4BRWA

Crystal structure of the yeast dhh1-pat1 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVDEFMDKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Yeast Dhh1-Pat1 Complex Reveals How Dhh1 Engages Pat1, Edc3 and RNA in Mutually Exclusive Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DHH1
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA02
3PENA 4PAQA 4ZO4A 1J8MF 1UM8A 2BIFA 2FEMA 2QY9A 4KLNA 3Q72A 1EFTA 1P7CA 3PVSA 1IBRA 3LNCA 3QENA 4GMXA 5C18A 2G1JA 4BASA 2AWOA 1WMSA 3UATA 4QGFA 3QKRA 4AIIA 4ESHA 1X86B 2ZE5A 3UANA 3V9PA 5EJEA 3OAAA 3DEFA 4TTPA 4MRVA 3WMFA 2MSEB 4PX9A 3AVQA 5FOWA 4C0SA 4CZ2A 2ERXA 4NYIQ 2A9KA 4QBIA 1XNJA 4Q4AB 2NZJA 3BAFA 1FMJA 1GNRA 2IA5A 2KE5A 4MITA 4R9UC 3CR7A 2BOVA 1KI6A 3EASA 3KJIA 3CRMA 4JT4A 1SVSA 2CNWD 2A78A 1E9BA 3JZMA 4B6FA 4A82A 1XB2A 2PX3A 3BE4A 1W36B 1TF7A 3ZD7A 4TMVA 3VR3A 3UXMA 1CKEA 2FFHA 1SVLA 2ODBA 4TQAA 4RD1A 5HCIA 1Y63A 1O3YA 1OHHA 5GADl 3VFDA 1II8A 2IHYA 4QFMA 2J1LA 1W0JA 1CS4C 3WY9A 3LLMA 2Z4SA 2X1VA 4RSGA 1EFUA 3BIFA 4OK6A 2RMKA 3KTAB 1G18A 2J5XA 3IPXA 3AUXA 2WKQA 4H1UA 4B3DA 5ELXA 1NY6A 3M1IA 1HUQA 4LHYA 2V7QD 3Q5DA 4UNSA 5HZKA 1J99A 3KFVA 1D9ZA 2PZFA 4TQUS 4XVUA 2BBWA 5EXXA 3THOA 5KSYA 4ZCMA 1NVWQ 3U44A 1N6LA 1IONA 4DDUA 3BWDD 3HR8A 1R7RA 1U2RA 421PA 1R10A 5CLQA 1W0KD 1JECA 3WNCA 1CU1A 1QDEA 2ATVA 4HB0A 1TQ2A 3I3SR 2OXRA 3HR7A 2AR7A 2QPAA 1G41A 2GXQA 5AJXA 3EPKA 1M1YE 1MT0A 1HYQA 2QPOA 2ZRPA 3CR8A 1BH2A 1QHXA 2O8EA 1Q57A 1ESNA 3GLHB 4MRSA 4PXAA 3MJRA 3F8TA 2IXGA 3OIUA 4LV5B 5AWFC 4RKEA 1A2KC 3EZ9A 1ZRHA 5G41A 4JIMA 1FP6A 2GXSA 4A2QA 2GF9A 4JLKA 1OFUX 4TYQA 1JJVA 2DHRA 1DAHA 1LW7A 4JSTA 4OQNA 3U60B 4XH9B 2VYFA 2WAYA 2CJWA 1XXHA 2D7DA 5CYOA 3AH8A 3THYA 4OJQA 3TVDA 1R0YA 5FOTA 2ZI4A 5TY0A 2WMNB 1W4BA 3LY5A 3P1JA 4A0GA 1GSIA 3ZS8A 4Q47A 3K09A 2C98A 3AQ4A 2F1RA 2FFQA 1UJ2A 4IJMA 2WPDD 2ZJYA 3QQ5A 4NZYA 1RRGA 2RH5A 2VLIA 3F3YA 1DELA 4A0HA 3Q7QA 2Q0HA 1FOEB 2CJWB 2ZVQX 1JEDA 3D3QA 1M6NA 3EXAA 2O8DA 2V6JA 2GXAA 4L9SA 1XJCA 2CK3D 1VHLA 4D0NA 3THWB 1E9CA 5K8TA 5FL3A 1B23P 3KKQA 2AKAB 1UKVY 1GWNA 2ZJAA 5AJYA 1NKTA 1VG0B 1ZUIA 1K6MA 2VP2A 2WM9B 3SZRA 2IUSA 3ADDA 1XEXA 2IYTA 1KKLA 2ZAMA 2PZEA 3TUIC 4R2IA 1V5WA 5C46F 3B1WA 1P72A 5G3ZA 2WWHA 3H1TA 1G3RA 3CRW1 4LC0A 5L8VA 4DLRA 2CHVA 1VG1A 1XZQA 4PO1A 2W2TA 3IIMA 2N46A 2YWGA 3EAQA 4UKDA 3B2EA 4D0LB 3PFIA 2G0TA 5C4GB 3SFVA 2WWFA 1YU9A 2J45A 2FX3A 1RZ3A 4W5HA 2IUUA 4NYJR 1IAQA 5HKKA 3IO3A 4ZKDA 4JVMA 4BUJA 4ASUA 4GI7A 2HJGA 3TSZA 1QZXA 1SVIA 4NKRA 2X77A 4IKEA 4DDTA 3FHOA 4PPFA 1OH5A 4OYHA 1Z6YA 1K5GA 1ZU5A 2LKDA 3SJBA 5IF9A 3I1FA 1R5NA 2QBYA 1RRPA 5JMTA 1XX6A 2GVZC 3CPHA 2WAXA 3QPUA 4EPYA 1NJFA 2QT0A 4H1VA 1P61B 1U9IA 3EG5A 5FUYA 5JSZB 4RY2A 4LPSA 5KNBA 2ZU6A 1AJEA 5CJPA 1NIPA 3WNBA 1VCNA 1YE8A 1EX7A 3K70D 4M8NE 4TLDA 3PJRA 1ESMA 2GRJA 3KTAA 4V03A 4KJZA 3A6PC 1EX6A 1P2SA 5KU1A 4Q9KA 3X1XA 2R2AA 1XD8A 2QAGC 1T6NA 2QMHA 2YWFA 4A4DA 1Z0IA 1M7BA 3Q9LA 3U2QA 1EXMA 4A6PA 3GLIA 2QBYB 5DYGA 2B8WA 2ZRCA 2IT1A 2F1HA 3MWLA 5GJBA 4Q03A 4QJ5A 2XXAA 1J2JA 1Z0AA 2R9VA 1T0HB 2XNDA 4V0OA 4AYXA 4JLAA 4HATA 4Q00A 2JDID 1E2FA 1KDTA 3GPLA 4A15A 5HE8A 4DRZA 4POAA 4HDOB 4YXWA 4BLQA 4HYYA 3FKSA 3RRYA 3AVVA 4DSOA 3SOPA 2F55A 5CITA 3SBEA 4ZIRB 4OQMA 4G0NA 2RB4A 5J40A 5FBQB 3JZAA 3KL4A 2OHFA 2ZI7A 1OPXA 3AM1A 1G6OA 1G20E 3ONWA 3QSYA 5J5CA 2V1UA 1TUIA 2AD1A 3RABA 3NHBA 4KV9A 2J0UB 3MGCA 1S2MA 3WMEA 3IDQA 4D81A 4IFEA 1IY2A 4CVNA 2GEDA 2ZRNA 1S4QA 3ZIAA 2OFWA 2F43A 3CH4B 1BYIA 1R0ZA 4RFVA 3CWQA 1SKYB 4ESVA 5TDHA 4P4SB 2QE7A 3PUWA 1AS0A 2QEQA 4Q4JB 3UMSA 4GFDA 2CVFA 3KX2A 4HAZA 4JYCA 4GPTA 1ZCAA 4B76A 3K0FB 3GJ5A 4LC1A 4A2PA 1T3LA 3EW9A 1VCIA 1XP8A 5L3QB 1JNYA 2VHUA 2CVHA 2ZJZA 4TTRA 4JMPA 1KZ7B 1P62B 2VP6A 4XD7A 3VTKA 3U3KA 2HT6A 1XJQA 2HV8A 1LF0A 3KQUA 2GAOA 5E3HA 3GJ6A 4DCTA 1U90A 3FYHA 4LJ4A 4PC3A 5JEEA 5IDVA 4F93B 4AKGA 4EDHA 2BCGY 3GFTA 1VECA 4JLNA 4DSUA 2YKGA 2ANCA 5FUWA 1JBKA 3BK7A 3QKUA 4D80A 1G4AE 4FD2A 4W9MC 2P6RA 3BH6A 1PV4A 3KQNA 4WXPA 1H8HD 3A37A 4TN1A 3A1WA 2OBLA 3B6EA 3HYTA 1G7RA 2RGGA 1QBKC 3ZYCA 2J7PA 3HYRA 4PHFA 3E70C 4PQFA 4TYYA 4C2UA 4IOKA 4JLVA 3OFND 2LKCA 2O8CA 3BOSA 1LVGA 1UBFA 2BBSA 1G19A 5AK0A 3SC3A 4B75A 1IXZA 2Z6VA 1ZW6A 1DPFA 2NZ8A 3RRZA 1KO5A 4AI6A 3SJAA 4JJKA 1YZQA 1P3JA 1CBUA 2G83A 4FN5A 1W4RA 2NO6A 4LZZA 2SHKA 2CDNA 4HAUA 2WKRA 3QXHA 1AA9A 2JA1A 3IIJA 4PPNA 5J4HA 2OFOA 5H8WA 2HCBA 4IXNA 4EJSC 3AVPA 4MUBA 3C15C 5TB5A 1GUAA 1LY1A 1G16A 3LW8A 5A5GA 5DLQC 4MRRA 4BLTA 2WTUA 1R4AA 3L0OA 2O5VA 4FCWA 3C5HA 3NVAA 2G6BA 1QVAA 1KK3A 3TR5A 1G4UR 3AP2A 1ZVQA 1W44A 5FR1A 5EZ6B 4DLUA 1JR3E 3RANA 1E98A 1Z0FA 3AF4A 1HA3A 3FFBA 4QL3A 4WZ6A 3SYNA 1R0WA 4Q9LA 4M21A 1DEKA 2Q9BA 1E9RA 4LRWA 2CCGA 4IVPA 4CT5A 4KITB 5G3YA 2BHRA 5FPTA 1KI1A 1OIXA 1SULA 1G9XA 2GHIA 2GJSA 4B74A 3U3MA 1HY3A 4GT1A 4KVAA 4G5SA 2YHSA 3QVVA 2G3YA 2IEZA 1NN1A 2VHJA 1ZIPA 1DBSA 1AM4D 1ANKA 4DCVA 1N3BA 1SVWA 2ONKA 3K9HA 4UNRA 1FQKA 2GK7A 3FE2A 2BDTA 3ZLJA 1EWRA 4L9WA 4JBXA 4DIDA 2CCKA 2XNSA 4NE2A 1QVRA 1RJ9A 2IYSA 4JVLA 1NY5A 3PUVA 2ZRIA 2IYYA 2RGXA 1IM2A 5EQTA 1OF1A 1P2TA 4DT1B 3VKHA 3GFPA 1GNPA 1WB9A 1AIPA 4LI0A 1JXOA 2FN4A 1AGPA 2C8VA 1NVXQ 3A4LA 2XNDD 1Z0DA 2NO7A 3KKOA 1M7HA 4PZZA 3CKLA 1MH1A 2EWWA 1LS1A 3SYKA 3HU1A 3ZS9A 2CLCX 1KK0A 1M74A 3TK1A 2F9MA 2JLVA 4JL5A 3AVXA 2FPLA 3LW7A 3EZFA 4Q01A 4K8OA 2EVWX 1AQYA 3P32A 3RAPR 3T35A 3LWNA 5C2JB 3OHMA 3ZGXA 2V1XA 2FFAA 3CM0A 2IF2A 2C2HA 4HAWA 5JI3E 4V02A 1XXHE 1PLLA 1T3SA 3GJXC 4PANA 2QRZA 4ACAA 3EZ2A 2PLRA 3FB4A 4C30A 1N0UA 4CRWB 3EARA 4RCYA 2HLDA 3W6PA 5EP2A 5FPHA 1G3QA 1ZM2A 3I4LA 5JHHB 2JLRA 3GLFE 1G1MA 3GLFB 4LHWA 2FZ4A 4HDCA 2B8TA 2BCJQ 1SQ5A 721PA 1XEWY 2B21A 5L3RA 4EAQA 3B8HA 3W9YA 1P9WA 3D6TB 4PZLA 2ZSEA 3H0KA 3QG5A 4XWAA 1IN7A 3KQLA 3IQWA 3WRXC 3HU2A 1E99A 4M1KA 1E9DA 1S0UA 2CLSA 2ZI3A 2GZAA 3UG6A 4BFWA 4LDJA 1Q1EA 3I62A 3CX7A 3TUJC 2MMCA 1E2HA 4M53A 5AUOB 2WJVA 4TMZA 3CPEA 2NPIA 5TXGA 1O87A 4B32A 221PA 4TYWA 1IXSB 3U44B 4D4KA 3KJGA 3CF2A 3A8TA 1VPLA 5SZIA 4BECA 4NDZA 1D6JA 4GP7A 3TRFA 1ZUNB 5EXTA 2ZI6A 1ZINA 4BZXA 5BYJA 3RS0A 1KJZA 3KXIA 3RNLA 1R8SA 3QVUA 2AK3A 4CEHB 3TNFA 4JBYA 1NVUQ 1ZYUA 2JJ8A 3FMOB 3NHAA 3FWYA 3X2SA 1L7VC 2YINC 1G6HA 4TLCA 1FW6A 3AUYA 2H17A 4PQRA 2XTNA 2PLFA 3U3JA 1XZPA 3WYFA 1VIYA 4B43A 1NBMD 4BLSA 5FI1B 3CIOA 1WQ1R 2QUZA 5JJKA 1AN0A 4P31A 3OFNA 5FTNA 4PO9A 4OHYA 2ZRFA 2YOFA 1D5CA 4DXAA 4LBWA 1COWD 3LAWA 2ZRGA 3QF4B 2VBCA 4Z8YA 1WA5A 2B6HA 1JPNA 3AVOA 1IN6A 1W0JD 1XBTA 3KB2A 2G9NA 1Z6GA 1SZPA 3IUYA 1OXUA 1KY2A 2CHGA 5FL7D 1IJFA 3ADBA 5BN4A 3BRWD 2C77A 3G5UA 4I4LA 4URUR 2OV2A 2R6GA 2W00A 4RVCA 3OIVA 4I1SA 4RFSA 1P2VA 2V7QA 3TJZA 1R2QA 4GSYA 2NPFA 4B34A 5CK4A 2IYQA 4L4UA 4DVGA 2KWIA 3FMFA 2PX0A 2ZS9A 4FMCF 3THXB 2K5UA 3WP0A 3THXA 3R8FA 2RGNC 4B33A 1RJ9B 5KUTA 3GD7A 3ZVLA 1KSGA 4DB4A 2VSOA 2IF0A 4RZ2A 3IBYA 3BC1A 3PXGA 4D82A 2EFCB 2DY1A 2PL3A 3WHKA 4Q4LA 1BKDR 1NMXA 3K9LA 4RZ3A 1MO4A 2FU5C 5FOUA 5E7MA 2ZI5A 1FX0A 1AKYA 1E94E 3GJ7A 1JI0A 4UNPA 1GL6A 4JBWA 5DSZA 4HUQA 4FMBB 1VIAA 2QG6A 4MKHA 1W2HA 1CP2A 4KFSA 5K8IA 4B71A 2VEDA 2P6NA 3J81k 5EXSA 4G5QA 1SVMA 1A4RA 3X1WA 1GG2A 1I4DD 2ZRJA 4HI0E 2DR3A 2EFDB 5JHGB 5F98A 1LB1B 2AHOA 2W58A 1XRJA 1LS6A 5EP1A 3BD9A 4DC9A 5JJLA 1NF3A 1G5RA 2WWXA 1U98A 1ZC4A 1QHGA 4M1SA 1KJWA 2W2VA 4BWYA 1P9NA 3JVUA 1E32A 3T06B 2ZSAA 3K0EA 4B73A 2JJ2A 3VR5A 4L16A 3MFYA 4OHZA 2CXXA 1CJTC 2GA8A 2R6AA 2E87A 3NC1C 3GLHE 2JLUA 4LYJA 1QHSA 3OE7A 2CE7A 3KUDA 1E2EA 4ITRC 1EGAA 2J0UA 4Y0VA 1X1SA 1F2UA 2J9RA 2UKDA 3SJCA 2Q6TA 3LBIA 5DIFA 4ZDWA 4CDGA 4D26A 1P75A 1ONBA 2O0HA 1ZC3A 4HZUA 1KMHB 3NEYA 5JWHA 5KNCA 1VYUA 1WBBA 2VTKA 3R9XA 5CYPA 4Q4JA 5KOYA 4DLWA 2FMXA 2XOKA 4KFTA 4OQXA 1DAFA 2QTHA 4EKDA 1RRCA 3AKEA 2RCNA 2O8FA 4H9GA 1J70A 2ZROA 2IL1A 4TQ9A 4CW7A 4OI4A 2HJVA 1E1RD 2RHMA 1LFDB 2XXAB 1T4GA 3OEEA 5FR2A 4RKFA 1M34E 2QTFA 3R7WB 2ZQ5A 2PCLA 4Q1AA 3DZDA 4BQSA 1OFTA 5CIQA 4HB2A 3Q5EA 4IDNA 3T1QA 5FOXA 4ASUD 2W6JD 1SVOA 1E2LA 4GL2A 2FWRA 4A0RA 1ZJ6A 4ZIRA 3MD0A 4RD0A 3SDZA 2YVUA 3VR6A 3ZZTA 4YDSA 5KSPA 1QF9A 5UKDA 2GF0A 2FDCA 3KFXA 1UPTA 3LO5A 4WBSA 4MDFA 3PEVA 1XFAA 4Z1MA 3W34A 1SXJD 3WBKA 2N1BA 2WICA 3CNNA 4F7WA 2KBEA 1YR9A 3B78A 4LBVA 2D62A 2GZDA 4LGMA 5DN6A 2UZIR 1VG9B 2ZSFA 3U4QA 2QTVB 3CX8A 4KBGA 4BEJA 1P73A 3NG1A 1WDTA 3CH5A 3LH5A 5E7JA 1MRNA 2QP4A 1H8ED 3D31A 4QBFA 2ZRBA 3A1VA 4QJ4A 3PITA 5L3SB 1XPOA 2RGAA 4UQOA 1BMFA 1FFHA 3ZQ6A 3CB4A 1AKEA 1N5JA 2JJ1D 4A36A 1GRNA 4HLQB 2VA8A 3TSOA 1Q1ZA 3A4MA 3HWSA 2HT1A 1DADA 5FUXA 4LJAA 4LSGA 1VKJA 2JIZD 2IK8A 2EFEB 2OEPA 2Q3HA 4Q19A 2EYUA 4DIEA 4EFLA 5LBIA 1U94A 2MSDB 1N6IA 2HYDA 3ASYA 4AWXA 2F1JA 3TH5A 2VF7A 1W47A 2RKOA 1K8RA 4V0MA 1IN8A 5F3WB 5TV2A 1KI9A 3NKVA 2Z4RA 1YR6A 5JEDA 1XCMA 3DKVA 3P27A 4D6PA 1XCGB 3NWJA 2FV8A 5FL7A 2ZM5A 1Z83A 1SXJB 1YRBA 4R98A 3SBDA 3T34A 5CK5A 5EE5B 2C04A 1RRFA 1YZKA 2OCPA 2QM7A 3DHWC 4MGIR 4PQYA 4BPBA 2BM1A 2GTPA 2C9OA 2G77B 2X19A 4G3XA 4M1TA 4Q66C 3TSWA 3SJZA 3L8ZA 1KOFA 3KJEA 2D3WA 2KB0A 1HQYE 1KI7A 1F60A 3CZQA 3LQQA 1BS1A 3U3RA 3REFA 2XSZA 5CDFE 1J7KA 1DAKA 1X1RA 1IY0A 2BJWA 4QHSA 4PHGA 3ICQB 1JQJC 3VAAA 2YWEA 2QP9X 3TBKA 2QE7D 3TW8B 2GCOB 4TLAA 3BFKA 4JZKA 5JS8A 1G7TA 1Q0UA 5IHPA 2EFGA 1HH4A 4PC2A 2YOHA 1DAMA 2O0JA 4QGGA 3GEHA 4FIDA 3KQHA 1S1CA 4Q1DA 1J8YF 3B85A 1MRSA 3V4FA 2X8AA 2OCBA 4Q4HB 1U8AA 3TW4A 4JKYA 2XGJA 1ZM3A 1DAGA 1Z47A 5KSZA 1P4SA 3FHCB 4EPXA 1T9HA 3B1ZA 1G8FA 1KY3A 4QRHA 3PCRB 3R20A 2DYKA 4HZUB 3QXXA 4II7A 4OK5A 5JLJA 2ZXUA 1NLFA 2GAAA 5JI2E 2Q3FA 1Y3AA 4JKIA 3I73A 4OI2A 3DDCA 3L8YA 1FNMA 2WPDA 1PVOA 3I61A 2G88A 2TMKA 4KSCA 3TQCA 4TL7A 2YC2C 3DO6A 4M1OA 3KKNA 3EWAA 4M9ZA 1KO8A 2JAQA 1UEJA 3HPQA 4LYFA 3S1AA 1OT3A 1TPZA 3QUSA 2ZS7A 1ZM9A 3CUEF 2DWQA 1E1QD 5KTYA 1HV8A 1GTVA 3QY0A 2JJ2D 4PTLA 2O0KA 2VSFA 4I1UA 4U00A 1KAOA 4D4JA 4HDQB 3LXXA 1KYIA 2F9LA 4I1VA 1GILA 4Z54A 2OBMA 2HYIC 1R0XA 5P21A 3LA6A 3QEOA 2ZITA 3RSOA 2V4ZA 2UZ3A 1ZAKA 3ZVNA 1S96A 3ZVRA 1Z2CA 2BBOA 4HUQB 1L4UA 1ZIOA 2KI5A 3QXSA 2KSQA 3CRVA 3P26A 4LJYA 2WJGA 4U7DA 1JALA 4TTQA 2R44A 2PMKA 3TKLA 1T8UA 1Z29A 3FFAA 4AURA 4B47A 2ZVPX 1Z6AA 2F43B 2VHCA 5FFMA 5TVKA 5JRZA 1XWIA 1F6BA 1E1RA 1JAIA 4DLZA 1E79D 2DCUA 1TUEA 3TQFA 1EFCA 2IYVA 3I5XA 3U61B 1H65A 2NOAA 3K0CA 1XMJA 4A6XA 2J0SA 1FNNA 3EZ7A 5L3SA 1TQ4A 4BE7B 4NH0A 3SHWA 4C0KA 2OCYC 1UFQA 4JL8A 1Z08A 3Q8XB 1GIAA 2J46A 2NG1A 2O8DB 3THYB 1TL7C 4PC7A 2EFHB 4QBGB 2IYLD 2KJQA 4HB4A 1HE1C 1WP9A 2XAUA 3F5FA 621PA 2QMOA 2ZRLA 3NDPA 4XWKA 2A30A 3SNHA 4QNRA 3W3AA 2GBLA 1OSNA 4LYAA 3NEJA 3FPAA 1Q12A 2EYQA 3LX5A 1RIFA 3MWKA 2H1LA 4IHQA 1TQ6A 3M0EA 4NBSA 1TU4A 4C0AC 1X8LA 2ZPTX 1RKBA 5LPNA 2YV5A 3MMPA 5DN6D 3MSXA 3OF5A 1DAEA 3EC2A 5CIWA 3U6KA 4M0LA 1NP6A 4Z8XA 2OUKA 2GJ9A 1Q20A 2PCJA 4B3BA 5CM8B 3RRNA 2BMJA 2IHBA 1H8EA 3OIYA 4XSHA 2RGEA 3OEHD 2AL7A 1E0AA 2AXNA 1DO0A 4FCTA 4IEEA 5KYKA 1EFHA 3TUZC 4DDWA 4LJ6A 4RD2A 3B1YA 3EPJA 1UBGA 1Z6XA 1W7AA 1NN0A 3FKSD 4ARZB 3WHLA 1OXXK 2FGJA 2FGKA 3ND9A 4M1WA 4A0FA 1XEXB 3HDTA 2XEXA 821PA 1EFRD 2AFIE 3BERA 4QHYA 3AVYA 2R8RA 1I4LD 4C3ZA 1DG3A 5DNYB 2R62A 4XIGS 3K70B 2YYZA 2GKSA 3P4YA 2I3BA 4X8LA 4C0BA 3Q85A 4JVSB 5JWOA 5D3MB 4LK2A 4HLUA 3U3OA 3M6AA 2QORA 1ELOA 1C9KA 1CULC 3ZZ0A 5FBRB 1ZNWA 1CRQA 3K1JA 2WSSD 4GBMA 1KI6B 1L8QA 2FH5B 1N0VC 3IKJA 3CF0A 3QNUA 5J4LA 4ON9A 2FF7A 3ZH9B 2B7CA 4OQFA 4TL6A 1X8JA 2R6FA 2VIIA 3O8BA 4G1UC 4PO8A 4G5OA 4HLCA 1U9IC 1DOAA 1QHHA 3C7KA 2OILA 3FMPB 3QKTA 1NBME 2J0VA 4HAVA 4IDOA 3MG9A 4BFSA 1TF2A 1KO4A 1FMLA 2GEVA 1N5LA 5J4KA 1S8FA 2QENA 3M4YA 4M1MA 4XD7D 4NCIA 4MYUA 1CRPA 2GNOA 5GJWC 3D8BA 1CIPA 1R8QA 4Q4AA 1N5IA 4ERNA 1XTIA 2CL6X 3CNOA 2C99A 1TTTA 3GJ4A 1DAIA 2ORVA 3HP1A 2W6ID 1KSHA 1BIFA 5JZVA 1XMSA 1NI3A 4MKIA 4P32A 3TE6A 1E6CA 1US8A 1LF5A 1N6PA 5TMPA 1QHHB 4KLZA 3EIEA 2CL7X 2ZJOA 4FXPA 2WZQA 3RRMA 1MV5A 1G3IA 3K0AB 1X8KA 4TT3D 3VX4A 4IDPA 1KNQA 2NO9A 1VHTA 5FPYA 5JECA 3MWJA 4DSNA 1AS2A 3U5ZB 5JBQA 1XPRA 3RC3A 2WV9A 1X6VA 2QU8A 3I92A 3LBNA 4Q5IA 4JLPA 3BJIC 4B3XA 1OW3B 2DPXA 4QC2A 4XVQA 2GJKA 2KBFA 1TADA 3T12A 5J4VA 1A82A 1G7SA 4YMSA 5GJVC 3EPLA 2NIPA 4B3CA 2O8BA 3QF7A 1IOZA 3G0HA 2D2EA 3O8DA 4EJSB 4EJSA 4W5WA 3NC0C 1E0SA 5FBVB 5BQ5A 5ANRB 3ZVMA 4QM6A 3U7HB 4HLDA 1GKYA 4L8GA 4E03A 3NBYC 3RS5A 2HDNB 2D2FA 2ZR9A 4DUGA 1KGDA 1WBDA 1Q44A 4IVRA 1YZLA 4B44A 4NCJA 2H16A 4N3NA 2PEYA 4YMVA 1W36D 5E7IA 2IW3A 3MUFA 1A5TA 4BFUA 2A3RA 4JLBA 3MRSA 3LBHA 4KHZA 3FVQA 3DZ8A 4AKEA 1Z0JA 2WWGA 2WWWA 1XMIA 3BB1A 3SI7A 1R6BX 4Q7KA 2F3TA 4LV6A 4K46A 2DFNA 4US1R 3RC8A 3I8SA 2REBA 3ND8A 4C7OB 2CEAA 3N2EA 4C7OA 3P4XA 4MUAA 1GAJA 4PAOA 4DLYA 1S9HA 3IO5A 3QF4A 2AD5A 1JEEA 4AK9A 3CRRA 4YLGA 1OH8A 4PPGA 5SZHB 3T61A 3GJ0A 2XJ9A 4FCVA 2D7CA 4JLMA 4Q1CA 1XTKA 3VNVA 4RJLA 3PUZA 2ZRKA 2HF9A 1NSFA 2HCJB 4CEJB 3AP1A 3QPWA 4YONB 1Z5ZA 2P5SA 5GVRA 2C78A 4O0MA 1EK0A 2OT3B 2NQ2C 2FSIA 4TWZA 3B82A 1G17A 4PPQA 2ORIA 1XDBA 4Q9JA 3VKWA 2WMOB 3OESA 5D3MA 3L0SA 4ZDKA 3WYAA 2OFXA 1UKYA 1A2BA 1IN4A 3VHXA 1T0JB 1XU4A 2FEOA 4G5GA 4E09A 2VHQA 3LV8A 1ZCBA 3GLGE 3BORA 1XPUA 2VH5R 1SVKA 3QKSA 4Q7JB 4E22A 2WVJA 1N2CE 3T5DA 3LLUA 5DHFA 3WNDA 1KO1A 1FTSA 4QKQA 2AFHE 4LHZA 1TEVA 4PSKA 1LV7A 2ZE8A 1Z2AA 2C03A 8OHMA 1KDPA 4NTZA 5C1BA 5IK2D 1KSFX 2FNAA 3VU9A 4LYHA 2JLZA 4W7SA 5LD2B 1W48A 5KDLA 2VP0A 3K0CC 1E3MA 5HKKD 5AUPB 4MA4A 4BGDA 3VNUA 3JVVA 3OE7D 1Q21A 3IHLA 2H7VA 3C5CA 3MAAC 4Q7MB 4BFYA 4PFSA 3DM5A 3W5JA 5G40A 1GL9B 1ZD1A 4DCNA 3LDAA 2ZI9A 1GVNB 2BEKA 4BRUA 2IS6A 3RVBA 4WZBE 5F9FA 2FOLA 2OSBA 2OLJA 4D0GA 4XTRA 4X8MA 3L82B 4KFRA 2VQSA 1K5DA 1OKKA 2NTYC 1G7CA 1E2KA 2ZR7A 5DGXA 3RYTC 2Q21A 4WA7A 4TZ6A 5JJIA 4DB2A 4LY6A 1AZSC 2BEJA 1UF9A 4HEJA 2J0QA 4TSFA 1T8TA 3DM9B 2ZJ8A 2IXFA 4ZCLA 5BYKA 1ZM7A 4ZPXA 4DZZA 1FL9A 2L0XA 1QG2A 3FOZA 3LXRA 3GCGA 3QPVA 4Q4HA 3ADKA 4NYIR 2ZYTX 3CF6R 4Q21A 1CR4A 4MGYR 1YKSA 3NTUA 2V54A 2ZIAA 1W49A 4ZV4A 5E95A 4OHWA 1FUUA 1KSJA 5BW8A 3R8CA 2ATXA 4HUTA 1W46A 3BFVA 3FGNA 5B30A 1II0A 4NU0A 3UWOA 4JL6A 2PEZA 1GFIA 4UNQA 3RLFA 1IQPA 2C96A 3CRQA 1GDDA 2QAGA 2WBLC 1CLUA 1LNZA 2CLDX 2AWNA 2DWOA 4QGHA 4KFUA 2QT1A 1E2PA 4M2LA 3L0IB 3S1AB 2QMEA 1US8B 4I99A 1SXJA 3A58B 1Z07A 1Q3HA 2BVNA 2QRNA 4DBLC 4DLXA 1S3GA 3CNLA 3CONA 4I1OA 5B57C 3I72A 4F38A 1XD2B 1YR8A 2HUPA 5B64A 1W2GA 5FTJA 2BJVA 2ZS8A 4NYMR 2WJYA 3VX3A 1T91A 1KAGA 4UXHA 5BN3A 2V6IA 4FMDF 3ICEA 4IW3B 2XX3A 1KIMA 4AKHA 1OLOA 2C9CA 3RWMB 3MJHA 1XEFA 1XEWX 5FTLA 3I32A 3GJ3A 1RE0A 3B9QA 1HEIA 2CCJA 1U0JA 1NN5A 1NBMA 1L4YA 1NLZA 4S35A 1P5ZB 3BH0A 5DE3A 2QAGB 4LBZA 4LJ5A 4YXWD 1AK2A 1E2DA 4DEXA 4EPWA 5BXQC 4KYIB 1YQTA 4MKFA 4QHTA 4P33A 1G8HA 1SKQA 1C1YA 2BMFA 3G82C 5FOSA 1U8YA 5KNDA 3BB4A 4JSYA 1CR2A 1XD2A 1OIWA 2FPKA 2D4HA 2D06A 1I2DA 1E69A 3A1TA 4LBYA 5DI3A 3K53A 5E4FA 1OH7A 2XZLA 1OYWA 3DKPA 1Z8FA 3ETLA 4EQ6B 5GVSA 3C16C 1M8PA 1UEIA 4NL4H 4P3YA 3BB3A 3FKQA 1KK2A 4TMKA 4IOJA 1WE2A 5SZKB 2G0NA 1CF4A 4URXR 4OBEA 1W4AA 2PJZA 1U99A 1NKSA 3LD9A 3W6NA 4ZDJA 1D9XA 4GOXA 2A5DA 2DFLA 2Z83A 3IIKA 4IXMA 5DI9A 3PEYA 1QRAA 2FSGA 3QKSB 3IEUA 4TMXA 2R6DA 5HPYB 4KO8A 5H1YA 3RS3A 3H2YA 2ZSDA 1GKIA 3H4MA 3VR2A 3SS8A 3LVRE 3SQXA 1P6XA 2YOGA 4M9XA 4GRAA 2CNWA 4JYBA 2EWVA 1YZGA 3RDPA 3QEJA 4GNKA 2IS2A 5EE0A 4DEYA 4RD6A 3K09C 2VPPA 4OL0A 2XZOA 1Z63A 2QGZA 5KPDA 2Z0MA 1WCV1 1MABB 4CEIA 2AXPA 1W4CA 1KI3A 3FHTA 4KVGA 2ZEJA 1AS3A 3QOFA 2P0EA 2JGNA 3NH9A 521PA 5GJCA 2ODEA 2WSMA 3KXKA 3T1OA 2CBZA 2VF8A 4JT2A 4PHHA 1SXJE 4L5BA 4LJ8A 3T1TA 4KI0A 1YZNA 4OK3A 2V8OA 2O52A 2V3CC 4BZQA 5HE9A 3TAUA 4KCGA 5B58C 2VP9A 3ASZA 2GJAA 4ABYA 1CTQA 2XITA 3QKRB 5AJWA 1KDRA 4O3MA 2IBMA 2GK6A 2IUTA 1GITA 2ZE6A 4NCKA 2GJ8A 4O2RA 3W90A 4YMUA 2YNMA 5K8LA 3SYLA 4NMMA 1B0UA 3HU3A 3CZPA 4B48A 4AG5A 3O47A 2FSHA 4A8JB 1RPZA 2BWJA 2CMKA 2P67A 4E07A 2F6RA 4DLVA 4NP6A 4QXAA 4F91B 2A5YB 4B3FX 2GCNA 1KI4A 1VYTA 2REOA 1Z22A 2IYXA 4Q7LA 1HQCA 3X1DA 2JEOA 2OXCA 4HLUC 1E2NA 4A1FA 1M7GA 2ZREA 1OKKD 2QM8A 4TYPA 5F9HA 4Q1FA 4V0KA 3W5IA 2BMDA 2WOJA 3F0TA 5DISB 2IS4A 1E9AA 3C4JA 4DT1A 5FOVA 3E2IA 4Q02A 4Q9HA 3AVTA 4GDFA 3WXMA 1I2MA 1N6RA 3KZ1E 2OZEA 1PZNA 2HF8A 4AY2A 4LOAA 2ZUCA 2ZUDA 1QHIA 1E2IA 3K8YA 2FZLA 2V9PA 1D2EA 4US2R 2EQBA 5HR5A 2QAJA 4MYCA 1U8ZA 1E4VA 2GEUA 1ZD9A 5JRJA 4IEIA 4LJ7A 2VP4A 1ZM4A 3RHFA 4BLPA 1U0HC 4DHEA 2ZE7A 4GZLA 4DCSA 1N25A 1SHKA 1ZP6A 1E2JA 5FUVA 4IOMA 5A0FA 1F2UB 3NIBA 4PC1A 4ILEA 4CGZA 2N42A 1ZD8A 4BRWA 5EZ5A 4C2TA 4IRUB 2H8KA 5FBWB 3GLGA 4N0DA 4WXRA 1DS6A 2NGRA 4BFXA 2NO0A 4TLBA 1JJ7A 3UMRA 5FBLB 3DOEA 1AGRA 1FZQA 2P3SA 1E2MA 2GBLC 2W0SA 1AZTA 1N6HA 2ORWA 1X3SA 3N5CA 3EA0A 5IRCD 5F2EA 2O8BB 4YC7A 4DLSA 3EX7C 4IDQA 4KYUA 2ZR0A 3R9IA 4LCBA 1MR3F 3GP8A 2JLQA 1NJGA 1YJ5A 3SN6A 3E1SA 1F48A 1NSTA 4OI0A 1IXRC 2Q3MA 3FTQA 2A2ZA 3KUCA 4WAUA 1RYFA 1VDZA 3ZD6A 2CL0X 3VR4A 2QSYA 3VKGA 5KO2A 1CXZA 2FPMA 4ZI2A 1PUIA 1XTRA 4TMTA 2RGNA 5CDFA 4DJTA 3L43A 1KMHA 3BBPA 1F2TA 4C0QC 1TAGA 4P4UA 1JR3D 3FDIA 4UJ3A 3TVTA 1UAAA 2QA5A 1TMKA 4N1AA 4WVFA 4D4LA 2GXUA 1YRAA 2WJJA 4I81A 1MO5A 1VCOA 2MSCB 1ODFA 4PSAA 1Z28A 3V00A 1Z6TA 3W8RA 2AX4A 5J47A 1VG8A 1T3HA 4ZCIA 1F3OA 3OAAD 1BYUA 2XTMA 3EIQA 2OLKA 2EW1A 4OKSA 1ZMXA 1E0JA 1L2TA 1IN5A 2ZSBA 3QBVA 3UMFA 2Y8EA 2IWRA 4BLOA 2J41A 2RHDA 1E2QA 2V55B 2IXEA 4MRNA 3AP3A 4G01B 4BZPA 2PZGA 3B9PA 5EE3A 5EUQB 1KJYA 1SGWA 3Q7PA 4P4SA 1D2MA 4EIWA 2JLYA 3DMDA 3REGA 5D3QA 2OESA 4B2IA 4OHXA 2EU8A 1QHYA 2DB3A 2VL7A 2W83A 2HXSA 3NDBB 4BFVA 1F5NA 3T5GA 2BKEA 1CJKC 2W0MA 4R7ZA 3PIRA 1PLJA 1E4YA 1S3SA 4YQFA 1IJEA 3PR1A 1G3MA 1OHHD 4URWR 3CWZA 1YZUA 4PHTA 1TF5A 3TMKA 2QL6A 3C41J 3EZ6A 5H68A 3AV0B 2WOOA 1UKZA 1Z0KA 2ZAOA 4EPVA 1T5LA 3ZQJA 4LHVA 4RFSB 2AN9A 2REXB 1TEXA 4CYMA 3B13B 4J0QA 1EESA 1OB5A 3O8CA 1UBEA 3UG7A 2IYUA 3N2IA 2W6IA 1HURA 1S9DA 2C5LA 4IFBA 4M9SA 1HE8B 1OJLA 3AF2A 4EFMA 2YJTD 5K8UA 4BFZA 4M4SA 2IYWA 1UDXA 1HT2E 3RS4A 4AYWA 4BEBA 5FPSA 1G8YA 1E1QA 4TT3A 1EG7A 3VR1A 3DVLA 2W2XA 1MO3A 2P2LA 3K0SA 3AB3A 2QQ0A 3IBGA 4IDHA 1OB2A 5JWRA 2O8CB 5EUMA 1JXMA 4TL9A 3QG1A 1FUKA 1ZNXA 1YHNA 3H84A 1COWA 3I8XA 3IGFA 3EC1A 4TMWA 3PEWA 3SQWA 4P4TA 1T5IA 4NONA 3Q3JB 3RWOA 1P60A 3H86A 3BGWA 4GMDA 4MYHA 4MGZR 1TNDA 2ZRHA 3LRPA 3CO5A 2RAPA 4S2EA 1Q3TA 3QXJA 1PUJA 4NYMQ 2VO1A 3DPUA 4JLJA 1KHTA 2ZRDA 4HAYA 5AUQA 1G8PA 2OBNA 5FTMA 4AD8A 4ZI3A 5LDDC 4XSGA 2A5FA 2QMUA 1G3UA 3KXLA 4MKGA 3IILA 4AKIA 5EP4A 4URYR 1E79A 1FX0B 4HB3A 2ANBA 4M22A 1G5PA 3VMFA 4L15A 1W36C 4GZMA 4JJZA 3OZXA 3X1ZA 3GLIB 3KJHA 3AEZA 4CIDA 2MMGA 3A4NA 3EIHA 4XTCS 5JFGA 1GNQA 2IX3A 4DDVA 5HZHA 1OIVA 1OXTA 2OE2A 4NCNA 1V43A 1HTWA 3QIAA 4UNNA 2J3EA 3B1VA 3CLVA 1DTSA 1H8HA 4V0NA 2CE2X 1XF9A 2QNRA 4NHOA 4MQBA 3IPYA 4KBFA 4WZAE 3C8UA 3I5YA 3QI2A 3HPRA 1KMQA 1OXVA 2B92A 2J7PD 3GFOA 4LWZA 2DFTA 1GRQA 3LVQE 2GDJA 1ZU4A 4EQ6A 4Q9IA 3K70C 2Z43A 3B5JA 1RC8A 4LPKA 1F2TB 4WW0A 3PEUA 5G53C 1JB1A 2WIBA 1NG9A 1G291 3FMIA 4Q18A 3P20A 3QJYA 1W5SA 4C0LA 2XB2A 4D4MA 1XD9A 1JAHA 2PBRA 3A36A 2D74A 5HCNA 2DWPA 2VRWA 2ODWA 4FWTA 4QJ3A 4ZKEA 4BLRA 3OIWA 4OQLA 4QG7A 5EE9A 4OHVA 2GWHA 3LFUA 4PZYA 4F4JA 2ECKA 3OEHA 2XZPA 5JSZA 4NYJQ 2RGDA 3T1VA 2IC5A 4YDHB 5J4YA 1II8B 3RSLA 1UADA 1YR7A 2H92A 4EPRA 5C4MA 4F92B 4GOKA 5DO9A 5FTKA 4YMWA 1CJMA 1KDOA 2GETA 1Z06A 1OYYA 3PG5A 3C14C 4RZUA 1Q1QA 2ZTSA 3UKDA 3PV0A 4MH0R 1VYVA 1E9SA 1KKMA 3V4RA 1IY1A 3WRYC 4LX0A 5M04A 4R2HA 2WJIA 2VHTA 2PJRA 1GRRA 4UXJA 4HSEA 1NVVR 4IVQA 3PQCA 4F4IA 1N6KA 1JR3A 2ZYWX 3K9GA 2F3RA 2XOKD 1XXHB 1DARA 2GILA 3GMTA 4FMCB 3THWA 1E96A 2Q9AA 4C9BA 4DKXA 1GM5A 2WIAA 3UPUA 2X2FA 2R6CA 1D8TA 3EA5A 4MGKR 1Q1BA 4XJXA 4B2LA 2RGCA 1YVDA 4XWOA 1D2NA 5L3VA 2P5TB 3WP1B 1A1VA 4WIAA 1NIJA 2XTZA 5DI3B 3ADCA 4GP6A 2BKUA 4TSFD 2PH1A 3VQTA 3ECCA 2XB4A 3B1XA 1VMAA 2BM0A 1TQDA 4TLEA 3SU8A 4O2LA 3U7FB 2G1KA 1TX4B 3B7GA 3IHWA 3AKYA 2FA9A 2J7KA 2FJUA 2QN6A 1BOFA 1MABA 4UXIA 2W6JA 1CEEA 2ZJBA 4DLTA 4P0TA 5IT5A 3O8RA 4TZ0A 3AF3A 3SFZA 1W1WA 3W6OA 2IWHA 1EWQA 2JDIA 1II9A 1MOZA 1RVDA 2R65A 4M1YA 4KAXA 4ACBA 4U02A 1GOTA 1ZUHA 2F1IA 1E9EA 2ZYUX 1OV4A 3R7WA 4EFNA 4EUNA 1UDWA 2JJ1A 4Z1MD 4KXFB 4JLDA 4RD4A 3VU9B 2ZRAA 4PAMA 6Q21A 5FI0B 3MWYW 3CBQA 4HAXA 4EPTA 4QM7A 4CEJA 3GQBA 3SR0A 2NMVA 1NG1A 2JIZA 3BH7A 3NH6A 4E5UA 2YZ2A 5LB2A 1CR0A 1Z3IX 3TIFA 2ZANA 3AF1A 3GEIA 1KZGB 4RZXA 3IEVA 4V0LA 3MLEA 4TL8A 3NBFA 3AGQA 2ODNA 2ZJ5A 2QSZA 4C0JA 3SEAA 1E2GA 3U4QB 4LV8B 3SHFA 3ZIAD 1FP7A 1BMFD 1N5KA 1XCPA 4JLOA 3QXCA 4R71A 2E9SA 3CX6A 4PSVA 2HLDD 4X8OA 4AYTA 3N70A 4OJKA 3AF0A 1GKUB 4AG6A 2A7QA 5H70A 2ZU0C 1UBCA 3UK6A 4TYNA 1ZNYA 1XTSA 2OG2A 4QBHA 2B7BA 2XSZD 3AGPA 1KK1A 3K0AA 5HTKA 3L0PA 5JCPA 4DCUA 3KDSE 4CEIB 2ZETA 3R9WA 4CF7A 1BO6A 1G64A 121PA 4GOJA 4M9QA 2QI9C 4UJ5A 4DUGD 5CB8A 4FW9A 2I1VB 1CJUC 1PLKA 1RFLA 2A5GA 3EPHA 4FINA 2WJHA 3KB1A 2C95A 2H57A 2GESA 3L2OB 4WOPA 3BS4A 5AUNB 2HXYA 2PMDA 3K9NA 2QZ4A 3WMGA 4V0ME 1I4TD 1SHZA 4A9AA 4U5XA 4LJ9A 5KHOC 1G8GA 4URZR 1DO2A 1E0KA 1RYHA 2J59A 2OO7A 2YWHA 2P65A 4Q1EA 3AVWA 1IHUA 1KTVA 1M2OB 1NLYA 2I4IA 2QQEA 4Y0AA 4PR0A 2JLSA 5B2ZA 4KU4A 4HZIA 2JLWA 2GCPA 4K81B 5LB4A 3AKCA 4FWIB 1J90A 2LWIA 2WKPA 3TGPA 2JLXA 3IQXA 5FH9A 5FPKA 4A8JC 5AJZA 1ETUA 1MKYA 2JATA 5CLLA 1PJRA 3UWKA 3A1UA 4B3GA 2O8FB 1XTJA 3A1SA 4QOSA 3ZJYA 3RS2A 3TLXA 3U7GA 2BMEA 1QG4A 3WYGA 1NVVQ 2LCFA 1SKYE 5CJ2A 1NNEA 1KO7A 1OH6A 1XJ0A 2WHXA 4CT4B 3AKDA 5JS7A 1A7JA 3GJ8A 1NL3A 3U7EB 3W3ZB 4Q1BA 2AK2A 3NXSA 5LD2C 4B6EA 1HT1E 1NMYA 1U81A 3GLIE 4NCHA 4LUCA 2UVQA 3GLGB 2ASEA 1W0KA 4QGAA 5BWMA 2E1RA 2ERYA 3DOFA 5IK2A 3DMNA 2IEYA 4G5RA 4A2WA 1AQUA 2FE4A 4FMDB 1LTQA 1YZTA 2JCSA 3D7MA 3BFXA 1OFIA 1GL7A 3RS7A 5CM9C 3SE0A 4BFTA 3QBTA 3K0FA 2H18A 2NO1A 1R5OA 4AC9A 2X2EA 3GEEA 4US0R 4JS0A 2QPTA 1S1MA 3E5HA 4IOLA 1P2UA 1N6NA 5EP3A 2XJ4A 5A4JA 4D25A 2QROA 4NPHA 5DYIA 5EXPA 4DSTA 1G21E 5AR1A 4DWJA 1NRJB 2P6UA 1JQLB 3MCAA 4XVRA 5KSOA 2BV3A 4X8HA 4Q48A 3PUYA 5EE1A 3U6BA 4KSBA 1C4OA 1KI2A 1FQJA 4B35A 3LQRA 1W5TA 2C9YA 5KDOA 3GLFA 3EWSA 5DHAA 1Q22A 3KKMA 2ZJ2A 1FTNA 4MYTA 5L3QA 3T15A 5DH9A 1WF3A 4QNMA 2RGBA 2QGNA 4F4CA 2IS1A 1NMZA 1GP2A 2QP3A 4Z51A 3KKPA 5KDDA 2BC9A 1G5TA 2J87A 2WWIA 1OE0A 1VCMA 4A8JA 1JR6A 1WXQA 4D2IA 4CEHA 3PUXA 1OFHA 1RW4A 2DBYA 2YC4C 2PT5A 3GLHA 2CHQA 2O8EB 4A92A 2ZUBA 3CW2A 1FPMA 2ZRMA 2Q9CA 2CK3A 1DG1G 2OAQ1 3HJNA 1N6OA 3TAHA 4B2PA 5AJVB 4URVR 1UKEA 5KPJA 3CPJB 2GZHA 2JASA 4ZDIA 1WRBA 3LX8A 4FI3C 4RCZA 3TR0A 3ZZUA 1P9RA 4OI1A 3UIEA 5TARA 1EFRA 4YMTA 2PT7A 4MDEA 4LHXA 2HEIA 4O25A 3X1YA 4MRPA 5JCZA 1VTKA 1ZNZA 1CJVC 3NBZC 2FSFA 1N0WA 4ARZA 2AKYA 2FFBA 1TU3A 2OCAA 3BXZA 3B60A 4RD3A 2GCOA 3AVUA 3WBJA 1CR1A 2A5JA 5BN5A 1JPJA 3NBXX 4XOIA 1KNXA 1R5BA 1XMVA 2DFKB 2ONJA 1NN3A 2GVDC 2I1QA 2WSSA 2OAP1 2FG5A 2H5EA 1KI8A 3W8NA 2Z5FA 1GZSA 5SZJA 3OEED 4N0EA 1DVRA 1SXJC 3KQKA 3QE0A 2BBTA 2F7SA 2IYRA 3VHLB 2OM2A 3ZDQA 1OXSC 1MO6A 1U0LA 1ZBDA 4C4PA 3DL0A 2ZYVX 1E9FA 2WWYA 4PC6A 2VP5A 4W5JA 1DE0A 2VSXA 4JVNA 4KODA 5CB6A 1XTQA 1QHNA 4C0HA 2IYZA
chains in the Genus database with same CATH superfamily
2PN1A 3EQ8A 4PAQA 3P9PA 1J8MF 4ZO4A 5A05A 2BIFA 2FHPA 4DYHA 4HNUA 4ZHQA 1C3VA 3Q72A 4KLNA 3CN7A 1P7CA 5IJ9B 4BO3A 3R3VA 4YJ2A 4GLFA 4B4OA 4IKOA 5CBKA 3D3NA 1ZVVA 3ZW8A 2XPCA 3PRHA 4DM3A 4UDNA 2AMYA 4ESHA 4C76A 3WSTA 4ZZIA 2O19A 2PD6A 2UZ1B 2ZE5A 1OAAA 3DEFA 4TTPA 4Z2AA 1NVKA 4GOLD 2MSEB 2VJAA 4JGBA 3RSFA 5CUQA 3TZEA 3GUCA 1MX1A 5FOWA 1EVZA 1IK6A 2P77A 1YMUA 1IEXA 4HOYA 4NYIQ 1HNXB 7MHTA 1O89A 1A88A 3V8BA 4LDPA 4LNUA 3R3XA 3BAFA 2IA5A 4U9HS 4DCPA 5I7OA 3Q9NA 4G4SP 4HDMB 1J1ZA 1K9VF 3F4BA 3KZMA 4M76B 2CNWD 1P7YA 1C0KA 1NNUA 4XQCA 3OA0A 1W36B 1OFGA 5CYFA 1NX9A 1CKEA 3OZEA 2M9MA 1NR7A 1O3YA 1SH7A 2HEGA 2NVWA 1MORA 2XEDA 3BGSA 3MINB 4GI2A 1OTHA 1RXSA 1Y5LA 4IGKA 3VFDA 1D1TA 3ID6C 3L84A 4BDSA 2IHYA 1Y89A 2VOEA 2Z8ZA 4QFMA 1CC1S 1Q16A 3NVDA 1V3TA 1LDNA 2GJ4A 3WY9A 2I9PA 2G25A 2Z4SA 2X1VA 4W4TA 1N8KA 3KOOA 1KZ4A 1P7VA 2PWAA 1XTUA 1CX9B 3AUXA 1VFNA 1E6UA 1ZJWA 1Y3IA 4WWHA 1HUQA 1FMTA 2A6PA 4K88A 4UNSA 1NXQA 3GRKA 5IC6A 3KFVA 4IWNA 2PZFA 4S1PA 4XVUA 3AFOA 1I6MA 2BBWA 5EXXA 1ZH8A 4DF3A 2BKXA 4WNIA 2EF1A 1QIJA 4R2JA 4YAGA 4DDUA 3BWDD 1F20A 4YYEA 1R7RA 3G3EA 1UPFA 4KAJA 2K7ZA 4JT8A 4QRDA 3NTOA 4TV9A 1TQ2A 3JQ6A 1BVHA 4E13A 3AIOA 4H6VA 1SCUA 1NKVA 1M6YA 1ENZA 1NQXA 1OFVA 1X92A 1BVUA 2H4ZA 2I4OA 5EG5A 4DA7A 2GN6A 3A9SA 2FQXA 3WE7A 1NVBA 6YASA 2CDAA 1E5DA 1SNYA 1M67A 1P91A 2GXQA 3DTVD 3UV7A 1GTMA 1DJQA 1MT0A 1ZONA 2QPOA 1VP9A 2ZRPA 2Z8YA 3FZQA 2I3ZA 2M6LA 2PYDA 3GLHB 1IYZA 1ESNA 3VZBA 4KQ2A 3COPA 1X38A 4MRSA 4QO8A 1C9MA 1LJ8A 4PXAA 4DZRA 1BWRA 4HWRA 4LV5B 1MJHA 3F71A 3M5DA 1C3XA 2X3FA 4EG1A 3EZ9A 1REQA 2FPXA 2OBBA 4JIMA 2Q4DA 1FP6A 1L9KA 4LISA 2YUIA 2GF9A 4QDUA 3VI4B 1SZJG 2GYYA 4RXTA 3ZDEA 3ZHXA 1AF7A 5A5FA 1DAHA 2OGTA 1JTEA 4JSTA 1TQ8A 2IIQA 4PLVA 1EUZA 3V32A 3OM0A 1X3LA 3A3PA 2VYFA 1JP7A 1XXHA 2A0UA 3G0DA 4HG2A 2D7DA 3KEGA 4OJQA 4C4ZA 1JLRA 2AZMA 1AKTA 2IJGX 2QTMA 1BGWA 2ZI4A 5AW5A 5LYJB 2BFEB 1Q15A 1XYVA 3A2MA 2A9OA 1GSIA 2YHUA 5IJXA 2GEBA 4A0GA 3ZS8A 2NXWA 4ECEA 4YK7A 3LT2A 4Q47A 2C98A 3WK5A 2PVCA 3TIIA 4IJMA 1VE3A 3BREA 2ZJYA 3QQ5A 5HK9A 4CJXA 4M0KA 5K05A 4Y2QA 1RRGA 5CIYA 1YDMA 4NCBA 2VLIA 3JVIA 2ORYA 3AF5A 2GYVA 4RXMA 4A0HA 5KTRA 2RGYA 3AEUA 1O9BA 4Q3AA 1E77A 1FOEB 2Q8PA 3OZWA 3MJDA 1O6GA 5GOZA 3WGIA 3EXAA 1Y4UA 4H08A 3HACA 2I65A 2CLIB 2JIPA 4L9SA 4CM4B 3IP5A 4V24A 1R37A 4PX2A 3TOSA 5AOBA 1VHLA 1YOVA 3TTXA 3THWB 1H6AA 1E7YA 1FP2A 1GKLA 1UH5A 4ALKA 2YQ4A 4RH1A 1UKVY 1W85B 1FK8A 3T3NA 2O3QA 4ZICA 3PIIA 1ZUIA 4CIBA 1K6MA 2XUDA 3ELDA 3OLXA 3EDCA 4L9RA 1Z5UA 4G0WA 1EPUA 1KKLA 2C57A 2PZEA 4JOSA 3TUIC 1RKVA 1J2YA 2HK7A 3SX2A 1I4OA 2WYIA 3B1WA 1F0YA 1P72A 4EY5A 5EJ9A 1GEEA 4B7CA 2V9CA 1G3RA 1YCGA 4LC0A 4WN3A 5EWLB 3C3WA 3HEAA 1KARA 4RSHA 4PO1A 3IIMA 5I9SA 3EAQA 4X1IA 3NZEA 3NHSA 3Q8MA 3IODA 3VVBA 3BE8A 2YFQA 4PCVA 4E2FA 5CVEA 3IT2A 5LC1A 3UF0A 4W5HA 2P3QA 2IUUA 1JFRA 3AONB 2G9UA 4MP8A 4NYJR 1V4VA 3IO3A 3JQEA 2IVZA 3E8SA 5M29A 1O95A 1RLJA 2O3SA 3WLQA 4JQCA 4BUJA 1PGQA 4YRKA 1M1YA 4FIZA 2OO5A 4C4YA 3V80A 3TSZA 4WN9A 4NKRA 3EDRA 4DDTA 1OH5A 4DADA 4AQ7A 3M34A 2H6EA 3HCRA 4X6UA 1ZU5A 3SJBA 4F2HA 2XMPA 3I1FA 2QBYA 2GZRA 3PU6A 3EMKA 3EFOB 1XX6A 3FH0A 4RVFA 2PVSA 2XOXA 5IJ9A 1OC2A 2GVZC 2WAXA 1DQRA 3E0XA 5JPCA 3KPJA 1Z3CA 1PEAA 1UPBA 5B58T 1MG5A 4GYKA 1ULUA 2QQGA 4RY2A 5DKFA 4P54A 5KNBA 4P92A 1NIPA 3AU9A 5AOAA 3R24A 2YHIA 1YE8A 1JLSA 1EX7A 1ESMA 5CDHA 2P2CA 2X0NA 1I9GA 1GHTA 4V03A 1ODCA 5KJ6A 1EX6A 3O6VA 5AK4A 3S70A 3BCRA 2VBFA 3OZIA 3NFRA 4E2ZA 3INGA 2IELA 4PGAA 4C4TA 2E89A 4GUDA 4S05A 3HXOA 4M54A 1AUQA 3BJZA 2QBYB 3ER8A 4WOJA 2F1HA 4LCJA 3ZU3A 3UMYA 1P2BA 2RH9B 3TLBA 5IMSA 3MWLA 4RTLA 4CKBB 1SN7A 3NVMB 3GBVA 1ULTA 2BAGA 4LE1A 4LRYA 5BR1A 2XXAA 3LC7O 3FUXA 3OEYA 2FN3A 4LA4A 4V0OA 5CGZA 2V3WA 4F3CA 3G85A 4QREA 2JDID 5GY7A 1E2FA 4M38A 1OXMA 3M81A 2HHAA 1Z6QA 3QU7A 4DGQA 3KZVA 1NULA 3LBAA 4YXWA 3BX1A 3C6YA 3VUEA 2C7PA 1O94C 3FKSA 1ISSA 2QRVB 3VJLA 2O1SA 2BR5A 3SBEA 1LWOA 3I12A 3IP9A 4J7XA 2Z98A 1XCOA 3B52X 1SOMA 5D84A 5FBQB 3UQZA 2OHFA 4AQDA 1MVOA 4B09A 3QOYA 5JQWA 2FCRA 2KYRA 3WLSA 1IQ0A 3B1JA 2HLNA 3ISVA 3AM1A 1G20E 4CBVA 1F2DA 1TUIA 2V7BA 3NHBA 5ER6A 8ADHA 5I5GA 1TTHA 3LY7A 4NECA 2APJA 5PNTA 1D4AA 3WMEA 4FUTA 1U4OA 1EFDN 2VUSA 1KYYA 2BM8A 3R5FA 4IFIA 8ABPA 1BW9A 1R6AA 4WNAB 2ZRNA 3ZIAA 4MQ6A 1E6LA 1K66A 3VNBA 3EEOA 1BYIA 4RFVA 3CWQA 5B7QA 1SKYB 4QWMA 3MOIA 4F21A 1MD9A 1H5NA 1YBMA 5TDHA 1JPVA 4X44A 3SMQA 3CVXA 4L28A 1ISGA 2VNAA 2ZB2A 4KFCA 2DKNA 2RH4A 4ILKA 5HFAA 3FJOA 1ULAA 3PT5A 2JGEA 1LBIA 4GPTA 4JCOA 1XZJA 2J31A 3IMCA 4IJKA 4YEDA 2BDUA 3EW9A 3UJDA 5DTIA 3H4IA 3TECE 3D0RA 1OILA 3AYZB 3DVQX 1J00A 2ZJZA 3FUWA 3LYLA 2BFEA 1XDSA 4WT7A 1W5EA 4D8WA 4B3SB 3TQHA 3U3KA 2IP4A 1XJQA 4OJMX 3KQUA 1FNSA 3EZYA 2E48A 4YMHA 2DBZA 1U8XX 3UICA 3VR6H 1MVLA 2QV0A 3MHPA 1CIVA 1M54A 4TOIA 5H59A 1BHSA 4Y2VA 1CZOA 1SC9A 1ADCA 4MLPA 4AKGA 1L4HA 4EDHA 1N5OX 5BQ3A 3GFTA 5D7BA 2RC5A 1ZH2A 3NBKA 4DSUA 1UXGA 1XUOA 2VZ8A 4MPDA 2ANCA 2I6XA 3BK7A 1WMEA 2EBHX 3H0EA 3QKUA 5AVOA 4W9MC 2EP5A 1ODLA 3KQNA 3MILA 2DFVA 3SC4A 3A1WA 4YR7A 1JE0A 3GEMA 4AJOA 1G7RA 1M5TA 1Z2OX 5HA5A 2XCUA 5G0TA 3HYRA 4K86A 3OICA 2WF5A 3BSFA 4TYYA 1Y42X 3OFND 2LKCA 3FNGA 2O8CA 1A9SA 2GYWA 3BOSA 4FHCA 2BBSA 5E0OA 3GGCA 3OKCA 2WTNA 3UT5B 1T25A 3SC3A 2XF8A 3E18A 1EBBA 1MB3A 3LCUA 1MH9A 3M6LA 4G1MB 4NZ9A 1ZW6A 1DPFA 4NK5A 2NZ8A 3QLUC 5LP6A 1JG6A 1EZ1A 4G4SO 1JLLA 1S2IA 1KO5A 4AI6A 3GZ4A 2DBQA 4CF5A 3SFTA 5JS1A 5AW1A 5HF6A 1EVJA 2DQYA 2AKEA 4FN5A 3KP1A 2WD7A 1W4RA 5A3RA 3UMVA 2F00A 1AU9A 3IEPA 5JR3A 2SHKA 3LOPA 2WKRA 3QXHA 1AA9A 1RXCA 3A31A 3F6RA 3MTBA 3SJUA 4JITA 3CE6A 4WK4B 1RM5A 3OOHA 3IVCA 1R3DA 3B6JA 2ZB4A 3ICWA 1EJBA 5BSTA 1T6XA 5TB5A 4BNFA 5JXGA 1G16A 3LW8A 5K3OA 2PMCA 4UM8B 5DLQC 1H42A 3N7AA 2J9FA 2WA1A 1C4XA 1LJLA 1R4AA 4FCWA 1RAEA 4B5KA 1Q7TA 1KK3A 2GPWA 1G4UR 1A8PA 1ZSNA 5BUZA 3Q3IA 4XR4A 3AP2A 3OU2A 5BWLA 1VRCA 3DAFA 1O95D 3BXOA 4N7MA 5LU9A 3HL4A 5TEWA 3RANA 5DBIA 3NRCA 4PYLA 5ALWA 1BHJA 1M1NB 3FFBA 1HA3A 1NW3A 4OXNA 4PVCA 5DTJA 4LSWA 4U8HA 1D6SA 3H7AA 4Q9LA 5DNAA 4J49A 3COSA 3PFBA 4YACA 5EJIA 4LF9B 4LRWA 2R86A 4TKUB 1OGYA 2CCGA 3SHTA 3W3AD 3ZHUA 4CT5A 4ER6A 1NXVA 3VKVA 4MYRA 4CG3A 5L95A 1GPAA 5LQDA 2E4WA 2WIKA 1DEXA 1ZS9A 2VYVA 1OIXA 1G9XA 3TAXA 4LXTA 3LL4A 4BCDA 3TTTA 5K0SA 2WT4A 2B3TA 2CYBA 1TW3A 3RUIA 1U7OA 3FAZA 1Z0SA 3HKEA 1MX3A 2IEZA 3E81A 3QVVA 4REMA 3M1YA 3C5EA 4DIOA 4D9MA 3RVPA 1ZLXA 1N3BA 3FDFA 4FSXA 3K9WA 4IQFA 4X1YB 1QUEA 1FQKA 4UNRA 2WZDA 4W5RA 4L9WA 5FA6A 1ZN9A 2QRMA 3FPCA 3MQ2A 2CCKA 4JBXA 5IFLA 4NE2A 4CMIA 2IYSA 4JVLA 4AJPA 1ZWKA 4TVKA 3OE4A 3PE6A 3ENWA 5JS6A 3WLAA 4MQMA 4CM9A 1X7DA 1IM2A 1LLQA 4DRXB 3NIFB 3AL2A 1DQZA 4W5TA 3MELA 5AW9A 3QA9A 4E5NA 2IU4A 4QLBA 4BZXA 3QX7A 4G0OA 5HKLA 1PX0A 5K8CA 3F98A 1RHJA 4NDAA 1JXOA 1AGPA 4JEIA 5BPHA 1NVXQ 4MPTA 1QZTA 1B1CA 1YFZA 4HF7A 3H97A 3NKLA 4AJNA 5BNIA 3CKLA 1MH1A 3IRUA 2PXXA 4RHYA 3B3QA 3HU1A 1Q7GA 2FEWB 3KR9A 3EZNA 5FUQA 3TK1A 2DJ5A 3GRVA 3ECAA 1FRQA 1KJIA 3MSCA 3DW1X 4Q01A 5KMGA 4AG3A 3UMGA 4BZZA 3RAPR 2N75A 4YQYA 3OHMA 1CY2A 3ONFA 2OK7A 4CNBA 1J1IA 3ZGXA 1T36B 1TB4A 4G4JA 4UM5A 5FADA 4CIXA 3U4MA 3N8HA 2C2HA 3L04A 4HAWA 5DNVA 4MLCA 2Q6KA 3KJZA 2PLRA 4BMNA 3EGVA 5AJTA 1CJSA 4NU5A 1FBNA 4L8WB 1J07A 1I7LA 1G3QA 3V7WA 4J90A 1FFEA 3E22A 3OLVA 3CXUA 3QELB 4NH4A 1WVMA 1MB9A 4XASA 5HZMA 4YFYA 5I51A 4D3FA 3GLFE 4LHWA 2FZ4A 3GLFB 3UC5A 1SVNA 1SQ5A 5MHTA 3DCJA 2WUEA 3W9YA 3D6TB 4PZLA 3OCWA 2HRBA 3D3EA 3H0KA 4UBLA 3WLFA 4BFCA 3QG5A 4IHAA 3RYFB 3LP6A 4Y6OA 4H7FA 1MHTA 1WOMA 4M1KA 5EMLA 4Q39A 4KXUA 4PTYA 2CLSA 4AMUA 9LDBA 1XTZA 2GZAA 1TKCA 3OTWA 7AT1A 4BKQA 4PZPA 2DKFA 3PDCA 1KPHA 1KR2A 3PR2B 3BYZA 1ZLYA 1SUDA 3PFGA 3RU9A 5LQRA 2F3PA 1J8QA 4NIMA 4KQ6A 1XF1A 1TVCA 1JHPA 4PE5B 5DW0A 4EO9A 1ZK3A 4M8KA 1S5PA 2O59A 5CFRA 4TYWA 3OIFA 4KR0A 2XVMA 5DULA 4UULA 1XZHA 4W8OA 1YAJA 4D4KA 4X60A 4EA9A 2UYCA 1I6WA 3MTDA 4JI2B 1UZUA 3DTYA 4RKWA 1NUPA 3A8TA 1PJSA 3R0XA 3RHSA 4MI3A 5HP4A 3FPEA 4I8XA 3BXHA 1PU2A 1U80A 1EE9A 3OJEA 5HIJA 5KX5A 4GP7A 4XXHA 4TWAA 3GP5A 4DWVA 2H1CA 5HJ7A 3H7IA 2PR7A 1GFWA 2GWRA 3LWBA 4H0FA 1KJZA 3KXIA 4X7RA 1PF7E 3OC0A 3RNLA 2WZBA 2DVMA 3QVUA 5CA1F 1ZYUA 3GNTA 2RBGA 1L7VC 3OU7A 1QQTA 2YINC 4FYVA 1G6HA 4G4GA 1F0NA 2H17A 2FEKA 1SOVA 3KEQA 3PQEA 3T9CA 1FFAA 5AM4A 2OHHA 3ES9A 1K7YA 3F4KA 3KDAA 1XZPA 3HWWA 4MB2A 2A1UA 2F3SA 1PJ4A 2N3ZA 4NMLA 4QOGA 3GNLA 4FVTA 5K6RA 1EX1A 1M1NA 1FRVA 2QUZA 1AN0A 2MOKA 3PHIA 1KRHA 3GT7A 3OFNA 3PPXA 4LDAA 2PA3A 4RDHA 5FTNA 1T5OA 1E7RA 3ULKA 3T99A 2QUJA 3CB2A 4UHHA 1JB9A 4X3PA 4MHSA 1JX6A 2I8LA 2VBCA 3TF5A 1EUQA 2Y1OA 3KB2A 1LTHR 4TVOA 2PY6A 2G9NA 3IEIA 1OXUA 2Y9PB 1KY2A 5E4YA 3EUFA 5EHGA 4G5XA 1JAXA 3HCAA 3UUWA 5B55A 5ES4B 2C77A 3G5UA 3MMNA 5CEFA 2W00A 3QLTA 3O4IA 2WDZA 1PV1A 3DEJA 3OIVA 3OLCX 4I1SA 4RFSA 2NPFA 4P08A 1NYTA 1F14A 1WU8A 2ASVA 2IYQA 4IIUA 5JASA 2VDKB 2XTJA 2I6SA 3CZAA 1AHIA 4L4UA 4DVGA 2ZS9A 2PGJA 3AMVA 2WU1A 3C3MA 4RIHA 3TZ6A 3TE7A 1U6IA 1H0RA 4RAOA 4KPUA 3MHTA 5CA1B 4WCFA 4WNCA 4WUTA 4MIEA 3INNA 1Q1AA 3VPDA 4C07A 5KUTA 4KV7A 3GD7A 1D1QA 3BD7A 3L1VA 3ND6A 5CVTA 4DB4A 5IC4A 1QH8A 2W11A 4J2HA 3IBYA 1RTTA 4D82A 5FLXA 3WHKA 1GRVA 2E4YA 1BKDR 1Q14A 4DG5A 1MO4A 3HC7A 4K28A 4FOTA 1SD5A 2ZI5A 3AY6A 2QKYA 2Z08A 3FJ1A 4HAOA 3IA2A 4P3KA 2OQVA 4DR5B 1CSEE 2PRZA 1RYYA 1TGYA 3GJ7A 3P9CA 3CC8A 2QTCA 4KWTA 1GNVA 1GSAA 1PWHA 2VK4A 2MSNA 3AR9A 1DEAA 2AR0A 1W2HA 1CP2A 2FUG6 4KFSA 3WDKA 5BV1A 4B71A 3NHLA 2P6NA 3OOYA 1I7SB 2VYVD 3GVCA 2O14A 2Y2VA 3FLBA 1A4RA 3MYRA 3X1WA 1PBTA 2ZRJA 3L4KA 2EFDB 4XGIA 5I9TA 3HUDA 3L7YA 4QT4A 1LB1B 1R4ZA 1BCRA 2W58A 4GPEA 5EP1A 3DT9A 4L4YA 4INZA 4EBFA 1JFTA 2CMGA 4GPZA 1H0HA 1EDBA 2JFZA 5A6SB 4C4RA 1P9NA 4CIWA 2V3VA 5BSMA 5IKMA 2GHRA 1E32A 1H1DA 1QKIA 5ETJA 1QOPB 1IM5A 2UYGA 1NFFA 4OX9B 3DBLA 4OHZA 3WAJA 1M8JA 4RJKA 2CXXA 3H1BA 4WV3A 6REQA 1QP0A 3BK1A 1Z45A 1A4IA 2R3SA 3KLNA 1HBJA 2WV7A 3FCAA 4P22A 3R76A 3IUJA 2HIGA 5K3FB 2J4DA 1E2EA 4KI7A 5I4IA 3G02A 2UKDA 3SJCA 2Q6TA 3WKEA 3PX3A 3F96A 8AT1A 2ZT5A 3LBIA 5I7WA 4N03A 3OPVA 5JIBA 2O4CA 1K8ZB 4HNSA 4ZDWA 4D26A 3RTEA 4LYDA 2OORA 1V3UA 4WE3A 2PL5A 2JIMA 4CKZA 1ZSVA 1MGPA 4HZUA 5ENDA 4OXRA 4U7HA 5EJ5A 4QQRA 4CF4A 3E7FA 4L85A 2JGLA 2I2BA 1T3TA 4INOA 3WIDA 2PFKA 4RABA 4UFPA 2VTKA 1N1GA 2WINI 2C42A 4Q4JA 4DLWA 4OQXA 2JC3A 5EIBD 3VHQA 4AZ3A 4EA8A 2P2YA 4GKAA 4H9GA 1SCAA 4NFLA 3JVDA 1W29A 3ZDDA 2IL1A 2Q5IA 4J43A 3AV3A 1E1RD 4MV1A 1BQ3A 4Y1GA 4ETNA 2AMFA 3WRYA 1JWLA 2RB5A 2W4IA 4NPAA 1T4GA 3OEEA 3VNSA 3WLMA 5FR2A 1Q91A 4RKFA 5KI6A 1PYOA 4LZOA 3CZCA 5DTMA 1AKQA 1OWNA 3NHYA 2BI8A 3DFUA 2VUHB 1U3GA 3DJYA 2QJWA 3ICOA 3QUTA 4BQSA 5KTOA 2WFLA 4HB2A 2XT9A 2BLNA 3T1QA 4IH9A 1G8SA 4UPEA 2IYOA 3PP8A 1UEXC 4TS9A 1NNSA 2G7MC 2AQ8A 2WHPB 4O33A 4RD0A 2CVZA 3OTQA 1W5FA 1W0CA 1JQ5A 4YDSA 2GLUA 3FIUA 1QF9A 4MVJA 3HJRA 2W2LA 1QUFA 1RCTE 1T35A 2ZSKA 3A4VA 3BWXA 3LHSA 5DNUA 1MQ8B 1LPOA 2BLLA 1SXJD 3H0CA 3WBKA 4XUGB 3WZMA 2N1BA 3LCCA 4F7WA 3GAMA 5HX7A 2OBYA 3ZZNA 5I9IA 3N0WA 4LBVA 3HCBA 3PL1A 4Y8VA 1JDZA 2DLNA 4PZAA 2XOEA 4KE7A 3V4LA 4ARVA 2IV2X 4CLRA 2ZJ3A 2CN1A 2YWDA 3DMRA 4YQEA 4UHBA 2JK1A 5JDCC 4BEJA 4TTTS 1E2BA 5FQNA 4RUKA 3HCEA 5T8KA 2QP4A 1LBHA 3SQLA 3NGMA 1HDXA 4QBFA 4BC0A 4OYRA 3A1VA 4J2TA 4E2YA 3TOZA 2QDXA 1FSGA 3PITA 3TZLA 4G23A 5L3SB 2WWTA 3L7JA 2H54A 1XPOA 1FS5A 2RGAA 1PZHA 3L5KA 4ZXFA 2VHYA 3IB6A 3ZQ6A 4BXOA 3EVAA 5CA1A 2PKQP 3JQCA 3IS3A 4A36A 5F1KA 2VA8A 3TSOA 1Z5WA 2PZLA 3IDZA 1V26A 4GVLA 1SA0B 1DADA 4EFKA 5FUXA 5FWYA 3W5DA 3C4QA 3LXUX 2Z6UA 4YALA 2HU5A 4I4CA 4LSGA 4QQ8A 4BMXA 3DOOA 2JIZD 5FEMA 2IK8A 4J0DA 2J3QA 2OEPA 1PTJC 1U2SA 1Z36A 2EYUA 2UXDB 1Y98A 2ZXFA 2C5SA 1U94A 3D4BA 1LPSA 4EG8A 9ATCA 3JAMA 3IXLA 2MSDB 5E9JA 1YNSA 2PTHA 5K4AA 5D5PA 4DDKA 1TVKA 2QX9A 1AHHA 4FDLA 1O03A 1W47A 2V7TA 1K8RA 4V0MA 1IN8A 1I3KA 1Z56C 5E6RA 4B2YA 2YV2A 2Z4RA 1YR6A 4MR8A 2H65A 2L17A 5H9VA 1F6DA 1L1EA 4WEQA 3S40A 1VL6A 3CE9A 3KVNA 1A4XA 3ZYZA 1YRBA 3G2PA 1KIAA 2ZB3A 3QYAA 3KOWA 2YJ6A 2AEJA 1SKMA 5CK5A 5EE5B 1T4DA 2OWEA 4PQYA 4XOUA 3UJBA 3MF4A 3QM1A 2C4WA 3Q8WA 4BPBA 4Q66C 1IH8A 4M1TA 4EKNB 4HAIA 5GM2A 3SJZA 1ZD2P 3L8ZA 1P1RA 3JQBA 2IPXA 3KJEA 3LQQA 1KI7A 1XVLA 3K6JA 4YPOA 2XSZA 2QVXX 4JJIA 4QHSA 1X1RA 1S01A 3A7DA 4R2KA 4Y9SA 3UOAB 4YN3A 2YWEA 3BWMA 4YRBA 4WN9B 4TLAA 3H6HA 1Q0UA 3QPBA 1LLFA 2G36A 3ZDYB 4RV4A 2O5RA 1W581 2CV0A 2O0JA 3LQ2A 1QO9A 3GWGA 2IH4A 2G8NA 1JIVA 3RHTA 2AUNA 1MRSA 4JA2A 2OCBA 4I3GA 1U8AA 4RF5A 3EVFA 3TW4A 3W1EA 3H2GA 2XUZA 3TLGA 1QB8A 5CLFA 2IYEA 5KSZA 1JDSA 3FHCB 1T9HA 4RU1A 4RVUA 1UAGA 5HIMA 1KY3A 3BD6A 1ECPA 3PDWA 5K03A 1CS0A 3UAZA 1A2QA 5JOQA 2YWJA 2PWPA 4C78A 2OL4A 4II7A 1JI3A 4M1EA 3V8NA 3ZDFA 1HYGA 3F9RA 1W1IA 3QQPA 5C31A 4UHFA 2GAAA 5JI2E 3C48A 4OI2A 3L8YA 1FNMA 2OZVA 4G8JA 1J09A 2CYAA 2WJ6A 1SRRA 4OPMA 3HQ4O 5BVHA 1RLUA 2QUIA 3ROGA 2JW5A 1VIMA 3GMIA 4M1OA 1FLDA 3I6YA 1QFSA 1MN6A 1QLHA 4M9ZA 3HPQA 3Q7IA 4NOJA 3S1AA 3WK4A 3ZEAA 3QX3A 1TYAE 1EQ2A 2HFKA 2FW7A 2AI2A 2ZS7A 3EIWA 1X19A 4NOMA 3ZN2A 2HWXA 1UBHS 4Q3CA 4X54A 5LMZA 5LR6A 3EG9B 1XAJA 1GNTA 2DFPA 3KJQA 4LSMA 4PTLA 1C1DA 3GRAA 4HVAA 1B0ZA 1HKUA 2QLTA 4EJFA 2XE4A 2O0KA 4EG7A 1YUMA 4A73A 2IVFA 2QYHA 4QKQA 4REQA 4HQOA 2I6TA 4G07A 1A8SA 1BXGA 1QRTA 2HYIC 1R0XA 1KP2A 3GDHA 3H3JA 4H31A 1J7JA 2I78A 1PT5A 3LA6A 3JQ7B 3MPOA 4Z3KA 4G1VA 4P4LA 3P8ZA 4DTIA 5B6PA 4YCNA 2UZ3A 2FDXA 4XYMA 2BMVA 3MWFA 1YULA 2BBOA 1A9OA 2HNAA 1ZIOA 3RSCA 4BQIA 4JB2A 2AN1A 2WSBA 4LJYA 1PJ8A 5TRTA 3B36A 2PMKA 4WJLA 2FMUA 1C3EA 4DMRA 3HEBA 1FTGA 4P7JA 2GN2A 2Y0PA 3T3HA 5AI9A 3G5TA 2M32A 2XWJI 4YP6A 3CLTC 3F46A 5MGBA 2G9RA 1BQEA 5TVKA 4CMAA 1XWIA 4UTPA 5IM4F 1E1RA 1JAIA 2DQSA 2X41A 1E1YA 1TUEA 3PTLA 4RW0A 3AJEA 1P2FA 3I5XA 3V33A 1DDOA 3L6DA 3LUKA 3OVMA 2CFTA 4A6XA 3RYCA 4IVNA 1F8XA 3FW1A 3M89A 1MPXA 3FPHA 2XF2A 2ZG6A 1UFQA 3PC6A 4HY3A 4JL8A 4K6GA 3U4DA 2IHKA 1Z08A 1VZ2A 2NG1A 4C1BA 3DEHA 2EFHB 1J9GA 4HB4A 4UU1A 1WP9A 2LTAA 3PB3A 4OXQA 2QMOA 4EB3A 3H5AA 1FF9A 4DV5B 3CQ9A 3RK0A 1T0IA 2QIOA 4QNRA 2IH2A 3I1JA 2W90A 3ENZA 4X20A 3H9BA 4MVJD 5T41A 5TE9A 2W2LD 3S1LA 1NHGA 1ZJYA 2HMVA 2TS1A 3NEJA 5B7NA 1M5UA 1YBHA 2QB5A 3LX5A 4QQKA 1EXWA 3CUTA 1TQ6A 5GV8A 1VFPA 3ONEA 3M0EA 1TU4A 3OG9A 4P86A 4AAYA 5FLKA 4OX9Y 5CPBA 4CU5A 3H5TA 1HK7A 4BJ5A 4TS4A 1NRIA 2YV5A 2V0CA 3OF5A 5BNTA 4G0UA 3FDZB 2IIPA 1UP6A 1PW7A 4Z8XA 1QH0A 1Q92A 2D1FA 1U7XA 2AEMA 3ZJ4A 2WUVA 1N9KA 3ICPA 3PPYA 4NU8X 2JB9A 5JXJA 1K08A 2FN9A 1K5HA 1XTBA 2O7QA 1DO0A 3NAMA 4IEEA 2BFDB 4M3NA 3WRXA 2R7KA 3IE2A 4F46A 4DDWA 2ZCUA 1PRYA 3OC6A 3R5HA 5ELLA 2B3DA 3PNMA 1UBGA 4MW0A 3ZWKA 1RBZA 4XA8A 5J1SB 3ZG6A 3ND9A 4AP9A 4H59A 3JD1A 4A0FA 3HDTA 4E5KA 1O94A 1RWMA 2PT6A 4ZGWA 1J5PA 2BMWA 2X0DA 3AVYA 4H7KA 4H35A 5A2QA 4FFBA 4J4HA 3N3BC 3ME5A 3S8MA 3K70B 1RI1A 1XNRB 3EFOA 1OCEA 3PDJA 4D9KA 1WQ4A 1X1CA 4RORA 4F8EA 3ENNA 3RO7A 1E5LA 2JHCA 4C0BA 4WZZA 5LBUA 5JQGB 1XZDA 4F60A 5JWOA 3S8YA 3H75A 5HF5A 1ZQ9A 1MF7A 3PGA1 3HFJA 1T6ZA 3LYHA 4L0DA 1C9KA 3U26A 2CFOA 1NC3A 1GGKA 2WQZA 4TKVA 3KKEA 1OUMA 3E8XA 2JD1A 5FBRB 4AQYB 5F76A 4C7BA 2G9VA 1CRQA 2AZDA 4LF7B 3S2IA 3WGUA 5EJ8A 3LU1A 1PR1A 1CNEA 2AOWA 2CUKA 4KQIA 1HZJA 1N0VC 1YB5A 2FWPA 1J2RA 3QNUA 3DUFA 1ARZA 4O3FA 5J4LA 4DFDA 1Z8DA 1YTUA 1ACLA 1ZPDA 2A9FA 2FF7A 1L4EA 2RHGB 4ZJPA 4CM5A 4QTUB 1HMYA 4KN6A 2VA9A 5DXJA 1YA6A 1RRVA 2WTEA 1T2FA 4UREA 2M6RA 3D5TA 3WB1A 2HDOA 3O8BA 3NOOA 1PJBA 1DOAA 1QHHA 3C7KA 1OY1A 3FMPB 3B5EA 1JFFB 5C8DA 3F6PA 4ES6A 2ZWIA 3QOWA 3KIPA 5A2GA 4D96A 3DLHA 2QENA 1WSWA 4CMEA 1L4KA 1RAHA 1CRPA 4FHGA 4D42A 2VAXA 3D8BA 4L75A 1IHPA 4RM3A 3VR3D 5C1PA 2I7VA 3BL8A 1U3UA 1N5IA 1XTIA 1L1RA 3LRTA 1DQYA 1FMCA 2AS0A 1HNNA 2I34A 2DH5A 1RDFA 2ORVA 4OHFA 3DFZA 3ZLUA 3PI6A 4RJTA 2PHZA 5CFQA 1BIFA 1TA0A 2WF6A 1SK9A 1XMSA 3U62A 3UWPA 1NI3A 3LCJA 5JCJD 4ADSG 1O1YA 2P1ZA 2IKQA 3MJVA 1J42A 1JS1X 4TWBA 4EA6A 1QQBA 3EIEA 3M82A 2F2TA 5DEOA 4DV0B 2ZJOA 2WZQA 4FBGA 2IBTA 3O31A 1QCCA 3F7TA 1U1DA 4CMEC 5BUCA 5FNZA 5JECA 1X8KA 4HN2A 3ONNA 1VHTA 4JJ4A 4DSNA 1UJ5A 5F2KA 2WYHA 4EB8A 3MIZA 1KYTA 2JRCA 2QU8A 3I92A 1KJ8A 2AMLA 2OXFA 3ACBA 1P1FA 4DR6B 3V9AA 3HO6A 4QUAA 3DJFA 2BR3A 1ZXLA 5JTTA 4IIYA 2KBFA 2G28A 1I33A 2E5FA 2X7JA 3HCFA 5DGDA 1A82A 5IBRA 3T12A 3ZU2A 2VDOB 4YMSA 4Z7JA 3EGIA 3NONA 3EPLA 3AILA 3V1KA 4EY7A 2O8BA 3QF7A 3RJTA 3AW9A 3W9SA 4AJHA 2IXTA 3BD8A 3RCBA 1LSJA 1QO7A 1U0TA 4GOOD 4G67A 4EJSB 1ZIYA 3MINA 3VZRA 2OBXA 3R3SA 2NXNA 3NAQA 2H4YA 5DCUA 3ETDA 5DSXA 5BQ5A 5FBVB 5ANRB 3ESYA 4IJWA 2JCGA 3FLMA 4L8GA 4KNVA 4CMHA 2D2FA 2VQEB 3REQB 1R88A 1EFPA 1XJ5A 1Y37A 1Q44A 1M1ZA 2EBFX 1FTYA 2G0AA 3BMOA 4KZPA 4B4VA 1T2EA 4NCJA 2CLOB 3T3EA 3CZ5A 2PEYA 4N3NA 3KOXA 4YMVA 1W36D 3UKOA 1V11B 4KDRA 1A5TA 5EQJB 3BDIA 1ZH6A 4AKEA 4OSPA 3DDSA 2WWWA 1F8FA 2DQ4A 4L5CA 1YACA 1T1RA 5C4IA 3BFPA 1R6BX 4PF1A 4LV6A 2ZIGA 4FFWA 4Q7KA 2DFNA 4MGHA 1OU4A 2DWUA 4OFXA 1FDRA 1XAGA 1JKIA 3OCXA 2IOFK 3QBEA 4JUDX 3IUNA 5CLGA 4JP3A 4DLYA 2R97A 1S9HA 3SX4A 3QF4A 4F6CA 2V7EA 1JEEA 1JN0A 4X93A 2HY7A 3NT5A 2BISA 4DOMA 3CRRA 2JEZA 4Q6WA 4HDSA 4BNJA 2D7CA 3VAZA 2FR0A 5FPQA 2C4TA 3VNVA 1JDJA 4GC5A 4RJLA 5ILGA 5J23A 4H3HB 3WMXA 5F5LA 1TCAA 2ID9A 3AP1A 3S55A 5EWJA 5CD9A 1I32A 4YONB 3PNVA 2QRLA 1KEEB 2P9BA 3LYUA 2X0RA 4LYGA 5FULA 1KBOA 3KAJA 5KYUB 1EK0A 2J0EA 4ML3A 1M0TA 2PKQO 3K92A 2NQ2C 5KHAA 4TRRA 4CCSA 3C6XA 3PYMA 2VF5X 3VKWA 4OB7A 2BKLA 3L0SA 4NAHA 4LRTB 1IN4A 4ZVKA 1WLYA 1B6TA 3S2SA 1T0JB 2FEOA 1LPBB 3LV8A 1QH8B 3BORA 3KWFA 3WA6A 2VH5R 1F5SA 1DIGA 2ZYAA 2BJHA 1G0OA 3PVCA 4MK4A 3T5DA 1SB8A 2X15A 3PQ5A 1ISMA 2VH2A 5HZGA 3GP3A 4EEKA 2NZXA 1QVZA 2B1JA 2DQZA 2UAGA 1LV7A 5G2OA 1Z2AA 3GWZA 3KBBA 3N53A 3UK2A 8OHMA 4NTZA 4H1WA 2IY9A 3DT6A 4W7SA 5LD2B 3AHIA 3H4VA 2A3NA 5GV7A 3M7IA 1EA5A 5JQGA 1AUVA 4YCJA 1DRWA 2P1DA 1SU8A 4HWPA 3ZWOA 4BFYA 3G9ZA 5G40A 1T8PA 4DCNA 1OX4A 4JMLA 3RNOA 2I67A 1O94D 4PNEA 2E6UX 1UBKS 4WZBB 3RVBA 3FDXA 2ABWA 3I8OA 3PC8A 3E9YA 4XTRA 2RI1A 1PIWA 4KFRA