4BRWA

Crystal structure of the yeast dhh1-pat1 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
b'NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVDEFMDKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE DHH1
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title Structural Analysis of the Yeast Dhh1-Pat1 Complex Reveals How Dhh1 Engages Pat1, Edc3 and RNA in Mutually Exclusive Interactions
pubmed doi rcsb
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA02
1G41A 3MWYW 3OZXA 2VP2A 1JEEA 2A30A 3IBGA 4B34A 3EIEA 3U3RA 1RFLA 4W5HA 2DCUA 3P20A 2W6JD 1WBBA 2R9VA 4D0LB 4YLGA 4DSNA 3RRMA 2REOA 3A36A 2VH5R 5DNYB 2N1BA 2IYXA 2IEZA 4DUGD 3LO5A 1J8MF 4P31A 1KI7A 1XJCA 3AVPA 3L0PA 4QJ5A 3Q9LA 3KB1A 4PZYA 3S1AB 1PUJA 1E9RA 1Q44A 4TYQA 3UMSA 2GKSA 3SYKA 5BN5A 3RVBA 1DE0A 1Z22A 3CR8A 5FTNA 1R0ZA 4OHXA 2WOJA 3MJHA 2JJ8A 5CYPA 3TR5A 2ZRKA 1T5IA 2YZ2A 3TE6A 4EPYA 4QM7A 3EPJA 1CTQA 1SVIA 2QQEA 3CRW1 3NG1A 1MT0A 2ORIA 1TUIA 2ZM5A 2LWIA 1Z2AA 4OHWA 2WBLC 3OAAD 4IJMA 2GJKA 3GJ6A 4WZ6A 4N0EA 4YMSA 4YXWA 3GJ0A 5EUMA 3UIEA 5EZ5A 4IDNA 1U0LA 2CCGA 4RD3A 3RRYA 4BQSA 1E9FA 4BFVA 4BWYA 2OCBA 5JRZA 1NVXQ 5SZKB 5EXXA 1W4RA 2G88A 2G0TA 4NYMR 1G8GA 1YJ5A 5FOXA 1FUKA 3AKDA 5E7JA 1BO6A 2BHRA 3JVVA 1HV8A 1AJEA 3RABA 2ZRNA 1YR7A 4KBGA 4W9MC 2H92A 4DCTA 1COWA 1D2NA 4TLEA 1AS3A 2F55A 1G16A 1H8HD 4PQRA 4G5OA 4MITA 2JDID 3VR5A 1T3SA 2H18A 5DSZA 5FR1A 4B43A 4CYMA 1P61B 1E2HA 2ZI4A 1JEDA 2CLSA 3MFYA 4MUAA 4DB4A 1LNZA 1WQ1R 2GTPA 1R8SA 2OCYC 2AWOA 4OQNA 1UBGA 3TMKA 3DM9B 5KO2A 121PA 4P4TA 5CLQA 3KQLA 2QP3A 2QAJA 1IN7A 5L8VA 2ZR7A 3ZVNA 4Q1CA 1KOFA 2QM8A 3MRSA 2F1RA 3EC1A 3FE2A 3IDQA 1UKYA 1XCMA 1UDWA 2CK3D 3HU2A 3AVOA 5HTKA 3W8RA 3LX8A 1P6XA 1DG1G 4CDGA 1NJGA 1ELOA 1FOEB 1NN3A 1XU4A 4FINA 1HH4A 3ZZUA 3EIQA 1SGWA 4A2WA 1VCMA 1ESNA 3EA0A 2PZGA 4JVSB 1D6JA 3A1TA 4CIDA 3LFUA 1E98A 4BFSA 4A0RA 2F3RA 3HYTA 1JPJA 2JATA 1DARA 4BFTA 2YINC 5KPDA 1AS0A 3GLIB 1G291 1Y3AA 4KODA 4C7OA 3SQWA 1Q57A 2NO0A 3TQCA 4A0FA 1WA5A 2WAXA 1NF3A 1UBEA 2AFIE 1M1YE 3KL4A 4KV9A 4D4JA 5EE9A 3ZS8A 1A1VA 3CBQA 1XEWX 3K0FA 1S1CA 5KU1A 3CLVA 1A4RA 4AD8A 1JR3A 2OLKA 2WJGA 3EXAA 4EUNA 2IWHA 2VYFA 4PHHA 3U7HB 1XTSA 1P2VA 1ZM2A 3CR7A 4FMBB 3FB4A 1KI1A 2DB3A 4C9BA 4E22A 3RSLA 3B1YA 4Q66C 4RJLA 2PX0A 1ZU5A 1S3GA 4O2LA 4MDEA 1M6NA 2D7CA 3FFAA 5EXTA 3W5JA 4F4CA 4ASUA 2R6GA 1Z2CA 3KFVA 4M4SA 1IHUA 3K9GA 4M0LA 3QVVA 2OBLA 3I8XA 4C0BA 3BH7A 5G53C 5AJXA 3L0OA 4NCHA 5JFGA 3TVDA 2B21A 3FHOA 4X8HA 2WVJA 3G5UA 1E6CA 4Z8YA 2ZU0C 4IKEA 4EFLA 4AC9A 4I4LA 1XNJA 2H57A 1XMVA 4LBVA 2ZRLA 3C16C 4O0MA 1F6BA 2BIFA 2TMKA 2RHDA 3FYHA 2HJVA 3FKSD 4OK3A 4OQXA 1KI9A 4NYJQ 4PXAA 2R2AA 3K53A 2ZUDA 4JKIA 3T1QA 3L8YA 4Q5IA 4AYWA 5FPHA 3TW8B 1ZM9A 1SVLA 1Z0IA 3PQCA 2IS1A 1PVOA 4KFUA 5FTKA 2OEPA 1X8JA 3W90A 3UKDA 4IRUB 2P5TB 4LCBA 4KCGA 2FE4A 4NCJA 1G7RA 1E0SA 3BB3A 1VG1A 2ZVPX 4L5BA 1G3QA 5DI3B 2MSCB 4Y0VA 3IPXA 1II8B 1O87A 4I1VA 1W48A 4KHZA 3QKTA 2F43B 5FI0B 1AZTA 2JIZA 3CRQA 4MGYR 4DHEA 4MRNA 3TSOA 1E9CA 3ZQJA 4YXWD 2PT5A 1J7KA 2PCJA 3BS4A 3K0AB 3ZDQA 4B71A 3B13B 1FP7A 4GZLA 1E2FA 4DZZA 4TL7A 2RGGA 2WSMA 1VTKA 3SYNA 2IS4A 1CJMA 4LPSA 2IS6A 1UEIA 1OXXK 1DOAA 4DLZA 1JAIA 3MG9A 5JS7A 1VPLA 5FPTA 1W36C 3A4NA 2J7PA 2WPDA 5FPKA 1NNEA 2GJSA 1E4YA 5GJVC 2FEMA 1N5JA 3H2YA 3U3MA 4LBZA 1E96A 1G3IA 2ZU6A 2ODWA 2WICA 1DAIA 3U2QA 1KYIA 3I62A 2VP4A 3AF4A 3KTAA 3QJYA 4EKDA 1NY6A 2WKPA 1HEIA 1KNXA 1GNQA 1WE2A 1DPFA 1VHTA 4Q48A 1YZLA 4LHZA 5KPJA 1OE0A 2YWHA 1XTRA 2OG2A 3EZFA 4A15A 1Z08A 4JLPA 2WSSD 2OHFA 1SHZA 4HLCA 3X1ZA 5KUTA 1Z0AA 1T5LA 4BPBA 2RGAA 4ACBA 3NH6A 3BH0A 4JVMA 4M21A 4Q4AB 2OO7A 2GHIA 1E2JA 4PQFA 3T1OA 4A8JC 5JS8A 2BV3A 1T4GA 3PUXA 4A6XA 1Y63A 1QZXA 1LFDB 3FFBA 2R44A 1R0YA 2WM9B 1ZM4A 3AEZA 5G3ZA 1KAGA 3ZIAD 1D2EA 4AK9A 1X3SA 3A1WA 4BRWA 4DWJA 1LY1A 3I3SR 5JWRA 3RRZA 8OHMA 5HKKA 5HCNA 1G7SA 1Z0FA 2A5FA 3ADCA 4PQYA 1I4LD 1ZCBA 2GETA 5KTYA 2R62A 3RLFA 3T61A 2G0NA 4OI4A 3P32A 4RY2A 2CCJA 2HYDA 2ZSBA 1LF0A 1ZYUA 3CZQA 2GK6A 4EJSA 3ND9A 4A92A 4I81A 4A82A 3QUSA 1NKSA 1I2MA 4GBMA 2I1VB 5BXQC 5LB2A 2O52A 3LW8A 2VA8A 2Z4SA 3AVUA 1U2RA 4B3XA 1Z6YA 2JLUA 1DTSA 4KAXA 1YR6A 2WWYA 1OLOA 3AKEA 3AV0B 5BYJA 3B7GA 4WVFA 2Z4RA 1KSHA 1XMSA 2QROA 3K0AA 3PV0A 1HTWA 3KJHA 3GLIE 2VHCA 2FFHA 4TL6A 3MWJA 2VBCA 1E2EA 3IHWA 4G5RA 1G3RA 4TQUS 1KO5A 2FGJA 2ZR9A 3IKJA 1YU9A 3QXSA 2IXEA 4RFVA 2BCJQ 2OXRA 5FOWA 2IC5A 3KUDA 3MD0A 1OF1A 3KKNA 1RYFA 4QHTA 1NVVR 1G9XA 1ETUA 3KJEA 5L3QB 2ODNA 5DH9A 2ZE5A 1JB1A 3BB4A 4N0DA 3KB2A 3FMPB 1U99A 2OXCA 2RH5A 1OSNA 2IUUA 4ZCMA 3C5CA 4YC7A 4LYFA 3RNLA 3IEVA 3IIKA 3LY5A 1CIPA 3Q5DA 4BLOA 4Q03A 1BIFA 1RRGA 3QVUA 3KXLA 1B0UA 3LV8A 1L4YA 1MABA 3SJCA 3GFOA 1P3JA 2NOAA 1AM4D 2C9OA 2HEIA 1SQ5A 4PO1A 4DUGA 3O8CA 1MO4A 2ZITA 2ZYVX 2O8DB 1JBKA 3BRWD 3CF0A 3BJIC 3PIRA 4HZUA 3U7EB 5FTJA 1J70A 4A2PA 1YHNA 4GI7A 1XZPA 3DMNA 4I99A 1GVNB 2XZLA 1QVAA 1ZD9A 3UG6A 3P27A 4QC2A 2J0QA 1NVVQ 2QG6A 5EP1A 3LWNA 3QF7A 4Y0AA 1I4TD 2BM1A 1HQYE 4NCKA 2QBYA 3QEJA 4TL9A 4NP6A 4DB2A 3BD9A 1NRJB 1XTIA 4HZUB 3NEJA 1A7JA 4LPKA 4K46A 1SVKA 4QGGA 1SVOA 2ZAMA 2IXGA 5A0FA 4JLOA 5EP4A 1Z8FA 4GDFA 1GZSA 1CRPA 2C03A 2CJWB 2NIPA 2BJWA 3RDPA 4PHTA 3DMDA 1LVGA 2AN9A 2YWEA 1R10A 4DLVA 1EFUA 1P72A 4JVLA 4XTCS 4XD7A 2Q9CA 2JLSA 1Q1ZA 1VDZA 3NDBB 2F9LA 1OH6A 1W5SA 5K8TA 4DLWA 3BXZA 3GJ4A 5FPSA 4RCZA 1YZGA 1PJRA 3LBHA 3SZRA 1KNQA 1VG0B 2VF8A 1CR2A 4ARZA 3LRPA 2CL7X 2GBLC 3R9WA 2FSGA 4EIWA 5AWFC 1YZNA 2GXQA 1S8FA 3MUFA 4ZCLA 5KDOA 5AJZA 2CLCX 5J4YA 5F9FA 3BBPA 1OXSC 3U61B 3GLFE 2NMVA 4NCIA 1BMFA 2EFDB 3PUVA 4BEBA 4M1WA 4HSEA 4KLZA 1PLJA 1OH7A 1BYIA 1RRFA 2XGJA 2IYSA 4ILEA 1OB5A 1W5TA 1WRBA 2BOVA 1GKUB 1H8ED 1CKEA 1MRNA 2ORVA 2WHXA 5DO9A 5FTLA 4FMCB 4D4LA 5JECA 2OUKA 4MH0R 4DBLC 1JECA 3RS4A 2V54A 2MSEB 3VNVA 3FDIA 1C1YA 3U6KA 4AI6A 3CF2A 3GLGE 2ZRPA 2WJHA 1P2SA 1ESMA 1Q3TA 4JLDA 2QAGC 4QM6A 2WJJA 3CO5A 1ZD1A 1KSJA 1ODFA 1NLFA 4MA4A 2R6AA 4HAZA 3GEEA 4U7DA 1TADA 4OI2A 5F3WB 1KKMA 4M8NE 3U4QB 3VU9B 2PCLA 4BRUA 5F98A 3IIMA 1R5OA 2ODBA 4UNNA 3I4LA 5CJ2A 1FNNA 2RHMA 5TB5A 1Z63A 5KSZA 4PHFA 1U9IA 4MRSA 1BMFD 4ARZB 4QL3A 4AY2A 2AK2A 3KJIA 2WWFA 2ZJOA 2XTNA 2CHVA 4GNKA 1G21E 3LXRA 3VU9A 2OFWA 2QNRA 1IONA 2NPFA 4ESVA 1NSFA 4IOMA 2C96A 1GSIA 5DI3A 721PA 1S2MA 3U44A 4L9WA 5ANRB 2OILA 1DO0A 5CLLA 2QGZA 3VTKA 1TNDA 4EPWA 1OH8A 2ZREA 4HB3A 5TV2A 2CHGA 2F43A 3SHWA 3I5YA 1JQJC 1IXSB 1W4AA 1UJ2A 2X19A 4EJSC 4LWZA 1IXRC 1RE0A 4LJYA 2QAGA 1N0VC 4TMKA 5BN4A 5JWHA 4JJKA 3OEEA 3OHMA 4LHWA 1OXVA 4RZUA 2JA1A 4BASA 5FL7A 3KQNA 2FEOA 4NONA 1XXHE 2IUSA 5IF9A 1Q12A 1TX4B 3A1UA 3SFZA 3O8DA 4Q01A 1YE8A 5K8UA 4LK2A 4US0R 2IYWA 3L43A 3ADBA 2QT1A 1NMYA 1R4AA 2BWJA 2HV8A 2ZS7A 3IBYA 5JSZB 4IW3B 4Q4LA 2HT1A 3PG5A 4LUCA 5DLQC 4DKXA 2MMCA 5SZJA 1QHXA 4BFYA 3B2EA 1GG2A 3PUZA 4WAUA 1L4UA 2Q9AA 3CH4B 2X77A 4NCNA 4Q9JA 5KNDA 1VCNA 2PX3A 4URUR 2BMDA 1JAHA 2UVQA 5CM8B 4Q18A 1GKIA 4QJ4A 2GBLA 4M1YA 4P4SB 1MO5A 2RKOA 1XPOA 2O0JA 4PHGA 2O0HA 2BBOA 1YZTA 1E9BA 1FNMA 2W0MA 3B6EA 2YOHA 3R8FA 3OFNA 1T6NA 2AKYA 4MGZR 4RD1A 1IM2A 4TTQA 1U98A 5UKDA 5EQTA 1GWNA 3W3AA 1HQCA 4QHSA 2J9RA 1KI6A 1Z0DA 5SZIA 4MRVA 1M74A 4IVQA 3WNBA 2QTHA 4F93B 4C0AC 4Q1EA 1NIJA 2ANCA 2VSXA 1EX7A 3HR7A 2WPDD 2JJ1D 4HLDA 4IEEA 2AWNA 4POAA 1G8PA 1F2TA 3WBJA 1XX6A 1N3BA 2X1VA 4HYYA 4C0JA 1K5GA 2YOFA 2J0UA 4BEJA 3QENA 3KZ1E 3O8BA 4JLMA 3DPUA 1OH5A 1QDEA 2ERYA 3JZAA 3MWKA 4OBEA 3HYRA 1UPTA 1MKYA 4DEYA 1KI3A 1N6KA 1SVSA 3SN6A 3K09A 3CM0A 3I32A 2VL7A 1OIXA 4A6PA 1G18A 1SZPA 2YOGA 3U3KA 4DT1B 1IY0A 4JLKA 4XWAA 4GOJA 3TSZA 1XMJA 1O3YA 2RGNC 3BAFA 2IYLD 2NO7A 1GM5A 1YZUA 1KSGA 1OJLA 4D82A 2LCFA 1Z28A 3IIJA 3JZMA 4V0LA 4GP7A 3D8BA 2XXAB 1EFRA 2J0VA 4LV8B 1R5NA 3C4JA 1ZUHA 2IYYA 3CPEA 2BC9A 4DT1A 2HXYA 2QI9C 4AURA 3V9PA 5FFMA 1Q21A 2H5EA 1R7RA 1Q1QA 4GPTA 3GLHE 3AGQA 3QEOA 4XWOA 2QTFA 5JJIA 1QHNA 2HJGA 4Q7JB 1IN6A 1OYWA 1JXOA 3B8HA 4F7WA 4JT4A 4TL8A 4OHYA 4R7ZA 3LLUA 4ON9A 2EFEB 1JJ7A 4M9ZA 4PZZA 2HLDD 3SEAA 1YQTA 3LW7A 5L3QA 4DSUA 2QGNA 2F6RA 3BFKA 3FOZA 1ZC4A 2IF0A 1CR0A 3A58B 4JSTA 1LS6A 5DI9A 3AF0A 2WJYA 2PLFA 1ZUNB 4NE2A 1KI4A 4LJ5A 4MYCA 3ZVMA 2NTYC 1Q20A 1S9DA 3RAPR 1VKJA 2ZRBA 1FTNA 4QXAA 4I1OA 1AKEA 4M1SA 1TF7A 2XZOA 5E7MA 5G41A 3TSWA 3ZVRA 2W83A 1VIYA 4QGFA 2W2XA 3AVXA 2PMKA 3VKGA 3AF2A 3FMIA 2NPIA 3H4MA 4V03A 1T0JB 3GMTA 1RZ3A 1YZKA 3K70D 3N2IA 5FL7D 3W9YA 4HDOB 3FMOB 4ZPXA 1JR3D 2OBNA 2O8FA 1E2LA 3T34A 2OE2A 4DEXA 1FFHA 1II9A 2W2VA 4TSFA 4URXR 3Q8XB 1JXMA 4IOKA 3UPUA 4UJ5A 5BYKA 3BC1A 4UXIA 4FWTA 2F1JA 4OKSA 4URYR 2WOOA 3AVTA 1N0WA 2GXSA 3SYLA 1C4OA 2CE2X 4B3FX 2Q3FA 5DIFA 3GLIA 4OL0A 4A0HA 4BFZA 2IWRA 4ZIRB 1T8UA 2CLDX 4R98A 2WWXA 1KK2A 2FMXA 4B75A 3QOFA 5LBIA 3ADDA 2WKRA 1XZQA 4LJAA 4CZ2A 4V02A 1CRQA 1X8LA 1XWIA 2FU5C 3A1SA 3CUEF 1KO7A 4CRWB 2QU8A 4DIEA 3QIAA 5CB8A 2JLZA 1SHKA 1KGDA 2GK7A 2ZQ5A 4LRWA 1E9SA 4CT4B 2CEAA 3CX6A 1TMKA 1TPZA 1UKEA 3AKYA 3K9NA 4DIDA 2QSZA 2C99A 2EFHB 2QM7A 4NHOA 2QEQA 3Q7QA 2KJQA 1N6HA 4KBFA 1F2TB 3GFTA 3CNOA 3H84A 4GOKA 2FN4A 1U81A 1HUQA 5TXGA 3RS0A 5KDDA 3X1WA 2D2EA 2V6IA 2WWHA 2P6RA 1XCPA 1A2KC 4M1MA 5DHFA 4DLUA 5AK0A 1P4SA 2ZEJA 4AYXA 2GZDA 1II0A 3MAAC 3LD9A 2BJVA 3NBXX 4HLUA 3VNUA 2FPKA 2J3EA 3I5XA 1GUAA 1KSFX 5JJLA 2DFKB 4N3NA 2JDIA 4RCYA 3QXCA 3PEYA 3CNLA 4QGHA 4V0NA 4GZMA 3Q3JB 3T5GA 3KTAB 1H8HA 2H16A 4V0MA 4Q47A 2O8BA 1GNPA 1G7TA 2NO6A 1KK0A 4JLAA 3TUIC 2KBEA 3GP8A 2ZJ5A 1DS6A 3IQWA 1XCGB 3TUJC 2Y8EA 3LNCA 1D9XA 1NN0A 5KYKA 3SDZA 4LDJA 1IY2A 4URVR 3H86A 1V43A 2XTZA 3GQBA 2FA9A 1XFAA 2BBTA 1Z0JA 1JQLB 3QQ5A 5GJCA 1RW4A 3Q72A 1VYTA 4W5JA 2BVNA 3OIYA 4XIGS 5G40A 4A1FA 4P4UA 4KO8A 1G5PA 3CZPA 3WMGA 4ESHA 3W8NA 3T12A 2AX4A 1AGRA 2IHBA 3VKHA 4S2EA 2REXB 2LKCA 1BH2A 2F1IA 1ZU4A 2GZAA 4HAXA 3AM1A 5HPYB 3NIBA 4G5SA 5CK4A 1GILA 1E32A 2C78A 2JJ1A 4UJ3A 4EPVA 1KJWA 4F4IA 5EZ6B 3CONA 2FWRA 2V7QD 4LV5B 2QMOA 2XTMA 3QPUA 2VP6A 4PPNA 4B47A 1DG3A 4HB4A 1MV5A 5FUXA 3OE7D 3UXMA 3KXKA 5IRCD 2QTVB 4CEHA 3A6PC 1GFIA 1XD8A 2EQBA 3OIUA 4Z1MD 5CIQA 1XJQA 1Z83A 3JVUA 5CB6A 4KYUA 1AZSC 3BGWA 3SQXA 5EE0A 5FOSA 3AB3A 3LX5A 3PEVA 4G5QA 4PPQA 1W4CA 3V4RA 2CBZA 2RGDA 1KI8A 2O8BB 3ICQB 3SJZA 3EC2A 821PA 1TQDA 2IW3A 1RJ9A 2NGRA 2ODEA 3U3OA 1CLUA 1S1MA 2FJUA 5EXSA 2R65A 4BUJA 2IYZA 1QBKC 2F9MA 2OBMA 3J81k 2JLWA 1GTVA 2Z0MA 1GAJA 2ZRAA 4V0ME 3SU8A 2XJ4A 1SXJC 2EYQA 2OM2A 1E9DA 2QSYA 2ZR0A 2YVUA 2IL1A 4C4PA 1KY3A 2CK3A 2Q9BA 2ZJ2A 4C0HA 1UF9A 1K8RA 1Z6AA 4DDWA 5D3QA 4QNRA 4MKGA 3QKRB 1BKDR 4TLDA 4Q9KA 1NP6A 4NKRA 3NBYC 1IY1A 1DAMA 2GRJA 2HUPA 4Q7MB 1F60A 5TY0A 1N5LA 4TLAA 2BEJA 1W1WA 5FOTA 3ZVLA 5KSOA 4H1VA 3FTQA 4LJ6A 4TMVA 3CKLA 1OXUA 3KQUA 4UQOA 4X8MA 3UWOA 2B7CA 5FR2A 4AG6A 4FMDB 1UBFA 1KMQA 2G83A 4Q21A 5DN6D 1COWD 4QG7A 4C2TA 3RHFA 2HCBA 2EWVA 1DVRA 2WWIA 3DZ8A 1E0AA 4XSHA 5TMPA 1NBMD 1FZQA 2ZETA 3OESA 4FWIB 1ZRHA 1VECA 2GAAA 4IDHA 5JSZA 4KFTA 4NBSA 1E9AA 4JL5A 4M53A 2AR7A 3VHLB 1CEEA 1EG7A 3DM5A 1JJVA 4KITB 3BB1A 3SHFA 2GCOA 2G1KA 3HR8A 1UBCA 3N5CA 3W6OA 3EG5A 5K8IA 2B8WA 4RD4A 2ZJAA 2ZI9A 3EW9A 4PAQA 1EX6A 2C95A 4PC7A 3O8RA 3L82B 2QMHA 3IHLA 4Q1AA 3T15A 4EPXA 1G5RA 4BLQA 2JLYA 1C9KA 3LA6A 4JBXA 1E1RD 4XVUA 3THOA 4IOLA 4HB0A 4Q1FA 2GZHA 1D2MA 2BKUA 3FHTA 2CE7A 1EFCA 1LB1B 5FL3A 4RVCA 3EZ7A 1MO3A 4PZLA 1G6OA 1MR3F 1YVDA 3VR6A 1R5BA 2D4HA 3MJRA 1FP6A 4LHVA 4YMWA 5B2ZA 3OEHA 3QBVA 4HAVA 2V9PA 4EPRA 5KSPA 3EX7C 1KO4A 1RRCA 3VX3A 1OIVA 1HE8B 3X2SA 4XTRA 3GLHB 4WBSA 5H1YA 1E99A 2GJ8A 2VHUA 4RFSB 1R0WA 3L2OB 2VHJA 4TLBA 1SULA 4EQ6A 1Q1BA 1NG9A 2Q6TA 4RKFA 3GJ7A 1NY5A 1XB2A 1EK0A 1OB2A 5K8LA 1DEKA 3L0SA 4JJZA 621PA 1US8A 4BZXA 1XTQA 4B3BA 2UZ3A 1JPNA 4OQLA 2C9YA 2GWHA 2XJ9A 4CW7A 1P7CA 1QVRA 3OIWA 5JLJA 3SBDA 4OI1A 2DFNA 3VHXA 2J41A 3OE7A 3ZYCA 4PC1A 4QRHA 3GJ3A 1Z6TA 4S35A 1LW7A 1CJUC 1UDXA 1P2UA 2IYVA 2HYIC 2J7PD 2G1JA 5HZKA 4Q4JA 1ZCAA 3DKPA 1S0UA 2OCPA 3NVAA 4TYYA 2QZ4A 4MRRA 1QHYA 4A0GA 1JR3E 4XJXA 1UADA 4B35A 1N6OA 3R7WA 1U8YA 1WDTA 3ZH9B 2ONKA 4PO8A 3EPKA 5FUWA 1F2UB 2H1LA 4EFNA 2R8RA 2GCOB 5JRJA 1KKLA 4TWZA 1SVWA 1ZC3A 2YV5A 3N70A 2AD5A 5DYGA 3K09C 1W36B 2VPPA 2G6BA 2P0EA 2ZSDA 4MGIR 2FZ4A 1KI6B 2IYQA 5SZHB 1IOZA 1W44A 4CF7A 1AIPA 3NBZC 4C0KA 3B1ZA 3PUWA 4TYWA 4TYPA 3BIFA 1TQ2A 3PENA 3WHLA 2NO1A 2ERXA 3AVQA 5TARA 4EPTA 3W34A 1GRNA 1EWRA 2QE7D 2XX3A 4KVAA 2ZJZA 1FQKA 2OESA 4AKEA 1W7AA 2J87A 1FQJA 2PJRA 3H0KA 1IAQA 1KJZA 3S1AA 5LD2B 2ZI7A 4A9AA 4IVPA 3T35A 2QENA 4C0QC 4R2IA 1HURA 2C77A 2RB4A 4BLRA 3LAWA 4EQ6B 2ZJYA 2ZE6A 3QSYA 5EP3A 4TMXA 3U60B 2QORA 2ZIAA 4D4MA 1XP8A 1KK1A 3HJNA 2VTKA 2FH5B 4MRPA 3TLXA 1G6HA 4BLPA 2GNOA 2BMJA 2D62A 1Q0UA 3HWSA 4TN1A 5FBLB 5DHAA 3TVTA 2WZQA 2GA8A 1T3LA 1EXMA 4HAWA 2F7SA 1U94A 2ZE7A 4D81A 4DLSA 1RYHA 2W6IA 2A7QA 3WHKA 4PFSA 3UATA 4H9GA 1KTVA 5HE9A 1XXHB 1CS4C 4YDHB 3PEWA 1HYQA 3BERA 3AUYA 3BORA 4PSAA 1E1QD 2XOKD 1T8TA 4HB2A 4R9UC 2ZTSA 4RFSA 4HLQB 4B6EA 1E9EA 4NMMA 2DHRA 1NBME 1OKKA 6Q21A 4CGZA 3HPRA 2GF9A 3TIFA 2E1RA 4N1AA 1OV4A 2DWOA 3AP2A 3OF5A 3C14C 2V1XA 4U5XA 1FTSA 3ND8A 4Z54A 1ZBDA 2PEYA 1DAFA 1VIAA 1XTJA 3LXXA 4LGMA 3X1DA 3QI2A 1W0KA 1XF9A 1CF4A 1XD2B 1ZIOA 2VLIA 3ZIAA 1NLZA 1U9IC 4HUTA 4R2HA 2O8EB 2K5UA 3VR2A 2XNSA 1LF5A 3QF4B 1U8ZA 1QHHB 2P6NA 3X1YA 5LD2C 5LB4A 1ZP6A 4OJQA 2OLJA 2OFXA 3K8YA 3NBFA 4B3DA 2ZRCA 2WJVA 1BS1A 2P2LA 3R20A 4XVRA 4CEIB 1OFHA 4E5UA 1SXJE 3RWOA 4LBYA 1DADA 5LDDC 2P5SA 3ZS9A 3CRVA 3GLGB 2WKQA 4G5GA 2AXNA 3WP1B 3WNDA 4EAQA 3WYGA 2GJAA 1IQPA 3AF3A 1G4AE 4FMDF 2LKDA 1Z6GA 1XJ0A 5F9HA 4KJZA 4KYIB 3U3JA 2YC4C 3AVVA 4I1UA 3MSXA 3ASZA 2ATXA 2XITA 5FPYA 2H17A 1OIWA 1DAEA 2DYKA 1E1QA 2ZYTX 2CL0X 3GCGA 1IJFA 1NJFA 4IDQA 1KZGB 5L3RA 4RD2A 1Z47A 5LPNA 1W2HA 4DDVA 4NPHA 3PUYA 2P65A 4M22A 521PA 5A5GA 2AK3A 1AK2A 1G20E 1TEXA 4UXJA 3C5HA 2FG5A 4YDSA 2ZI3A 4TT3A 5HE8A 3F0TA 1S3SA 2JLRA 2MMGA 2JGNA 2Z5FA 3DO6A 3VKWA 1DAHA 1B23P 4LSGA 2FSHA 1JI0A 1GDDA 1G4UR 3OAAA 3IO5A 2KE5A 1DO2A 2AL7A 1GL7A 1T3HA 4DSOA 2VP9A 1ZNZA 4TMWA 3GPLA 1U8AA 3KXIA 4JKYA 2FGKA 4A4DA 4MQBA 3ZD6A 4AG5A 1AKYA 2REBA 4JMPA 4WOPA 2A5YB 4URZR 1VG8A 2IXFA 3WNCA 2ZUBA 5EP2A 3N2EA 3PCRB 4CEIA 4PTLA 1YR9A 4CVNA 1S9HA 4YQFA 1IXZA 4ERNA 1XEWY 4ZKDA 4DC9A 1ZNWA 3TR0A 3TH5A 1H8EA 2E9SA 3CF6R 2G9NA 3T1VA 4FXPA 4LJ4A 2ZRDA 1W36D 1N6RA 2ZRHA 2QE7A 3I92A 2XXAA 2W6JA 5JWOA 4WW0A 2DBYA 2PT7A 3OFND 1R2QA 1JALA 2Q21A 3FKSA 2OFOA 5L3SB 1NVUQ 3PITA 3PJRA 4FMCF 3CRMA 1L7VC 2P3SA 1YRBA 3ASYA 2EVWX 3NXSA 1KDTA 2EWWA 4O2RA 5F2EA 3B5JA 1RKBA 5E7IA 4XVQA 3C15C 2DPXA 4LZZA 1N5IA 2IK8A 1E2GA 3GEIA 3AP3A 4Q4HA 2N46A 3WRXC 4ASUD 2W00A 2ZYUX 1E4VA 2H7VA 3CPHA 4HUQB 1OHHD 2A78A 3R9XA 3EZ2A 3QG5A 4QJ3A 3KQHA 3LBIA 1ZUIA 4GMDA 2QPAA 1RRPA 2QL6A 2VO1A 2NO9A 4TZ0A 5EXPA 2GJ9A 4QGAA 2WTUA 2OAP1 2EFCB 5FOVA 4XOIA 3NHAA 2X2FA 3LQQA 4TYNA 5J4LA 1G7CA 1KHTA 1ZW6A 3I61A 1G5TA 2GILA 4JS0A 3SJBA 3OEED 2Z83A 4G3XA 1N6NA 2GCPA 2JJ2D 4AKGA 1XRJA 2FZLA 3WBKA 4IHQA 1AGPA 3F8TA 4ZCIA 2CXXA 1IN5A 4B33A 1TU3A 5FUVA 2ZSFA 2GVDC 4PSKA 4JBYA 4C2UA 3EA5A 1JR6A 2OT3B 3VR1A 1TF2A 5J4VA 3ONWA 4ZDWA 2D74A 4AKIA 1AS2A 2C9CA 3A4LA 1OPXA 4M1TA 5IDVA 2IUTA 4Z51A 1N0UA 4UKDA 2FX3A 2ONJA 4TTPA 4KI0A 4DDTA 2GCNA 2V6JA 4UNQA 3GLFA 3RWMB 2O0KA 1XEFA 4DCUA 4IOJA 4ZIRA 3IUYA 3B9QA 4E09A 5C1BA 4MDFA 3A8TA 2FFAA 3NTUA 4K81B 4DLXA 2MSDB 2D7DA 1P5ZB 3OEHD 4C3ZA 4B48A 5C4MA 4GMXA 1E2MA 4NU0A 5A4JA 4C0SA 4D0GA 1R6BX 2CVFA 4JLJA 3RANA 4FCVA 1EGAA 4JSYA 4NYJR 1Q1EA 1WF3A 4QBIA 3GLFB 2XAUA 1R0XA 2RMKA 3QXJA 4PC2A 5AUOB 3KQKA 4LJ8A 4LX0A 4M9XA 1CJVC 1E1RA 4ZI3A 2D2FA 3UMRA 1N2CE 2XEXA 2PJZA 2PMDA 4D4KA 3RSOA 5DYIA 1T91A 3C8UA 4QNMA 2WMNB 3UANA 1W4BA 2OAQ1 4QFMA 2YNMA 3CW2A 1Z5ZA 3FMFA 2WWWA 4GSYA 4MYTA 1SKYB 4J0QA 4Q02A 2ZROA 3R9IA 4Q4AA 4Q4JB 2J45A 4GOXA 2H8KA 2KBFA 3KDSE 3THYB 1G64A 4M9SA 4A8JA 3SS8A 5GVSA 3VR4A 4Q7KA 4RSGA 4XH9B 5EE5B 2WMOB 1J8YF 4Q19A 2G77B 2EU8A 4B74A 4PPGA 5J4KA 5TDHA 2X2EA 1Z3IX 1KIMA 1ZM7A 2IEYA 3QY0A 4PC3A 1E69A 4DJTA 3MLEA 4GFDA 4H1UA 4CT5A 1Q22A 1W0JA 3QXHA 4MKIA 3V4FA 1CR4A 2XB4A 2A5DA 1KAOA 4Q1BA 2VQSA 1QHGA 2B7BA 3NDPA 4US1R 5DISB 1OW3B 4P4SA 1S96A 2A5GA 3CX7A 4OQFA 4LHYA 1K5DA 2J0SA 4LOAA 1XEXB 1U90A 4PSVA 2AFHE 1J2JA 1JNYA 3DDCA 3SNHA 2HXSA 2QMUA 5JEEA 4FCTA 3HP1A 2BBWA 4AKHA 1KMHA 4MUBA 3BFVA 4PC6A 5KDLA 3RS2A 5IK2D 1ZINA 4DCSA 3G0HA 1CULC 3KKOA 3P26A 3C7KA 2OV2A 2VSFA 4ABYA 3LLMA 5AJVB 3P1JA 4C30A 1TF5A 1EFHA 2V55B 3WMEA 3AUXA 1N5KA 1KMHB 1IJEA 5KSYA 1ZAKA 3RC8A 3THYA 1QRAA 2Q3HA 2WJIA 5CJPA 1FW6A 4HAUA 2ASEA 2R6DA 2BM0A 2W58A 3LDAA 1P62B 2BBSA 4A36A 3F3YA 4BZPA 2DY1A 5GJBA 3KFXA 4O3MA 1Z6XA 2DWPA 1Z06A 3QBTA 4ZDIA 1CJTC 2IA5A 3EWAA 3UG7A 4BE7B 5AUNB 3I8SA 5L3VA 1VCOA 4D25A 1ZIPA 1E3MA 3BK7A 2OCAA 2Z43A 1FPMA 1US8B 4AWXA 2ORWA 2RCNA 3U7GA 3B9PA 5C46F 3EWSA 2AXPA 1ZMXA 2GESA 4LC1A 4Q7LA 3U5ZB 1T0HB 4OI0A 2YYZA 3Q5EA 1K6MA 1TQ4A 2C04A 4FN5A 1KY2A 3DVLA 2DWQA 3D7MA 4HLUC 4R71A 3LQRA 2O8DA 1G8HA 4YONB 1Z07A 3K0CC 2UKDA 2ZJ8A 4IFEA 3TBKA 3FGNA 3NWJA 3E1SA 5FBQB 1E79A 1ZJ6A 2HF9A 5CYOA 5J4HA 2IHYA 3IILA 4KSBA 4Q9LA 1W0JD 1ZNXA 4FIDA 3MWLA 4LJ7A 4RZ3A 1P9RA 1GL9B 3VQTA 3NC1C 2ZRIA 3R7WB 4AIIA 2AD1A 4KFSA 2QBYB 4UNRA 2CHQA 4PX9A 2QP4A 4OYHA 3FVQA 5KNCA 1FUUA 2BKEA 2EFGA 3I72A 3ZGXA 1GOTA 2V8OA 4LYAA 3K0SA 2JLQA 1KJYA 4Q1DA 5E95A 3K9LA 2Q3MA 1E2QA 2B6HA 5DN6A 3K70C 1QHSA 2AHOA 1P60A 1QHHA 5E3HA 2R6CA 1LV7A 2Q0HA 3L8ZA 4ACAA 5JCPA 4LHXA 3FHCB 1ANKA 1VYVA 2GVZC 3TK1A 4A8JB 5B58C 2B92A 1G1MA 4HAYA 3B1XA 3GLHA 1N6IA 2QMEA 2QUZA 3SBEA 5IT5A 1PLLA 4BFUA 3LH5A 3RS7A 4ZI2A 4V0OA 4F91B 421PA 4Q9IA 2VP5A 4TTRA 3EZ9A 3U6BA 4D6PA 1NN5A 5J47A 2NZJA 3H1TA 2QRNA 4NYIR 4OQMA 3PFIA 3ETLA 1WBDA 2J1LA 2OZEA 2NQ2C 2GXUA 2BCGY 5HKKD 2SHKA 3EARA 1H65A 1W46A 2ZYWX 1Z0KA 221PA 3KUCA 3Q85A 4GRAA 2FFBA 3SFVA 1X8KA 1PV4A 3EPHA 2QQ0A 2NG1A 4BGDA 2ATVA 3VR3A 4DLRA 5M04A 5FTMA 3QKSB 1SXJA 1E2IA 3SE0A 2YKGA 3LVQE 3ZJYA 4F38A 4LI0A 4KVGA 3I73A 2DFTA 3WYFA 1RIFA 4DVGA 1MO6A 3E5HA 4P0TA 1NG1A 1W49A 3D3QA 1FL9A 1WB9A 4BFWA 2FPLA 2CNWA 2IYRA 2ZI6A 1WMSA 4L8GA 1NSTA 1YZQA 2YWFA 4Z1MA 3K0CA 5AUPB 1D8TA 1X86B 2ECKA 3AKCA 2JJ2A 5IK2A 1N25A 3CIOA 3QE0A 5GADl 4FCWA 2V7QA 1PZNA 4WA7A 3E70C 3CPJB 2O8EA 5BN3A 4M1OA 2JCSA 3QF4A 4MGKR 3CWQA 4ZV4A 1N6LA 3RC3A 2PLRA 4P3YA 3SJAA 4X8LA 5B57C 2J0UB 4JYBA 1QG4A 3KKQA 1IBRA 5FUYA 3E2IA 2RGCA 3WYAA 4L9SA 1KDRA 3O47A 5AJWA 2RGEA 2GDJA 2F3TA 5HR5A 1NIPA 5JMTA 2C8VA 4RZXA 3KX2A 1RVDA 2JIZD 2XSZD 3NKVA 2FOLA 4DCNA 2ZRGA 5CIWA 5EUQB 2PL3A 2FPMA 2VRWA 1G3MA 3B78A 3I1FA 4KFRA 2AKAB 3LBNA 4HEJA 2CJWA 1D5CA 1PLKA 2HLDA 2XZPA 3REGA 3W6NA 3DOEA 3QPWA 4TZ6A 4TQ9A 3SI7A 4F4JA 2KWIA 4LV6A 5JHGB 3TKLA 1XD9A 1HT1E 2IYTA 4JLVA 3AH8A 4YMVA 1J99A 1OFTA 2JAQA 1M7BA 3WY9A 5FH9A 5JZVA 2V3CC 2O5VA 1DBSA 3THXB 3AP1A 4D0NA 3GLGA 3AVWA 1VMAA 4NZYA 5JJKA 3W6PA 2ZS9A 5AUQA 4O25A 2J46A 3SOPA 1M8PA 4LYJA 3ZZ0A 4PR0A 3A1VA 1TL7C 1TTTA 4M1KA 3TW4A 4QBHA 1SXJB 4IDOA 1DELA 1M2OB 1BYUA 3RS3A 2RAPA 2W2TA 3THXA 3BOSA 3QKUA 4OK5A 2ZSEA 4MKHA 4BLSA 4CEJA 2I3BA 4U00A 2NZ8A 1NVWQ 3A4MA 2JLVA 3VMFA 4C7OB 4IXMA 4TT3D 2WAYA 1J90A 3AQ4A 4L16A 4MYHA 4QBGB 3CWZA 1II8A 4B73A 2GF0A 3MGCA 4X8OA 4WZBE 1ONBA 1GRQA 4K8OA 4B3GA 1P9NA 2I4IA 2VEDA 3IQXA 4PPFA 4KSCA 1QF9A 1XMIA 3VFDA 5J40A 3EASA 2QPOA 2QY9A 1MH1A 3P4XA 3KKMA 5KNBA 2WIAA 4JBWA 4XSGA 3T1TA 2P6UA 1OYYA 3OIVA 2W0SA 3LVRE 3GEHA 1P75A 4B76A 3IEUA 1XXHA 4TSFD 2KI5A 3CNNA 3RRNA 3F5FA 3B60A 3RS5A 1AN0A 2PBRA 1GRRA 1Q3HA 1YRAA 4D80A 4OJKA 4HUQA 4IXNA 4B3CA 3BE4A 1VYUA 4TQAA 1WCV1 3ICEA 1L2TA 1G8YA 2JASA 3AF1A 5ELXA 1LS1A 3CRRA 3K0FB 2A2ZA 3X1XA 5HCIA 4JZKA 1A5TA 5CM9C 4D26A 5KHOC 4JT2A 2ZSAA 3DOFA 1G19A 1U0HC 5FI1B 3K70B 4US2R 1W2GA 4EFMA 2QN6A 1NMZA 3BH6A 1AQYA 1MOZA 2BEKA 2VHQA 1EESA 1HA3A 1W0KD 2WIBA 1UAAA 5D3MB 5JI2E 4E03A 1KO8A 4PANA 4DXAA 4DDUA 1E2PA 3M1IA 4KU4A 4UXHA 2YHSA 1FX0A 2ZVQX 1SKQA 2DFLA 2GEUA 4NTZA 3REFA 4G1UC 4IEIA 3K9HA 3WXMA 1D9ZA 2I1QA 5D3MA 5AR1A 1OKKD 4LC0A 2XB2A 2UZIR 4Z8XA 5E4FA 1VCIA 3ZLJA 4PO9A 1VG9B 2XOKA 1FX0B 2O8FB 2VSOA 1UKVY 4P33A 1RC8A 1GP2A 4ZDJA 4EJSB 3R8CA 1XDBA 2KB0A 4WIAA 3M6AA 2D3WA 1V5WA 2HT6A 1XPUA 1EFRD 4U02A 5HZHA 3K0EA 4YMTA 3ECCA 2ZI5A 4MYUA 1AQUA 2CVHA 2WWGA 3B82A 4ZKEA 2WV9A 4HATA 4HDCA 1F5NA 2GXAA 1P73A 5P21A 5EE3A 3BFXA 1KDPA 3NC0C 4NH0A 4OK6A 2GEVA 2GEDA 5B30A 1I4DD 5JCZA 1MABB 1ZNYA 5AJYA 4RD0A 1E79D 3EIHA 4C0LA 3PVSA 4G01B 4Q00A 4GP6A 1S4QA 2RGNA 1GKYA 2ZXUA 2C98A 3C41J 5BW8A 4IVRA 1E2KA 4LBWA 4W7SA 3W3ZB 1KDOA 2O8CB 2FFQA 1NI3A 4FD2A 2E87A 4NL4H 3AGPA 3SC3A 4CEJB 1GITA 2A9KA 1RPZA 1F48A 5TVKA 5C4GB 5C18A 4M9QA 2CL6X 1X6VA 2KSQA 4XWKA 4CEHB 4Q4HB 3SR0A 1NL3A 4B2IA 4L15A 2BMFA 4QHYA 4E07A 2ZRFA 2GAOA 3DEFA 4Q9HA 1I2DA 4EDHA 2ZUCA 4YMUA 3EAQA 3NEYA 1UEJA 2ZRJA 4M2LA 4B2PA 1E2NA 3HU3A 1F3OA 2IYUA 3M4YA 1GNRA 1QG2A 2Z6VA 2BMEA 1KI2A 1T9HA 4PAMA 1CR1A 1TQ6A 4L4UA 5B64A 3CX8A 2B8TA 3NH9A 1XBTA 4TMZA 2FSFA 3GD7A 4MKFA 3RYTC 2XSZA 3VAAA 1OFIA 2HCJB 2J5XA 3DKVA 1G3UA 3CH5A 3IO3A 2FDCA 1M7GA 2JEOA 4JL8A 1EFTA 3AVYA 4B2LA 5H68A 1YKSA 4A2QA 5IHPA 3CB4A 3EPLA 2YJTD 2VIIA 5C2JB 3TUZC 5L3SA 3FWYA 4W5WA 1KZ7B 2PH1A 1DAGA 1FMJA 3DZDA 2FSIA 3QPVA 5DGXA 5JI3E 1CP2A 4LJ9A 4GT1A 2C2HA 2EYUA 2XNDD 3D31A 4I1SA 1IN4A 5JEDA 1E0JA 2IX3A 3T06B 1U0JA 2X8AA 4JYCA 1A82A 3V00A 2O8CA 1XTKA 3BWDD 3W5IA 1TEVA 4KLNA 1BOFA 5FBRB 2V4ZA 1X1SA 3GJ5A 2QP9X 2IBMA 3PXGA 3A37A 1HT2E 1SKYE 3TGPA 2J7KA 4NYMQ 4DRZA 1E0KA 3GJ8A 3THWB 2FF7A 2QT0A 4IDPA 5FBWB 3KKPA 1CBUA 2CNWD 1QHIA 4II7A 4RZ2A 1DAKA 4JLNA 1NKTA 5CITA 4BLTA 5JHHB 2ZANA 4DSTA 5BWMA 4QOSA 1TAGA 3FPAA 2V1UA 3B1WA 1E94E 1HE1C 1SXJD 1NN1A 4PAOA 1KK3A 2VP0A 4BFXA 5EJEA 1G8FA 2W6ID 4RKEA 1TUEA 1SVMA 1W47A 1CU1A 2HDNB 1LTQA 2RGXA 4URWR 5EE1A 3ZZTA 2G3YA 2RGBA 3NHBA 1HY3A 1E2DA 5H70A 2P67A 2R6FA 3G82C 3UK6A 4OHVA 1PUIA 2YWGA 1ZM3A 4QBFA 2CDNA 2EW1A 5CDFA 1AA9A 2ZPTX 3DHWC 5DE3A 3T5DA 3UMFA 3U4QA 4IFBA 2QA5A 3QKRA 4JIMA 3ADKA 2L0XA 3UWKA 5GJWC 1UKZA 2N42A 4HZIA 3PEUA 4LY6A 4DCVA 3B1VA 4B44A 5H8WA 4AYTA 2BDTA 4ZDKA 2J59A 4TMTA 4ITRC 5JBQA 1OXTA 1P2TA 1OT3A 2QRZA 2ANBA 3VX4A 2A5JA 2HF8A 3HDTA 1M7HA 3QXXA 2C5LA 2D06A 1P9WA 4QKQA 3B85A 4DLYA 1RJ9B 3TQFA 2FV8A 2PZEA 2ZAOA 4F92B 3QG1A 4UNSA 1XPRA 1NLYA 3Q7PA 4P32A 4LYHA 4NYIQ 2QAGB 1NMXA 4HI0E 1NBMA 1A2BA 2IT1A 5G3YA 1XD2A 3KJGA 3FKQA 5GVRA 3ZQ6A 2QPTA 4B6FA 2CMKA 4RD6A 1VHLA 2F1HA 1IN8A 3IPYA 1WP9A 2VHTA 3GJXC 4G0NA 1ZVQA 2ZRMA 3WRYC 3WMFA 3QNUA 3TAHA 1G17A 1MRSA 4DLTA 3TAUA 3TJZA 1N6PA 1WXQA 5KOYA 2ZS8A 3ZD7A 2PEZA 2OSBA 5CK5A 1KO1A 3THWA 4FI3C 3HU1A 1R8QA 4UNPA 4XD7D 1YR8A 3TRFA 1CXZA 2IF2A 3WP0A 4JLBA 1GIAA 5FBVB 3P4YA 4B32A 4OHZA 1FMLA 2PZFA 2ZJBA 3L0IB 1CJKC 1UM8A 2XNDA 2ZE8A 4BZQA 2JLXA 3U44B 3HPQA 3D6TB 2FNAA 3GFPA 3K1JA 4WXPA 4ZO4A 3QKSA 1UFQA 2A3RA 4GL2A 4D2IA 4WXRA 4KXFB 1OHHA 3MCAA 1X1RA 1TU4A 1M34E 2YC2C 2CCKA 4HDQB 5FOUA 1Z29A 1F2UA 5J5CA 3TNFA 4V0KA 4TLCA 2VF7A 4FW9A 3M0EA 5CDFE 4JVNA 3U7FB 1XEXA 3EZ6A 2IS2A 4WZAE 3MMPA 3PR1A 5BQ5A 1OFUX 1EWQA 3DL0A 4BECA 1L8QA 2DR3A 4NDZA 1ZD8A 1GL6A 2WSSA 4JL6A 3IGFA
chains in the Genus database with same CATH superfamily
4TMFA 2YZ7A 5I9SA 5LXTB 2FCRA 2OY0A 4AF8A 2VP2A 1E6WA 1JEEA 1B2LA 2JI4A 4BB9A 1BROA 4B34A 2HA5A 3DF7A 1HSOA 1NOKA 1GY8A 2ZIGA 3R7BA 3GLVA 4Z3DA 4RPGA 3QEAZ 2HQBA 5JARA 1JILA 1R6VA 1RMYA 1QH9A 2OBYA 1WBBA 3HB5X 3RRMA 2G8NA 1FUIA 2REOA 2FWMX 1POWA 4GKJB 2N1BA 5C0OE 3HCEA 2IEZA 3OKCA 4HGZA 1U2SA 4WECA 4WKCA 2Q7DA 4BB0A 1R9MA 3COJA 3IA2A 4J0FA 3KB1A 4PZYA 1MJNA 2GKSA 4ZAYA 3E82A 1UDAA 2B4YA 2IP4A 2O2XA 3TJRA 3VYTB 3E53A 3AY3A 5FTNA 4OHXA 2OP0A 3DOUA 2QR2A 1QNLA 4IMJB 3DOHA 5CYPA 4KWEA 5FA5A 4C4YA 5DOVA 1PTJC 1T5IA 3G8BA 4JJ8A 4EPYA 4ND7A 4JJ4A 4YP7A 3QM1A 3H8SA 4FM9A 1SVIA 4YTEA 3CRW1 1BJRE 1MT0A 2ORIA 2PGJA 1G63A 4IIDA 3K7EA 3EXEA 3KQPA 4R68A 3AI7A 4D8UA 2I2WA 2GCIA 3GJ6A 1HNWB 4YXWA 4PLZA 1N1DA 3UIEA 4IDNA 1CWUA 2CCGA 3RRYA 5JBIA 2C83A 4BBZA 1TW2A 1XZIA 1AHIA 5KC8A 1H2RS 1NVXQ 2JFHA 4DL9A 4N4AA 2XMBA 5IEJA 4TRRA 1IFXA 1Y4AE 2CFIA 3A2NA 2YMMA 4DQ0A 3CVXA 4ZJUA 1YJ5A 2PT9A 1FUKA 3DPSA 4G0MA 2FB9A 4MWOA 4ND1A 3SR3A 4DIMA 3JVVA 1N2HA 1WZ2A 3HK2A 4WUTA 1SCKA 4MVCA 3UOGA 4XEHA 1MOPA 4W9MC 2NSHA 3ER8A 3K72B 3L7YA 2H92A 3WJ7A 4RTOA 5DP2A 4DCTA 1JKMA 1D2NA 1AS3A 1YNOA 1G16A 4ER5A 5F1PA 4G5OA 5GV7A 4MITA 2Y1CA 1J0EA 3R4CA 4AZVA 4FYJA 3EXFA 3VR5A 2H18A 4X6LA 4CYMA 2HSGA 3IUMA 5KREA 4Z2AA 2CLSA 2VYCA 1H9CA 4HNAB 1AK1A 1LNZA 1PYOA 2JVIA 1NBAA 4MUAA 4U9UA 4MA5A 4L75A 4YRPA 3G0OA 5K01A 1R8SA 1JKIA 3U7RA 4L22A 4DARA 2AWOA 3TMKA 1C9YA 3BWBA 3RUAA 1JMVA 4DCMA 2H9IA 4JDUA 2XGGA 5ALWA 5IC5A 3NC4A 4LTNA 3MQFA 3EVZA 4J0CA 4Q1CA 1KOFA 1QJ4A 3DYIA 1GZ6A 2QM8A 3FPFA 4B4VA 2F1RA 1ULBA 3OOJA 4Y2XA 3I2FA 1UKYA 4NJMB 3P45A 4U1RA 2DLCX 4LY0A 3HTXA 4ZK6A 2GNAA 5AKZA 4HGYA 3M70A 2LD4A 5BPHA 3ZV7A 4CDGA 4S1OA 1ORDA 3ROXA 1FOEB 1NN3A 1FRFS 3D54D 2GN0A 4U2DA 3SDSA 3HXKA 1EMDA 3WWOA 1VCMA 4A03A 4DJJA 1BA2A 2PZGA 4JVSB 2PO7A 2EHJA 4A0RA 1KAMA 4ALNA 1THGA 2DH5A 3HYTA 5A4IS 4HJRA 3RIEA 1NBIA 3Q1LA 3RUCA 3DGFC 4EKNB 4CDMA 4PZEA 3GUYA 4D5GA 2QN9A 2QRKA 3P94A 1NF3A 2VYVD 4N0MA 4ROTA 1UBOS 5CYFA 4EP1A 3KL4A 1UJBA 1YK1A 4WSOA 5IJZA 4P36A 1A1VA 3NFRA 3M7IA 1GT91 3PTAA 3LDUA 3BQNB 3OTQA 3QA3E 3KPUA 4YA6A 2HN9A 5CVVA 1O95C 2PKYX 4EA9A 3D1VA 3H42B 1KVRA 4KPUA 4N9QA 5E9QA 5EKSA 5CT6A 4XVCA 1FYVA 2OLKA 2WJGA 4KC0A 1GAQA 4UAJA 1YBFA 3GCZA 1XTSA 1P2VA 3TL3A 2GFHA 3PPXA 3UN1A 4X66B 2DB3A 4DV1B 5KWIA 4HH4A 4WY8A 5EERA 2V4MA 5K0NA 3B3JA 2NSDA 4MW9A 3S3TA 4RJLA 2V6FA 3O4HA 1KYXA 1BN7A 1NNUA 3OQBA 1K7YA 4O2LA 1C1HA 2ZCUA 1YDFA 3ZGYA 2X41A 5AOBA 5JD6A 5I7SA 3MRVA 4NJMA 2OHXA 1Z2CA 4M4SA 4JNKA 3CR3C 2G63A 3M83A 5TT1A 3QVVA 3I8XA 2GN2A 2Y4NA 4S0XA 4W4TA 2BY4A 4KLRA 5EPOA 3KZVA 2ZULA 1Z2EA 2I33A 3LKZA 4S12A 3TVDA 3FHOA 4FLEA 2R1VB 1E6CA 2ZU0C 4IKEA 5H7XA 2CEKA 5K0GA 2HHJA 4AC9A 4G5YA 2VJQA 3KAJA 4I4LA 3FNHA 2IPLA 4LBVA 5HIJA 1YZVA 2JIDA 3C16C 2XCRB 3VR4H 2BIFA 3O82A 3G0DA 3JWIA 2Y6UA 5KBYA 1KI9A 1JXQA 3JQAA 3G9ZA 1J5EB 3R7FA 5FPHA 4AYWA 1ZM9A 5EJ8A 5JAIA 1SVLA 1XROA 3ONNA 5E6SB 3LG2A 1JHDA 1NQAO 2I6TA 2ZJ4A 1IMOA 5DU2A 3F9CA 3JASB 4WDQA 3ZWMA 5DT9A 2R00C 2O6LA 1KWGA 4I5DA 4O2BB 4Z9BA 1G98A 1L7NA 2IFTA 2V65A 3D4NA 5B7NA 1Z5GA 1G3QA 4L76A 4ARBA 2W5UA 2A88A 1PFQA 4P38A 4HOYA 4N3CA 1BHJA 2R7LA 5FQOA 1H0RA 1W2WB 2VS1A 3F90A 5FI0B 3ZI0A 3L02A 3JATB 5CFPA 2G36A 1RQNA 2IU3A 4U7WA 3DZHA 1NDHA 3F5SA 3ZK8A 1J7KA 2YWRA 4L0QA 1X7WB 3BS4A 5BSVA 3GBVA 5CD9A 3OSUA 3MINA 1U6KA 1X7ZB 3SYNA 4PWZA 3H9EO 4TV9A 2Q49A 1PG2A 5FNVF 1E3QA 1PRYA 1PSWA 3WYBA 1JAIA 2ZW9A 4IIEA 3MG9A 4MVJG 1UCFA 3EQ7A 5DX0A 3UXHA 4C4TA 1VPLA 6AT1A 5IASA 1UPBA 2Q1UA 3A4NA 4OIFA 4INJA 4CG3A 3GQBB 1OT5A 1W36C 1NNEA 1G42A 3N0VA 1E4YA 2ZOSA 5GJVC 3I6YA 1N5JA 3H2YA 3U3MA 2HNAA 3JQ6A 4LBZA 1GKLA 2ZIWB 2I7TA 1O94D 2E6KA 3K20A 3P9IA 3O03A 2FZEA 1L7RA 2BGTA 3FOFC 5EGSA 2VP4A 3KEMA 2VDRB 3AF4A 4HAIA 1W75A 3IXMA 4HDSA 5CCDA 5DTEA 1EFAA 2R8XA 4MWTA 2GA9A 3MK31 1FUYB 3KOWA 1ITZA 2V59A 2XD9A 4IKOA 5CAEA 3WGUA 1JSXA 1IEQA 1KNXA 4QJIA 2G04A 4WNYA 2Q3DA 2XA2A 1WE2A 4CN9A 2W8BA 4B3RB 2X7JA 5AVVA 4BN5A 4Q48A 3G9TA 4DIFA 1YZLA 1HDRA 3A27A 3DTVA 2YWHA 1AE1A 1D6SA 1MXFA 2OBBA 3EQZA 3PYXA 2XI4A 2Q2NA 3L41A 4D99A 2FPSA 3G7UA 4I4NA 5E3IA 3W5CA 2DQYA 4D57A 5CA0F 5CHYA 1D5WA 1DNPA 2GAJA 1MB0A 2Y0BA 3AI1A 3BH0A 5WRFA 3BHJA 4PZCA 2GHIA 5EYPB 2NU9B 3TQHA 4P3OA 3NHPA 4DYHA 1E2JA 4PQFA 4A8JC 5JS8A 4XWTA 2Y71A 3P9XA 4A6XA 1U0EA 1QZXA 1LFDB 4FKMA 4JN6B 2R44A 1TYAE 3TW8A 1R0YA 5FNZA 1ZM4A 3AEZA 4E46A 4N65A 3F1LA 3L06A 4P6VF 4EYSA 5C5EA 3EDCA 2NV0A 4BRWA 4DWJA 1ADBA 4I8DA 1XZHA 4UHBA 5JWRA 5AI8A 2IS4A 1NBWB 3RIHA 2A5FA 1PTKA 4PQYA 2GETA 1OOEA 4HV4A 3N6RA 2R62A 5K0ZA 3NVKI 4FYVA 2G0NA 4OMUA 1FDTA 5BNFA 2HYDA 4GM0A 1LF0A 1R8JA 4HPXB 4F3CA 1BXRA 3ESDA 3ND9A 1DB3A 4IH1A 4AN4A 4I81A 5ALVA 3OKFA 4H7JA 4NESA 3QUSA 1Z63A 4GBMA 1E1DA 4MO2A 1C2TA 1X7XA 1A77A 3REOA 5HKOA 4CWAA 2O52A 3N2NA 1NASA 4FHDA 1RYEA 1ZO8A 4L4XA 3AVUA 1QOQB 4OB8A 1SUCA 2PUHA 1JMKC 3V1TC 3GX1A 1Z6YA 3JQFC 3RYHB 4DCCA 1Z0SA 1NM5C 1EQUA 1CX9B 1U04A 2GMWA 3DV0B 3LZCA 3MC1A 3AV0B 3R40A 4YT2A 1NX6A 1KSHA 2VI5A 3K0AA 3PV0A 3RQIA 2VDNB 3GARA 1WB5A 1ZWKA 2QBYA 4TL6A 3JWHA 2O50A 3K31A 3RTGA 3QVGA 2IDZA 1RXCA 1I7DA 2JANA 3QX9A 5F7OA 4F72A 2GCEA 1KO5A 3KE8A 3IKJA 3QLVC 3IQHX 2BE9A 2OGUA 4RFVA 2F3SA 2VBGA 5FOWA 4AN1A 1DEHA 3II6X 3BRCA 2FW1A 3EMVA 4KAFA 1PJ3A 3HR4A 1D6MA 3FDJA 3T9BA 2VUIB 5B1YA 3KKNA 4H7KA 1NVFA 1TD9A 3ZHVA 1G9XA 1HYEA 1Q5PA 2O4UX 3AU8A 1MGPA 3KJEA 3OQIA 4M7RA 4O4HF 1X1EA 3UXYA 4AP9A 5BORA 3MW8A 1HGXA 3PKJA 4FE3A 2ZYAA 4IVNA 3FMPB 1U99A 4MARA 3VKUA 2C3PA 3UJ3X 3IJPA 2CHFA 4IQ0A 5GTDA 1TYDE 3G5AA 3GD5A 2XVXA 2UZ4A 3U19A 3IEVA 1CHDA 3FVTA 1E5DA 2X23A 1YS2X 5FV7A 4Q03A 1BIFA 1RRGA 3LC7O 2I71A 3KXLA 4YRDA 3VJKA 3DBLA 1A7UA 3VYWA 4YYZA 4V1CI 2RKBA 1MABA 4BB5A 3CIFA 3GFOA 2NOAA 1AF4A 1MB9A 2H0AA 1XTTA 2C9OA 2FLKA 4NFLA 1SQ5A 4DUGA 3OTOB 4UTXA 1DC7A 3BMXA 4X95A 2Q3LA 1GN9A 5BR7A 3V8MA 1KPIA 2ZYVX 5CBPA 2O8DB 2PWPA 3VOBA 1E89A 1FCJA 1A5AB 2X3FA 3G5TA 4GQIA 4K88A 5CHEA 1SUBA 3GR6A 3TZ6A 3LUJA 3WGMA 1NXTA 1D07A 3IALA 2H4ZA 4R9NA 1RM0A 2O1EA 2W37A 1QVAA 3EH1A 3IDAA 3UG6A 3P27A 4QC2A 1JSLA 3CNQS 3DHYA 5AW1A 5EP1A 3RK4A 3OFSA 1I4TD 1M1ZA 3RSCA 2G6TA 1XTIA 2AFVA 4HZUB 4BWFB 4O4JB 3I5UA 4U0JA 3USES 1VQ1A 5EJMA 4GYYA 4MW5A 3KQYA 2YZNA 3O7WA 4DAOA 3D6VA 2IXGA 1GQFA 1E3WB 5FPQA 5EP4A 1Z8FA 2OZKA 4GDFA 5JDCC 2C03A 1PNQA 5A7GA 1Y1RA 2CJWB 2F8MA 2XBUA 1U0NA 2ZPUA 3RDPA 5FRDA 3ZLUA 5DCUA 2AN9A 3H8WA 4DLVA 4CHGA 4KGZA 1RLMA 1P72A 1QBGA 5KYVA 4JVLA 2JFUA 4RBNA 1ZMTA 3PC6A 1CJSA 4BO3A 1DC3A 2UVPA 3P71T 4CM8A 2IOQA 2QTNA 1KBZA 4XB2A 4C01A 4TXHA 2AUMA 2CD9A 4C88A 3DBLB 2FPIB 4ZJYA 2BZGA 1IRIA 2YIMA 3N7AA 1RQ7A 3QV1A 2CDRA 4NPCA 1GO2A 2WJWA 2WHEA 3OO1A 3ECSA 4DLWA 3CW8X 4ZV7A 4KAJA 1BWQA 1SBIA 3OCCA 3I1YA 1JTEA 2O2IA 2PH3A 3LRPA 4ZEWA 1ECPA 1PEYA 2GBLC 3BK1A 3D4PA 4EIWA 3R9WA 4LDNA 2G40A 3H5VA 2VEOA 2GXQA 4PNPA 3T1HB 3SAJA 3T7JA 3RF6A 2YL2A 4TKVA 1MEJA 2NMVA 2TS1A 1BMFA 4Q4CA 2IKSA 4J9UE 4KLZA 2XGJA 2BDEA 1BQEA 1OB5A 2XMRA 1FFGA 1W5TA 2ZYHA 1WRBA 2BOVA 1GKUB 2W6PA 1M34B 3UMVA 2YYAA 1CKEA 1MRNA 2AOUA 2DECA 3AHJA 4H7EA 5G0SA 1T9BA 3ELUA 1W59A 4F2PA 1R0KA 5JECA 2IHVA 2OUKA 4EMSA 4PTYA 5GGXA 4BQOA 1WULS 3RS4A 4EW6A 3P9SA 1FNCA 1M0TA 5CW1A 3VNVA 1FJ2A 4HVLA 3IOYA 1J0AA 2HX1A 3DFFA 3MUNA 1Z8HA 3I01A 1CYEA 4PINA 1P29A 4PXSA 3EPRA 2B30A 1ZD1A 1QGAA 4GD3Q 1P2DA 4XJTA 1MFZA 4GZ5A 4OB7A 5AD1A 4G63A 5B6JA 1LGYA 1QRRA 4Z7JA 2NUBA 5J2TF 4U7DA 5ILQA 3IUEA 3R5FA 5F3WB 4IJQA 2PCLA 4BRUA 3NOVA 3CINA 4K6MA 3DPIA 3OOSA 5EZYA 4TGLA 2VNJA 3PGKA 1O7JA 3CWCA 3LJKA 2RHMA 2XMQA 3M9LA 5I4KA 4NE7A 4PHFA 1U9IA 4MRSA 4EELA 1BMFD 1CD5A 4GPBA 3UH1A 4EEZA 3MOIA 4EMBA 1GZ5A 4R2MA 3QU2A 3T3GA 2CHVA 3LXRA 2J3MA 4XYEA 2NPFA 1Y81A 4ESVA 1XDUA 1L7OA 4IOMA 1GSIA 3DXYA 5DI3A 1EZ4A 3AESA 5AHKA 4L9WA 5ANRB 5JNSA 1DO0A 3VTKA 1TNDA 1DTWB 4D9BA 4HB3A 3EWIA 1I9GA 4RK5A 2X19A 1W4AA 3B38A 3UMCA 1RE0A 3LCJA 4HZGA 5JADA 4KH1A 4LJYA 5EPEA 4TMKA 1P0MA 2D2IA 2P9EA 4JJKA 1MA3A 5PNTA 4MA0A 3NMUF 3CEMA 2FEXA 4PYJA 3IAM1 4RZUA 4JXZA 4LZNA 4AL4A 1H1TA 4F2DA 4BASA 8AT1A 5CA0A 4XPZA 5C32A 5FL7A 2C31A 3KQNA 3BTVA 5AI4A 2FEOA 3WK8A 1L4FA 3HA3A 2R6HA 4NONA 3TNYA 2IY7A 3CNBA 4Q01A 3SLRA 1TK3A 5DNCA 4LK2A 4US0R 2F4VB 5JSZB 3VZDA 2A14A 3CZCA 3IBYA 2BUCA 4NEGA 5FP0A 1ZSYA 2HT1A 3PG5A 4QX6A 3OZSA 5SZJA 3C3WA 4BNKA 4D44A 4MEJA 4S1TA 3P0HA 3B2EA 1T29A 3EZGA 3D0OA 3F7OA 1HFEL 3HS3A 4AFNA 2Q9AA 2E48A 2X77A 3BMNA 4NCNA 4CGYA 3NALA 4GICA 2PX3A 2QVGA 2YVQA 4URUR 2E82A 2QV7A 4OSOA 3ROTA 1JAHA 4V24A 3PPYA 5CM8B 3TLKA 4JY7A 5HOEA 3AERA 1NNSA 1J0BA 3ME5A 4RNCA 3W7BA 4CG0A 1XPOA 4PHGA 3D3KA 1YZTA 1E9BA 3R8FA 1IXKA 1NQTA 1WZCA 4EBBA 4O4IF 4MGZR 4XWGA 4OGKA 2HHAA 2J07A 2R7MA 2QD5A 4W1RA 3R0QA 4UQLA 2HV9A 3JD4A 3NHJA 4TTQA 5AW2A 1RAAA 1X7ZA 1GWNA 1Q0RA 4XB6B 3TOXA 5A62A 5TQJA 3UJ8A 1J4AA 1HQCA 4QHSA 1M2NA 2H06A 1C5KA 1M74A 2AJTA 1D0SA 4Q37A 1Q1AA 3AZPA 4Q1EA 2C7VA 1BVYF 4LG1A 1KFKB 4IEEA 4POAA 1Y8ZA 2BGGA 1U1IA 3N2GA 5B1HA 5ILOA 4ISBA 3EGXB 1NV8A 2JCVA 3WX0A 1NZFA 4AXXA 4YPOA 4C0JA 1UUFA 5IWAB 2P6OA 5L4NA 3DB2A 1ZW1A 3NTRA 3QENA 4WLUA 3T7CA 4CQMA 3CB2A 2VYNA 4X7BA 3HKBB 5SYAA 3D02A 3INTA 4KGVA 3SIRA 1R1DA 2ZWPA 2ACWA 2ONYA 2NVWA 3GXBA 4YAOA 3RU7A 2QN3A 1ZX1A 2OOKA 1VBKA 3O1IC 3HCRA 2XQKA 4JR0A 4ZYWA 3HWX1 1G18A 2GI4A 1SZPA 2XWBF 2YOGA 4JLKA 4Y2JA 4GOJA 5ESXA 1R0CA 4YFYA 4LSZA 1ONPA 1SUIA 3K6KA 1IMJA 2C0CA 2ZIXB 4DIKA 2LCFA 3JZMA 4V0LA 1EDBA 1NYTA 3S7TA 3QW4B 1T1JA 5CA1A 5JH7F 2XXAB 3PUIA 4X5OA 1N7JA 3ZLTA 4CMAA 4LV8B 3E3AA 4I2VA 4D3FA 3C4JA 1ZUHA 5K6AC 2IYYA 3CPEA 1EINA 2ZBDA 4Q3AA 2GPBA 3V9AA 2C9ZA 4DA4A 4ND8B 1BMDA 1Q21A 2K2WA 1R7RA 5AVOA 4FNGA 4FZJA 3FYDA 1QTIA 3U4AA 1XA4A 2C4VA 3IYLW 3AGQA 1QKIA 2PHZA 2QTFA 2W6QA 3WYDA 3J81A 3KZNA 1YHYA 1OYWA 2PJDA 3PFFA 4MRMB 3D7LA 4TL8A 3EIUA 4JP1A 2JNWA 3E9ZA 3LLUA 5IH3A 5HIKA 1E18A 2Z5GA 3OY7A 2VBIA 1AD2A 4M9ZA 4PZZA 1V5FA 2NSLA 1YQTA 2ZJFA 4PX3A 1YA8A 1FDIA 4WPGA 3SEAA 4CM5A 2Q28A 5L3QA 1G5FA 4DSUA 1TUBA 1JQ5A 1HYBA 1M66A 3A58B 4DQKA 5EJ6A 2POCA 3HMQA 3AF0A 3PD1A 4ND2A 5DYWA 4NE2A 2AYXA 4LJ5A 4D3YA 4QPNA 1BGVA 2NZYA 4MYCA 1Z45A 5CX4A 3ZR4B 1KJNA 1N1GA 2Q5EA 2QXUA 3DC7A 1S9DA 3ESYA 1VKJA 2IVZA 5BN4B 1Q0LA 1H2XA 4IIGA 2BZ1A 2UU9B 2VTEA 1AKEA 4YRLA 1PWYE 2HSEA 4TTIA 3STUA 1CRLA 1N2ZA 1USUA 3EZXA 4M1SA 3EEQA 1V45E 4IDEA 1NU6A 1XNHA 5E7MA 3C24A 3RSSA 3VSDA 3W2EA 4DSZA 5JJCA 3S1SA 5DNUA 4KN6A 3AUJB 1O95A 4CNBA 5JCJD 2NPIA 5C7IO 5I7HA 3TGWA 3GMTA 1G21B 5AW6A 4Y2GA 1KFEB 4R1SA 1TM4E 4HDOB 4MKXA 1GCIA 1JR3D 2O8FA 1E2LA 2OE2A 4EDFA 5IAGA 1MRZA 1T13A 4KKVA 3KT0A 1CUSA 1A69A 3O0TA 4URXR 1ZHFA 3DW1X 2Q6KA 1JXMA 1V37A 2VC2B 4UJ5A 5BYKA 1L5VA 2G9VA 4LF7B 4UXIA 1S2LA 4IXWA 2F1JA 4RSMA 1Z16A 5HIAA 4BP3A 1N0WA 4LXQA 2VWGA 4B3FX 2OFFA 5DZSA 1H9AA 3ZWQA 4KPUB 1O94A 4OL0A 2PZAA 2CV0A 4X6UA 3KHUA 2J3LA 1NXQA 1QIFA 1KK2A 4R98A 3ZDDA 4FZ5A 4V0SA 3QOFA 5EIAA 5LBIA 4ZOQI 3T41A 5JTUA 4LJAA 2XYPA 4P7KA 4COOA 3JAKB 4CZ2A 1LDMA 3F3KA 4EFKA 2GPJA 4GR5A 4CRWB 1XWIA 1E3MA 3CUEF 3ENKA 1ZVVA 1HTTA 1LQUA 4J6EA 1SHKA 2A4MA 3B1KA 4WXMA 2ZQ5A 2PTGA 2X8JA 2XYQA 1N8SA 3CG0A 3KHSA 4HNSA 3U3DA 3HH8A 2CEAA 4K5QA 3DBOB 3DUWA 1TPZA 5BOVA 4BX0A 4CM1A 2J9ZB 4KQEA 2GB4A 3D6JA 5GMOA 1KY5A 1N2OA 2QSZA 2JAXA 2JZCA 4FKZA 4GPD1 1XMPA 4NHOA 4C6RA 3CN9A 1WDMA 1CQXA 1N6HA 1F2TB 3AONB 4NDAA 2WUVA 1B15A 3GFTA 2VZ9A 5P8WA 4UM9B 4U2EA 1XK7A 2CZGA 2RFLA 3R0VA 3UK0A 3IP1A 1HUQA 3RS0A 5KDDA 3VV2A 3X1WA 3MFQA 1UM9A 3L18A 4NWIA 1XCPA 1XN1A 3DBRA 2GBGA 5BV1A 3EZYA 4M1MA 5AK0A 1WDWB 1P4SA 1VB5A 4WVLA 1DAOA 2GZDA 3EY9A 4Y2YA 3RT1A 4K05A 4U4AA 2GASA 1FNSA 2QNIA 2WM3A 4HLUA 4KXXA 1YJQA 2EBHX 2OC4A 4KREA 3I5XA 4IV0A 2FWJA 4EUFA 4KQWA 4PV7A 5C37A 1MNQA 4GBJA 2X40A 4RCYA 5EJAA 5GQSA 3CNLA 1E8DA 4C89A 4AJPA 4TPKA 1CUXA 8ABPA 1VYHA 3DOOA 3ZWNA 3UHFA 2R87A 4Q47A 3V1YA 3A6DA 4CTNA 2P4EA 3I64A 5FT9A 1MJHA 1M9NA 3KLMX 3TUIC 3CLRD 4CL3A 3GP8A 5TIIA 1JEYB 3IQWA 5B36A 1XCGB 3LHFA 4N41A 4NZPA 4ZVOA 2MYTA 3GPDG 1D9XA 3R8XA 5CD1A 1R4MA 1NN0A 2Q3CA 3BMCB 4JJ6A 3RC1A 2WD8A 4PZPA 4AECA 4FDUA 4BVHA 1O77A 16PKA 1V43A 2XTZA 1XMQB 1Y9ZA 4DMLA 1J07A 3PX7A 2W48A 1WMFA 3CLSD 3EIXA 2FJ0A 3ZOZA 10MHA 4IHJB 4PBRA 4CM4B 5BWLA 1T2UA 4FSDA 5DN9A 5I7WA 4ES6A 4GSKA 4XQCA 3HC7A 1W85B 2AC7A 3NHSA 3Q72A 4W5JA 3EXIA 5GJCA 5HQ3A 5FV4A 3HNRA 4OP1A 1C50A 3I9V1 4B3MB 1G5PA 4HRAA 4ESHA 2HEGA 3F6SA 4W6ZA 3GNQA 4M7WA 3T12A 2AX4A 3M49A 1V1RB 4RV9A 1E8NA 1V9CA 1E3DA 5HW0A 3UAGA 2P1RA 2Q4EA 2IITA 4HAXA 4QLAA 2R6JA 1IOLA 1QH8A 1QZ3A 3HXLA 1GILA 4P22A 1XZAA 2C78A 2JJ1A 4EPVA 1PDWA 2QXTA 3CONA 2PSHA 3WLOA 4LV5B 4OB6A 2D0PB 3JQPA 5JS6A 3ESQA 2ZCJA 1DHTA 1ZK4A 2KHZA 2QW0X 5FUXA 3DP7A 3OE7D 3S0JA 1V9SA 1ZNQO 2QIPA 2EQBA 1AHHA 3CN7A 4ZVSA 3ZEIA 4AX8A 2H2HA 4C14A 1XJQA 4OYRA 4MR9B 4GKAA 1EP1B 4CM9A 3SQXA 3OC6A 1RXWA 1DRVA 1GTZA 3TLAA 2VDWB 5BV2P 1W4CA 2HMSA 2RGDA 2AG5A 1E61A 4MV9A 3ICQB 1KXZA 1KS2A 3A1NA 1AN9A 2VQ3A 1ZICA 3O8QB 4BTVA 5CDUA 3K5WA 2PWYA 1GPBA 1YB2A 4BKRA 2UZ0A 1QBKC 2F9MA 3OOHA 3CUTA 3PXXA 5KNDD 3GT3A 1EAYA 1GTVA 5DXAA 5F76A 2Z0MA 1GAJA 2ZKLA 3L6RA 3LM8A 3D3JA 2JJMA 3D7RA 5DMXA 4DA7A 1H2HA 2OM2A 5JQGB 1BCSB 1WMAA 2A33A 2X1LA 1VL6A 1OBCA 1B4DA 1VBFA 1SU7A 2IL1A 3C7DB 3QLUC 2Q9BA 2CK3A 4WNAA 2ZJ2A 4WLEA 5EWJB 5H81A 3U4CA 4E1AA 4QU8A 3U4MA 4RLSA 2G0AA 4ZVUA 4ZK2A 2D5AA 2ZTHA 5TC4A 2ABWA 1T3ZA 2F00A 2FVXA 4NKRA 4M36A 5EL0A 4TS3A 4DMUB 1RWNA 3RYIB 2FWAA 5LWHA 5THXA 3OOWA 3CUSA 5TY0A 4WUVA 3FTEA 1UWCA 3TSAA 1O0SA 2WI8A 3ZVLA 4RVFA 4B80A 3H5TA 3EGOA 4LJ6A 1C8KA 4BVFA 4F4FA 3A7DA 3K8OE 4XCVA 1E5VA 1GU0A 1UMKA 2QOEA 4TMVA 5LCXA 4UQOA 4X8MA 5H4HA 3UWOA 2PUGA 3I9KA 4H1TA 1YIAA 1I01A 1U8XX 2FN8A 2HREA 3H2GA 3L1JA 4GMFA 3HGQA 4YLEA 3VYUB 4NXMB 2Q4RA 4RXMA 1P4RA 1JF8A 3RWBA 4CM7A 3D3WA 4NZMA 3VR5H 3UTCA 4C2TA 3DFMA 1DWQA 2B4KA 1QO9A 2EWVA 2WWIA 3DZ8A 1T2NA 1FDWA 4XSHA 4BJ1A 5TMPA 1FZQA 4DV5B 3M9XA 2PR7A 3D2AA 1VECA 5JSZA 4G0VA 3HLTA 1XQWA 3IP9A 1S2IA 2P3QA 4NC9A 1Y5MA 5EKDA 2Z3ZA 3CNHA 3FA2A 3NAZA 4F8YA 4KITB 5ITWA 2GCOA 1NVEA 1ONNA 2OGZA 3HR8A 3N5CA 5F4BA 3EG5A 4M83A 5KWJA 2B8WA 3GFFA 2ZJAA 2ZI9A 1KVUA 3ZE8A 1D4ZA 3K1YA 1LPMA 2XDYA 2C95A 1TAUA 3RIYA 4BBPA 2QMHA 3K15A 3EQ6A 4Q1AA 4QAJA 1YRWA 3KWFA 4Z3KA 2JLYA 4PW0A 2F48A 4XVUA 2YXPX 1J9GA 1N7GA 2JFVA 2CLKB 3L6DA 2VATA 4GBED 3UA4A 5JH7A 3HJHA 1V16A 1LV8A 3OBIA 1D2MA 4HD8A 4BNYA 1HO3A 4BWVA 5L95A 1LB1B 5JAHA 2IE0A 5JO9A 3PXEA 4B4OA 4G24A 4KQXA 3EZ7A 4EVIA 1R5BA 4LHVA 1W6UA 3P0JA 5AOVA 4EB6B 3I2KA 3OEHA 4HN4B 4MS1B 4WKPA 2IV3A 2FP4A 4EPRA 3HLKA 5KSPA 3STWA 1DUIA 4O5OA 4DYVA 1WOYA 3AG6A 2IY9A 1Y4SA 3EUEA 4XTRA 4WBSA 3ROGA 1E99A 2P40A 4RMHA 4LF4B 3O38A 3H1PA 4CMEA 1KQPA 5E0KB 5G1OA 4BIMA 4J4BA 4D9MA 1FNDA 4TLBA 5DX8A 1GA1A 2QDKA 5KX5A 4UATA 4RHTA 4J0JA 1SULA 1YTUA 4NABA 3MLBA 4G0QA 1H2ZA 1XB2A 1EK0A 1NV9A 3S68A 1UZUA 3C6KA 3QPAA 4O4LF 5THKA 5EXDA 1M76A 4CXMA 1BRMA 4QQNA 3OPNA 3DC2A 5LKRA 3MB5A 1PGQA 2Y76A 4UU8A 4WCFA 1XTQA 5F64A 4B3BA 1JPNA 2PRIA 4OQLA 2I8CA 2C9YA 1T5HX 5DTRA 3DFKA 4Y2SA 5HBRA 1B0AA 3MJ4A 1JTFA 5KMGA 2XJ9A 3DW3X 5DW3A 1EWYA 2HK7A 4EX6A 3G2MA 2DFNA 4FE4A 2AOXA 3CMCO 4TTSA 4QRHA 3GJ3A 1GZ4A 1Z6TA 1IDN1 2QYOA 3E8XA 2BGJA 1CJUC 1P2UA 4A5OA 2HYIC 2J7PD 2J9XB 4I19A 4Q9DA 3RVOA 3LTNC 1UOPA 1DSSG 1RKXA 2A9PA 3GV0A 3GL9A 4UZFA 1S0UA 3NVAA 4TYYA 2QZ4A 3H1FA 4GOND 4HMPA 2P7IA 5KJEA 1XVVA 5JWOA 1U8YA 4B84A 4ZAZA 4N39A 1F1JA 1WDTA 3K32A 4CLRB 2ONKA 3C43A 1AOXA 3OQVA 4KYVA 4KZKA 9MHTA 1P5FA 1HKHA 1OAOA 4WDRA 3UC5A 2H1SA 1A3CA 1KKLA 3G2KA 5JRJA 3OJLA 4TWZA 3KNZA 3TTYA 1ZC3A 1I24A 2OYSA 4MR7A 1LC3A 1YHZA 3ETCA 3X2FA 1Z4PX 3MJDA 2V0CA 4K03A 2VPPA 1O97C 2G6BA 2V3VA 3TAXA 1B26A 2WWVD 4WADA 5B2FA 2VAVA 1C8LA 2P75A 4P34A 4YP5A 3ZHSA 4CCWA 4H7HA 3ZNNA 4Q3NA 4GGPA 3B1ZA 4TYPA 3PENA 3WHLA 2NO1A 1OBFO 3JQGA 4O4HB 4Q0MA 3DR5A 1CUBA 1A98A 1J2TA 2I2DA 4NU5A 1YR3A 1ISFA 2FRDC 3HLYA 3PHGA 4UAGA 4WX2B 3W34A 5A03A 1ZIDA 1SK9A 3CKKA 4E6EA 2OESA 1OX6A 4FFBB 4WMLA 3U1VA 1YQWA 2EKDA 1NUTA 4M1EA 1FQJA 2QVLA 1WPRA 1IAQA 1DV1A 4MCHA 3E6AA 5CGQB 2PJRA 4JB8A 2YXNA 2ZI7A 3HUEA 1DC5A 1HLFA 2EC5A 4FEAA 1JIXA 3QFCA 1LQ2A 1SEVA 3Q2KA 4R2IA 2CBXA 2C77A 4ZCPA 4I5IA 5CVEA 5CU7A 4PZUA 4UU1A 1XUOA 3RVKA 1GQOA 5JSFA 3QSYA 2ZE6A 3IMKA 3U60B 3WQHA 1K8ZB 4JGIA 2BEVB 3AU9A 2WJ4A 1UPCA 5B4VA 2G25A 4W1SA 2ZM5A 3DDHA 1XNQB 1KK1A 2RK6A 3ZW7A 4LQ4A 3A9CA 3HJNA 2FH5B 4QVKA 3ZH2A 2B0JA 4RMNA 4BLPA 2H52A 1VZ3A 3DBIA 4QU0A 3FF1A 1XTBA 1EIZA 2ONZA 5D86A 4CLDA 1Q0UA 1NMEA 2WG2A 4KTVE 5FBLB 5DHAA 3V8BA 1MC1A 4YBZA 1G66A 2F7SA 2ZE7A 3CKMA 3HE3A 4D81A 1RYHA 3WHKA 2A7QA 3D0QA 4M0CA 4PFSA 1U3UA 2WNHA 3WFIA 3NIGB 3U5TA 1PQWA 3KP1A 4R81A 4YDHB 2ZK7A 4FT2A 4RPHA 1EHIA 3E3MA 3WGLA 4I08A 3AUYA 5KSWB 3UBTA 4UEJA 3H5RA 4HB2A 2XCTB 1VSQA 4KXUA 4L5AA 3IP3A 4B6EA 3I9MA 4Y1FA 3KOMA 1R9JA 4NMMA 2A67A 4G1VA 1F0NA 1THMA 1NUQA 1X38A 2F3QA 3HPRA 1NXVA 3EUFA 2XOXA 1IB0A 4HTFB 2E1RA 1PW5A 3A25A 3ZBQA 4AMGA 2QDXA 1XZEA 4B85A 1XKQA 2EATA 2DWOA 4CQNA 3EGIA 3C4VA 4ZVRA 1ZEJA 3BRQA 3LF1A 4FHFA 4O6VA 5F52A 4Z54A 2PYIA 4ZT3A 3IULA 1QIEA 1DAFA 1YK0A 1G6Q1 3ZUGA 4LMPA 3LZ6A 2Z2IA 4JXJA 3N0RA 4BC1A 2I2AA 1QX3A 5ITSA 2WYHA 4XQ9A 3VHXB 1FXSA 1GAEO 2WF8A 1BD3A 1ZKDA 1C7IA 2H7YA 4K28A 3VPHA 1EGMB 1ZGCA 2JGKA 1M67A 1ZIOA 2VLIA 3SLGA 3ZIAA 1C30A 1PQPA 4RANA 1A2QA 4DMMA 2QAIA 3RU9A 1UKBA 2HMYB 4HQ6A 5C34B 3K05A 5LDHA 3T5BA 3PE4A 1UBTS 1B3RA 3OBBA 3R3SA 4LWOA 3X1YA 1C1DB 3KD3A 3MERA 4R2LA 2HHLA 3PHJA 4FJ0A 1SU6A 3NEAA 2WNSA 3K8YA 1FFBA 3NETA 5EMMA 4E5DA 3A9TA 4YS6A 3UW3A 1EFDN 1ZSNA 3ESCA 4BMNA 3GMSA 5IDXA 5LQUA 2IEAA 1SXJE 1JWLA 5LDDC 1DADA 1P1HA 1Q92A 2WSLA 3CRVA 3GLGB 1U9YA 3FDXA 1NC3A 1SOUA 1YGPA 5C8DA 5HWSA 5KYUB 4DANA 1KH3A 2AXNA 3PC8A 2HDHA 5BT9A 3WP1B 3WYGA 2GJAA 3AF3A 3DV2A 1G4AE 3CSDA 3HWWA 1Z6GA 3QW2A 4FMDF 3HBMA 1UXJA 3AVVA 4A73A 1DZIA 1Z74A 2YC4C 3R7DA 1NFQA 2QMZA 4XLTA 1BX3A 3PDIA 1ZRMA 3ASZA 3UJAA 1W4LA 2HU5A 2H17A 3FRIA 2ACKA 3H3JA 1E0DA 4ZAFA 1MC5A 2DYKA 4JMLA 1BJKA 1TI7A 1IJFA