4BRWA

Crystal structure of the yeast dhh1-pat1 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
376
structure length
376
Chain Sequence
NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVDEFMDKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Yeast Dhh1-Pat1 Complex Reveals How Dhh1 Engages Pat1, Edc3 and RNA in Mutually Exclusive Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DHH1
total genus 130
structure length 376
sequence length 376
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4brwA02
1ZNWA 1XXHE 2ZUBA 4NE2A 4DLTA 3EPKA 4DEYA 4HDCA 4AURA 1G20E 2P6NA 1CR4A 2W6JA 3U4QB 4CEJB 4BZXA 1U9IA 2Q0HA 3CB4A 2VQSA 2QROA 3EZ6A 4DCTA 3QY0A 3RWMB 3FKSA 2ZXUA 2RGEA 4OHZA 3T5GA 2OLKA 4TYQA 5G40A 1P9RA 2ZQ5A 1XD8A 1VPLA 1KSHA 3THWA 5JHGB 3R9XA 1LY1A 3C7KA 4UNRA 2R6GA 3JZMA 3EIEA 1U9IC 3I3SR 2QAGA 1ELOA 3AKEA 3DOEA 3MAAC 4C0AC 1IQPA 3SR0A 4RD0A 4RFSB 3SJBA 1VECA 5CK5A 1U8ZA 2OILA 1CJVC 1R4AA 1YZLA 1F5NA 1KDTA 2PLRA 3TVTA 4B32A 4DUGD 1R8QA 1ODFA 1Z6XA 2XZOA 2B8TA 4TMKA 3SFVA 4F7WA 2IUUA 4EQ6B 3CNLA 3AH8A 3F0TA 3SYKA 2HXSA 3KJEA 4DB4A 1EXMA 2GK6A 2REBA 2ORIA 1S8FA 1SKYE 1XZQA 2FF7A 5EQTA 3C5CA 3T34A 4JL5A 4TL8A 1RPZA 5K8IA 2PJZA 1W4CA 4URYR 1DOAA 3IQWA 2YWGA 2A3RA 3KUCA 1OH7A 4JLNA 2Z43A 5CK4A 2FV8A 4QBHA 1VIYA 3QI2A 3LFUA 1VCMA 3IKJA 5K8LA 1DO2A 1SKYB 3OHMA 1C1YA 3HYTA 4Q03A 4TL7A 3PCRB 1HTWA 2ORWA 2QMEA 3QNUA 4URUR 3AF4A 1FTNA 4EIWA 2GF0A 5C4MA 3U61B 2IYSA 4X8LA 2WBLC 3GLHB 4II7A 3SZRA 3PVSA 2GJSA 4IEEA 3KXLA 4S35A 2W2XA 3HJNA 5CM8B 2CLDX 4MDEA 3ASZA 2O8BA 2FOLA 3GD7A 2V6JA 3DL0A 4YLGA 3DO6A 4NTZA 1ZBDA 5DE3A 4X8MA 4HUTA 1XTKA 3Q7QA 1TUIA 1P61B 4AG6A 4TYNA 1UEIA 1GRRA 2HT6A 2QNRA 5BN3A 1AK2A 4D2IA 1M2OB 1HYQA 2BOVA 5CB8A 4BFWA 2FEMA 1AZTA 1QHHB 1KO4A 2EWVA 1UAAA 2DHRA 2P67A 1KTVA 3CX6A 5FOSA 3AKDA 3UMFA 1XNJA 3GFTA 2EWWA 2ZRKA 5F98A 4Q4HB 4IOLA 3KQLA 3KXIA 4RD3A 4KFRA 2O8DB 1GTVA 2IXFA 4OL0A 2YKGA 2FWRA 2LKCA 1ESMA 3FFBA 1KO8A 3EA0A 4A36A 5E7IA 2H17A 2GNOA 2WWIA 2J3EA 4Z1MD 2B7CA 3Q3JB 3ZD6A 5L3SA 2ZTSA 3G5UA 1E98A 4GPTA 4JL6A 4KI0A 2V1UA 3CRMA 2AKAB 2R6AA 3BD9A 2J7PD 1D6JA 3BWDD 5SZKB 3C14C 1DG3A 3DM9B 1CRQA 4LRWA 4BE7B 1GVNB 2GWHA 1IN5A 4LY6A 4O25A 4UXIA 4BFXA 4LX0A 1HA3A 2B21A 2PEZA 3A1VA 1FZQA 1MRSA 4B33A 4HZIA 3SFZA 1KO5A 1JEEA 4AC9A 2QM7A 3MG9A 2A30A 4MRNA 1W48A 5FOXA 2G0NA 2MMCA 3ADDA 2AKYA 4DLVA 4HUQA 1RJ9A 3HPRA 2ONJA 4OK6A 3A58B 4BFVA 5EXPA 4BFZA 4D4MA 2ZEJA 4HLDA 5B58C 4PSAA 5EP3A 2ODNA 4AKIA 4M0LA 1XBTA 3MMPA 4BFSA 5FTJA 1E1RD 4GOKA 4ACAA 4YMSA 3QKRA 2MSEB 1DAIA 3R20A 4TZ0A 1OB2A 3TR5A 2FN4A 2IEYA 4O0MA 1AIPA 1A2KC 5GJCA 4C4PA 4UKDA 1GDDA 2CK3A 2N1BA 3QUSA 4ITRC 3DDCA 3TAHA 1E2KA 1U90A 5ELXA 3VU9A 3KUDA 3PUVA 1NF3A 2NIPA 2FDCA 1MABB 2BHRA 5FL7A 2C78A 1JI0A 3L8ZA 5JI2E 3RC8A 3CRW1 1OHHD 1XMSA 2Q9BA 3WBKA 3W5IA 4C0JA 3LH5A 2Z83A 1VIAA 3KKMA 1II8B 1XMIA 2JASA 3FOZA 3U7FB 2R65A 1XRJA 3U7GA 2F1JA 5HE9A 3T1TA 1E96A 3QBTA 1VKJA 2PZFA 3FFAA 2IT1A 4G5GA 3ND8A 5DN6A 1N0UA 4EFNA 1VYTA 1QG2A 3W6NA 4RD1A 2CLCX 2GETA 4D80A 1GL6A 4TYPA 1WXQA 3FGNA 1YR8A 3GLGE 4FI3C 1NVVR 2WJVA 4F93B 4PAMA 2OLJA 1NIJA 3NHBA 2DWQA 1NSFA 3IIKA 2ZU0C 5E7MA 4B3GA 4LJ9A 4GP6A 1E2NA 1DPFA 421PA 1M7HA 4NKRA 1OSNA 3GJ4A 5FPKA 5GJBA 1EGAA 3AF0A 1N6IA 1T3SA 4N0DA 3HU3A 4LJ4A 5TV2A 3NEJA 1W0KA 1N25A 2RHDA 3DPUA 4JLBA 3SC3A 5BYKA 1NKSA 2WSSD 3VU9B 2DWPA 1NBMD 3QXJA 3PR1A 2A5FA 2EW1A 5LB4A 3QPUA 2IYVA 5E95A 3V00A 4DCUA 2F1RA 3B1VA 2X1VA 3K0AA 4LJ7A 4G5OA 1U0JA 1NKTA 1GP2A 5FOWA 1FX0B 1QDEA 2QORA 5JLJA 5EE0A 3E2IA 1LNZA 3D3QA 1N0VC 621PA 4C0BA 4PC6A 5EE1A 1TQ6A 2ZU6A 2XX3A 4M9XA 2ZS7A 1FNNA 1PLKA 2F9LA 4A0RA 2XNDA 3IEVA 4FIDA 5BN4A 3CWZA 2GCNA 3NH6A 1OYWA 2FSHA 4NCNA 4EAQA 3GLIE 1T6NA 1VDZA 1S4QA 3LNCA 4A1FA 2AXPA 2GXUA 1W0KD 1EFRD 3AGQA 4MUAA 2QBYA 4KSCA 1KI1A 2WKPA 4Q66C 3X2SA 1XPUA 5HKKD 3TGPA 3K0EA 4JSYA 1G17A 2FPLA 1N3BA 4JVMA 4ZDIA 1HQYE 1P2VA 4TSFA 4WW0A 4URXR 1EESA 1KK0A 5AUPB 4M53A 3G0HA 4Q21A 3IIJA 4M21A 4PXAA 4TT3D 3EPLA 5EE9A 4AD8A 4TWZA 3QF4B 4TLCA 3VHLB 4BASA 4Y0AA 3KL4A 5J4HA 1EFTA 4P0TA 2CHQA 1H65A 5FL3A 3T35A 4PC1A 1GRQA 3RS5A 1WF3A 3GJ6A 2AX4A 4AY2A 3NEYA 1OXTA 2CEAA 2XEXA 4Q7JB 3TKLA 3ZQ6A 3GFPA 4PZYA 3UWOA 2F9MA 4YQFA 3ICEA 2OCBA 4PO1A 4WA7A 5HZHA 1QF9A 2ZR7A 2ZRJA 3W34A 1S2MA 1T0JB 3A4MA 3CRRA 4JLAA 3GLFA 3ADCA 4HAWA 1MR3F 3IQXA 3BC1A 1XD2B 5AJYA 1Q1ZA 1R10A 3RS0A 1YE8A 4I1OA 1F2TA 4BECA 3G82C 2QGZA 2PJRA 3AV0B 3FHCB 2VA8A 4QHTA 2OHFA 2IYQA 2ZETA 4MGZR 2OO7A 5L3QA 2H18A 2VPPA 4LBWA 3SHFA 5JJLA 1KI7A 3R8CA 3KKNA 1US8A 2QU8A 1W5TA 2ZUCA 4HAUA 4PHTA 3CRVA 3L0SA 5DISB 4TYWA 3UXMA 1NVWQ 4DSNA 3B1ZA 4FINA 3R9WA 1RVDA 3BXZA 4PC3A 4UNNA 4GMDA 2DFKB 1MT0A 4W5HA 5FUVA 4WXPA 3SQWA 3AVUA 2ERYA 4MYCA 4IOMA 3QKSA 3TAUA 1QRAA 2C9OA 5A5GA 4BEJA 2Z5FA 5M04A 4LBZA 4NYIR 5JSZB 3A36A 2XZLA 1N0WA 1P6XA 2IHBA 2ZI6A 2ZROA 5FPSA 1C4OA 1NG9A 2VIIA 3FMFA 1TU3A 3B7GA 2WV9A 4LGMA 4US2R 3QIAA 2CE2X 3W8RA 3BH7A 4A9AA 1D2MA 3C16C 2ZJ2A 3F5FA 2FU5C 3PUZA 2YWEA 4KFUA 1JPJA 5HCNA 2WTUA 1JJVA 4Q5IA 2JATA 2JDID 2XOKD 5DO9A 4B2PA 3Q8XB 4GNKA 4OHYA 2CJWA 3KFVA 1Q12A 1AS0A 4JLOA 3NBFA 4UQOA 2YZ2A 1P3JA 2YVUA 2J0VA 1F2UB 4A2WA 3I5XA 4HB3A 2JLVA 1DG1G 1PLJA 2V9PA 2IF0A 2ZIAA 4JKIA 5G3YA 4DLRA 221PA 1P2SA 1Z8FA 2I1QA 3MWKA 2WAXA 5AR1A 4TYYA 1XZPA 1KYIA 1EK0A 2G6BA 3LV8A 1G4UR 1NSTA 3AF2A 5FUXA 4P4SA 5CDFE 3VKGA 3FKSD 2ZRHA 3KKPA 3OE7A 1TF2A 4ARZB 2A7QA 1KJWA 2AFHE 2YC4C 3IPYA 2MSCB 1T5IA 2GEDA 2JDIA 2QP3A 3B82A 5AJWA 4XJXA 1U8YA 1ZNXA 4NP6A 3WP1B 5BXQC 2WM9B 3C4JA 1E32A 4JT2A 5JSZA 3TQFA 3GJXC 4U5XA 3DHWC 4RKEA 3QKSB 1CTQA 2QAGB 3EPHA 1BO6A 4JL8A 1T91A 2QMOA 3AVOA 1SXJA 1LF0A 2GXQA 3IHWA 1H8HD 1P60A 4DB2A 1DADA 2GTPA 4DCVA 3OEED 2O8EB 2HDNB 3WNBA 2HYDA 2C99A 3X1DA 1AKEA 1M7BA 2CHVA 2FEOA 2HJVA 1Z6GA 2OBNA 2PH1A 1TL7C 5CJ2A 2UVQA 3HR8A 4C30A 2QMUA 4HB4A 4D6PA 4NYJQ 4UNSA 5LPNA 4QG7A 3QPWA 2VEDA 2ZSEA 3K0CC 1UF9A 1NLFA 4Q02A 1E2EA 2VF7A 2IYUA 3IDQA 5FOVA 3LAWA 3VR5A 1WP9A 4GBMA 5KOYA 4ACBA 4DCSA 4M9ZA 2PMKA 1DE0A 2BMJA 2BBSA 4HZUB 4YMTA 1SVLA 3FTQA 4E22A 4GP7A 4DSTA 2O0JA 1A4RA 1KMQA 1S3GA 2QPOA 1W5SA 1AS3A 2ZAMA 5LB2A 1NMYA 5L3RA 2HYIC 1QHIA 4QGFA 4WIAA 1ZU4A 1RRCA 2V4ZA 3QOFA 3SS8A 4V0NA 3HPQA 1SZPA 1NLZA 5EUMA 1T4GA 4R9UC 1GZSA 4MYUA 3WXMA 1OH5A 1SXJB 4AK9A 2OFOA 1FP7A 3HDTA 4F4CA 3O47A 4OHWA 1CJTC 4H1UA 2CL0X 3QQ5A 1HQCA 3TW4A 1JECA 5CLQA 4KODA 5HZKA 1YU9A 2QMHA 3GLGA 2YWFA 1JBKA 3CZQA 1OH8A 1E0KA 3MJRA 1Q3TA 1XCGB 2ZYTX 3EZ7A 4PSVA 3CLVA 4BWYA 1ZW6A 3O8RA 4NHOA 4E09A 1Q57A 4G3XA 4MRVA 3WBJA 2JLYA 1KKLA 5TB5A 3TSWA 1R2QA 2JGNA 1LTQA 1S96A 5GJWC 2A5YB 4LUCA 1IN8A 3M4YA 3NWJA 1DAMA 4B3XA 4DDWA 4GDFA 1Z08A 4ZV4A 1DEKA 2JLSA 3FHOA 1OIVA 1FX0A 1T9HA 5J5CA 3NG1A 3TLXA 2W6IA 5JEDA 4P4TA 3RANA 3ETLA 5F3WB 3CW2A 2GZDA 4CGZA 2W2VA 4GOJA 4HLUC 5FPYA 4NPHA 2FJUA 2V3CC 1Z0AA 1JAIA 2AK3A 1OHHA 2GDJA 4IDOA 3CKLA 1M1YE 2RKOA 5EP2A 5CB6A 5EZ5A 4AKHA 4WOPA 4ESVA 1IY2A 2C04A 3NC0C 1BH2A 4TQ9A 1ZM3A 1LFDB 2H7VA 3K0CA 3BFXA 4JVSB 1K5DA 2Z4SA 3FWYA 2IYWA 2YOHA 2ZE6A 4HI0E 4IKEA 4PANA 4HDOB 3QENA 5EP1A 3PJRA 2ZE5A 3K9HA 2TMKA 2WOOA 2ZI9A 1S0UA 4EPXA 2QEQA 3QE0A 1XDBA 2ATXA 1E79A 3WMFA 4LHYA 1Z0FA 3VTKA 4A0FA 3EZFA 5TMPA 4W9MC 2BBWA 4PTLA 5DI3B 4XSHA 1CU1A 1N5JA 2R8RA 2WWHA 1WA5A 1N6OA 1CF4A 1E0AA 3E5HA 3EZ2A 5FOTA 1CIPA 2R6FA 4NCKA 4ZPXA 5TARA 2WKQA 4C3ZA 3U6BA 2P6RA 4URZR 1G291 2ZE8A 5DYGA 2IW3A 2ZVQX 4XOIA 1IOZA 2BDTA 5FOUA 4LOAA 4LJ5A 3GLGB 4MKIA 2F55A 4POAA 1KK1A 2ZJOA 5UKDA 5L3QB 4Q47A 4XVRA 2QM8A 2DFTA 1QHNA 1ZM4A 4IOJA 1E4YA 2VF8A 3IGFA 1W36C 3NHAA 2CVFA 1X3SA 1MO3A 1UJ2A 1E9CA 2OAQ1 3B78A 1DELA 4PZLA 4P4UA 3GCGA 1IBRA 3MWYW 1ZMXA 3U3KA 4BLOA 3RS3A 3TIFA 4N1AA 4P32A 2PX0A 1D5CA 3CO5A 1F6BA 3KJGA 1FUKA 1ZUHA 3QKRB 3RVBA 4ASUD 4DT1A 5FTMA 2HT1A 4DWJA 2ZRFA 2AHOA 1IJEA 1K6MA 521PA 3TSZA 4S2EA 2KSQA 1PZNA 2O8FB 3T06B 4DLWA 4XWOA 1E1QA 1KIMA 1COWA 1UBEA 3KXKA 3QKTA 4UNQA 2JLXA 2WPDD 3EARA 1DBSA 5JCZA 1X8JA 4DHEA 4E03A 2AK2A 1P2UA 2ZJ8A 2RH5A 4Q1DA 1OH6A 2BKEA 2HUPA 2QBYB 3FE2A 2IXEA 1R8SA 4GOXA 4TQAA 2PT7A 4A15A 1Z83A 1AA9A 4L9SA 4LHXA 1P73A 3VFDA 3AVPA 1G1MA 1Z0DA 3ZLJA 1U8AA 2NPFA 4U02A 3NDPA 4Q18A 1VCIA 4NONA 4V03A 4ZKDA 4BFYA 1EWRA 1YJ5A 1N2CE 3T1OA 2ZYWX 5LD2C 1XJQA 2D62A 2H5EA 2X2FA 1AGRA 2G1KA 2ZSFA 5AUNB 1VG8A 3THXA 5FL7D 1SXJE 1FPMA 1BMFA 4MA4A 3ZD7A 1WCV1 3AGPA 3OIWA 5L8VA 4UXJA 2Q9AA 1W1WA 4Q9JA 2NPIA 2IS2A 3X1YA 2GA8A 5JRZA 1E6CA 4YC7A 1G8HA 1P9WA 4LV8B 2QE7D 2ZSBA 1G5PA 1J90A 2ECKA 1KNQA 1IY1A 4JLVA 1QHHA 2WWYA 1KK2A 5CYPA 2XNDD 3GFOA 1WQ1R 5TXGA 4M1OA 3W6PA 4QGGA 1KZ7B 3UPUA 4QNMA 3CPHA 1T8UA 1O3YA 4RCYA 1HE1C 3VR1A 1J99A 3PG5A 3UATA 3C41J 4P31A 1JNYA 1W0JD 5SZIA 1BIFA 1TTTA 1JALA 2CDNA 1TAGA 4DVGA 3OEHD 4F38A 2O8BB 4KITB 2QL6A 3B6EA 1VTKA 1VMAA 3VX3A 3KQUA 1JQJC 4US0R 2QE7A 4R2IA 2OFWA 3GLHA 5D3MB 2CNWD 4FW9A 4M9QA 1M7GA 2JJ2D 4JLPA 3BB3A 3P20A 4XIGS 4TLAA 4DJTA 2OBMA 4LJ8A 3AP1A 1C9KA 1Q20A 4A6PA 3AUXA 4RVCA 1ZCBA 4LHWA 4LV5B 5JMTA 2CHGA 4O3MA 2OCAA 2I4IA 3K0FB 5P21A 4AYTA 3MFYA 1E2LA 1A1VA 2ZRGA 4OQMA 1YR7A 3OFND 1NL3A 2ZI7A 4FN5A 1CLUA 2CCKA 1IN7A 2WVJA 1GL7A 2XXAA 4TZ6A 5DSZA 4N0EA 2G9NA 1BYUA 2ZRMA 3BGWA 3WHLA 1W46A 2D4HA 3OEHA 1P2TA 2PMDA 1II0A 1W49A 1QHYA 3O8BA 1D9XA 1NLYA 1R0XA 3FKQA 1NY5A 3NVAA 5KSPA 2WJYA 1Z22A 3AB3A 4RFVA 4XSGA 1TUEA 5KUTA 3R9IA 821PA 1VG1A 2CL6X 3UK6A 3R8FA 1Z63A 1L2TA 5K8TA 4PO9A 1CR2A 2BMEA 2NZ8A 4BLPA 3L43A 4HUQB 4LV6A 5EJEA 3MCAA 3IO3A 4RFSA 2YOGA 2R6DA 5EZ6B 5GVRA 2UZ3A 3JZAA 4FMCF 2E9SA 3MGCA 1DVRA 1G8FA 2QSZA 4AYWA 4QJ3A 1R7RA 3HP1A 5BN5A 3BJIC 2ZRAA 4A92A 1YR6A 3B1YA 4TLBA 5CLLA 4AIIA 2WICA 3K8YA 4FMDB 1F48A 4A82A 1OW3B 3F8TA 2GF9A 2WJIA 2ZRDA 3SBDA 4H1VA 4NU0A 1YHNA 2XTNA 4OI1A 3AUYA 4G5QA 2ZJZA 1LV7A 4EJSC 1Q1QA 1E9EA 5L3SB 4DLXA 1F60A 4AWXA 1HY3A 1I4DD 1GM5A 1ZP6A 1M8PA 2AD5A 3AKCA 3UG7A 2VP9A 2B8WA 4JSTA 1MKYA 2OCYC 3KJHA 2D7CA 4OK3A 1W44A 3GJ3A 3ZVMA 5FBLB 1WBBA 5FPHA 2A2ZA 3AVYA 2G77B 4BRUA 4Q4HA 2ZI4A 3T1QA 3WNCA 1H8ED 3AVVA 1P5ZB 4U00A 4BGDA 5D3MA 3SHWA 5E3HA 4BEBA 4QXAA 4WZAE 4NDZA 3K0AB 4MRPA 1HH4A 2RGCA 1XD9A 4TLDA 3ICQB 2Z4RA 3PUYA 2G3YA 2ZS9A 2Q3MA 2FFAA 4IXMA 4OHXA 1V43A 2EQBA 5FH9A 5KPJA 3KX2A 3IO5A 1JXMA 1I4TD 4PC2A 5LDDC 4J0QA 4B74A 2P0EA 2XOKA 2XNSA 2V7QD 1I2DA 3A1SA 4TTQA 2K5UA 1I2MA 4CEIA 1UKZA 3IBGA 3PUWA 1FL9A 2RAPA 4C0QC 5GJVC 4KLZA 5G3ZA 4LJYA 4EFMA 2XSZD 5AJZA 3AF3A 1AN0A 4K8OA 1ZM2A 5B30A 2AD1A 1CS4C 4LSGA 1AZSC 2GILA 3CR7A 3EPJA 1NBME 3HU1A 4PFSA 3VNVA 3FYHA 3GLHE 3I8XA 2WWFA 1W4BA 1ZD1A 2QY9A 1GFIA 4B3CA 1E2MA 2J46A 4BRWA 5JZVA 3V4RA 1II8A 2NOAA 3QG5A 4HLQB 4G0NA 5F9FA 4IXNA 1SGWA 1KDPA 1ZM9A 5IF9A 3BE4A 5E4FA 2FFHA 2I1VB 1XJ0A 3CRQA 1NG1A 2AL7A 2O52A 1NRJB 4D4LA 4MRSA 1NJFA 4QOSA 2GXSA 3EW9A 1OPXA 3BB1A 2IK8A 4GFDA 3U7HB 1YZQA 2CK3D 4DZZA 1XU4A 3AVWA 2ASEA 2A5JA 3K53A 3U60B 1KKMA 3GJ5A 4DIEA 2A5DA 1G5RA 2BKUA 2DFNA 2YINC 4DLYA 1E2HA 3LX8A 5HTKA 2W6JD 2HLDA 4DCNA 4Q00A 3O8CA 4C2UA 1X8KA 1N5KA 2E87A 3VNUA 5JJIA 2A9KA 3BFKA 4XD7A 4X8HA 1GNRA 3DM5A 4GSYA 3KFXA 4DC9A 4QKQA 3UG6A 4ABYA 1GOTA 2FPMA 3Q5EA 2CLSA 5C18A 2NZJA 2C9CA 2J7PA 4IFEA 4CEJA 4C2TA 4B43A 1ZNZA 2G88A 4I1SA 2VTKA 4B73A 4Q48A 5AJXA 1BOFA 3RRYA 1E99A 3LO5A 4QBIA 2KE5A 1IAQA 1UKVY 1ANKA 2GBLA 3B60A 3BOSA 4TMWA 1ZJ6A 1Q21A 2OUKA 4B6FA 2VO1A 2HLDD 3SU8A 3P27A 1XFAA 1SQ5A 3CX7A 4YXWD 1JJ7A 5JCPA 4F4IA 1KNXA 4ILEA 2IYLD 1G8GA 3HYRA 5EE5B 3U3JA 3PEVA 4D81A 3K70C 2GK7A 3BIFA 2RGXA 4FCVA 3VKHA 1COWD 1NNEA 1CRPA 4QC2A 4CIDA 1JR3A 1G6OA 2O8DA 4ZCLA 3T61A 3EAQA 2UZIR 1SVKA 1TPZA 1II9A 4B71A 2X8AA 4A0HA 1JR6A 1T5LA 1ZRHA 2CBZA 4FXPA 1QZXA 3ZDQA 4L15A 1QHSA 4M1KA 2O5VA 4JBXA 1E2QA 3DOFA 4KFTA 1NMZA 3ONWA 1L4UA 2WSMA 3PXGA 2B92A 3REFA 1D9ZA 3R7WA 5JHHB 3W5JA 1IXZA 1SVWA 3IIMA 4ON9A 4G5SA 3O8DA 1N6RA 3ZIAA 3FHTA 5BQ5A 1X1SA 2ANBA 2P65A 1AKYA 1G64A 3L2OB 1KI6A 4Q1AA 4A2PA 4B3DA 3PEWA 3THYB 1N5IA 1EFRA 3SI7A 4CRWB 2XGJA 1SXJC 2BMFA 4LK2A 2MMGA 4PAQA 4WVFA 4A6XA 4L16A 1G8YA 1BYIA 1HT2E 1OKKA 1KSGA 4D4KA 5JRJA 4TSFD 3ZH9B 1GILA 1LS6A 2EU8A 2R2AA 3I32A 2GEVA 4BPBA 4NH0A 5SZHB 3U44A 1IJFA 3BK7A 1NVUQ 5KSOA 3A1WA 4MDFA 3QG1A 1VG9B 2IL1A 2I3BA 2JJ8A 4RD6A 3M0EA 2ZRLA 2ZRNA 4A0GA 1YVDA 5AK0A 1K8RA 4YMWA 2VP6A 4XWAA 3WMGA 3AM1A 3P4XA 3WRYC 1NIPA 1VHTA 3SN6A 4NBSA 5KNDA 2E1RA 1WDTA 1XTIA 4B47A 1KAOA 3RDPA 3TJZA 5JI3E 3LBNA 5K8UA 4YMUA 4DSUA 3IUYA 4RSGA 2BJVA 3B1XA 3J81k 4G5RA 3REGA 4V0ME 5HE8A 3U7EB 3EWAA 3GLFE 3CR8A 3L8YA 4JVNA 3TVDA 4F92B 3ZVLA 2JLWA 1P4SA 3CX8A 3JVVA 4LYAA 3GMTA 2HCBA 4LC1A 4OQXA 3LVRE 3CZPA 1UEJA 3GJ8A 3W3AA 1IONA 3K9NA 1XEWY 4ZCMA 3CF0A 4IDPA 5FTKA 4OI2A 2IF2A 1J2JA 4OI4A 3KQNA 3KQHA 2ZVPX 4B35A 4A8JB 4O2RA 4CZ2A 4G1UC 2REOA 2HV8A 3MWLA 4BZQA 3M6AA 2FPKA 2O8FA 1KI8A 4HEJA 2BMDA 2XAUA 4JMPA 4HLUA 2QG6A 2Z6VA 4W5WA 3A37A 1U2RA 3IBYA 1Z0KA 1XX6A 2BV3A 4QNRA 3THOA 3KQKA 2BVNA 2O0HA 1VCNA 5H68A 1SKQA 3EC1A 4GZMA 2OBLA 4TLEA 3BFVA 4KBGA 3U3OA 4UXHA 4QRHA 4RZ3A 5HPYB 1NBMA 3QSYA 4DDVA 2QQEA 2J5XA 1GNQA 1ZVQA 2KB0A 1AM4D 2NGRA 2ZITA 4NCIA 4Q19A 3RS4A 5KTYA 3I4LA 5JS8A 2WIBA 1X8LA 2ZRIA 1GUAA 1QHGA 3VR4A 2EFDB 2WZQA 2AN9A 1S3SA 5A0FA 4NYIQ 4PPQA 3CPEA 2D2EA 4I81A 4EUNA 1XF9A 4R7ZA 2ZJBA 4DIDA 2QTFA 1ZYUA 2YJTD 1YRBA 4TN1A 5G41A 2NG1A 4CT5A 4KVGA 3TUZC 4K46A 3ZYCA 8OHMA 2OT3B 4LZZA 4PAOA 3VAAA 3KZ1E 4NMMA 2EVWX 5J47A 3KB1A 4Z8YA 1CR0A 1OFHA 1KY3A 3TW8B 1S9DA 2AWOA 3SQXA 2EYUA 1A2BA 3L0IB 5DI3A 4B2LA 1OJLA 4AI6A 5BWMA 3N2EA 3GLIA 1TQ4A 2P3SA 4X8OA 1UDXA 3CM0A 2JJ2A 1L4YA 5A4JA 4B3FX 3CF2A 3UKDA 1Z6TA 5CM9C 5J40A 2W00A 2V8OA 4N3NA 4Q1EA 2F1HA 5JEEA 5J4VA 3BB4A 1EX7A 2PEYA 5C2JB 2X19A 1F2UA 3BS4A 2L0XA 2A78A 4A2QA 2GCOB 3D6TB 2HCJB 2ZPTX 1KSFX 2GJKA 2N42A 4TMTA 1ZC4A 1NY6A 1ZIPA 4LYFA 1DARA 1OF1A 1T0HB 4QHYA 4TL9A 2GRJA 2F1IA 4JS0A 5FBRB 3H1TA 3U44B 1CJMA 1W4RA 2YYZA 4WXRA 1FOEB 5G53C 1G3QA 2C5LA 3KTAA 4ZDWA 3TSOA 2GZHA 1W7AA 4B6EA 3NH9A 4NYMR 3S1AB 5IHPA 1ZM7A 1IXSB 1VHLA 2Q21A 3AEZA 3WRXC 1ZUNB 1HV8A 1KI6B 2G83A 3MSXA 1LF5A 4HATA 3THYA 1FW6A 3EX7C 2ZANA 3ADKA 3P4YA 3RSOA 1CEEA 4NCHA 4Y0VA 3FDIA 2J87A 4OJKA 3R7WB 1Z28A 2FMXA 4QBGB 2ERXA 2VP5A 5GVSA 3QXSA 2IX3A 1LW7A 1OE0A 2DY1A 4NYJR 3KKQA 3VR6A 2QTVB 4JYBA 1FMJA 1XTSA 4B3BA 1KJYA 1KSJA 1GWNA 1TMKA 2XITA 5ANRB 5L3VA 2ZJAA 4TMVA 3EC2A 2WJGA 4KVAA 4DDUA 2PCJA 2BM0A 2ZJYA 3N2IA 4B34A 4RZUA 3GJ0A 2O8CA 2VYFA 2NO9A 1KAGA 3OIYA 1XTJA 3A4NA 4Z1MA 3TRFA 4EDHA 1YZTA 5IK2D 1G3RA 2B7BA 1OIXA 5TY0A 3RC3A 1FQKA 1NI3A 1XEXB 1SULA 2PT5A 2ODBA 4MYTA 4E07A 4HZUA 1TF7A 2KBEA 2IS6A 3AQ4A 1XEXA 2IYYA 3L0OA 3GEEA 5IT5A 1Q1EA 1M34E 4V0KA 3BH6A 3K09A 3LWNA 3PUXA 1EFUA 3U6KA 4DLZA 4HSEA 4D0NA 3QF4A 2NQ2C 3IHLA 4PZZA 1G7RA 4C7OB 1JR3E 2QT1A 3K1JA 3TK1A 3BRWD 3W9YA 2CVHA 4TMXA 1GNPA 1RRPA 3CIOA 3P26A 4IVRA 2RHMA 3OZXA 5KDLA 1YR9A 2HF9A 3KDSE 1PJRA 2VH5R 4FMDF 4JKYA 2GZAA 4TTPA 4BUJA 3OE7D 3EIQA 4LJAA 2XTMA 2OXRA 1TF5A 3IILA 4WZ6A 2QUZA 4DLSA 4KYIB 3SDZA 5AJVB 2V1XA 4IFBA 2OXCA 2PZGA 1XXHA 2Z0MA 1ZCAA 5FTNA 5CDFA 5DIFA 3T5DA 1TQDA 3SJZA 5AUOB 3FPAA 2CCJA 3QXCA 2EFEB 1SXJD 4WBSA 3S1AA 3Q85A 3H4MA 1E79D 1XPOA 1H8EA 3U3RA 1Z5ZA 3KTAB 3W90A 4ARZA 5DLQC 2JLZA 3CUEF 2WIAA 4Q1FA 3PV0A 1ZAKA 5JECA 1FNMA 3QKUA 3RSLA 1XJCA 5EUQB 1W2HA 1GKIA 2Q6TA 2PLFA 1NN5A 1P7CA 4MRRA 5C46F 2VHTA 4B75A 1UBFA 4CYMA 3QF7A 1NJGA 4BLQA 1AGPA 2F6RA 3MLEA 3GP8A 3ZJYA 1ETUA 2F43A 5H8WA 1Z2AA 4C0HA 4MKFA 3LBIA 2KBFA 2QPAA 3RRNA 3MRSA 2ORVA 3T12A 4D4JA 1G3UA 2LKDA 2QP9X 2IHYA 3FMOB 3NDBB 4GRAA 2V7QA 2GCPA 2ZUDA 4L5BA 4A4DA 1IN6A 5FBQB 3VR2A 1HUQA 3CPJB 1J8MF 2J0UA 4DUGA 2RMKA 3KKOA 1T3HA 2FSGA 3D8BA 1VCOA 2WJHA 2D06A 3B2EA 2HJGA 6Q21A 3PEUA 2IYXA 3D7MA 4V0MA 5KHOC 2QAJA 4EPYA 5EP4A 2R44A 2CXXA 4IVQA 5FI1B 3U2QA 1HURA 2FX3A 5FUWA 4DDTA 4ESHA 1U98A 2QENA 1E0SA 4PHHA 3QEJA 1AQYA 4K81B 2WJJA 4HAYA 2DR3A 1AS2A 1KK3A 3D31A 1XCMA 3K9GA 1MV5A 4KCGA 4OHVA 3EA5A 3QPVA 1UBGA 1LB1B 4PQFA 4OQNA 2ZSDA 2PZEA 2X2EA 1OB5A 1NN3A 4MGKR 4Q9HA 5D3QA 3RS7A 3RRZA 2GHIA 2F7SA 4MITA 2IWRA 2WAYA 1AJEA 2YWHA 5KNBA 5BYJA 3V4FA 4NL4H 2FFBA 4L4UA 3EIHA 1WBDA 3ECCA 2JEOA 1Q22A 2YC2C 3LW7A 5C4GB 4YONB 2VRWA 3I73A 4OQFA 3H84A 3WYAA 5IRCD 4G01B 2FG5A 5C1BA 2EFGA 2IBMA 1E9AA 1KDOA 2RB4A 4HLCA 1X1RA 4URWR 4B76A 4E5UA 1XCPA 3BBPA 2GEUA 2J1LA 4P33A 1KDRA 4DBLC 2NMVA 5HKKA 2ZJ5A 1OFTA 1RFLA 1RJ9B 4ZIRB 1L8QA 3GQBA 3LA6A 3WYGA 2NO6A 5SZJA 2C96A 2KWIA 4D0LB 4Q9LA 2B6HA 4RZ2A 4I4LA 2BJWA 1V5WA 2ONKA 2D2FA 2X77A 4UNPA 3W3ZB 2FH5B 2VHQA 5DYIA 2IEZA 5EXTA 4Z51A 4IEIA 1CKEA 2QRZA 1KI4A 3N70A 1P62B 3LY5A 4HB2A 5JJKA 2OZEA 1TX4B 4JZKA 2QAGC 3FMPB 5CYOA 4QFMA 5AWFC 4EPRA 2IWHA 2J45A 3QJYA 5HR5A 1U0LA 2FZLA 4ZIRA 4D82A 5F9HA 3DEFA 3X1WA 4JBWA 4OQLA 1D2EA 4AKGA 2GKSA 2WSSA 2DFLA 2C77A 2J9RA 1D8TA 1WE2A 2A5GA 2WPDA 4ZI3A 3K70D 1GG2A 1A7JA 3EG5A 1IXRC 1UPTA 4P4SB 4IDQA 1N6PA 2OM2A 2P2LA 1S9HA 4IRUB 1VYVA 1JR3D 2QT0A 1IHUA 3T1VA 3I72A 1JAHA 3GPLA 2JLRA 2CNWA 4JT4A 2XXAB 1E2JA 1RZ3A 2QI9C 3WHKA 5JWHA 2W58A 4AG5A 1W47A 4IHQA 2XJ9A 1NN1A 2Y8EA 3BORA 1TNDA 2CCGA 3K0FA 4GZLA 1E2DA 3M1IA 1D2NA 2LWIA 1CR1A 3CBQA 1N6NA 3KB2A 2CJWB 4PHFA 1XPRA 3C5HA 4L9WA 4UJ3A 4DKXA 2ZREA 4TTRA 5GADl 5KDOA 4MH0R 1WMSA 4AYXA 1KI9A 4JJKA 1KMHB 5E7JA 4D0GA 1HEIA 2QZ4A 4D26A 3LQQA 4M4SA 3CNOA 2YHSA 2GVDC 4MKGA 1TEXA 4BFUA 2PL3A 1YZUA 2J59A 3OF5A 3UANA 3CH5A 2KJQA 1RW4A 2FSFA 1OYYA 2VSOA 4KHZA 4BLTA 2J7KA 3SJCA 4DXAA 5KYKA 1XEWX 1YRAA 1VG0B 4CDGA 5B2ZA 5J4YA 4R2HA 3TBKA 1RRGA 2QQ0A 4B2IA 1GL9B 1NVVQ 4YMVA 1US8B 2BEJA 1Q0UA 2VBCA 1W2GA 1OIWA 2WWXA 4KSBA 3LBHA 2Q3FA 2HEIA 3TR0A 4IDNA 2V55B 5CIQA 3A8TA 4LYJA 1W0JA 2VL7A 1E9SA 1L7VC 3NTUA 4LPKA 2QA5A 4Q4AA 3ND9A 1F2TB 2C98A 4HYYA 5JWRA 1LS1A 3DMDA 2ZRBA 4YDSA 3C15C 4EFLA 2AXNA 3Q7PA 1HT1E 2BCGY 2ZS8A 4QM6A 1ZC3A 2ZSAA 1B0UA 2RCNA 2RGDA 2RGNC 3TQCA 4EQ6A 5LD2B 2ZRPA 4Z8XA 1E69A 4JLMA 3LW8A 1OV4A 4Q4JB 2AR7A 4NZYA 1SVOA 3THXB 1P9NA 1Z29A 4C0KA 2V6IA 1OFUX 2WMNB 4JLKA 2ZRCA 2QRNA 3PFIA 1R0ZA 4LPSA 1W36D 1H8HA 2R6CA 3N5CA 2IYTA 1ZD9A 3EXAA 4QL3A 4RJLA 3RABA 1A82A 1SHKA 3QVVA 3TMKA 1GRNA 2OCPA 4JYCA 2QTHA 3THWB 2QGNA 5DHAA 1OXUA 1P75A 2GJ9A 2NO1A 2OFXA 3UMRA 3DZDA 1UKYA 3E70C 3AVXA 1IM2A 2EFHB 2VHCA 2OEPA 2W0SA 3RS2A 2YNMA 1GKYA 2DWOA 5CIWA 1YZNA 2W0MA 4BLSA 2WMOB 2VP4A 4BLRA 1RIFA 1E3MA 3DMNA 1MO5A 4U7DA 2XB4A 4C7OA 1UFQA 1GITA 2JJ1A 3HWSA 4US1R 3LQRA 1JEDA 3AP2A 1FQJA 1Z6AA 2YOFA 1PUJA 4JLDA 2ZM5A 2J0SA 3ZS8A 4R71A 4DT1B 4I1UA 3Q5DA 2RGBA 1Z47A 4ZKEA 5BW8A 1G5TA 2ODWA 2C03A 1MO6A 2QSYA 1MOZA 3QBVA 4Q4JA 3VX4A 2IS1A 1FP6A 3A1TA 4P3YA 4V0LA 3WY9A 1GKUB 2H92A 4JLJA 2OE2A 4ZDJA 4BQSA 3I61A 3A4LA 4XVQA 5KO2A 1X86B 1PUIA 1YZGA 5DI9A 1RRFA 2O8CB 3OAAD 5EE3A 1ZUIA 1G7CA 1OXXK 1X6VA 4MUBA 1ESNA 1JPNA 3SEAA 4LBYA 1J70A 4Q4AB 3ZZTA 1N5LA 1G18A 2GAOA 4HAZA 5J4KA 1DTSA 5KSZA 1CP2A 2W83A 3C8UA 1O87A 2JJ1D 3CH4B 1Y3AA 2RGAA 3DVLA 1A5TA 4KO8A 4CEIB 2IYZA 1Z6YA 2SHKA 4W7SA 1ZNYA 2P6UA 4L8GA 2RGNA 4PQYA 3LVQE 1OXSC 1FUUA 2DBYA 2IS4A 3P1JA 2OSBA 4OKSA 3GEHA 4KXFB 4DLUA 1RYFA 3EWSA 1NVXQ 1QG4A 4IVPA 4Q9KA 1T8TA 3TUIC 2RGGA 2J0UB 3QVUA 1UBCA 2W6ID 2VHUA 4IDHA 5CJPA 121PA 1QVRA 3SOPA 1U99A 5FTLA 3LD9A 2ZI3A 4PR0A 4LHZA 1KMHA 1KZGB 3DKVA 3MD0A 4PPFA 5AUQA 5FI0B 4LBVA 1TADA 1E9BA 4WZBE 4CEHA 4M1SA 3NC1C 2F43B 3SYNA 4GL2A 2G1JA 3VKWA 1Y63A 3DKPA 5IK2A 2JAQA 3ASYA 3L82B 1N6KA 2QP4A 4OK5A 3WNDA 2CE7A 2WKRA 3I62A 1AQUA 3W6OA 1MRNA 5TDHA 3SE0A 2ZR9A 3NBXX 3T15A 4FWIB 1E9FA 4BZPA 3H86A 3AVTA 2XSZA 5EXSA 2ZI5A 2BWJA 3WP0A 5IDVA 3LLMA 1PV4A 1F3OA 3H2YA 4DSOA 2BBOA 2D7DA 4URVR 4KAXA 4A8JC 4MYHA 4H9GA 4PO8A 1E2IA 2GAAA 3OFNA 1SVIA 4TMZA 2IYRA 2ZE7A 1S1MA 3IEUA 4QJ4A 2FGJA 1EFCA 3LXXA 4FCTA 3NBZC 3LXRA 2O0KA 2ZYVX 4HAXA 3TUJC 1E2FA 4B48A 3JVUA 3QXHA 4JVLA 1MO4A 2BC9A 1T3LA 1G8PA 4M1YA 4PX9A 4JJZA 4RY2A 4RZXA 1TU4A 3OIUA 3BAFA 4MKHA 4O2LA 2CMKA 3FB4A 3TH5A 5KSYA 3PITA 4JIMA 1G6HA 4HDQB 1MH1A 1XB2A 2VHJA 4CW7A 4Q7LA 5FFMA 1XP8A 3U4QA 4ASUA 3ZIAD 2BEKA 3K70B 1YZKA 4LYHA 4MQBA 4CVNA 4XH9B 3TE6A 2R9VA 1G7SA 1GAJA 1Z0JA 3E1SA 2JCSA 4JBYA 2WHXA 4RD2A 2WOJA 4ZO4A 4RCZA 4EJSA 4XVUA 1OKKD 4HAVA 2C95A 2P5SA 3W8NA 1Q3HA 4QGAA 1QVAA 3AVQA 1B23P 2VLIA 4Z54A 1ZINA 2J0QA 3VHXA 4Q7MB 2H16A 1J7KA 1G19A 3TNFA 2EYQA 3SYLA 2OESA 2J41A 3HU2A 1R5NA 1M74A 2F3TA 3F3YA 4LI0A 1XMJA 1IY0A 1DAEA 1G41A 1LVGA 1XWIA 4IJMA 2Q3HA 4MGIR 2O8EA 1SVMA 1KOFA 3NIBA 2OAP1 1Z2CA 5FR1A 2JIZA 2FSIA 4TQUS 3X1ZA 1CULC 5EXXA 5FBVB 1EFHA 3H0KA 2ODEA 1E2PA 1ZD8A 2IXGA 3B8HA 1TEVA 4DRZA 1ONBA 2YV5A 4M1TA 2XJ4A 1BS1A 4QBFA 3CWQA 2XB2A 1SVSA 5DHFA 3ZS9A 2Q9CA 4I99A 4V02A 5H70A 4F91B 5B57C 1KI3A 1OXVA 3I92A 1ZU5A 5DN6D 1U0HC 3UMSA 3PEYA 2PX3A 3KJIA 4Q1CA 3BH0A 3L0PA 4EPVA 3FMIA 4KLNA 4F4JA 4ZDKA 4QM7A 3PQCA 3P32A 4OYHA 4KV9A 2D74A 2JLUA 4EKDA 4I1VA 4LC0A 5JBQA 1R0WA 2P5TB 721PA 1G4AE 3B85A 2ZR0A 4XTCS 1IN4A 1DAGA 1J8YF 2GCOA 2JIZD 2VSFA 4LCBA 4OJQA 4EPTA 4V0OA 5F2EA 3ZZ0A 1PVOA 2N46A 3FVQA 4PPNA 2V54A 4M1WA 5JWOA 3K9LA 3NXSA 1R6BX 4WAUA 2OG2A 3Q72A 2AWNA 1I4LD 3U5ZB 4PC7A 3GLIB 3I1FA 3B13B 4LDJA 3A1UA 5DNYB 1FTSA 1OFIA 1UADA 1R5BA 4KJZA 1EWQA 1DO0A 3K0SA 4LJ6A 3BERA 4FMBB 3VQTA 2IUSA 3SJAA 3ZQJA 2GJAA 3B9QA 2DB3A 1KJZA 3U3MA 2JA1A 4IW3B 1E2GA 1JB1A 3LLUA 4GT1A 2EFCB 3ZVRA 4PHGA 3MJHA 4PPGA 1NP6A 2ATVA 2XTZA 3RLFA 4Q4LA 2BCJQ 3PIRA 4ZI2A 5J4LA 2UKDA 1KO7A 1JQLB 3LDAA 1W36B 1U81A 4EPWA 5KNCA 2C8VA 1E94E 1XXHB 2C2HA 3CF6R 4RD4A 5TVKA 1S1CA 4BFTA 2AFIE 5JS7A 1YQTA 2VP0A 5LBIA 4EJSB 1E9RA 2BIFA 2DPXA 5DH9A 3A6PC 1YKSA 2R62A 2XZPA 1G21E 4KBFA 4XD7D 5KU1A 1G9XA 1XEFA 1G16A 1ZIOA 2G0TA 1E0JA 5FR2A 1KY2A 3VR3A 3WMEA 1E1RA 2OV2A 2IUTA 4RKFA 3CNNA 1FFHA 1RYHA 1Z06A 3ZGXA 4MGYR 2ZYUX 1N6LA 2KI5A 3VMFA 2GJ8A 1XD2A 4CT4B 5FUYA 4R98A 3MWJA 3HR7A 4KFSA 2LCFA 4PQRA 5CITA 3GLFB 1DS6A 5KPDA 4FD2A 1RC8A 1DAKA 1KGDA 1CJKC 3AF1A 4A8JA 2W2TA 1Z0IA 2IA5A 3X1XA 3B1WA 3OESA 4YXWA 3IPXA 4XTRA 4QGHA 3ZZUA 3Q9LA 2VSXA 3B5JA 1QBKC 4W5JA 1G7TA 1TQ2A 3AP3A 2C9YA 1XTQA 2NTYC 4DEXA 1SHZA 4D25A 2BBTA 1E4VA 1EG7A 2H8KA 4GMXA 4UJ5A 1GSIA 4Q01A 3RYTC 5FPTA 1DAHA 4HB0A 1WRBA 2REXB 2FA9A 4M2LA 1Z3IX 3GEIA 1RKBA 1W4AA 4Q1BA 4TT3A 1GIAA 1HE8B 1OLOA 4YDHB 3RHFA 1FMLA 2FZ4A 4C9BA 2ANCA 4KU4A 3GJ7A 3UWKA 1KHTA 1XTRA 2WWWA 4LHVA 5B64A 3B9PA 2PCLA 2GESA 2MSDB 2HXYA 2F3RA 1QHXA 1JXOA 1P72A 2WWGA 4C0SA 1Z07A 1G3MA 2H1LA 5DGXA 3WYFA 1PLLA 3I8SA 3UIEA 4OI0A 3ZVNA 2IC5A 4FCWA 1BKDR 4FMCB 2H57A 4AKEA 1E1QD 4CEHB 4KYUA 3QEOA 5H1YA 1NMXA 3OAAA 4NYMQ 4Q7KA 4M22A 4CF7A 1N6HA 2CL7X 1Q1BA 3PENA 3LX5A 4M1MA 1CXZA 5KDDA 2QN6A 3SNHA 4QHSA 1RE0A 1M6NA 2HF8A 1K5GA 1DAFA 5JFGA 1UKEA 1R5OA 2QPTA 4FWTA 3EASA 2D3WA 3DZ8A 3LRPA 4Q9IA 1Q44A 3NKVA 4GI7A 3RAPR 3RWOA 4LWZA 3EZ9A 2FNAA 2GXAA 2ZAOA 4M9SA 3RNLA 1KI2A 1U94A 1XMVA 2FFQA 3CONA 4PSKA 3SBEA 5FBWB 4B44A 2DYKA 1E9DA 3MUFA 1UDWA 3AKYA 2NO7A 1BMFD 2VP2A 2GVZC 5HCIA 2NO0A 2FE4A 1KO1A 3K09C 1CJUC 2JLQA 4M8NE 4OBEA 2FGKA 3NBYC 4TL6A 2BM1A 1WB9A 3V9PA 1EX6A 1OT3A 4ERNA 4IOKA 4C0LA 1R0YA 3I5YA 3ADBA 1UM8A 2PBRA 2GBLC 4ZCIA 1MABA 3OIVA 2DCUA 1G3IA 3OEEA 4NCJA 4QJ5A 1NN0A 1VYUA 3RRMA 3QXXA 4XWKA 1CBUA
chains in the Genus database with same CATH superfamily
1ZNWA 1XXHE 2FR1A 3KC2A 4HBZA 5K45A 4B4WA 1E1CB 3PUJA 2ZIUB 4G67A 1QZTA 5AT1A 3E0XA 2OXEA 1CR4A 2W6JA 4K03A 3PXBA 4CEJB 1V9SA 4BZXA 1DQYA 2FZVA 3LLCA 4C14A 2VCHA 3PFBA 2Q5EA 2QROA 2VATA 1R6DA 2PU5A 2XI4A 3RWMB 1YGPA 2VUTA 1FSPA 4OHZA 1FNBA 4I5IA 2OLKA 3DNMA 3LBYA 1P9RA 2ZQ5A 3CLSD 3FYCA 4OGFA 3P0FA 4TTJA 3SBXA 4ALIA 1X94A 4CMEC 1VPLA 4IWXA 1U9ZA 5JHGB 3BA6A 1P0FA 1F06A 1FFXB 1FYVA 1Z8DA 3C7KA 3M1LA 3LXUX 2GO1A 2R6GA 4EHAA 1N2OA 3DL4A 2QAGA 3DOEA 4JR2A 1IQPA 2W2NA 2OYSA 5D1HA 1M5UA 3EZXA 3QVXA 4YMLA 2VAWA 4RFSB 3SJBA 1NF8A 4DQKA 4LISA 1Q84A 5I7WA 1EWQA 4EM6A 2H31A 1R4AA 4LC9A 4B32A 2XMBA 8ADHA 1Z74A 2XZOA 2OTCA 4EQ6B 4ID9A 1HL7A 2G08A 2HXSA 1EXMA 3KJEA 3LKZA 2REBA 5J58A 1KJ9A 1V95A 3CH6A 2UU9B 1DC7A 3M6XA 5LFAA 1SKYE 1IY8A 2X9QA 5EQTA 3G02A 4E15A 3BL8A 3CMMA 1RPZA 5IKEA 3H6KA 5K8IA 1CZKA 3CZAA 4KQ6A 3ZQUA 5EMJA 1H9BA 1IFXA 2EKPA 4YROA 1U6IA 2BFFA 4URYR 5J5VA 2QL7A 2VDLB 4EEXA 2A3RA 2AQKA 3KUCA 1F8GA 4HV4A 1OH7A 1QIIA 1R6XA 1QRSA 1I1OA 1T9GR 4CFYA 2BGWA 3KAPA 1OROA 1PX0A 1M10A 4DCJA 3LFUA 1VCMA 2C07A 3IKJA 3TGWA 1FP4A 3OCUA 3TZCA 4YVFA 1RXVA 4O1HA 2LCIA 3FOBA 2D0IA 3HYTA 4JT8A 4Q03A 1VFNA 3HRKA 1HTWA 3RUDA 4MB0A 3QNUA 2O23A 1N5DA 3LQ4A 3FPGA 3GFVA 4EIWA 3U61B 2PZJA 4TKZA 2VJDA 2IYSA 2XNJA 3IAM1 1L4NA 3GLHB 4QU0A 3PX7A 3TLEA 2GJSA 1RCTE 3GLKA 4AJPA 2C3YA 3ZZ1A 2R86A 2FHSA 3ASZA 2LW7A 4HDSB 4BNVA 4MQEB 5DHTA 4MQ4A 1ZZEA 1ZBDA 2EGGA 2P9GA 2WJZB 5K5EA 1FPQA 4HUTA 1L5HB 2YIMA 1P61B 4AG6A 4Y2RA 4TYNA 3PICA 2HU2A 1UEIA 1GRRA 1JWAB 3AZOA 4X1KB 3DAOA 3JQAB 1SWWA 1RJFA 1XTVA 1GQRA 2XCSB 1Y89A 2R7KA 5KYNA 1HLDA 2ADOA 2AFIA 3E03A 5LKRA 4NLLA 1JG2A 1NLUA 5BUSA 2FEMA 2VTBB 1AZTA 1MVNA 4WVLA 3Q6IA 1IWOA 4LXUA 1NW9B 2DHRA 4AZWA 2JS7A 2W8ZA 3FLEA 1V7PC 1XZEA 3TCKA 3PI7A 3LMKA 3GP5A 2VZLA 2VKTA 2X0IA 3DXFA 2G9RA 2EG5A 3VHXB 3A6GA 3OZSA 4IOLA 5HJ7A 5IFKA 3L6CA 2WUEA 1RR6A 1GTVA 1FK8A 2W7TA 4OL0A 4HCJA 1WKCA 1FJHA 4RQBA 1ESMA 1KRHA 3CW8X 1KO8A 5EIEA 5B4UA 4IY1A 3UMBA 1QGED 1KU0A 3K15A 5A5DA 2H17A 3HV0A 1RU3A 4IJUA 2BUCA 5AXCA 1P81A 5BWCA 3FOFC 1L9KA 2B7CA 4DN6A 2VOEA 5CPBA 3H6HA 3IHKA 3EGDB 3R3SA 1J5EB 5CYFA 1I9CA 3G5UA 4HXEB 1UBTS 1QIGA 1WUKS 2H1SA 2BHNA 4H0FA 5D01A 3UHOA 1A7UA 1ODSA 3CRMA 3KYIB 2FP4B 4EFKA 3LDFA 4JI8B 2J7PD 5SZKB 4BMSA 2A1IA 3F2IA 1DG3A 3NHMA 1CRQA 1PFGA 3OM9A 3RCBA 4BE7B 4BFXA 3BMQA 1RWVA 4GIBA 5MGBA 4PEVA 5GONF 2B21A 5AVYA 3A1VA 2JANA 1MRSA 1D4AA 4LA4A 2NNWB 1JEEA 3A27A 2P68A 4MV8A 3MHPA 1TU0A 3M34A 3O2NA 2WUFA 3UJ7A 2O59A 3B53X 4GPAA 3F7NA 2MR6A 2AKYA 5IWAB 3R8XA 4OK6A 2J3IA 2AOUB 1Y3DE 2B7LA 4Q34A 4BFVA 2B36A 1SAYA 1N5MA 2COEA 4P3OA 4X24A 3OFKA 2GN2A 2OXIA 2ENUA 5B58C 2VRBA 1XMOB 3HYLA 3QA9A 5D86A 3D1VA 1IDN1 3RKUA 4JQSA 1GUZA 2A0FA 5JNSA 4XM2A 1YTUA 2MSEB 1QGYA 3KQOA 2IY8A 5I8WA 1DAIA 4B4KA 1DAOA 2FB9A 4TZ0A 2XBLA 1ZGBA 3F7MA 3OZBA 5ENZA 2IHTA 1XKQA 4UUPA 4W5NA 1GAWA 2PWYA 5B6IA 3TR5A 5KQGA 2FI1A 4C4PA 1LVUA 4JJFA 1IZYA 2W48A 3QOWA 1GA6A 4QPDA 4L8FA 1LLQA 3DDCA 3EQ8A 3ONFA 1GZHB 3PP8A 1B15A 2YASA 3GAMA 1E2KA 2ZTVA 3EOZA 3BDIA 1JIIA 4J16A 2FDCA 1N2GA 2BHRA 1C7RA 2DG2A 5FL7A 5E2IA 4YWJA 5KQLA 4H7FA 5K0CA 3RC8A 3CRW1 2Q7XA 4CQJA 1XMSA 3GAZA 3WBKA 3W5IA 4C0JA 3GGJA 4G8JA 3UW1A 1Z5NA 5F2OA 2H07A 3KKMA 4OD0A 5BSUA 3U7FB 1EAMA 4X95A 3T1TA 2ENWA 1E96A 1JI3A 2BI7A 3ZWMA 1NTRA 3JATB 4RGQA 4UOQA 1HE4A 2E4XA 2W37A 3QBTA 4XIYA 3VR4H 3FOCA 3FFAA 3PGA1 4G5GA 3ND8A 4EFNA 1N0UA 3ZDFA 1VYTA 1QG2A 3W6NA 3JV7A 2YUIA 4KWEA 3UOGA 4CJXA 1N0IA 4ZVMA 3OI7A 3AETA 3DLPX 1WXQA 3FGNA 2IEGA 4DQUA 2WJVA 1QBGA 2P9EA 1ADYA 3ROTA 2DWQA 1Y5LA 2ZIWB 3EG9B 1NSFA 3W5BA 3JSXA 4NH4A 1JIVA 3STUA 2YV3A 1BROA 3N7UA 2R5WA 4LJ9A 1PYOA 1DPFA 4AF8A 1QKKA 5CUQA 1M7HA 4DC1A 4J3JA 2EGHA 2B8JA 2W6OA 1KP9A 5GJBA 1EQUA 4HH4A 1C0KA 2F9FA 2WD8A 2VXOA 2I7CA 2XHZA 3A06A 3DHNA 3FCAA 3L40A 3WL3A 1L6IA 1G63A 1FS5A 4FHCA 4HXGA 3MT8A 4QA9A 3VAZA 2WSSD 3LS2A 2A5FA 4UPEA 3V00A 4UTVA 3K16A 5E95A 3FIUA 1KHHA 2GF2A 3B1VA 5HFJA 1ES9A 3K0AA 4LJ7A 1U0JA 4EW2A 4D9GA 1I6WA 4TXJA 3E2IA 4CKWA 4U7FA 2YN2A 3TI7A 1AD2A 621PA 3KD2A 5CH5A 2Y1XA 3PSAA 2XX3A 4RJ2A 2R0QC 4A0RA 2F9LA 4ML3A 4BVKA 2AMVA 2CYBA 2FZGA 3DZBA 4IQGA 2ZKIA 1T5SA 5BN4A 4HN9A 2GCNA 2W2PA 2FQ1A 5JAQA 4MVJP 4EAQA 1T6NA 2LBPA 5FWNA 1DDGA 3L7DA 4BVGA 3M2TA 3RC1A 3P4UA 5HKKD 2ERCA 2V7BA 1P8AA 4NEHB 4MICA 3TGPA 3MJCA 2PD6A 3AY0A 1H6CA 1HQYE 5YASA 1WHSA 3DD5A 2DULA 2XKKA 3OQPA 3A1EA 1V6AA 1KK0A 5T41A 1PS0A 1Y98A 3IIJA 3KEGA 4M21A 4PYKA 1LK0A 4BX9A 2C9ZA 1PZXA 4M98A 1PWZA 3Q6MA 4D46A 1EWYA 1YWGO 3E4DA 4BASA 2WJPA 3W4IA 1XL1A 2QN2A 3KL4A 1WU7A 4P0TA 3T35A 4RL4A 4PC1A 4KL8S 1LQTA 4D7AA 1PG2A 3IJRA 2BP7A 1WF3A 4BAUA 2BTQB 4CTJA 2ZUFA 1O58A 1NDHA 2PG3A 4EYKA 1T13A 5JT1A 3TKLA 5JARA 3H19A 1XMQB 3DDSA 1P1KA 1C1DB 4L6AA 4W6ZA 1SIWA 2OCBA 4M1ZA 3F6YA 4AXXA 3W34A 1U11A 5ABPA 4KQFA 3TD6A 4JLAA 3V1LA 4R0MA 2H0AA 2YRXA 3OOEA 2V4MA 3BC1A 1RXWA 1D2GA 1Q1ZA 1WPXA 1YE8A 2QM3A 4I1OA 3RS0A 3G82C 1PAUA 1SKAA 2QGZA 3KPVA 2PJDA 1D1SA 4WUTA 4KXXA 5EN4A 2VA8A 4BNDA 4RTLA 4LDNA 4MGZR 1FUEA 3CB2A 1XYYA 2XWBF 3QBEA 1RXCA 2B82A 4GNRA 3VO2A 1L5FA 4RW0A 4DMUB 1KI7A 3E61A 5ITZB 3DP7A 4X1YB 2IV2X 2DAPA 1JIXA 1Q0LA 2J4CA 1EGVB 1FUIA 4UFNA 5CLJA 1ZDMA 4IGKA 5L95A 2C97A 4FINA 4RL6A 1RVDA 5TT0A 2FPPB 3BXZA 5ICGA 2I4NA 2FSVA 1W5FA 3ABSB 3P0HA 1MT0A 4KRGA 2VDKB 4J4BA 4Q9DA 4WXPA 1NYLA 2ERYA 4MYCA 4YRRA 3SQWA 4IOMA 3EHEA 1BAPA 1QRAA 4JQZA 1FEZA 5A5GA 4ZEWA 5M5BA 4NYIR 3RJZA 1NUPA 4NXNB 4N7RA 1K92A 3K5HA 2XZLA 1P6XA 1V47A 4PYJA 1EXNA 1R66A 2OLEA 4TVKA 2BMVA 5BR7A 1MCZA 3I9OA 2IDKA 4US2R 2XVZA 3RHZA 3NW9A 4FYIA 4YCMA 1TA0A 1BHQ1 5A4DA 3BGSA 5K4GA 4IQ0A 2YWEA 5DM70 1JPJA 2VNJA 1NW4A 1BX0A 2H1CA 3EB9A 2WUVA 1CIVA 3GH1A 4MP3A 4WKNA 1FS4A 5B55A 1GA4A 2IZ7A 4GXTA 5DO9A 2R4QA 2C0QA 4GNKA 2NU9B 1NTOA 4JGBA 2FMFA 4UQOA 4RZIA 4G36A 1HYGA 2C57A 4FFVA 3T7JA 3B51X 1F2UB 3S99A 4F96A 1D3AA 5BWLA 3ABQB 1WABA 1QS0B 1FYEA 1PG0A 2ZIAA 1T2AA 3U4AA 1GPJA 4OXXA 4DLRA 4EO7A 5EIWA 5COQA 3QLVA 4XZ3A 2H3HA 2EKLA 4IQ4A 2OSVA 2I65A 2QDXA 4Z4EA 4YR7A 2VF2A 1WY5A 2X3UA 3L8EA 3O2SB 3VC3A 4CDRA 4IP0A 5LLSA 3FNIA 2VPWA 4K7JA 2O4UX 4XX0B 2VZEA 3ZU5A 3LV8A 4COKA 2XYGA 1G4UR 1JEQA 3AF2A 3PIIA 5D85A 3GN2A 3ZXXA 5CDFE 3FKSD 4ZO8A 5BOSA 3VZRA 1XNRB 2VSYA 1V71A 5JZSA 3ZDBA 1TF2A 1NF9A 1O96A 4ARZB 1KJWA 5IVIA 3B6MA 3ACDA 4CI9A 1SXQA 5JC8A 3QY9A 3B82A 4L5CA 3NIWA 5LQMA 1U8YA 1ZNXA 2O7QA 3EAGA 4WK0B 3MB5A 3C4JA 1H1DA 3AC0A 5BXQC 2MHCA 2C1XA 3E9RA 1N9KA 3GJXC 3PTZA 1U8CB 4U5XA 3KLPX 3TQFA 4B7UA 2JHPA 3IV7A 3QKSB 1CTQA 1N2EA 4CLXA 1AHIA 4ROTA 2PT6A 5C3UA 1JKFA 1T91A 3QU9A 4R2KA 5K4AA 3RD5A 5JIBA 1LNQA 1SBIA 1YVRA 2O3JA 3GT3A 3K72B 2PS1A 1H8HD 4V38A 1CLEA 1SWVA 4HRYA 2AFRA 5LMNB 1J39A 1DADA 2GTPA 4HTAA 4DB2A 2O8EB 1NVKA 1OBCA 1XYVA 2HDNB 4DR1B 1KH3A 1ORIA 4IV8A 3ZTWA 4PLWA 1YB7A 3WA7A 1M7BA 2CHVA 4NJMA 5JUWA 4BCCA 3EOBI 5CJ2A 2UVQA 1L8LA 3HR8A 2VDQB 4PBSA 3FCEA 4X90A 4XJVA 4OL9A 4HG2A 3ZU4A 3G13A 5I4BA 3K0CC 1QK4A 3O90A 3QVLA 2FWIA 3QZUA 1P0IA 1CT9A 3I2HA 4YHBA 3HVUA 2IIPA 3BHIA 2QG4A 1DIRA 1UZLA 5CXSA 5IUNC 3I2GA 2OK7A 1LK7A 2VYVD 1LCIA 4ENWA 4I5GA 3GBVA 5I5GA 4E22A 4GP7A 3H5VA 1T0IA 1KJ8A 1KMQA 1LKZA 2QPOA 3NM6B 4TWRA 4ND5A 3AESB 1ZRSA 4FGSA 4QPZA 1NMYA 1SIOA 1E4EA 1QHIA 1V8ZA 1QUEA 4QGFA 4RCVA 5T3UA 5C5CA 3SS8A 3HPQA 2O57A 2P2YA 1GU0A 5CVTA 4JX9A 3KPJA 2AF4C 1OWNA 2J3QA 1J9EA 1X1TA 3JQQA 5B3AA 4F4CA 4G89A 1WR8A 1A3CA 4H1UA 2HBZA 3TW4A 1Z56C 1IHOA 3DFKA 4Q12A 4B7XA 2NX2A 3AUKA 2HHJA 5A6SB 4B81A 4ZPJA 4HYQA 4IYRA 1JN0A 4I08A 1QYDA 1BJKA 2YWJA 3AIKA 4BVAA 1NQOA 4PSVA 5ICCA 3JYOA 4BS9A 3I2IA 2BEVA 3DUFB 3CE9A 1DRVA 4HNAA 3ZE2B 4GU5A 4AJOA 1KKLA 5TB5A 1NJ8A 1WSWA 3TSWA 5KWVA 2JGNA 2QKYA 3E9EA 5E4JA 1LTQA 1S96A 2YIVX 5GJWC 2A5YB 4CIWA 4UM9D 2W6NA 3T9BA 5F7OA 4QVIA 2H4WA 1V4NA 3MXOA 3IMKA 1N7GA 4GDFA 2BHTA 4ZV4A 2HA2A 1P74A 4OYYA 2G5TA 2SCUA 3M9XA 4NIMA 3FHJA 5J5CA 1NFRA 3NG1A 3GJTA 4KRYA 2ZDGA 4P86A 3RANA 3G2JA 5F3WB 2IV7A 3E18A 4ZQBA 2JGRA 5IKOA 1VLVA 1L5OA 3RGWS 5HILA 4IJ5A 3SHQA 4NPHA 5GONB 3ZD9A 1U28C 3EA4A 4HWOA 2GDJA 3GGDA 1TO6A 4IDOA 2OFPA 1AN9A 2PGAA 5EP2A 2FW6A 5EZ5A 4Y1FA 4WOPA 3U4HA 4AKHA 4ESVA 1IY2A 2X7JA 1BH2A 1LI7A 2JD2A 4TQ9A 4G24A 3IE0A 3QTLA 3KEOA 2H7VA 4FFNA 2E89A 3NHWA 4H0NA 3BFXA 1KE1A 4JVSB 1K5DA 3CJRA 2IHJA 2IYWA 2X40A 4HI0E 3ZY5A 4EMBA 1A5AB 1VLLA 1B4DA 2TMKA 3OM1A 4ZTZB 2ZI9A 4EPXA 1SBNE 4BN0A 2PANA 3QE0A 4D42A 2RI1A 1I5EA 4GL2A 4LHYA 4A0FA 3EZFA 1F2DA 5K51A 1EJ6A 2BBWA 3ZWBA 5JH7B 5DI3B 1A9RA 4JA2A 4QQ8A 1CU1A 1N5JA 1WW8A 4ZOLA 5FTLA 3ZCQA 3D2BA 3BMCB 4D8TA 5IVKA 1E0AA 5FOTA 3THSA 1A4IA 2LDXA 3VUEA 3U6BA 3QU4A 4NCKA 4ZPXA 1A5SB 2PH3A 5TARA 3S1LA 5CBPB 5I7HA 3F1KA 4URZR 1REQB 1PFKA 2IXDA 2IW3A 2ZE8A 2R00C 5ALQA 5JAPA 3I3OA 1H05A 1E5VA 1JFFB 3KWFA 1M75A 4TV9B 4MKIA 5FOUA 5IP5A 2ZJOA 1TVEA 2JKYA 2Z58A 1FU8A 4ZC1A 4UUOA 1MHTA 2PX5A 3G8AA 1VLJA 2Z9DA 4XVRA 4CM9D 4HY3A 9ATCA 2OFFA 5SY9A 3FWNA 1KEUA 4FFBB 1E4YA 3COYA 3GG9A 3IGFA 1YB6A 2P7HA 4MQFB 4KXQA 1V3VA 1O0SA 5I7EA 1XZNA 3LUJA 4PHCA 3W3AD 4FEEA 1EFPA 1L5MA 3H3JA 2B1JA 4GOLD 1M8FA 3IXMA 3MWDA 1YIAA 1ZMXA 3MWYW 3H87A 2YFKA 4A10A 1QM5A 2IPXA 2DXIA 1V35A 2AG1A 2ZAIA 3AO0B 3DXZA 1AHPA 1F6BA 2WFZA 3CZCA 4GR4A 4KKVA 5AKYA 4DMCA 1FUKA 3M82A 3RVBA 2Q5LA 4TS3A 4ASUD 4K6HA 2HT1A 4DWJA 1ZN7A 1T9CA 2AHOA 3OF2A 1IJEA 3L1IA 3PXAA 521PA 3E58A 2EF0A 4AY4A 4EZBA 3HZOA 3AU8A 4FUTA 2Z2JA 1V26A 1Q7RA 4O4IA 1GO2A 3DQPA 3KXKA 1P0MA 4J1QA 3D5QA 4UNQA 1NJSA 1QAOA 1U02A 1J1IA 2ORYA 1A76A 3G2LA 2BR5A 2NT4A 4P93A 1X1CA 5H9VA 5FDFA 1X8JA 1ZGZA 4DHEA 1ZOLA 4J2HA 3Q8WA 1FSFA 1RXUA 4AQ7A 4XQCA 1P2UA 2CUNA 3IOCA 4Z2YA 2R4UA 3TNYA 4KPEC 1QF7A 1AK9A 2WFLA 1QG0A 3R40A 5MGNA 2XE6A 2QBYB 3BD7A 3FE2A 1D07A 5AM3A 4MVJG 1P7WA 2PKXA 1QE5A 4GOXA 5M34A 1Z83A 3LYAA 3H65A 1P73A 4GI3A 3BWMA 3G2OA 2IYNA 1U8AA 1B0AA 5ALMA 3VTFA 4KPUB 1KEVA 1TM4E 1EWRA 3DHYA 4J9VA 1YJ5A 4NRDA 4XSVA 2VI5A 3T1OA 5LD2C 5EEHA 4F86A 2D62A 5AUNB 2X2FA 2HFJA 2G1KA 2AI1A 3PC7A 4GW3A 4GUDA 2VPYA 4FYXA 5FL7D 1QFSA 4JR1A 2Y0EA 5B7NA 2RI6A 5G2OA 3RTCA 4YREA 4FEAA 5B1SA 3U26A 4ZZ3A 1RVV1 3OIWA 3E5NA 1PSDA 2XRFA 4P7JA 3UUFA 2P4UA 1XQYA 1W1WA 1X1DA 4C78A 5FIUA 1D6MA 4RPCA 1TJNA 1GN8A 1RI3A 1RQXA 2APJA 2PH5A 4GO1A 2FJ0A 1V6CA 4ISBA 4R8KA 4DWWA 1M0EA 5JRZA 3C6MA 3OQJA 4GAEA 1YDWA 4LV8B 5TSDA 2QE7D 3F4KA 4XR9A 1G5PA 1J90A 2JJYA 4HVAA 4J76A 1UK9A 3ZDAA 1U0TA 1KNQA 1BU5A 5H02A 2I2CA 1ZLXA 1QHHA 4LJLA 2P0AA 1KK2A 2PKCA 3BEOA 2XNDD 3NV7A 3C74A 2FXIA 1L8AA 1UINA 2JAXA 3OZUA 4RIEA 3AL0C 3FI0A 5TXGA 2IVZA 1UQUA 1D5WA 1WKVA 4PO3X 1KH2A 1MEJA 1T8UA 1FRNA 1O3YA 2OP1A 1WNFA 3IAAA 4RCYA 3VUFA 5IZCA 1GGVA 3W6UA 1QNFA 2IU4A 3PG5A 4YP7A 1FVXA 4ARVA 4PFQA 3C41J 3OVMA 4XGNA 4WFJA 1JNYA 4Y9SA 4GLOA 1T25A 2Z4TA 3OZFA 5E9JA 2IE0A 5SZIA 1XQ1A 3RUCA 3T94A 4XRGA 3H9EO 5JSQA 3NGMA 3TTXA 2H1VA 4LHSA 2NLOA 2XTAA 2ADMA 3E7FA 1ISRA 3HDHA 4TV8B 3SQMA 2QE7A 2P2SA 3VHRA 3OE1A 2XT0A 3AL3A 3U1TA 4KX3A 4DMGA 4FFLA 4K6OA 1DRKA 4YPFA 4TLAA 3RT7A 1QFMA 3MWFA 4Z99A 3AUXA 1A8SA 2MWMA 2XF2A 4OM7A 3MINA 1Z5OA 1SHUX 2N9UA 5AJTA 5FEMA 4FGJA 5CG1A 1I3NA 2OCAA 4O3MA 2Q29A 3K0FB 3KR1A 4B4VA 1OGJA 2DKNA 2OA0A 4A5SA 1E2LA 3UUWA 1YR7A 1U2TA 3OFND 1ESDA 1OX6A 2N1MA 3A9TA 4PZ9A 1CLUA 5EJ6A 2CCKA 2BFMA 1GL7A 2B4AA 2G4CA 3IQGX 5K3DA 3KD3A 1JSXA 2BLNA 4MQMA 5ALGA 1LPMA 1CY0A 1Z0UA 4F84A 1W49A 1NLYA 3NVAA 4IIBA 4ND8B 4R16A 1FFYA 1VKZA 2WJYA 1Y9AA 4OCZA 3P8ZA 5AKJA 4DG9A 5L9AA 3EE6A 3AB3A 1VKRA 4MUYA 4RFVA 5DTJA 4H15A 4G0XA 2ACKA 1X19A 3ZCVA 4W7HA 1FFBA 5KX5F 2CL6X 2QIOA 3UK6A 1QYRA 2R66A 4DIMA 1WXEA 1CR2A 3R4VA 1X7XA 3IB6A 5A3SA 4HUQB 5EJEA 4PE5B 4WXMA 3ZGZA 2G36A 2Q1WA 4B3IA 2B5WA 3HKBB 3SXUA 2I2BA 3MGCA 4XFDA 1JFSA 2XXJA 1OZFA 2JC3A 2QSZA 1SCQA 3C3MA 1EE1A 4N49A 2PRIA 1ABBA 1YR6A 4ITVA 1ZQ1A 1JR4A 4TLBA 2WAMA 3CYFA 1IG3A 3OT5A 4Q0MA 4AIIA 1L7NA 3EISA 1L5RA 3HVKA 1ZIXA 1TVKA 5EKDA 4BY9E 4TS1A 1B1AA 4H59A 3IR7A 2HLPA 2QQGA 5EHIA 3Q1LA 1AO0A 2B1QA 3CNQS 2VTVA 3PKIA 4I55A 4G5QA 2C54A 4BJHB 4IIHA 1F60A 3PC3A 4IV0A 5F2NA 4AZVA 3FCCA 5HOEA 4IEFB 4O4LB 1E1DA 1M8PA 3AQIA 1S3IA 4E46A 3HKDB 4JOSA 4N82A 2VP9A 4JSTA 4ZOEA 1MKYA 2Y4OA 3DEJA 2OCYC 1JHAA 2E7ZA 3A05A 3KJHA 2AJDA 1WBBA 2UDPA 2UZ1B 3T3NA 1B42A 1KXZA 3NETA 5JNVA 2Z2KA 3I34X 2CN1A 4Z1OA 2ZUTA 4YRZA 2NXNA 1MW8X 3MHTA 1JB9A 4QYMA 4R51A 3RSFA 4CU5A 3M6UA 4CCAA 4QOGA 5D3MA 5E3HA 1FJGB 4KDFA 1AUOA 3GT7A 4CN8A 4JUCA 4GMGA 2VA9A 4NEQA 4TLDA 2KW5A 1G60A 4UM5A 2C7OA 3CEAA 3ICQB 4LRSB 2Y92A 1JZQA 2G3YA 3AYXB 3K31A 4C20A 2FFAA 5FH9A 5JJCA 5JPCA 5KPJA 1H6DA 1K7CA 1TCAA 4CL0A 4XARA 2PRKA 1O54A 4CV3A 4N7MA 3N8GA 1ZOPA 1JWBB 3COWA 3CWCA 3NOQA 1I4TD 3LM8A 3B20A 3MJ4A 3Q15C 4PC2A 4RVHA 5HBGA 3I9LA 4KLAA 2NP7A 2ZR8A 2HGZA 4GXRA 3G8BA 3PU6A 3ZLBA 1DG9A 2R8YA 1WQ4A 1KH1A 2V7QD 3UV3A 4V0RA 2XUIA 3L8FA 2CLHB 2ZYDA 3PUWA 3R5FA 3AM4A 5DU2A 5G3ZA 4CQMA 2H7YA 4Y3UA 1XQVA 6GPBA 2WZCA 1EQ2A 1R4NB 3D6HA 3LCRA 4TXHA 3KLMX 3OICA 4HNUA 4CG1A 5CG2A 1PL7A 1U0NA 1YFKA 2O2EA 3ZXUB 5B30A 4OA5A 1G98A 4NX2A 3QITA 3HU1A 4E88A 1CUXA 3VPSA 5TPWB 1FMFA 4C88A 2WWFA 1ZD1A 1Z5UA 3GARA 2PKEA 4BRWA 2J46A 4X1IB 3UCFA 3WOVA 1U5CA 2B2CA 3FVRA 4QAJA 2NOAA 3IOMA 2ZCVA 3D7LA 3LVFO 3QG5A 4LTDA 4MR8A 4BNJA 3TAXA 3UV7A 5IZ4A 4P34A 1ENOA 1N2HA 3DZFA 1H85A 1UFVA 2J9XB 2RGUA 3LDGA 1LPOA 4IXNA 2I34A 4KMRA 1N9ZA 5K2MA 3BE4A 3IERA 4GE3A 1NQ5A 3CNBA 5K0BA 3CRZA 4P4GA 3WTBA 3DDOA 2XBMA 1WXGA 3CUYA 1DXYA 1BCSA 3E9CA 1CD5A 3Q2OA 2JFHA 4KBYA 5B12A 4MRSA 5LZ9A 3I9V6 3HO8A 2GXSA 2XMCA 3EW9A 3BB1A 3T9DA 3WYDA 1R0LA 2C2WA 1Y6ZA 4KK3A 3TLYA 3ZUPA 3LY7A 2W98A 3ZHTA 3NHYA 1M1YB 4DZZA 3NFYA 3VZDA 3BK2A 3FTDA 4HGNA 5AI4A 3TLMA 3U7IA 2A5JA 3UJ6A 3G9TA 3WQQA 1KKMA 3GJ5A 4HDMB 4DIEA 2BKUA 2YINC 3DA8A 4DLYA 4J7CA 2QTNA 2J3KA 3ESCA 2W6JD 4JT9A 4UQPA 4REQA 3R7LA 5AVRA 3SX0A 1AKUA 3UNXA 2W93A 4HDKA 4CKEB 1SCJA 3AEUA 2C7QA 4ZO9A 2A6PA 2ISQA 3DM5A 3O8NA 4CIYA 3U80A 3KFXA 4LRTB 4TPKA 1J21A 3IE2A 4QKQA 3UG6A 1XL0A 3CT6A 4CTMA 2FPMA 4YUZA 3V8NA 2HK8A 1W85B 1QP4A 4XDHA 2HMWA 3MJTA 5AW1A 4E51A 1BE8A 2NZJA 2Y2UA 1E3IA 2P6OA 4X61A 2J7PA 4W8GA 3I9KA 4CCYB 3NU1A 2GA9A 2G9UA 3QHPA 2BFNA 4B43A 4C2TA 2G88A 4I1SA 4PG4A 1AO3A 2E6UX 1P7PA 1SHLA 1Y6RA 1EDEA 2NSHA 3DAGA 1JQEA 2I2WA 1E5XA 2OQRA 2UAGA 2VDPB 5AJXA 4MQLA 3RRYA 1HGXA 1Y8QA 3K5PA 2V97A 1IAQA 1ZWLA 1ANKA 1IE3A 2GBLA 3QLUC 4WN9A 4UOEA 3BOSA 3K2QA 2OZKA 4QLOA 2GX6A 2ZWIA 5G02A 1OR8A 1SC9A 3LCUA 1XFAA 3CX7A 4J2TA 3UAYA 4WADA 3TLJA 3BQMB 5JCPA 3CZ9A 2BZ1A 4QFCA 5BSGA 3CUWA 3HYRA 4EX7A 1Q16A 2GCIA 3ZWQA 4O2BB 3K70C 2JJQA 1I14A 4K6KA 3BIFA 2DR2A 1NNEA 2FWAA 1EZZA 4BLUA 3A0RB 4PG6A 2VDRB 2ZJ3A 2Q07A 1JR3A 1G6OA 1WUYA 3HGTA 3L93A 3OOSA 4WASA 5FWXB 4MWBA 4BU1A 4ZCLA 2PH7A 3T61A 4EHFA 1BX1A 1U0SY 4FR5A 4ESOA 5BV7A 1R4ZA 1II9A 4B71A 3VR2D 3T4EA 4MTCA 4A0HA 1KETA 1DZ3A 2EJWA 5FTWA 4CF6A 2CBZA 5LSAA 2Z6UA 3JD2A 1XLUA 1IMOA 3I52A 3OLXA 1LI4A 3F5SA 4G1MB 3TO5A 3ILXA 3K4QA 1ECCA 4JBXA 4BJ5A 2GD6A 3WAJA 1NMZA 4HMPA 3AJ8A 1P17A 1T6BY 1QPBA 3A7EA 3CSUA 3DT8A 2X22A 1EU1A 1H22A 4KG7A 4YV7A 4C43A 3R7WA 4NOJA 4DMRA 3RT1A 1SVWA 2DGDA 3D3EA 4IWNA 3O8DA 4ON9A 1PJ4A 3U3ZA 3ZIAA 5C51B 4RMIA 2ZYHA 5BQ5A 3FHTA 3KU1A 1X1SA 3KQVA 2P65A 5AVJA 4B3DA 4A2PA 1VLMA 3TZLA 1N5IA 2V0NA 2YXNA 5KNDD 1QXSA 1YCDA 2JIPA 2MMGA 4ZZ2A 1YRQA 4WVFA 4A6XA 1GQOA 3GVIA 5LQAA 1U3GA 1G8YA 4XYLA 1OKKA 1PS9A 1KSGA 5EWMA 4WA8A 1S6YA 4EY3A 3INYA 5JRJA 3ZH9B 2ONZA 1JS1X 5KCMA 3C3KA 3GRKA 4INPA 1VJTA 3VO9A 1PI3A 2GEVA 3C8DA 3IUMA 3ZU6A 3BCHA 3MT9A 1IJFA 1HFJA 2X6TA 3SS7X 2QLMA 5FA5A 4GMKA 3A1WA 3U44A 4OHOA 3IJPA 2WIKA 3EBLA 3RIEA 1X77A 1S8OA 2I3BA 4G8BA 4GMHA 4F3NA 2JJ8A 4MIOA 1EDBA 4NK5A 1GZDA 3KCNA 4KQXA 1B1CA 1KGSA 3KVOA 2ZRLA 1F7VA 5KX5A 4A0GA 2Q3CA 1YCHA 3I4CA 1YL6A 1P0PA 3F67A 4NAUA 4UTOA 5AK0A 1Z12A 3AI1A 1H9CA 3EXFB 2X0RA 2UV8A 3EXG1 3IQHX 5KHLB 4G4SP 3AM1A 1X1AA 3WRYC 2AEJA 5IFLA 1AG9A 1VHTA 1PSWA 1GLGA 3DBRA 3IE1A 4FZJA 4YRQA 1QQBA 1XTIA 4JCCA 4B47A 3RDPA 5JDIA 4UHJA 4J4TA 1IRXA 4WOCA 1CJSA 1FUYB 4D8XA 1UMDA 2GK4A 1UXKA 3DEYX 2BGRA 1NNSA 3LBNA 1TC1A 3M81A 2F4VB 4ALNA 4G5RA 2HRCA 1UBHS 4V0ME 5KYYB 5HE8A 3EWAA 3ROQA 5BV8A 3GLFE 3TX2A 3TVDA 1FSSA 2F3PA 4HFJA 3ZVLA 4HX5A 1F0KA 3PF8A 3T5MA 2NUTA 3GMTA 2HCBA 3SKVA 3IKTA 2B2XA 3CZPA 3QUBA 4WY5A 2RK3A 1XEWY 3D6JA 2YYYA 1M6EX 4OI4A 2VPZA 4EI8A 2C00A 2ZVJA 1WM1A 1EUDB 1W581 1RRVA 2ZVPX 4DUYB 2G1PA 1IG0A 3EAFA 3MUOA 2YXPX 2HV8A 4DRYA 4B40A 1L1QA 2FPKA 3M6AA 2O8FA 4E21A 1KI8A 3E8MA 2VS1A 2BMDA 4HEJA 4JMPA 3D8TA 4ND7A 3SPXA 5C52B 1YDMA 3JTEA 4GI2A 1VSBA 1XX6A 2Q6IA 4Y30A 4IUCS 3RYFB 4LZJA 1CIJA 3EC1A 2HHHB 5B1DA 4ZAWA 2FEWB 4PIMA 4H4EA 1GFSA 2DR0A 3WWOA 2ODTX 3NV9A 4MYSA 3GO4A 4MVJI 4UXHA 3RYIA 2CUTA 5IX8A 1G66A 3OLYA 2DPLA 4DY6A 1ZVQA 2KB0A 1AM4D 2D1YA 2NGRA 5DVZA 1U7ZA 3KAKA 1YQDA 3SZMA 3QUCA 2IHNA 1ZSVA 1X8LA 2VDWA 1KQ3A 4Q37A 5LDGA 3RYFA 1INLA 2I4OA 2VT2A 3SF8B 3UJAA 4DCCA 4ED9A 5KKNB 1JWLA 4AUKA 3KTFA 2AN9A 4TXLA 2XAAA 2HKIA 3NUQA 1DWPA 4N8SA 4JK3A 3ESYA 4REOA 1FQWA 4I81A 2D2EA 4PPQA 4R7ZA 4DIDA 4TQGA 3KR9A 3O6VA 1YRBA 2JIQA 1NI5A 3OLWA 3ZDRA 2XXBA 3TLBA 5G41A 1NVFA 4D9KA 4F4HA 2A5LA 5K0JA 4LFCB 1SIBE 1NBIA 1OLUB 2C61A 5HQ3B 2QZ9A 1VOTA 1IUPA 4LZZA 4B7CA 4B6JA 1WSBA 3KZ1E 4NMMA 3UTCA 1K86A 1YS9A 5J47A 2R11A 2QRVB 3OTOB 4ZU3A 4CNBA 3RFTA 1KY3A 1ZZGA 1H93A 3OTHA 2ASVA 3LPDA 3RG8A 4N3GA 4KIGA 2GEFA 2VWPA 1OJLA 3BWXA 1UFRA 1HDYA 1RWMA 2X76A 1JH8A 2ZK7A 1ZVKA 4AECA 3ADCA 1SBHA 1UDXA 3OJ0A 4GGMX 4GKAA 4LY0A 1L4YA 1OI3A 1R15A 1LLFA 2QW8A 3IULA 4OXNA 5DP2A 5T4HA 3UKDA 1KZ6A 1C7JA 3ZBTA 1TKRA 5IPFA 1CEXA 1DIHA 3ZXSA 2CNDA 2V8OA 1B6GA 2YV2A 4ZU1X 1EX7A 2XT6A 3OQMA 3NAMA 2X19A 2WD7A 3JWIA 4XYMA 1XZHA 2A78A 3HA5A 5CVVA 4A2QA 5KX5B 4DL9A 4CLOB 2B6NA 5LM3A 1KSFX 2EKZA 3EF0A 3MEQA 4JJGA 4QYWA 2N42A 2O8VA 4GPEA 4H7JA 1VSTA 4MCJA 1ZVMA 3WSTA 3V2UA 4LYFA 4WNYA 2JJMA 4TL9A 1BXGA 1YS2X 5FBRB 3UFBA 3OPMA 4Q4DA 1V1JA 2A1UB 2Q6KA 4F3KA 3U44B 3C6QA 3K9CA 3F46A 1FOEB 1X92A