4BRWA

Crystal structure of the yeast dhh1-pat1 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
b'NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVDEFMDKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE DHH1
publication title Structural Analysis of the Yeast Dhh1-Pat1 Complex Reveals How Dhh1 Engages Pat1, Edc3 and RNA in Mutually Exclusive Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA02
2YZ2A 4RD1A 3FYHA 2ZJ8A 5AJYA 4DHEA 3NVAA 1YZTA 1KI8A 2XTMA 4C0SA 4W5WA 2OSBA 2I3BA 4DDVA 1PVOA 2YWEA 3S1AA 4G01B 2EVWX 4M53A 4OQLA 5CJ2A 2WJIA 2ZI3A 1A5TA 2G1JA 2IK8A 2RH5A 4JLMA 4US1R 1FUKA 4EQ6A 4I4LA 3ZQJA 3RDPA 2AD5A 4KSBA 2JLRA 2YWFA 3BB4A 3TMKA 1MV5A 4Q7JB 4DSNA 5IT5A 1S8FA 1G291 3KKQA 2H16A 4RD4A 3TVDA 2JIZD 1ZD8A 4ZKEA 4D4MA 4P31A 2LWIA 3L82B 2V9PA 1COWD 2O8FA 3K9GA 3RNLA 2CJWA 1E1RA 3O47A 1TU3A 1D9ZA 1II9A 1GDDA 4LHWA 4BUJA 5D3MA 4OHXA 4M1OA 2H1LA 4HLUA 4L15A 1KNXA 2OCYC 2QI9C 3QVUA 2G0NA 3K09C 3SFZA 2GXQA 3P32A 1OXUA 4BFYA 1ZM4A 3LA6A 3TK1A 2V3CC 3L43A 4TYWA 4IVPA 2V54A 5J4VA 3BIFA 2QM7A 2V1UA 4B6EA 2ATVA 3LV8A 1Z2CA 1X86B 3IQXA 4KYUA 2C9YA 4R7ZA 2IBMA 1CR4A 3AF4A 3R7WA 3SBDA 3T61A 3AVYA 4F7WA 2F7SA 4Q5IA 4QXAA 1MRNA 1RRGA 1CJUC 2P3SA 2IEYA 4A8JC 4PPFA 1DG3A 2E87A 5LBIA 1OH5A 1W4AA 4CF7A 4E03A 1XWIA 3RRZA 2CK3A 5FBVB 2FX3A 1SKYB 4QM6A 1UJ2A 2LKCA 5G41A 1SVWA 2QAJA 3IQWA 5DH9A 4FN5A 4JLAA 4YXWA 5JS7A 3OESA 2G83A 5FTMA 3K70B 2IS4A 3BJIC 1CJKC 4QNRA 1ZNXA 4RVCA 3FMIA 1OIVA 3EA5A 3OE7D 1VMAA 4OQNA 4HSEA 3GEHA 1G3QA 2QMOA 2P6RA 2Q9BA 4RFVA 1E9EA 1ELOA 2GILA 1TAGA 4B35A 2WWHA 1Z28A 4B76A 3VU9A 4BEBA 4EPYA 3LLUA 1Z07A 4G3XA 2BMDA 4GOKA 3UATA 1KI1A 4OI4A 4HDQB 5AJZA 4E07A 3W9YA 5AJXA 2XITA 1R0WA 4PTLA 4C4PA 4V0LA 3R9XA 3EWSA 3UK6A 1E2MA 3CWQA 4DCVA 5BWMA 2JAQA 2VHTA 1EFRD 2ZS8A 1Q0UA 3SS8A 4KBGA 4NYJR 1QBKC 3THWB 1G8GA 2RMKA 1X8LA 2C95A 5EZ6B 2O8EB 4RZUA 4DLTA 3QE0A 5EE0A 1JBKA 1CS4C 1NL3A 4ACAA 3L8YA 5IK2D 1E98A 2YWHA 4PHGA 1Z2AA 4CEIA 3KQNA 2IC5A 1H8HA 1G4AE 4U02A 5EXXA 3TAHA 4JL6A 3PXGA 1UBEA 3EZ6A 2GNOA 3IIKA 1R7RA 2NOAA 4LBYA 1XTKA 4KFSA 4A0GA 1CRPA 3QXSA 4GOJA 2PZEA 3P4XA 4QFMA 2YOHA 2DY1A 3QPWA 1A4RA 1T0JB 3PR1A 1F2TB 4NDZA 2JEOA 5HKKD 3OFND 4JVMA 3W3ZB 2CMKA 4OBEA 1LW7A 2VA8A 2QGNA 5LB2A 4Q4JB 4NU0A 1XEFA 2ZRAA 3REGA 3V4RA 2WV9A 1G3UA 4GT1A 4W5JA 3QKUA 1NMZA 5FPHA 2ZYVX 4DIEA 4LV6A 1QF9A 2F1HA 4QNMA 5HZKA 3QG1A 3BB3A 2VSXA 3IPYA 1ZU4A 1OW3B 2C9OA 5KTYA 5E4FA 1UKEA 3SBEA 3V9PA 4Z54A 2O8CA 1RRPA 3SZRA 5BQ5A 1NNEA 2QENA 4RFSA 2GA8A 4C0KA 3ECCA 5LPNA 3EPLA 1M74A 1NIJA 4UNQA 2D2EA 3SJCA 1PUIA 4JVNA 1IQPA 3WHKA 1II0A 1D6JA 3AQ4A 3BFXA 3ZIAA 1M8PA 2QTVB 4RZ2A 1MOZA 2ZE8A 3U6BA 5J5CA 3O8DA 5M04A 1JR3E 1O3YA 1Z6XA 3OAAD 2OFXA 1TMKA 2WMOB 4DXAA 4D4KA 3REFA 2XZOA 2B7BA 2ZU6A 4JSTA 5JLJA 1U81A 1VG0B 2JLSA 4A0RA 4TL8A 4F4IA 3A1SA 5SZJA 3OIVA 2D74A 4ABYA 2ODWA 1JALA 3J81k 1LY1A 1WE2A 3G0HA 3KXKA 5F9FA 2Q6TA 2IUUA 4EFLA 4EQ6B 2AWOA 1YKSA 1DEKA 2H57A 2ATXA 2FOLA 2GTPA 1QRAA 1NP6A 3IHWA 4DWJA 1IY2A 2GDJA 3CUEF 1HV8A 5C2JB 1G7SA 2GETA 2XB4A 1NVWQ 4ITRC 4A2WA 3AF2A 2X19A 1SXJC 1NN3A 2QP9X 2WICA 3MRSA 2XNDA 4BE7B 2XTNA 1NLFA 4M9XA 3IO3A 2BJVA 5FPYA 4BECA 2I4IA 4NKRA 3VTKA 5C4MA 4DB4A 1HURA 3MLEA 1TQDA 5JWHA 1BYIA 3IKJA 4Q4AB 1LV7A 1A1VA 3FE2A 1IN5A 3CPJB 1W0JA 1VG1A 5BN3A 2C77A 4EJSA 2GK7A 3UXMA 1NKSA 1C4OA 2V6JA 2NG1A 4Q7LA 1M6NA 3PVSA 4BLQA 1E79D 2JDIA 3IUYA 1XXHE 5JCZA 4BEJA 2ZRMA 1V43A 5FOWA 1XF9A 2FU5C 1JQJC 3HPRA 1W0KD 2OHFA 2H18A 2PLRA 3M1IA 3QVVA 3QF4A 4JLOA 1N25A 4TSFD 2WSSD 2WVJA 4RKFA 3TQCA 3GEEA 5J4YA 3LY5A 4KCGA 2BKUA 2ZSDA 1FTNA 1M1YE 3B1ZA 4PXAA 4GRAA 4G5OA 4LC0A 4F4CA 1QDEA 1SVOA 2J45A 5GVRA 4QBFA 1LVGA 5EXSA 1W4RA 2VP9A 3WYFA 4HAUA 4PO9A 5E3HA 3THXA 1P73A 1QVRA 5P21A 2YYZA 2RGNA 2QT1A 1KO4A 2A9KA 2EFCB 4MGZR 1NLZA 1DO0A 2JLYA 3IEUA 4MRVA 2PMDA 3U7HB 3RC3A 2BDTA 2GBLC 2VO1A 3VR6A 2ZRNA 3OIWA 5EE1A 3P1JA 2OXCA 1CJTC 3TJZA 1ZM7A 4EPWA 1QG4A 4EUNA 1KK3A 1W4BA 5FBRB 3RANA 3SYNA 2ZRBA 3CRW1 2NMVA 3RS3A 5D3QA 4TMWA 3TGPA 4LHZA 3RRNA 2BBSA 4DT1A 4I1OA 4DJTA 1HYQA 1CULC 2N1BA 2OBLA 1M7GA 4NYJQ 1KZ7B 1EFTA 2JLVA 4XD7A 4DCSA 3DM9B 4HB2A 3ADCA 2G3YA 1WQ1R 1TUEA 4C0AC 1X1SA 1IAQA 1R5NA 2GEDA 4LZZA 4NH0A 3HU3A 1X8KA 3WNBA 2NO6A 3QI2A 3T1VA 2N46A 2MMCA 5FOUA 2G88A 2QTHA 3PFIA 3ZLJA 1KGDA 4JYCA 4LUCA 5FUWA 5L3RA 1NY6A 3K70D 2QBYA 4BQSA 4URYR 2X1VA 4A0FA 2C99A 3THOA 5EE3A 4LHYA 1J8YF 3NC1C 1YR6A 1GITA 3GLFA 1FP7A 4Q9KA 3LLMA 4FWIB 3GLIE 4CW7A 3V00A 4DSOA 5J4KA 2KBFA 2OAP1 2Q0HA 3A1UA 1XTSA 3GQBA 1JR3A 1YR7A 2EFEB 4W7SA 2BV3A 5KO2A 2IYSA 2OCBA 1WB9A 3GJ3A 3GMTA 5KDDA 1ZC4A 3ZVNA 4HLUC 1OFIA 1XCPA 4CEJB 1YR8A 2F55A 3T5GA 1OXXK 3C8UA 1P9WA 4TLCA 2W58A 2WM9B 3L0SA 3A1TA 1NVXQ 4D0NA 3PQCA 3MFYA 2AFHE 4Q1DA 3ZGXA 3ZDQA 5AUOB 4L9WA 4Y0AA 4MYCA 1DVRA 3C5HA 5DGXA 3SHWA 3CLVA 2O8CB 4G5RA 5FBWB 2WOJA 4Q4HB 1NMYA 2CLSA 2AK2A 2OFOA 2OE2A 4BFUA 2ZE6A 4UJ5A 2RGDA 3RYTC 5GADl 3QXCA 4QOSA 2JJ1D 5L3QA 3MSXA 4B32A 4TZ0A 3GFTA 3VNUA 5FTNA 3AVOA 1II8A 3AEZA 1QHHA 3DDCA 4AKEA 2PT7A 1RVDA 3K0AB 2KE5A 3SHFA 2XGJA 2WHXA 2D06A 2GAOA 3ONWA 1UM8A 1J90A 3DMDA 4BLRA 3GLHA 3LFUA 4EPTA 1L4YA 1AJEA 2UKDA 4D4LA 1L4UA 4LJ9A 4TLAA 2DWOA 2XTZA 3EZFA 2ZXUA 4QJ3A 5B57C 3QPUA 1CRQA 1P3JA 1F60A 4HAVA 2NPIA 1TL7C 1E9FA 4FMDB 2WWXA 1E2PA 2JGNA 3DOFA 4QJ5A 3FB4A 1XD2B 3X1ZA 1UBCA 4DCNA 5FPTA 5C46F 1FW6A 1NBMA 3H86A 1X1RA 1XXHA 4AURA 4B3GA 2HCJB 4M0LA 3BWDD 3CH5A 2ZE5A 3KKMA 5L3VA 2HYIC 1Q3TA 1C9KA 2L0XA 1KK0A 3I1FA 4C7OA 5FL7A 3NKVA 5FBQB 2NO9A 3Q9LA 4OHWA 1G8PA 2IHBA 4KI0A 3SI7A 1H8EA 5DSZA 3K0SA 3O8RA 2F43B 4MITA 2QROA 2KWIA 2F1IA 2JLXA 2EFDB 3OHMA 3EZ7A 4U7DA 3IPXA 4BFZA 3TH5A 1OKKA 2IX3A 2IF2A 2ZAOA 4D0GA 1G5TA 3AM1A 4PX9A 1S9DA 3A1WA 1OIXA 4TLEA 4Q1BA 1E2IA 1R0ZA 1W1WA 3AKCA 5G3ZA 4IVRA 1IY1A 4IHQA 4ZKDA 4MKFA 3QENA 4V02A 5AUPB 5JWOA 2ZUBA 5CIQA 1E94E 3QF4B 1P4SA 4URUR 5TB5A 1Z0KA 5DN6A 4QGFA 3QKSB 3ADBA 3V4FA 3Q8XB 3FVQA 2FDCA 4OI0A 1IHUA 1XEWX 1JJVA 2A5DA 4ZO4A 1UDWA 1Z06A 2ZM5A 2DPXA 1X8JA 1T0HB 3Q5DA 3THYA 1E1RD 3HR8A 1HTWA 1LB1B 2QUZA 2GJ8A 4C2TA 4DDTA 2Z5FA 1TF7A 3KJIA 1QVAA 1R8QA 4M1TA 2NPFA 4B47A 3U44B 1RJ9A 1YU9A 3EA0A 4B74A 1G4UR 2Z83A 1HY3A 4PAOA 3RS0A 1ZNZA 5CM8B 1D9XA 3EZ2A 2AHOA 3UPUA 1P9RA 1YZQA 4F4JA 1CTQA 1IJEA 4GI7A 1S0UA 2O8DB 1E0SA 5AUQA 5FUXA 4M1SA 3WMFA 3GLIA 1F6BA 2FEOA 2RKOA 2ORWA 5B58C 5KYKA 3W6NA 2ZYUX 1N0VC 3AGPA 3CRVA 1UBGA 2C2HA 4C9BA 2YOGA 2W6JA 2BBWA 4TL9A 1LFDB 1Z47A 5DHFA 2QQEA 2ZJAA 2VHUA 4DDWA 5G3YA 1GIAA 3SFVA 1UAAA 1PLKA 4OHVA 4L4UA 4ZDKA 3QXXA 2ZVPX 1I4LD 2CK3D 3AVVA 3AUXA 5CB8A 2QPOA 2A2ZA 2AXNA 2GEUA 2NIPA 1FTSA 2QT0A 5FOXA 4LBZA 1T6NA 1L8QA 2SHKA 3CPHA 5FL3A 3DMNA 3ZD6A 4YXWD 1KZGB 3QY0A 4RD6A 4MDEA 2BIFA 3K53A 3I62A 4B75A 2QBYB 3HYRA 3PJRA 4QM7A 4AYXA 4IDOA 5F98A 4EPVA 5CJPA 2QTFA 3FPAA 4IFBA 4WA7A 5CYPA 4PHHA 4B3DA 4D81A 1Z22A 2JLZA 3QBTA 4M1MA 5KNDA 2ZUDA 4D25A 1G18A 5LB4A 3U61B 1HA3A 1VCIA 1TNDA 4ILEA 1N5KA 3ND9A 821PA 5JBQA 3RABA 1GILA 1GAJA 3NEJA 2GCPA 1GRRA 4TZ6A 1SHKA 1KI7A 1YZLA 3GEIA 2W83A 5JZVA 2IS6A 3WYAA 2UVQA 3QNUA 1OFHA 3TUZC 1Z8FA 5DI3A 2CHGA 3VMFA 1NN0A 3W5IA 2V7QA 1G7CA 4UNRA 3LX5A 4A8JB 1P60A 4RSGA 3X1YA 2ZIAA 4JVLA 4KSCA 4EJSC 2A78A 4CGZA 1TQ2A 1FNNA 2X2EA 2DBYA 1E4YA 4AY2A 2DHRA 3OEHA 3WMGA 5L3QB 5JCPA 2WPDD 4ESVA 1II8B 1KSHA 2DB3A 1G6HA 2B6HA 3ASYA 4ARZA 4TLBA 4P32A 2R6GA 2R62A 3B85A 2J0SA 1EXMA 1ZIOA 2JJ2A 2GHIA 4U5XA 4US0R 1H65A 2EFGA 2BHRA 3L0OA 4MUAA 1IN4A 3N2IA 2IYLD 2RGNC 1KDTA 4GMXA 1SVIA 2QE7A 2BVNA 3BERA 1P9NA 3TR5A 3B1VA 4Q9JA 3UG6A 1BYUA 1XEXB 3AF1A 4G5QA 4DB2A 5CYOA 4LSGA 1C1YA 3K8YA 5CLQA 4CRWB 3PITA 1E2FA 2OZEA 1TPZA 2O8BA 3PEYA 2ZJOA 2DFLA 1SKQA 3CF2A 1XXHB 5CIWA 4OHZA 1BMFA 4PQRA 2O0KA 2Q9AA 3HJNA 1E99A 3F8TA 3RS7A 5KOYA 3U6KA 4EIWA 4C7OB 421PA 5FUVA 1I2MA 3WRXC 2W0MA 4C30A 4MYUA 4TMVA 1EESA 2N42A 3QUSA 4NYMQ 2F9MA 1IBRA 1AS3A 3VR3A 2A7QA 4RJLA 1WDTA 2CL7X 2ZJ2A 3A58B 4Q02A 3K0FA 3L8ZA 2AR7A 2ZEJA 3DEFA 3T5DA 4FCTA 2WOOA 2REXB 1ZMXA 1I2DA 4BFXA 1D2EA 2QMUA 2GVZC 3CR7A 2IYYA 3NBYC 1MO4A 1PJRA 2IYWA 4HUQB 4QC2A 4DLZA 2ZSEA 3HU2A 2J41A 1F48A 3H4MA 2FWRA 1YE8A 1KO5A 3CRMA 5DLQC 2O5VA 3L2OB 1ZJ6A 5BXQC 4LCBA 2VYFA 4Z1MA 4AK9A 4K46A 5DYGA 2PZFA 3BFKA 2ZRKA 1CIPA 4F93B 2B92A 4MGYR 4P33A 1LF5A 1DELA 2YOFA 4YDHB 4TMZA 1XB2A 4B33A 1HT1E 4FMDF 5KSZA 1UPTA 4MA4A 3CWZA 2RGXA 4MUBA 1E9BA 3C14C 1UFQA 3MWJA 4GFDA 5IRCD 5EE5B 1DOAA 4G5GA 1Z0IA 4GP6A 1KI6B 1S96A 4KVGA 2JLWA 2RGCA 4IEIA 5EP4A 2OV2A 3U3MA 2BM1A 1Q1ZA 2XNDD 2LKDA 3LVRE 5K8TA 1RJ9B 3NBFA 2LCFA 3T1OA 1HUQA 3AVWA 1BOFA 1VTKA 2D3WA 3GFPA 1CLUA 1XZPA 4L5BA 1CXZA 2D7CA 2G6BA 4HYYA 721PA 4F91B 4MKGA 2ODNA 3B78A 3SQWA 4RY2A 2QZ4A 4P4UA 2GXUA 2IS2A 3FGNA 2R9VA 3GLIB 4Z8YA 4OQFA 5EZ5A 1FUUA 1W0JD 1CEEA 3EIHA 4Q66C 3HWSA 4KVAA 4M1WA 3FMFA 2OESA 3SJBA 1R5BA 1FMJA 1KJZA 2JDID 1G7TA 2ZVQX 4FCWA 1E2JA 1G21E 4RZXA 1M7HA 3I4LA 1DAKA 5FOSA 5TVKA 2H17A 5UKDA 1OXTA 4LWZA 1WBBA 1ODFA 4A2PA 3KJHA 3VHLB 5FOTA 5DHAA 4D80A 5HTKA 3PEUA 4JZKA 4CYMA 4Q03A 221PA 4H9GA 2FF7A 2GWHA 1W5TA 3VFDA 1J7KA 4WZAE 1WBDA 4PZYA 3TKLA 4A1FA 2FA9A 3TE6A 1SXJB 2AK3A 1NJFA 2RHDA 4FWTA 3OIYA 4PPQA 4BLSA 3KTAA 2VP6A 3I73A 1SGWA 3JVUA 5IHPA 1G8YA 2IXEA 3VX3A 4MKIA 2FFHA 5HPYB 4BASA 4PZLA 1K8RA 2ZS9A 4BGDA 3EG5A 2PJRA 4RD3A 2CHQA 3VX4A 3FMOB 3IBYA 1TTTA 2ZRJA 3M6AA 2IYRA 1JEDA 4GZLA 4LI0A 2FZLA 1NMXA 3PEVA 2QNRA 3D31A 4LDJA 3NG1A 5JHGB 2CVFA 3MCAA 2DYKA 1CF4A 3NBXX 2FSGA 1VCNA 2ONKA 1NKTA 4BZQA 3UWOA 4XD7D 4M21A 1ZNWA 1U0HC 2OFWA 3N70A 1DAHA 1GL6A 4M2LA 4GL2A 1CJVC 1W48A 2DFTA 2EU8A 4YMUA 2R8RA 3SNHA 3VKHA 1OIWA 1XRJA 5F9HA 4DRZA 2IT1A 1UDXA 3QIAA 3OEEA 1FPMA 4IFEA 5BN4A 4WXRA 4PZZA 3WNDA 4A36A 1KKLA 3DPUA 1FX0A 3ND8A 2WJHA 2GRJA 2H8KA 2J0UA 5DO9A 3D3QA 4CIDA 2QGZA 3JVVA 2OT3B 5EP2A 3I92A 3PUXA 1TF5A 3GJ5A 1ZD9A 1FL9A 3AH8A 4X8HA 1W7AA 1KTVA 4BFVA 3QKRA 1KK1A 5DNYB 2O0HA 3NEYA 2GK6A 3T34A 5H8WA 2ZI7A 1JR3D 2Q3MA 3R9IA 2NO0A 2GEVA 3AV0B 4N0DA 2GCNA 4TYNA 3GLFE 3EX7C 3IHLA 3K0CA 4JSYA 2ZR0A 1Z6AA 1KI2A 1ZNYA 4PO8A 2ZE7A 4A0HA 2J5XA 1P2SA 3EWAA 1A2BA 2ODEA 1F2UA 2C9CA 1G19A 3CO5A 5TY0A 5JI2E 4B3XA 3CNOA 1DTSA 4B48A 2CLDX 1US8A 5L3SA 2VF8A 4DSUA 3WHLA 3ADKA 3QF7A 4AKIA 3TR0A 1KSJA 1EFHA 3HPQA 1Z6YA 4KJZA 3FFAA 4NCJA 4OJQA 5AUNB 3WRYC 3LH5A 3S1AB 3C16C 3KUDA 4EPRA 2YKGA 4LJ6A 1IJFA 4CVNA 2FG5A 2K5UA 4JJKA 2EW1A 4IVQA 4JVSB 2IYXA 2ZRIA 1KSGA 1E2EA 3NHAA 4GBMA 5DISB 5SZKB 3GLGE 2VLIA 1N6PA 4LY6A 2DR3A 4Z8XA 3CONA 4A82A 3TIFA 3BAFA 4D2IA 1CBUA 4KLNA 2FNAA 1U0LA 2R2AA 4V0NA 1F5NA 4JBXA 2O8FB 1OFUX 3E2IA 2OLJA 2CJWB 4RD2A 3X2SA 1G20E 2ZI9A 8OHMA 2WSMA 1G3IA 1N2CE 4TWZA 5D3MB 1Z0JA 2F6RA 3H84A 4GMDA 3N5CA 5JSZA 3GLHE 4QBHA 3I8XA 1R0YA 2VEDA 5FI1B 4B2LA 1E2NA 3WP0A 2GZAA 2RGEA 4B34A 3ZVRA 1XCGB 4TN1A 4NL4H 3VR2A 2ZRGA 1KYIA 3LO5A 3PUVA 4ZDWA 4DLUA 4M9QA 1ZC3A 1QHSA 2O0JA 4AC9A 2ZSBA 3KZ1E 3C41J 1ETUA 3IIMA 1L2TA 5JRZA 3R7WB 4HATA 2DWPA 5FBLB 1R4AA 2ODBA 1DAGA 3AVUA 1YZUA 2WZQA 1NBME 4DEYA 2C98A 3U60B 3I5XA 1FNMA 1KOFA 1VCOA 2OLKA 4TL6A 4V0OA 2BMJA 3ZZTA 3U3RA 1A7JA 1H8ED 3AKYA 5E95A 3PEWA 1E9RA 2OO7A 2BCJQ 2HF9A 3B6EA 3EASA 4H1UA 4M1YA 5JECA 2QU8A 3LAWA 4D6PA 1YJ5A 1Z6GA 5K8UA 1K5GA 4F38A 2IYQA 2J46A 1XU4A 2Q3HA 2W2VA 4NCIA 5FR1A 2X77A 1I4TD 3BXZA 1CR0A 1GNQA 3SEAA 4IOLA 1Z0FA 4JBWA 2CNWA 4HUTA 4FMCB 3E1SA 3AB3A 4MQBA 4HLDA 2R6FA 2XB2A 3VU9B 4R2HA 1E1QA 1OSNA 4MRPA 1OT3A 3NDPA 1Q44A 5FFMA 3QEJA 3QQ5A 5A4JA 1VYVA 3GFOA 3RS4A 2MSDB 1XEWY 1N3BA 2CL6X 4PFSA 2BJWA 3KJEA 4QKQA 1Z6TA 1E2KA 1VYTA 1VIAA 3LVQE 4CZ2A 3JZAA 1MO3A 1QHGA 1LNZA 1W44A 1DADA 4O2RA 2XAUA 1X6VA 1XFAA 3ZS9A 5TMPA 5JJKA 4O0MA 3HR7A 1VECA 2KBEA 3X1XA 4L8GA 5GJWC 1TQ4A 1GL9B 4ZCIA 4JBYA 4GPTA 4UNNA 3BS4A 2OEPA 3NC0C 3CH4B 1U99A 3WBJA 1NY5A 5JWRA 4AKHA 3BE4A 1OHHA 2NO7A 4GZMA 2HCBA 3RSOA 4CEIB 4BZXA 5B64A 1UKVY 3VAAA 3ADDA 2KI5A 2KJQA 1N5JA 3EARA 2B7CA 3QJYA 3EPKA 2Z4SA 2ZETA 4URVR 2R6DA 1YHNA 5BN5A 3QXHA 3LXRA 2WKPA 3L0PA 3EXAA 2W6JD 3GJ7A 2EWVA 3OFNA 3ETLA 2OUKA 1OPXA 4Q19A 1ZUHA 4LOAA 3ZQ6A 2XOKA 3U7GA 2RGBA 4DCTA 2QORA 4PQYA 1GNPA 4TMTA 1S1CA 3PUWA 3C7KA 3DVLA 5CK4A 4ZDIA 3TRFA 2BWJA 1ESMA 1SHZA 3UWKA 1VHLA 2IXFA 3IIJA 4YDSA 3D8BA 1KAGA 4CT4B 1GKUB 4ZCMA 5FUYA 1ANKA 1P2UA 1P62B 3HYTA 2WJGA 1ZUNB 2VHQA 3CRQA 2FE4A 2IS1A 1ZUIA 1N5IA 1SXJD 2J0UB 1AM4D 4ZV4A 1OXVA 3W3AA 1U94A 2FFQA 4LJ4A 4RFSB 3VQTA 121PA 4JKYA 1ZU5A 4PC3A 3QKRB 3GLGA 5E7MA 4IOJA 3BH0A 4I1VA 4J0QA 5IDVA 4II7A 1Q1QA 1UKZA 3CKLA 5CM9C 3TUIC 1RIFA 3AF0A 1GKYA 1KNQA 2W0SA 3T1TA 1IN8A 1KAOA 2C96A 1D8TA 2ZYWX 3R8CA 2Q3FA 3I5YA 2QPAA 4JLPA 4OK5A 4M9ZA 1VHTA 3CF6R 1F2UB 3CR8A 1GZSA 1L7VC 1TF2A 5CK5A 4KO8A 1P7CA 4B3CA 4OI2A 3AVPA 2QP3A 5G40A 3A4LA 3I3SR 3BC1A 3DL0A 4X8MA 521PA 2VIIA 3NBZC 2QPTA 2QRZA 3A4MA 3EW9A 4RD0A 1G64A 1Z5ZA 2VBCA 3IGFA 1NJGA 1CP2A 2MMGA 1SVSA 2QP4A 5EQTA 1Q21A 3CIOA 3Q85A 4NTZA 4YMTA 1DS6A 1BO6A 2JJ2D 4CEHA 4KFRA 2GZHA 2WWIA 4KYIB 4XH9B 3UMSA 1WP9A 2YHSA 2YC4C 2ZUCA 1G16A 4DC9A 4QGGA 4PO1A 2HT6A 4BFWA 1G5PA 1JQLB 1JPJA 2AN9A 2GF9A 2QE7D 3QKTA 4NYMR 4UKDA 2CXXA 4JL8A 5JSZB 1E3MA 4TYPA 4C0LA 3QXJA 4N0EA 3VR4A 3BH6A 1ZM3A 1NSTA 2NQ2C 2FFAA 2XX3A 1SVLA 4AIIA 5SZHB 4LHXA 4OHYA 2X2FA 1RRFA 2HEIA 4XJXA 1HH4A 2OM2A 2OBMA 4A6XA 3SN6A 1P5ZB 2Y8EA 1CJMA 1SVMA 2QG6A 3ASZA 4KITB 1W36B 5CDFE 1BMFD 2WIAA 2ZROA 1E79A 2QRNA 4PAMA 3CW2A 4DSTA 2ZRCA 4EJSB 4NHOA 2F3TA 3CX7A 3KUCA 3SJZA 2IA5A 3PUYA 3UMRA 4TSFA 5HE8A 2WSSA 2XSZA 3RWOA 5LD2C 1T8UA 2WKRA 3DKVA 3RRMA 4ZI2A 5FH9A 3CBQA 4US2R 3O8CA 3ZD7A 4IOKA 3ZYCA 2X8AA 4D82A 1TU4A 3PENA 4V0KA 4BLTA 4QG7A 4ASUA 1XTQA 3W8RA 3AP3A 5JS8A 2G0TA 4JS0A 4KXFB 4FW9A 1N6KA 3W6OA 4AYWA 2G9NA 1BS1A 1NVUQ 3NXSA 2FGJA 2DFKB 2B8TA 1HEIA 3CM0A 3RS5A 5JJIA 3RS2A 2H92A 2FSHA 5AJVB 4B43A 3THXB 1XPOA 2D62A 2IL1A 3MUFA 3OZXA 1AKEA 1GTVA 3CF0A 2CCGA 4Z1MD 4NPHA 3B60A 1P6XA 2A5YB 2NZJA 3UKDA 1QHYA 5BW8A 2XZLA 4B2IA 2DFNA 1YR9A 1FMLA 3T12A 5L8VA 4V0ME 3K0CC 4WZ6A 5J40A 3PIRA 2F9LA 4HAWA 1VPLA 4C0BA 4DT1B 1TQ6A 2PEYA 3OF5A 3FMPB 1CR1A 1PLJA 1RE0A 1WF3A 5HR5A 4HB3A 3I32A 5HCIA 3T15A 4WXPA 1T9HA 4KLZA 3NHBA 1T5IA 2F1RA 2J1LA 3IEVA 1S3SA 4P4SA 4TT3A 1G3RA 2ECKA 2UZ3A 4X8OA 4OYHA 1MO6A 1N0UA 1XMSA 1W4CA 3UG7A 1RPZA 2CBZA 3CZPA 5K8LA 1GKIA 5JI3E 4JJZA 3B1XA 1KK2A 1KO7A 1NG1A 2JJ8A 1Q1BA 1NF3A 4B3FX 3RLFA 3F5FA 1O87A 5KSOA 2ZRLA 1Q20A 4NONA 1XP8A 1WA5A 2FJUA 4LJAA 4DZZA 3EC2A 2CHVA 2P0EA 4N1AA 2QAGA 3C4JA 2GF0A 3FHTA 2ZAMA 4QBIA 4Q47A 3GLFB 1QG2A 4JLDA 4Q21A 1LTQA 2G77B 2WJVA 1S9HA 1Z08A 2JLUA 3JZMA 4S35A 3SOPA 1WCV1 2BKEA 4FMCF 4E22A 5FOVA 1XMVA 4JYBA 4QHYA 1OXSC 3U5ZB 3B82A 3LRPA 3PCRB 4IDHA 4QL3A 3IILA 5KDOA 2PEZA 4JT2A 3THWA 5C4GB 4PHFA 1M34E 2EYUA 2O8EA 2CE7A 2I1VB 2GZDA 5H68A 2ZJ5A 1W36C 1DO2A 3KB1A 4M1KA 3SR0A 2WWYA 4DKXA 2WWWA 2W2TA 4UNSA 5BYKA 2JJ1A 3BB1A 3GLGB 3W5JA 2VL7A 4Q1EA 4WOPA 3LDAA 4WAUA 4YMWA 1H8HD 5EUMA 2RAPA 4F92B 2JATA 1A2KC 1MKYA 4QGHA 5EP1A 3W90A 1MABA 1U9IA 3EPJA 1AZSC 3A36A 1QHHB 3Q7QA 3AP1A 4Q9LA 1T5LA 5J47A 1E2LA 1J8MF 4UNPA 3LD9A 4YC7A 1TX4B 1F2TA 3BOSA 2ZJYA 2ZRHA 2HXSA 1I4DD 3GLHB 4HDCA 3TSOA 2AX4A 4TYYA 3DZ8A 1ZVQA 4BRUA 1XPRA 4DUGA 1YZNA 4XWAA 1E69A 4Q4JA 4B73A 1HE1C 4XWKA 5DI9A 2IYTA 2JA1A 4MYTA 4QGAA 4WIAA 1VG8A 2QSYA 1OJLA 2XJ4A 2IYZA 4IOMA 4P4TA 3TNFA 4BPBA 4ON9A 1T8TA 5JJLA 3OEED 2QN6A 5CDFA 1DAFA 1XTRA 1SZPA 4KFUA 3TVTA 3VKWA 1GWNA 1W49A 4LGMA 4XOIA 5BYJA 3GCGA 3K0EA 1IONA 1DARA 3U4QA 1G17A 5GVSA 1ZCAA 3NWJA 3AVTA 3B1WA 1XMIA 3GJ0A 4Q7KA 1JXOA 4Q7MB 5TXGA 1GFIA 3LBNA 2VP5A 4TMKA 3TW4A 3CNNA 3ZIAD 2V6IA 4KU4A 3FDIA 1KY3A 3P26A 4LX0A 5TDHA 1GSIA 1Z0AA 3X1WA 4A4DA 3PG5A 4XTRA 4OJKA 5H70A 1RW4A 2FN4A 4E5UA 4JLKA 1U2RA 2ZQ5A 1NI3A 3B9QA 4LV8B 4D4JA 4IXMA 1NVVQ 1NSFA 1FFHA 4U00A 4AG6A 3IDQA 1Z83A 5FPSA 4ZIRA 4LJ7A 3LW8A 2YVUA 4CDGA 4V0MA 1RKBA 1ESNA 4KODA 2BCGY 1KDRA 1Q22A 4R71A 3O8BA 1KDOA 1P75A 4FCVA 4I99A 5AR1A 3WYGA 4MGIR 1OFTA 2PMKA 1VIYA 4EDHA 3GD7A 4RKEA 1XZQA 2RB4A 1EGAA 2CEAA 2RCNA 4TQAA 3WP1B 2HJVA 1Q1EA 3THYB 3EIQA 3ZZUA 2REBA 3QBVA 3QG5A 1FQKA 4ZDJA 1P72A 3MGCA 4D0LB 2AXPA 4YONB 1RRCA 2P2LA 2YJTD 2HDNB 2ZANA 3LQRA 1IOZA 4L16A 1E0JA 3QPVA 5ANRB 4LYFA 4EFNA 2QSZA 4Q4AA 3H2YA 1QHNA 5K8IA 5KNCA 4ZI3A 3HP1A 2XXAA 5C1BA 4NYIQ 4Q00A 4URWR 1FOEB 4NCNA 2ZRPA 3VR5A 3ZS8A 1W36D 1OE0A 4PQFA 1CR2A 3NTUA 2RHMA 4IRUB 4P4SB 2OAQ1 4EAQA 1AQUA 2VHJA 3TQFA 4PPNA 4KHZA 1UADA 5F2EA 4TMXA 4G1UC 3ZH9B 3BORA 1E2QA 5AK0A 4O3MA 2IF0A 3Q3JB 1MRSA 2FV8A 2J7PA 4L9SA 4PPGA 3A4NA 4DLRA 3FKSA 1MR3F 2HV8A 1YQTA 3U3OA 1FP6A 3AKEA 3KXIA 4FD2A 2QMEA 3AF3A 1YRBA 2WJYA 3FTQA 4Q1AA 2QAGB 1TADA 2CNWD 2GAAA 2PZGA 4QJ4A 4YQFA 2P6NA 1PV4A 3K9HA 1VG9B 3Q72A 4C0JA 1Q12A 1IN6A 1E1QD 2VQSA 2HJGA 2HLDA 1G8FA 3HU1A 1G1MA 1UF9A 3RRYA 1GRQA 4UXJA 2ZJZA 1E9AA 4B2PA 1E32A 2CE2X 1TEVA 1FZQA 3MD0A 3R20A 3UMFA 3F3YA 4HEJA 1U8AA 4LJ5A 2WWFA 3ICQB 1E2DA 5KU1A 2ZRDA 4IEEA 2AL7A 1GG2A 2A3RA 1KKMA 4DLYA 1JXMA 5DI3B 3KQLA 1RZ3A 3B8HA 1XD9A 4AKGA 2VP0A 2W2XA 1KJWA 2GJKA 1ZYUA 1GP2A 1W46A 3MJRA 4YLGA 1Z29A 2VHCA 2QY9A 4RCYA 1IM2A 1PUJA 3B1YA 1EG7A 2PL3A 2WPDA 3H1TA 1MH1A 1OHHD 4XSGA 3R9WA 2ZYTX 4LJYA 3WY9A 4DLVA 4OK3A 3K9LA 1MABB 2TMKA 3KQUA 3NH9A 1NN5A 1R5OA 3BRWD 3CNLA 5H1YA 3RC8A 4ARZB 3SYLA 1F3OA 2P65A 2D7DA 1YVDA 4JLNA 2VH5R 4PC2A 1KI4A 1OH8A 2W6IA 2C03A 3G5UA 4JL5A 3LX8A 2ZU0C 3D7MA 3NH6A 1Z0DA 4NCHA 4JKIA 4CEJA 3AKDA 2XOKD 4G0NA 4A9AA 2E1RA 2UZIR 5GJCA 4HAZA 5AJWA 2ANCA 4NBSA 3QSYA 2WTUA 5J4LA 2ERYA 4GDFA 2J9RA 1IY0A 4LYHA 3R8FA 1IXZA 4R98A 2GJ9A 1E2GA 1Z63A 4DEXA 3SU8A 1SQ5A 1G8HA 2CCKA 4V03A 5KUTA 2O8BB 4PHTA 2XJ9A 1N5LA 3CX8A 4Q4HA 1HQYE 5CLLA 3GJ8A 4CT5A 2CL0X 3U4QB 5FI0B 5JFGA 2VPPA 4LPKA 5FR2A 1JAIA 2J0QA 1KIMA 2HF8A 1E0KA 3BD9A 4KV9A 4LHVA 5DIFA 1SULA 1UKYA 2IYVA 3P27A 1G7RA 2Z0MA 1X3SA 4HI0E 5FPKA 4A15A 3K0AA 2FPMA 2CDNA 1JAHA 1W2HA 1XJ0A 1ZINA 2JIZA 2ZPTX 2W00A 3K0FB 3ZZ0A 1VKJA 1COWA 2DCUA 3KKNA 1XJQA 1YZGA 1T3SA 5B2ZA 3K70C 3P20A 3VNVA 3T1QA 2ZREA 4LK2A 4LYJA 3GP8A 1LF0A 2GXAA 2PCJA 4IDNA 2WJJA 5FTKA 4E09A 3A37A 1T3HA 3CZQA 1B0UA 1KO8A 4M4SA 1S3GA 4OKSA 4EFMA 5EUQB 2YV5A 4WZBE 3VHXA 1N6OA 2QAGC 2YWGA 2ZI4A 2VSOA 1E9DA 4ZIRB 5IF9A 4TL7A 2FSIA 2WAYA 3P4YA 4HLQB 1XD2A 3CPEA 3EZ9A 3LWNA 4JIMA 2C8VA 1HT2E 1AKYA 3T35A 1AS0A 3FWYA 1SVKA 2XNSA 2Z43A 3I8SA 3ICEA 4BWYA 3U7FB 4UJ3A 3WBKA 1NBMD 1KJYA 1VCMA 3PV0A 2VRWA 4IDPA 2ZSAA 2VP4A 2PX3A 2EQBA 1KMHA 1N6NA 2VF7A 2OCAA 3BBPA 3BH7A 3K1JA 4WW0A 1Q57A 4Y0VA 5FL7D 2Z6VA 4I81A 4PC6A 3ZJYA 4TTRA 4AI6A 1GVNB 5FTJA 2F43A 1OB2A 2JASA 3UIEA 5KHOC 5F3WB 4K8OA 1EK0A 4NZYA 4ZCLA 2FPKA 1K6MA 1W2GA 2DWQA 4WVFA 1OYYA 3U7EB 2QM8A 1NLYA 4DCUA 2FSFA 4Q01A 2GESA 1D5CA 1OKKD 4RCZA 4AWXA 3OE7A 2XXAB 1E6CA 1OV4A 1XNJA 2BEJA 4HDOB 1U9IC 2IYUA 4BLPA 4MRSA 5FTLA 1ZP6A 3TUJC 3Q7PA 3NIBA 1RYHA 3VKGA 1M2OB 1AGRA 5AWFC 3A6PC 4HB0A 3KDSE 5HE9A 1GM5A 2C5LA 2NO1A 4LPSA 3ZVMA 4FI3C 2ZI6A 3TLXA 1KMQA 2FZ4A 5J4HA 2IUTA 2KB0A 1P2TA 2ORIA 2XSZD 2ZR7A 1JB1A 3QKSA 2ZRFA 3LNCA 1FQJA 1VYUA 3EAQA 3LQQA 3B2EA 3M4YA 4ASUD 5GJVC 5DN6D 1G6OA 1NG9A 1EFRA 2VP2A 5HCNA 5JHHB 2CLCX 2IXGA 1T3LA 4OK6A 1N6HA 2BMFA 2WWGA 1D2NA 2A5JA 4M9SA 1OB5A 3U44A 3KB2A 4QHTA 1BH2A 1W47A 1D2MA 2HT1A 4EKDA 4QBGB 1OH7A 5IK2A 1G3MA 4QRHA 1KY2A 3KTAB 5KNBA 4LBWA 3A1VA 1XD8A 1S2MA 3EIEA 4GSYA 2P5TB 3DOEA 2ZR9A 2O8DA 4QHSA 1AGPA 3AUYA 4BFTA 1QHXA 2GCOA 3UANA 4C3ZA 2OXRA 4DVGA 2AFIE 3GPLA 3VR1A 1G9XA 2FMXA 2HXYA 3E5HA 4B71A 2BMEA 1GUAA 2I1QA 3T06B 4BLOA 4MGKR 3DKPA 2Z4RA 2XZPA 3IBGA 4X8LA 1AA9A 2V8OA 1E9SA 1K5DA 5HKKA 4N3NA 4TT3D 3PUZA 4JLJA 5LD2B 3MWKA 4B3BA 1RC8A 2P6UA 1LS6A 3QOFA 4I1SA 1JI0A 2Q9CA 3WNCA 4XTCS 2YNMA 2ZJBA 1SKYE 4TTPA 1KI9A 1R6BX 3C15C 4M22A 4FXPA 1ONBA 1DG1G 3FHCB 4PANA 4GNKA 3EPHA 5JRJA 4FIDA 2A5GA 5HZHA 1GRNA 1FX0B 2KSQA 4P0TA 2BOVA 4B44A 2ANBA 3TSZA 4XSHA 4RZ3A 3K09A 1XPUA 3RAPR 4OQXA 4XVUA 1WXQA 1S1MA 2GVDC 4B6FA 4UXHA 2QQ0A 1R8SA 5A0FA 2QMHA 2J0VA 3N2EA 1UEJA 3FHOA 4PSKA 2PLFA 1JECA 1TEXA 4NMMA 1J70A 3TAUA 3OAAA 1P2VA 1NRJB 2FH5B 3A8TA 3LBIA 4NP6A 4POAA 1N0WA 4MH0R 3FOZA 4HZUA 4LJ8A 1AK2A 2OCPA 4ERNA 1U98A 1U90A 1E4VA 3C5CA 4A8JA 4NCKA 4EPXA 3MWYW 2V7QD 1UEIA 5L3SB 1US8B 2AKAB 2IHYA 4DBLC 1JEEA 4IDQA 1DAMA 4P3YA 4JLBA 5DE3A 4AYTA 2IUSA 3RVBA 4NE2A 1SXJE 3U3JA 1KI3A 2P67A 3KQKA 4R2IA 1VDZA 3SE0A 3B9PA 4MYHA 2NGRA 2CCJA 3DM5A 1N6RA 4OL0A 1ZCBA 1DE0A 3OEHD 2BEKA 4Q18A 4C2UA 1GOTA 1RYFA 2CVHA 2ZI5A 3KKOA 3LW7A 1BKDR 3KQHA 4C0QC 1U8ZA 1XMJA 4OI1A 2V55B 1M7BA 2ERXA 1IN7A 1ZAKA 2BM0A 3KL4A 2J7KA 4KFTA 5DYIA 2B8WA 2BBOA 1NIPA 1HE8B 4UQOA 4Q9HA 2E9SA 3MAAC 3KJGA 4FINA 4TTQA 4DUGD 4AD8A 1XEXA 2J3EA 1IXSB 3KX2A 3CB4A 1KDPA 4URXR 1DAIA 1P61B 2OBNA 2REOA 3M0EA 1CU1A 1XCMA 2ORVA 5LDDC 4HAXA 2VSFA 4HAYA 3TBKA 1EX6A 1GNRA 1YRAA 3FFBA 1J99A 5G53C 2QA5A 2JCSA 2GJSA 1NVVR 4IXNA 4Q1CA 4HZIA 2ASEA 1KMHB 2H7VA 2GJAA 4ZPXA 2MSEB 1W0KA 4IW3B 2WKQA 4JT4A 1IXRC 1NN1A 3AGQA 4Z51A 2F3RA 1Y3AA 3LXXA 3KKPA 2R44A 5KPDA 1WMSA 1MO5A 2D2FA 2IWRA 3AVXA 3TSWA 1ZD1A 1QHIA 2AD1A 2ZITA 4TLDA 4DLXA 3H0KA 3WXMA 5JEDA 2EYQA 1AQYA 2JLQA 1ZW6A 4HUQA 3L0IB 2FEMA 3CRRA 4AG5A 3G82C 4PAQA 2ZSFA 2R6CA 1A82A 1OYWA 3OIUA 4JLVA 4XIGS 1E9CA 5ELXA 4I1UA 3RHFA 3SJAA 1AN0A 1MT0A 2PCLA 2PT5A 3K9NA 4UXIA 1GL7A 1JPNA 1J2JA 4TYQA 1PLLA 1ZIPA 3B7GA 4MRNA 1E96A 4C0HA 1Z3IX 5CITA 1V5WA 3BFVA 3DO6A 4NYIR 2R65A 3FKQA 1KI6A 2IWHA 1JJ7A 2AKYA 2O52A 2OG2A 4D26A 3QEOA 1EFCA 2WBLC 3AVQA 1N6IA 2R6AA 4YMSA 3GJXC 5TV2A 3GJ6A 1OLOA 1EWRA 5EJEA 1RFLA 3MG9A 1ZBDA 5E7IA 1AIPA 1KSFX 4PSAA 2FPLA 2WMNB 3Q5EA 4TQ9A 1QZXA 1Q3HA 3KXLA 1KHTA 2HYDA 3B13B 1OH6A 2ZS7A 3B5JA 3MWLA 4MDFA 2NZ8A 3WMEA 4JMPA 1YZKA 1BIFA 3IO5A 4W9MC 2GCOB 1R0XA 2IEZA 3SQXA 3MMPA 3BGWA 5KSYA 4KAXA 3EC1A 4PR0A 4O2LA 2J59A 4ESHA 2PJZA 4LBVA 1T4GA 4DDUA 4A92A 1ZRHA 1CKEA 1W5SA 1DPFA 2YC2C 4KBFA 4OQMA 1AZTA 2D4HA 4URZR 2A5FA 4LV5B 2FGKA 1XTJA 5E7JA 5EE9A 1R10A 5SZIA 2HUPA 2B21A 4O25A 4Q48A 5GJBA 4YMVA 1S4QA 3GJ4A 2J7PD 5EXTA 3FKSD 3RSLA 3HDTA 1U8YA 621PA 1SXJA 2GKSA 2AWNA 2MSCB 1EFUA 5KDLA 2PH1A 2PX0A 5JMTA 2H5EA 2QEQA 4HLCA 1EX7A 1JR6A 4XVRA 4A6PA 1HQCA 3RWMB 4S2EA 4R9UC 1B23P 4W5HA 1UBFA 2IW3A 5EXPA 1AS2A 2PBRA 3U3KA 3AP2A 2HLDD 4GP7A 5TARA 3DZDA 3MJHA 4MKHA 1XTIA 4BZPA 2WAXA 2RGGA 2ZTSA 3BK7A 1XBTA 4DLWA 2YINC 4HZUB 3CX6A 2F1JA 4PC7A 1ZM9A 3LBHA 3SC3A 4LC1A 1XDBA 3W34A 2EWWA 6Q21A 3X1DA 2EFHB 3SYKA 1E2HA 2XEXA 2OILA 5EP3A 1WRBA 3W6PA 4BRWA 2J87A 1E0AA 3U2QA 4FMBB 4XVQA 4WBSA 1EWQA 4DLSA 4K81B 2ONJA 4XWOA 2P5SA 2WIBA 3E70C 1OF1A 3F0TA 4A2QA 1U0JA 2FFBA 2C04A 1PZNA 2BBTA 5B30A 2QL6A 2G1KA 3D6TB 4LYAA 4TQUS 3SDZA 2NTYC 3KFVA 4M8NE 4PSVA 4BFSA 1TUIA 2GBLA 3I72A 5KSPA 1KO1A 5A5GA 1N6LA 2V4ZA 4ACBA 4Q1FA 4Q4LA 4DIDA 4CEHB 5CB6A 4PC1A 3I61A 1DBSA 2W6ID 1Y63A 3DHWC 3KFXA 5KPJA 1LS1A 2BC9A 2Q21A 1JNYA 4G5SA 5C18A 2RGAA 4MRRA 2A30A 1ZM2A 4GOXA 3W8NA 2VTKA 2V1XA 4H1VA 1T91A 4IJMA 3NDBB 3TW8B 2C78A 2GXSA 4Q9IA 1G5RA 1XJCA 5JEEA 1XX6A 1R2QA 1G41A 1DAEA 4LRWA 4IKEA 4HB4A 3ZVLA
chains in the Genus database with same CATH superfamily
3NLLA 4C76A 5AJYA 3Q41A 2RBKA 4R4JA 1I6KA 2CNOA 3F7TA 4NFLA 3SMVA 2XTMA 3MBIA 1PT7A 3KLPX 5SY6A 1KQOA 3DTVD 3HBNA 4H4DA 4OQLA 3RVJA 2BDUA 2W4QA 3H0CA 4H2DA 4JWTA 3V2HA 1IM5A 5LA6F 5L4SA 4CODB 5EHNA 4UPVA 4N5NA 1U63A 3MZ0A 3RDPA 3ZQJA 1PFYA 3TQTA 3BT7A 3E0QA 3DF9A 3DB2A 1S8FA 1G291 4X45A 3TVDA 1C1HA 2OCGA 3BMNA 5A2GA 1DQZA 4E4YA 2FFJA 4ME6A 4PBRA 5AJTA 5DSXA 3GYGA 4F8JA 2Y71A 4FSHA 2O8FA 1NBHA 2G5GX 3PHHA 3T7EA 4G2TA 4BWGA 4UTNA 3RB8A 1YOBA 3W1WA 3SNKA 2FWIA 3D59A 3T3MB 4YJ3A 4WJZA 3EQ2A 1B2RA 3RVLA 1M0TA 5LU8A 2OCYC 3FGPA 3QVUA 3RG2A 4WLNA 3K09C 3D0RA 3EXEB 2JFNA 2H1WA 2GXQA 2GR9A 3HUEA 3C24A 3IBFA 1DKMA 4AJ4A 1CUWA 4BFYA 2YDYA 2IY9A 2P11A 3Q5GA 5CYGA 1QTQA 4IZIA 2RB5A 5LMZA 5EHXA 4D46A 1EB9A 1QP8A 2MR5A 3TLMA 4X63A 2PE5A 1QK3A 4OHKA 1UKCA 2O7NA 2R25B 3ZI4A 2DBVO 5CG1A 1X86B 3I6ZA 2Q50A 4KYUA 2ZYRA 4R7ZA 2IBMA 5H59A 4J4TA 2JAXA 3R7WA 3SBDA 4XDHA 3T61A 3UMVA 3CH7A 2AOXA 2B4YA 1UXIA 2F7SA 3Q87B 4MW0A 4Q5IA 1TZBA 2X9QA 4WESB 2P3SA 5CH8A 5AOAA 3D4PA 4KRGA 3LC2O 1UDBA 2XXBA 1NT2A 2E87A 3ECAA 1JWLA 1QO0A 4HFRA 3ZHVA 2BFFA 2P40A 4WCFB 3MTEA 4CF7A 1OH5A 4BJHB 5G1NA 5FBVB 1ZH6A 5DOVA 2Q6OA 2IELA 1L7MA 3JS5A 5EWLA 1UJ2A 4FP9A 5KYYB 4JGBA 2EF0A 1SVWA 1M1XB 4L51A 3FNBA 4WNIA 4L07A 3WSWA 4AUMA 4MR9A 2X5XA 3K70B 3QELA 4BVEA 4W9NC 1NE7A 3BJIC 4OXQA 3HXKA 3P9ZA 1OIVA 2CXQA 3J7AC 2G09A 4OFBA 2XHEA 5FKJA 1YTLA 1E9EA 3BD8A 1AX9A 1TAGA 1JDUA 4BEBA 1OTXA 4D74A 2PKXA 1X0VA 1IZ0A 2BMDA 2IX9A 2NSJA 3LCCA 4L5IA 5K3DA 1WTAA 4OI4A 3H1AA 3AEKA 1W75A 1WZEA 5TQ0A 1KJIA 3VDNB 2OHOA 1A9RA 4M1QA 4C3UA 1WQ3A 2COEA 4JEMA 1P33A 5KKNB 2XITA 4PTLA 1R74A 3QLVA 3UK6A 1NUAA 1GCUA 4EI9A 1SIOA 3VR6H 3E6AA 2WYHA 2VHTA 2Q5EA 4P5EA 2K7FA 3NDRA 3HJTA 1JV2B 1G8GA 1L5VA 4L5CA 1X8LA 2C95A 1NYLA 2GHRA 2O8EB 2AZDA 3CZAA 3PDIA 1LK5A 3GDGA 2PAFA 2Q3EA 4RZUA 4DLTA 3N0VA 1GNSA 3QE0A 3CJTA 1BAPA 4LA4A 3V33A 4F04A 3DT8A 5LJIA 1Z88A 4O3FA 1V48A 2B25A 2QYOA 3I01A 5KNBD 2YWHA 3IA7A 3REQB 3BZBA 3CO0S 3ETGA 1O4WA 3BZUA 2IX3A 4U02A 1JLLA 5EXXA 1XZEA 2VJDA 5FULA 3W4KA 2E4UA 1EPUA 1R9GA 1EM8A 1JLMA 4UBLA 1DBWA 2VQFB 4FKMA 2GNOA 4TRRA 4QTYA 3R4CA 1DDGA 2NOAA 4O59O 1CRPA 3QXSA 4Z9AA 5CLFA 3WLAA 2PZEA 2PX2A 4B71A 3MGAA 4FFBA 2YOHA 1E6WA 3PXAA 2DFPA 1DUVG 2IHTA 4FGSA 1O97D 1W5AA 3PR1A 3Q3VA 3R4VA 2HPZA 3JV7A 4ITVA 3KVYA 3TB4A 1J8DA 5FPPA 4L72A 2JEOA 2IZ6A 3FF4A 3JAKA 4KRXA 2FQWA 1QYIA 5EWMB 3G2NA 3OFND 1T8YA 5BR7A 2DLDA 3AF6A 1YR1A 4UE6A 5CJJA 1GZDA 3GOHA 4NU0A 2ZRAA 1H2YA 3I9KA 4RJ2A 1YRYE 1UBJS 2HIHA 2WV9A 4ZYXA 2CNDA 3CFYA 4L5YA 1XQWA 2XLBA 3WR5A 5I48A 3GJZA 3UGKA 4DIEA 2X8JA 2EJTA 4QNMA 4JNCA 3JQ7A 2R0QC 3FPBA 2YYSA 3D3EA 5NLLA 3HKEB 3SZRA 5KOHA 4I36A 2QENA 2W6ZA 3HA3A 2GFIA 4QQFA 2Q6KA 4RFSA 4J3NA 1LPNA 3W9UA 5EPEA 1V3UA 4JXKA 4O1IA 4EW6A 1MXFA 3ECCA 4KG7A 1U0SY 2DECA 3R5TA 3FLEA 3OPNA 3VU3A 2D2EA 3SJCA 2OORA 1CW2B 1H2XA 5K0CA 1IQPA 4J91A 4XLLA 3WHKA 2X3YA 5J63A 4HNHA 3DLHA 3BFXA 4LSMA 3ZIAA 3O8OA 3OOWA 1MOZA 2ZE8A 3HM2A 4Y9TA 1U11A 1Z2DA 3FOCA 2FB9A 4IUCS 4CDGA 1O3YA 3Q2IA 4YHHB 3OAAD 3AUTA 3CSDA 5ENVA 2XH8A 1TMKA 2IOQA 4YWHA 3Q9SA 4DJEC 4OFXA 3ISVA 1IBKB 2MINB 4M7PA 2XZOA 3BRSA 3DO8A 3H87A 1NI5A 1UBOS 2XUDA 2EF1A 2AZTA 2XLCA 1QK5A 3FCXA 3RV4A 1E8DA 1EK2A 1U81A 1YH3A 3QA9A 4R0NA 4TL8A 2H4WA 5ALNA 5IW8A 5BMOA 5I9NA 2QTLA 2X0FA 3VC1A 2ODWA 1JALA 4FDLA 2C42A 4YVFA 1H5QA 4EJMA 3E7WA 1BRTA 2WAOA 3I6QA 5F9FA 3LZDA 1Y1KE 2Q6TA 2ZTVA 3ZCRA 1D6SA 2I7TA 3PL5A 4S1PA 1Q7EA 4Q9NA 1YKSA 3GFGA 3VO8A 2QNIA 4OREX 5ER9A 5FPQA 1VE1A 2GTPA 1QRAA 4Y7CA 5BT9A 3IHWA 3BMNB 1R1DA 2Y1OA 4LOIA 2GETA 3DE4X 1QCYA 3LFHA 3MJCA 1NVWQ 1X2EA 2HQBA 4ITRC 4R0VA 3V48A 1J1IA 4AJKA 4BTEA 1FRQA 2D2XA 2OB2A 2P1DA 3L4SO 1U7WA 4YROA 1Y7IA 4XI9A 1NN3A 1NBAA 2WICA 5DX8A 2VJKA 3AIOA 2I2WA 4WK6A 3C7TA 1CUCA 3IO3A 2YXPX 3HACA 2FK7A 2A0FA 2HSWA 1M75A 3DXZA 3M6FA 5ADVA 3OM9A 4N5HX 2QB5A 5HIKA 3MLEA 2H0QA 1H3FA 2P1ZA 4IUDS 1AGNA 1TQDA 4A26A 1YL7A 2VBFA 3S2ZA 1X7YA 1XZNA 3QLEA 1U7XA 1Y6JA 4NK4A 5HOQA 3IKJA 1JFTA 3KT6A 1YDGA 3FE2A 1D6MA 3CPJB 4H35A 3KXDA 3BZWA 1VG1A 5AI9A 3WXBA 1BX0A 5AHOA 3JQGA 4GP9A 5G1PA 2GK7A 2MYNA 4FWBA 4HAIA 4UE3S 4GXTA 2G70A 2V6JA 1FFBA 1Z82A 4MQLA 4Q7LA 2VRCA 2AJCA 3ECSA 1E79D 3EVGA 3I5UA 3IUYA 3GPCA 4IX9A 3K4QA 2WSYB 4RMJA 4BEJA 3QVVA 3IIEA 1JAZA 2H18A 4K05A 4W63A 2IH5A 2DLCX 1VSVA 4JWKA 1GU7A 1KARA 4E13A 2C84A 4K86A 2X7HA 1L5RA 1TPYA 3L4KA 2Z5VA 2A86A 1OXMA 3A1FA 4BJ5A 3GAZA 5BN1A 3VXKA 3UK2A 2HL6A 1QJ4A 4LC0A 3TRJA 3U31A 4F4CA 1QDEA 1O8BA 2WYIA 2V4UA 1W1UA 3FTDA 1IUNA 3HNOA 4MARA 4MR9B 4QBFA 2VP9A 3MEQA 3WYFA 5E3HA 4NOJA 3SJ7A 1P73A 1QVRA 3THXA 2YYZA 1OLUB 5JQGA 5JZBA 4PO3X 3UB4A 4ZVPA 1RPAA 1FVFA 2P8JA 3AV3A 4GOLD 4A03A 1DMSA 3V1MA 3ZU5A 4WKNA 4TWAA 1D03A 2O3SA 4IY1A 2MIIA 3TJZA 5I8WA 1CEXA 2LCQA 3AEKB 4PQGA 4P3NA 4YCSA 1KAMA 5FBRB 2VSYA 1YR3A 4MVJG 3SYNA 4YRSA 2ECQA 1HDXA 2HSGA 2G17A 4MUHA 4W8OA 1EVJA 2F59A 4BB9A 4DT1A 3TI7A 4I1OA 4DJTA 1C3OA 1CULC 4QDOA 1SXHA 2OBLA 1QCZA 2ZZNA 1Y8QA 2XUGA 1EFTA 1UJNA 4MV8A 2JLVA 3RJ9A 3NP7A 2VDQB 4DJDC 3N7UA 1Y1SA 3ADCA 1WQ1R 3PDIB 1H6DA 3IBSA 4IDDA 1R5NA 1O08A 2W8BB 1VC2A 3EVNA 3QI2A 4RX1A 3AL2A 2HF2A 1GPNA 2MMCA 4CIAA 1C41A 2O7RA 3WLQA 5CCEA 2BKLA 3PFIA 4L2IA 3IP9A 3ZLJA 2C4HA 3WA6A 3K70D 2WEKA 1QTRA 4GSKA 4A0FA 3BRWA 1UH5A 5HEKA 4IINA 2ISSD 4H6XA 3NWEA 2F8MA 4N7RA 4MROA 4EGFA 5AW2A 1GITA 5I7RA 1FP7A 1I3MA 1WCXA 4CW7A 3FCYA 1IL0A 2HFJA 4B40A 2Q0HA 1MAWA 3EZNA 1XTSA 3NHRA 2DJIA 3BDVA 1JR3A 4ARUA 1C7QA 1YR7A 1RRKA 3CC8A 2PZJA 2BV3A 2R8PA 3HWX1 1ISGA 1I3KA 5AXBA 5KO2A 1ZIYA 3LSTA 3O3CA 1ISJA 1I2BA 4DZRA 3ZVNA 3H2GA 5IC4A 2ZWOA 5KNDH 4J43A 4ZO9A 3GRYA 5EKDA 3OM0A 5TR9A 5CTAA 4XX1A 1YRQA 5EIAA 1S3FA 2IOFK 4E5YA 3JAMA 5B12A 3TTVA 1XYYA 1C0EA 1ULZA 2IKSA 3PQCA 3MFYA 3UCXA 2FUG6 4BV9A 1WD5A 5EIHA 4L9WA 3UJNA 3JQ7B 4EUFA 1KFKB 4L5JA 3ZHYA 2WG2A 3L79A 4Y0AA 2IXDA 1YACA 3C5HA 5EFOA 1J9EA 3QNMA 1U5CA 3TD6A 2HNBA 2QVZX 3T9EA 4Q4HB 2OFOA 3PL1A 3E53A 1ADBA 2OE2A 3JWPA 5FBZA 3IDSA 4Y6QA 3U26A 3UFBA 3WFJA 4EGSA 3Q8KA 2VDMB 1V37A 1WOYA 4FQ7A 3RYTC 3F49S 5IVHA 3JWEA 2P77A 4QOSA 2JJ1D 1BOOA 4HPWA 1J06A 3GFTA 4CF6A 4G5HA 1CJBA 3JWHA 4WKOA 3O8OB 1A76A 1H2BA 1QHHA 5ALRA 4DPMA 4NATA 3K0AB 4KGZA 3SHFA 3PU6A 4ZK2A 2NUBA 1AC5A 1NRXA 2P68A 3VH1A 1HMPA 4N9QA 3TNDA 4M9UA 3HA7A 2UKDA 2L42A 1PFGA 3UV3A 1ZUWA 2JFVA 2IYAA 3TCNA 3S2IA 4F5DA 1QX4A 2QZZA 2ZXUA 3E9ZA 1WPGA 4HQNA 2IZZA 1QIHA 1GCAA 1SZJG 3O9ZA 2PSHA 1JHDA 5BURA 1C4KA 2JGNA 2JVJA 5GONF 4B9EA 1RU3A 4UHJA 5KQMA 3MWEA 3OJXA 5BWCA 3C6YA 4WEOA 5L9AA 2SICE 4DA6A 1AMUA 4PLPA 1PNOA 2HEGA 3OTQA 4DSZA 1DX6A 2CVZA 2PZ8A 3FYUC 2E6UX 4XIFA 2PGJA 4DQXA 2IUEA 4OY3A 4O2BF 1VE5A 3I1FA 4UTXA 3TL3A 4D42A 4ENQA 1KVRA 1NX9A 4RHEA 4RVFA 5FL7A 3TLYA 1B15A 3ESZA 4N6OA 3ZXXA 4J75A 1H69A 3SI7A 1H8EA 1JYEA 2OXFA 3JAWA 4KIFA 4CM8B 3O8RA 1OXBB 1RBZA 2BH9A 2GYUA 5IJ0A 4MITA 4QNNA 2EIHA 2KWIA 4L4RA 2XHZA 4AB1A 3OHMA 4IFIA 1TAUA 3N6RA 3IPXA 5CLJA 5A4MS 4BFZA 1M67A 2Z2JA 2COKA 1LRLA 1HE4A 1ZZGA 2HGZA 2PVCA 3L1UA 1H5UA 2C94A 2ZAOA 3H2SA 4PX9A 2XVZA 3PPYA 4U7JA 4Y8VA 3ZW7A 1YL5A 4YMHA 2RKBA 5TQVA 1NVDA 3ITNA 3KPUA 4GH5A 4XCVA 1ADFA 4ZMSA 3U9LA 4Q1BA 2Q27A 4D45A 5ARBA 4RPHA 4DIOA 1VQ1A 3DULA 2QRPA 4KN8A 4R8RA 4XQCA 4IVRA 4MGEA 3ZV6A 1IY1A 4E12A 1WBJB 1CZRA 3QENA 1SXGA 2J3KA 2XODA 3BMOA 5CIQA 4CMGA 2PKWA 3S81A 1WPQA 1XTUA 1WP4A 4ZT7A 1KZ1A 1HPLA 1XRNA 3EWIA 4EAAA 2GZ2A 4QGFA 3ADBA 4L4XA 4RC9A 1MB2A 2VNAA 4FX2A 4N03A 2B83A 5JVDF 2OL4A 3H5IA 1JJVA 4TKZA 4ZO4A 1UDWA 4P98A 3N6VA 1OFUA 1SHUX 2A9RA 2V0NA 4HDMA 2YXEA 2PUWA 5IP5A 3THYA 4XJSA 3NJRA 2QUZA 2KHZA 3IUSA 3Q8WA 2X5OA 2Z5FA 4FOPA 4K9DA 4MK4A 1FFXA 1QVAA 2ZBEA 4QU5A 2BUCA 3U44B 1Z0UA 1YU9A 1U1GA 2WP0A 5JPDA 4DYVA 3D3JA 5I01A 2Z83A 3PFHA 4PAOA 4RBNA 1H2FA 1IK6A 1CUZA 2G72A 4NG4A 5CM8B 3RS0A 2VHZA 1Y3DE 2AHOA 2YJGA 2GD0A 1QC5A 1R9MA 1UWLA 2YMPA 1K7SN 1P9RA 1YZQA 3Q88A 3ACDA 4RJIA 4X6LA 2X0DA 5K0EA 3KQOA 4GI7A 3ZU2A 2I2AA 3M9XA 4PSUA 2Z2IA 4NMXB 3C6KA 5AUQA 3GLIA 3TECE 2RKOA 2PT9A 4J1TA 1WABA 2FRDC 2K87A 2ORWA 4NU5A 5B58C 2X76A 1C3OB 4TTVA 2XCIA 4CCAA 1EJ6A 3EUAA 4M7RA 3LHIA 1Y8QB 2C2HA 4C9BA 4TV9F 4MQFA 1CG6A 4JI4B 3QYAA 2ZFUA 1Z47A 4NJMA 2ZJAA 4DSNA 2VHUA 3DDWA 1NF2A 3CHYA 4DDWA 3KQQA 5G3YA 1GIAA 3YASA 5BSVA 1EX1A 5FX2A 1QO0D 5JNVA 3P2KA 2QV0A 3ZX5A 5IWAB 1I4LD 6ABPA 3UKOA 1R6AA 1KYZA 2J5KA 5CB8A 1BDHA 2R47A 2AXNA 4HJRA 3WNVA 4DCMA 4AMZA 1L5HA 1T6NA 3CPHA 4MDEA 1BFUA 2O6HA 3QY0A 4L2IB 1ISHA 3IJEB 4MEBA 4O4IF 1VL6A 1JKXA 5BMVF 5K6AA 1FYWA 1TUGA 1IXYA 3PJRA 4IDOA 5F98A 3LPCA 2ZTUA 5CJPA 4EPVA 5K0GA 4IFBA 4WA7A 5EKXA 4OU4A 3E22A 5E1MA 4XYMA 2JLZA 4M1MA 2R4TA 4D25A 5LB4A 2RHHA 2CUZA 3EMBA 3STVA 1UQRA 2H5IA 3CJRA 3U61B 3UQYS 4OX9B 3H5RA 4MI1A 2OYRA 1F51E 2MSKA 3AIKA 3LF2A 5I9BA 1NPDA 2EV9A 2OGWA 2P4QA 3R6WA 5IN4A 2WNHA 1GRRA 4J6FA 4JBNA 1YVUA 4TZ6A 3K5HA 3OEYA 3RIEA 3IERA 4CM6A 1U7PA 1FB5A 1RAAA 1OX5A 2W83A 4KDEA 2VDUE 5A4DA 4O6VA 5T67A 2L19A 3WYAA 4QDJA 3ZWYA 1F2VA 3KVRA 5GP1A 3R1IA 1J0EA 1JDBB 3HFGA 4Y2QA 2CHGA 2ZYIA 3LQ2A 2BTOA 2C7PA 1Y8CA 5GY7A 1CYEA 3R7BA 1U5AA 3JALB 1M5RA 4HBGA 5A6VA 1JKMA 4FFVA 3HB7A 1TYBE 4IO1A 4TTJA 4TZTA 2EEPA 4MJLA 5GWXA 2ROQA 4OMCA 1JJFA 1IHPA 2ZIAA 4O4JA 4JVLA 3PIDA 2Q4TA 5EOVA 4KSCA 5D1NA 5D86A 2A78A 1MEOA 3DLTA 5J3JA 1KVTA 3OIFA 3KP1A 1FSZA 3VU8A 3VZBA 3Q3EA 2HDHA 5SICE 4AT1A 2DHRA 3AJRA 3KLNA 4TOIA 5EZQA 3PYLA 2Q1UA 4MYHA 1FMFA 5HF5A 1AN9A 3ZDZB 5EIEA 2WPDD 1MAAA 1KSHA 3RARA 2B6HA 3P94A 5AVXA 4Y2JA 4ARZA 4ZO6A 4H77A 2R62A 1YS2X 4I5FA 5KCZA 1B2LA 3FETA 4F21A 2VAVA 1SUEA 3ESAA 3NHZA 4OH1A 2EFGA 3GL9A 2BHRA 4KWCA 1D2CA 4D0SA 1IN4A 3JQRA 4BHTA 1VCHA 3GNQA 3MMZA 3SQNA 3PC3A 5AJUA 2P9CA 1I6WA 1JIXA 4D0GA 4D3SA 3LKVA 3UG6A 3RU3A 5AKEA 2GD1O 1VHDA 3CNEA 3AF1A 1TT5A 2VYND 4G5QA 4GPBA 4BAGA 3HSKA 2F67A 4LSGA 4QSMA 3A3OA 3MWEB 1JLSA 2JVIA 3C39A 3CB2A 4NI5A 4R54A 1C9EA 5CLQA 4R9RA 3GFQA 4H3VA 3P9QA 3PITA 5KMGA 4W1SA 3MINA 3PEYA 1P81A 1K7XB 4RORA 1SKQA 3CF2A 1JILA 2PX5A 2ZOSA 5KVAA 3KALA 3OOSA 3IT2A 4YALA 5ALLA 3UXEA 3L7JA 4OQEA 2JIQA 2H2WA 3A6HA 3AZQA 421PA 5FUVA 2YIDA 1MVNA 2W0MA 4Z6KA 4MYUA 2YHUA 4TMVA 2N42A 5C1OA 4UM7A 2CFRA 1QYRA 3LT0A 3R5JA 1QUFA 4JCCA 1IBRA 1ZITA 3JAWB 4TS4A 3VR3A 4RYLA 2J4DA 3A58B 2VCHA 5IJ0B 1AKMA 4L0DA 2CUTA 1NBWB 1N2SA 2AR7A 2X1HA 2ZEJA 2OMKA 3HEMA 2KLBA 4NAVA 4BU0A 2BFOA 2X4DA 4MLZA 2OV6A 4ZVTA 4CQNA 4YCBA 4BP3A 1TCBA 4O4LF 1D2EA 1BRMA 3QWHA 1GU1A 1XAGA 2XGGA 3M33A 4MUFA 3TOVA 1PJRA 4HUQB 3THRA 3OQMA 3ANXA 3HU2A 1F48A 3H4MA 2FWRA 1RCUA 5DLQC 3CRMA 4F12A 4QQ8A 5JAMA 5JXHA 3Q1KA 4LCBA 4Z1MA 1IQRA 2PNFA 2RC5A 4K46A 1KJ9A 3TZLA 4MKRA 2H2GA 2PZFA 3BFKA 3FDJA 5D3ZA 3M3DA 2O1EA 3DYIA 4F93B 1LF5A 4B8ZA 1DELA 3UKJA 5LNK6 2YOFA 5JZ9A 4YQZA 3ETCA 2YJZA 4TMZA 2IFTA 2QN2A 5DHUA 4QUEA 3BRQA 4B33A 5IUJC 2QZSA 1W581 3O83A 4R9NA 4UU1A 4BP1A 1UPTA 5IUNC 3GBPA 3I0NA 1CB7A 2XWBF 3QVJA 4MQEA 4MUBA 5GOTA 3UJ7A 5AH0A 3JTEA 3R3HA 4MWOA 1B8NA 4QPZA 5EE5B 3RC2A 3ROFA 4CQLA 3RSQA 2PG3A 1KI6B 4G0XA 5LJLA 1T0IA 3DDOA 1UQUA 3ENKA 1IB0A 3OETA 2OV2A 5AMXA 4B8WA 2BH2A 5HQTA 4BV3A 3W9SA 2CLMB 3EGXA 1OAOC 5K8TA 2Q8PA 3AY7A 5DM70 3W2TA 3L46A 3AVWA 4QLBA 4L5BA 2D3WA 3GFPA 4K6FA 1XZPA 3GCDA 2QTAA 2D7CA 2G6BA 3HJBA 4IR7A 1QC5B 1T2DA 1Y7LA 3O1LA 4MKGA 4TGLA 5EPUA 5AHKA 2AQIA 3EC7A 1RLTA 3P9IA 4P4UA 4V0QA 2Q0XA 2EC5A 3ICOA 3GLIB 4JYAB 3D1VA 3LWDA 1FUUA 4JJ8A 1VJRA 3UB2A 3G02A 1YDEA 3ILXA 3V4LA 2HIAA 2XT0A 1T2EA 5DNCA 3HWSA 4KPEC 3ZDFA 4KVAA 4HEA6 4M1WA 3FA2A 3FMFA 3L1HA 1PV2A 2OESA 3CF4A 1FEZA 2E5WA 3FBTA 1U9ZA 3SJBA 1KJZA 4IH9A 3IAUA 2FLKA 4NJMB 1Z4QA 3ZWBA 4JB8A 4ZCRA 1E2JA 2A1TS 4EKGA 4MV0A 2K6GA 2WJPA 5IANA 5E9JA 2OOSA 2VJLA 3I34X 5T4BA 2FDRA 1WBBA 3G2JA 2VAWA 4G2NA 2HJRA 2PO5A 2NNWB 5CXXA 3UEOA 2Y9PB 3AIMA 4NR0A 5FOTA 4XYGA 3DT9A 1O58A 4JZKA 4H9GA 2GWHA 1W5TA 5KCMA 3GLQA 1GLVA 1I4WA 1W9HA 2EAUA 3TE6A 1L0BA 4NXNB 3W5CA 4QEZA 3E22B 1R0SA 4DDMA 3KTAA 4MMXB 1EE9A 3GFFA 3KQYA 5CX1B 1L7NA 3EJ6A 5LM3A 2BI4A 4HG2A 1BN7A 2DMRA 2FFHA 2GZSA 4KGXA 2YUIA 1P6QA 3QV1A 1V1JA 2PTHA 1GTSA 1ZD2P 1QQ5A 3MFQA 3H8WA 4MYDA 2R1UA 3C74A 4RD3A 2WILA 2QIOA 1KEWA 2HBQA 3EHEA 3FMOB 4IYRA 1LNSA 1TO2E 3H5VA 2ET6A 1JEDA 2OCKA 3C6QA 3M6AA 3MCWA 1U2ZA 2QNRA 3PEVA 4LDJA 4YP6A 3V7FA 3ZGOA 2IGTA 3G1WA 3GEBA 3MCAA 1NKTA 4OM7A 5KX5F 3HO1A 3NBKA 1K1EA 1ZNWA 2VHVA 1U0HC 4MWCA 1SNYA 2CDRA 3LK7A 3OQOA 1BGWA 4K8RB 4PCVA 3SY8A 1XMPA 4M2LA 1W48A 2OWDA 3GT4A 4GL2A 2EU8A 2WDZA 4B5LA 1FYDA 3SNHA 3OA2A 3DOHA 4WJKB 5HSGA 5F9HA 1VPDA 2VJNA 5EXDA 4GIBA 3TRKA 3DOUA 1QWSA 1JLHA 1KJ8A 1URPA 2YNMD 4LCEA 1KRWA 2I34A 1VSTA 4PZZA 3T3NA 2V9CA 3U4MA 5KWJA 1BXGB 4WJLA 3ND8A 5CVVA 2WJHA 2FR0A 1J0CA 2GRJA 5JZMA 2GD6A 2J0UA 3HRIA 4Y1EA 5T5QA 3NYIA 2M6KA 3W7BA 3JVVA 4F5YA 3R0XA 1DQRA 2OT3B 3PS9A 4FDAA 4HH0A 4QGSA 1NHGA 4IDEA 1ZD9A 1TA0A 4E08A 1ZVVA 3RFVA 3ZCTA 1W7AA 1HDRA 4DWVA 3FCEA 2CL5A 3NEYA 4EUEA 9LDBA 2ZI7A 1A2OA 1JR3D 5FHRA 2Q3MA 5EEHA 2BY4A 2GEVA 2LD4A 2BGLA 2GCNA 2D5CA 2NO0A 3CEPB 4TYNA 3GLFE 5J59A 4GYWA 4X24A 4MVJI 1JH8A 1RKUA 1EP3B 1BKSB 3I9NA 4JJFA 3D02A 4EW3A 1A2BA 4HVAA 1EGHA 3DAPA 4BFSA 4B3XA 2I3GA 1DTSA 5C1PA 4LYYA 1US8A 1LLUA 2JBHA 1Y48E 1U1IA 3WQSB 4XVCA 3C1OA 3QF7A 1N3LA 5AQEA 1UDRA 2PSEA 4ENWA 1EFHA 3IV7A 4I1IA 4NCJA 2H06A 1DSSG 4AECA 3S1AB 3PNLA 2YKGA 4DUZB 1HSOA 1QMGA 2H2AA 4LJ6A 4B3RB 4CVNA 4R81A 4E5DA 5CLHA 4F2HA 3CKKA 4IVQA 5GPBA 3SDBA 3FG9A 4JLUA 4REQB 5ALKA 3N39C 4GBMA 4K2HA 5DISB 1NF8A 5SZKB 3W5AA 4CV2A 2GFQA 3D43A 4D2IA 1XEAA 3BAFA 3ZCXA 1UZLA 1UZUA 3UMMA 1JEYA 1WCIA 4V0NA 2R2AA 1RHMA 4IMPA 4ZVNA 3TN7A 1BROA 3T5TA 4IF6A 4LF7B 3X2SA 2OLJA 2CJWB 2PGAA 1NXQA 1W0CA 2ZI9A 4RF4A 8OHMA 3T95A 4MV9A 1G3IA 1Q6YA 2FW0A 3NJ8A 2BZSA 1K92A 1X7WA 4J7UA 1FU8A 3S2YA 3H84A 4TUYA 4YCLA 3I8XA 1R0YA 2WF6A 2Q1YA 2P27A 5C53B 3SHTA 3WP0A 1IOVA 2HK6A 3K1TA 3RUDA 4L6AA 1B93A 4NL4H 2BEUB 4RKQA 4MQ5A 4ZQFA 3W1VA 2WNSA 5LP6C 4ZDWA 4JR1A 3K1AA 4HQKA 2C58A 4ZWNA 4M9QA 1QHSA 2O0JA 2R7KA 3HV2A 4INAA 4RHYA 5B7NA 3ZGZA 2VCYA 1L2TA 1XL1A 1P9LA 4IQFA 4Y2YA 1JSLA 1T34A 4A6EA 4CQLB 5CDYA 1J23A 5JRZA 2BDEA 3W8DA 5JYDA 1PDOA 2MOKA 2DT8A 1GKKA 1SOUA 2ODBA 1YZUA 1SC1A 4EY6A 4HOYA 2WZQA 1NBME 4KYTA 1BNCA 4EZIA 2FMTA 5IT9A 1NPTO 2GO7A 3VJMA 3QHPA 1NW4A 4V0OA 4XIJA 1OQAA 4KH0A 3AKYA 1H8ED 2PJUA 3EOBI 2PN1A 1UBNA 3B6EA 2ZBFA 3ICWA 3M70A 3EIUA 5TGTA 4FLMA 4BLVA 5G0WA 2FSPA 1NMQA 1VA4A 2PL9A 3X43A 2BTQA 4KQ6A 2Z3ZA 3K73O 5K8UA 3MXTA 3IMGA 5FFNA 1XU4A 5FR1A 2AS0A 1DJOA 2SKEA 4CF4A 3BXZA 2YY7A 1GNQA 1NYQA 1L1FA 3AFHA 3OJLA 4LF4B 3L0BA 4LX8A 4ZQIA 5KREA 3FDXA 3ODGA 3OIGA 5CW2A 4HUTA 3E1SA 4HLDA 2R6FA 1HFWA 1PQYA 2IYNA 3VU9B 2BGUA 4R2HA 1YB7A 4BE4A 2PUCA 4REOA 4OKIA 4CUJA 2QRUA 1OT3A 2W93A 3WLRA 2WFAA 3D9QX 1Q44A 1PAUA 3NDPA 4GKKB 2XOEA 4G1FA 1T1JA 3QEJA 2CHUA 2Z09A 2WG0A 3H83A 4F8YA 1X92A 1BG6A 4CFSA 4TM7A 1XEWY 4PFSA 1VZ2A 2BJWA 5LCXA 1HO3A 2FK8A 4EI8A 4A8HA 2A1UB 3W77A 5JAZA 5F4ZA 4DAOA 3LVQE 1MO3A 2LR0A 4YWJA 1D5WA 1W44A 1P77A 1QZUA 5TSDA 2FHSA 2XUAA 3ZIDA 1DOHA 1Y6RA 1JMYA 1XFAA 3ELWA 4JOCA 4Y2RA 4DMUB 5DLDA 3HR7A 1V25A 1VECA 3CGWA 3L6BA 2JGDB 2PTGA 1BX3A 5THXA 2I66A 3MQFA 5GJWC 1K3FA 3ABOB 3A3YA 5JPIA 2NAFA 3EZLA 3H18A 3NC0C 4RNCA 1FXWA 1NY5A 3C48A 2QUKA 3EDYA 3HSSA 1IMOA 3VV2A 2MYPA 4BNWA 4AKHA 2IOFA 3OE1A 4CEIB 2L69A 3RSOA 4JA2A 5J5VA 1RNLA 1ZD5A 1UKVY 1AHNA 3VAAA 2KI5A 2QX8A 1QG6A 3AU9A 2ATCA 5AOBA 3EARA 2B7CA 3QJYA 4BNLA 2EKPA 1WMDA 2C2XA 4WQMA 4C4OA 5CBKA 2BCEA 1YHNA 1PNVA 1U6IA 3QXHA 4YJ2A 2Z6UA 1ACJA 1SUFA 2B82A 4KMSA 1T5DX 3L0PA 4PIPA 4QULA 4OV6B 1AUOA 3MPUA 3HXPA 1ZN8A 3RI3A 5BW4A 2VA9A 3R0JA 1BVRA 3ETLA 3WK9A 1T1IA 2VNSA 1NVFA 1DQNA 5K3OA 1MXHA 3SOZA 4YAKA 1PUXA 1JQAA 2RGBA 3LF1A 1QE0A 1BEUB 4B17A 4L3WA 1A97A 1ULBA 1DTEA 2CLHB 3PUWA 4PGMA 3WQHA 2PGLA 3LY8A 4CLRA 1ESMA 1Y8RA 3IIJA 5K0FA 4YDSA 5JYBA 1GKUB 4PLFA 3ED1A 5FUYA 5BV1A 1XZFA 2C7GA 1P62B 1P2UA 4KRYA 4ZI5A 2GSWA 1WB5A 3HYTA 2Z6QA 2RGUA 1WUJS 3MT0A 1KEZA 3K8QA 2O1XA 1S2OA 3TRHA 2J0UB 2MT9A 3ZE6A 2A84A 3H5WA 4E5PA 5GINE 1RYMA 4IJKA 2PANA 3U0BA 3REOA 1GXSA 4CF5A 3AY6A 4DMMA 3W3AA 4LJ4A 4GI5A 4QO7A 1JTFA 3HADA 3VQTA 1HR0B 2I4MA 1ZU5A 2BFWA 1W5FA 3K20A 1UPBA 4MQ4A 3ZW8A 4JI7B 4OP3A 2NZVG 3GROA 4H7FA 4F46A 1WEHA 1YVEI 2A92A 1QRSA 4XSVA 1M1ZA 1Q1QA 4TXLA 3CKLA 4BNNA 1DRVA 2MSNA 5EJ5A 3FUWA 2Z8ZA 2C96A 2O2YA 3HDYA 4NVRA 3PNKA 3I5YA 2Q3FA 3DPSA 1GZSA 4DLBA 3QLJA 4ZEVA 2WKSA 5CK5A 1B00A 5IDWA 4LXXA 5LMUB 2H1OA 1MCZA 3C5VA 4HDSB 1NR1A 4B3CA 2C92A 1CZLA 1O2DA 3IVGA 5DWVA 3IJRA 5G40A 4ZOAA 4N5LA 3RUAA 4C78A 2UUAB 2B2NA 4E14A 2VZEA 3UK1A 4KQ2A 3TLCA 2VIIA 1PS0A 5J58A 1MAUA 3UWSA 1DBPA 3V8NA 3UWMA 1Z5ZA 1IPHA 4WHMA 4MZXA 3SLKA 4QPDA 3NX4A 2J9FB 4MINA 1FE8A 1PP4A 5EQTA 3VOBA 1V4VA 2D1SA 3F1KA 4LJKA 4DS3A 1FFEA 4ZTZB 4NTZA 4QA9A 4DRXA 1VRCA 1XRPA 4YPOA 4FNAA 1EHYA 4W1QA 2I9PA 1WCIB 4ZCTA 1PJBA 1M54A 1S4MA 2WWIA 4KYIB 3UMSA 2P9JA 4PF1A 4WGFA 3CT4A 2B4AA 2CNBA 2L18A 3GCXA 5L51A 3ZNOA 3HI4A 3RVRA 2EBFX 2Y99A 4BFWA 4CMHA 4O1HA 1H9CA 3KG2A 4UKDA 2GF9A 2EEZA 3QKTA 1XZIA 4TUYB 1VKZA 5F1OA 4DCGA 3QX3A 1E3MA 1UC9A 4LJRA 4TYPA 4DUPA 4N0EA 3BQ9A 2DPYA 3DEHA 1LWNA 4CL3A 2O06A 2WIFA 3LP5A 3JVIA 2FFAA 3KLBA 3RYIB 4D56A 1H4VB 4WY8A 1P2GA 2X2FA 1RRFA 2HEIA 4WDRA 1DRKA 1NW3A 5IYZF 3UV7A 2JJYA 3K1AB 4YQYA 5FJJA 3KDAA 1JVBA 2Y8EA 3WK4A 1Y33E 4AJ2A 3ZX4A 2PR7A 3A6DA 3GPDG 1HLFA 2VQ6A 4KITB 1E63A 3ZGVA 2ZVJA 3IQGX 5EXEA 5CDFE 4QXRA 2WD9A 1A5SB 3GGPA 3VYWA 2WIAA 4PAMA 2MTBA 4B7XA 4EJSB 1DO8A 1O94A 1EBUA 1K9SA 4Y6OA 3ZE8A 3WL3A 1N1EA 1FP2A 2QRQA 4Q3LA 4TSFA 5ESRA 4BNHA 5FEUA 2XCLA 1ZSVA 4IQ0A 2WKRA 1B0PA 4BZWA 5ES4B 3VR3D 4ZQBA 3OLVA 4WZAB 4B2YA 2AA3A 1PV1A 2V7WA 4QG7A 3IE0A 2GA9A 3LX6A 1FJHA 4A27A 4W1PA 1ST2A 1VMKA 3WLNA 5JS8A 3R75A 3W6OA 2AH5A 4UQPA 4AYWA 1XLTC 1BS1A 2BZGA 1NVUQ 1DDIA 3NXSA 5HMLA 4BXOA 4KXXA 3RS5A 4YGXB 1A7UA 2FSHA 1KF0A 1XPOA 3FLBA 1W52X 2VWPA 1BH6A 1FLVA 1SD1A 1BXRA 2LCIA 2QYTA 3NHUA 5LLTA 5IVDA 1F3LA 1Z38A 1M6VA 2DKFA