5EVJA

X-ray crystal structure of crarsm, an arsenic (iii) s-adenosylmethionine methyltransferase from chlamydomonas reinhardtii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
APPPAVRAALADVPTEVKEKFWGCGNPIPAGIEGLRVLDLGAGSGRDAYVAAKLVGEKGSVTGVDMTPAQLEVAISHADAYARDKLGYGKSNMTFIQGEIEYLDRAGLEDSSFDLVISNCVINLSPDKARVLSEAYRVLAPGGEMHFSDVYVDRRLPQSVRSHPVLLGECLAGALYNNDFIRLARKVGFTDPRQLEAEEIQIHDAELRDQVGEARFYSITYRLFKVPGQIEDLAEDYGQVAVYKGTIPGHSHAYDLDDHHRFVTNKPMLVAGNTASMVGESYLAPHFTIIGDRAVHYGQFDASGPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Arsenite methyltransferase
publication title Crystal structure of CrArsM, an arsenic (III) S-adenosylmethionine methyltransferase from Chlamydomonas reinhardtii
rcsb
source organism Chlamydomonas reinhardtii
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5evjA01
3G8BA 4CTJA 2I9KA 5FADA 2BR3A 1R6AA 3P9KA 3EEYA 5DTMA 2IH5A 4LECA 4PIMA 2PKWA 5EEHA 3SX0A 3UWPA 2FRXA 2KW5A 2PX4A 2ZLBA 3I58A 4M7RA 4P7JA 1NBHA 5EVJA 1EG2A 2PLWA 1JSZA 1XCLA 5FWDA 3DXZA 3CJTA 4BP1A 2PVCA 1I1NA 3G2OA 4YMHA 3C3YA 3PT9A 3FTFA 1N7IA 2P40A 5HZMA 1QYRA 2GAFA 3FPHA 3PX3A 3G2MA 3QOXA 5E1OA 3UA4A 3P71T 2C7OA 2QE6A 1NV9A 2NXCA 5E1BA 3BZBA 1R8XA 2K4MA 3KR9A 3FPGA 3FYDA 3CJRA 3HVJA 4FT2A 4DCMA 1NW3A 4BLUA 3KQQA 3DULA 5E8RA 3FPJA 5ICEA 1O9HA 2B78A 3EVFA 1XDSA 1N2XA 2PXCA 3HVHA 1M0EA 3G5LA 4FGZA 4E33A 4EKGA 4XUDA 2AZTA 3PX2A 5KQSA 2C7PA 3NVMB 2R3SA 3GJYA 2H00A 3OE4A 3DUWA 1ORIA 3BKWA 3ANXA 3P8ZA 1JG3A 2JHCA 1G55A 3THSA 4CKCA 3EVBA 4RTLA 5BW4A 3MTIA 4G56A 4E30A 2B2CA 5HIJA 1L3CA 3WSTA 3T7RA 3DMFA 3DMGA 4OBWA 2P3QA 3GU3A 1VL5A 2GH1A 4P7KA 4PYOA 1QAQA 5DLYA 5EKXA 4RTSA 2C7RA 2PWYA 2ONZA 5FA5A 8MHTA 5DRYA 3RW9A 2H11A 2Q41A 5BP7A 3P97A 2DULA 3P9IA 4YV1A 4YUXA 5LR6A 5GIPE 4KRGA 5EQJB 5K8VA 3P9CA 1NW7A 3R9XB 4H0NA 2PX8A 1EIZA 1EJ6A 4X63A 1X1BA 3AJDA 3AXSA 5CUQA 4AZVA 4HSGA 1AV6A 5FWAA 5C0OE 4HTFA 4XCXA 1RJGA 4EVIA 5CD1A 3NJRA 2ZZNA 3HA7A 2GPYA 5EC8A 3KU1A 4QQKA 2PX5A 3KR2A 3L8DA 4GF5A 5T67A 2O57A 3SSNA 4AZWA 4DCGA 5MHTA 2CWWA 2XBMA 3MERA 4KWCA 3EVEA 2BR4A 2YXLA 1R74A 3LKZA 3UA3A 1AF7A 4YUWA 4RTJA 2IFTA 4P7FA 5LQCA 3ER8A 4ER5A 4FSXA 4PGGA 3TLJA 3KR0A 1DUSA 5EG5A 1G38A 2P8JA 7MHTA 1RJDA 1WXWA 4PYQA 3R3HA 3FRIA 4KDRA 4CKEA 2IGTA 2AR0A 3KPYA 5FA8A 4WXHA 2AOUA 2O05A 3G88A 4PYIA 4XUEA 3G2QA 3M6XA 4FT4A 3LCVB 1I4WA 1XTPA 3GWZA 3I5UA 3CC8A 5DM1A 4A6DA 2F8LA 3E05A 1D2GA 1PRYA 3BWBA 4U7TB 2HR1A 2ZBRA 4M37A 1P1CA 2FK7A 3AY0A 3KQMA 5FULA 1D2CA 3K6RA 4Y2HA 3T7TA 5E1DA 1XJ5A 2LD4A 5CVVA 5FUBA 5K0JA 4RTKA 1B42A 4PYNA 1INLA 5HIIA 3OFJA 4C05A 3HM2A 4E2ZA 2BM9A 4RWZA 1R00A 1Y8CA 3MAGA 2PX2A 4EKIA 2IBTA 5KVAA 2GS9A 3BGVA 3DOUA 3KQYA 3GDHA 2CMHA 4PGHA 2AVDA 2AN5A 3EVDA 2ZIGA 1XVAA 3EPPA 3I9FA 3A26A 1KP9A 3HA5A 1D2HA 3OZRA 2JH8A 3TFWA 1KPIA 3NWBA 3EGVA 5K0LA 4GOND 3E8SA 1JTEA 4QVGA 5D1HA 5E9JA 2PT9A 5ERGB 5DX8A 5EEGA 3ORHA 2YX1A 1KPGA 3UJ9A 3HP7A 1SKMA 1NKVA 4R8RA 4R6WA 3PFGA 5DM4A 2OO3A 3P2KA 2QRVB 1U2ZA 1G6Q1 2YXDA 3HA3A 4K6MA 2OXTA 4MWZA 5EMMA 2IP2A 2I7CA 4AZTA 3GCZA 5U4XA 1AQJA 4L7VA 2P3OA 2R6ZA 4GUAA 2H1RA 5EOVA 2AS0A 3C0KA 3ELDA 3M6UA 4P7GA 5P8WA 5EIFA 2GA9A 5GP1A 5IKMA 4QPNA 3NVKI 2NXNA 2ONYA 3OPNA 4HGYA 5FHQA 1H1DA 1N7JA 3GGDA 5G02A 4GOOD 4AZSA 2ERCA 2ESRA 2P7IA 2N47A 4F86A 1YFJA 3KQVA 3VSEA 2PV0A 3H2BA 3EVZA 1PJZA 4PYJA 3FRHA 3MCZA 4PWYA 4U7PB 1NW6A 4GOLD 2IPXA 4OBXA 3ELWA 5GOZA 5CCXA 2Y1WA 1WS6A 4FR0A 5CM2Z 5EHGA 4HH4A 5CVEA 3LDUA 4OQDA 4QPPA 2PT6A 5DTQA 1YB2A 2PGXA 2UZ4A 3V97A 1UWVA 1KIAA 3U81A 2VDUE 1P39A 3A27A 2HWKA 2VP3A 4M36A 2IH2A 3PLAE 4FS8A 2B3TA 2NXEA 3KR1A 3LHDA 5T64A 1G60A 2IH4A 1XXLA 5EHIA 3O4FA 1ZGJA 2WK1A 3X0DA 3SR4A 2ZBQA 3RODA 1RI4A 4IKPA 2G72A 4KW7A 3DTNA 2JJQA 2PSSA 5FHRA 1JQEA 1X1DA 4YUZA 1DCTA 2QY6A 3UZUA 1WZNA 3BWYA 5EKUA 2ZULA 3IV6A 4EQZA 4WVLA 2EFJA 1R18A 1RI1A 3KPUA 5E8JA 3O31A 4F85A 3HEMA 5EZQA 1F3LA 3FUWA 4AUKA 4CXMA 3CVOA 4BLVA 2OB2A 1P1BA 1DL5A 3BGDA 5LQAA 1RI3A 5ICFA 2CMGA 3TOSA 4GEKA 1QAMA 3BUSA 4KIGA 2GB4A 3KKZA 1KPHA 4O29A 3B5IA 1RJFA 3Q87B 1JG4A 1VLMA 2HTEA 4OA8A 2OZVA 3EMDA 4JXJA 4PYLA 3S68A 4RTNA 1ZQ9A 3LGAA 3OU6A 3A7EA 1YF3A 1IM8A 1AQIA 1KYWA 3B3FA 3DXXA 4V0RA 3VYWA 5K01A 4ER6A 1BC5A 4FZVA 3D2LA 3TRKA 5M5BA 4QVKA 3FPFA 3OE5A 2YXEA 3SVZA 1JR4A 3THRA 5JUWA 3KQPA 2ADMA 5DXAA 2YR0A 4KVZA 2QRVA 3C3PA 5CVJA 4DKJA 1WY7A 2EG5A 2OY0A 4X41A 5K0FA 4IV8A 3FUTA 1JTFA 1WXXA 5BXYA 4R6XA 3UJCA 4F84A 4HG2A 3LCUA 3K0BA 4LWPA 1XCJA 1SQFA 1JQ3A 1M6EX 2V7EA 3O7WA 4CTKA 5CCBA 3FTEA 3CKKA 4PINA 4BLWA 4B17A 3BWCA 3LECA 3PTAA 4E31A 2P41A 4E2WA 5E9QA 2OKCA 2G71A 3LSTA 1ORHA 2P3LA 4C03A 5GIOE 5KS2A 2AOTB 1OR8A 2VDWA 3REOA 1VE3A 2B25A 5DXJA 4RTRA 2FCAA 3GRRA 3KQSA 4HRAA 5EPEA 4RTMA 5BW5A 5K0CA 2ZZMA 5B1SA 5K09A 1IY9A 4NECA 4RV9A 1FPQA 4GQBA 4QTTB 5C9ZA 3G8AA 1HMYA 1VP3A 2WA2A 4LWOA 3ELYA 3OU7A 3I64A 2ZZKA 2FYTA 2O0LA 4PYMA 4POOA 3G7UA 3KQWA 1I9GA 2PXXA 2P35A 2CKDA 3CGGA 5IH3A 5E1MA 3LPMA 4DMGA 2HV9A 3C6KA 3KHKA 4YV0A 3GO4A 4RTOA 3PVCA 1YFLA 2YVLA 2HMYB 1R8YA 3C6MA 3CCFA 2VZ9A 3OCJA 2NP6A 1TW2A 4GC9A 5K0GA 5EGSA 4RSRA 4DQ0A 1KYZA 3SSOA 4KIFA 3UJBA 1MHTA 4RVHA 5GINE 2FK8A 3JWJA 1BHJA 2ZWAA 1VQ1A 3B89A 4GOMD 4RYLA 3FUXA 1QAOA 3E7PA 3KPWA 2Y1XA 4KDCA 5JR3A 1L3BA 1L3IA 1SQGA 3BGIA 5DRTA 4C4AA 3NW9A 2ZFUA 2A14A 3MQ2A 9MHTA 4QTUB 3BKXA 3KQOA 1EJ0A 3CBGA 3HTXA 3ID6C 1MJFA 5D1NA 4RVDA 1X1AA 3TM4A 1KXZA 4CWAA 5HIKA 3KPJA 4MQ4A 3IYLW 2NP7A 2G1PA 2UYOA 4IV0A 5EMLA 5CVDA 5LQRA 3LX6A 3EMBA 1EQAA 3EEOA 4MIKA 2NYUA 5F2NA 5LQKA 2UYCA 4DM3A 2ZSUA 1O9GA 4RTPA 1NV8A 2HNKA 3NTVA 4YMGA 5DM0A 5FTWA 1ZKDA 1VP9A 3B3JA 3DMHA 3LCCA 3OU2A 3NDIA 4E2XA 1RI5A 3M6VA 2ZTHA 5FCDA 1Q0SA 5EMJA 4QQNA 1QANA 3LBFA 5FQOA 1JQDA 1JG2A 4EMSA 5ICCA 2DPMA 5LSAA 3GRVA 2IDJA 4R8SA 5LQJA 2AVNA 2O06A 3TM5A 4X60A 2I62A 4PCLA 3JWHA 3QOWA 5EMKA 3LL7A 1L1EA 3FUUA 3HCEA 4PCAA 3SXJA 5LQUA 5EZSA 4E32A 2ZCJA 3LDFA 2C7QA 4A6EA 3EVGA 3TKYA 2AN3A 1RI2A 1TW3A 1VPTA 2AOTA 3FPEA 3HCBA 3RIEA 5HILA 10MHA 1KHHA 2AOWA 2OPBA 3GRZA 3HVKA 4X1OA 3SGLA 1SUSA 3DH0A 3VC1A 1T43A 2PWPA 2ZWVA 3TR6A 3T7SA 5K03A 1YZHA 2G8NA 1FBNA 4DA4A 2P7HA 4ISCA 2QYOA 3HCDA 2V74B 4X61A 4C04A 4BY9E 2GLUA 3I53A 3BWMA 2EJTA 3A4TA 3NWEA 4ZTBA 2IBSA 4ATNA 3CJQA 1RJEA 1NT2A 3UJDA 1NW8A 4XUCA 1WG8A 1XDUA 3UFBA 2ORED 4QDJA 1FJXA 2Z6UA 5HEKA 2YUIA 5DT2A 3G5TA 2VDVE 3TMAA 3GRUA 4ER0A 5HIMA 1HNNA 3OFKA 1JSXA 1IXKA 2BM8A 2CL5A 2G70A 3HCFA 1SVUA 5DX1A 5FQNA 3ERCA 3JWGA 1G8SA 2OB1A 3ELUA 3E23A 4PYKA 5K0BA 3FTCA 4MHTA 4IWNA 4RX1A 5T6BA 4PONA 5CVUA 2PBFA 4Z2YA 1UFKA 2UYHA 3MHTA 4DZRA 4OX9Y 4R05A 2ZBPA 3R24A 4C07A 1M6YA 1NBIA 3BXOA 5E9WA 2BR5A 3F4KA 3EGIA 3P2IA 2VS1A 5F2KA 1NW5A 1SUIA 3FUVA 4C06A 4FP9A 3P9NA 3Q7EA 1BOOA 4FSDA 2P1DA 3UJ8A 1FP1D 2ZIFA 5GWXA 4BP3A 2PXAA 4E70A 2E5WA 5E2AA 4ER3A 2UYQA 2XYVA 2NNWB 5KQRA 2XYQA 3KQTA 3DXYA 4ER7A 2BH2A 3NMUF 3QV2A 3DR5A 3BT7A 4HGZA 3V8VA 2B9EA 1UIRA 3HNRA 3UJ6A 1SG9A 1X19A 5K0NA 1L9KA 2JHAA 3B7PA 3EVCA 4RVFA 2I6GA 1TPYA 4P58A 4EK9A 3DP7A 1G8AA 5ICGA 3UJAA 1F38A 3M6WA 5K0EA 3M70A 5HFJA 3AXTA 4E2YA 2NXJA 2YQZA 3DLIA 5KYGA 3OZTA 2XYRA 5HOQA 3PFHA 4V0QA 2AN4A 5DX0A 3IHTA 3A7DA 3TKAA 3EVAA 1NE2A 3TQSA 2FHPA 2WA1A 3EGEA 3IEIA 3R6TA 1KR5A 3P2EA 3M33A 5F2OA 2EX4A 2XVMA 4RVGA 4LG1A 4DF3A 1VBFA 2XVAA 3GRYA 5DTRA 3SM3A 4PIPA 3T0IA 3TPZA 1YZ3A 4YV2A 4YUYA 1ZGAA 3UBTA 4PNEA 2O07A 2JH9A 2BZGA 2ZVJA 4M38A 3AWIA 4C08A 1BKYA 2EJUA 5DPMA 1O54A 3LDGA 5LQNA 2ZW9A 3JWIA 3GXOA 3HVIA 3DLCA 5EIWA 3B3GA 3NDJA 3MGGA 5GM2A 3MB5A 2OBFA 3LBYA 1Q0TA 2IDKA 3PS9A 4HC4A 1P91A 1EAMA 5E2BA 1JG1A 1V39A 3GIWA 4HTFB 4UOEA 1ZHFA 3KPVA 5K05A 2JHPA 3GNLA 4AX8A 4MTLA 5DSTA 2IIPA 5DSXA 2Z6AA 4GC5A 2Z6QA 3MCTA 3R0QA 1ZG3A 3G89A 5H02A 3LKDA 4GBED 2ZIEA 1QZZA 1YUBA 3FZGA 4OA5A 1Z3CA 4QDKA 3M4XA 2PY6A 2YTZA 2QM3A 5DM2A 3MTEA 3UJ7A 2AOVA 3ER9A 3HCAA 2JG3A 3ME5A 1XDZA 3FYCA 3SMQA 2AOXA 4Y30A 2OYRA 5GM1A 4YUVA 5CIYA 3HCCA 1X1CA 5C1IA 3FTDA 3PB3A 3VC2A 2FPOA 1VIDA 3SSMA 4CKBA 1FP2A 3A25A 2PJDA 5DWQA 4OQEA 3G2PA 4RTQA 3OZSA 2AOUB
chains in the Genus database with same CATH superfamily
3WGYA 5F1YA 3KJHA 2FLVA 3MS4A 3QY9A 3P9KA 3OOSA 3UMVA 2IHTA 2TMKA 3HB1A 13PKA 4DC9A 2LW7A 2P9EA 1QKIA 2HC9A 3QF4A 4GBMA 4KWHA 1QIJA 2JFPA 3L93A 5K6TA 2VC2B 1ENPA 2DHEA 4OHZA 1NX6A 2V8OA 4NK4A 1QC5A 5HZMA 3ZBUA 1OFUX 4BXOA 3PX3A 3KXIA 1RABA 3WOVA 1NV9A 1UJCA 1NLYA 2IUSA 3A32A 4G65A 4YT8A 3ISVA 4BNFA 4JT4A 2K4MA 1Q77A 2C42A 4G86A 2B4QA 5K8TA 3CLSC 4AKIA 3ZYZA 4WAUA 2V7BA 2A0WA 3B1WA 5F5XA 5KSZA 1JJVA 5H7XA 2PXCA 1M1ZA 4PAGA 2O5RA 1Z6AA 3SLGA 3UTCA 3C14C 1Y1PA 2X5JO 3EZ2A 3GGGA 4DW8A 4DR6B 4X3OA 1JG3A 1PGQA 1VJ5A 4PO9A 4HWKA 3TR0A 3U7IA 1I94B 1USUA 2WC1A 4ZJPA 2AIRA 4R2XA 4B7ZA 4RFSA 3GMSA 3X1DA 1GNVA 3H4MA 1VIYA 2HBQA 2NUPB 1YZYA 1V4VA 4IIJF 3ZV3A 3N8KA 2VHJA 1QRDA 3VH2A 4EP1A 1IBLB 3CZ9A 1XZNA 1ZIDA 1QDUA 4XSGA 1SCBA 4Y1EA 3TW4A 4BB9A 2RAFA 3BHJA 3DZFA 2IUTA 4KP7A 2RD2A 4YUXA 2XQVA 4CUZA 1MORA 4BO8A 1E8DA 4B8ZA 1E3LA 5L3VA 5FLXA 1EIZA 3WX0A 3NFRA 1QGED 2I76A 2RB5A 4X63A 5JMPA 4BATA 4DXHA 5ADWA 3THYB 5KJCA 3OLWA 1NWCA 4RZ2A 4L5YA 4PANA 3LBNA 3BJEA 3OCYA 1XP5A 1IB0A 2A4KA 2GPYA 4R98A 4DCGA 3KR2A 5DN9A 5IC5A 5C8YB 2O57A 4Z99A 1N6LA 1L4BA 3GWGA 3D81A 3SKVA 3GLHB 5C5CA 1KEZA 1OPXA 4ILEA 5ESRA 2POQX 3JYPA 2BEVA 1KO7A 2O19A 3CMMA 1LNZA 1RRGA 1KI3A 4LWQA 2MWMA 2VEOA 3LLSA 1ZCBA 1JIXA 3G23A 2I6FA 4ZK2A 2J9ZB 3A11A 3MGBA 4BIIA 1H93A 2ODPA 3JZMA 4S35A 4UMEA 7MHTA 3OEHD 4H31A 3ZLVA 1PZHA 1USGA 2V5VA 4X1IA 5AW5A 1FJ2A 1K7FB 1QH0A 4NEHB 3UAYA 4XLLA 4B4DA 5DLDA 3PQDA 1Y8AA 1EA5A 2OMEA 4KQMA 5BOVA 2CNKA 4IQGA 4D3FA 5K3EA 3MJVA 2EARA 1WZEA 4MULA 4Q3AA 1MO6A 2ZBRA 2ZSIA 4KE8A 2O4UX 3KQMA 5EUCA 1SRQA 3S1AA 5CH3A 1YRYE 3K6RA 4IFTA 4Y2HA 2I4MA 4BV9A 1XJ5A 3OWHA 5KREA 1MXFA 2W6JA 1B42A 1DFHA 2B5VA 2XZDA 4MJ7A 1SGWA 1E99A 3IQHX 3OJEA 4C30A 2ZRDA 3AHGA 3CZ5A 3DA8A 5I01A 4ZOLB 3ZJTA 5CA0A 2XNSA 3BG5A 3EVNA 3K94A 3L7LA 4EAQA 2FEXA 5HFNA 4N3CA 3IQEA 2CMHA 2BMEA 3LTNC 1PQYA 1KETA 3OKCA 1T8RA 2WKPA 2ZYWX 1KP9A 1ODCA 2I3DA 3M5DA 4A8JB 4MTCA 1W85A 1ZIOA 4Y9DA 3TSCA 3BTSA 4HWOA 5CIWA 4D99A 1KY2A 5H59A 2WWTA 3PQFA 1ZGBA 4JWTA 5KOIA 4FOTA 4ID9A 2DBRA 1JQJC 3HFSA 1WPQA 2AI3A 2JAQA 4QHSA 4IDHA 4QO8A 3UJ3X 3EODA 3QYAA 1T1IA 3L4EA 5JVDA 3STYA 4QWMA 5JAZA 4PZAA 3EVTA 2GHQA 6AT1A 4WX2B 3ASYA 2W43A 4KV7A 3QK7A 3AHJA 1P7ZA 2IZ1A 3C0KA 3CH4B 1KAQA 3M6UA 1NXXA 1VL2A 2NUAA 3KLNA 1KMIY 1D3AA 4JL8A 1Y1TA 3OPNA 2CFTA 3LOUA 4URYR 1CEYA 1Y33E 1PNRA 1L7BA 1R6DA 2R6R1 3FDIA 4CHGA 3PEFA 2VYFA 4XUGB 1E6UA 1JI3A 2G3YA 3AYZB 3NHPA 3G0DA 5C3MA 1V96A 3U9SA 5FOQA 1VHLA 1ZJJA 2JKZA 3AO0B 3AUTA 5I9LA 1HE4A 1CW2B 4QRDA 1W87A 5C8YF 3CUYA 2P77A 3LPNA 2IPAB 3LRTA 3EG5A 2IPXA 3RG2A 3ELWA 4K1LA 1OC2A 4LNAA 4B48A 4UQLA 3CIOA 3LWZA 3CO5A 2PVSA 1RLMA 2H3EA 1YB2A 3N5CA 3PXXA 5LZ5A 3UKOA 3ITDA 1IWBB 1TD9A 2HLNA 3LI2A 1UWVA 2X0JA 2Z6VA 3OG9A 3RM3A 2V5UA 5D01A 2C3UA 3MTQA 4EMTA 1HOTA 3OJLA 4X8HA 2GHTA 3WA7A 3KUKA 3B36A 3CS3A 3VU0A 2XH8A 5MFPA 5AH0A 1ADFA 2PCLA 2VQFB 3I6QA 1ZGJA 2P4UA 2LIPA 4EPRA 1LPPA 2G72A 5CM9C 2X0FA 1P6XA 2UVPA 2GHIA 4UBOA 1J00A 4WOCA 3UZUA 1ZC3A 4ND1A 1B93A 3JQRA 4F2GA 2B1JA 5FO0A 4Y6QA 4K2HA 4OXRA 3B38A 3FMIA 3HEMA 3TNLA 3V8RA 2RHWA 3N05A 5CB0A 5J23A 1LX6A 1U1GA 2D54A 4KREA 3V7WA 1QAMA 3O6VA 3X2FA 1NI4B 5EQFA 3DMRA 3T0FA 1RIIA 3NHFA 1BFKA 2VHCA 2WDPA 5GGXA 4YRAA 1QG6A 3Q87B 2EEZA 2QUIA 1VLMA 3ERCA 3WHKA 3P4XA 4KIJA 4TMZA 1WSWA 1MG5A 2DPHA 2QTHA 3OU6A 4ZOLF 3S68A 1HKHA 3AM3A 4DLUA 1CBUA 1SELA 3DCYA 1R0RE 3IEPA 3QVKA 1KL7A 3QXGA 4O0LA 2FZGA 4R9UC 1Y6JA 1EWTA 3L7AA 1BC5A 1SXHA 1RE0A 5LA6B 1AC5A 2FRDC 1XZ8A 3SG0A 3TRKA 3T1HB 1ZJWA 2JGDB 2Y1EA 1H2FA 5DB4A 1N6HA 3IDZA 3PC7A 1UT6A 2WD8A 3ZCRA 3HLYA 1L0BA 4YAKA 1W4ZA 4PAQA 4HJRA 4ZXFA 1E2UA 2VUSA 3AUXA 3MILA 1XAIA 4QUDA 5B3LA 5BXYA 3R6GA 4D3XA 3LCUA 4IVQA 1SQFA 3BL6A 4TVOA 1LBIA 3F3SA 3BD8A 3OLXA 1Z6QA 4H0CA 1KH3A 3WHIA 4JQSA 4AP9A 4LCEA 1L7EA 4WV3A 1TAHA 5IZ4A 3Q3EA 4WXEA 1VE3A 3HHPA 3V33A 4YS6A 2GBFA 2B37A 4JT2A 3FFWA 3PGVA 4P5PA 5CW1A 4F5ZA 4OB8A 5IM5A 1ZLXA 3B13B 1ES9A 4HAXA 4K3UA 5BNTA 3BC1A 1HMYA 1SM4A 2PKXA 1MF7A 3CX3A 3PUWA 3HO8A 4GZ6A 3V8EA 4OIMA 5KTRA 1J70A 4O02B 5TGTA 1NBEA 2IHKA 2A78A 3NONA 3RVKA 2C0CA 1GXSA 4D92A 4B4KA 4HB0A 1JV2B 4G81A 3GAZA 3IXMA 4BLOA 3ROXA 4LRWA 3FLBA 3PVCA 3LHIA 1DDOA 1R0KA 3CUUA 5CU7A 4OF4A 1JECA 1JU9A 1AE1A 3RD5A 2DUNA 3PNYA 4J9VA 3WLEA 5KNDH 4QXAA 2FE4A 4HT3B 1FMTA 2P9HA 1WZCA 2JFBA 3R5KA 1SPBS 1A8QA 1YC2A 3BJZA 3K9CA 3B89A 5LOVA 1H0RA 3BA6A 2BKAA 1SU6A 2GHRA 5BMVB 3KWFA 4CRWB 5DRTA 3PJGA 2Z04A 4QLBA 1YAHA 5J59A 3REFA 2AE1A 2V9CA 2HMWA 3WRXC 3JXEA 3JYOA 3BVPA 5DGIA 3HTXA 1X8KA 2I6UA 2QVYX 2R87A 3IUJA 1PWEA 4TQUS 4CWAA 4QGFA 4U63A 1VDMA 2GLTA 3K6KA 4WH0A 1DAGA 1NIPA 5E6SA 4MIKA 4UTZA 2PYZA 3NHYA 4BFSA 4V0NA 5AJWA 3H9BA 4LYJA 1I2AA 4LYAA 4TYNA 1CDZA 1QFJA 2P2LA 4BLRA 4ZIRB 3H4VA 3BSFA 5EP4A 1Z7GA 5AMXA 5HWSA 2X7XA 4CEJB 1PW7A 2HGSA 2GR9A 4UTPA 1J4AA 2WLTA 2Z4TA 2XZOA 1LFDB 1NXOA 5LA6F 2RAPA 4IXDA 4S1WA 2FZKA 2VP6A 1O96B 3EWSA 3I32A 1ZUNB 4QBGB 4F1KA 1T8TA 2CVQA 4KXMA 2WINI 4TXMA 3NRCA 3ZWQA 2FQ1A 4FUQA 4G5YA 4CCAA 2EJCA 3P19A 2VJPA 2Y1LA 1Q57A 2Q4OA 4P35A 3LL7A 1JHAA 2W42A 3RUAA 2H2DA 1SEVA 1LGYA 2YY7A 1GRNA 2ZATA 3LUFA 1E2PA 5BRNA 1D6MA 4DQXA 4F12A 5ANRB 3TKYA 1FFXB 2C2BA 3RIEA 2D0PB 3RROA 1GVNB 4KRYA 4F4DA 2OYCA 2AN9A 2QNRA 1H8EA 4GZLA 4MYHA 4F60A 4MCIA 4K6FA 5GV8A 3SHFA 1AY0A 4WDRA 5F7OA 3AUJB 2WM2A 4HCJA 2J45A 5KTSA 3WMRA 1QYXA 4HFNA 1L4EA 1J20A 1ZXBA 3WIVA 3O3CA 1C1DA 3AW9A 1DJQA 3RABA 2F43A 3WO0A 2RGRA 3UUGA 4HNHA 4DSTA 2FZEA 1IOWA 3RRNA 3VNSA 4N65A 4HNSA 1Q11A 4W82A 3SZ3A 4DDTA 5KHOC 1ZNQO 1RC0A 2VATA 3FNFA 5HJ5A 3KYDB 1M73E 1SCAA 4Z9XA 3R7WB 1WG8A 3U5TA 4PRYA 1R4MB 4I66A 2ORED 2PGJA 1YS6A 2B1RA 5ER9A 4JI1B 1FUYB 1FRVA 2XB8A 3CUSA 4N03A 2M6KA 4PLWA 5HQTA 5DVZA 4KO4S 3SYMA 3H11A 3ZD8A 1F06A 4LV8B 2R8EA 1E3IA 1V5GA 1W4RA 1BRTA 1U0SY 3CCCA 4AZ0A 3U4QB 1YRAA 1RWPA 1NVVQ 2H4XA 1HZZC 3TWOA 4WN3A 2L69A 3F98A 2FP3A 5CVUA 3NPAA 3SWWA 1T13A 1VCNA 3PDCA 4FEYA 3JQ9C 4KCGA 3WLPA 1PVOA 5TEVA 3BXOA 3GN1A 1Z0ZA 5BMVF 5I7EA 3BMQA 1DC5A 5T5QA 3VR2D 5ALDA 2VH5R 3A6JA 1UOEA 1L4MA 3Q7EA 4BX9A 4DZZA 3NX4A 5JBNA 1N6IA 3EUAA 3IAAA 5GWXA 2WOOA 4MNTA 1KDYA 5KYKA 4J1TC 2V7WA 3TDMA 4BUJA 3JWEA 4MJ3A 4YP5A 2H0QA 2IPLA 3KD2A 3KWLA 1FL9A 3R3SA 2YYAA 4J4BA 2R68A 4HGZA 2A84A 3M3HA 4MW0A 4R40A 3ZH2A 1R5JA 6REQA 3FZYA 2IOFK 4CDMA 3E70C 4MV5A 3IT2A 4PG5A 1TA4A 1P2UA 1ZUD1 2PJUA 3LDAA 1AQ6A 4EK9A 2CHUA 4IG4A 3ESYA 4Q39A 1F38A 1ZAYA 3AEKB 4LHVA 1G21E 4OQMA 4HDRB 1T1JA 1OWLA 4XM1A 1NR7A 2CLFB 4JEIA 4A8JC 3QYPA 3EVAA 1DMRA 3IQZA 3V6LA 3F78A 1WEKA 3VTFA 4B3BA 4F7WA 3WY9A 3NC1C 1FZQA 1HRDA 3BBLA 5IU6A 4IG9A 2A7QA 2XVMA 1CG6A 3E61A 1NQOA 4PTZA 1WHTA 3IIEA 4L8VA 3T5CA 2PBRA 2PYIA 3W04A 2XWBF 3SJCA 1MAWA 3UOAB 2OORC 5I7UA 3TI9A 4BLPA 5JNSA 2W5UA 1K06A 1U7WA 2DHDA 2Q9BA 1WZ2A 4DNOA 1P44A 4CBVA 2W58A 3DO5A 1OI3A 1V9SA 3QUQA 1PT6A 3RREA 4C08A 3LDGA 1AKWA 4QX6A 4MDHA 2O2YA 3DLCA 4QSMA 2VK4A 3DV9A 4QFBA 5EHNA 5E2BA 4LZJA 2EFEB 4EG7A 4UU0A 4F46A 1U90A 5L40A 4ZQCB 1T1EA 4OHMA 1W2GA 2OFXA 3HYRA 5ALJA 3IELA 3OBIA 5JDCC 1JXAA 4DLXA 3U7QB 2XTNA 1J1UA 1K98A 5E0KB 4WJKB 3NNDA 4MLDA 1KH1A 2Q5EA 4B4UA 3ESCA 5D7BA 1MV8A 3ZVRA 4J16C 1II8B 5CLGA 1SQ6A 4K9MA 1TQ2A 1KQFA 1S8AA 2HFJA 2RHDA 1NSYA 3U0VA 2UUCB 3ME5A 2RB4A 2ZI5A 3QJYA 4FC7A 4V2IA 4G4GA 2WF8A 1NI3A 4EW2A 4WDQA 1J8FA 1OMOA 1RBYA 4GEGA 2VAWA 4QUJA 4MVYA 4BJ6A 1EVKA 1PJ8A 5LYJB 3JARB 4DJTA 2RCNA 2ATEA 3D02A 2B4AA 3UK1A 1JBKA 3T35A 1BXGB 4FDMA 4RTQA 1F2VA 4AVYA 1Z37A 3MTAA 3G9TA 3Q40A 5E7QA 4CM8B 1XMVA 1V5FA 3KL2A 4OLAA 4NCNA 1UPXA 4YCNA 2I2CA 4ZQFA 5IDVA 4UTVA 5FX2A 4KQHA 3OZEA 3I58A 2JHGA 2ZLBA 4HGNA 4JP3A 2FUNB 4BUCA 4TLLB 4BQFA 3BQNB 3U17A 1GZ4A 3U13A 4C78A 2RC5A 4RHFA 5AW6A 4EB6B 2YJ3A 3ODPA 4Y2JA 4OHRA 3U26A 2H2GA 4BO9A 3EWAA 2XITA 5J43A 3D6FA 4B3TB 1GZHB 4HRVA 1N4AA 4CMIB 4E13A 4RGBA 3KWMA 4BQQA 2Q9AA 4WESA 1CQZA 2X0DA 1QTIA 3V5NA 1Q15A 3OCZA 2TSYB 1VSVA 3DULA 2W83A 3IT1A 5KOHA 4MVJE 2RGBA 3PKJA 1TJPB 1F6WA 3W3ZB 5CB6A 1NJ5A 3EVFA 2RGUA 3L6CA 121PA 3HKCB 3HVHA 1JJ7A 1KJWA 4L27A 3BIOA 3HN6A 2AZTA 2XAAA 3NETA 4YRKA 2QVGA 4CMKA 4BV2A 4M0LA 4IXNA 1C7RA 5HA5A 2YWJA 4DIOA 1AKNA 4OHVA 1THMA 3HJNA 3L6OO 2F8TA 1FFYA 4ETNA 4QNMA 5DTJA 4EJ0A 3AFIA 4ZOQI 1Q92A 1NW4A 1ZIYA 2WJAA 2IYXA 5C53B 2I8CA 2GEKA 4P7KA 1H2HA 1IN5A 1VL5A 3IR7A 5B1DA 1U0BB 2F00A 1N2GA 2BAGA 3GH3A 2W93A 2UUBB 4CTNA 4MX8A 1HORA 4E4TA 2M32A 4BECA 3L9XA 1EJ6A 3WRYA 2YS6A 3QXJA 4F8EA 5AKHA 5CUQA 3LK6A 4AZVA 2VJMA 4BJ3A 4HTFA 1GTL1 3LPCA 3MUNA 3O83A 3K2QA 4BRWA 4LZZA 3KV3O 4W99A 2VA9A 2IU3A 4MV8A 4PHHA 4LXYA 3SZUA 1M1UA 1VIAA 2RHMA 1GPKA 3ZYCA 4J3FA 1OZFA 1NPDA 4YP9A 1BJKA 4F3TA 3ZWCA 1RS0A 3N0VA 3QKUA 5TLSA 3ER8A 3R1IA 4ZAGA 2FVYA 4CUKA 3ZXIA 3WWEA 4GP6A 1X7WA 2EIXA 1W34A 2P8JA 1RJDA 2A0UA 4O33A 2OKGA 3DKVA 2TMYA 3PPIA 4GM4A 4NFYA 2LDBA 2ZSJA 5E95A 5IRCD 1DJOA 4IDAA 4RK4A 2X9QA 1KZHA 4D9CA 5BUZA 2QG4A 4PYIA 4OD0A 4V0KA 4G07A 2GETA 3AGPA 4IIVA 3I5UA 1HPLA 5SZJA 4TSFA 2WSBA 3LAWA 5FPPA 4DRXB 2RBEA 3ADDA 1AUQA 4I5EA 4DPKA 2FK7A 3E35A 2DFPA 3RTEA 2WJWA 3UB4A 2AMYA 1CZHA 1X7XA 2MOKA 1R6UA 5EJIA 3R3UA 2BGJA 3LGXA 5IT5A 1RYHA 4FYXA 1RNLA 4P3NA 1L8LA 1SZCA 2WMNB 3EAGA 2PTHA 3MMXA 3DQPA 1JLKA 3LWNA 4Q9LA 5JEDA 1YJQA 1R00A 3SQOA 4LFCB 2WZDA 1EFVA 2WD7A 3DL0A 3QPDA 1M2GA 4JLMA 3DOUA 2F8SA 4ITUA 1ZA2A 3EQ6A 3GDHA 4PGHA 4Q3KA 3V4VB 1O03A 1SURA 2V7VA 4NYMR 1XVAA 1MFPA 4LHSA 3A26A 4Y7DA 3W6NA 4B6EA 2PZBA 2JH8A 2R60A 2OC4A 3UHFA 5KHAA 1A8HA 1E79D 3E8SA 4N6OA 3RS7A 2PT9A 4JSRA 2FY8A 4RA9B 4ZU6X 1WVMA 1PUXA 2D0DA 2WILA 3PNLA 2YXPX 5L3ZA 3UMBA 3D1VA 4B6GA 2C9YA 1U2DC 4RU1A 4M6WB 1J5EB 1UXOA 4ZZ1A 5FWNA 1E2MA 1C3VA 1KEPA 2Z9BA 1NP3A 3K1AB 4B2PA 5BORA 1AQJA 3OQNA 5IF3A 1NIJA 1PT7A 3IIIA 4PCVA 2R6ZA 2ZOSA 5KNBA 3THWB 2NO6A 2AS0A 2ZQZA 4DLWA 5EIFA 3BN3A 4UHHA 3VR5H 2UYGA 2ODWA 1WCV1 2JCSA 2FRVA 4ZT3A 2BMFA 5FHQA 4UVHA 1C1YA 4LDRA 3F46A 1SCKA 1J7KA 2H2HA 5EWJB 4PBRA 4Z3DA 2GKSA 2BM0A 4F86A 4MP3A 3TLAA 2Q2OA 4L78A 5JV5A 2QD5A 2DTDA 2OO5A 3ZHYA 3W8DA 1T34A 1BWSA 3V8PA 2A0XA 1KI6A 4M0KA 3UFXA 3OOEA 5AKZA 1YJXA 1UADA 2VDLB 3Q12A 4NE7A 5T4HA 1NMQA 2J67A 3CW2A 3LY7A 1OHHD 2AEMA 3EPJA 4IFEA 4DBVO 3CPSA 5LP1A 3LH5A 5KVQA 4F6CA 4J91A 4LZLA 2Y3IA 4JJZA 4K86A 3VI3B 1O4VA 3FDZB 4FS8A 2DP4E 2OAGA 4BVFA 2OLKA 2H5JA 2X42A 3FLMA 3IVMA 4G9GA 1N7HA 2PIAA 2JIZA 5IYZA 2A1IA 2WK1A 1W5FA 1KS2A 2ZBQA 2Q4TA 1TMYA 2JAWA 4QECA 2FFAA 1R88A 4MVJA 4YUZA 1T4CB 1ORTA 3DAPA 1Q14A 1SVNA 3B2EA 2JVKA 3ESZA 1R12A 1RI1A 1YQWA 5B55A 4IIGA 3ZDZB 1OX4B 4Q1AA 4B47A 4TXLA 5GZ3A 1SCJA 3JZDA 4O2AA 1P1BA 1PR9A 1GA6A 1I5OA 4YRQA 1E3WB 4GR4A 1UMDB 1QR2A 1HE8B 2PSFA 4ZVRA 3VO1A 2QSUA 4LMAA 1EIWA 3VTAA 5DNVA 2BMJA 3KKZA 3PFFA 3O2JA 5KDDA 1NLUA 3LT0A 3DW1X 1NXPA 3IIKA 4LJKA 1XLUA 2W6JD 3K0SA 2WMYA 3BD6A 4NJEA 1JBEA 3Q41A 5KYXA 5FNVA 4CI0B 2NO4A 2ZAIA 4JFRA 4RH0A 3K31A 4B4VA 1G98A 1KO4A 3HXOA 1SAYA 3ZY2A 4M8KA 4OAQA 3UC5A 2BMWA 3FGPA 4MW7A 1CUIA 2QMZA 4O1HA 2Y9PB 3SKXA 3DONA 2DF8A 4MQ5A 3U48A 1JTFA 5YASA 4IEIA 4R6XA 3PK0A 2IDZA 2EFCB 2CNDA 3L84A 3ZN2A 1TKCA 3CNOA 1W94A 2P30A 3O7WA 4QDZA 2OHFA 5SZHB 5MN6A 4G1BA 2GTIA 3O75A 5D5PA 1L4NA 1DTWB 1VPDA 2O2HA 3HZHA 4WBXC 4Q9KA 4EFKA 5FWYA 4Z4QA 2OQ2A 3MN1A 3ROKA 4PZ0A 4NDAA 2A9QA 1Y3IA 4HRAA 4DNQA 5G0TA 2I7TA 4U0JA 5BW5A 1JHYA 5JJKA 3JD2A 2WE8A 4KAJA 3WWOA 2OZLA 4YAOA 4N76A 1DIBA 4I6EA 1BEUB 3OY7A 4GQBA 2C97A 2JKYA 4NTZA 3T06B 2UUOA 2WJIA 3CTPA 1GGHA 3UQYS 4GRIA 3UH1A 2FH5B 1U63A 1NXQA 4OQYA 4UASA 1PNTA 3Q9UA 4FFBA 4IKEA 4NU5A 5ALRA 3SC4A 2O0LA 3NXSA 2Z3ZA 2A8YA 1A4XA 3E22A 4KYUA 1KNQA 2P35A 3D5QA 3O1LA 3CG4A 2Q3JA 3PYLA 2B5OA 4KXUA 5HE9A 2FPIA 1W5EA 3U09A 2XUZA 3SSAA 4A7PA 1QP4A 3W8NA 5JOQA 4AROA 1OXVA 3B2QA 2J4CA 2FSSA 4F9TA 1KDOA 2QTVA 3NEJA 4WY5A 2P27A 2O59A 4HRXA 4EHJA 1CUCA 1AN9A 3T9BA 3VDMA 1VCMA 4EFDA 3VO8A 1X8JA 1ZVQA 3AF6A 1KXJA 1BHJA 1UCFA 1F17A 4OJQA 2PD6A 2GSWA 4MV0A 4PXAA 3WNBA 3ZE7A 4HGRA 2I8AA 2P1ZA 4AJ4A 3TG8A 4RFLA 1EKXA 3PEWA 4RY0A 4I9UA 3ZGVA 3PX7A 3O84A 4F5YA 2CLCX 3RASA 4W5WA 4QE3A 1KEEA 1CF4A 3SK0A 2FGJA 1GADO 5G2OA 3RHFA 1CB0A 3ZS8A 4DLZA 4IMIB 3URKA 4V1CI 2XB6A 4RPGA 2G1PA 5EMLA 2YJ5A 3BJMA 1OI2A 3RRBA 4C0AC 4KITB 3AETB 4EVRA 5DHAA 1RE1A 3EASA 4DA6A 1FYXA 5F2NA 3TTVA 2VQDA 4YRBA 4RK6A 2RGYA 4NH0A 3KYCB 1UJ4A 2W98A 1VP9A 2J33A 2P62A 2ZUSA 1MTZA 3LMKA 3R3VA 4HZUA 3SF0A 3TCXB 1YJAA 4BMDA 4J2OA 2BSXA 3FI9A 3LP6A 2QJWA 4TKLA 4KN9S 4ED9A 1NRWA 9LDBA 3H0CA 5KYTA 3VPHA 5DULA 3GQVA 4W1RA 2CGEA 1UKEA 1S01A 4MIOA 2RIPA 3H42B 4OUDA 1ZR4A 2IXDA 5AP9A 4X60A 1XZCA 2ZI9A 4KQWA 2RH8A 2ATIA 1CQIB 1O3YA 4D9GA 2YNMA 4OMFG 3JQDA 5DN6A 1XKTA 3GPIA 3WZMA 2AN3A 1QG2A 1RI2A 2NTJA 3HCBA 1RHKA 2Q1TA 3TO5A 1QK4A 3HEAA 5DTEA 2XGOA 3C5HA 1ZNZA 3GFPA 2P9FA 3PF8A 4QAJA 1KI1A 3WDKA 2ZAYA 5F98A 2IY9A 3T7CA 2CVFA 4AO7A 3QW2A 5SY6A 3DEIA 3UXEA 2VJOA 1UDXA 1B8OA 4BFLA 4EB8A 1YACA 3FY4A 4B2LA 3O1IC 4U7HA 5KWIA 2P1RA 5U4QA 4TT8A 5C4MA 4GX5A 1SPXA 3AZOA 3ILXA 1Z15A 4JLKA 3I5YA 3PC8C 5J3JA 4M0UA 2G08A 2DUJA 2OCIA 1W46A 3KU4A 4URZR 1BG6A 2P6PA 1XDUA 2QDKA 3GV0A 1X94A 2Q7OE 1HY3A 1CZLA 5IDYA 1KWGA 2FPKA 2VBIA 3BFJA 2Y1GA 1OBOA 2C8KA 3RNOA 1EWYA 3R09A 1BA3A 5CG1A 1M67A 1G18A 1MIOA 1GLNA 3I28A 1N3LA 3LQFA 5KPJA 1I5RA 3MT0A 2JGIA 1DAIA 5DO9A 1QRAA 2HSWA 4MRSA 5CB4A 1XF1A 4G0VA 3F47A 3PV0A 2BFOA 1E1NA 3V46A 2IYRA 1APBA 3K72B 1MLDA 3FNQA 2BFCA 4Q16A 1GNLA 1XO1A 4MB2A 5BY2A 1UPFA 1B00A 1IJFA 1A9YA 4Z0TA 3M3PA 2BF7A 1XEWY 4KIUA 4G1UC 1E1LA 1NBWB 2HYDA 4P83A 4GPAA 4TTPA 4X20A 2QTBA 4EF4A 2ZWOA 3OCWA 2C57A 1Q44A 4TRJA 5CURA 3P9NA 2A7XA 1LLFA 3QYFA 4DARA 3F6BX 3LXXA 5HQ3B 3WMFA 1NYLA 2GJAA 3PP8A 1KAHA 2E5WA 4Y2UA 5E2AA 2UYQA 3X2SA 1MJGM 4ERNA 3IURA 4G09A 3IESA 1Z6YA 2IYQA 4X84A 5IASA 4TMVA 4F97A 4FCVA 5ERXA 3ZUGA 5AJVB 2I1WA 2X0RA 3NR2A 4YACA 5JO0A 3GGJA 1DBWA 4DHEA 5DBHX 5HKKA 1XZFA 3LF2A 2JHAA 2SCUA 3G68A 1WDTA 4ZPXA 1EBUA 3QFTA 4QD3A 4BZXA 5AW3A 2VAMA 2NU9A 1L7XA 3OHMA 4M4SA 4LJYA 1J06A 1RSZA 1NRJB 1U9IA 2E4XA 3LKVA 4WOJA 1T1SA 3JASB 3M6WA 4TQAA 1RQNA 1U0TA 3C3EA 3Q0TA 3ZCUA 1JYFA 2GJ8A 2R79A 2CHQA 2A9RA 1WVIA 3EIQA 1SN7A 2I1LA 2QTAA 4OU5A 3EC7A 5BQOA 2P6UA 2XDQA 3EAFA 2WY2D 1N9ZA 4WXMA 2ONKA 1UH5A 1BX1A 2YMLA 2ZJ2A 3NI2A 1LZLA 3KVNA 2WA1A 2L82A 5BV2P 1XVIA 3ABSB 3F9RA 2ORIA 2EX4A 1SC3A 2AL7A 2VO1A 1EVJA 5AJHA 3BRCA 3GJ0A 1P1IA 4OSOA 2EF0A 1N33B 2P9QA 2EX0A 3RVRA 1R27A 1YKGA 2DWUA 5LP6F 7YASA 1GNTA 5JY1A 4AF8A 3AWIA 4MQEB 4YRPA 1BKYA 5LQNA 2GXQA 5JTTA 5BURA 2A58A 4FNOA 3QXHA 4QSHA 5BW6B 4B81A 2ZYRA 5EIWA 1A5TA 2OBFA 4X45A 1U8YA 4N18A 3QF7A 4YJKA 3TB6A 3W8FA 2H8KA 3A6HA 4UEQA 3WK8A 3K8OE 3DSRA 3L43A 3PE4A 4OL9A 4XTCS 4D0RA 2JHPA 1S2NA 2GCEA 2A5GA 5HRAA 2B61A 3STUA 3Q8KA 2PR2A 3FKSA 5JCPA 1XCMA 3SDSA 1Z5VA 2PFGA 1YI0A 5E2IA 1FMFA 1QE3A 1UWCA 2MYPA 4A0HA 1X80A 3ICVA 4N3BA 2JG3A 2E3JA 4XJSA 3SMQA 2AOXA 2VLIA 3KOUA 4OKSA 1S3IA 4BO4A 2RE8A 4PC2A 4BUZA 4TS9A 1DAPA 1UINA 1DAKA 4G9BA 3F7OA 4JU9A 4I3HA 1QX4A 2VDPB 2YDXA 1UOOA 1X1SA 2A86A 3NHSA 1M76A 1QYIA 1IFXA 2C29D 2QF7A 3G49A 3GA0A 4RZIA 2RHTA 3O8DA 1M7GA 4D42A 3A6ZA 3R5SA 1A71A 4IO0A 3NYIA 4G0YA 1M1YA 3UWPA 3ZY4A 2FRXA 5JD4A 4M7RA 1JNYA 2VOJA 1NBHA 2XKBA 2GYWA 1NQUA 3LQ2A 2C84A 1W0CA 1M2NA 1HC7A 4KUEA 4UVGA 1E3QA 3QEAZ 4GMXA 3W7AA 5LBIA 4FI3F 4QXOA 3A1WA 2VAXA 4MUFA 2B2NA 3WKCA 3FTQA 4HB3A 3X1YA 3ADCA 1X2BA 2DLNA 1C3XA 1EE2A 3L8HA 5AVZA 3A6EA 1TKAA 4DCMA 3JQ8A 4FYVA 4AY5A 4DILA 3SJAA 1WXEA 4X66B 1PFWA 4GM1A 1XDWA 5TSDA 1SXQA 3D1LA 4JGGA 4JKYA 5K8JB 1P74A 1D9XA 4NHEA 4ZYZA 4ZT5A 4YO7A 3TOVA 2PK3A 4AS1A 1DXQA 1KFJB 1QCCA 1SCDA 2H7YA 3GJYA 4PY2A 5C7YA 4I50B 3R9WA 4OGWA 1EFUA 5AVVA 4G56A 5JZ9A 3E9CA 1BIFA 4YAFA 1FE8A 1Q16A 2IS1A 3M1YA 2JVIA 2QAIA 2P3QA 2W37A 4OHKA 4M3NA 3PQ8A 4J2TA 5EKXA 3TOXA 4E5KA 8MHTA 2PWYA 2IA5A 2ONZA 2XBLA 3ZZ1A 1N9KA 4JP5A 1G0NA 5TQVA 2GBLA 2H2AA 4IDOA 1CUSA 1FVXA 1M7BA 2CLDX 3ND7A 3NTUA 3Q9SA 1LFAA 4I4TA 2WFMA 2LR0A 4JQCA 4TSKA 1R4NA 2VPZA 4FX5A 4FZJA 5AKYA 3S0JA 5AHOA 4J3NA 3BRWD 4EVIA 4RCVA 3TQOA 2QXUA 3MXOA 1OFVA 3PL1A 4A1FA 1YCDA 4S2UA 5JCXA 1EJBA 1FNDA 1PEAA 2H85A 4PN7A 4B6SA 3LX4A 1UJBA 1O95A 1M3SA 3SCZA 4JUIA 1XXHB 3VU8A 1CYEA 4GFDA 1WDWB 2P75A 1NW9B 3TNJA 2V0CA 4EFMA 2BDUA 3DWEX 3I9MA 4LWZA 4TT3A 4X97A 2VHXA 4FFLA 5CFZA 2EKQA 1V11A 4LJLA 1WXWA 1YR8A 1U02A 2HXYA 3WZ2A 3HVUA 2OHOA 3SFZA 1IOVA 4C7BA 3KPYA 4LVOA 4ZTUB 4N5MA 1CUZA 1YZTA 2WVAA 3Q3GE 4KN5A 4LZOA 3VSAA 4BBJA 4PLVA 1Q6YA 1NQXA 3AVWA 3GPBA 2JGNA 2DWCA 2G06A 2QGFA 1N25A 3EGDA 3KZOA 1U3TA 2VYCA 1C30A 2IYLD 1DKQA 1G41A 2KPOA 2G17A 1WPXA 2BVNA 1E58A 3D2BA 3IPXA 3QVGA 5IBPA 3VNBA 1BAPA 2P69A 5EP2A 1VI5A 4IHAA 5EMHA 5FULA 4CMBA 5B4UA 1J8QA 1ZIXA 2YIMA 3KZXA 2YY5A 4WQMA 3T7TA 5K0JA 2EP8A 2ZI6A 3F0TA 4BMNA 4BTEA 5JJIA 1XQXA 2R7MA 4FCTA 4GMFA 4O25A 4UD6A 4GNRA 1U2PA 4C05A 3P9PA 1VTKA 1TTQB 1QF9A 2RKBA 1IHXA 3B52X 3LW7A 2XAUA 2ONCA 4LY0A 5F7XA 2C1XA 3PD1A 1Q7CA 1UJNA 1QVRA 1FDOA 1W0JA 3G2LA 1ULUA 4GKBA 4IIUA 2H4JA 4FX2A 2PSJA 2XR1A 4PRKA 4RGVA 3KE9A 1NLZA 3ZQUA 4M89A 1SXPA 1YE3A 2Z5GA 1J0AA 3I6ZA 1ZVVA 3IE0A 4JENA 3QKRB 3K8ZA 3U4MA 3CH5A 3DB2A 5KU1A 2Q5OA 3BXHA 1JX6A 2JJ8A 1UXJA 4GOND 3PXBA 1ATZA 1VBMA 2W70A 1A95A 1NTOA 1NXSA 3A3NA 4GXTA 2YX1A 3H18A 5FPHA 3BWDD 2X7JA 1K3FA 3E3AA 1Q20A 4R6WA 1EH5A 4JASB 1O57A 3VDQA 2NIPA 4ZYXA 3V8BA 4MMZB 4QYMA 4MUKA 5D00A 4IS2A 2JLYA 1Z4OA 2YASA 4NFLA 3B6IA 5FFFA 2FN7A 3L7CA 4WOPA 3I61A 4JMLA 4RQAA 1HYEA 3IUBA 5LB2A 1TT5B 3AHIA 4EH1A 1U9CA 5F52A 3L0IB 3C3MA 3ELDA 3C1AA 2E4ZA 1HFWA 4OGGA 4P7GA 3GEPA 1UP7A 4XI9A 4H60A 2BMDA 1HLFA 3UPDA 4P1ZA 3AHCA 3WRWA 2GBIA 4OHYA 1L5HB 4ALNA 3ZU4A 3JX9A 1PTJC 1J42A 4LOJA 4IIYA 5LP6C 3ZU3A 3PNSA 4AJIA 3ORYA 1OREA 4E6EA 3P9YA 4U2FA 3TNYA 5EE0A 3VX4A 1MFZA 2G4LA 5EJMA 5F77A 5F7ZA 3T61A 5A06A 4JQZA 4AKHA 3MCZA 3NJ8A 4U7PB 1HK7A 1M2OB 2ISQA 3A9VA 4OBXA 4GI2A 5GOZA 1B3RA 2ZUCA 1DKOA 3GROA 4UBNA 2NTEA 4MH0R 5CVEA 3B1YA 5HTOA 3HKEB 2UZ4A 2BGIA 4I4CA 1NXTA 3DF9A 1G5FA 1JG6A 1QJ4A 1S6YA 2HCBA 3FJ1A 3GDOA 1UJMA 4KAFA 3U81A 4L85A 1F4LA 3QSGA 5EFOA 1PG5A 3M6FA 4PC7A 4QPDA 1NVUQ 1WDLA 1ZI8A 3AVVA 2JGKA 4BNVA 2J3QA 2B3TA 3N9IA 3UHJA 3HV0A 5FBKA 3DLBA 4P4LA 2WAMA 5ICSA 1PK9A 3W78A 3V4PB 4L6CA 4KW7A 1LS1A 1NKTA 1AKRA 4J1QA 3JQ7A 1GZUA 3NASA 4B7CA 2FPRA 5AI9A 1QMGA 4IQ4A 4R81A 3IHWA 4IRXA 4ZAYA 4ABYA 4TKVA 1ZINA 1DG1G 3GEMA 3FUWA 4HVLA 5BR4A 2PL5A 1WV1A 2ZKLA 2DUUA 1DL5A 1ORDA 4RYDA 2PPLA 4H7JA 1TZ2A 3HI4A 4BMOB 1ECFA 2H2IA 2X40A 3ZIUA 4DLYA 3P0EA 4MS4A 1KQGA 4I14A 4WZAA 4JV5B 3ZLJA 3EDYA 2GD0A 2BRUC 2E1RA 2HK7A 4OLHA 4N0EA 2QUBA 4YJHB 4DM3A 4MQFA 4FI3C 1N0VC 3RS5A 1SHUX 3AF4A 4DQVA 1I2CA 4V0RA 1JMVA 2AB0A 1SQ0A 3LCRA 3OPYB 4ZANA 4LBVA 2WEKA 5E7JA 5K01A 4FFDA 1IEWA 1JR4A 1SD2A 3DYBA 1XDGA 1T9ZA 4PFKA 3ZHUA 3PD7A 3M89A 5E6RA 4W9MC 3HV2A 4LF5B 4JBNA 4X00A 4N6GA 1TUBB 1V7PC 2R4UA 3LU1A 4YWHA 2IUUA 1A9ZA 4X41A 4RPHA 1SIWA 3OHPA 1I2ZA 1VE6A 4F4JA 2COUA 1QGUB 3NEPX 4L15A 4Q15A 4BHTA 2NSDA 4WN9A 2DBVO 3DR3A 4G85A 5A9RA 4CT4B 3I5XA 3JVEA 4E2WA 5E9QA 3A4VA 5HF6A 2WMOB 5TJHA 4DSUA 2REXB 2HADA 4RK0A 2AOTB 1KFKB 1ORRA 2XIJA 1EZ4A 3HYSA 3IP6A 4LJ9A 3REOA 1GQOA 3SHWA 2E4WA 2YZMA 2B25A 4MPJA 3A1CA 4FDTA 3RS9A 1VIMA 3IUEA 1OILA 2Z56A 3L07A 4GLLA 1C1HA 3T9AA 1BE0A 3MB8A 4XGIA 4KDEA 1K7CA 1M1NB 1RYYA 4BRUA 1FPQA 4CN9A 3D8NA 1GGFA 5EHXA 2OBMA 1KSHA 1XMXA 4JCCA 4LWOA 4CTMA 3NVAA 5HOEA 3A70A 3TIIA 3AMVA 2G67A 3RBXA 3EXIB 1NL3A 3E58A 3ZKWA 2IHYA 3QPVA 1KI8A 4PLGA 1PFKA 3GLIE 1I9GA 2HMTA 4HQFA 3TSOA 1NBMA 2C5LA 4UBLA 5BO5A 1YC5A 3RRFA 1NLMA 3WFZA 3S27A 3P20A 4JBWA 1R15A 2HCRA 1OLUA 4GVPA 4OGKA 3EXFB 5I9IA 2VF4X 1MC1A 1FOEB 2RHOA 3QUCA 2ZRLA 2I78A 5JS2A 1N36B 3ADKA 1T3ZA 2I3ZA 3MJHA 5I7HA 8ATCA 3ER6A 2IYOA 1IQ0A 1ZX1A 1COWA 1FXWA 1ZSVA 1KY5A 1PU2A 2BWJA 2MSKA 2QLLA 3IJPA 3PWSA 4BX0A 5LN1A 1L3IA 4C4AA 2MSCB 4R7GA 1W7AA 2AKEA 9MHTA 2R11A 4MARA 4P0PB 2B1QA 1KA9H 2PBLA 3ZX5A 3PE6A 4PEVA 2B4RO 3NYQA 2JIZD 3TZCA 1KXZA 3C6XA 4OIFA 4R2LA 2XMDA 5SYMA 3D2AA 3U3DA 1T8WA 2I1QA 4IY1A 3W5JA 1NT4A 5KSWB 3CZ4A 4M55A 3LX6A 1R50A 3L82B 4B43A 4FHCA 5L7YA 2PMFA 4S0ZA 1BXKA 4TYMA 4B3RB 2QMHA 4R5MA 5JH7B 1MH9A 2R66A 4EY7A 1KSJA 2QZ4A 5KWJA 1UEIA 3GFBA 4DCCA 3B3JA 2YVAA 2HLPA 1P6QA 1PHPA 1HFEL 2YZKA 4V0ME 5DTIA 1PDOA 4I3GA 1L7AA 3D3NA 4G8JA 5EMJA 1OXXK 1Z0KA 4P38A 3LBFA 1I8TA 1P7VA 3SEQA 1LS6A 1JG2A 3LV8A 2OP1A 4XRRA 3DJFA 4WD3A 4I55A 4NATA 5EHQA 2LRHA 2IVZA 3OIYA 4CM1A 2DJ5A 3CR7A 4XYLA 5DNUA 4R8SA 2QRHA 2GPWA 3MT9A 2MSWA 1GG9A 3J81k 2GCNA 3FUUA 3A6GA 4Q66C 3A28A 4YYEA 2X8LA 2KM1A 3NT2A 3EVGA 1LNQA 4P53A 2IYWA 3RUPA 1M6VA 4JH0A 4CLDA 3FPEA 3DL4A 1T36B 1XZQA 3DYVA 3MGAA 4FFOA 4N54A 5HILA 3ZPXA 4DCUA 4PQEA 5DCYA 2ZGVA 1QORA 3PGJA 1E9AA 3QLUA 3KOXA 2XCOA 2LKCA 5D51S 1N2IA 3ZXXA 4XX0B 4RQTA 3SQNA 2A5YB 3DBRB 3NHWA 4M22A 4HN4B 4PLTA 2ZG6A 4ND8B 1EX7A 1LI7A 2M1ZA 3DKPA 1BHSA 5A7GA 4DMRA 2YRWA 3A4TA 2FZCA 3NWEA 4Y0AA 2PZGA 1GGKA 3ORFA 3R7BA 1T0HB 2CXSA 3CSDA 3HUUA 3GEBA 1OF1A 1TD1A 4XUCA 3R7SA 5FV4A 5KTNA 3RTAA 1QRUA 5JNVA 5A1TA 2XE7A 3M81A 1E59A 3M9LA 1BN6A 4A0SA 4L07A 3SHQA 1YRQA 2Q5IA 2YWHA 4JB3A 4P4GA 3G3EA 4L28A 5I8WA 2HKIA 1TZCA 3AEZA 3AP3A 5CJ2A 5FYQA 1ONPA 3AIKA 3DJYA 3ZEIA 3EMKA 4E1VA 4HDSA 5JQGB 2P9CA 3FDXA 3H6HA 2P6MA 5ALOA 5FQNA 3BB1A 1LJ8A 1YASA 4G5GA 2CVZA 2GXUA 4WECA 1J90A 2UVQA 4K6OA 3VGPA 3CX6A 3L3BA 4E51A 3GRPA 1XV5A 1PJLA 3MFQA 4ZRMA 3FMOB 3QBTA 4KAAA 1YE5A 3M4ZA 4R83A 3UW1A 1XGKA 2AZXA 2BR5A 5IX8A 4QUGA 4YGXB 2ZRBA 3RVNA 2CLMB 2ZM6B 1UFOA 4HAVA 1FDTA 1KI4A 2CXOA 4QTXA 4OBEA 4E5SA 3VZPA 5JANA 2PH5A 4BAUA 2XZPA 4IZHA 4S1VA 2CK3A 1VKRA 3CPJB 2XYVA 3PC4A 4JLBA 4PN3A 2NNWB 5IDWA 4CV0A 1Y81A 1E1QD 3U39A 1BU5A 2AF3C 4PNHA 1X87A 3SC2A 5AKGA 4UPVA 3OETA 4FGUA 1QC5B 4PZEA 4BWYA 2C2MA 1W19A 1VRVA 2I4TA 1P1HA 1T9BA 4ZU3A 2ZUEA 3I2JA 2GM9A 2IU6A 2VNJA 3PENA 3R9KA 3VHXA 3ZQKA 5A3JA 5SYAA 4Q7LA 3AXTA 1VB5A 2Y1KA 1LLDA 2XWJI 3DLIA 3KTDA 3ZZMA 4HATA 5ES3A 2FFJA 1Q5PA 3RC1A 5JFOA 1Z4JA 2WB4A 5HYVA 2Z43A 3PPYA 5EUQB 3DE3X 3TQSA 3SLKA 1Q95A 4WJZA 1VB3A 2WSLA 4DXDA 2E55A 1L1RA 1Z73A 1QHNA 1NUSA 1WZIA 2XVAA 2FPPB 3LBAA 4G26A 4JQYA 3H9JA 1JEAA 1AD2A 4RFSB 5FPSA 4C0HA 4YGYA 3AKEA 4EW1A 5WRFA 3F96A 5NLLA 1WJGA 4QYIA 1OAOA 1N5MA 2RONA 4M8NE 4NENA 3F49S 5DN6D 3KV1A 3R7AA 1NDQA 5U1PA 3DPUA 3K2EA 2HA4A 2RAVA 1TK9A 2ZB8A 3AL3A 2EJUA 3CH7A 1O54A 4NMXB 4QJ4A 4XSVA 4KUHA 1UM9A 2UZ0A 1QQ5A 3ZGYA 5K3CA 3DDNA 2SKEA 2H4YA 2ZJ5A 4XD2A 2ATXA 1JH9A 2Z2ZA 4MYUA 2SKDA 4GSKA 2DQSA 1PJ3A 2CZCA 4WCVA 4YJ2A 2CDBA 2Y2UA 4TL6A 1MP0A 2XHEA 3HJGA 4L74A 1K6EA 1PV2A 3VUFA 1SBIA 5T3YA 2X1LA 1U81A 3ZLBA 3ZGNA 1JHRA 4F21A 1N2HA 1ZG3A 4IDQA 4P86A 3TX2A 1N34B 3H17A 2V9PA 1KK1A 1CF9A 5LQSA 2PD3A 3FYCA 3ZQ4A 1ISMA 2C5FA 3CNNA 3QPAA 1T1RA 1WKBA 4DDVA 2PUDA 2NN3C 3MWDB 4U9HS 5MGNA 3I9V1 5CHEA 1Q1GA 4L6IA 2ZUVA 2PS1A 4X1IB 5EESA 4PIVA 3W5UA 2DHCA 3D8TA 2GLXA 3G8BA 4A2QA 5FADA 3UJPA 1NM5C 1V7CA 1MR3F 2J46A 2JAUA 3AB8A 4MPPA 4OTZA 2I2BA 4WHMA 3W90A 5ALYA 2PKWA 2V6BA 4C4YA 2DR2A 4PBSA 4FJ0A 4EG6A 4X8OA 2V97A 2QTGA 3EFBA 3CJTA 2J3KA 2NZJA 5EERA 4OLBA 2AGVA 3QE3A 2QXTA 2IV2X 5LLDA 5CR9A 2P40A 4NV1A 3S1AB 1FNSA 3LYHA 5CNMA 3VO2A 5E1OA 2NX2A 4BRSA 2ZROA 1O89A 1IG3A 1UBNA 1T8SA 3EG9B 4FZRA 5DHUA 4A0RA 1WXHA 2RJNA 1OASA 2IIQA 4OHCA 4N48A 4LZWA 3RWOA 1ORVA 4YMIA 5CA0B 1HG0A 2JIBA 2C00A 3BIFA 3IAFA 2GNOA 2J4FA 4N3AA 4HQKA 4BIMA 4GMKA 4W5RA 4YAEA 2ZSBA 1RKXA 4GXNA 2VNIA 2WSIA 3PX2A 4F5EA 5KQSA 1W85B 5HK9A 2H00A 3HFRA 3WIDA 1HM5A 1YXMA 1NBAA 4W4TA 1N4DA 1DLJA 2JHCA 1IM2A 2NO7A 3H2SA 3BRSA 4NS1A 4Q4JB 3QNWA 4CKCA 1W36D 2QBYB 2WJZB 3FSEA 2IP1A 3JVVA 3RT1A 3R77A 5FAXA 3VOTA 2QM8A 2PX6A 3E27A 3FZQA 3PNPA 3LUAA 4IJ5A 1DSSG 2EZUA 2VHVA 3DMFA 5JVDB 4ARZA 5BN1A 4B0PA 4M21A 2WU8A 2NSHA 3H2HA 3M2TA 1GN8A 3JV7A 4HY3A 4KXNA 4MA4A 3TECE 4HWPA 4YV1A 2OV3A 4RAQA 1OH8A 2ZXFA 3G13A 2YMQA 3D2CA 3CLTC 3MJTA 4MWDA 2QN8A 2NUAB 2IHJA 1OXUA 3NH9A 4IQ0A 5THQA 3S4YA 5CDYA 1DCFA 4MGEA 3WKDA 1I6MA 1NAHA 2ZWPA 4EHLA 2IHBA 1EJ2A 1TC2A 1ZD9A 2A4MA 2NV2B 1D6SA 3DDWA 3IDSA 4X8LA 2ZS7A 1Y8ZA 1MDBA 2EBUA 2G1KA 3WAJA 5KO2A 1SC6A 2YVUA 3DMTA 2QL5A 2HA2A 2YC2C 1NC3A 1XU4A 4D4MA 1MB0A 3TD6A 4DRYA 5CLQA 2F1KA 3CB2A 3BB3A 3EQ8A 3IMFA 4RF5A 3WISA 3G17A 2AD1A 4Q3EA 1QH9A 4UHEA 1B23P 4JCOA 3FR7A 1OQAA 1UJ2A 2BTQA 1PW5A 3OUUA 4WNYA 2JLXA 3T0GA 5I3CA 3DBLA 1RCTE 1Y63A 1G7CA 2Q2VA 4GWGA 3NIDB 1BS1A 2QQ0A 3FKSD 3A0UA 2XE4A 5M7EA 1J0XO 2XUKA 4YRTA 5HNKA 4R1MA 2O05A 1AMUA 1UJ6A 3G2QA 4QFCA 2R6GA 5JXHA 1D2GA 4LMRA 4Z51A 1DAEA 1GPLA 1XNQB 2FTKE 5BNWA 3G2JA 5JE8A 4B32A 4COOA 3TIXB 5BMOA 3WP1B 1DO8A 1I3NA 2UVPB 4Y3UA 4RPCA 1H22A 4ZICA 1D2CA 5KJ1A 1BDBA 3ZVMA 2DT8A 4C6TB 2LD4A 4KLRA 4J0KA 5TRTA 1RYBA 1QX3A 2YFYA 1CUBA 1RVV1 2R8PA 3GARA 2QSJA 1GHTA 3JW8A 4HQOA 4WCFC 2AG0A 1T6YA 5C8ZA 5KU7A 1VLJA 2OUKA 4H1VA 4ZVVA 3WLRA 4J0HA 4O1IA 3ZU5A 3PVZA 2CBXA 4BNTA 3A1EA 2FEWB 1BE6A 2JEOA 4XIFA 4GYWA 4FN5A 4LNHA 3UAGA 3H5NA 1JYSA 4EUNA 1JEYA 3D3JA 4DC1A 3TE7A 1UDWA 5B3JC 1JKFA 2BL4A 5CA0F 3C3BA 2JS7A 2P67A 2V54A 2R751 4JYMA 2PMEA 3AKYA 1GZVA 5DYNA 5ERGB 1QRSA 3NKLA 4OAOA 4MAMA 2EDAA 3I2FA 2C99A 2G6TA 1X13A 4DYHA 4AZ3B 1XTRA 4JLDA 1SKMA 5GADl 1J39A 1OUMA 3JR3A 3PFGA 2VSFA 3QIAA 3N2LA 4X3PA 5L3RA 3HA3A 3WK5A 1W96A 1XMPA 4P3OA 5CDFA 5EMMA 4D3SA 5MGBA 1L4LA 5IVKA 1BCRA 4NI5A 5BWMA 1Y5IA 2GAIA 421PA 5AVWA 3PUHA 4QATA 3TSZA 1Z13A 1HH4A 2DOKA 4L7VA 1MOSA 1UEJA 2QX9A 3K30A 3SJ7A 3QQ5A 2EKPA 2IEAA 4FZ5A 2JGLA 4K28A 5JVDF 2CCKA 3C48A 3GK3A 1L2TA 4JLSA 1FDIA 2NXNA 4UBIA 2FQWA 2HRCA 2CFSA 1P17A 2LDXA 3IIMA 4XB1A 1QO0D 3M49A 4OJKA 2P7IA 1FXSA 1YFJA 2DC1A 2YCBA 1U8TA 3CHYA 4J29A 4UQOA 1Z0SA 2GK3A 1ULSA 4N47A 3X2EA 2VFAA 4ZP1A 4BKOA 4RM3A 1O5IA 4WZZA 4XCVA 5HQJA 2PMDA 3D1JA 3GPCA 3N74A 2XMCA 3KYIB 2YWCA 1Z74A 3DDOA 4N5IX 1V3UA 3GJTA 2Q4BA 3LVFO 4PPGA 1E6LA 3R6WA 4OGFA 4K46A 1QF6A 1YOVA 1TO1E 4QBTA 3TLBA 1GXSB 2H54A 1VPLA 3SIRA 3NQ41 4HHEA 4OHFA 4XM0A 5CMLA 4OFBA 3WQQA 1Z35A 1X7YA 4M36A 1VFNA 4E12A 4MUYA 1NVVR 3D8UA 1O95D 3MFYA 4ZAZA 3ILHA 1BQ4A 2I6XA 2IELA 2ZB2A 3INRA 4Z9AA 5G41A 3MHPA 2VF7A 2XUAA 2B8EA 1GKKA 3TAHA 4MRNA 1C9KA 2G76A 3KC2A 2D2FA 3L6EA 2ZYHA 4OQNA 4D98A 2XJ9A 3CPHA 4TYWA 1XYYA 2GZDA 4LBZA 3ZXUB 3FJOA 3GGSA 1GM5A 1UPTA 2ZULA 4EQZA 3DF7A 3G1WA 4CIBA 4R3UC 2ZRQA 1WIWA 2O1WA 1IONA 1H3FA 4CXMA 1ZONA 3FFAA 2ZE8A 4JL6A 3HBNA 3QHPA 3QNMA 4M53A 4NBWA 4WZ6A 1BCSA 2WHEA 5DYWA 5FTMA 2GF0A 4P2GA 3TOSA 4R1NA 4JMPA 3HUDA 2CSXA 1QM5A 2G6BA 1PK8A 1NG1A 3IPRA 1YR9A 1U99A 3BUSA 3K6JA 3IC5A 3KL4A 4HAOA 2H1VA 4V1CA 3JQCA 5ALGA 3B5IA 5E6SB 4PYLA 2ZB7A 1PN3A 4MRMA 1CY7A 3EEIA 3LWBA 2BFEA 2Z1NA 1L5WA 4G5RA 4MXDA 4J2HA 1E5VA 5FEUA 3VYWA 3L1HA 3HJFA 3MTJA 3P5SA 4K2AA 5A05A 1I4DD 2OV2A 3GRCA 4QVKA 4YP7A 3U1VA 4WLFA 4DR5B 1G2QA 3F74A 5AW0A 1W0JD 1I1QB 2UZ3A 2YR0A 4KVZA 2QRGA 1XYGA 1E18A 1ODFA 3CXUA 3GAFA 5KKNB 4FWTA 2Q5CA 1VJDA 2ISSD 2JGRA 2TMDA 2PQ2A 1Q19A 2CNBA 1RQXA 4TKUA 5F33A 5IAAA 1CVIA 1WTCA 3FBTA 1N9GA 1OLOA 3G2IA 1JQ3A 1Y6QA 1L1QA 1RZ3A 2OGWA 2P0YA 2YBDA 4OAPA 1X6VA 4BEWA 3DLHA 4DMHA 1CUDA 1JEJA 1IZ0A 1MB3A 4TYQA 3UVEA 2P41A 2YV1A 2FWPA 4L02A 1MAAA 1AKMA 4EFNA 1ID8A 3IALA 2O2DA 4O8CA 2R5WA 1OLXA 2BFBA 1QIGA 1NJ8A 3N58A 5IVHA 5I9TA 5ETJA 1W4AA 3V7YA 5KQLA 1Z0IA 2QRPA 4U6QA 1E66A 4B74A 2OSBA 3W5AA 1MH1A 1C1DB 1T26A 2O7SA 2RKOA 2F43B 2YHAA 3DVRX 1GVHA 2IEZA 2JVJA 3U1TA 4DB2A 3AVYA 4CMAA 1UXHA 4MJXA 4WE3A 1OXMA 4Q7KA 3VVCA 1JZQA 4FYWA 5BT9A 1HV8A 3Q10A 5EJ9A 2C7BA 1I6LA 1I0IA 3UICA 3NDBB 4MPDA 2AEJA 4EYEA 4DFDA 1P80A 3C70A 3FNIA 4N1AA 3WVNA 4QZVA 4KC0A 2XHZA 3H11B 4OQZA 4HQRA 1OVGA 3UJBA 3WOHA 1H4QA 1F0PA 4RVHA 1XZAA 4CFSA 4ANFA 3IHKA 1Y6GA 2O50A 1VQ1A 4AZ0B 2NSLA 1F8GA 2Y1XA 1ENYA 2BKXA 4HQLA 2YQ5A 1DINA 1WZUA 4M9ZA 4P4NA 3M0EA 2WT8A 2RK6A 1GFIA 1YBVA 2IF0A 2VLBA 3GQBA 1AT1A 3MQ2A 2ZR9A 4HX9A 1BYIA 5HVNA 1FQKA 2HBZA 4RY8A 5LOVF 1W581 4CQJA 2HYIC 3K8QA 3SYTA 2BHNA 4EY6A 5L45A 1WCXA 4BV3A 1E7SA 2FV8A 4JEHA 4MQ4A 3L4JA 3GLQA 1L4KA 3B6EA 4PWZA 4XASA 1SKUA 4NY1A 3OLCX 3HR4A 2H1WA 1RM5A 1MJGA 3FI0A 1EQUA 1NV8A 4XE5A 4F56A 3ZY5A 1CEEA 3HU5A 4M7OA 1IWOA 3AERA 1XG5A 2XWQA 3DMHA 4E2XA 3AR2A 1HE5A 3N39C 3MWKA 3FSRA 6REQB 1JHPA 1E1DA 1QANA 4QDOA 2IKQA 1JQDA 3DE4X 3IKTA 3AR5A 1U1CA 3DB1A 5ICCA 5I45A 2DPMA 5I6DA 4O4IA 2IXTA 5AM0A 4NS4A 1KZ1A 2X4IA 4DIKA 5IAOA 3H5TA 2HK8A 3GLFB 4AKEA 4FE4A 2IZ7A 4X65B 2VTVA 2O3RA 5D86A 4LEIA 5T8KA 5DM70 1SCQA 2I2XB 5A03A 4Q1BA 3W1WA 1JAYA 1KKUA 1NVGA 1VPTA 1CU1A 2R1VB 2VRWA 1CP3A 2QQEA 2XGGA 2GEJA 3HPRA 4MZDA 2GI4A 3OTGA 3HVKA 3ZOZA 2GUWA 2Y1FA 5FTLA 3L01A 3QFSA 1UKCA 4YFVA 1JPJA 2HSJA 3HBJA 2ZRNA 2K7FA 1TT7A 2QMOA 3RAEC 1DQYA 2V1XA 2G8NA 1CHNA 5JRDS 4IOMA 4O2BA 1G63A 1RHJA 2JCVA 5FPTA 5F64A 3SOZA 5A9SB 5TIIA 2YH2A 3D6NB 2OQIA 4OI4A 2G1AA 3FTPA 3VR0A 2VQEB 2QX4A 5LD2B 4AJKA 2NTVA 1Q84A 1WX1A 1PR4A 4B3JA 1UP6A 4ND5A 5E6UA 1YHYA 3RWMB 1FSPA 1NT2A 1A9OA 2ID4A 5KNLA 4DV1B 4P08A 1VG8A 4NXMB 1U2TA 4ZCIA 5CA1F 4D1YA 2WF7A 1RWXA 5FUVA 4LZAA 2QVCA 2F1IA 1FQWA 2NYAA 3C16C 4Q9NA 3N8GA 3U7EB 5JZBA 1ZW6A 1XQWA 4L4UA 1AB5A 1DRKA 3MINA 3OC0A 2P2CA 3WHPA 1X39A 1QFYA 4KQ2A 2QENA 3WL6A 5BVHB 1Z2CA 1GV1A 1G5QA 1N6NA 1NX9A 1D2EA 1JHZA 1NBMD 3U3KA 5K0BA 3F5DA 1PGJA 4H4CA 3A1VA 2JIMA 4KE9A 1KKLA 4PCUA 3W6PA 3NOVA 4OG2A 1ZEMA 2BDEA 1WMSA 4ENWA 1EBFA 4UVDA 3TOCA 4AC9A 2F4NA 1Z4MA 3ROEA 1JKMA 4YJ3B 3T5TA 3N76A 1UBJS 5LKRA 1M6YA 1RU3A 2GQ0A 2HU2A 4P84A 3GUZA 2J6IA 3UENA 3QELA 1G6OA 1XPJA 2EATA 1LPNA 1RQRA 4DNPA 1COWD 4RDIA 3FAZA 4XOUA 1VYHA 1XOIA 2VA8A 4F3KA 2W4QA 4ER7A 2J3JA 2BH2A 3MCVA 1NJ6A 1SY7A 1M34E 3DDZX 2HIMA 1GSIA 2QROA 3AUAA 3V8VA 1W6RA 3DKRA 4TRMA 1LWOA 4ZVTA 2E9SA 4GXQA 3PLRA 4K1XA 4K9QA 3KNZA 4TSRA 5HGJA 4CJXA 4MDEA 3ZDRA 3OD1A 1IJEA 1COZA 5AI8A 5JWHA 3Q2IA 3LT2A 1XJWA 2GEUA 2LE0A 3DP7A 4R9NA 3UOGA 3GW8A 4R2HA 4DIMA 3UJAA 1U1DA 2HRDA 3BCRA 4K9RA 5CK5A 1PJAA 1A2KC 1DRWA 1MC4A 2XYRA 3IOBA 1NG9A 3LG2A 2C2XA 3IHTA 1I7PA 5DX0A 1BVUA 4Q01A 2CWDA 2FEAA 3LA6A 3W2GA 2YWRA 4YQFA 1OH6A 5CNKA 1OAAA 2J6BA 3N6VA 2DAPA 5KSPA 4RTMA 3FCSB 3ZDYB 4QJIA 3SM9A 2JLAA 5KC9A 5IFKA 4F45A 2C4MA 5BWNA 4I7EA 1ZMTA 3O74A 4ZODA 4G9EA 1BDHA 1KFBB 1UMKA 5A0TA 1DWUA 2I4LA 4GIBA 2H08A 1YNSA 1D04A 2JZNA 1GAQA 1CZRA 3MSCA 2AZDA 5FA6A 3REQA 3SNHA 3KDAA 1XHEA 1SULA 3IMEA 4K05A 1QVZA 2OGSA 3PS9A 4K3VA 1C4KA 4OGLA 3NTLA 4PXYA 4YJFB 5HG0A 4JXXA 1G7RA 4HTFB 4WY2A 1WTAA 1U3FA 1YI1A 4EX7A 4B6RA 4ZMSA 3GJ8A 5G1PA 3UG6A 1QTRA 1MIHA 1NF9A 3SE7A 1MTOA 2NUPA 3FZGA 5G3ZA 3HK2A 3HCAA 4Z4HA 4OXYA 3N2ZB 5AVQA 1THZA 2BISA 3EYAA 4N3NA 1X7WB 4UDOA 2H63A 2JLSA 1KEWA 2G88A 2JA2A 4YLEA 1G20B 2WQZA 1UANA 1AGXA 1OWOA 3NAMA 3OFND 4IWYA 4NKRA 4R2MA 4EYOA 2CV1A 2PJRA 4BQOA 4BU1A 5ISMA 2W2VA 3PDWA 2PE5A 2H1LA 1Z08A 2DQYA 3MT8A 4BCCA 3EEYA 5EHZA 1AVTA 2O8BA 3DQZA 5EEHA 1E4EA 1ZITA 2REBA 3UAWA 4D0NA 4F3YA 4J0JA 3T95A 1CY1A 3H3FA 3GLHA 3TQRA 3C3YA 1DEXA 1Y82A 2I22A 2I3BA 3AV3A 1FMCA 5IUKC 4CM5A 3FPHA 5MN5A 3RCBA 3UA4A 1WHSA 3ONFA 3L7DA 4A16A 1T4DA 1WXFA 5KYYB 1QGOA 3I73A 2CK3D 1A5SB 3SQLA 1XQ1A 3HHEA 3D5TA 3NGXA 4JXZA 4BMXA 4Z5XA 1A9QA 1U9YA 3LFHA 1BD4A 1E9BA 3OPVA 2I4RA 3AZPA 3FJYA 3Q5DA 4G01B 4J7CA 2WD7B 3WB9A 2B78A 4D44A 1U9JA 4JODA 3O8NA 1JILA 1V8OA 3WB0A 1FFWA 3UK7A 1ZIPA 5DP2A 5IJAA 4BN4A 4DDKA 4P0QB 2H7CA 3A6LA 1YVDA 3B8EA 5GAJA 4LOKA 1WABA 3INNA 5AKJA 4JELA 3WJAA 2V7QD 2XRFA 3NHBA 3F71A 1YR1A 4O8ZA 4XR9A 4E30A 1YR3A 1E9DA 2V6IA 1CXZA 1LBSA 1SOVA 4L16A 5LJLA 2A2ZA 4M87A 1DFGA 3P7MA 4X7MA 3QU4A 5DLYA 2Q3CA 5HJ7A 1VC2A 3EOAI 4XM2A 3ZNPA 3B2NA 1H42A 4GSLA 5DLEA 3ZJYA 5F3WB 1Y5RA 2DULA 1QQAA 1IN6A 1RBZA 3LPDA 1LC0A 1UBEA 4ARBA 2QRNA 1S4MA 1WULS 3KUXA 4FYKA 2CXXA 5LC1A 1X1BA 2GCIA 2JIRA 3E15A 1NC1A 1X0VA 3QMVA 1GTVA 3STWA 3WR5A 1E5QA 1A98A 5UKDA 2V6FA 1YQ9A 2XZTA 3OQ1A 5CD1A 1BVHA 1SUAA 2QAJA 2GERA 4XWAA 2BKUA 4B84A 5AD1A 1VYVA 1O5OA 3SSNA 4BVEA 5BSFA 2CWWA 4EMUA 4ZO4A 3L4SO 1JAXA 2DRIA 3EVEA 4L5JA 4QAQA 4MROA 1KDRA 4TQGA 3CNEA 2XOKA 2AG5A 4MRAA 4ZJYA 3KEGA 5L4SA 3N2GA 1QU2A 3H13A 4RLQA 2WAXA 1DXOA 3EPHA 3ZW8A 1BDJA 2BE9A 4D6XA 3V4SA 2ZBEA 1REQA 3TOZA 4B6OA 2I66A 5BYJA 4LUCA 5BT8A 1WETA 1GRVA 1ZFNA 4UNQA 3ICEA 3TLCA 2ZUWA 3G88A 5CDTA 2I29A 5AUOB 1XTKA 1WQ1R 4LDQA 4D0GA 3E9YA 4TVBA 1N1DA 1ZOLA 2AW5A 3J7TA 4BKRA 4U7TB 1E9CA 5GZ6A 3T5MA 1IIRA 2G82A 1EZ1A 3AY0A 2XUIA 4MHOA 3VYRB 2JAHA 2QD4A 3TL2A 2VF5X 1QYWA 4IDBA 4EG0A 5JC1A 2B1IA 2QI9F 1YV9A 1A27A 3EF1A 4PG6A 1I7LA 5CVVA 1DQNA 2XDWA 3RS0A 1YTLA 4CKXA 5DJ5A 2BI7A 1A7KA 2O8EB 1U04A 3JQGA 3DC2A 2O2CA 1RRPA 1X8XA 1QV9A 3Q7PA 4O2AB 4WFJA 2UAGA 3RT9A 5C7OO 2JHFA 2OP0A 2PGDA 2XV1A 3GRFA 1K68A 3O2QB 3HXPA 3F6RA 3OJ0A 3MAGA 4GYYA 4HUQB 5HRUA 1IJBA 2FDRA 3NAGA 1QO9A 3UY4A 2AT1A 3IL2A 1LBQA 3MG9A 5JNRA 4LSWA 4JVSB 3KJGA 4MW1A 3O1HB 4EIWA 4EHKA 2C3YA 1WUHS 3COZA 3NV9A 4QVGA 4Z4EA 3F2IA 3JYHA 3FVWA 5FNVB 1LDGA 1KTVA 3T7AA 1GQYA 3ORHA 4LJ6A 5JMOA 1CIJA 3OJCA 3WG9A 4L2IB 1MCZA 2YRFA 4LSZA 1JDUA 4ESEA 2ZRMA 1VDZA 2JGJA 2OWDA 3AFNA 4KYIB 4K6MA 5B6IA 3M6MD 4OCZA 4PM4A 2E4AA 4IQ8A 4UMDA 1YB1A 3ZE6A 3G0CA 3L0OA 4BMSA 4D79A 1FUIA 3OQPA 1CIVA 4X62B 4CKWB 3IB3A 3OQHA 3WLQA 1GL3A 4ZI3A 5J1SB 2O14A 3N2NA 3ZLUA 5FH9A 1LW7A 3G2HA 4D4IA 1WEHA 3DNPA 3KZMA 2VUUA 3DWFA 3KQKA 3T3MB 1DAOA 1OU4A 4FLEA 5FWYB 2G83A 1P2VA 1P4RA 2ZJZA 4NK5A 3UV3A 3ZOKA 3TNDA 2A0YA 3TKLA 1TZBA 3I9V6 1U28A 2WHYA 1AXRA 3CEMA 3HCNA 2ZRCA 3IGFA 5DLPA 4C1NA 5CPFA 5KAPA 2OZLB 3U