGQA 5DTRA 4RVFA 2XB2A 2Q5IA 1HDEA 2YW2A 5FBLB 1AN0A 3MHTA 2WV9A 4YJGB 1GG8A 3F67A 1D4OA 2VHVA 4KXFB 2RGEA 4QPDA 4CKCB 3U61B 4MGHA 1YJBA 3A11A 2WLSA 4HNQA 4OBBA 5LD2C 3DA8A 2I6SA 5F12A 5B55A 2IHBA 2NP7A 3C45A 1KVRA 1KDVA 3G9UA 3W3AH 4HEA6 4LBYA 1NKTA 2NZ2A 2WM3A 3H6KA 5IANA 3V1YA 1TZCA 3O5AA 2QR3A 2GCIA 4EJ6A 1IQ0A 3UOGA 4OGFA 3FSGA 1HLPA 4B6OA 3GP5A 2DFTA 4JLSA 5IKXA 3ROZA 1GZ6A 3TX6A 3OE7A 3JQQA 2PX2A 2CVZA 2Q3MA 3M0EA 4RFSA 4K9KA 3WBBA 1U2PA 2Z9CA 5AWFC 3ODGA 3UWDA 2ZM5A 4BNTA 4BHTA 1U0RA 2J1LA 3VNSA 1Q0TA 2QT0A 2YOGA 3B2EA 3VYUB 4JQSA 1XK6A 4TN1A 2AC4A 1RIFA 1DOZA 2WF9A 1SUAA 4IIVA 4K1LA 5HXAA 1V5GA 1IM2A 2QU7A 3BG5A 4QQ8A 4D6PA 1ZKMA 2NSDA 2ZR9A 1MB0A 1S0UA 2JVKA 5C2JB 1B14A 2GKGA 2OM2A 1EFVA 3V8VA 4GR4A 3ZZNA 5AI9A 1JV2B 3AW9A 3ZTYA 2HXGA 4IDPA 5DCYA 4U0JA 3O90A 4L5BA 5AW8A 4KPGA 3UJCA 4Q3AA 2ZYVX 4NCXA 4BJ1A 1M2JA 1CUBA 3PBKA 3HDGA 3CT4A 1KOGA 1O94A 4AJNA 2X7HA 3K4QA 4L0CA 4RTMA 1BJRE 3EISA 1MIHA 4MDYA 13PKA 2QI9F 3A6EA 3TRDA 2CVHA 3ZDYB 1PV4A 3V8MA 2F1HA 2ZIVB 4UCFA 5C5CA 1R27A 3N7AA 4RVUA 3E9QA 1R18A 1M1YA 3FCXA 4G0QA 5C51B 4GL2A 3E7DA 1JZSA 1SN7A 2IUTA 2PL1A 3B1KA 2AL7A 3H5NA 3IP6A 3ZEIA 1FRZA 4AJEA 3WLFA 4NYIQ 3LGSA 3LBHA 1YKFA 4LSGA 3TQQA 1P5RA 1I2AA 4GAEA 1T8RA 4X6UA 5T67A 2FSFA 1Y6GA 4H77A 1Y4DE 1ZZEA 2PLNA 1BYUA 2YH2A 1C3VA 2WJ3A 4JLVA 4E2FA 3QLVC 1AD2A 3PL1A 1F8FA 4LXXA 3UXYA 1B74A 1CWUA 3UY4A 1WDTA 3NOQA 3IEVA 1EBBA 4HRAA 2FJ0A 3LDGA 5DP1A 5AK3A 1A04A 1K6MA 2EFGA 2HK6A 4LEIA 1VBMA 1QXSA 1V37A 3L6CA 4OQDA 1XCGB 5BT9A 2BGLA 2RGRA 2Q5EA 4DMCA 2XUOA 1N33B 1QO7A 3M70A 4FNAA 5C5IA 4LECA 1B26A 2A67A 3PGVA 2O1EA 3NQ41 1KSJA 3NBXX 4KLNA 1NN3A 4QTUB 5DU2A 1W94A 4GX5A 4BCCA 4I55B 2PFSA 5F3RA 2NZVG 2IYEA 2VSNA 2ZS8A 3DV2A 4AJKA 1ZA1A 2SKEA 2X2OA 3VNVA 4F04A 3ZE0B 1UEXC 3T1QA 1R9JA 3DVLA 4EB6A 4YONB 4KFUA 1LU9A 1BWSA 3CSDA 5E1MA 1CR1A 5B1HA 5KNCD 5I7EA 2PWBA 1K68A 1KDRA 4WSOA 2P2YA 5F3DA 1G8PA 2AXQA 2CJWB 2H54A 3R0JA 4FYKA 3PDIB 3PYMA 2VUIB 4FDUA 2J0UB 1JDTA 2YHIB 3VC7A 2V8OA 4Q12A 3W1EA 4AJ4A 3PGLA 3IDFA 4LVOA 1KIMA 1X7WB 2HN9A 3MLBA 1ETUA 1NC3A 1JEYA 1ZD5A 3DBVO 1WMFA 3SZ3A 2P9CA 1PYGA 2E18A 1O58A 4RZSA 3TPZA 4ZHQA 1W36D 3QSGA 4RC9A 2OT3B 1HOTA 5KREA 2NIPA 2JANA 3HBAA 5D3MB 3HDQA 3EY9A 2HSEA 2RJNA 4QHSA 4P4SA 1ZXLA 1MPTA 3TQFA 3F6EX 4D4LA 4DA9A 1R2QA 3WGNA 3PEWA 2HMVA 1JTVA 2HNBA 3KKLA 5CDFA 3RVQA 1G9SA 4A1OA 4AJPA 2QTBA 2HTFA 1IIRA 4Y2JA 1D2GA 1K8YB 3QUBA 3FUUA 1HE8B 1TEVA 2NXCA 3O73A 1NF8A 5HNKA 2BVNA 1PFGA 3QXXA 1VJ0A 4OREX 5DN6A 3CVXA 4L2IA 1OKKD 2W2LA 3ND5A 2OD7A 1Z83A 3SYLA 2BFBB 2IXGA 4KSCA 3SLKA 4E5YA 5K5EA 2PUGA 3DM5A 3HXPA 4GVLA 1BA3A 4LNUA 4OQ4A 2MSLA 5CCBA 4MDFA 3GLUA 3M2PA 1IL0A 5B6JA 4FOOA 5LPNA 5FPTA 1AURA 1XN4A 3KQOA 3LPAA 3ER9A 4DRXB 1MDBA 2EP7A 2LWIA 5E7MA 5IC4A 1F5NA 2G28A 3EA4A 3EGXB 1M5RA 1SULA 1ORWA 2IS1A 3E9CA 2GBGA 2NSYA 3E1GA 5DHAA 3K9WA 2RHGB 4PZLA 5DWQA 3ZGNA 3T3DA 2Q45A 3A1NA 3QPDA 1PWZA 5CT8A 1U2QA 3LDFA 3D3JA 5TMPA 4FFRA 3ZY4A 3S5UA 5DM4A 4YB8A 5EJAA 4C2BA 4D4IA 3M4ZA 1M74A 1G1MA 5CH5A 1KHTA 1W4CA 3H75A 5I7HA 4AMYA 1KJJA 1NNUA 2BE9A 2HJWA 4C6RA 1C9YA 1E3QA 4Q4JB 1P7YA 4BV3A 2C42A 4PLCA 1KO4A 3ZW8A 5K01A 1EX7A 1FW6A 3F74A 1CUIA 1G8JA 1XLVA 3OD5A 3OMWA 1HT3A 1R6TA 1XMVA 1Q2XA 5E6SB 2XITA 4E08A 5JNWA 2VDWB 3HCBA 2KBFA 3OOJA 2Q0XA 4DLZA 1O6ZA 3TOCA 3ZHTA 2P0AA 4BU0A 1U8FO 3O03A 2BGGA 2Q3BA 2EGUA 2ZRLA 4KNVA 4F06A 1Y0BA 3K70D 4JNCA 5GONA 1PWYE 2IS6A 4Z0NA 2PKWA 1ZJWA 3FN4A 5EG5A 3X1KA 3UV7A 1DWQA 2VHYA 1UJMA 2X19A 1DTWA 2QLLA 3CQ9A 4EZBA 4HYQA 4RJTA 2DFKB 1CF2O 3B6JA 1WXGA 2VQ3A 1WD5A 3PUVA 2XZOA 1B2LA 1GNLA 1PTKA 3E18A 1NBHA 1WF6A 2HQ1A 1W8IA 3OX1A 1CDDA 1E9BA 3C7TA 3IE2A 3SDSA 5JARA 3DE7X 3A6GA 4RKFA 1PUJA 1PCXA 3OSZA 4ZI3A 2ZPUA 4KQ9A 1DQSA 2P9YA 2G0TA 5ENDA 4CV2A 3M4YA 3AFHA 2FX3A 1JR3A 4LJ7A 3I01M 1Z2PX 3VTZA 1I6KA 3QYFA 3DWEX 4MUNA 1YV9A 2GOYA 3V33A 3JYHA 3OU6A 3V9AA 1QRUA 1S3IA 5I9NA 4PYMA 1AGNA 3DCJA 2QAGB 3L7AA 4HAYA 1AN9A 3GPCA 1JLMA 1FP7A 3RLFA 3T1VA 3WYBA 4RVCA 2BZGA 2JVIA 2YJ6A 2FETA 1ZVKA 2OZPA 1LNZA 1MB9A 1RJGA 1NJFA 1P1RA 1Y33E 4TXHA 3ZNOA 4IZHA 4CF4A 2EC5A 2P3QA 2WT9A 3KHSA 4DSAA 3A3YA 3GN2A 3HA7A 1CR2A 3ML1A 4GI2A 2PFKA 4WQMA 3RIEA 4LQDA 4CQLB 3WNDA 2O8FB 1DX9A 5AUPB 4ML3A 4JC4A 1RZRD 3RYCB 1T8WA 4EFLA 3STUA 2ZS9A 4Q6BA 1GEGA 2HDWA 1P7WA 5CGZA 4RPGA 5FTKA 1GNQA 3MD0A 1F8UA 4R51A 4WCDA 1IAQA 5IX8A 3EGOA 1IUOA 5DI3A 4KO3S 2N47A 5E2BA 2XT6A 3TMYA 2IYSA 4R8MA 4WLOA 1K92A 2YBDA 5DM2A 5BRAA 5MFPA 4G84A 4GBMA 3QLVA 3EZFA 3WOHA 3G2LA 1L5QA 1G5PA 3GBPA 3KOOA 4BEJA 2OKGA 4ENVA 4AZSA 4BN5A 5KTTA 1NNEA 2I99A 1KOJA 2WV7A 4GLLA 5BW8A 3ZHZA 5ECYA 1G7CA 3U5TA 1LFAA 1N2GA 3AHHA 4QNRA 1EG7A 2YZMA 3CNHA 1ZJ6A 3NVDA 4RV9A 1MRSA 3OG9A 3H2ZA 4UAVA 5IS2A 4TKZA 1DI0A 5E1BA 4QYSA 1HDCA 3QWAA 3OCZA 3VAZA 1GAWA 4C2TA 1EWYA 1E3TA 1ADGA 1YQTA 2VCHA 3CSSA 4LV6A 2CJYA 2VNJA 2G3YA 3OQOA 2BBSA 3I09A 5G02A 5HZGA 1O7JA 4UTXA 3RT9A 1HGXA 1BEUB 2VL7A 1ECCA 3AF6A 3MW8A 4M8IA 2O8CB 4YAOA 3U4GA 2JFFA 3KQPA 5IT9A 3UMMA 3E9MA 3CNNA 2AK3A 3K6RA 4WN9A 4FOLA 3L4KA 3R3ZA 1B1CA 1U7TA 1C7EA 2FK7A 3G59A 4EHKA 1OLXB 1BS1A 2VBCA 5HPYB 2QKYA 4ENPA 2CJPA 4OQNA 2VT7A 3ZHRA 2YHAA 3CLUD 3C98A 3M6LA 2ZE8A 4RV4A 2HQOA 2PGAA 1XPJA 3RTGA 3S2SA 1H6DA 5EIBD 5EIWA 5LZ7A 3WAJA 3LUBA 3HEMA 3OEYA 1W73A 3FE2A 2QY9A 4FOTA 4EO7A 5A02A 1YA6A 4I4NA 4UHCA 1F8XA 2BZ1A 4NATA 5ALMA 3H3FA 5CEEA 5FTLA 5FUBA 2PBRA 2YZKA 2FRXA 2WUGA 4RDHA 3A6ZA 1NOJA 1PQ4A 4G0XA 4UM7A 5CVTA 1EJBA 1N6KA 2H06A 1O6CA 2O2XA 3HCFA 3VXKA 1QIIA 4ILKA 4Q7JB 5EWLA 4E30A 5CBKA 5JBNA 1YDEA 3QF4B 1IWOA 5D6OA 1T1EA 4C9BA 4YRRA 2ZT8A 2BSAA 4WT7A 1QOZA 3E58A 4L8VA 3BHMA 1CQWA 1XXHE 3Q85A 2PKQP 4PM4A 1P1JA 4TV8B 3S2FA 3R4VA 4DCCA 5KX5B 4OD0A 2FWNA 4Q21A 1RWWA 3ANLA 4E2ZA 3PGJA 1LRLA 2C5SA 3IQZA 4WJLA 3BF8A 4ZAXA 1U3TA 1T8TA 1CQXA 5IABA 2YN4A 2QHXA 4CG0A 1MV5A 4TLMB 2Y1GA 3VU1A 3UJ6A 4CEJB 4FMPA 4F38A 1W52X 1NYTA 2B8EA 2O2DA 3RSHA 4G5GA 4CLEA 4EY7A 2AD5A 2P11A 4G24A 2ZAOA 5FI0B 2NZ8A 4EKYA 1WXIA 2OV6A 3DLCA 5KNLA 3B12A 2NXNA 1LRKA 1HSOA 2OBFA 1NZFA 3A36A 3E48A 3GT4A 3QVLA 1BVHA 4Q1CA 4L4XA 5K3FB 3RFXA 3QUSA 2J9YB 2IHJA 2XWSA 4IKEA 4RNDB 2AUTA 3KV1A 3GMSA 3A1SA 3LLMA 2CJWA 2HFJA 2OHHA 3KB8A 3CX3A 1Z06A 2X22A 1OVMA 3CGWA 3VNAA 2Z6VA 4BTVA 1ZVQA 2BM8A 4CWAA 2BHRA 2C9CA 4ZJUA 4EB8A 2WZCA 2ZI3A 4LXHA 3SS7X 3NRCA 2FVYA 2E82A 3UQYS 4HQ6A 4DPMA 4DLTA 5J2TA 3VU0A 2A88A 5DVZA 5AK5A 3VU8A 5JMWA 1G55A 1T91A 1WWKA 1Y42X 4M0LA 1U0TA 3O4HA 4NMLA 4CCWA 3AR4A 4D42A 5KDOA 1JA1A 1TKBA 3K6KA 4AAYA 4GG1A 5EKSA 4HGNA 2WUFA 4EY8A 2LGJA 2LKDA 2XADA 3MWLA 4PTLA 4RMHA 1CS0B 1GSIA 1Z2NX 4KQ2A 1XMIA 2IXEA 3HYSA 2OLEA 5TT0A 5EMMA 5D2CA 3DMRA 3QX8A 2FRDA 3RG2A 3E2MA 3LUDA 1C5KA 1GRVA 3DDWA 4MPTA 4EDHA 4G0UA 3TUIC 2VRWA 3BRCA 4EPXA 4YIHA 4DKJA 4KWTA 3PXEA 4C05A 2WTMA 3EEBA 4Y2UA 1QZZA 4YIKA 1UMBB 3P9CA 1U1EA 2IBSA 3SG0A 1SC3A 3LP6A 2IHKA 3R20A 1L5KA 4OKSA 2NLOA 5ESDA 5HIMA 8ATCA 2F3RA 3H6HA 4LGCA 3COZA 4YAWA 1T4BA 4LQCA 5D5QA 4OLBA 3BC1A 1CJUC 3VJRA 1ODSA 2WSMA 3Q2IA 3R3YA 4R6WA 1BAPA 2O8NA 1PLLA 1XG5A 2EF0A 3PEUA 2ATXA 4I5IA 3ZHXA 5HZKA 5J2TB 1G3MA 2ZWMA 3TAXA 5IJ9B 3L7NA 4S1OA 5FR2A 2ILVA 3K9QO 2Q7DA 2BP7A 3BWBA 4DJEC 4QVIA 2QV7A 1BZYA 4YCMA 2F1OA 4C4RA 4ZJPA 2ZR8A 4MPDA 4LOIA 2NO5A 4FDLA 1VM6A 1TECE 2YFHA 4N8SA 3F5MA 1QANA 3OZVA 4ZI7A 3KL4A 4B6PA 1T1SA 3NG1A 3VO9A 1KO8A 2NZXA 2SECE 3WKBA 3G2NA 3LY9A 2DFVA 1SWWA 2JAHA 2WFLA 4MUEA 1K9VF 1W4BA 5EERA 2Z2IA 4MRVA 1RLUA 2GM9A 2QJWA 3HWX1 3ONFA 1OFGA 2HD4A 2HLNA 2G1JA 3CG0A 1GN8A 5AM5A 2YQ4A 4D02A 5BV1A 4JLUA 4OQFA 2ZP1A 5T3YA 3W8EA 1HA3A 1E2DA 3NHZA 5DSZA 1GGHA 4ZDKA 2HWWA 5B58C 3Q3HA 3GFSA 1WXXA 1CU1A 4J29A 1YC5A 4DQVA 2Y93A 3TAUA 3ZJTA 4GYYA 4ZXPA 3WWCA 5AK4A 1FDOA 2YV3A 3MRTA 5I45A 1QV7A 2X9QA 5CJPA 4HDKA 1FFEA 2FMTA 1RI3A 4CV1A 4Z9BA 3TH5A 2XB8A 1K3UB 1NI4B 4G1EB 1O6BA 1EP1B 1UBSB 4F5WA 4FZ5A 2POCA 1T29A 3B1VA 5BRJA 5I7SA 1VLZA 2X8BA 4FGZA 1ESEA 1XA3A 3IELA 1F06A 2INGX 2QW1A 4RGVA 4B47A 2OGZA 4US0R 1KJQA 1J2TA 2IUUA 1I24A 2YZ2A 2QTHA 4Y2PA 3GFPA 2A35A 1K8XB 1D8TA 3BORA 2D5CA 4GFDA 1G4HA 4MQEB 1CIPA 3DR5A 2JAUA 3C3AA 4I14A 4QHTA 4B2PA 3AL0C 4X54A 3FMIA 2COEA 2DAPA 3PXCX 2ZIZA 1JEJA 1N34B 1J0CA 5BV0A 1GTJ1 4W5JA 1ZSNA 3L9WA 3WGQA 5IKPA 1IY0A 3JQAB 3CVOA 4NEQA 4PNHA 1ODLA 5KNDH 4Z9FA 5BW5A 3P7MA 1QOQB 3NH9A 1GL9B 2ACVA 4OP2A 3RRNA 1NJSA 4FMDB 3PFNA 2QLBA 1DKNA 4L8FA 3OLXA 4CQNA 1AT1A 5CXSA 2AOTA 1R15A 1NG1A 3GLHE 4GMHA 4KXYA 4TOIA 1P2GA 4GOKA 4Q82A 5LQUA 1MN6A 3AKCA 4WL0A 4N6NA 5HA5A 3WZMA 1BTOA 5FWAA 4IKOA 4KIFA 2HSZA 1ZGBA 4ZREA 1T6NA 5FWXA 4BCBA 1ISSA 1Z4JA 3EWIA 4W5OA 2XUZA 3KLOA 3B1JA 1GPWB 1P8AA 4XD7A 4Z1MD 2R7KA 1RLMA 2PRZA 3HE3A 3IQGX 3THOA 3I1FA 4AKEA 2D54A 3DHYA 4DLYA 4YAGA 3PX7A 3FWHA 1G5FA 1BHJA 2DMRA 4H6WA 4XQ9A 3FOEC 2VZ0A 2QTNA 2YUTA 4G1MB 4M1QA 2ZRGA 1XZBA 4D4GA 2PU5A 1VDZA 2AE1A 1JYEA 4WK6A 4F92B 3FYDA 4UNIA 1A8SA 2B0JA 1U2GA 3QWFA 3E3AA 1KYVA 5C1DA 1GPNA 4RH1A 3RADC 3IVXA 1HY3A 5AI8A 3A9CA 1ZXXA 2JRCA 5DNUA 2R3SA 2AW5A 4QJBA 4ZARA 4LF6B 2PS9A 4UTOA 1XTPA 5HE9A 1IHOA 1UBUS 3UJ7A 5JNSA 1CB7A 1X1SA 3HBFA 1ZOIA 4UMEA 2YS7A 4PIPA 4U02A 5ARCA 5EZYB 1H8HD 1VJGA 2X1HA 4ARAA 1NY5A 3PQ7A 1V25A 1YASA 2VYVA 3I8XA 2LIVA 4D9KA 5TJHA 3RH0A 3UYLA 4ZOBA 3BFJA 1S1CA 4KOAA 4M86A 4DHEA 3ZLJA 1JJFA 3NDJA 2O6HA 4Q37A 1JILA 1GCUA 1ZVMA 2YN2A 2ID8A 1W9HA 5CLJA 1BXGB 4WOCA 2J5XA 1BXRA 3RHTA 3HO6A 4BFCA 4D9BA 5GQSA 3KPVA 5JS6A 5ALKA 1QH9A 4R16A 1VB5A 2OCDA 4IIYA 3WADA 1N0IA 1OZHA 2AYYA 3EBOA 1VIAA 3KDSE 3QXSA 4RM2A 4RUKA 4XWYA 1E6WA 1YTLA 3H7AA 4X00A 4DIDA 1CY6A 3C48A 1GOTA 3B82A 3DTVD 3L06A 1MW8X 2I4OA 2CZCA 2PT6A 2UYQA 5E0KB 4CTOA 1W48A 3IE1A 3DP7A 3L1KA 3W5HA 1AQJA 2YWHA 1I1HA 3I0NA 1TK2A 4C4ZA 5E7QA 4HG2A 5IM4A 1EG2A 1Y1QA 4WJKB 4GZ6A 4G0MA 3PWZA 3I5XA 4EENA 4JEHA 1IBMB 2FEMA 4TMXA 1P7VA 3VR2D 2DUMA 4YQYA 2R6GA 3HCNA 3TE6A 2VS1A 2E1PA 1W59A 3KT3A 3RV3A 3VU3A 4R84A 3Q88A 3HCCA 4YQFA 1PJCA 3U4QA 3MA0A 1O4VA 4OP3A 3AKDA 1KY2A 2FKAA 3I3SR 3KUUA 4HADA 1BEEA 2PUDA 2Z2XA 5HUJA 4RHFA 4AN0A 3AEUB 3S2ZA 2QJOA 5A6SB 4MVJE 3K5IA 1R74A 2PMFA 1FMFA 5D3ZA 5G40A 3M83A 4HNRA 4KIGA 2XA9A 2QN8A 4NZYA 2C7RA 1R3DA 4JGGA 1XRSB 3RUFA 2WA2A 1S96A 1ZNWA 1NQAO 4OEHA 3A3OA 1L6RA 5IWCA 4IG9A 1MHPA 2AMFA 3DAHA 3T7KA 3VR0A 2DFLA 1FLVA 1R6BX 2SBTA 5DYGA 1AHIA 2JHCA 2P9BA 4KW7A 2XTJA 3AR3A 2HADA 4ZQCB 1DQNA 1XVVA 4FMCB 5ILGA 4JI3B 3VPDA 2ZRDA 4D43A 4WKBA 3KB2A 4BZZA 1TZBA 1L9KA 1SHKA 4OI1A 1RKVA 4WA8A 4Q47A 1KQGA 4GQAA 4PGGA 3MRVA 4ZI2A 3OE7D 5AJXA 3TSWA 3BWXA 4WDRA 2GPBA 1A72A 2D00A 4TT3D 3LHIA 2BD0A 4AKSA 1WS6A 2MYNA 3SIRA 1HEYA 4IDNA 5EHNA 3TUZC 3HRIA 4P38A 1NBME 4QELA 3M5WA 1K6IA 3IV7A 4E2WA 1U8ZA 1VIYA 3VYTB 1HDZA 2XNKA 3PKIA 4FK8A 2X6RA 4FFDA 4B6GA 1DWPA 3AILA 4FQ5A 3MTBA 4EH1A 4PNPA 3N87A 2OHGA 2OE2A 4IIGA 3EMVA 2C95A 2W9XA 3OQIA 1MV8A 2DY1A 3EQ9A 1RRFA 2CXTA 3FPEA 4L74A 1FDSA 3OJ0A 1U4NA 1ZP6A 4C5AA 3FYUA 1V2HE 5DTQA 4JT9A 3BSWA 3KK0A 1SUCA 3V7YA 3QPAA 1QG6A 1IOLA 4J7AA 3LC7O 4KLCA 4NPAA 1W0CA 4MV0A 4Q39A 3LLCA 4DZZA 1FUKA 4YWHA 1NNI1 4FNGA 1AXEA 2IPAB 3JASB 1GGJA 5BT8A 1UEJA 4QYMA 2BDTA 2BKXA 1NBMA 1DQRA 2D5BA 3LUGA 3ZLBA 4JAVC 4JFRA 2Q3CA 821PA 1UBCA 1ZYUA 3AKEA 5CT6A 2Y1LA 5CP8A 3BMOB 5EZSA 5AUQA 4R2HA 4R2IA 1OV4A 3BCRA 6REQB 3FB4A 1C7JA 1WLYA 3UANA 1IQRA 3FAKA 4J0CA 4ENSA 4BEWA 1DUSA 1PWEA 2Q3FA 5JCJA 3ZIAA 3QLUA 1QVWA 4XYBA 4DCJA 4R0VA 1QB7A 3UT0A 2ZSJA 3BJRA 4BQEA 4P54A 4WXMA 4QASA 2GA8A 2FPKA 2ZJ5A 3TJRA 2IHNA 3TI9A 4B09A 3LL7A 4DV6B 5FD8A 1AUQA 1LD3A 2B25A 1U9IC 5D3KA 2W6JA 1WPXA 2ZYSA 3NO4A 4LZWA 3C3JA 5AJTA 4Q9KA 1S3GA 1SOWA 3DVSX 2GPJA 1TLTA 3LGAA 4YPOA 4CKZA 5LVAA 4LBZA 3TEFA 4MK4A 4S1PA 4TTTS 4QAJA 4TYPA 2QTAA 5CCEA 2C5LA 5KQLA 5EXPA 2AH5A 4X97A 2AJTA 2AN9A 1WUYA 3G5AA 4DRYA 1T2AA 1RHRA 3UJ8A 5L4LA 3K2BA 1SQSA 5BSRA 4B48A 1SVUA 3UICA 5JI2E 2G1PA 1QHXA 4V39A 5LQAA 4EG1A 3BXZA 4KCGA 4QPPA 2FWAA 5GTDA 1DXYA 5LB2A 5FOUA 1KTIA 5ESRA 3VGJA 1JQDA 2HT6A 1NLUA 3OWXA 5DLDA 1H42A 1XK7A 2VAXA 4M7PA 4RK7A 5G0VA 2I6GA 2VR1A 3NUZA 3B36A 5EA2A 3HM2A 4P8RA 1ECLA 2FN7A 1TD1A 5DNYB 3CEMA 1HYBA 2CKMA 1GIAA 3ILSA 3ZV6A 3DZGA 3I9LA 3C5HA 2FQQA 2BR4A 2XB9A 1DDOA 3F7NA 2BEWB 3K8QA 1KK2A 3OP4A 2MR5A 5E4YA 3RVPA 4O4JF 2BGUA 3ZWCA 3KHUA 4COOA 1RU3A 1FXSA 4PXAA 4ZOEA 2Y71A 4V0OA 2X1LA 2JGMA 1CTQA 1WUIS 3I6MA 1LW7A 2FN4A 4OFXA 4XR9A 4DDMA 4DLLA 2VEDA 3W5VA 3D6JA 5JZ9A 2V0GA 3NYQA 3MUNA 4U2BA 4DXHA 3SSMA 2O52A 1FS6A 3LK6A 5EXSA 3ECAA 2YZNA 1B93A 1J24A 1T10A 5G4KA 10MHA 4XM1A 5JATA 3ZJVA 4O1MA 1JWBB 2Q6OA 5GIOE 1EGHA 2WG1A 2WU1A 1C3EA 2NSJA 4UREA 4QDXA 1JECA 1QGDA 4R2MA 1AK1A 1GUFA 4Y6LA 1LUAA 2WJIA 2G6BA 4KN8A 4P0PB 3AHFA 1OBCA 3U7RA 2UZIR 3NX4A 4AS2A 2OQVA 4ITRC 4RTRA 2WWYA 2Y0DA 4CIDA 5B4UA 4XEHA 1BH6A 4M3NA 4C2UA 4JL8A 2Y67A 5HF9A 2A84A 4GU5A 3VX3A 5GVSA 1YOVA 4L95C 1GGFA 2DTEA 2IIBA 1M8GA 3IJ5A 3KKEA 4UPVA 1DWUA 1GG9A 4V3BA 3WRXC 1IONA 5E4TA 4EAAA 1ULSA 5BNTA 2H5EA 1S2OA 4LXIA 1C30B 5AH0A 4GBJA 3TB4A 3BIFA 3PRKE 1ENZA 2QN6A 1WCIA 2WSSA 1ONNA 2E55A 3FOFC 3DPIA 3DVRX 2RFLA 3FMOB 4Z3KA 5EESA 1J9GA 2PVPA 1MVNA 3ZIDA 2OKCA 2OQRA 2C2ZA 4CT0A 3ND6A 4OLAA 4FQ8A 2N42A 2QTLA 3V4OA 4EJ0A 1PHRA 5K8VA 4UD6A 3W2GA 3BL8A 2C2WA 2BJHA 5DV9A 4CMAA 1E6MA 2HDHA 1I7QB 1UMBA 4BXOA 2I62A 1T5BA 2B5OA 3GQVA 3MWYW 5HGJA 5FDFA 1VMEA 1E2GA 4L15A 4LMAA 4ZANA 1N5MA 4I4CA 5I8WA 2QJFA 1V8FA 1PD1A 1HUQA 3U5ZB 1CUAA 1QE0A 2HMTA 4Q3NA 3WLKX 1FA9A 1T25A 1LSSA 2EERA 3K0AB 5IT0A 2C5AA 4IS3A 1ONBA 2DFNA 4B2LA 3CB4A 4ZGBA 2ZIXB 2YV4A 3FOCA 5FR1A 2IODA 1LSOA 3OVMA 3TE7A 2HDNB 1WHSA 3K7EA 2V3CC 3AVXA 5BR4A 5TT1A 5D1NA 4I0WB 4FFVA 4RPCA 2Q6LA 2O8BA 1QP7A 5G0SA 3UG6A 2JLXA 4KXUA 2GAAA 1GPUA 2HX1A 1W44A 3LF1A 1M3SA 2PMBA 2R751 5AW6A 4YLGA 1J6UA 1WG8A 2VNKA 4JCOA 2WP0A 3PR1A 2V7PA 1CHNA 1S01A 2JCYA 2QX8A 2Z2JA 3TBKA 4K6FA 1FU7A 5EY5B 4ZQBA 3HHEA 1X7HA 4CU5A 1EB8A 4HR7A 1UBTS 1FVFA 3WGZA 1UFKA 2AG8A 2ODNA 3PFKA 4UTRA 4XSGA 2IVZA 1Z6XA 4G65A 2ROQA 1XHEA 3H2GA 1QTIA 3I9V1 4Q9LA 3ZBPA 2QORA 4DVJA 3TBFA 3OMLA 3GUZA 1I3CA 4MJXA 4I50B 4NV0A 5LBTA 3D7LA 2W00A 3FUTA 3OHSX 1P3Y1 4GP7A 2WE8A 4Z86A 4NDAA 5AI5A 4A0QA 2AHRA 1W34A 4L3WA 4YAJA 1WXWA 2IQ5A 4GXNA 5EE3A 1PT7A 3M4NA 5AVJA 4YI3A 3GEBA 3LLVA 1U2ZA 2P5SA 3O31A 3E6AA 1O1YA 4K88A 4II2A 5GJCA 4YRJA 4YUVA 1JKMA 3ST7A 4C4XA 4C43A 5J4VA 4DV0B 3E1SA 4Q4CA 4ZMBA 2C2KA 3CVVA 2HMWA 4HDRB 3OPVA 1LSJA 3LT4A 2G6TA 3RRMA 3SXUA 4MIEA 4ZA2A 1ZCJA 3CPHA 3EXG1 1VRVA 2CXUA 3J80A 1GHTA 4J03A 3F3YA 2O8EB 4CCYB 3QPCA 2Y0BA 3LHDA 5KNBH 2H2IA 1QDLB 1CSEE 2MSWA 2J5BA 2JFPA 2SNIE 2ORIA 2I29A 4P2BA 4A92A 3W0LB 5AM3A 1FBNA 5IXYA 2XBMA 5H70A 5BR8B 1GPBA 1PJBA 1TO2E 4AKHA 4ITVA 1JIUA 4Z0HO 2VATA 4QBKA 2Y99A 4HNSA 5FPHA 1Q3HA 1GQFA 3GDGA 4YT2A 3RRYA 3C16C 1X86B 1Q7RA 4L7VA 4OFWA 5HK9A 5K45A 4HVAA 3NVAA 3GLIA 1E1CB 1YZKA 2AB0A 2AZDA 1E92A 3FPHA 1E9RA 3PKJA 4U8HA 3T9EA 1TX4B 2I4NA 3WZLA 2DPGA 2P6MA 3AUAA 3FWPA 1GTL1 3MTGA 1TW3A 4DBVO 4HEQA 5C3MA 5AKZA 4G1CA 3NHFA 3JQ7A 1XMSA 4JWKA 3DXYA 1YZVA 1W88A 3ZUGA 2VYND 4DLAA 3GFVA 1XPRA 2WFMA 2JLRA 3JX9A 3LBFA 3PQ3A 4LCBA 2PGXA 4M99A 1Y8ZA 1X7DA 2AR7A 2QIPA 3T54A 1DARA 2BW0A 2ZUSA 3PVSA 1Q44A 2AN4A 2BLNA 4MITA 3ZQ4A 3I1IA 4TVOA 3SYNA 1QHIA 4Z0PA 4KG7A 3ZGZA 4LJ9A 4DXAA 3CX6A 5KQGA 1EVLA 4TL9A 4YYEA 4TN5A 2IF2A 1FTNA 3LY7A 5FWYA 4RNCA 3ZK9A 3CMMA 3BREA 1OYOA 3VTFA 3OE1A 1OWMA 3DTYA 5HIKA 1SRQA 4W82A 1JG6A 1RPNA 4R41A 3NC1C 4DYDA 1UKBA 2B8NA 4I4TF 2QRVB 2VHUA 3FY4A 4V0SA 5IULC 2VO1A 4QX6A 3TRIA 3UW3A 3DFZA 1EINA 3JQFA 1RS0A 3M6AA 2B30A 2YCLA 1NX6A 2QN9A 4OJQA 3UK0A 4BFTA 1J7KA 4ZDWA 1RJDA 4URVR 3AGQA 3R8CA 3LFHA 4GOJA 3R7WB 5SYNA 4M1EA 1JSRA 4RHCA 3RSSA 4AY4A 4EUEA 1KBZA 1QHFA 2O6LA 3PNYA 2ZJ4A 3B53X 1E8DA 4IJKA 4MRMA 4NBNA 5DE3A 3QUTA 3T5TA 4K7JA 4FMCF 4JQZA 2ADFA 5IXJA 4RPIA 4GPIB 1OHHA 2QMOA 4JB3A 2D4HA 4KTTE 1ZICA 1H93A 2X1VA 3CJQA 4BATA 4BL5A 2IH2A 3M6VA 2CLOB 1T1IA 4IXNA 3ER6A 1M0EA 2ID4A 5IDWA 2REBA 1VSQA 4EGJA 2VF5X 1EPUA 1AK2A 4YJ2F 1SG0A 5BP7A 1ZHOA 2AYXA 2W2OA 5IH7A 4NCBA 2QD3A 3PICA 2NYRA 1C41A 2FQXA 4H6PA 4PHHA 4LW8A 1AQUA 1JR3E 2BGNA 3O74A 4UNRA 4C5CA 5AD1A 1F2UA 2OG2A 2VJKA 1GZHB 3BERA 1JHYA 1O6GA 3I6QA 1FYFA 3M5CA 3CNQS 4H1HA 4J0IA 3VC3A 1L5LA 1Q3TA 3ORYA 4JX9A 4G26A 3N9IA 1Z82A 4KO2S 4PAWA 1NMQA 2GS9A 1TK9A 2K7FA 1D09A 3C6QA 4ZJZA 3CVWA 3O2QB 3E61A 3C5WP 4PFQA 3I62A 2GTHA 4ZFNA 3AETA 4EGSA 2EL7A 1NVAA 4ER6A 1M6EX 1KU6A 2B9VA 5BMVF 3QVKA 5ITZA 2VP3A 2X5JO 2HUPA 4RORA 3P4UA 1GNTA 5L8VA 4CYMA 4DG9A 2XTNA 1JEQB 1YZ3A 1QAOA 2AMJA 2CXOA 3R24A 2W2PA 1IPEA 2YDXA 1Q3KA 3F1LA 3GHYA 4QPCA 5DTEA 1J20A 5L7YA 3OA2A 5IC5A 4LYJA 1T2VA 1TA9A 2GGSA 3O9MA 4OQYA 1DP4A 1YVUA 4HGZA 1OMOA 1ZMTA 4IDBA 1XCMA 3ASUA 2ICAA 1T3LA 4X7MA 2YX1A 5JOQA 1S7GA 3V7UA 2ZRNA 2XY4A 4G07A 1W5FA 1L3CA 4LGMA 1CPYA 2EG5A 3TTSA 1VRCA 3MERA 1FUUA 1JHAA 1QHHB 2WT8A 3GRRA 2PUBA 3HJAA 3T7DA 3EG9B 3MM4A 1X14A 4FJ1A 4KFCA 4TMWA 3LQ1A 3EZ2A 3ABRB 5FCDA 2GEBA 2GK7A 1Y6QA 3ELBA 4LYAA 3RM3A 4LWZA 2HAEA 2VH2A 3OHPA 3GFOA 5JLAA 1VLMA 4OKNA 3EH2A 3ICVA 3F9CA 4CJXA 3U31A 1MQ9A 3NRJA 5IKEA 2EWMA 1NVKA 3RT1A 3GFBA 1TPZA 2QZPA 3TOSA 4EZEA 1RLJA 2PJDA 5IG2A 4DV7B 3KV3O 5KU1A 5FORA 4AFNA 3CBGA 3ENVA 4IP0A 4JL5A 3KFLA 3JVDA 4LDQA 3UO8B 4YAUA 3EX7C 4HDKB 1SXPA 5LUAA 5LYJF 1CZHA 2QDKA 2YY5A 2FEKA 1OKKA 2YVAA 4ARZB 3ZZ0A 4BX3A 4OHPA 2ZUWA 4TTVA 4OSEA 4P1ZA 4JT2A 1AZSC 5EIOA 2RGCA 3UTDA 1V9SA 3K16A 4YROA 5K3SA 2IE0A 3PNQA 3EODA 5TARA 3BE6A 4CR8A 4DR1B 3VDMA 4TZTA 2ZRAA 2HEGA 4AURA 4GP6A 4KO1S 2L19A 1JBQA 1KSFX 4I6EA 1KJ8A 1U0SY 3QI2A 4QUKA 3AEXA 1EJ0A 2F4NA 1I80A 2V59A 3NJRA 1DCTA 4TTRA 4UULA 1IMJA 3A6HA 2YVUA 3PL5A 2P75A 3GLIB 2GA9A 2NV2B 1N1GA 1Y1RA 2JFBA 1HTWA 1OBHA 3RAFC 1VE1A 3P97A 4C7OA 2GAOA 2WW8A 1G5TA 5DX8A 4BLQA 5EJFA 1AS2A 1MHTA 2VK8A 2Z83A 3EGCA 5KBYA 4MV8A 4HDSA 5U4XA 4EA6A 3I30X 7REQA 3IGFA 4WAUA 1NPDA 4FFWA 4BQRA 3I4CA 2OR3A 3E9RA 3DZIA 4HLUC 4Q4AA 4MAMA 5C8VA 8LDHA 4MQUA 3NAZA 1L2TA 1DC5A 1DMSA 3FZQA 1ABFA 1M2OB 4Q4LA 2QTRA 1NJ2A 4P98A 5I47A 1KJZA 3BE5A 1M2KA 1VKOA 3ROFA 2JG3A 2GEKA 2H7XA 3C7AA 4LISA 3R2JA 1N6OA 5EQTA 2MSKA 1Y4ZA 1JFFA 3LQ2A 4MI1A 3EIFA 4PPQA 1U5BB 2L17A 4ECAA 1XLWA 2DU8A 2RKWA 3PIDA 4U7GA 1IXRC 3CF0A 5C34B 4R1QA 1OLSA 4CUZA 1SMKA 4YMHA 1JG4A 1KPHA 3W06A 1U3DA 2APJA 2OD9A 3ET4A 3I5YA 4EATA 4Z1MA 1J1UA 2Z8XA 3H5LA 1U3GA 1YDGA 3I76A 3ILVA 1L5HB 4TRMA 4EJFA 1R8XA 5ELLA 5HMLA 1JEEA 1OIVA 3E27A 2HPAA 4E94A 1BDMA 1YUMA 2IYTA 3ZU6A 1DC3A 4FZRA 4H1UA 1M7HA 4M9CA 3NM4A 1K97A 2X0DA 1H6CA 3T0FA 1J0EA 5AMXA 1VTKA 2WTEA 2CY0A 2ZIEA 4A2QA 1UPCA 3PJGA 4IDHA 5AM1A 4EFMA 2I87A 3HR4A 3G2MA 5A3JA 1ECJA 1U02A 2O1XA 2DQZA 3VPCA 1XE3A 2MT9A 2IYRA 3UG7A 4BP3A 4P82A 4IJ5A 2YDYA 5F9FA 1CP3A 2XOXA 5DRTA 2UDPA 2B1RA 3AR9A 4H7JA 4NI5A 1HRDA 3VTAA 5LLSA 3R1IA 1U1CA 5TGZA 1Q1GA 1SOVA 1QAMA 4JNKA 2VT6A 2YXLA 1P2UA 4PCAA 3LBIA 2IZ0A 1NN5A 1A27A 4IINA 1RCUA 4OIFA 4PZDA 5K3FA 3RIMA 3VR5A 2FWIA 4ZQGA 2WWWA 1EVYA 4B4KA 3FX2A 3GZ4A 3DDZX 2Q8QA 1WBJB 2FY8A 1UZAA 4RTNA 3RSQA 1VYVA 3EZNA 1X70A 2PGJA 1GTG1 3NH6A 3WGTA 3PIRA 5ED0A 2JIRA 2YXEA 5E9AA 3TZEA 2EX1A 2XYVA 2MHCA 4PLHA 1J49A 2P30A 1UFRA 1HOXA 1LNQA 1VSVA 2X8LA 2XWJI 3FFTA 1R8YA 3TLBA 4TM7A 5JYCA 1DO0A 5J5CA 3MRSA 1BYIA 2QZZA 2NU7A 1P2FA 5C7OO 3NFYA 3L7LA 3JQRA 4RD1A 3A4TA 2PL3A 2LV8A 4JUFA 4WZAE 5T4HA 1DG3A 4KR7A 4N3NA 3DP9A 2J7PD 3ZG6A 4DYVA 4GPAA 3LQRA 2M6RA 2EGGA 2YW9A 3CEJA 2C82A 2YIDA 3BMNA 5TQ0B 4HFMA 1QDUA 5DGDA 4DM4A 2HCBA 1NQWA 4MYSA 3D4OA 4P93A 4YH1A 3VR3D 4YV1A 1T1RA 4MDEA 2E4VA 2O59A 1KF0A 1YBFA 3EJ6A 2ZYAA 3QOWA 1FLAA 1SM4A 4S35A 3ZW9A 1GUAA 5BQFA 3NONA 4BO1A 3SHFA 4KE6A 3LXMA 4ZRNA 3RBVA 4IV0A 1C3LA 4UXHA 2HMUA 4GMFA 1FFGA 4PYIA 2Q1SA 2QA5A 1WEKA 3DCYA 5ALRA 1PGNA 1B6RA 5JQGB 3O8OB 3VZQA 3R5XA 4H7IA 3V2IA 2G82A 3H1EA 4GW3A 3ZOKA 3T9DA 3UOAB 1J99A 4H6VA 4QBFA 5BUSA 4NMHA 2ODEA 1KEUA 5MHTA 1XVTA 4UXJA 1IM8A 1MQAA 2XGOA 3A28A 3O9VA 4QUEA 5C1OA 2JNWA 3ZHVA 1HTBA 4C4PA 1Q0HA 1X13A 1P75A 2XMCA 3I37X 5DT9A 1OI2A 5J1SB 1JFTA 2BV3A 1NJ5A 2CVPA 4GS5A 1L4UA 1LLQA 5JQWA 4AF8A 4MZDA 4O25A 2C3MA 7GPBA 2OBYA 4RWEA 1N8TA 4XUEA 5SZIA 5BW4A 1JFRA 1XA0A 2C97A 2MR6A 3F6SA 4QARA 5E95A 4B3JA 3EY4A 1IBKB 1JAIA 1DC8A 3OTHA 4RA9B 1CP2A 1UC5B 4QO7A 4KQXA 4IO0A 2GKSA 4HQNA 2R8RA 4E46A 4W63A 1GT6A 5LWHA 4B43A 4N8EA 2X2FA 3RSOA 4YRAA 1YUNA 1L1RA 2IUEA 4ZODA 3JASA 4OMFG 1EFPA 4PCVA 2JH8A 4HZGA 3NCTA 4MWDA 4ZRMA 3GRCA 4EGCB 1JLRA 2FG5A 3AEZA 4JN6B 1XDZA 3IQHX 3UEOA 1FYWA 3E35A 2BL4A 3GBVA 2AQ8A 2I54A 3LA6A 3OTQA 3G6KA 4N65A 4ND2A 1N9ZA 6AT1A 3RYTC 2D7DA 3HEAA 1O8BA 1DRJA 2HF2A 3ANSA 1RCFA 4DDHA 3LCUA 2O07A 3E9ZA 4TLCA 3C41J 1DHRA 1OSNA 4O4HF 3IOYA 1RXEA 3SZLA 2IP2A 4M54A 4D2IA 3C0KA 4OMUA 1ZUHA 2IU4A 1KMCA 2IU3A 4UBMA 4DR6B 5CB8A 3ZWXA 1Q92A 3NTOA 3IEMA 3OZGA 4ZPJA 5JJBA 1QVVA 2ZFUA 3TTXA 4IV8A 5HYVA 1Z8DA 1FBTA 2DP4E 3VHXA 4F4IA 5JSUA 4KQGA 3ZWKA 2UYGA 4CMHA 5GJVC 2IPLA 4G85A 1KZGB 4Q9IA 1FZQA 2PXXA 4IWXA 5HMMA 1AQIA 4BC0A 1Y8RA 1Y4AE 3FNFA 1YR3A 2I8CA 1T9DA 5IP5A 2R5WA 4LZOA 1E5QA 1LTQA 2PGNA 2UVPA 3BH6A 3DJFA 3UMYA 2GPYA 1D7OA 1EX1A 3PHJA 3L6UA 4EHLA 1YBAA 1Y3FE 4FP9A 2PANA 4JSYA 2GHTA 2GZMA 4OVKA 3K0BA 4N82A 3B78A 2J41A 1R0ZA 1A1VA 4MTLA 1UC9A 4B31A 4AT1A 1SBYA 2BMAA 2QE6A 2FUKA 1FUIA 1CY2A 2GM3A 1K5PA 5KU7A 4A1FA 2P3SA 2Y1FA 2PX8A 4JIMA 1XVAA 3W04A 4I1YA 1N4AA 2YASA 2RGDA 2XQKA 3GEEA 4DCPA 4XW2A 2EWWA 2V6IA 3E7XA 2P77A 3HDJA 4YUYA 1H1DA 1L5MA 4QA9A 1OREA 1PJZA 2C5BA 4UTVA 3RBZA 2I2FA 3EUAA 3RG8A 2GCEA 5FTNA 4LSZA 1G3IA 3KWMA 4MW7A 3KBBA 5DCWA 4UCXA 4CEHA 5IJWA 1GCOA 2NP6A 4Z3DA 3UMJA 4EA7A 5IAOA 3EVBA 2D7JA 5G0TA 4CE6A 1RZRA 5EKXA 3WLSA 1VCOA 3B9PA 3H5VA 4O6VA 4WUTA 3R9XA 4QFBA 4JZYA 5EXXA 2HF7A 4B2YA 1COWA 3FH0A 3HSSA 4YXWA 2FZGA 2JLAA 4RQUA 5F35A 2YL2A 3IAS1 1SGWA 1AQNA 1JWLA 4JA2A 2PRSA 4CMIA 3SBEA 1WBBA 5DX1A 4MA4A 3GJTA 2XAUA 3IUBA 4A6EA 1O9HA 3OTIA 2XVAA 1KJYA 3ECCA 4ZYTA 2Z8YM 4F56A 5JLJA 2CUTA 5T5QA 4N5MA 4HEA1 4BRZA 3HCEA 4CLXA 2P6UA 3E9DA 4DCOA 5TS3A 4L8LA 4KXMA 5ICSA 4GKJB 4FYYA 1GDHA 1XZEA 1N25A 1E9VA 2CDRA 2H0AA 4F84A 2FSHA 2OBMA 4I2NA 4KE9A 5G41A 3DEKA 4GE3A 1LC0A 2G0NA 2EF1A 3SX2A 2POQX 3N2KB 2PKYX 3OIYA 2OO5C 4G0ZA 1EVJA 3GU3A 3JZDA 4EUFA 2VFAA 3C3BA 1C0EA 5G1OA 3TIIA 3H2YA 4TSRA 1ZM7A 2WIDA 3CEPB 5KSWB 2JBAB 1ZRMA 1WMAA 4FGUA 4HXGA 1HBJA 2E85A 2GUWA 4KXVA 4QYWA 4CMKA 4ARCA 1ZN7A 2VUSA 4LJ4A 3AONB 1YJ5A 1GGVA 4L9WA 3WRXA 4A2WA 3K2QA 4EF5A 4FBLA 4I50A 1KYQA 5CDGA 2VTDA 2CDCA 1MH1A 1TB4A 2BFNA 4NWIA 5A03A 3EFOA 3NBMA 2XDQB 3UBMA 4BWVA 4N5HX 1GXSB 1GLVA 4QUDA 4ZDJA 4X90A 3CG4A 4WHMA 4EMSA 5A5DA 5ALLA 1WB9A 3TZLA 1J23A 1FVHA 3L04A 1P6UA 1EFKA 2DKNA 4KGZA 1VL5A 2FMKA 2NU9B 1P4AA 2JVJA 5LSAA 2L42A 4M8SA 1RYEA 1FP4B 2Q41A 4OHMA 2A4KA 3UCXA 1EE1A 3FKQA 4LF7B 1U0FA 1UMDA 2BKAA 4KWIA 1FZTA 1TZMA 5C8YA 2W93A 5C5EA 1DFHA 5T57A 3SXPA 1T9BA 3DKPA 5ICGA 1C8BA 3T3NA 4L9RA 3AI7A 3UPUA 1UAGA 2YWFA 5JW6A 5KTKA 3NUQA 5K4HA 1MW9X 3PR3A 3H42B 4NAVA 5LBUA 5JY1A 3ADCA 3R5JA 2R8OA 3JQ6A 1V41E 2RC6A 4LYEA 5J40A 1U0BB 521PA 2BI4A 5JXHA 1VMDA 2GYWA 2QL7A 2Y3IA 3ZCVA 1MA0A 5DMHA 4YRFA 2SHKA 3GCXA 5FYQA 1U2TA 1AKMA 3FCOA 3ZW7A 2FPGB 4MVJM 5K4AA 1QNLA 4JHLA 5P8WA 3DEIA 2XOEA 4AIRA 3TL3A 1S8AA 2GF9A 5AM4A 1V1MA 4ND4A 4UPDA 3SZMA 2X8JA 3E3OA 1CJMA 1DQPA 1EQ2A 1SQGA 2J9ZB 1ISFA 4GWLA 4DYHA 1JP7A 2ZRPA 3SK0A 3Q7PA 1H2HA 1T5OA 1JLSA 4OI4A 3OCJA 4YO8A 1NQ5A 1HV8A 4FFSA 3LT5A 1XLTA 4YMUA 1Q1BA 3C3MA 1KP2A 1BC5A 3CUUA 5AM2A 5TPWB 721PA 4U3JA 4NJMB 1J90A 1NPYA 2R5NA 1C81A 3NHSA 4FWBA 4P4GA 5EPOA 3HKEA 4DNFA 4CXMA 4YCNA 4DC1A 4J3FA 2V6FA 5LOVB 4V0RA 1V11B 2ATEA 3T5BA 2FPRA 1P2DA 1XV5A 1ZW1A 2O5VA 3TXYA 2BT4A 4EBBA 3QMMA 5AQ1A 2P2ZA 1QFZA 4EW1A 2VK4A 1TAQA 4WZBE 2Y9MB 2XTMA 1WMSA 4XQGA 4RIEA 4YCSA 2DG2A 4L4SA 1DT3A 1WXEA 1SPXA 4MLZA 1WABA 3KOXA 5LYJB 4OSPA 3D7RA 4YN3A 5AKXA 2GCNA 4K0KB 3EOAI 3K9GA 3OKFA 5CW2A 2FH5B 3FOAA 1JKXA 4JZKA 1TAHA 4V03A 1FYXA 3ZZMA 4A2PA 4F4HA 2C61A 4YUXA 5LD2B 4ND3A 3AXTA 3GAMA 4PC1A 5CM9C 3QFHA 5HQJA 1P81A 3F8WA 1K06A 4B32A 3P9PA 2R47A 3D5QA 1GGMA 1N9KA 3U4IA 3NNSA 5ALNA 5F7ZA 1VBKA 3RYIA 4AY5A 4O4LB 2NVOA 4YUWA 3Q7SA 5E2IA 1M7BA 3NTRA 5FB3A 4F45A 4UASA 3KNZA 3KSRA 2GI4A 3LU1A 1Y3BE 3I73A 5CLHA 4BMSA 5AJYA 3PUXA 4EBFA 1AU9A 4CQLA 4A6PA 2FUG1 1KGDA 4LWQA 1E2NA 5AXDA 4B3CA 3P9IA 5LU9A 2CNKA 5IK2A 1CD5A 2QJRA 5F76A 4KR9A 1Q1EA 3GJ8A 1ULAA 4J3NA 2CSUA 5IHXA 4MRAA 1VCNA 5C46F 5SICE 3HVUA 1IBCA 1AZLA 3AI3A 3K1JA 2QPOA 2OG1A 4TLEA 4QUJA 1UBNA 4YLEA 2VP2A 4U7FA 2HK7A 3K0CA 1QQAA 5AW1A 1RRKA 1WNTA 3WGHA 3V55A 3N74A 1DIRA 3PJEA 3DFKA 3V97A 1LBHA 1VCIA 3FDIA 5AVWA 1DSSG 4MWGA 1HMPA 1G5IA 4JGBA 5ALHA 4R7GA 1XQYA 5EEHA 3SY8A 4Z9AA 1YE5A 2A78A 2ZRFA 4BNIA 1ECFA 1ZVVA 4WKCA 4LI0A 4YXFA 2VDQB 3O0TA 1T5TA 3A58B 3B1ZA 4NBVA 3OC0A 2JLSA 1D4AA 1QP8A 2XGGA 1QIHA 1PJTA 1XZMA 1JAZA 3DMFA 3AVQA 3GQBB 2HJSA 4EYGA 4X66B 1N57A 1VGRA 1WW3A 4PGHA 4HFNA 3LTNC 4FSHA 1J2YA 4R0MA 3WGVA 1QLJA 1BROA 3SHVA 1XQ1A 3T9BA 3IEIA 1XYGA 3NJ8A 4K9OA 4BDSA 1VBFA 2EZUA 3MIIA 2CV2A 3C5CA 4MB6A 5HJ7A 4DL9A 3GMDA 5EL0A 1PVDA 2C3OA 3KC2A 4WOKA 2IE8A 2QUIA 2W43A 1M8PA 1WA5A 4A0FA 1N5JA 1X74A 3RV4A 3WO1A 4ES6A 1IU9A 4YCAA 4ZOAA 3DBHA 4LF9B 4LZZA 3O3NB 2JBWA 3Q3IA 4G5QA 5THQA 1EFPB 2WT4A 3T3GA 1PSZA 2GRAA 2H9IA 1KAHA 1LTKA 3TTTA 3HCOA 4RK6A 1V6AA 1YU6A 4AD8A 3U7HB 2MINA 1CB0A 1DMRA 2IOFA 4JMPA 2J87A 4Q9AA 2Z30A 3H19A 3WYFA 3K96A 4JOBA 1WKBA 4NJOA 1I8TA 1H69A 2FW9A 4MR8B 1IHXA 4NQRA 3VMMA 1YA8A 1I7LA 2QZ9A 1E96A 4H7FA 1V8PA 1AKWA 4EGAA 5ALWA 1ISPA 5KJEA 1DS6A 1XD8A 4GXTA 1AIPA 1OA1A 1DB3A 4L4RA 2Q0HA 1NW8A 2RGWA 4D9NA 4EJSC 4H7HA 2QRKA 4EZIA 1Z2CA 5HFAA 2FEAA 5HFNA 1EXWA 2X0EA 4RHTA 2O2YA 2XQVA 4S04A 3THYA 2AWOA 2PKEA 5JPCA 4RKEA 4Z8XA 2J3DA 4CLHA 1QFJA 4G25A 4NBLA 2B20A 3SYTA 1ARZA 3C6ZA 2P6RA 1TPYA 2A9OA 4IUCS 4EG4A 1G66A 1IHDA 1YVRA 2XI4A 4NV1A 2XNJA 5I9IA 2D7CA 1KRHA 4CTKA 5LFAA 1W36C 5LP6B 4EKEA 5HEKA 1J2JA 1G7TA 5FNZA 3F6YA 1D3AA 4JKYA 3F2VA 4E5KA 4GPEA 5GZ3A 4ABTA 2BTEA 4B2IA 1OUMA 4GP9A 2B1GA 5LKAA 4QEKA 3JAKA 1HFEL 2LDXA 1GU7A 4ZCLA 1KJNA 3QITA 5CA0B 1JG1A 3FIJA 5FQNA 3ODPA 1SH7A 2ZVDA 4UW9A 4DILA 1OXMA 3A3PA 3LTEA 3ERCA 3U39A 5BORA 3TQTA 3C87A 1E1RA 3ZD6A 3VKUA 1P91A 1OQAA 4HDOB 4S24A 1H3FA 5COAA 4DNPA 1G20A 3RJ9A 1IQUA 3EBLA 4X92A 3ZYCA 4AYWA 4PC6A 4P83A 2WBLC 3TZKA 4BX8A 2JGRA 2REXB 2BFFA 3PTAA 4TYQA 4J0FA 4Y6QA 3R41A 3ETHA 4KAAA 3U40A 1O89A 1W36B 2A7QA 3ZIUA 4PVCA 2XVYA 4R8LA 1UWVA 1YJQA 3O1IC 2UVQA 3NEPX 1YIOA 1XSEA 4QUIA 4A03A 2CGEA 1N2BA 4NZPA 4DREA 1ADBA 1K6JA 2RB5A 4FDVA 4R2XA 1U7OA 1SWVA 3CY6A 3PCTA 3PNPA 4G1BA 2RCNA 3OIFA 2DUWA 3FI9A 4I50F 5KC9A 4OJTA 4BECA 1I4TD 1W581 4YRBA 1KK1A 4Q1FA 5ESXA 2EKQA 4MUIA 3RVSA 4S05A 2UXDB 1CEQA 3K1YA 1ADYA 1CJTC 1E7SA 1XEXB 2BGKA 2AI1A 3GNLA 1DBVO 1WDMA 3MTAA 3QOYA 4AZVA 2IXDA 5JE8A 4POAA 1XN1A 3PLNA 3TPFA 1F0YA 4EPVA 1JQ3A 1QHGA 2GBCA 1UPTA 2HLHA 1M2GA 1L0BA 2JFNA 3LX8A 3O4GA 3QE4A 4JB0A 1UOOA 4ND1A 2AR9A 5CVCA 3ZI7A 4JI7B 4Q4JA 4QU9A 3KPYA 1NHGA 3DO6A 3NASA 1U8CB 3ENZA 4G63A 4XJSA 1X80A 5T64A 1ZLXA 2GETA 3GLTA 3I6IA 1XJ0A 3QKRB 4YO7A 2ALJA 2WAAA 2P9JA 3KLBA 4KMOA 5GOTA 1JTFA 3UXEA 2GEDA 5K6RA 1F4LA 4NOKA 3PVCA 4EARA 2XB6A 4P0TA 2OY0A 2COUA 1FNDA 2BFWA 1IAVA 4H4DA 4BFSA 3MPOA 4ZGWA 4XTCS 2BKVA 2CFTA 3BVPA 2W6MA 3OP1A 1O8CA 5B2FA 1Y80A 1J0XO 4QU8A 2V7QA 3H7IA 2OUKA 3FVRA 2V7WA 3DFFA 3PHBE 4FOPA 4IO1A 1OIXA 1L5HA 3RIHA 4L16A 2J4CA 3WKDA 1E2HA 4E21A 3UK7A 1US8A 4HQOA 4B6SA 1W47A 4WECA 4KWCA 5IYZF 4ER7A 1SQ6A 3MXTA 4BQOA 1XHFA 4IIJB 5EZ5A 1V8ZA 3STXA 3HKCB 3I32A 1M6NA 4ZVTA 3IOMA 2VZ8A 3UJ3X 5C32A 1ETHA 1BWRA 2F9FA 3N8DA 5EQFA 5JRJA 1Q7TA 4FLFA 1WD7A 1H22A 1JB1A 2AFIB 1D4ZA 4R2KA 5E4JA 4U2EA 3EIXA 3UAYA 2E87A 1JVBA 1JDPA 1L4GA 3JAWB 3QKIA 2DHQA 4OJNA 4ASUD 1EXDA 2GBLA 4DPKA 2VQDA 3LVBA 1RRCA 3PFHA 2YOHA 5CFLA 3QPBA 1KQFA 3R7NA 1E1RD 1W5AA 3N58A 1VL6A 3GELA 4XFJA 3CUWA 1L3BA 3MGGA 2C00A 4YAIA 1T24A 1OX5A 2X4GA 1FFBA 4PFKA 1PQUA 3CLRD 4QDTA 3DOIA 2CWWA 3HNRA 4X24A 1OWLA 1SHUX 4MQEA 3NGXA 5AVVA 4NJEA 2J7KA 2VYVD 1J8FA 1X7WA 4WZBA 3OUUA 2VAVA 2V0CA 2VUTA 3L7JA 3W5CA 1O03A 4N6GA 4AKTA 1U6KA 1T2EA 2A0UA 3AF2A 2PKCA 4B8YA 3WDLA 4MWOA 3FNGA 2KX7A 4B5LA 1C4KA 4M98A 3NBYC 2OCGA 4I1RA 2GYVA 5A7FA 1FJHA 1UL1X 2CCKA 2TMKA 2XA1A 4MI6A 4JYCA 4E4YA 5JR3A 1RAIA 3PXGA 5EJ8A 1X7ZB 1FFHA 1W5TA 2HHJA 3U16A 4LNAA 2A14A 2W6ZA 4KO8A 2ISSD 1QGED 4RV5A 4JKIA 3OLCX 1ZIXA 3IP5A 4FT4A 1FE8A 4GX0A 4ARSA 4URWR 4AJIA 2PAFA 2JIQA 3AJRA 2ZT5A 4MI3A 1A95A 1R8JA 1EHYA 3DEZA 3I3OA 4LC0A 2VXCA 1EK2A 5FF9A 3S27A 4DBLC 3PC8A 5CFQA 3I0ZA 3QMVA 3NHYA 2H6EA 1FS4A 1FMCA 2V3WA 1U90A 1XBTA 1UXHA 2I3AA 2BHNA 5AW5A 2HU7A 2ECQA 4L3VA 4EB0A 4R8RA 1UWCA 3FVWA 1V9CA 1WRBA 2JDID 2O2CA 2CN1A 2O8VA 4LYFA 2WYHA 3AUSA 3KQYA 3TNFA 1CR6A 3QTLA 3CLUC 1R0SA 2Q6TA 2ZJ8A 1HQYE 1KDPA 1NRJB 3FHCB 4LRSB 2ONZA 2IV7A 1X94A 5JDCC 3AB7A 5I3ZA 1A50B 4X63A 3B3FA 1WSAA 2HA4A 2VJOA 4ZD6A 4B3SB 1RZVA 1PSWA 4PHTA 1MC5A 4NG5A 1NMSA 4ZO6A 5DNWA 3G8AA 1XMOB 1TF2A 5EWMA 1NP6A 1R9MA 1VMIA 2PR2A 4RHXA 3HTXA 1YFKA 3QBTA 3V4LA 1YD7A 2VZLA 3IP8A 1EWQA 1FMTA 3G79A 4HBGA 3W8FA 4YALA 2JBAA 2XTAA 3ZWNA 4F1KA 1PG2A 5ALOA 3LYUA 5HW0A 2J85A 3W05A 2H31A 2QTTA 1GG2A 5EE5B 4F91B 4B6RA 1XZIA 4BAZA 3HR7A 1QGAA 5TPZD 4JHXA 2PBLA 3G0OA 2IKSA 1N77A 3GLFB 3EVGA 3YASA 3E5MA 1U99A 4D25A 5INTA 2OD2A 2QLTA 4UNSA 1W2HA 3KJHA 3TX2A 2CZGA 5L6LB 1YBHA 2JHAA 4NDZA 4TTQA 2P35A 3KU1A 3KDPA 4RL6A 4ZK6A 3PHLA 3NMUF 1IHPA 3IT3A 4M8KA 2AEMA 1E4VA 1JNYA 4G5RA 4HFJA 4QTXA 5DHQA 5ARDA 1YTUA 5LIPA 1AVTA 4X91A 5A1JA 4IX9A 2WDPA 1NL3A 1FP2A 2WK1A 4WMLA 1CJSA 1X8XA 5GADl 2CMFA 2XYGA 4PE5B 4YS6A 5JNRA 2IXBA 3BRWD 3NIWA 4IOKA 2AEJA 5IEBA 4R8VA 2GCPA 1X8LA 3O8BA 4OA8A 2ZANA 5HP4A 3HS3A 3NHPA 1SXJC 1VQ1A 1R8QA 1R10A 2IY9A 3QKWA 4OP1A 5H02A 4YAKA 3KPUA 2A5LA 3LOPA 2GPTA 2WY2D 3OA0A 3OH8A 2ZR0A 2JFUA 1FQWA 2VPZA 3M6MD 4IVNA 4NX2A 2VHZA 1AGRA 2IRWA 2NO1A 2AZXA 2EBUA 2PRYA 4Y6PA 2F8MA 2VP4A 1D5WA 2A8YA 3EXIB 1OXTA 2JZNA 4B75A 1WQ4A 4Y6GB