4BRWA

Crystal structure of the yeast dhh1-pat1 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVDEFMDKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DHH1
publication title Structural Analysis of the Yeast Dhh1-Pat1 Complex Reveals How Dhh1 Engages Pat1, Edc3 and RNA in Mutually Exclusive Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA02
3L82B 2ZYUX 2FE4A 2IYWA 4JLKA 3U6KA 1JAIA 2QPTA 5JEEA 3I72A 4BLTA 4URXR 1ZBDA 2ZAMA 3A1WA 2C9YA 2X1VA 2DFTA 1PLKA 3BGWA 2HCJB 2QG6A 1P61B 1GNQA 3KUDA 1MO5A 621PA 1JB1A 1JXMA 3WYAA 2DYKA 3PENA 1T6NA 2AKYA 3LWNA 1XEWX 1KZ7B 1VCIA 1LVGA 3AQ4A 4P0TA 2GXQA 3U44A 1N6KA 4DLYA 1OHHD 3OAAD 2ZJBA 1TU4A 3P26A 1EESA 1LFDB 4TL8A 1SVMA 3IIKA 1KYIA 1XD2B 1P60A 2ZTSA 2CDNA 4RZXA 2AK3A 4A92A 5BW8A 2OCYC 3GJ0A 1IQPA 2YC4C 4HB4A 2PZGA 3P4XA 4BLSA 4ZI2A 2A78A 1TEXA 2GVZC 2HJVA 2QP4A 1Q20A 1IJEA 4GFDA 3GLGB 5TDHA 1ZC4A 1VG9B 2AKAB 3KKOA 3GJ5A 2WSSD 2GJSA 3WNDA 4PHHA 3TW4A 4KV9A 3WYGA 2QEQA 3X1XA 3D31A 4YLGA 2J46A 4JVMA 2V6IA 1Z3IX 3H84A 4MUAA 2VSOA 1TEVA 2ZUDA 4A4DA 2BM1A 1Z0IA 4BPBA 4HAZA 4MKIA 2VLIA 3PV0A 1XMVA 2J59A 4US0R 2AD1A 2XTMA 2Q3MA 2GA8A 1A7JA 2ZRPA 2FJUA 3R8CA 4P4SB 3GJ3A 1ZM9A 2WICA 3BB1A 4HAYA 3CX7A 3WMGA 2QBYB 3HU1A 4DC9A 3F3YA 3AP2A 3SHFA 1XPRA 5EE1A 3KTAA 4MITA 4XJXA 4GSYA 5TARA 1OXUA 2QT0A 4HZUA 2Z0MA 1E4YA 1Z5ZA 421PA 2OXCA 2ZSBA 5KSYA 1FQKA 4NPHA 3RSLA 2ORIA 2UKDA 4B3CA 4NCNA 3V4RA 2ASEA 4B76A 3WBJA 1XZQA 2GETA 4KI0A 2Z4RA 2NMVA 1E1QA 2J87A 5KSPA 2O8CA 4OHVA 2ZE5A 4AYXA 3AV0B 3SR0A 1GFIA 1N0VC 1DEKA 1VG0B 2WHXA 2BJVA 5FPHA 3EPJA 1U9IA 2HXYA 2PEYA 2RHMA 3CWQA 2FOLA 5FBVB 4JIMA 3M0EA 4D4MA 3O8RA 3OFND 4UNSA 4W5JA 4IDHA 4FMDB 4BFWA 5KNDA 3KQKA 4UQOA 5HE8A 1S3GA 2IYZA 1KNXA 4GP7A 2WWGA 1JJ7A 4RZ3A 3NWJA 1XPUA 1L7VC 1YZUA 2F1HA 1Q0UA 3NHAA 3WNBA 1KO5A 4B2IA 3AEZA 4AURA 4P3YA 5EP2A 4DB2A 4AKGA 4M1SA 1Z29A 4TTQA 1F48A 4BWYA 4JVLA 3PR1A 1E2MA 1OKKD 4R71A 1YR6A 3PEVA 3TQFA 2JLSA 3WNCA 1GOTA 1TTTA 2ZI7A 2XNDA 4DLVA 4PC6A 1GG2A 1Q3TA 3ZS8A 2ZVPX 3EW9A 3QKRA 4RFVA 3T5DA 3EZ9A 2H92A 2ZS7A 1W0JD 4RSGA 1W1WA 4TQAA 5DN6D 1ZUNB 3NDPA 3TVDA 4PSKA 2ZETA 4YMUA 1P3JA 1Z2AA 4RKFA 3UK6A 4KFRA 2QAGB 2QZ4A 4W5HA 1P6XA 1KI2A 4XD7D 3DEFA 3ND8A 4LV5B 4FWTA 4JBWA 1Z63A 1HUQA 2ZS8A 2ZRMA 4PAQA 5B2ZA 1NIJA 4BLOA 1T4GA 1SULA 2AFHE 3E5HA 1SXJA 4A0HA 2ZIAA 1TQ2A 3TUIC 4OK3A 4PTLA 2WMOB 4QJ4A 3QQ5A 3TW8B 4AKEA 3CX6A 4A1FA 2XOKA 4US2R 4FINA 5FOTA 1XPOA 3MD0A 4Q4LA 5EXXA 4XVQA 2HJGA 3ICQB 1R0YA 4NCHA 3A8TA 1NN0A 3W8NA 4QJ3A 3QIAA 3LXXA 2PZFA 2J9RA 4M1OA 4PC3A 4YXWD 3JVUA 2QAGC 4HLDA 3VMFA 3QJYA 4F4IA 5FH9A 2PL3A 1G9XA 2FSIA 4LBWA 2P6NA 3SHWA 2WKRA 3UPUA 4M9QA 2J7KA 5FL3A 2CVFA 4GZLA 3LLUA 2F1JA 5JWHA 2WSMA 1U2RA 2ZE8A 2IWHA 1P4SA 2W6ID 1VTKA 3QF4A 2XGJA 4TSFD 5G3ZA 3ASYA 1JR3E 1Z6TA 3C5HA 3L0SA 3QE0A 1CR2A 4LI0A 1OT3A 3RRNA 4ZIRB 1UEJA 4QKQA 1RW4A 1W4CA 4PANA 3W5JA 1W48A 4L16A 1IN4A 1LY1A 4IHQA 2IC5A 4QNRA 1E9EA 4TL7A 4Q9IA 5FBRB 5EP3A 4BRUA 3P4YA 2ZJZA 3FB4A 2ZSAA 3QPVA 4CT4B 4AKIA 3LQRA 2QA5A 4Q03A 1EX6A 1RZ3A 3W9YA 3QXCA 1QHXA 1IY2A 2BKEA 1TF2A 2GK6A 1DG3A 2LWIA 3C5CA 5TB5A 5BXQC 4Q4JA 4C2UA 2CE7A 3SBDA 2CHQA 1WF3A 1EG7A 1JQJC 2QENA 4JT4A 1YQTA 3CF0A 1Q1ZA 1T3LA 2VHUA 4PHFA 1SVOA 2PMKA 4HB0A 1NBMD 2ZU0C 3RRYA 3AKEA 2PBRA 3I5YA 4IRUB 1V43A 4NHOA 1GRRA 4AG6A 2EFCB 4Q7JB 4PC1A 2IT1A 4MYHA 2VHTA 2WWFA 3VNUA 4ACBA 2BC9A 3HP1A 4Y0AA 4H1VA 5IT5A 5F9FA 4BQSA 1YVDA 1G7RA 3SZRA 4Q1FA 3LVRE 1YE8A 1MKYA 4HAXA 2PZEA 1A82A 5EE9A 1ZYUA 2DR3A 5CDFE 1KZGB 2JIZD 5AUQA 4HUQB 4R2IA 4B75A 1SHKA 4W9MC 1IBRA 2YWGA 2A5DA 1Y3AA 2IS2A 1CP2A 2QMUA 1Q1BA 2F43A 5AWFC 4U7DA 4URZR 3EA0A 4Q01A 4NZYA 1GNRA 1DELA 3IIMA 2B8WA 4PO8A 3TMKA 2GEDA 2RGNC 3U7HB 1XU4A 5FUXA 1FMLA 3A1SA 1FTNA 4I1OA 1FP7A 2ZRNA 1E69A 3MWKA 2EYUA 3X1WA 2BMFA 3AKCA 2REXB 2P3SA 2BIFA 4TL9A 1YR7A 1QHIA 2A5JA 4G3XA 3C15C 2UZIR 3GLGE 1KDPA 2H16A 3K09C 4TLDA 1W2HA 1JQLB 1ZNWA 2OCPA 2ZI6A 3EG5A 2X19A 3K0FA 1IM2A 1M8PA 1F3OA 1U8YA 3PUZA 1HTWA 3CPEA 1VDZA 4YDHB 1XD9A 1UJ2A 4C0KA 3WHLA 2O8EA 1J8YF 1CBUA 4V0KA 4JKYA 3RS3A 1G7CA 5LD2B 3Q9LA 3AM1A 1KSJA 5FPYA 1ANKA 4GL2A 1F6BA 1K6MA 2NO1A 3AKDA 5TMPA 5UKDA 1NN5A 3EWAA 3EZ2A 4Q7MB 5HCNA 3DKVA 3IO5A 3PCRB 3VU9B 2YOGA 5JBQA 1ZUHA 3W6OA 1NY5A 2GZHA 2VP0A 3R7WA 2YJTD 2D62A 3ZZTA 3FFBA 1ETUA 3AF2A 2J0UA 1P75A 1KAGA 4C0QC 3KQNA 2ZANA 1ZC3A 2ATXA 1EGAA 5AJWA 4XSGA 3RRMA 2H5EA 3KKNA 4LV6A 1NRJB 2V9PA 1EFTA 3VHLB 3CRRA 1SGWA 1UF9A 1J70A 5KSOA 2YOHA 4GBMA 1FQJA 5LD2C 3W6NA 4JL8A 1E99A 4F38A 2YZ2A 1IN8A 1KDRA 1LNZA 1XTJA 3BXZA 3GCGA 1P2SA 1Z0FA 1F5NA 2YVUA 4TZ0A 4IW3B 1Z83A 3M6AA 1HV8A 3GFPA 3DL0A 1ZM3A 2JDIA 3AVXA 2A9KA 2JAQA 2RCNA 1DADA 4OI4A 4MH0R 2IYQA 3AP1A 3SFVA 4KCGA 1CKEA 4YDSA 2GTPA 2IK8A 2W58A 1E0AA 1XZPA 2H7VA 4B6EA 2QTFA 3UIEA 4EPVA 3R9WA 2RGGA 2AK2A 2Q21A 2QSYA 3O8BA 2ATVA 2JA1A 1DAKA 5EUMA 1G17A 4UNPA 2JGNA 4PPQA 3VKWA 1H8HA 1PJRA 2GAAA 4HZUB 4MKHA 4Q7KA 3U6BA 1ONBA 1VG8A 1XTRA 1TL7C 3U4QA 3QG1A 2JCSA 2IUTA 2GCPA 4DCSA 3FGNA 1HQYE 2WBLC 3LX8A 2BCGY 5KPJA 1XEXA 2O8BA 2CEAA 3IGFA 5F98A 1WDTA 3UWOA 1EFCA 4PFSA 3KJIA 4Z8YA 8OHMA 2VHJA 1VECA 2OFOA 4CEJA 1SHZA 1KMQA 1D5CA 3TSZA 4FI3C 2XTZA 4BLPA 2IYSA 1U8ZA 4ZKEA 1NVWQ 1W4BA 4V0OA 4WZ6A 3B1XA 3LQQA 1U99A 3WXMA 5JWRA 2P6UA 4DBLC 4HAUA 2JJ2D 4MQBA 1F2UA 1OHHA 2C5LA 3CW2A 2IYXA 1UADA 5FTLA 1KMHA 2ZROA 5JJKA 1KO4A 2IXFA 3NG1A 4OJQA 4RJLA 521PA 4AWXA 2L0XA 4DSTA 2ZRJA 1FX0A 4W7SA 4ZCIA 1EWRA 4XVRA 4ITRC 4M1KA 2IYVA 4J0QA 2DWPA 3IIJA 1CTQA 1Q12A 2WSSA 1FW6A 1VKJA 3QKRB 4PZLA 2F3RA 1FZQA 5LB2A 4BECA 4JLOA 3BE4A 5FI1B 2GCNA 2CHGA 2JLZA 3MWYW 2EVWX 3GFOA 1RYHA 5JRJA 5IRCD 1M7HA 4DLTA 2Q3HA 3AF3A 2VP9A 4X8OA 3CRVA 3THWA 5FTNA 4OBEA 1W5SA 3MAAC 3THOA 3RS7A 3Q8XB 2XX3A 4HB3A 4LJ7A 1JAHA 3FYHA 3B1ZA 4PX9A 4QGFA 5FPSA 1E94E 2QORA 4TYWA 2PLRA 2ZI5A 4DZZA 1IJFA 2CCGA 1GM5A 2HT6A 2Z6VA 4QJ5A 5SZHB 2GCOB 4LBVA 1VMAA 3VR3A 1N5LA 1XJCA 3K70B 1XD8A 3E70C 1W2GA 5J40A 2ZRBA 3CRQA 2XNSA 1LV7A 3K8YA 4OQNA 3X1ZA 2XXAA 3D3QA 3LV8A 1WRBA 3ADDA 1NI3A 4O0MA 1MT0A 2WV9A 4TN1A 5BYJA 4PAMA 2QQEA 1CR0A 1UKZA 2J5XA 4GOKA 4RCYA 3EC2A 3AVUA 3BBPA 2ZRHA 4TMTA 2DPXA 5AJVB 1OIXA 2X2FA 2X77A 4XH9B 3AUYA 5ANRB 1GWNA 2BVNA 4M1MA 2VPPA 5EP1A 5JCZA 1ZRHA 1UKEA 5P21A 5B30A 1T0JB 2REBA 2R44A 2IYUA 3NVAA 1H65A 3OFNA 2ODBA 4Q19A 3CIOA 1RRGA 4M9XA 3ZQ6A 2QNRA 3K70C 1E4VA 2V8OA 5DI9A 3ICEA 3B82A 3GLHB 4HDQB 4RD3A 1X1SA 5EZ5A 1KO7A 3GLIA 3RRZA 4MA4A 1W0KD 5KNBA 3LO5A 4TMWA 5GJBA 1PVOA 3BC1A 3BRWD 1J8MF 5IK2D 1J99A 5C18A 2FNAA 1BMFA 3MWJA 4PPFA 5F2EA 1COWD 1OKKA 1U8AA 2OV2A 4TLCA 2IW3A 3VR5A 1Q44A 3AVYA 4Q4JB 2PT5A 3FPAA 4MKGA 4UKDA 2QI9C 1R5BA 1W0JA 4B48A 3SS8A 2PCLA 2XAUA 5J4YA 3L2OB 4H1UA 2P65A 5DN6A 3QUSA 1KI7A 4EFMA 3B9QA 3PFIA 2Y8EA 3OEED 3K0EA 5L3SB 2ZJAA 3AVOA 3QEJA 4KJZA 3IEUA 1Z47A 1G1MA 3G5UA 2P5SA 4A8JB 1UPTA 2F3TA 4XD7A 3VAAA 1IONA 5KPDA 3I5XA 4Q21A 2B92A 5E7JA 2FWRA 2D06A 2GBLA 3THXB 3FMFA 4TMVA 1BH2A 1G3UA 1OW3B 4D80A 4OI0A 2WJVA 3S1AA 4LSGA 1Z08A 1D6JA 4O2LA 2JLWA 3RLFA 4IDPA 3B78A 3EX7C 1XTKA 1EWQA 1VYTA 1G41A 4Q66C 1OH7A 3LH5A 4G1UC 5J5CA 3THYB 4DLXA 2H17A 2XB4A 3KXLA 4B3GA 1HA3A 3PEUA 4I1VA 3T1QA 4GRAA 4YXWA 5CB8A 4QM7A 4JLBA 5EE3A 1S4QA 4A8JC 3CF6R 1R8QA 2YWEA 1E0KA 4ZDWA 1IAQA 2XEXA 3W34A 1R0XA 3GLFA 1Z28A 1JEDA 1HE8B 2Q9BA 1MH1A 1AKYA 3K0CA 4TSFA 1QG4A 4PAOA 5JJLA 1UKVY 4UXHA 4QC2A 2VL7A 4RD6A 4DKXA 1DPFA 2BJWA 2ODNA 1ZCAA 3QPUA 3L8ZA 2E9SA 2QMEA 2ZJYA 4NONA 4R9UC 1UKYA 4MGIR 2C2HA 3RS5A 2VP6A 3DZ8A 1RC8A 3LBHA 3VX4A 5CLLA 4WW0A 5DSZA 4Q4AB 3TSWA 5F9HA 1JR3D 3B6EA 3KQHA 4XWKA 3SDZA 2NIPA 4B73A 1Z6YA 2ZUCA 1Z8FA 4OQLA 3AVWA 5HKKD 3GD7A 1UBCA 3ONWA 1NY6A 1E1RD 2IYTA 2N46A 3X1DA 3FOZA 2GXAA 4KFSA 2ZS9A 2QPAA 1P7CA 2W2TA 2O8FA 1N6HA 2ZXUA 4HEJA 1NBMA 4II7A 4V0NA 3T61A 3U3KA 2OBMA 1SQ5A 4TTRA 5L8VA 3IHWA 3TRFA 4M4SA 2V6JA 1B0UA 3KQLA 3EIQA 3A6PC 1G5PA 2DHRA 3ZH9B 2W83A 1LF0A 1CRPA 1GL9B 1DARA 4DCVA 1DG1G 1BYUA 2JASA 5JHGB 1ZM4A 2H18A 2RMKA 1F2TB 1W36B 5CITA 1NSFA 2HEIA 1L4UA 3Q72A 4KBFA 1KI6A 4YMWA 2REOA 2JIZA 2WWYA 4NTZA 3I32A 1YZTA 3GPLA 1HT1E 4C0HA 3HWSA 1VCNA 3ZLJA 1U94A 3GFTA 4KYIB 3NEYA 4JLAA 4QHTA 3R20A 4ESHA 3D7MA 5KO2A 1K5DA 3ZGXA 2VO1A 4NYJQ 3E1SA 3SYLA 2TMKA 4PC7A 4URVR 2J7PA 4BFVA 1MR3F 4DDWA 5K8UA 3QG5A 5TV2A 1N6IA 3T1OA 3TJZA 2VEDA 1CULC 4KBGA 1ZNYA 3LY5A 3I4LA 2YWHA 1UBGA 1FUUA 1ZM7A 4JVNA 5FPTA 2IWRA 3EARA 4ESVA 1R7RA 1AQYA 2JATA 1W36C 2EFHB 5DISB 5KDDA 4NCIA 1KDOA 1MOZA 1ZUIA 1XEXB 2QSZA 4YMSA 1U90A 3UXMA 4IVQA 1AZSC 2E87A 5K8IA 5A0FA 2GDJA 1FOEB 3A4LA 1E9DA 1Z6GA 2W2VA 4FCTA 1AA9A 3UMFA 5KOYA 2FZLA 2HXSA 4CEJB 3KJEA 3MG9A 3SJAA 5DGXA 4LC1A 4N0EA 4QOSA 4AG5A 1G64A 2BCJQ 3HPQA 3MJRA 1KJWA 2DWQA 2IXGA 4URUR 5CJ2A 1R6BX 3QVUA 4WZAE 2ZI4A 1E2PA 3BB3A 3BB4A 5K8TA 4G5GA 3R8FA 3SYNA 1GTVA 5JSZA 1F2UB 5C4GB 3RDPA 1P5ZB 1G4AE 2ZRLA 4RD0A 2V7QA 3SYKA 5JWOA 1P2UA 2LKDA 3P32A 5CK5A 1OIVA 2C8VA 4EDHA 2V3CC 1OF1A 4TZ6A 2YOFA 3F8TA 3EIHA 2JLRA 4TMZA 4DWJA 1QHNA 1L8QA 3B85A 1MO3A 2FGKA 5SZJA 1XX6A 2Z43A 1YZKA 4O3MA 2XSZA 4Q1EA 3EPLA 1SZPA 4MDFA 3LVQE 4B2LA 1XNJA 2FX3A 4EJSB 1S9DA 5CYOA 3NBZC 2QU8A 1QHHA 2I3BA 2C95A 4LHZA 3LBNA 2WJJA 4V0LA 2QN6A 4LJ8A 1SVIA 5JRZA 2RH5A 5JEDA 3VKHA 1SVKA 4LJ9A 1CF4A 3GLHE 4IEIA 2IS4A 2CK3D 3ADBA 3OEHD 2V1UA 3FMIA 2HYIC 1WCV1 1G18A 3KB1A 4DIEA 5AJZA 4L8GA 3BH0A 4DT1A 4WXRA 3A4NA 5FBLB 1ZINA 4OQXA 5JCPA 2GRJA 1LW7A 1XJ0A 4IDNA 4PXAA 1QRAA 2VSXA 1UBEA 4ZCMA 1S96A 2OM2A 3LAWA 4EPTA 2ORVA 4QXAA 2G9NA 4EJSC 2XXAB 1XXHA 4KU4A 1CXZA 5H8WA 2ZRIA 2WAXA 5E4FA 2KWIA 3OIVA 2G77B 3VQTA 2FPMA 4C4PA 3LRPA 4R7ZA 1MABB 1E9BA 1ZIOA 5E7MA 1P2TA 3IDQA 1J90A 1SVSA 3L0OA 1L4YA 1WA5A 1WMSA 2G88A 4C0AC 2ZRAA 4LV8B 2ZQ5A 4A2QA 2QGNA 1RJ9A 2VIIA 2WWIA 4LUCA 2EU8A 2ZRGA 5IDVA 1UM8A 1Y63A 4FD2A 4A0RA 2JJ2A 4D0GA 2QTVB 1D2EA 4JKIA 1GKIA 4RFSA 4GMXA 3ZIAD 3ADKA 4ASUD 3GLIB 3K0AB 4BFXA 5JECA 4C9BA 1UBFA 3GJ4A 2OCBA 3AGPA 5EXTA 5FI0B 2FSHA 4LPSA 1TQ6A 2IYYA 1E79D 1NMXA 1NKTA 2YWFA 2ZI3A 4FCVA 4BEBA 4Z1MD 1II0A 4ZPXA 2VYFA 4Q1AA 4U5XA 4B71A 4NKRA 3IPYA 2CMKA 3IO3A 2NZ8A 3MLEA 3TUJC 2DY1A 3RC8A 3NC0C 1R8SA 2DFNA 4TTPA 3QKSA 3EZFA 4MGZR 4UJ3A 1VIYA 3KJGA 3A1UA 1NNEA 2HUPA 2XB2A 2OLJA 3CRW1 4F4JA 1G3RA 3TKLA 1KIMA 1I4TD 3OHMA 3KKPA 2QP3A 1FFHA 2V1XA 3OIYA 4KLZA 5FFMA 3K9LA 3NHBA 4TMKA 3RANA 4YONB 4KITB 3A37A 1J2JA 5GJWC 2Q9AA 4HAVA 1RFLA 1CLUA 4KSBA 2QGZA 4ARZB 4G0NA 5FUVA 2WOJA 3WMFA 2QM7A 2GEUA 1S1MA 2HF8A 2BDTA 2VP5A 3BFXA 1G3MA 1QF9A 1A5TA 1N6NA 3RC3A 2AL7A 1NJGA 4AYWA 4ON9A 1X3SA 4B47A 1FL9A 2AWOA 2FPLA 4PSAA 3MSXA 1O3YA 1Z07A 2QPOA 2WTUA 1KK2A 2OILA 2FV8A 2D74A 3P20A 1C4OA 4JLDA 1XFAA 4LY6A 4M8NE 1XJQA 4PSVA 4FMCB 4HLUA 4C3ZA 4WXPA 1KI9A 2Q0HA 4MUBA 4F7WA 1GRNA 4B33A 4EQ6A 1II8B 1W49A 2CVHA 3EIEA 5BYKA 4LJYA 4V0ME 2ZI9A 3HPRA 2WAYA 3AVPA 2ZEJA 2ONJA 5L3QB 2BMJA 4PQFA 4FMCF 3HR8A 1E3MA 3GEIA 1OSNA 3TBKA 4P32A 4BFYA 1W0KA 2FMXA 5LDDC 2E1RA 2OAQ1 1P9NA 5IK2A 1YRBA 2EW1A 5AUPB 4EPXA 3DHWC 1COWA 2F1RA 3WBKA 3ADCA 5D3MA 3B8HA 2PT7A 4B32A 2UVQA 4OHWA 1N6LA 3FDIA 2J41A 2FFBA 2O0KA 4CGZA 4LHYA 2CJWB 1E9CA 3OEEA 3DPUA 1KSHA 2A5FA 4MRSA 1T3HA 4HATA 3WP0A 2H1LA 1ZU4A 3TIFA 4V03A 2H8KA 2B7BA 2WVJA 4M9ZA 5H68A 5AK0A 2GJ9A 2GJ8A 2XTNA 1BOFA 3J81k 1P9WA 1Z2CA 5DI3A 1PUJA 1AZTA 4IDQA 5JMTA 3AB3A 2FA9A 1RRFA 4BASA 4TLEA 1ZP6A 3KDSE 3LW7A 4TYPA 5BN4A 4C7OB 3H4MA 3RAPR 3KUCA 1G8HA 2O0HA 2CCJA 4XOIA 4YC7A 1PV4A 4AYTA 3PITA 3BIFA 3CNLA 3FWYA 1ZW6A 1KTVA 1JBKA 4A2WA 1W46A 1K8RA 1XMJA 5J4HA 3GEHA 3QNUA 3WRYC 3CZPA 5LPNA 4A0FA 1RE0A 3B1YA 1OE0A 5A5GA 2OUKA 3K9HA 1YKSA 4OI2A 1W4RA 1EFRD 3CWZA 3WMEA 3TAUA 2G3YA 1Q22A 2GJKA 4X8HA 4NCKA 4DSUA 4WAUA 1W7AA 1X8LA 4QBHA 3SBEA 3FVQA 1E2GA 2KJQA 3ZJYA 2JJ1D 4UXIA 5JZVA 1AIPA 3RSOA 5KHOC 3U44B 4LX0A 1X8JA 3W5IA 3IHLA 1OH5A 4D82A 3O8DA 1S2MA 1DAHA 1M7GA 1N25A 2WZQA 1U0JA 4DCNA 4S2EA 5FUWA 2OSBA 2R6GA 4LRWA 5FOVA 1JR3A 1DOAA 3U5ZB 2C78A 1XP8A 3L0IB 4D2IA 4LYAA 4K46A 2WWHA 4DHEA 3UG7A 1GAJA 1XDBA 2R62A 3K53A 3SNHA 4A9AA 5HKKA 3EPKA 2ERXA 3B2EA 4NCJA 2I1VB 3Q5DA 1G8GA 4HYYA 4TWZA 5A4JA 1E1RA 5BN5A 4CF7A 4Q9KA 4LYHA 5B64A 2WWWA 3EC1A 1E9RA 1EXMA 2JLXA 1KGDA 1M34E 3CR8A 4NYMQ 1R4AA 1O87A 3ETLA 3OESA 5EJEA 3ZD7A 2O52A 3AH8A 1HYQA 1NF3A 2VH5R 5E3HA 1MRSA 1FMJA 5HPYB 3RS2A 3NDBB 2AN9A 3LNCA 2GAOA 1LS1A 2WKPA 2GF9A 4CEIA 3KTAB 2PEZA 2EWVA 1A4RA 3CB4A 5FTMA 3T34A 1NG9A 1SKYB 3TNFA 3KKMA 3PVSA 3NIBA 3SFZA 4D4KA 3K9GA 4WBSA 4QGHA 3QBVA 5H70A 2O8CB 1QVRA 3CUEF 1YZNA 2CLDX 2PCJA 4NE2A 5HCIA 4KVGA 1FUKA 3DM5A 4XWOA 4DJTA 2MMGA 3GLIE 2ODWA 4B6FA 3CZQA 3AF0A 1TQ4A 1NKSA 1Z06A 5CDFA 1JEEA 1VPLA 2IYRA 2LCFA 2XJ4A 4CW7A 1DO0A 5F3WB 3JZMA 1IOZA 2VBCA 1XCPA 2ORWA 3GJ8A 5BN3A 2IX3A 1KOFA 2GKSA 2DB3A 2A7QA 1T91A 2C98A 5L3VA 1E96A 2OLKA 1KO1A 1DAMA 2O0JA 4WA7A 5K8LA 3OAAA 2D7CA 1NVXQ 4IVRA 4I81A 4IEEA 2HLDD 4WVFA 2J0SA 3GJ7A 4G5RA 3SN6A 1E9AA 1HY3A 2ZYVX 3CLVA 4TQUS 4DEXA 1G19A 2ZJ8A 1Q1QA 1XRJA 2X2EA 4HZIA 3TK1A 4CRWB 2NO7A 5C46F 2QAJA 3GLGA 2FH5B 4M21A 1G7TA 3CNNA 4P4TA 3CR7A 1U9IC 3HU2A 1KK0A 3PUYA 1G5RA 3MWLA 3PEWA 4JZKA 3GEEA 1E9FA 4E5UA 2AHOA 3TQCA 2CL7X 4UNNA 1I2MA 2BM0A 4OYHA 4DIDA 4KXFB 5GADl 4A36A 1ZD1A 2FFQA 4M9SA 4L9WA 5KDOA 2QQ0A 4RFSB 1ZM2A 1FPMA 3TSOA 2B6HA 2QROA 4NP6A 3DKPA 6Q21A 3T35A 3Q7PA 4HDCA 3HYRA 2ZR0A 4D81A 2QBYA 1XB2A 3W6PA 4AKHA 1BO6A 1GL6A 1JPNA 2KE5A 1KI1A 1JECA 1OV4A 1SXJB 1WE2A 1AS3A 3Q5EA 4LC0A 5E95A 1XBTA 4RD4A 1HQCA 3K70D 3NXSA 4AI6A 3UMRA 1X86B 2HV8A 3FMOB 1YR8A 1YZGA 4JYCA 2C9CA 1LF5A 1CJTC 3RS0A 2EFDB 3R9IA 3QPWA 3ZVRA 1DVRA 4C2TA 2RGXA 2R2AA 5B57C 2ZSFA 2CK3A 3KQUA 5CYPA 3OEHA 2ZYTX 3LLMA 4GT1A 1NVVQ 5GJCA 2H57A 4DDTA 1GVNB 2ZREA 1SXJC 3RVBA 5DYGA 3QF4B 4XSHA 2HYDA 3IQXA 4JS0A 4I4LA 1XEWY 2MSEB 4IXMA 4MGKR 4E07A 2WKQA 4HB2A 3REFA 4A15A 4PC2A 2BBTA 5J4VA 1G20E 2W0MA 4JSYA 3UATA 4M1WA 5LB4A 2PX3A 4RCZA 5D3QA 4GOXA 2D4HA 4DB4A 4NYIR 2WMNB 4I1UA 4B34A 2OBNA 2CL0X 3X2SA 1QBKC 4TMXA 2IS6A 2P2LA 4CZ2A 3QXHA 3ZVMA 1CJVC 4HLQB 3K1JA 1G8YA 3K9NA 2FG5A 3HR7A 3W90A 1PLJA 3U7EB 2QAGA 3PXGA 4MRPA 4ASUA 3KXKA 3VHXA 3VR6A 2G1JA 4OL0A 1UDXA 1UFQA 1D2NA 3MJHA 2OT3B 221PA 2VP4A 4ZDIA 1E79A 4Z1MA 3T1VA 5KU1A 2D7DA 1E2FA 4CDGA 1U0LA 1WXQA 4LGMA 2J0QA 4FWIB 4DCTA 3D6TB 5D3MB 2ZE7A 3JZAA 2V54A 2GILA 1C9KA 4PO1A 3O8CA 4DSNA 1R5OA 3AGQA 2QUZA 2ERYA 2QRZA 3N2EA 3HYTA 4JMPA 2PMDA 4Q5IA 2WJHA 4TQ9A 3RABA 721PA 1BYIA 1RVDA 2F43B 3IKJA 121PA 3MMPA 4U02A 3KX2A 4A2PA 5JLJA 5AUOB 3BOSA 1AS0A 5DI3B 4L9SA 4Q9JA 4G5OA 4B3BA 1QVAA 4DLRA 1R0WA 2NO6A 3OE7D 3P1JA 2W6IA 1A1VA 3FTQA 3M1IA 2P0EA 3RWMB 4LJ6A 1V5WA 2C9OA 5SZKB 4ZIRA 4QG7A 1ZIPA 4GI7A 1LTQA 2O5VA 1GDDA 4QHSA 4B43A 4DSOA 1OLOA 1HEIA 4Q00A 1WB9A 2G0NA 2YHSA 2LKCA 3PUVA 3LFUA 4Q47A 5DYIA 1VCMA 3IEVA 5EP4A 2Z5FA 3KFVA 3TH5A 3WHKA 5TVKA 1MRNA 3K0FB 3LW8A 2JEOA 4NH0A 1IN5A 1N0UA 4MKFA 5GJVC 2BHRA 2FSFA 2CXXA 1PUIA 1ZVQA 2FPKA 1WBDA 4LK2A 4IVPA 2AWNA 5CIWA 5SZIA 2O8EB 5KDLA 2YINC 3TVTA 4CT5A 1DBSA 2OHFA 4BE7B 2G6BA 3Q7QA 4PHGA 4URWR 2BV3A 5DE3A 4LHWA 4OK6A 5IF9A 4AK9A 2A2ZA 4FW9A 5CK4A 5FL7D 1N5JA 4LBZA 1CJKC 3NC1C 1CJMA 1E2KA 5DO9A 3R7WB 4FMBB 2ZRDA 1OJLA 1SKYE 2J0UB 2RGNA 3LDAA 1T8TA 3HDTA 3QSYA 2C03A 2VSFA 4QNMA 1G3QA 2C96A 1DTSA 1X1RA 3ECCA 4AC9A 5JHHB 2QM8A 3ZD6A 2AD5A 3AUXA 2XZOA 2QTHA 4GP6A 4DRZA 3A1VA 2ZYWX 1W36D 3BFKA 3GMTA 3TLXA 1VYVA 3K09A 4UJ5A 1KJYA 4M0LA 4TYQA 1YZLA 2RGEA 3H2YA 1Z0DA 4EAQA 1N0WA 1G3IA 4B74A 3AVVA 4HUQA 1KDTA 2B8TA 4DLWA 3BH6A 4JL5A 2QY9A 3DMDA 4Q9LA 2IS1A 3EXAA 2B21A 3A4MA 3ZDQA 2CLSA 5EQTA 3B13B 4OHXA 3F0TA 3U60B 2F9LA 2W6JD 3CPHA 1N3BA 1H8HD 2AXNA 5FBWB 1VHLA 2BOVA 1OH8A 2QRNA 4K81B 1AN0A 1FNMA 1KY2A 1TPZA 2W00A 3FHOA 5CM9C 3U3JA 5GVRA 4ZV4A 2FN4A 3U4QB 3T15A 2WIAA 1H8ED 2R9VA 1WQ1R 3SE0A 4CVNA 1S1CA 1XMSA 2CNWD 2GEVA 2WOOA 2O8BB 1C1YA 4ZCLA 3N70A 4CEHA 1E9SA 2IL1A 4JVSB 3QKTA 1E2NA 2FZ4A 3QXXA 1II9A 3UKDA 1SVLA 3U7FB 2CHVA 3VTKA 1UEIA 1G5TA 1E2HA 2ZJ2A 1EFRA 3TR5A 1AGPA 2MSDB 4PR0A 1VG1A 4BRWA 2F6RA 2W2XA 1RRPA 1G21E 3VU9A 2EFGA 1SXJE 2D2EA 3KKQA 2JJ1A 4A82A 5C2JB 4L15A 3I62A 3KL4A 3RHFA 1JALA 1OFIA 3BAFA 2K5UA 3I8SA 1KMHB 2VHQA 3DZDA 3RS4A 1FX0B 2IYLD 2DFLA 3OF5A 1DO2A 2QE7D 4LYFA 4G5SA 5CIQA 3K0SA 1G291 1W4AA 2G1KA 3B7GA 4IOLA 1G16A 3QENA 4JJZA 4LHXA 1YHNA 1I2DA 3B1VA 3FHCB 2R8RA 2VTKA 3C7KA 3H1TA 4B3FX 3KJHA 2NGRA 3QXSA 2KB0A 3RYTC 4KODA 4TYNA 4E22A 1P2VA 2BBSA 2ANCA 1SKQA 2BMDA 2R6CA 5HE9A 1KAOA 3VFDA 4D4LA 3THWB 5C1BA 2WM9B 3IUYA 4QL3A 2NO0A 5JI3E 2QT1A 2IXEA 4PPNA 4WZBE 3G82C 1ZD8A 2IF0A 1EFHA 3WY9A 1ELOA 2HF9A 4Q1DA 2XJ9A 4PQYA 2IUSA 2ZSDA 5TXGA 3FKSD 5KSZA 3QBTA 2PJRA 3CH4B 1T9HA 1YU9A 5FTKA 2F7SA 4LOAA 1MO4A 4TT3D 4EPWA 2JLVA 4D6PA 4Q1CA 1GP2A 4L5BA 4H9GA 5G40A 4KVAA 4A0GA 1CRQA 4MRNA 1WBBA 2CL6X 5JS8A 1GITA 3MCAA 2C99A 2DFKB 4M1YA 2ANBA 2ZR7A 2D3WA 1YJ5A 5JFGA 2GZDA 1JJVA 3CKLA 4JL6A 2X8AA 3FMPB 2G0TA 3QEOA 3MFYA 2WJGA 3DOFA 3BWDD 2RGCA 1NMYA 821PA 2NO9A 2HLDA 3WYFA 2XITA 2ZRCA 4FMDF 4PZZA 2A5GA 2BWJA 3C41J 3AP3A 3CONA 1BMFD 3CM0A 3QKUA 1D2MA 2EYQA 2WWXA 4NU0A 5G3YA 4DUGD 1E0SA 3NKVA 3U2QA 4IXNA 2AFIE 2IA5A 3QVVA 2OE2A 4LBYA 1N5IA 4BZXA 1QHSA 4P33A 4W5WA 3L0PA 1YR9A 2FU5C 1TF5A 4C0SA 3D8BA 5ELXA 1R2QA 3U7GA 4GDFA 4JLVA 3IILA 2F55A 2UZ3A 3L43A 2QL6A 1GRQA 4BFTA 3DVLA 5FOUA 1P73A 1KSGA 2NPFA 4TYYA 4MRVA 1PZNA 1KHTA 1NG1A 2FF7A 2MSCB 4NYJR 1IHUA 4P4UA 2FEOA 1XMIA 1KO8A 2HT1A 1RKBA 2C77A 1JPJA 4LCBA 3TGPA 5DNYB 3ZQJA 4M1TA 4X8LA 1G6HA 2GCOA 5GVSA 3U3RA 2A3RA 3REGA 3S1AB 4P31A 3W3ZB 3H0KA 3JVVA 1KI8A 2IBMA 2VRWA 3ND9A 4MYUA 3IQWA 2WPDD 3B9PA 4GMDA 3OIUA 3I1FA 5HTKA 3LA6A 3W3AA 1RPZA 4G01B 2OXRA 4C0BA 3EASA 1NMZA 2RGBA 4B3XA 1E2LA 1DE0A 1VHTA 3GLFB 3KFXA 3WRXC 1IXZA 1M2OB 1GNPA 1ZMXA 2BEJA 3IPXA 2GBLC 3B1WA 2BBOA 2F9MA 1GSIA 3KB2A 1NN3A 3B60A 4QGGA 1M1YE 1T3SA 2G83A 4ILEA 4V02A 1IY1A 2EQBA 2OFWA 3PUXA 4HSEA 4OQFA 4QBFA 4LPKA 1CEEA 2PX0A 3GLHA 4DVGA 3SC3A 1W44A 4AD8A 2FGJA 5H1YA 4BGDA 5BQ5A 4X8MA 5LBIA 5KYKA 2ZPTX 2BKUA 1WP9A 3A36A 5CM8B 5FBQB 4B2PA 1US8A 1ZU5A 1NVUQ 4Q18A 4B35A 1XCGB 5DH9A 4Z51A 1T8UA 2IHYA 1N6RA 1AQUA 4PZYA 2FDCA 4S35A 3SJZA 4E03A 4Q4HA 1TUIA 1XCMA 4IJMA 3U3OA 5DIFA 1A2BA 1X6VA 3N5CA 4Q1BA 3BERA 2P67A 4FIDA 4RY2A 5AJXA 1OYWA 2PH1A 2J3EA 3K0CC 5L3SA 2NTYC 2P5TB 3I8XA 4MYTA 4LDJA 2O8FB 1HE1C 4NDZA 1Z0KA 2NG1A 3I92A 5EZ6B 1VYUA 3BD9A 1XTSA 4A8JA 5JS7A 2JLQA 2Q3FA 4M2LA 1IN6A 3VKGA 4OJKA 3CO5A 2I4IA 4RD2A 3THXA 1EX7A 3CPJB 1NL3A 4EFLA 1HT2E 3G0HA 1Q3HA 4MYCA 4D25A 3C8UA 1Z0AA 2GHIA 3M4YA 4PPGA 1Q57A 4BZPA 4N1AA 5IHPA 1GIAA 5JJIA 3EA5A 2IUUA 4PO9A 4AIIA 4BLRA 2V4ZA 3NH9A 1K5GA 1KI6B 3O47A 4QHYA 3THYA 5J4KA 1AGRA 2R6FA 2YC2C 4EFNA 1GZSA 3I61A 4LWZA 3CF2A 1T0HB 4HDOB 1KKLA 2OBLA 3PUWA 2J0VA 1EK0A 3QOFA 2NOAA 2J7PD 1DAEA 2BBWA 3U61B 1AKEA 3VR4A 4BLQA 2ZU6A 1KY3A 3LBIA 2NQ2C 3LD9A 2Q6TA 4RVCA 3C16C 4JSTA 2EFEB 4YMVA 1JR6A 2DCUA 1P62B 1B23P 1NLFA 3GQBA 2QP9X 3DMNA 3OE7A 1P9RA 1R0ZA 2OO7A 3AF1A 3W8RA 2IEYA 4BUJA 3RNLA 1TNDA 1RIFA 1ZCBA 4BFUA 1M7BA 1T5LA 4D0LB 5J4LA 4JBYA 4NMMA 4DXAA 4CEHB 5TY0A 2ZUBA 1OB5A 2AX4A 4Q4AA 2J45A 3H86A 3Q3JB 5CLQA 2GWHA 1CR1A 4ACAA 4HI0E 5FTJA 4K8OA 5FOXA 1BKDR 3EZ7A 3E2IA 2AR7A 3AKYA 4L4UA 2CBZA 3DM9B 4QBGB 2A5YB 1KK3A 1TAGA 4G5QA 2N42A 1N6PA 4MDEA 4QM6A 4LJAA 3DO6A 3X1YA 2ZAOA 2KBEA 1KNQA 3EZ6A 5FL7A 4A6XA 5JSZB 2V7QD 3T06B 2C04A 3PG5A 3FHTA 1D8TA 3SQXA 2YNMA 3PIRA 3QY0A 4AY2A 5M04A 3HU3A 2GK7A 4JJKA 5DHAA 1OFTA 3L8YA 2O8DA 2Z4SA 3NBXX 2ZRFA 4V0MA 1KK1A 1OXTA 2XSZD 5B58C 1F2TA 3T12A 4NYIQ 2HDNB 1F60A 1QZXA 4CIDA 1G8PA 1A2KC 1E2QA 3DOEA 3TAHA 1ZAKA 3ZZUA 1QHHB 2RAPA 1CIPA 1M74A 2R6AA 3KXIA 3TUZC 1E1QD 4I1SA 1GKUB 3SQWA 4JBXA 1ODFA 1W5TA 1T5IA 3CNOA 4WOPA 1X8KA 1GILA 4B44A 1RRCA 1OPXA 4JYBA 4PHTA 3NH6A 4DCUA 2PJZA 2W6JA 5HZKA 2NPIA 4DEYA 1JI0A 3UWKA 3ZVLA 4HUTA 1DS6A 5KTYA 4DT1B 5JI2E 1E98A 4EIWA 4I99A 3VNVA 4JLMA 4PQRA 3BORA 3I73A 3OZXA 4C0JA 1TADA 2ONKA 4E09A 4RD1A 1H8EA 1CU1A 2I1QA 3BS4A 3N2IA 2N1BA 4XWAA 2CNWA 1N2CE 1XD2A 1XXHB 1ZNZA 2VHCA 4UXJA 3OIWA 3P27A 1ZNXA 1N5KA 1VIAA 2ZRKA 2VF7A 3BJIC 5HR5A 5KNCA 1AM4D 4QGAA 2OG2A 2RB4A 3I3SR 2R6DA 4KSCA 4RKEA 4IOKA 2XNDD 5FUYA 3V9PA 4QBIA 3WP1B 1TX4B 2KBFA 1DAIA 4Q02A 1W47A 4KAXA 1RJ9B 2DBYA 3PQCA 2ZJ5A 4QFMA 2VQSA 1OXVA 1E32A 1Z0JA 3MGCA 4N0DA 4FCWA 4EPYA 1E2IA 2ZITA 4DLUA 3C14C 4KFTA 4RZ2A 5FR1A 4P4SA 2JLUA 4OHZA 1YZQA 2R65A 1OXSC 5CJPA 1RYFA 4FXPA 1P72A 1OH6A 4BZQA 3A1TA 4ZKDA 1SXJD 4US1R 2ZM5A 2GVDC 4OK5A 5HZHA 4IDOA 2QE7A 2VF8A 3HJNA 5DLQC 2BEKA 4UNQA 1GUAA 2GJAA 4BEJA 2XOKD 3QKSB 4EJSA 3GLFE 4TLAA 4MRRA 1Q21A 3ZZ0A 1OFUX 5C4MA 1U98A 4DDUA 4D26A 1OFHA 1YRAA 3UANA 1Z6XA 5FOWA 4OI1A 1ESNA 3FE2A 4B3DA 1NSTA 1G7SA 3BK7A 3TE6A 4MGYR 2VP2A 5EE5B 3SJBA 2ODEA 4UNRA 3CBQA 1AK2A 3SJCA 1MV5A 2RGDA 3T1TA 3GJXC 5EUQB 3SOPA 4Q9HA 2PLFA 1SVWA 3UG6A 2CLCX 1I4DD 4IFBA 5DHFA 4ZDJA 1JNYA 1KI4A 4JLPA 1S3SA 3FKSA 5EXSA 3SEAA 2GF0A 2FFAA 1ZJ6A 4KHZA 4JT2A 5FPKA 2YYZA 4EPRA 1QHGA 4Y0VA 3ASZA 4TT3A 5G41A 2QMHA 3NEJA 4LJ5A 2JLYA 3LX5A 4DLSA 2XZLA 3KZ1E 2A30A 1HH4A 2RHDA 1LS6A 4XTCS 4LHVA 1MABA 4Q48A 1NN1A 1TUEA 2GZAA 1OXXK 1NBME 4RZUA 1GKYA 4ABYA 3CRMA 1NJFA 1R5NA 2QMOA 2RKOA 4JLNA 4IKEA 3DDCA 4IOJA 1KKMA 1LB1B 2J1LA 5G53C 2ZE6A 4YQFA 4DDVA 2V55B 2GXUA 2VA8A 1PLLA 4EQ6B 5AJYA 1GL7A 2IHBA 1XEFA 3SI7A 1NLZA 4NYMR 4C30A 1L2TA 3K0AA 2YV5A 2ZVQX 3ZS9A 4XVUA 4N3NA 3ZIAA 1E2EA 2MMCA 3MRSA 1E2JA 2DWOA 3LXRA 4KLNA 3PJRA 2NZJA 1US8B 1TMKA 3NBFA 4POAA 2OZEA 4FN5A 3RWOA 4C0LA 4ERNA 1IXSB 4DUGA 4Q4HB 2B7CA 1AJEA 3QXJA 1E2DA 4TL6A 3QF7A 1G6OA 1D9XA 2FFHA 3MUFA 4HAWA 4HLUC 3ZVNA 1OB2A 1TQDA 1XTQA 2XZPA 2BMEA 3CH5A 1EFUA 4HLCA 3GP8A 3EPHA 5BWMA 3IBGA 5CB6A 4F93B 2F1IA 2GXSA 2KSQA 1M6NA 3B5JA 4Z8XA 5J47A 4OKSA 4NBSA 1Z22A 4ARZA 2HCBA 2JJ8A 4A6PA 1DAGA 2Z83A 4R98A 3F5FA 4U00A 4ZDKA 5FOSA 1ZD9A 1KI3A 4Z54A 1CJUC 2SHKA 1XWIA 2WIBA 4BFZA 2P6RA 3C4JA 2OEPA 1U81A 1E0JA 1NLYA 4GPTA 4QRHA 5EE0A 3FKQA 4OHYA 4ZO4A 1IXRC 1HURA 1G8FA 2WPDA 4GOJA 2OFXA 2OAP1 5AR1A 2IEZA 2ZJOA 1XF9A 3EAQA 2D2FA 4LYJA 4CYMA 3NBYC 1MO6A 1I4LD 2WJYA 1DAFA 4LJ4A 1IY0A 4XIGS 3U3MA 1VCOA 2WJIA 1G4UR 4EUNA 1Z6AA 4Q7LA 4KYUA 1FP6A 1OYYA 1UDWA 4OQMA 1TU3A 1II8A 1UAAA 1Q1EA 2GESA 4KO8A 2ZR9A 4YMTA 3T5GA 2YKGA 1BIFA 3EWSA 4URYR 2Q9CA 4NL4H 2EWWA 5L3QA 3VR2A 4IFEA 3ZYCA 1BS1A 1KJZA 5AUNB 2CE2X 1FNNA 1NIPA 2GNOA 2KI5A 1AS2A 4M53A 3BFVA 3SU8A 1NP6A 3V00A 3CX8A 2RGAA 3IBYA 3VX3A 2OCAA 2IF2A 3GJ6A 2CCKA 1ESMA 4O25A 4F4CA 1D9ZA 2ZSEA 4DLZA 4ZI3A 4F92B 1CS4C 3AVQA 3TR0A 4BFSA 5KUTA 4IOMA 1QHYA 1S0UA 4KFUA 4D0NA 2CJWA 1FTSA 1S9HA 2OESA 1XTIA 3A58B 3AF4A 4WIAA 2FEMA 3VR1A 1J7KA 1E6CA 1R10A 2JDID 4F91B 3QI2A 1OIWA 3Q85A 2AXPA 4GZMA 2ECKA 4EKDA 2FSGA 2W0SA 3R9XA 1NVVR 1XXHE 1JXOA 3UMSA 3PEYA 4LZZA 4TLBA 2O8DB 1CR4A 4GNKA 3V4FA 3AVTA 4CEIB 3BH7A 1N6OA 5E7IA 5FR2A 1U0HC 4JLJA 4C7OA 4M22A 1IN7A 4R2HA 1KSFX 1QG2A 4D4JA 5EXPA 1QDEA 1TF7A 3FFAA 4O2RA 5L3RA 1S8FA 4XTRA 3NTUA
chains in the Genus database with same CATH superfamily
4IIJA 3WGZA 3IUEA 1XYGA 1UR5A 1JAZA 2JAUA 1NUHA 3ET5A 2QPTA 3INRA 5CB4F 4DOMA 1GEEA 1MGOA 2ZAMA 5AOVA 3A1WA 3ECAA 4JBIA 1SR8A 4KWHA 2ZBVA 2I6GA 3BGWA 3ZV3A 1LBEA 4C4ZA 4XYEA 3M6VA 1GNQA 1BSVA 1HBJA 1Y4DE 1MO5A 1ID1A 3FM9A 2WDZA 2DYKA 2HU8A 1F3LA 1T6NA 2PFKA 3BTSA 3GCZA 1M10A 4K6GA 1F0YA 2P9QA 4QTZA 1SHUX 4WK6A 2ZDHA 2EP5A 4M9CA 2ZJBA 5AXCA 1VA4A 1KYIA 3MOIA 4PGGA 5BT8A 4C04A 1PO7A 2XTJA 1O6ZA 2PGDA 4XQ9A 4C22A 4A92A 1QX3A 2AI1A 3BAZA 4HB4A 2Q5IA 3ETDA 4BLSA 3HVHA 1YDFA 4YCJA 2HJVA 2QP4A 1Q20A 2HBYA 1IJEA 5DTEA 3V5NA 4KN9S 4GFDA 1UBKS 4I55A 1VG9B 1I13A 3LTEA 4EENA 1W30A 3GJ5A 5T5QA 1H42A 4PLTA 5SYAA 3TW4A 4DWVA 2NUAB 2ZQYA 3MQ2A 1N8SA 1N34B 5COAA 2JANA 1XVLA 2B1RA 2HPAA 2J46A 1Z3IX 3H84A 1C9YA 1ZJ4A 3KPJA 4GICA 2VSOA 1TEVA 4MUAA 3GIDA 4RPLA 4U7WA 4A4DA 2BM1A 1YK0A 2IEIA 4MKIA 1XMVA 2NUTA 3GRRA 4O2BB 2Q3MA 3ORQA 1A7JA 3T38A 4WADA 1SPXA 4DAOA 1S7GA 1SOMA 3L92A 4K9SA 3R74A 4S3MA 3NONA 2WJWA 1WVIA 3ZWBA 4O2BF 5CM2Z 1EDOA 4AL4A 2Q8PA 4HTFA 5TARA 1ZUWA 3G0BA 1P6QA 3KDPA 3EQZA 4WASA 4CCYA 5EJ5A 1RXEA 1L7AA 2JIDA 3B3JA 1L8LA 3BREA 3VR3D 1Z5ZA 5FCDA 5IDXA 1RAAA 4YRRA 2C4VA 3FPJA 3QPAA 4N49A 3TQTA 1U4SA 2I2AA 2UKDA 3RSLA 3V4RA 4OAQA 3F2IA 3QU2A 5HQ3A 3CJQA 3IEPA 3EQ2A 2PLWA 3S1LA 1OA1A 1E66A 4M8IA 1PQ4A 3RJ9A 1I7PA 4R2WA 2EEPA 3HVKA 5ED4A 5KSPA 2C94A 2O8CA 4OHVA 1U7XA 1CRLA 1XRMA 3GELA 4Y1EA 1REQA 1SXQA 2QLMA 2R1TA 2Q2OA 1QXSA 2CLKB 4WCDA 3ANLA 1KQ3A 1GFIA 1N0VC 1RCTE 4PFKA 5FPHA 2BJVA 1X7ZA 3U3DA 2HXYA 1SELA 1SK8A 4YJKA 1E1DA 3G5MA 4UAUA 3U1TA 3UBTA 3TPCA 3CUUA 2WUEA 3RKSA 4CM8B 3PUIA 3K2EA 4R9VA 4D5EA 3OFND 4UNSA 4AUEA 1KEKA 4MS3A 2PH5A 3ZY4A 1VM6A 2CFSA 3N2LA 2NVWA 2FEPA 4ZCQA 1KNXA 3MMNA 3UB2A 3C3XA 3DQZA 4ECEA 4AJIA 3KT0A 5EWMA 3KE9A 3WS7A 3NWJA 2FFJA 4LCEA 4RABA 3SJUA 1Q0UA 3NHAA 1XPUA 4HX2A 1SY7A 1O58A 1Z12A 3AZPA 3I5MA 4G2TA 4DA8A 4BB0A 3IEKA 5TE9A 3TIGA 2ZBRA 3GD5A 5B1HA 1YQXA 3HL0A 1DFIA 2VNIA 5DTQA 3O93A 5TGZA 4B40A 3T5BA 1Z29A 1VE7A 3PQ6A 1F48A 1WEHA 4TTQA 3PR1A 4BU0A 4BWYA 1E2MA 4R71A 1U1IA 3JALB 1TTTA 3WNCA 1GOTA 4INAA 4DLVA 2XNDA 2P2DA 4FFWA 1E3TA 2RHBA 4CL2A 4U7PB 1JZSA 3DVSX 1JAYA 5K4AA 3T5DA 3EZ9A 4QIHA 4COKA 4RSGA 1W0JD 2MU1A 3U7RA 2XDQA 4TQAA 1ULUA 1ZIYA 3D2LA 5DN6D 2QLFA 3TVDA 5TT0A 3BZWA 3PKJA 2HF2A 4JC5A 1NP3A 3VR6D 1MQSA 2PBLA 4KFRA 3AUAA 5EUBA 4WEOA 2QZ4A 4UEQA 4Q3CA 3DEFA 3ND8A 4OSEA 4XD7D 4JBWA 2YV1A 4ZK2A 3IT3A 5L7YA 2AE1A 2DHDA 3EBLA 4PAQA 1PUXA 3OQNA 4DV0B 2I62A 4I66A 4P22A 5LIPA 4G89A 1TQ2A 1Q0LA 4OK3A 1THTA 2QD4A 1Y9DA 2ZTMA 2ZSUA 3ZOKA 3QQ5A 3TW8B 3PR2B 1FNBA 3CX6A 1J0AA 4US2R 4CG1A 1MC1A 5FOTA 1P7PA 1Y1PA 2IFTA 2DLDA 4XVQA 2RFLA 4A2CA 3L1UA 1R0YA 4UHHA 4NCHA 3A8TA 3W8NA 2V7TA 5K6AA 4R3NA 1ISFA 3L3BA 4TKZA 2OCLA 3IP6A 2PZFA 2FW6A 3GAMA 4M1OA 4PC3A 3JVUA 1UWKA 3VC3A 3C7AA 3ZHYA 2HIMA 3UKJA 5EINA 5FH9A 3L7DA 5CT9A 5IVKA 2XTAA 3DZFA 4L0MA 9LDBA 2P6NA 3A9CA 2WKRA 4Y1RB 4BV3A 2CVFA 4GZLA 2YZMA 3AOEA 3EOZA 3IT0A 3JD1A 4RV5A 1M8GA 3DFMA 1P4SA 2W6ID 2I0FA 3PNVA 5JQGF 2IIQA 3KVRA 1WZNA 3RYCA 3ZHUA 3CEAA 1JR3E 5H81A 5ICCA 3DTYA 1YDGA 2H00A 2XUJA 1YS2X 3BD6A 3RRNA 2FP3A 3MA0A 4EMUA 4EG6A 1A5ZA 2W90A 1RW4A 4PANA 4TKUB 4UATA 3RQIA 2XD9A 5HDQA 3QLVA 3PL5A 1KR2A 4CNQA 1PT8A 2IC5A 4Q9IA 4E7PA 3ZUGA 5FBRB 4BRUA 1Y8RB 2C3UA 3P4YA 3EXIB 4F4UA 2ZSAA 2CKDA 4E2FA 1S4MA 5ALIA 2A0XA 3PLAE 3LQRA 3TR6A 4IXWA 5IN4A 3C43A 3KCNA 5AH0A 4KDRA 5C37A 1U7OA 2RHLA 1MNQA 1WXEA 1IY2A 1IVSA 3OX3A 5TX7A 3C5CA 1DG3A 4R8VA 5TB5A 2ZBPA 5BXQC 3KE8A 3HJUA 2MDTA 1PR2A 3H2GA 2Z5VA 1WF3A 4U2EA 1JQJC 2C9BA 1LTHR 2QENA 1PD0A 3KBOA 1V4BA 3O7MA 4XWYA 1ML4A 5SV2A 4JI6B 4IG4A 4BLUA 1BDMA 4ENSA 4D8VA 4B0OA 1KAHA 2ZU0C 3L40A 3V1UA 1FVOA 3GIWA 4IRUB 1EAMA 1CY1A 5ESXA 1ZDMA 1GRRA 1P1HA 2KW5A 4PW0A 1UPXA 2QRQA 2WWFA 5DJ5A 3VGJA 3WLPA 1SOVA 3PXXA 4EJ0A 1LTKA 3ONNA 4Y0AA 4H4DA 4FBMA 1OWPA 1G2IA 2XUDA 3G17A 1JHAA 5FRDA 3NDJA 3VX3A 3E9QA 1KP3A 4BQSA 1LPSA 3GVIA 5JDCA 4G24A 3K94A 4XM2A 1YE8A 2IBSA 1JB9A 4FIZA 1K86A 3GNQA 5AKLA 1E2UA 5EE9A 5A03A 2DR3A 2H1IA 4P81A 1KZGB 3I28A 3R4CA 1BX0A 1RVV1 2EDAA 1LQTA 3FRIA 4WDRA 2VK8A 3OJCA 1IBRA 2YWGA 4PTZA 1IWOA 3DT6A 1OU0A 3KTDA 2IS2A 1KRXA 5AWFC 1QH8B 4XAQA 4Q01A 2K2WA 4NZYA 1DELA 1PZXA 1NQTA 1A97A 2AOUB 2IOHA 2RGNC 1IUKA 4IMRA 1YB4A 5FUXA 2VDNB 4AO8A 1FMLA 1WLYA 2RI1A 1V6AA 1DQRA 1RXVA 2ZRNA 4RTSA 2OVBA 2BTEA 5JDIA 1ZH0A 1IB6A 2VXCA 5GM2A 1DDGA 2REXB 1M8JA 1X2BA 1QHIA 5I4BA 3N2NA 1KDPA 4B0PA 4G4GA 3FHJA 4R69A 3AUJB 3FWHA 3NHYA 3QUCA 3AEUA 3P9QA 4KQKA 1CP3A 3CISA 3EG5A 1JIUA 2X19A 5ENVA 3DEIA 3K0FA 1BA2A 3SLGA 1I2ZA 4B3RB 2D5IA 2DQKA 3AESB 2QOEA 2JGDB 4PLWA 3ZG6A 3NP9A 2PRIA 2I22A 1AMOA 4E94A 2BZSA 4C0KA 1P4GA 4G0QA 4MWTA 1F0KA 1ZLYA 4HEA6 4X94A 4LE0A 5DM60 4ZYXA 3E9EA 2A9FA 4FEAA 1KSJA 1I4EB 2JGLA 3F9IA 1XQ6A 2NU9A 3NHKA 4QUBA 1ANKA 2QYSA 5F3RA 2RHCA 2IY7A 3AKDA 1NN5A 4Q7MB 1TECE 3ECSA 2ZYIA 1QGDA 3IO5A 4LOKA 1F6DA 2QDKA 2YOGA 1ZGZA 5AM1A 5JBQA 2J33A 4JROA 4I7EA 1GZUA 1M6YA 1IDN1 4N8DA 3F6YA 4KE8A 2ZUSA 1P75A 3QHPA 4JN6B 1I8TA 3FUTA 2YWBA 4QX6A 3U80A 1EGAA 1OX6A 5AJWA 4XSGA 4AWBA 5JWHA 1MOQA 1ML3A 2VJAA 4YYZA 1NDQA 1AO3A 3QE4A 4MPJA 4QDXA 4O29A 4H7EA 4Z0NA 1THZA 2WFLB 3WGJA 3KQPA 3F71A 2D5LA 2PQMA 1SM4A 3IT1A 3KOOA 5AMXA 4D0RA 4RPGA 1PG2A 1UP7A 2B0JA 2FPUA 2YOHA 5CT5A 1LBHA 3ZXSA 4Z7QB 3GFSA 2G4LA 1FSZA 5LD2C 2FJPA 3GEDA 4JL8A 1CQIB 1E99A 2XE8A 3UA4A 4MS1B 1JLMA 4MYSA 4F1JA 3OEWA 4U9IS 3E15A 3GCGA 2H1RA 1JF8A 1VE9A 1Z0FA 2O3RA 4NIMA 4IW3B 3F98A 3GFPA 4QUIA 2DM6A 1TDJA 2XQFA 1ZM3A 3A11A 3PGKA 3AVXA 5LR6A 1DADA 4M49A 4TKLA 4KR0A 1CKEA 2Y2UA 5AICA 4BX8A 3U0BA 5KQLA 2BFNA 4F5DA 4JJEA 2QTFA 2XYRA 5JYCA 4GR9A 4B84A 1EFVA 1QGAA 2RGGA 5ALSA 3O8BA 1M1NB 2W6CX 1P8JA 5F7ZA 1QPGA 3KKKA 4PPQA 1H8HA 2VDJA 4NJMB 3MK31 3VOAA 4WK0B 4MKHA 5K09A 1TL7C 3U4QA 4LA4A 2JCSA 3ROKA 4DCSA 1Q15A 4B7AA 4EGCB 3FGNA 5IZCA 4UMVA 4IDBA 4HVCA 1GZ5A 2MSKA 3K8OE 4LKRA 4XGNA 1XEXA 4NLLA 2CEAA 1BHJA 2F3QA 2WA1A 3LDHA 3QPDA 3KZNA 4FVTA 4EI8A 3O2SB 1QTRA 1N75A 4DXDA 4Z8YA 1EUZA 1MA3A 2BHTA 4WKNA 1ZGJA 2VHJA 2WZCA 3KQWA 1L5GB 3VI4B 1VECA 2PH7A 3VPXA 4ZI7B 4BY9E 2OFOA 4Z4FA 1SHZA 3HB7A 1KMQA 4V02A 5HCUA 1L5HA 3TSZA 3FKJA 5KZMB 1F38A 5BURA 5GV7A 1QOZA 5IVDA 2DTDA 1ARZA 3HWRA 3HRIA 1U8ZA 3NANA 5IFKA 5KIAA 4LVCA 2AUMA 4V0OA 1EK2A 3UPDA 1IOVA 3B1XA 4A91A 1N2OA 2PD3A 2QTNA 1U99A 3OCZA 1T2AA 3S70A 2HGSA 2P6UA 2Y0CA 3A3PA 2PMFA 4HAUA 3RU3A 4EZBA 4MQBA 4X54A 5EGSA 1OHHA 2C5LA 3I83A 2E4ZA 3PPIA 2Q2VA 3CW2A 1I4WA 4RDIA 6NULA 3C3YA 1C0IA 5HGJA 3K1AA 1E7QA 3GGSA 5DHRA 5JJKA 1RWMA 1ZD3A 4CU2A 1FYEA 2L0XA 2HMVA 4CG2A 2HMAA 2C58A 2ZRJA 3A04A 3ILXA 4FHCA 4FHDA 1PW7A 2BFCA 4L50A 4XWTA 3OZSA 4LXYA 4N03A 1KS9A 4L7VA 1BJTA 2UZ1B 4KV7A 4G1FA 3BMCA 1XROA 4Q7EA 3RSCA 1G5HA 1CTQA 4OL9A 4RHXA 4BPRA 5ARBA 2F3RA 5EZYB 2AI2A 1E58A 4D43A 3H1BA 3NXKA 2C2WA 4HMOA 2DUJA 5IAGA 5FWNA 5AI6A 1RYMA 3FRHA 3MWYW 5DFAA 3G2HA 4NCAA 5GWXA 4KC0A 5DCLA 2Q3HA 4GVPA 2OB1A 4TWRA 2PSHA 4XZ3A 2GN0A 3BXPA 2IP1A 2IU0A 3KU4A 3RK0A 3THWA 5EPUA 3ELBA 4MVYA 4D4GA 3MAAC 3THOA 1WZ2A 2ZIFA 3JAKB 2XX3A 1JAHA 4I8XA 4WZAB 1Q84A 3B1ZA 4ZOAA 4ZGWA 1PK9A 4TYWA 2C8JA 2PLRA 4EGJA 2JH9A 3HP4A 4DZZA 3QVTA 5A2QA 2CCGA 5LQDA 1GM5A 2VUHB 5SZHB 1JDBB 1MCZA 3I2KA 4RS3A 1VMAA 3I6ZA 1N5LA 1SCQA 1SG0A 5L4SA 2J0SA 3OZBA 1C9EA 4H7KA 1E8NA 5JMWA 3DYIA 1H2AS 3DBRB 4H3HB 4BC0A 1XNQB 3Q3GE 2J6HA 1W76A 3D3QA 1VMKA 1TIKA 3RC2A 5BUQA 3JZDA 4JI5B 5E4TA 1ADBA 5I7FA 1RZRA 3EEYA 4O0MA 1MT0A 2WV9A 4ADSG 3SX0A 3MGKA 6REQA 2PHZA 3NRCA 2H4YA 1CR0A 4NHEA 4RCYA 4WPGA 5BYJA 4B4VA 5M34A 3DO5A 3SC6A 4NJEB 1JHPA 1Y6ZA 2QX9A 3LT0A 2P1DA 4XCVA 3FNGA 5KEIA 3UO8B 1SVUA 2NSDA 1GWNA 3SX4A 2PK3A 2WQ7A 1HQDA 4ZARA 1GPDG 2PT9A 1T0JB 5BV8A 3JSXA 2R44A 2IYUA 3AI7A 3W0LB 3EY4A 2E2WA 2DUUA 5A3QA 1ESEA 1RRGA 1SUIA 5KNLA 5JSYA 1IUNA 5TPWA 2ZAIA 3P5BA 1L3CA 4RAQA 4XE5A 2V8OA 4KXXA 5K05A 3B82A 1B4DA 3Q0IA 3GLHB 3L46A 1NBHA 4AJJA 5EZ5A 2Z9BA 2ZRQA 3DBHA 3RRZA 3W6OA 1QE3A 5CURA 2H7YA 1LJ8A 3FSJX 4JENA 3CXRA 3LT1A 4O4JB 1YACA 2YHIB 2Y1CA 1MG0A 3QFTA 5JALA 1XMOB 3VAYA 5F2EA 1OKKA 1U8AA 2OV2A 2H9AA 4GOLD 3E82A 5REQA 2BAGA 4J07A 2QN3A 2J3KA 3AVYA 1PGNA 2HW8A 2WF8A 3FPAA 4MKGA 2C5EA 2O2HA 1VKNA 1GRCA 2QI9C 4C6TA 5U9CA 4DA9A 2P2SA 3SS8A 3NJRA 1CWUA 3HE3A 2P65A 4ENUA 4MTLA 3B7WA 5L3SB 1JLRA 2M98A 3HG7A 4RMJA 4Y6GB 4ALNA 4CI9A 2XVYA 3DOJA 3P52A 2R11A 3W7BA 1A8IA 2G82A 4LJRA 1WUJS 3SIRA 1M73E 2R8OA 3AUFA 3EGDA 4NMLA 1IONA 1BXGB 1C3EA 1C1XA 4P2GA 5IC5A 3HEAA 2EW8A 3R7FA 3UFXA 3VHQA 4X24A 2FPPA 2GBLA 2D06A 1Y8QB 2JGAA 4UEKA 3WWZA 2LE0A 4UU8A 3RJZA 1BH2A 3AEYA 3UK1A 3AL2A 3FGPA 4HEQA 3HJRA 5ULLA 1Z4PX 5K01A 2XCRB 4OI0A 1CYDA 1B7GO 4K6OA 4R1LA 4YIHA 1JR6A 4A5OA 1KZ1A 1C7IA 3RLFA 3B78A 1AX9A 4LYEA 3W77A 2E5LB 3OD1A 3O8NA 2QZPA 2VDUE 1KVQA 3GV0A 1ZK0A 5D01A 4IS3A 2JI8A 3FMGA 1EKXA 2R66A 1L8AA 1VBFA 1SMKA 1NDHA 1K0FA 2XB4A 5A9RA 5TGTA 4B3GA 1Q95A 1TU0A 3PEUA 3JQBC 1Q77A 4PAGA 4NSNA 4E51A 5EMMA 4F45A 1NZFA 1U9JA 2XE7A 3OQ6A 4YXWA 3AY6A 5CB8A 4RDXA 4A8JC 3CF6R 1R8QA 1QIIA 1E0KA 4NBUA 3M2PA 1GGHA 1IAQA 2YHAA 3W34A 1Z28A 1QAOA 3A9UA 4HFNA 4FHZA 2Q9BA 3IHTA 3FZYA 3OA2A 1V11A 4TSFA 4QUGA 3R9KA 4DCPA 2VNKA 4AX4A 1U5AA 4J4HA 3ZDRA 3D0OA 3L84A 1GQOA 2O50A 2X3YA 1BMTA 2ZXFA 3I09A 5K3OA 2FPWA 1L4KA 1JQ5A 1OTYA 2JI6A 1KMMA 3LUPA 3CLRC 4BMNA 2HB6A 2QMEA 5TJHA 4FOTA 1UKYA 3DR3A 3T8YA 4PLGA 2Y0DA 3DC7A 2VP6A 5KVAA 3VX4A 4AN1A 1RC8A 3DMRA 4Q4AB 3QUQA 1J56A 3H2IA 1P1KA 1O5TA 2ISSD 4ZJZA 3B6EA 1U0GA 3AW8A 1UMCB 3V4LA 3VJKA 3RUFA 4S1OA 3MUNA 3OU6A 4MS4A 4FD3A 4F84A 4UASA 5KOHA 2CFTA 4GIBA 3T0IA 4JX9A 2YQ5A 1E1RD 1O6FA 2IYTA 3Q3VA 1ISJA 4M0MA 3X1JA 3W5AA 4BWVA 3TDMA 2FN9A 4GECA 4L28A 4H4CA 2P4EA 4OHPA 4RIGA 2ZXUA 4II7A 3WJ2A 2UYOA 3V4SA 2D5BA 1SQ5A 4Q16A 4TTRA 1AHIA 3BJMA 5L8VA 3G2IA 4ND8B 2AH5A 4LECA 4O02B 2YMQA 2V6JA 3VPSA 3IXMA 2YVLA 5CPBA 3RO7A 2X41A 2AF3C 4M8LA 2PL5A 3N2GB 3DMTA 3HNPA 3KHKA 1QMGA 2K2QB 3AK4A 1GL9B 4FFBA 4I3FA 3VSDA 3QLTA 1DG1G 1BYUA 1F12A 2AS0A 1Y4UA 3RR2A 5JHGB 1V6CA 1ZM4A 1V48A 2IZ0A 3DWIA 3AY3A 4J2HA 3BMOB 3RS9A 8GPBA 3ZQ4A 1NSFA 2HEIA 3COSA 1L4UA 3TTWA 3ZKAA 3KJZA 1Q74A 2HA6A 1J6UA 2WWYA 1C50A 2B1GA 1V2HE 3M5WA 4QOJA 3BEDA 1IK4A 3LYLA 1MF7A 4K9DA 4NTZA 4E5VA 1D4AA 2B99A 4AP5A 4E6PA 4TM7A 4BQQA 2J07A 5KNBH 3HWSA 3GUHA 3WSWA 1U94A 2NTNA 3AINA 4JLAA 4KYIB 4QHTA 4M6WB 4ROTA 3D7MA 3RV4A 2YNMC 4KKXB 3HR4A 2VO1A 4QTYA 3E1SA 5HRAA 2TMKA 4PC7A 1R27A 3KVYA 2G9ZA 2Z5GA 1NXXA 4BO6A 4D3DA 1OFGA 2HWWA 5C8XA 3HKEA 3ZHBA 1MLDA 3D6NB 3TSYA 3TJZA 3VR5H 4A6DA 5NULA 4AUMA 3JU3A 1NPTO 1ZNYA 2CNNA 3LY5A 1UBGA 1ZM7A 4JVNA 4N3GA 1FDSA 1PR5A 4U2GA 2IWRA 4CV3A 1R7RA 2HOQA 2BDUA 4QOIA 2EFHB 1W36C 3DE2X 4NS4A 5J59A 3MM4A 4BNIA 2VYVA 3RBAA 2W7TA 4WWHA 2EKPA 5DHUA 1JP7A 2FPGA 4ERXA 3V2IA 3UXMA 4IVQA 2FHSA 5DM2A 3SCZA 3GJYA 4HP8A 5EPEA 5B3KA 1E9DA 4EYKA 1A95A 4BO7A 4EG3A 2H2IA 1U7HA 1UUFA 1E7SA 4CEJB 3ZWKA 3DL2A 2I9KA 3KJEA 1DBIA 5DGXA 3R5XA 5DTMA 1AKMA 1VA5A 2BCJQ 3HPQA 5LMCA 2NLOA 4K2AA 1HG0A 4HQFA 4XM1A 1FTWA 5JSHA 4FTWA 1PI3A 1FXWF 3ZWYA 3QVUA 4JOSA 1E9VA 4WZAE 5BWLA 4HDKA 2ZI4A 4CUKA 3PNOA 4JXKA 3NV7A 1B14A 2ET6A 1JHZA 3OOSA 5K8TA 2HBZA 4ZVQA 4HEHA 3T9BA 3SYNA 3WTCA 1CUIA 1MIOA 3AEKB 3K2IA 4HAIA 3RDPA 4YRIA 1G4AE 1K8XB 1RXYA 2V7QA 3OLXA 3GMIA 2JLAA 2CJFA 2QE6A 4RZHA 1MAAA 4K6MA 3D3EA 2JARA 4LZJA 4IZ6A 5TS3A 2C8VA 3MWFA 5K0ZA 4XGRA 5L45A 2AC4A 4TZ6A 1U04A 3TCKA 4HQ6A 5FA8A 1IBKB 3F8TA 1L3IA 3F5DA 3EIHA 4LDRA 2P9YA 4WCFB 5IU6A 4DWJA 2GK3A 3IHKA 2GARA 4F86A 1MO3A 1BH6A 1DIRA 1C3LA 4HN2A 2Q6OA 3C8HA 3EAFA 4Q1EA 4ENQA 2AJTA 1XNJA 1PKXA 3HI4A 1U65A 5J3JA 3NBZC 1BMQA 2VHYA 2FZCA 1CETA 1WSWA 1GU1A 1NU8A 2WJJA 3F6EX 5E2BA 4MVJD 1SVIA 5JRZA 3ZLBA 3VKHA 4X95A 3OHPA 4M9UA 4E5YA 1TO1E 5D2CA 3UJNA 1CVLA 5CLIA 3OPMA 3GLHE 1DZIA 5JJCA 3ADBA 2JCXA 3OEHD 1J1IA 2V1UA 2HYIC 1FPQA 3RIEA 3UWSA 1G18A 3UGKA 5L6LB 2ZCJA 1R0RE 1X1BA 1ZN2A 2H2FA 5AJZA 4OLHA 4DT1A 3WLTA 5I7WA 3A4NA 4TWJA 1GARA 5B3AA 4DV2B 3MWDB 4QT0A 1FDWA 1Z5VA 2HA3A 4HYTA 3ZWXA 2J48A 1QRAA 2JI4A 2FWBA 1PJ2A 3FCCA 3MS4A 4JHXA 2ABWA 3LAWA 2XT9A 2XWSA 3UAZA 5A3VA 1ZH8A 2QN7A 3UOGA 1GU0A 4WLOA 5FV7A 1CXZA 2HREA 2IZZA 3IIEA 4CMCA 3GLRA 1LC0A 2KWIA 4YJFA 4F5ZA 2G77B 4OX9B 2FPMA 2L69A 3LRPA 5DNUA 4R7ZA 1MABB 2BR5A 1BN6A 3OMXA 2ARKA 3CE6A 3OQBA 2ATCA 2R1UA 2XGOA 3F2VA 3FA2A 3GNTA 1X13A 1LBSA 3JQAA 3TPFA 2NV6A 3KYJB 1CJBA 2IYNA 4JB8A 5CA1A 2HSZA 4C0AC 1JE0A 3DTNA 4L75A 2FW7A 2W2KB 2ZIXB 3MTQA 4XD2A 4RXMA 2ZRGA 3TD9A 5IDVA 1R12A 4FD2A 3O4RA 4D0GA 1D2EA 1X7YA 4JKIA 1PD1A 1AG9A 1GKIA 1JR2A 1U2EA 4IHAA 3ZIAD 3BIWA 2Q1SA 2ZT7A 3A3KA 3IAHA 3LRTA 3KOXA 5DN9A 3GJ4A 3SS9X 2PKXA 4C29A 4PZ9A 3AGPA 4TXNA 5FI0B 2PAFA 4LPSA 5EJMA 3HB1A 3H99A 1DSSG 4FCVA 3IOMA 4MI6A 4OFWA 3RYIB 4Q1AA 4U5XA 5B5SA 3IPYA 2W2OA 1WW2A 3BN3A 3I9V6 3IO3A 3MLEA 3QHQA 4PBRA 1Y42X 3TUJC 5JISA 1R8SA 4I5DA 4I5EA 4IUBS 3RC8A 3EZFA 5L6MB 4MGZR 4R68A 2ZWPA 4I8IA 5LXTF 3R6TA 1V8BA 4QBKA 2C7QA 3A1UA 2YCLA 1NNEA 1RXSA 3QLUC 2XB2A 3CRW1 1YQQA 4GI2A 4R1TA 2GI4A 1KIMA 1Q3KA 3AM5A 4OMCA 2BKXA 2OCGA 5GY7A 1FFHA 4KLZA 4GMGA 3CTMA 1AQIA 5HUJA 5DTIA 5LQUA 1MPXA 5CCBA 3NHBA 4IHKA 3FNRA 4BO5A 1YWGO 4G0WA 4PSUA 4TLMB 4EGSA 4KITB 3IUMA 5HX7A 3O3NB 4I1PA 5DCWA 4DYDA 4L73A 3U4IA 4HAVA 2KYRA 4BS9A 2CXRA 4G0NA 2X3FA 5FUVA 1HO3A 3E5RA 5CT8A 4DGQA 5T4HA 5CXUA 2GEUA 3H6GA 1Q7GA 3BFXA 4UEJA 3AFNA 4DIBA 1A5TA 2WG2A 2G5PA 1CY8A 1OLSA 2Q4EA 2Q4DA 4GGPA 1OVGA 1NJGA 5A5VA 4AYWA 2NT4A 5EUCA 2H2WA 3DVQX 1SEPA 1SQ6A 2W2LD 3ESRA 1I94B 3EDQA 1JDUA 1VHDA 4BB9A 1I6MA 1JWAB 1FL9A 1P4HA 2AWOA 2FPLA 3QU5A 3R23A 4LZNA 2GUWA 4WZBA 3MT8A 1J49A 4GPBA 2QPOA 4Q3OA 2M2IA 1GO2A 1OBVA 3OWOA 4RVFA 1CDEA 5KYXB 1T1RA 4OATA 4E14A 2NUPB 2D74A 3P20A 3E2MA 3ZWNA 2J32A 1UP6A 3OI7A 1PJ8A 3KC2A 4FMCB 1NJSA 4KUEA 3Q40A 4PSVA 4YRFA 2XLBA 2RH4A 4C3ZA 3I5UA 4F7WA 4B33A 5PGMA 4GQIA 3VVBA 1W49A 2CVHA 5BYKA 3NHPA 3L9XA 2CUZA 1AKUA 1EYZA 3C3EA 1XWFA 2ONJA 3D7NA 2JG3A 1U31A 2ZBGA 1DX4A 1KETA 4FMCF 1E3MA 3GEIA 2G67A 2VF5X 3DHNA 3L0ZA 3R5FA 4IWNA 4MV1A 3ACCA 4P32A 2I2WA 4BFYA 3KVVA 1AO0A 3R3WA 5FQOA 5AOCA 2JHAA 4YJ3B 1P9NA 4IZIA 1YRBA 4Q15A 2W70A 4C4OA 4WXMA 1COWA 2LUOA 3B5EA 1V7CA 4TYMA 1ENPA 4BNHA 1YR3A 3H8WA 3WK4A 3ADCA 3B8HA 1HG1A 2KLHA 4ZAYA 1U8XX 3SVTA 3QLJA 5EZQA 1N2JA 1GTRA 4OHWA 2AYYA 3MCVA 3QVGB 3WKBA 1TCBA 2XV1A 2O0KA 4L6IA 5L4NA 2D5CA 1ECCA 1AUPA 2BGMA 3OEEA 1UQTA 1SQFA 2A5FA 3RSQA 4EVQA 3WP0A 4IO1A 3CUKA 3E7WA 1XGKA 2H1LA 2P9ZA 3DF9A 3G59A 3I52A 3L6UA 3KR0A 3QWFA 4V03A 5H68A 1Y8ZA 1X0VA 1KEWA 2V6BA 3VZQA 3L1HA 1TC1A 1JU4A 4G0XA 5HFNA 4WINA 2GJ8A 3EIXA 1V0JA 3NFRA 2EGHA 1Z2CA 3SDBA 2PZLA 3AZOA 5H83A 3R76A 3C6XA 3EVGA 1SHLA 4PLZA 4EB0A 1BWPA 3BXGA 3AB3A 3IJEB 2FA9A 5IMSA 3PQFA 1RRFA 3T7SA 3MCWA 1JLHA 1ZP6A 4YV7A 3LW7A 2FCRA 4NICA 3H4MA 4FMPA 3BDIA 3RT9A 4AB1A 5GP1A 1JH9A 1G8HA 1K7XB 3FUVA 2P11A 3KCQA 1W4ZA 4KR7A 3TTVA 3G1WA 2HU7A 3CNLA 3JQGB 4JQOA 1KTVA 5BSUA 2VJYA 3TFOA 2AFHA 4R41A 3QJGA 3PF9A 4IIJB 2FR0A 2HO4A 3GEHA 1GR0A 4OB7A 1RYNA 2UDPA 1Q91A 2VFAA 3OO0A 5EKUA 3WK9A 5AKKA 1R0BA 4EM6A 3H17A 5K0GA 1W4RA 1IBLB 3ER6A 4MICA 1ZGCA 2PPVA 1DU4A 1PTJA 2G3YA 1Y6RA 4NARA 3TL6A 4ZREA 5D6NA 1W7AA 3MXOA 5GZ6A 3FGOA 2FLWA 1E2GA 2HY7A 1OFVA 2VXBA 4BAGA 2YWRA 1NJ1A 5ITZA 1Y3HA 5JZVA 1VBNA 3V7FA 2F3UA 4HYQA 1NASA 4KMMA 3TINA 1TB4A 2YRWA 3IA2A 3KKEA 4BP8A 2X6TA 3EGIA 2CF6A 1Y80A 3NRJA 4O5OA 1V1MA 3DDZX 4FHEA 4DBVO 4N82A 1PR1A 1UWCA 3O8DA 1B26A 1S2MA 2B5OA 1DAHA 1QIDA 1YULA 3JAWB 3N8DA 1M7GA 3IX7A 2WZQA 1U0JA 1RMQA 1XI2A 4L9AA 2OSBA 2R6GA 2FG6C 4S2EA 3QA3E 4MK4A 4TVSA 3MWEA 1DOAA 3U5ZB 2EHJA 4MKZA 2C78A 2FW9A 2QJRA 3L0IB 4MWCA 9ABPA 2V6MA 4I55B 4NAVA 4QRDA 2QV7A 4BB5A 2VPIA 2R62A 3UG7A 5C8DA 3P2EA 4CLOA 1NXOA 1NVGA 4BNJA 1OC4A 1BROA 5A4JA 2G1AA 3F4KA 3A10A 5CDUA 1RLOA 5B64A 3EC1A 2XCQA 1O0BA 1E9RA 1EXMA 1Z5OA 3S3TA 3HL4A 1KGDA 4ZO9A 2RHJA 3TQHA 2C2GA 3PGLA 3W2FA 4ZD6A 1PN3A 5H16A 2NUTB 2JIRA 1PWHA 1O87A 2NZUG 3ETLA 1QYXA 3OESA 4UREA 3ZNNA 2O52A 3ZD7A 2PQ6A 1HYQA 1EH5A 2CMDA 2D2IA 1Y8CA 3C87A 3NHFA 4KPUB 4W5NA 3NDBB 5FFNA 3BMQA 4YNBA 3LI2A 2XUKA 4BGVA 1EB8A 5B4UA 2XUIA 4HTFB 1IZ9A 1PZEA 2VDRB 4IF4A 2EWVA 3M7IA 6CHYA 4B6OA 3FBGA 2PAAA 3WWOA 2EF0A 3D7LA 2IUYA 1DDOA 1PX2A 1ZJZA 2AJCA 1Q7EA 2ZWVA 4PVDA 4XRRA 3TNFA 3EVDA 5HQ3B 4AJLA 5ECYA 4CI0B 4ZEWA 4NU6A 3TQIA 3RUDA 2C5FA 3NIBA 4WBSA 2WM8A 1M67A 2O8CB 1OC2A 4QPJC 1YZNA 2CLDX 1REQB 3JTEA 2M6SA 2R1TB 3ND7A 1J06A 4NNPA 1JQKA 2MMGA 2ODWA 3R2JA 2H1FA 3TZ6A 1X7ZB 1HFKA 1TQ4A 5DGIA 5CDFA 1KDZA 1NX9A 3HMQA 2TMGA 3WGYA 1VPLA 4U3JA 5TIIA 2OD2A 4RJJA 1DO0A 4JT8A 2WIKA 3CT4A 2VBCA 1XCPA 2ORWA 4AN0A 1LRLA 5ESWA 1KOFA 1MDBA 3OTHA 5LYYA 4QPPA 4D9KA 5I47A 5L3VA 3GT4A 2X8WA 1DOZA 2C42A 2OLKA 1KO1A 1EFLA 1V26A 1XO1A 2HJWA 3GA5A 3PQ8A 1Y5MA 2D7CA 1NVXQ 1TCUA 3SKYA 2OECA 4G5RA 1SCUA 5EWMB 1HYGA 1E9AA 4BVBA 1HY3A 3RIXA 1A9XA 4R8MA 3OTWA 1NT4A 4HZIA 1DX9A 3TK1A 1N7HA 2NO7A 1XN4A 2QAJA 1J42A 3NYWA 2VJPA 4AJ4A 1V5GA 3AUTA 4E15A 1JEYB 1T2FA 5EIBC 1WQ4A 2ZJ0A 4KN8A 3CR7A 1U9IC 3HU2A 5BWBA 3BX1A 1DTWA 3AR2A 2AI3A 4MTCA 4UNNA 4GPEA 2BM0A 2J85A 2ZTUA 5CCDA 4DIDA 4A36A 2EJTA 5J2UF 5GQSA 4CL8A 2V7PA 2ZTVA 2JHCA 4UEOA 1GTZA 5HIMA 4B44A 3DKPA 3KAKA 2QRLA 3Q7PA 3ETHA 4S1PA 1J0EA 2BCEA 3ANMA 2QBYA 4HXEB 1QIHA 4WOCA 4RIEA 2CUKA 2B4RO 3R75A 5LN1A 2Q2NA 3AFOA 4E7OA 3K20A 4G23A 5LSAA 3O26A 3LX4A 5H3CA 3UYKA 5HUQA 1KI1A 1WE2A 4PNHA 5IPFA 1XBTA 3UPTA 1HQCA 1Y8AA 3IIIA 3NXSA 3OM9A 4I50A 4R1PA 1TRHA 5D1NA 5H3HA 3AM4A 1OPRA 1ZMRA 1RM3A 2FSVC 2WTXA 4FFDA 4TUYF 2K7ZA 4I1IA 4ZVRA 1M3SA 2OZLA 2XRFA 4EDFA 3P7MA 1YR8A 2XD4A 4JYCA 2C9CA 2LCQA 1LF5A 4CKWA 4WOKA 1MUUA 1DVRA 1JIVA 3ZXYA 4EWLA 3QX3A 4C2TA 3PE6A 3K6SA 2JI9A 2RGXA 2PA0A 4QQFA 3HFSA 4KE7A 5B57C 2VPZA 1AB5A 3BILA 2B69A 2ZSFA 3DP9A 3L07A 1O6CA 2OZPA 5CYPA 1GV1A 2EJBA 4B6GA 4JYZA 3PVZA 3UT5B 2RHTA 2JLVA 3AJAA 1ZN7A 2ZREA 4BO2A 3P2YA 3MBKA 4Y1GA 5DYGA 7MDHA 2HYDA 5E38A 3HY6A 1JDBC 3ZX4A 3WTBA 4EB3A 3LYUA