5EVJA

X-ray crystal structure of crarsm, an arsenic (iii) s-adenosylmethionine methyltransferase from chlamydomonas reinhardtii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
b'APPPAVRAALADVPTEVKEKFWGCGNPIPAGIEGLRVLDLGAGSGRDAYVAAKLVGEKGSVTGVDMTPAQLEVAISHADAYARDKLGYGKSNMTFIQGEIEYLDRAGLEDSSFDLVISNCVINLSPDKARVLSEAYRVLAPGGEMHFSDVYVDRRLPQSVRSHPVLLGECLAGALYNNDFIRLARKVGFTDPRQLEAEEIQIHDAELRDQVGEARFYSITYRLFKVPGQIEDLAEDYGQVAVYKGTIPGHSHAYDLDDHHRFVTNKPMLVAGNTASMVGESYLAPHFTIIGDRAVHYGQFDASGPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenite methyltransferase
publication title Crystal structure of CrArsM, an arsenic (III) S-adenosylmethionine methyltransferase from Chlamydomonas reinhardtii
rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transferase
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5evjA01
5E9JA 2FPOA 3MERA 5D1HA 4BLUA 5BP7A 1OR8A 4BP3A 1I1NA 3QOXA 5GIPE 1EIZA 5EIWA 5GINE 3LPMA 2O0LA 3FUUA 3FZGA 5E1MA 5EMKA 1P39A 2YUIA 4KW7A 2IPXA 5E1OA 3NVKI 4M7RA 2ZIEA 3EMDA 3GO4A 4KIGA 4U7PB 4POOA 5ICCA 3OFJA 5DM4A 3VC1A 4DCGA 4RSRA 4YUYA 3NW9A 2I7CA 2PX8A 3JWIA 2YXDA 4PGGA 1G55A 5HIIA 3LBYA 2PT9A 2VDWA 3A7EA 5E1BA 3VC2A 1QZZA 3M6VA 3VSEA 4XUCA 5HZMA 5LR6A 5LQAA 1P1BA 3F4KA 2NNWB 3FPEA 3FUWA 5DSXA 1NKVA 3KPUA 4PCLA 3SMQA 4B17A 5HOQA 5GIOE 3LHDA 1TPYA 1EQAA 1UIRA 2BR5A 3PFHA 2PV0A 5E9QA 3HEMA 1AF7A 3UFBA 4KDRA 1I4WA 4R8SA 5HIKA 3AY0A 3MGGA 4FR0A 3CVOA 2AN4A 2P7IA 4FT4A 5F2NA 1NW5A 4DZRA 4V0QA 1YFJA 1VP9A 2PWYA 4RVDA 5HIJA 1VL5A 3EGEA 5EZQA 4YV2A 2E5WA 2ZZMA 4RTKA 1KYWA 2IP2A 1SQGA 3FTFA 4X61A 3Q7EA 4XUDA 3SSOA 1KPHA 4RTOA 4PINA 2CL5A 3HVJA 5C9ZA 3O7WA 4O29A 4EKGA 3L8DA 4CTJA 2PT6A 1BKYA 5FUBA 3KQPA 3LGAA 2WA1A 1KP9A 4HGZA 5BW4A 2ZIGA 5FHRA 3DTNA 5K03A 2UYOA 4DMGA 1L3IA 4IWNA 5DRYA 4AZWA 3E7PA 1BOOA 3KQOA 5DM1A 1YF3A 3JWHA 2IH2A 2PJDA 5FA5A 4PYLA 3KQMA 1VP3A 5CCXA 3C3YA 3TM5A 4HGYA 3OPNA 2EFJA 2A14A 3TOSA 2HMYB 1RJGA 3EGVA 2C7PA 2UZ4A 4CKCA 1VPTA 2NXJA 5KQSA 2YTZA 5E8RA 4GC9A 3EMBA 3SXJA 2ZBPA 1WG8A 5DTQA 3E05A 3GU3A 4WXHA 1NW3A 5HILA 2AOTA 4PYIA 1NE2A 2QY6A 2ZIFA 3G8AA 4YMHA 1EJ6A 3X0DA 5KVAA 1AQJA 4QVKA 1WZNA 2N47A 3G8BA 4H0NA 5EIFA 5FULA 5H02A 4E30A 3GRZA 4DM3A 3EPPA 5EVJA 1EG2A 4KVZA 4F86A 1R00A 4GOMD 1YUBA 3M70A 1JG2A 2NXEA 4MQ4A 1QAQA 3TR6A 1JQEA 2B3TA 2ZW9A 2YX1A 3P71T 5JUWA 3MHTA 4FSXA 4E2ZA 4BLWA 2IH5A 4AZSA 4ZTBA 5EMJA 2PX2A 3TLJA 5GOZA 2ZZKA 1ORHA 2PX5A 3REOA 3OZRA 3R0QA 4AUKA 3AXTA 3UJCA 1JSZA 2P40A 4RVGA 8MHTA 3PLAE 3KQYA 2AVDA 3EVZA 3I58A 4WVLA 2Q41A 2FK8A 4RTPA 3EVAA 3PVCA 4HH4A 4RV9A 2PXAA 1RI2A 1ZGAA 4R6WA 3SSNA 1JTEA 1JQ3A 1WS6A 5GWXA 4UOEA 5GM1A 1FBNA 1L9KA 4C07A 2PVCA 3BGDA 3RODA 3EEOA 3KHKA 4IV8A 4E31A 5E1DA 1P91A 1ZG3A 3CGGA 4YUZA 2IIPA 3FPGA 4ATNA 1R6AA 1NV8A 3C3PA 1PJZA 3EVGA 3GRVA 3KR0A 4P7KA 3TRKA 3UJ7A 4EQZA 2G70A 3KU1A 3GCZA 3BZBA 2LD4A 5K05A 1WXWA 1FP1D 1RJEA 3MTEA 5LQCA 5EOVA 2I9KA 3NMUF 1JG4A 3ID6C 3LX6A 5K0CA 2O57A 2QRVA 4LWOA 4HSGA 1AQIA 1R8YA 4RVFA 5FTWA 2JHCA 3THRA 1WY7A 3HNRA 3FTCA 3FYCA 3KPYA 3TKAA 3CJTA 4OBWA 1MJFA 3ERCA 2WK1A 3R3HA 3M33A 4Z2YA 2VS1A 2AOTB 2ADMA 2ORED 2HTEA 2NXNA 3KQQA 3B5IA 4HRAA 3K6RA 2XBMA 2YVLA 3T7RA 3R24A 2PGXA 1Z3CA 4R6XA 2FK7A 2VP3A 2XYRA 5F2OA 5DRTA 4ER3A 2ZCJA 4XCXA 4LECA 2B2CA 3ELWA 2EJUA 1XVAA 2NXCA 1IM8A 3G88A 3BXOA 3KQWA 5C0OE 5IH3A 4PIPA 3HCBA 3QOWA 5E2AA 5ERGB 2XVAA 1R18A 4GC5A 4PIMA 4QPNA 5EMMA 3S68A 3LDFA 4BLVA 5JR3A 4RTNA 3G2QA 3K0BA 3P9KA 1O9HA 4M38A 1R74A 3A4TA 3LBFA 2P8JA 2P35A 3DMFA 2B78A 5EC8A 5EG5A 5EHGA 1M0EA 3G89A 2KW5A 5C1IA 2H00A 3EVDA 1JG1A 3LDGA 4IKPA 1G8SA 3OE5A 4NECA 1ZGJA 2ZSUA 3HCAA 3SSMA 3UZUA 1EJ0A 4FP9A 3UJ8A 1UFKA 2JH8A 3HP7A 1SVUA 5CCBA 2OY0A 1RJDA 3TFWA 2Z6QA 3GJYA 5DXJA 2CMHA 5DX8A 3FPFA 3SGLA 2DPMA 3ELDA 4AZVA 1D2GA 4P7FA 3UJAA 3IHTA 3GNLA 1UWVA 3R9XB 4ISCA 3R6TA 3PX3A 2PXCA 3PS9A 3IYLW 2ONZA 2XYQA 3P8ZA 5DT2A 3LKDA 5ICFA 1Q0TA 3HTXA 1HMYA 5CVDA 5K8VA 3V97A 5K0JA 2G1PA 1X1DA 1O9GA 1QANA 3BGIA 4P7GA 2UYHA 1RI4A 4YMGA 1V39A 5BXYA 3GXOA 3T7TA 3I9FA 4HG2A 2Z6UA 4X1OA 4ER6A 2QRVB 4C03A 4RTMA 4RWZA 3CJRA 4ER7A 4Y30A 3C0KA 3ELYA 3LSTA 3QV2A 4QDKA 1R8XA 1XCJA 3AWIA 1KPIA 2GLUA 3HCDA 3HVIA 1SQFA 3SM3A 3UWPA 1L1EA 3GRYA 4C4AA 3FPHA 2GA9A 4GOLD 1B42A 5FCDA 4OA8A 3MQ2A 4C08A 3JWJA 3M6WA 4RTJA 3UJ6A 3NDIA 4OBXA 4OQEA 5DM2A 4E33A 1NW7A 2I62A 3ER9A 4KRGA 5FQOA 1BHJA 1H1DA 2P41A 2FRXA 4G56A 2OPBA 3DR5A 3BWBA 3P9NA 4X41A 3TKYA 1XDSA 1NV9A 3KR9A 4V0RA 5CVUA 3DLCA 2QE6A 4R8RA 4DQ0A 4YV0A 1QAOA 4AZTA 2OZVA 3OCJA 5CM2Z 2UYCA 2ERCA 1FPQA 2YXLA 3C6KA 5FQNA 2I6GA 3MB5A 3ORHA 4FS8A 3G5TA 3DMHA 4MTLA 4DCMA 3SVZA 3KPVA 3P2EA 3OE4A 2BR3A 4DKJA 2BR4A 1M6EX 2JHPA 2JH9A 5B1SA 3BKWA 3UJBA 5K09A 4FZVA 4QTUB 3EVBA 3LCUA 4CTKA 2F8LA 2G8NA 3O4FA 3HCFA 1KPGA 1ZQ9A 1DL5A 4OQDA 4E2WA 4EK9A 3P9IA 3G2PA 3EVCA 3A27A 4BY9E 5D1NA 2IBTA 2Z6AA 4GOOD 3Q87B 2ZWAA 3OFKA 2OBFA 4RX1A 5MHTA 3KPJA 1SUSA 1NW6A 3GIWA 4PGHA 1F3LA 3BKXA 3LL7A 2AOUA 2EG5A 5LQJA 4C05A 5EMLA 3DULA 3M4XA 3P97A 2AOXA 2PY6A 3UBTA 1L3CA 4C06A 4YUWA 3BT7A 4PYKA 4RTQA 3DLIA 3E23A 1N7IA 5U4XA 1G38A 1ORIA 3B3FA 4MIKA 1RI1A 5FHQA 4LWPA 2O06A 5EZSA 2R3SA 2YXEA 1PRYA 3GDHA 4QQNA 2FYTA 1I9GA 5IKMA 1WXXA 2ESRA 3I5UA 4CXMA 4XUEA 1X1CA 2EJTA 3PT9A 5G02A 2AN3A 2DULA 4FSDA 5ICEA 5K0FA 2QM3A 3HVHA 5HEKA 3U81A 3FTEA 4YV1A 4DF3A 2IGTA 4PYNA 3C6MA 1VQ1A 4GBED 5EPEA 2V7EA 3BGVA 2G71A 1QAMA 1G8AA 2AOVA 3GGDA 2AN5A 2GS9A 2FCAA 5EKUA 5KYGA 5FA8A 3PTAA 3RW9A 2AR0A 3KQSA 4RTLA 2P3QA 1NT2A 1XDZA 2BH2A 3TM4A 1Q0SA 2NP6A 5K0NA 5E8JA 5T6BA 5FADA 1AV6A 4GQBA 1VLMA 2P3OA 2ONYA 5FWAA 2BZGA 2G72A 2OB1A 4F85A 1QYRA 3VYWA 2H11A 5CVEA 4CWAA 2V74B 3P2IA 4X60A 1BC5A 3SR4A 3KKZA 1JG3A 2R6ZA 3DXZA 4MWZA 4RTRA 3FRIA 3PX2A 5EEHA 3OU6A 1G60A 1XTPA 4A6EA 1YFLA 3HVKA 4KDCA 5DXAA 1SUIA 2ZVJA 1NBIA 4U7TB 3D2LA 5DPMA 4X63A 3MCTA 1ZHFA 1G6Q1 3CJQA 2GB4A 4FT2A 5DX0A 3LCCA 5DX1A 3GRRA 4M36A 3EVFA 4YUVA 1RJFA 4PNEA 3HA5A 2ZFUA 4Y2HA 1RI3A 5DLYA 3KPWA 4BP1A 4QPPA 2OYRA 4EMSA 3LCVB 4OX9Y 3FUTA 3ER8A 3M6XA 2AOUB 2JHAA 3TQSA 3OZTA 2XVMA 1NBHA 2NYUA 3A26A 2IDJA 2IFTA 2O05A 3B3GA 3KR1A 2ZULA 4GOND 5HIMA 4RYLA 1KYZA 4KIFA 2PLWA 4GUAA 3EEYA 1DUSA 3OU2A 5K0BA 5LQUA 4DA4A 3LECA 2O07A 3LKZA 4PONA 2EX4A 4ER5A 1FP2A 5EGSA 5T64A 4P7JA 5E9WA 4YUXA 4PYQA 4KWCA 3P2KA 5EKXA 2B25A 3IEIA 3T7SA 1VBFA 3AJDA 4QTTB 4A6DA 2VDUE 3HA3A 3LDUA 4M37A 3I53A 3BWMA 5LQKA 1NW8A 2IDKA 5CVJA 3DMGA 4FGZA 2NP7A 2HWKA 5KQRA 2PWPA 4LG1A 1D2HA 2ZBRA 2IBSA 3B89A 3H2BA 3GWZA 4OA5A 5M5BA 2OO3A 5K0LA 3KQTA 5F2KA 1Y8CA 1RI5A 1MHTA 1INLA 5BW5A 1D2CA 4QDJA 4MHTA 1IY9A 1M6YA 1JQDA 3NWEA 4K6MA 3PB3A 5FWDA 5EQJB 1L3BA 3HM2A 4QQKA 4HC4A 5LQRA 1IXKA 1JTFA 4CKEA 2GAFA 4E32A 3UJDA 2JJQA 2JG3A 2QYOA 3DH0A 5DTRA 4E70A 1SG9A 4E2XA 1SKMA 2AOWA 1XXLA 1XDUA 1O54A 1XCLA 2ZBQA 4HTFA 3O31A 4C04A 5T67A 1FJXA 2P1DA 2PKWA 1KIAA 3CBGA 4PWYA 4PYMA 5DSTA 1N2XA 3UA3A 5HFJA 2ZTHA 4P58A 3B7PA 5KS2A 5CVVA 2CWWA 7MHTA 3EGIA 5DM0A 2P7HA 2Y1WA 4GF5A 2HR1A 5E2BA 4PCAA 3V8VA 1YZ3A 3BWYA 1EAMA 3UA4A 3THSA 5CIYA 1ZKDA 1JSXA 2OB2A 3OU7A 3IV6A 4L7VA 2CMGA 2HNKA 2VDVE 3PFGA 4RTSA 3HA7A 1TW3A 1T43A 4E2YA 2PX4A 4PYJA 3G7UA 3GRUA 2C7RA 3ME5A 3FTDA 3P9CA 5K0EA 2Y1XA 2ZWVA 3NWBA 2B9EA 3MCZA 4RVHA 1KXZA 4R05A 3HCEA 4ER0A 4PYOA 2H1RA 4IV0A 3NJRA 3NVMB 4F84A 5CD1A 2P3LA 3DUWA 2CKDA 1X1BA 1X19A 2AVNA 2YR0A 2BM9A 1YB2A 3A25A 3BWCA 3DXYA 5EEGA 1XJ5A 2OXTA 5EHIA 3MAGA 3BUSA 2BM8A 2IH4A 1JR4A 9MHTA 4QVGA 3WSTA 1F38A 1X1AA 3TPZA 2VZ9A 1HNNA 1P1CA 2C7OA 2ZZNA 5K01A 3I64A 3NTVA 3FUVA 2PXXA 2UYQA 3G2MA 3M6UA 2OKCA 5CUQA 1U2ZA 5DTMA 3G5LA 5GM2A 10MHA 2YQZA 3HCCA 3G2OA 4EKIA 5K0GA 4EVIA 3MTIA 5GP1A 5P8WA 1N7JA 4CKBA 5ICGA 3T0IA 3KQVA 1DCTA 1VE3A 2GH1A 3FPJA 4AX8A 1TW2A 5LQNA 3DP7A 5DWQA 3UJ9A 3E8SA 4GEKA 4JXJA 3AXSA 3DOUA 3NDJA 4HTFB 3RIEA 2K4MA 3FRHA 3CC8A 3B3JA 3JWGA 3FYDA 3SX0A 1YZHA 2HV9A 5LSAA 2AZTA 2WA2A 3CKKA 2PSSA 3ANXA 3ELUA 3KR2A 3TMAA 2GPYA 2PBFA 2ZLBA 3EVEA 1KHHA 1VIDA 2XYVA 3CCFA 3DXXA 3FUXA 2FHPA 1KR5A 3A7DA 2AS0A 2C7QA 3OZSA
chains in the Genus database with same CATH superfamily
1P7VA 4HDRB 4MR8A 5DLPA 4BP3A 3ZGLA 3FMOB 4DL9A 3G0GA 2PZBA 2QE7A 1OYYA 1ECLA 1FLDA 1KY2A 1M8GA 1C7QA 1NULA 3H2GA 2J0VA 3NH6A 1ODSA 3IP8A 3TIIA 3WJ1A 3BX1A 2O8EB 3P2OA 4FFSA 1T9HA 4RC9A 4AUEA 3CZ4A 1PW5A 1Q7CA 1N0VC 4KGZA 4QFDA 3NVKI 1OAKA 2VYND 4D0LB 1EXDA 2CKMA 3GO4A 4I1UA 3C7TA 1U3FA 1P0FA 1AUVA 1PAUA 2HWUA 4B6QA 3GLQA 1G55A 1PLKA 3I76A 3M34A 3ZHRA 5LL6P 3AR9A 3F9RA 4N5DA 5KPJA 4KFCA 3VSEA 2O5EA 5HZMA 3CX7A 3PHBE 1P7CA 5HOQA 5EJIA 4KDFA 2I4NA 3ZXSA 4IQ0A 1COZA 2YHAA 3U4IA 4JODA 1EQAA 3SAJA 2PZKA 4BN0A 1VRWA 4G4IA 2QVYX 4WZBE 5E9QA 3STWA 1VMAA 3B82A 3W3AH 1E9FA 3ZWVA 4ND5A 1I4WA 1M6HA 2QEQA 2OHJA 3AJ9A 2OV8A 3AY0A 3MG9A 2E4YA 3CVOA 4F3RA 5HIKA 3H4VA 4P32A 3DE5X 4OHMA 1NYQA 4UNQA 3L0DA 2WF8A 2ZAGA 2R47A 3KV3O 4YV2A 5JE8A 4FXPA 1PV2A 1RFLA 2EP8A 2H3EA 4KO4S 4BNHA 1DIGA 2Y1OA 2O2IA 1JKMA 1EKXA 1PZXA 2JAHA 1VHTA 2P6PA 1EFLA 1T5HX 4NDAA 3VNBA 5C9ZA 2ZBUA 4EBBA 3O4GA 2B30A 1LLFA 3PRYA 3BD8A 5EP2A 2PUBA 5JU6A 2CVZA 2OCPA 3WICA 1LNZA 2XNDD 3DTNA 4M0EA 1GD1O 1NWHA 3LP6A 4J0GA 7REQA 1T5IA 5DM1A 1ZK4A 5JY6A 4US2R 3B85A 1CS0A 3TM5A 5M34A 3S2EA 1E94E 5FOWA 4XLZA 4IG4A 3L84A 5E38A 4B34A 5K20A 3CRRA 2XI4A 5E6RA 1IAQA 1OQAA 3H3XA 3JQ9A 1U90A 1UFRA 1FNMA 3KYJB 3TL2A 4XWGA 3B13B 1QQ6A 2BV3A 2YTZA 4M87A 1U2GC 4GC9A 3X1WA 5K4GA 5L3RA 5EKTA 2ISCA 3DZBA 2MTBA 3E05A 3WTBA 2AJBA 2O48X 2Q0XA 2Y9PB 1SXJE 3M6MD 3TSOA 1EJ2A 3VPSA 1WZNA 4UE6A 3GZ4A 1N2GA 1L7MA 3W2EA 4MVYA 1ENYA 4COKA 4IJVA 4JFAA 3LVBA 3A6PC 2NSLA 4BO6A 3G6WA 4AG5A 2XLBA 3WGTA 4Y2VA 1IN1A 1J0AA 2AFIB 3CUSA 2XNCA 4OF4A 5I5GA 2DPXA 2HRQA 1JQEA 4IINA 3U5TA 4I6JA 4QUJA 3HKDA 1H3NA 4IDAA 1BW9A 2HT6A 5B6IA 3WB1A 4EA8A 3TLEA 3OIUA 4ZTBA 5KVVA 2IH5A 2RG7A 3QY0A 2P4UA 2MDTA 3PLNA 2E4ZA 4RKQA 1T3GA 3EVZA 4O2BF 3Q41A 4BCCA 1ZY2A 3C8ZA 1JMVA 2RHOA 3V1UA 4TZ0A 3W9UA 4Q9JA 1TO2E 2RHCA 4ZTUB 4RAOA 2XLCA 2FWIA 1XKTA 4RDXA 3ZCTA 4FFBB 5A6VA 5A5GA 3G8YA 3CVYA 4LDZA 1P75A 4WN9B 2Y4OA 5IANA 3FDXA 5BWOA 3LYLA 4P6VF 3B2NA 3JARA 2X2EA 4RE6A 1AMNA 1E8DA 2GN9A 4G67A 1S2MA 4IXWA 3WLPA 3HN2A 2AH5A 1R6AA 4XFKA 5IVDA 1IXRC 3TZEA 3MCWA 3N87A 2G70A 4Q9AA 4QC2A 5E6UB 3V3TA 2ZRGA 3EXG2 1H2RS 5FPQA 5D2CA 4IIBA 1NUPA 1UMDA 3BQNB 1JFVA 1H2BA 3QVVA 4NDZA 2AI3A 2C58A 3AM4A 1GGFA 2PRJA 4Z4IA 4W8GA 1EFAA 4LWOA 2P90A 5ALJA 1Z35A 4KWEA 2C03A 4DE5A 2ZE5A 4IHJF 3AL2A 4MEJA 3TS1A 3ZV6A 2A9JA 4LF6B 3ENZA 4OBWA 4D1YA 1A69A 1I6LA 3IMFA 3M3PA 3KTAA 1TNDA 4UAGA 3TBKA 1E5DA 3FHOA 1KI2A 3MOIA 4IVNA 3K6RA 3D54D 1QIIA 1XWFA 2MSLA 2Q3BA 3DPIA 1A1SA 1RYNA 3QE3A 1UFQA 4L73A 4S04A 1P60A 1ZM3A 2XCQA 3B3QA 3BTSA 4YS6A 2YJ4A 2XIJA 3G2HA 4XCXA 1QONA 2EW1A 2MT9A 1SC1A 1Z8FA 3SJ7A 1C8BA 3RTEA 1QYXA 5EIBD 5F9HA 1FXWF 4OKNA 1P6UA 3GJ5A 4CUJA 4DREA 5J23A 1KQ3A 2HQRA 3C1TA 4KHZA 5ERGB 4BP9A 2O8DA 1AK2A 3A9CA 1SEVA 5JAQA 1RCFA 5GONF 4ND1A 4ETIA 5C46F 3R9WA 1K5DA 4W5RA 1QRRA 1UP6A 3IP5A 1IB0A 3ON5A 1M8KA 5I9TA 4ONEA 4D44A 4ZOBA 4CIAA 2UVQA 2XDQA 5E2IA 2P5YA 5JASA 3VR6D 1JG1A 1ZUNA 1O95A 3GAZA 3RT7A 5J40A 4B4DA 1FYVA 4TXLA 2AQ8A 1Q77A 1XRMA 5JTTA 2XB2A 2FUG6 5IF3A 4IMJB 2CNWA 3STUA 1IHPA 3IE1A 4ENWA 1YS9A 4HWPA 2AXQA 4RPIA 3V7WA 2V7PA 2GKGA 3RUCA 1UQUA 1FA9A 1T2EA 4NFSA 4Q4JA 4DLVA 3U6KA 4I7EA 5JECA 2O19A 3IYLW 2ONZA 4JUBA 4LRQA 3DR3A 4R3UC 5BOSA 1O9BA 1SD1A 4J49A 4LTMA 4BAUA 3OQIB 4CI0B 1U5CA 2HK7A 4CFSA 3JAKB 5COBA 1FJ2A 2IRWA 1MABB 4DWWA 5JPCA 4OQZA 4RA6A 3FJOA 1JT9A 3GXOA 1Q21A 1PL6A 3QEJA 3TTVA 1H6CA 3NYIA 4HYTA 2FPIA 1LW6E 1SXJD 4QUKA 3ROPA 1NX9A 5E95A 2NYRA 3VR2D 4KE8A 1T3SA 5A4DA 1JIUA 4UE2A 4CMGA 3AFIA 3ABRB 3BXPA 4C4AA 1IZ0A 1P9WA 3H6GA 1ND5A 4NZPA 4X65B 3K0CC 2H65A 3KCQA 4C76A 2QLFA 2Z5FA 3NDIA 4MLCA 4CDGA 2HSEA 4KITB 3TJZA 2P41A 1PDWA 3U9LA 1BEZA 1HBJA 1TCAA 2WKSA 4C0BA 1NA5A 5TS2A 4Z9XA 4D46A 3R3YA 4V0RA 1DWQA 4E03A 5EJ4A 2UYCA 5JYDA 1Z2EA 1XLTA 2H1HA 5AUNB 4AKHA 4OB6A 4X94A 2H2WA 2G07A 4WEQA 2I5PO 1EXVA 4ID3A 1XMSA 4TWZA 4IR7A 5TY0A 4RELA 4B32A 1YRYE 2DHRA 2Y66A 3HJBA 1UK9A 2PCJA 2DECA 3R3SA 2Z4RA 4FC6A 4FXOA 2PTGA 2OUIA 5HOEA 1YAHA 3EIXA 3L43A 1QVWA 3B1WA 3FBTA 5SV2A 4CKZA 5AVKA 2AGVA 4HDMB 5B2EA 3PR2B 2W43A 3PR3A 4HNGA 3O9ZA 1MAVA 1NVKA 1KZ4A 2I3BA 3PSHA 4OLFA 4PG8A 3EAFA 3ROGA 2PAAA 3ZWYA 1I3MA 1QOQB 4JKIA 2NUAB 4B76A 2XOKD 1TFUA 2VYVA 2Z08A 3GQBB 4R16A 1FYFA 2I2CA 2A57A 3HJTA 1CG6A 2XWPA 3I1YA 5IBQA 4C4ZA 3P4UA 3HUUA 3R7SA 3VZBA 2YS6A 3QGMA 1G5PA 3M5DA 4RMJA 4YH1A 4L0CA 3WGJA 5BV2P 3A32A 2GCIA 1ENPA 2HIAA 3HWWA 4P4TA 3GLFB 4LWPA 4Q4LA 3GDHA 2CMDA 4HDSB 3RUPA 2I6SA 2EJTA 5K0FA 2DULA 1MO3A 2GN1A 2QM3A 4ZQEA 3FTEA 5BYJA 4M54A 2QX9A 1E9BA 5M2QA 3V4RA 3H5OA 3PXDA 1E32A 4YRTA 5FO1A 2BPOA 3L7NA 1SOWA 1CY8A 4MKZA 3LQKA 3T1NA 4B7UA 2AN5A 2FCAA 1U0LA 2R1VB 3CKLA 4TTJA 2XQFA 3WWYA 5JROA 2P4SA 2O2SA 3VHXB 1R0CA 3U16A 2WJAA 1M7HA 2HCTA 4BFUA 3I5YA 5BSTA 4HYEA 5BWCA 4B1FA 4Y2UA 3GLKA 1D04A 2C7RA 4BXOA 4A1OA 1WU7A 4FDUA 4KNVA 5JJLA 3CLUD 2ONYA 3F46A 1ZW6A 1AO3A 2QMHA 1ST2A 1U3TA 5A05A 4A5SA 4M6WB 5BVGA 3N76A 4G86A 4TXNA 2OSBA 3EIHA 3V48A 1AQ6A 1G60A 4X8LA 1GN9A 1JEDA 1WKBA 4MYSA 5D8DA 3DYBA 4HVAA 3QEAZ 4MO2A 1EVYA 2XYPA 1SKQA 3L40A 4KXUA 2OORA 3RIXA 5FEUA 2JJ1D 4L4YA 1NQAO 3HHPA 3HWX1 1FYEA 1G6Q1 1R9MA 3CJQA 3MD0A 3KJZA 4RFVA 4UAJA 4YO7A 5FI3A 3ZOKA 3W5DA 3EVFA 4MLZA 4TWRA 1XZ8A 5CT9A 4MCHA 1W0KA 1TGYA 1TM4E 2VUTA 1LLDA 4X24A 5F1KA 3U7FB 4COOA 4P35A 5C53B 4EMSA 4A23A 1D4FA 2OXRA 1ORWA 3LUAA 1G6OA 5KTOA 1W36C 1P9RA 1ZAYA 1F06A 3EHEA 2R44A 2CDCA 2UUOA 1KYZA 2WKWA 1KTIA 4CMCA 3SBDA 4GUAA 5C8VA 2D62A 2IHYA 2OM6A 1ODIA 3A6FA 3FNQA 4OJMX 5JC8A 1OLSB 5BSGA 4NMLA 2DQZA 1REQB 2G0TA 4BWFB 3CZ5A 1ZOSA 1S3GA 5LOVF 2FMUA 3INGA 4G1FA 2B21A 1SCAA 4EG1A 3U7GA 3TOZA 2JHFA 1O8CA 3LDUA 3SK0A 1M2GA 2C78A 3OTHA 4X20B 4F4IA 1Q5PA 3Q7PA 4M22A 1D3AA 2HWKA 2PJZA 1OC4A 3M89A 5EI5A 3RUDA 5DFAA 3SCZA 2Y0DA 3B89A 2QTWB 4PV7A 4R1SA 1JA1A 2I6UA 3I42A 3ESAA 2WWHA 2DBVO 3GWZA 3NG1A 4FI3F 4RF5A 4E14A 1EFKA 3VPGA 5TVGA 4CM4A 5KSYA 3FM9A 4IDDA 3RV4A 4NBKA 2HRDA 3K30A 3WLKX 3D3NA 3FOEC 2NUTA 5JISA 1M5RA 4D2IA 1WW3A 4OQLA 1X74A 3AEYA 1C3JA 1XSEA 1NLUA 4H1VA 3ILYA 2AYXA 3QPWA 5K8JB 1O96A 1PKXA 2NSHA 3SR0A 4YJFB 4HC4A 1W4LA 3BMXA 4IXNA 4ND2A 4YCCA 5D85A 1JAIA 1AKQA 5REQB 5GVRA 3J81k 1FTNA 3G9QA 4GXRA 4M9CA 2YJ5A 3RIYA 3THYA 3DH0A 1GAWA 1GO2A 3JU3A 2J6HA 3JQFC 4G1UC 3ZU6A 3IDSA 5EXXA 4JI4B 5DT9A 1YQEA 2GZRA 2QL7A 3R77A 4FU0A 1EWRA 4BWGA 4CM1A 4RVSA 2WWGA 4XM0A 1V3QE 3PDCA 1UJ2A 3Q3HA 4JYZA 3RVPA 1FJXA 3CBGA 3LU1A 1O03A 3BH0A 3OLWA 1T4GA 4B2IA 2ZJ6A 4LZJA 7MHTA 2VDMB 3QELA 4NG4A 4YVFA 3RSLA 3TQFA 3D1LA 4EUSA 1G7RA 2G7MC 2IEDA 3GG2A 3R3WA 4W9RA 5A9SB 2BH9A 3F4LA 1RHUA 2X5JO 3OICA 3ORQA 1GNLA 2OGUA 5FI5A 1DT5A 4OJKA 4BZQA 1AGPA 1SCKA 1ZVQA 3BCHA 4Z0PA 1MGOA 2FWBA 2IVFA 5CFOA 1WPGA 4PVCA 3O83A 1J4AA 2HHCA 4XFDA 2Q6KA 1NQOA 4KUGA 1SVNA 5E4YA 3PJFA 4MJ7A 4JLDA 2XDYA 3MCZA 5HR5A 2DETA 3ONDA 3RANA 3GLUA 3ER6A 2XQIA 4ARBA 2H1RA 3ENVA 5AUOB 1V8PA 1DX4A 1E2EA 4B45A 2BM9A 3H1FA 1KYXA 2RBKA 1T2NA 1IU9A 3O7MA 1K3FA 1Y8AA 4R2IA 2BM8A 5EHIA 4ROTA 3A9VA 4BCBA 5KVCA 5LB4A 2EKZA 2QTZA 3VNQA 1RD4A 1Z5VA 5FNVB 1X15A 4U0JA 1N3IA 1H0SA 3BJZA 1F4LA 3OMXA 2ZS8A 3QLJA 1IHYA 4J94A 1Y63A 2HFKA 2G9VA 4MICA 3VOSA 2DFVA 2FV8A 1G18A 521PA 5DM70 3NPAA 4XYLA 4PM4A 1N2CB 3DWEX 8AT1A 2UZ1B 4NZOA 3RWOA 1G7CA 5DNUA 5KOIA 1C50A 1G5QA 3UH1A 4NS1A 3N8GA 2JASA 2BFWA 4C6RA 3R8XA 3HDYA 5LN1A 4LRYA 4CV3A 2OILA 3HV0A 4MA4A 1UKCA 5T4BA 2O3TA 1WZCA 4DZTA 4K0RA 1TB4A 1U2SA 3GEPA 4W5TA 2K4MA 3H04A 2VEOA 3AB7A 3OPYB 5E4JA 2X8BA 5KOHB 5JNVA 3L4BC 5JCZA 4FJ2A 1Z33A 4PY2A 3U3OA 2IYTA 4N40A 4KRYA 2X4GA 1FQKA 3P20A 3RGWS 1E1NA 4FLFA 2C4NA 5AKEA 1RC0A 2JJ2D 2G0AA 4TS4A 4IFEA 2IZ5A 3S5UA 1L5FA 2WIAA 2ASEA 1XZCA 2ZXFA 3A1UA 1GUBA 4V0LA 2E55A 3ND9A 1G8KA 5LVAA 3TG8A 3KKPA 2BYTA 2X7JA 3B36A 5AW8A 2RK3A 1LFDB 4M98A 1PL0A 5C32A 1T6NA 1PTKA 1Z5GA 5GGYA 1ZUWA 1RZRD 3ZLBA 1EIZA 4F71A 4YRAA 2C2KA 1Q1ZA 3LUPA 4QGGA 4WMLA 4D3SA 2R1ZA 4HDNB 1KK3A 4EYGA 4QYWA 1SVSA 4J3FA 2GJKA 3W2HA 1AV7A 3KUXA 1QFZA 1SOUA 2C7BA 3OIDA 4Q7JB 1GU7A 4EL0A 3AVXA 5EFZA 1MBZA 1NXPA 1IY1A 1NZDA 1VL8A 5EP4A 2RJ3A 1R8SA 5KU7A 2A8YA 5GMOA 2OM2A 4IKOA 4ZOLA 1MOZA 1R27A 2I3DA 2ZAMA 1SCDA 3TOCA 5JJCA 2DR0A 2O8CB 1R0ZA 4U63A 3ZNOA 1EVLA 5JY1A 4DV7B 3KPUA 4IL5A 2BMVA 3P32A 4PCLA 3SMQA 2O0MA 5A2QA 5LU9A 1E6UA 3VV2A 1P0PA 4HWTA 1Z0FA 1P8AA 5B58C 4N9WA 1MEJA 1JFFA 1SZJG 3FWNA 3HNPA 3UAWA 4HB2A 1N2BA 1BXZA 1JDZA 1PYOA 2JDIA 3MN1A 4FYVA 2CXNA 1JVBA 1PQYA 1XP5A 1DARA 3B2QA 3FTFA 4MXDA 3DDNA 4OMUA 3KZKA 5CT6A 5JYBA 1G8GA 2A7XA 4PINA 3GVCA 3L05A 1SUAA 5ARCA 1T24A 1B6RA 1SB9A 1SVWA 4O29A 4ZU3A 4E12A 1BKYA 3KWFA 4BLPA 2D1YA 4EKGA 1NVMB 2J0QA 3MLBA 5J2TF 1RCTE 2FOIA 4PLWA 2IT1A 5A5DA 1PT5A 2UYOA 2ZRMA 1YK0A 1ZDMA 3E9YA 5JH7B 4NCIA 2G77B 2XBUA 2Z0MA 4MA0A 4FNGA 1CUZA 2C2ZA 1LDBA 2PJDA 3D6JA 3O21A 2ZRDA 2D7DA 1JA9A 1QSGA 1XYGA 2B4TO 3VXKA 1CQZA 3OSZA 4LTDA 2ZYAA 4MYDA 2Q6TA 3EOAI 3NDPA 4TV9A 1T8RA 3WIBA 1G0OA 1IOZA 1IEWA 4HADA 4V1CA 3FKSA 1OU4A 4KFUA 4J07A 4O4LB 2AEJA 7ADHA 3SKVA 4DILA 4YWHA 1NW3A 4E3WA 1AA9A 3EF3A 1EJ6A 4CV2A 1VECA 1DFGA 1NI4B 2KBFA 2OQIA 3PKZA 4M8KA 1RC8A 2WD8A 2CVQA 1N1GA 1U0BB 2C59A 2QZ4A 5BNFA 2RCNA 4UZSA 3AF3A 4TL9A 4G63A 3NOVA 4RD1A 2V55B 2X9QA 3RVKA 4GI2A 1XZBA 4Q5IA 5IU6A 1QAQA 1WUYA 3PITA 6PFKA 2B3TA 2C2HA 4N1AA 4Z6KA 5BV8A 3P71T 3QBVA 4TTQA 4D0NA 4UUNA 1Z4QA 3EYWA 3FJYA 2B7CA 3QA3E 3GEHA 2X0KA 3RTCA 2WHPA 4INAA 1SBYA 2WUGA 2TECE 3MUEA 4R1NA 1LBIA 2XWBF 3TE6A 3AESA 2PZFA 4DWJA 1APBA 3T34A 5LJIA 3RSSA 1VMKA 2WTXA 3CINA 1Z0IA 3OTQA 4HH4A 4RV9A 5SY9A 3CVWA 5JMTA 4YT2A 4LOLA 1NJSA 2J48A 1OXBB 2I22A 3DBHB 2ZETA 3KE8A 4H0CA 4ZIRB 5JFOA 2X0IA 4YB8A 1AVTA 2XA2A 2FP4B 2M6SA 2QG4A 3AG5A 1K7CA 2IXDA 4KVAA 4RHUA 1N75A 2K7FA 4BMOB 3LAWA 3EVGA 5CYPA 3TRKA 4DEXA 2DTXA 3ZI0A 1ADCA 4HAZA 4BP8A 3QWHA 2ZIXA 4XPIB 5JAOA 3LO5A 1KTVA 4N8DA 1X1RA 2VJMA 3IOMA 3P1JA 1U4SA 1J22A 4KQXA 3UEOA 2ON6A 2IDZA 3H9GA 5K8UA 1QP4A 3SHQA 4KK4A 4AM8A 4PSCA 3TFOA 1WXDA 2FE4A 2FSPA 2VP6A 1YKFA 4H35A 4XIFA 3RSFA 3VUEA 4KR7A 2W11A 3Q85A 1MMFB 1XRQA 3FGOA 4G0UA 1IRIA 1JIKA 5CR9A 4C7OA 2C88A 4ZI5A 4W5WA 2VRCA 4A92A 3MWEA 4JSTA 3WLAA 3CJTA 3F3MA 1BQ4A 5IM5A 1S4MA 2NZYA 1JBKA 4G25A 3L49A 3N3AC 4JI8B 2VS1A 5G0TA 1D07A 3EC7A 2LE0A 4B6FA 4MUAA 1GTJ1 4W7SA 1A9YA 1U9YA 4GMKA 5JVDB 4C29A 1I32A 1R7RA 4Z3DA 3E22A 2AQIA 4FB5A 4LWQA 4C0SA 4HCJA 3VU9B 1PJ4A 3IPLA 1B8UA 4Q4AB 5I4BA 3PJRA 2B2CA 2X77A 4FJ1A 3GVHA 4Y6OA 3ZDDA 4L8GA 3N9IA 3G7SA 3L1HA 4TLBA 4XDYA 1SD5A 4R1MA 3DEAA 4WDRA 4AECA 8ABPA 2PKXA 2XVAA 4DW8A 3CVUA 5DHRA 3QX7A 2YN2A 2BFCA 2ZIUB 2KM1A 4UBKA 4QXOA 1Z83A 3Q72A 1EUZA 1R74A 1WHTB 1ZVJA 2JLQA 3A4TA 4HEA6 5GY7A 5BPHA 4HPJB 1C30A 2PRSA 5EHGA 4LZPA 4ZRNA 3EYAA 2P77A 4FIDA 1UINA 1AB5A 1UDXA 2OK7A 1NAIA 3HKEA 4NQZA 1NNSA 2JFHA 2WSYB 2AL7A 3L4EA 2AFHE 3PSAA 4GZLA 5CITA 5KOJA 1NUAA 1JIXA 4N0QA 2QRHA 1N2SA 3NIGB 1KAEA 5IM4F 5ALDA 2DBQA 2W2MA 2VHJA 4J8PA 2MIIA 3I12A 2CMKA 2BEUA 4NLLA 3EDOA 3IHTA 1MIOB 1UWVA 1DUVG 3I01A 4IQ8A 2RBGA 2ZWMA 3DCNA 1U2TA 2ONKA 1SBHA 1N36B 3KT0A 1GM5A 1T1EA 4UPEA 2BGTA 5KJ1A 1GRRA 2WAXA 1SPBS 1YE5A 4PPQA 2OAEA 2R2AA 5EJ6A 2OVFA 2XHEA 1X1DA 1GCOA 3JASB 2UYHA 2EERA 1XYYA 1VJRA 2J3HA 4M9ZA 5E6SB 4UEKA 4UTPA 4W8OA 3PGA1 1F1BA 2VTEA 2QLBA 3X44A 2WV7A 5BXYA 4B3HA 4UD6A 4WZAE 4XIIA 3JQ7A 4D6PA 1MJGM 2QBYB 4C2UA 1K63A 3LY9A 4MEAA 1ODCA 2Y71A 3NB0A 1ND6A 2CLEB 2Z57A 2J6BA 5KJ6A 3WSVA 4BEJA 4ZCIA 5GAJA 2GQ0A 3H65A 1B42A 1RM3A 2Y1DA 1FJHA 2YICA 3GRFA 1RQNA 2AI1A 3WWPA 4E33A 2QRGA 4AYXA 3SOZA 4J91A 5GJWC 1Y9JA 2FRXA 2FSHA 3JVIA 4LC9A 4X6UA 1UKVY 4FGUA 1M2OB 3KTFA 4DV2B 5CA1F 1HLPA 1PNOA 2ECQA 2FPUA 2QLTA 3RRXA 4EUEA 1Z74A 2X19A 3A31A 2XKKA 2C7QA 1CRLA 3UPTA 4JLJA 2YXNA 1K97A 4PAQA 1F2TB 4WD3A 5FQNA 5CK4A 3EHDA 4FS8A 2QD5A 4EG3A 3FFTA 3FMVA 4JU9A 4JVOA 1KGSA 3AEKA 4G84A 5K3FA 2QY9A 3RAPR 4BDTA 1VHQA 2P9BA 3DPUA 4DIDA 2V4MA 3ISVA 3BAZA 3AU8A 4QU8A 1YBVA 1YBHA 1R0RE 2G67A 1S96A 1Z5PA 2AJCA 2XOEA 2HD4A 4JL5A 4MWTA 3BK1A 3T1QA 2VQ6A 3MK31 2DOKA 2IHUA 3KUUA 1F48A 3WP0A 2FPGB 4G4GA 3I1FA 1BGXT 1UM9B 2M6RA 3LW7A 4HGPA 5TC4A 2O0JA 1P5FA 1HDRA 3DP9A 1YZQA 3KPJA 3SQOA 3O1LA 1HSOA 1Z45A 2BFFA 2QSYA 3HY6A 3MZ0A 4HAYA 4OATA 3PEFA 4UULA 2OGTA 4EW1A 1V1JA 1R50A 2B1IA 3QEMB 4OXKA 2TRSB 4PYRA 5JCOC 4X1YB 2JFBA 3EZNA 1A8SA 3BT7A 5AKJA 3ZKAA 2IYNA 3VMFA 3DOFA 2X8WA 1N7IA 3H11B 1ANKA 3A4NA 3NASA 4F5EA 1YCFA 1Y5LA 3JQBC 3K1YA 4F2PA 3PEYA 2Q7OE 2QW8A 4DVGA 1VPVA 2R3SA 1W94A 1B3BA 3IIIA 3VZCA 4ZC8A 1SK9A 3EAQA 3ECSA 4S1PA 1GU0A 3W2GA 3ZGNA 2GBFA 3HU3A 2FUG1 4HUQB 1V16A 2A88A 3BHIA 4KBGA 3K0AA 3HRIA 4U9UA 1VOTA 5TGZA 3S2ZA 2V7EA 3RBVA 3I5MA 3MMNA 4N49A 1FX0A 4RZQA 4EHNA 4JLWA 3OKCA 3RAFC 2CVHA 2P9EA 4J3NA 1BDIA 4HYQA 3MUFA 5IAEA 3FYUB 4JUAA 5U4QA 2RAVA 4BNZA 2AV6A 1QH9A 3FJ1A 4FDAA 5E8JA 5ESRA 2R4QA 2R6HA 4YROA 5FV4A 2YWBA 5JBIA 4UBIA 4BQFA 2Q21A 2VAXA 3I9NA 3DZHA 3P9SA 4L72A 1KO4A 3ZWOA 1TQ6A 3L0CA 4JIMA 2Q9UA 4LJ9A 2D5AA 2EGUA 2WAOA 3SC6A 4PX2A 2O7RA 3TD6A 3OU6A 3DHWC 4RVNA 1N5JA 3OP1A 1O89A 4EA9A 5ELMA 2OO5A 2A5DA 4IJMA 1F2UB 2OD9A 4XYEA 1WCXA 1U3WA 5AVRA 1Z0AA 5ALTA 3RBAA 4CIBA 3MS4A 3BREA 3I5AA 1OXSC 2F8SA 1P72A 4I36A 4ZP1A 3L7MA 3LVFO 1J8DA 1UMBB 4I4CA 1UKYA 4LMPA 2I3AA 4WECA 4YUVA 4E11A 4QPPA 2V6GA 3H1AA 5DP1A 4EKEA 4NCAA 4O3MA 1LY1A 1ZBQA 2IDJA 2VAVA 4R9UC 5DCLA 2BGRA 3AEQB 2VZ8A 4O2BB 4RYLA 3W5VA 4KIFA 4DDKA 4YV7A 4RPLA 1KYIA 3EEYA 4KGDA 2PUCA 1BA3A 4BNXA 2PX0A 2ZYIA 2AHOA 5F21A 4ZVQA 2W6PA 2VT2A 1V95A 2C92A 2LPMA 5JV5A 3PA6A 3KUDA 3QUCA 1FLVA 1C3XA 4OH7A 4WCVA 1LXCA 4DQLA 1G8HA 1QJCA 2OV2A 4TVSA 5B57C 1S7CA 1EX6A 3K0SA 1E4VA 2ZRJA 3A11A 2BGJA 3BWMA 3UAVA 4J0DA 5C4MA 4UU1A 2BP7B 3DMGA 5B1DA 2RH4A 3FN4A 2B6HA 2OV6A 4LG1A 4H1WA 3ZEIA 1XO1A 4ZHQF 1DADA 3HFRA 4QOGA 3QYPA 3UJPA 4J16C 2V6JA 2VDOB 4CLRA 4F4CA 3E58A 1ODTC 1Q3TA 1EX7A 1DOAA 1OLUA 4KH0A 4QDJA 4IHJB 1OH8A 1BX0A 4GG1A 3I1IA 5FLEX 1ZN2A 3L7LA 4NATA 4NH0A 4QQKA 4U7WA 5AVJA 4BFZA 5DDIP 3VZSA 3ANSA 3DCJA 4N41A 1NXVA 4OH1A 1VRVA 3VPDA 4BWVA 4RIHA 3UWSA 4DYVA 5I9LA 1DEHA 4FW9A 2AC4A 2NZ8A 2Y4NA 4FCWA 2JBHA 3ETCA 4N5IX 1T3HA 3HJCA 4B09A 4RDHA 1E9CA 1NXTA 1SUEA 3C7CB 2VA8A 4MDYA 3ONNA 2R8XA 1LBHA 1XL1A 2HHHB 3ZDBA 4W1QA 3SYLA 4KXFB 2LRHA 2YNMA 5HFJA 5GONB 2Z5LA 4G0PA 3SYKA 2RAPA 3DLPX 1HT0A 2YCLA 3ANTA 4XDHA 1JJAA 1DBWA 3RF6A 5EUQB 2WJ6A 4Z0HO 5K6AC 3SFVA 1JS1X 4KU4A 4CG2A 5KTRA 4Q1DA 4JT2A 1WMFA 4HPXB 3TD9A 3GFQA 2WSIA 1KL7A 5E7MA 3WZ2A 5LFAA 2HY7A 3N3BC 4LVOA 3ZHBA 2ZUVA 1GOTA 3EFBA 4C2TA 2DAPA 1P1KA 1KVUA 2HNKA 1XMQB 4REQA 2W6ID 3T5GA 2A5FA 3AI3A 1HV8A 2DBYA 1Z8DA 2ODBA 3FTDA 2Z8YM 2GEFA 3L7CA 4OB8A 4F8EA 3GLIE 1GA1A 4G1CA 1LX7A 4EB3A 4B8ZA 4ER0A 4EUKA 1OOEA 2GEBA 2QAGA 1XRNA 1JEYA 1VPLA 4NXNB 3FFWA 2OD2A 1LVGA 3KJEA 4QXRA 1VIAA 2XIQA 2HTFA 1JZQA 3MRVA 4AJ9A 2WZBA 1MQSA 2WE7A 2GKSA 2C0CA 4UVGA 1CUEA 2Q1WA 3P0HA 1G8JA 3PQDA 4N9QA 1U2ZA 2EKBA 3LKBA 4OJQA 2BD0A 3C3AA 3IPRA 4RPKA 1PVDA 1ESCA 1EFVA 5DNYB 1ZA1A 5ICGA 1NW4A 2TMKA 4RCYA 1RAFA 2ZJ1A 2XQGA 3KQVA 2R48A 3NBYC 4IZ6A 1FFSA 2MSNA 2R4TA 4DV5B 1M1ZA 2VQEB 1QO0D 3C87A 3JZIA 4AX8A 4CE6A 5LQNA 3N70A 2COEA 2OYSA 3HJGA 4IRMA 1K8YB 1E4OA 3DOUA 3TXYA 4K9DA 1FSZA 1U65A 2XEDA 3CC8A 2XB6A 3JWGA 4Y9RA 2WHRA 3U7HB 1J2YA 3LMKA 3UAGA 1UBMS 1N2EA 1A1VA 4G3XA 5I48A 1SOAA 4MI3A 3FLEA 3ELUA 3TMAA 3K2EA 4J4TA 5H9WA 2Q5JA 3W2TA 4MW6A 3RC8A 4TYYA 4X8HA 4J0EA 1KHHA 1PFWA 1CZRA 3D7RA 4JBNA 3V2IA 4BV8A 2RSLA 3VFDA 2M9MA 4K6OA 5EMLA 3LOUA 1MB2A 2PZEA 1ADBA 1A98A 1ACJA 2FZLA 5CJPA 5LKRA 4MYUA 4YMLA 1PJTA 3CUYA 4JP1A 3TZ6A 1D6SA 2HSJA 3GI1A 1NBOA 2I2FA 2V98A 3VO1A 2ATXA 5IT9A 3OEHD 4DC1A 4U2FA 1VPEA 5FOQA 3QW4B 3KAPA 4KW7A 1OHHD 3NYWA 2NVWA 1YXMA 2YXBA 5F1PA 4DG9A 1Q1QA 1MAUA 2O8BB 1E96A 2DQKA 3HGQA 3AKCA 3M8KA 3R5JA 5D7BA 2H3HA 1AZLA 2B8WA 3L04A 3MRSA 1KEEB 3IV7A 1U8YA 4DCGA 4BGDA 3HXPA 4D9NA 3AVOA 5FWYA 4GBJA 1W5EA 5KZMB 3WIVA 1IXYA 3MRXA 3RFVA 3WFJA 2XRYA 1GSOA 1ZK3A 1ONPA 3N6XA 1OA1A 3FGNA 4EHKA 5LQAA 2VJBA 5GIOE 3JQEA 1T6ZA 3R4CA 1S8OA 3USZA 1QGUA 4HXEB 2KPOA 3DBLA 3OIYA 2NTJA 5AVYA 3HYNA 4D92A 1DOHA 3MINB 2OLJA 3L4JA 3SJUA 4XWKA 2PVPA 4DPLA 1BJRE 5KUTA 2ENWA 2ONCA 1O6FA 4BVAA 1W4ZA 3T95A 1YFJA 2QJFA 1E79A 1VL5A 2P9TA 3DJFA 3RFXA 4BVHA 2VEDA 3WXBA 1M3SA 1V5IA 1VCNA 2E5WA 2JK1A 5KYKA 2ORYA 5CRIA 2CNDA 4ZGWA 1X38A 3V8EA 3WA7A 2HDOA 1NN5A 3U19A 1QTQA 2EVWX 1E2HA 2Z2ZA 3LUKA 3MTJA 4W6ZA 1BS2A 1A2QA 1JHMA 1PT8A 4KXYA 2FU5C 4TPKA 3T1OA 2IHVA 4FDMA 1TYZA 5EJMA 3WBBA 5K03A 4X44A 5ADUS 1CFJA 4MVJF 2R8RA 5CU7A 3DDCA 4A27A 4LFAB 3K8OE 3TCKA 4XWAA 1FFHA 1Y6ZA 3TUZC 1GZ5A 2VJQA 3ZJUA 2VTDA 4FOLA 1SIWA 2BEKA 4FYWA 4D4HA 4Y2TA 4TYWA 2I3ZA 1GGKA 1DE0A 5LZ5A 1L7RA 3UWKA 4I1PA 1KJNA 1AF4A 1MB9A 4D98A 1V1RB 3THOA 1BMTA 1MCZA 1G19A 3DTYA 3HZZA 4MSUA 4NBVA 4EGSA 1JLKA 5KDLA 3D7LA 1J8VA 1G4UR 1NJFA 2I7XA 1PHPA 3PC6A 2PYZA 2H8KA 1SC4A 1THGA 1Z25A 3LLMA 4LVNA 5TQ2B 2FVYA 3MCVA 1MNAA 4RMIA 3S40A 1FVFA 1E0DA 1N6HA 3U3RA 2OGZA 2PU5A 3NAGA 3UWOA 1R6BX 1TGVA 4FFDA 4JY7A 4Y2JA 1H1LA 2P75A 2QWXA 3ZHSA 3FB4A 3UKDA 3O9MA 5LOVB 2G83A 1Z63A 4CLDA 3H2KA 3L5KA 3UF0A 3COPA 2C4UA 1Q44A 1LI7A 4HNTA 4L8FA 1L7XA 1R5BA 3L1JA 3VU0A 1UXJA 1J90A 1Q57A 3E3AA 5LDGA 3I0ZA 3EZLA 3GLHA 3N2LA 3RLFA 1R0WA 3AXTA 3WYBA 3LK7A 1E5LA 4AUKA 4D0RA 2IW1A 4BUZA 2EYQA 2ZUUA 5K0SA 4ZOQI 3NEYA 5B3JC 2H1LA 4ZK2A 5U9CA 4Z4FA 1BJKA 1CIPA 4P4NA 4Y7CA 3PVCA 4F21A 3EFHA 1VI5A 4ASUD 2QT1A 4EFNA 2ST1A 2PLNA 4TLDA 4U2GA 3WE7A 4MDEA 2AJLI 2Q5EA 3JYPA 1CUHA 5HRUA 1ORVA 3ETJA 4IV8A 4IIGA 3ZQ4A 4CQMD 4DC0A 1A4UA 1TK9A 4Q02A 1ZG3A 5KNDH 1AHIA 1NVVR 2GZSA 4YUZA 4ZXFA 4CKYA 1GGNA 4OHPA 5E4FA 1UP4A 3PHHA 5DKFA 1WD5A 4I0WB 5T3YA 2IPAB 3E2PA 1J06A 2H54A 3NTXA 3O2SB 4FZRA 2QQFA 2DHQA 4LDJA 4WHMA 1WXWA 1EGMB 2V1UA 2VTKA 5EOVA 4S1OA 1FS6A 3PGLA 1BHSA 3R7LA 3EXHA 2XSZD 2I2AA 3GPBA 1YJAA 3CUWA 2ZUSA 5AR1A 3WADA 4CV1A 4DNQA 1H2FA 4R5HA 4WWHA 3HN6A 5JNLA 1HZZC 4I3FA 3TB4A 2WK1A 1CSEE 4IIHA 4W8HA 3K15A 4XEUA 3PQ6A 4ARIA 4M60A 2V8OA 3O8OB 4GP6A 4LIPD 4N4AA 4PZYA 1GKIA 4Q3EA 1GNQA 4V02A 3TGWA 4OLBA 4LSMA 4FX5A 5L3QA 1NYTA 1OXVA 1SCUB 1GNRA 1UH5A 2P78A 4IWXA 2BKUA 1BXRB 3PLRA 3SVLA 5EERA 1W47A 4XGQA 5AJVB 4QPNA 4PLFA 4FYYA 3KEGA 1JZSA 2CK3A 3G2QA 4S0ZA 2I91A 1AK1A 2P9QA 2HA7A 1BEUB 3LC7O 1F12A 2AFIA 3NHFA 2E37A 2PLRA 2DPHA 3H9JA 3QVSA 3R6LA 3MGBA 3ZD9A 5KSZA 4IMPA 4OI2A 3ET4A 4M83A 5CX1B 4IHQA 4BGVA 3T94A 2QR5A 1QC5A 5LXTB 3Q7IA 4HRYA 2ZSUA 3MXOA 1PSZA 3BYZA 4O2AF 5CM8B 3X1XA 5A5FA 4WKGA 3BE5A 3CR8A 2HRZA 4NHOA 3C7DB 4EG6A 1H22A 1RWXA 5DXJA 2XZDA 4UUMA 1JHUA 4G01B 4L9WA 4HLCA 1MRZA 2C5LA 3UAOA 1L5HB 2C5FA 2NZ2A 3S5JA 1W5AA 1W52X 4NJEA 1GSIA 3QFTA 2YJNA 1RTKA 1ZRMA 1KS2A 3LW8A 3RO7A 4MNTA 2XAAA 4V0ME 1UXGA 4RFSA 3DZIA 3CLSC 4EB6B 5FX2A 3Q9UA 5KNCA 2DY0A 2J3DA 5A06A 1Z38A 4KREA 2G9NA 3LL4A 2Z1DA 4TYPA 3IMKA 1DTWB 4RBNA 5TT0A 3TQCA 4NBUA 1PJAA 5E6UA 4MIOA 4OU5A 3CZRA 3LWZA 5K3OA 2WTUA 3FSEA 4ZT2A 5I3ZA 1CNMA 1BKDR 4BVFA 2FWMX 3BHJA 3F1KA 4XH9B 3H8WA 1AGYA 4PLTA 3HU5A 5FCDA 2DWUA 4BC1A 4F1KA 1M5UA 4MOWA 4I4TA 2R5FA 3VH4A 2W71A 1DJPA 2IZ7A 5DM2A 4ZN6A 4EECA 4KRGA 4PZDA 1BHJA 4UM9B 2XUAA 4KNYA 3CLUC 3QVUA 1PQUA 4P3XA 2B1RA 5IVHA 1EWYA 2VDRB 3KR9A 4F2WA 3TLMA 2C8VA 3DBIA 4EB8A 5CM2Z 3TNFA 4JLAA 4GI5A 3L6UA 2OFXA 1UR5A 3G5TA 2P9GA 4F4FA 1CUCA 5BSHA 3SVZA 1PFVA 3KPVA 3SQNA 2QNRA 2MMGA 1GV0A 2WWVD 1FUUA 3PNLA 5DEOA 2H0RA 3EVBA 1DAOA 3KB6A 4MK4A 1GCIA 2PQ6A 2G8NA 5KI6A 2G08A 1PNTA 3BRCA 3T7DA 4FGJA 1ESDA 5IDVA 5BN5B 1KMHA 4Z9BA 1P5HA 3EVCA 1Y42X 2OV1A 5JZBA 1Y3AA 3Q87B 4YBZA 1DMRA 5MHTA 2PX6A 5EXDA 5FR2A 1N34B 1NW6A 1JHAA 3F90A 3MMZA 4XZ3A 3TKLA 2X3FA 1CQWA 2G36A 3D9QX 1FYXA 2D1TA 2W2QA 3C3XA 1EUDA 1M2KA 2NU6A 3NAQA 4LPKA 4BVEA 4UM8B 3M4XA 1I01A 1GTZA 1G21E 4CF6A 4UAVA 3OCZA 2J9FA 1II8A 4HEA1 4ITUA 1FVHA 2X8LA 4B4UA 2BGKA 4NCBA 1T4CB 1XZGA 6LDHA 4X66B 4MGKR 2JFNA 1ESEA 1XD9A 2ZYHA 4MIKA 5DASA 5CDYA 3KKLA 4PQFA 1XFDA 2YYYA 1PFYA 4RABA 1A8HA 2UZIR 5FKJA 3HADA 1E1CA 4ESHA 3CB4A 1JECA 5IX8A 4ALKA 2XXAB 1NJ5A 1G9SA 2J0UA 3LPAA 3OIVA 3OQIA 4R68A 2JF0A 1DT3A 1HYEA 1Z22A 2PV7A 3PUVA 4LDPA 4JYAB 1V7PC 2GCNA 1TLTA 3CM0A 1AHHA 1LTKA 2ZWOA 3GGDA 1QGYA 3M9LA 5FA8A 4K1LA 4FD3A 2CLLB 2GBLA 4MMYB 3KKKA 5KSPA 1IDN1 1P5ZB 5HF6A 1E4YA 5FL7A 4DNPA 3A10A 4OHFA 2MINB 3DHEA 4MA5A 3CEAA 1OXTA 4LYEA 4N12A 4Z8YA 3DOJA 3OQ1A 3VPXA 2P9YA 2Y1CA 5FADA 4DSNA 1MD9A 2YDXA 5H80A 1JG7A 4C7VA 4NVRA 1COWD 3VR5H 3VYWA 3EMKA 1G2IA 3KM0A 3PFIA 4CMAA 3QOYA 3WL5A 3ZGXA 3IKTA 4HGRA 1BVYF 3GMDA 3KKNA 3L7DA 1AUOA 2BTQB 1T9GS 1U7OA 3DHNA 5JMOA 1ZD8A 4HLUC 1P7ZA 1XA3A 3HWRA 5CHEA 4E1AA 1GPMA 4UU7A 4LUCA 4YAWA 2ZR8A 5C31A 1PLJA 2ZJ4A 3GG9A 1YBFA 2O0KA 2IVZA 3ZZ1A 1KZYC 5FA6A 2ZM6B 1TA4A 2YWRA 3BSFA 3HB9A 4HEJA 3FPCA 3NNNA 3BFXA 4MR9A 3ZWDA 2ORVA 4V3BA 2C9BA 2V6MA 3V1NA 2R0QC 3AONB 1E5QA 1QS0B 2X1HA 1GSAA 4CM6A 4QASA 3CEJA 4A0SA 4Q7EA 3FPKA 1QFJA 5L45A 2ZJ3A 1Z7WA 3LS2A 5IJXA 5IZCC 3PDUA 4MWEA 2BN4A 3FLMA 5A4AA 3WNBA 5F1OA 4OBEA 3HH8A 4F5YA 2CBXA 2NUAA 5FOVA 2O59A 1TU4A 4KFSA 1ITZA 2QVGA 3OPYI 4PN7A 4YRNA 1SXPA 3OG9A 3P2KA 4UU0A 4YMWA 4ZI3A 2ZJYA 5KWEA 1P62B 4NQRA 5AKHA 4X85A 1JKJB 4IQGA 1NC3A 2FX3A 3PDJA 1VMIA 3W7BA 1BE0A 4UHKA 5CT4A 5FTJA 4B3CA 2A9OA 13PKA 1YDWA 4MQEB 1N6NA 1I7NA 3QLUA 1DKOA 3BOSA 2VF5X 5DCWA 2ODQA 3OLZA 1K89A 2HJHA 4L3OA 1Q15A 2DUNA 3A1CA 2LDBA 3PYMA 4PQEA 1DELA 1FTSA 3HJRA 4YTEA 5ENDA 5T8KC 2QX8A 4F5DA 2J3KA 4LZZA 3VR4H 1JIIA 1QYCA 2VP9A 3D6NB 4NR0A 5HXAA 3C97A 3LC0A 2GTPA 1W2HA 3M6FA 4EVQA 1TM3E 1NZJA 4HFMA 3RD5A 2CXPA 2WWWA 1RP7A 3AFOA 3VHXA 1YK1A 2VNJA 3IQWA 3KSAC 5TF0A 3DA8A 2O7VA 1RZ3A 4W9MC 4E5VA 3ABZA 5DTRA 4DXAA 2BEWA 4FDVA 2FN7A 3DDHA 1JJFA 3P9RA 2AC7A 4H1HA 3OCUA 1LQUA 1BRTA 1CWUA 4WOBA 4LY9A 4N01A 5BR1A 3HS3A 1TC1A 2BFDB 2NU7B 5DW0A 3NONA 2FFJA 4C04A 2YHIB 4GO1A 3HSKA 1SB8A 1QWSA 1LNSA 4JL6A 5LP6F 3B7PA 1JSRA 2PFSA 3H2IA 1UBFA 3B9BA 2Z9DA 3JS5A 1AQLA 4G8DA 4R0NA 4RLFA 3T3MB 4PCAA 3CG4A 1BRMA 3RJ9A 3WAGA 1CP3A 2UUPA 2IZ0A 3THSA 1XAHA 1JSXA 4P53A 3EZ7A 1G5RA 3OU7A 4C14A 2KWIA 1EQUA 2W42A 4NPAA 1DZ3A 3A3PA 4D3XA 2J7KA 5AUPB 4XJTA 5I9IA 4EI9A 1E18A 1KY5A 2BJWA 3TL3A 3HCEA 4UDYX 1XELA 4DADA 3OX3A 4BZXA 4EO4A 4PLZA 3I9JA 3NJRA 2CKDA 2I34A 3G2LA 3OQHA 4PBRA 4AJPA 2JKYA 1X92A 2CDAA 2A1IA 4IUBS 1YJBA 1CEYA 5EIHA 3QVJA 4Z54A 4UD2A 1J00A 3FE2A 1GPKA 4RGQA 2BCEA 3AEXA 3KAJA 3IJRA 2VHUA 3TTWA 3BFPA 1JDTA 3RVDA 3CIFA 1E5TA 3O6VA 5JS1A 3N2ZB 4FR2A 3GUUA 3KBBA 1IOVA 4GH5A 2ZI5A 2AZ4A 1TQ4A 4BO0A 1Z4IA 5B1IA 1QHXA 3DZGA 1Q92A 5GP1A 3ZCRA 1YFKA 4GL4A 5BQXA 3T0IA 2BGUA 2I6QA 3PICA 3ZBPA 3LHFA 3KQLA 4Q3NA 1L4UA 3PFWO 1DCTA 3NXKA 5F64A 1PL7A 2GH1A 3NBUA 4TVKA 4B82A 4EITA 5IKXA 3NO4A 4F9EA 4H6XA 4H7JA 1HQDA 3GARA 3CIOA 1R0XA 5CA1B 1AK9A 3TYXA 1UBJS 2PKCA 4YP9A 4GZ3A 2V7VA 3KXDA 5K3BA 5CDUA 5AIBA 4NU5A 5ISMA 1LX6A 1KMMA 1KDRA 1X3LA 3HJHA 2AG6A 4FBGA 3L6EA 3PGKA 2IS4A 2F7SA 1XXHA 3OZGA 3ZYCA 1U11A 1PDVA 1KZHA 3TFQA 3NDRA 4DLZA 2PSSA 5WRFA 3V8QA 4X95A 2BW0A 1ZFNA 2PBFA 3BB1A 1V6SA 3WKAA 4UTRA 2VYFA 1N6OA 2RGWA 4UVHA 1I24A 3HJNA 5FPPA 3R7NA 3E27A 2AS0A 1XKXA 4LOJA 5E9JA 2GO7A 4DDUA 1LRLA 4BLUA 2W7TA 2X42A 4KKXB 4BLSA 4QXPA 2E9SA 3LT0A 5C8YF 4CEJB 1IVSA 3FNGA 3PENA 1N9ZA 4MQMA 4GDFA 2G5TA 3W5IA 5JD3A 3L6RA 1YBAA 1ISFA 1ISJA 4FHFA 1EA7A 4M55A 5KTMA 2GHTA 2R9VA 3FMIA 4BNVA 1MRNA 1DRWA 4I1SA 1U7UA 1T2VA 1MG0A 2V3CC 1GTL1 1MJNA 3PC8C 1GG9A 1CJSA 4TYNA 2WM3A 5KWIA 2VDWA 3IDOA 4HX5A 5E1BA 1Z88A 1DJNA 1SCNE 2B9VA 4G8JA 4F93B 5LLDA 3EBPA 2DSTA 5HJ7A 4CIVA 2OHGA 2C2WA 3TN7A 2J3QA 5JDCC 5BW6B 2QAJA 2O9JA 1Q14A 1H0RA 3TI7A 2GPAA 3E9DA 2PXHA 3JXEA 2WJWA 1QP8A 2BBSA 2OP0A 4JLMA 4YMTA 2SHKA 1T3ZA 3U9TA 3UFBA 4CBVA 3ZGVA 1NY6A 1Z5ZA 2OOSA 2YY6A 3D43A 1U9IA 4FT4A 5BWBA 1Y82A 1DQPA 1B43A 2PWYA 1E60A 4S0XA 3EGEA 4BVJA 2ANCA 4MCIA 4C7BA 3EX7C 4O4JA 1UC4B 3DFMA 3FOCA 2ZQZA 3K4QA 2P4HX 3ZDQA 3K09A 2QUJA 3GOHA 4G5QA 1I4LD 3F7TA 3JVEA 1ZPDA 2IKQA 3UYKA 5BN4A 4S2EA 2QJOA 4F91B 1KOFA 2GEVA 1KP9A 2Z95A 3NH9A 4EF5A 2XNKA 1AGNA 5DIZA 4L07A 3LY5A 2DR3A 4YJGB 4WBNA 3C48A 5EYPA 3C15C 4EPWA 2KMLA 4MVJG 4EGCB 3CONA 1NQTA 1TCCA 2BI7A 3BCUA 5I8ZA 4A8JA 4UNNA 4JC8A 1VL6A 5CXUA 1J9GA 3I6MA 4YJHA 2QUZA 1GN8A 1SY7A 3CRVA 4CKCA 3IBYA 2XV1A 2W00A 3GFVA 5I7EA 2HDWA 4WACA 4MWBA 4M8SA 4YP0A 3K70C 3AV0B 4EJSB 1J2UA 2W4QA 1RMQA 4PZUA 4ZOCA 2NZXA 3P0FA 1KKLA 1WY5A 3LX8A 1T36B 1SBCA 4QVKA 1F6WA 3PCTA 4D8UA 3LV8A 2DQYA 3D6VA 4RO0A 5KNBA 2XRMA 4YMUA 1DFIA 1LDMA 2RHWA 4F86A 2CF6A 5A04A 5JXIA 1E9DA 3A0UA 1H6AA 3NTUA 4ICIA 5DHQA 4CM9A 1N25A 5T4EA 5AVVA 3F6EX 3NIFB 4X9XA 1W85A 3SS7X 1NSYA 2Y1EA 5DBEX 5KO2A 1FFXB 2G28A 5F5XA 4ZDKA 3M2TA 4A2PA 1CUJA 2F8MA 4FSXA 5LQMA 4YJ3A 3PC7A 4BC0A 2NPIA 4UCWA 3GLGB 3M9XA 4OHOA 2IU3A 2JFWA 5KNLA 4ZO4A 5ESXA 2YBEA 4DJTA 2CUKA 2XQJA 3CRW1 2O8CA 4HXGA 1IL0A 2C0PA 2PEYA 3LQ2A 2QU7A 1MTOA 2R5WA 4M86A 5P21A 2YW2A 3RJ5A 3UGTA 3SE0A 5A6SB 1U4OA 3EPHA 1FE8A 1KVSA 4MV6A 2L18A 4GKVA 1MVOA 1RLJA 2PL1A 4QLBA 1JQ3A 4EQ6A 4ZO7A 4P98A 3A4LA 1M34E 1YKSA 2BE9A 2AEMA 3DG9A 3M6AA 4K8OA 4QXMA 2ZWIA 1NM5C 4H6VA 2ZI3A 4GWLA 5L7WA 3CGGA 3HFGA 3IE2A 3HDJA 3N5KA 3O0DA 4DZZA 4Z53A 3I83A 2E3JA 2GRJA 3OLXA 4LY0A 4LF7B 4YCAA 1NKSA 2CW5A 2GAOA 4OD0A 3AKEA 1QLWA 1FP1D 3FFXA 2BKLA 2C4TA 6NULA 1YTUA 3UB2A 3QWAA 4X7PA 1YQXA 1OFTA 3E9QA 5CBKA 2QG6A 1PUXA 2GERA 4PLHA 2QTHA 1P1IA 3KYCB 3RVOA 5LMNB 4FN4A 4DNXA 2X9LA 3QXJA 4AS3A 4ZV4A 5A4FS 4NONA 3CUTA 2EZ8A 3KSMA 5DJ5A 1KK0A 2HQSA 1HT1E 3BE4A 2QV7A 5EY5B 1RM4A 4NZZA 1TFRA 5ANRB 5FWNA 2G6TA 4IWYA 1PJ8A 1N4AA 3BL8A 1YS2X 1WSDA 1OBHA 1R1DA 3GT0A 2IXTA 4D9HA 4RY0A 5IT0A 2IXEA 1Y7IA 4ZHSA 2FQWA 2VPPA 2X2PA 1CU1A 4XYGA 5H3LA 3RRBA 5ES4B 4KNWA 1P4JA 3LDFA 4RNDB 4BLVA 5MGBA 4CGZA 3HO1A 2IS1A 1IN5A 2GF9A 5ALXA 5A0TA 5G0UA 2NU9A 4PO8A 4HFJA 1KO5A 2WKRA 4BB6A 4AS1A 1R3UA 2XH8A 2P35A 3KZXA 3QX8A 2OHFA 3M6IA 4O4HF 3U3DA 3QWFA 1Q7BA 2WBLC 3JQ6A 4RY2A 3WL7A 3GP5A 3T7JA 1RAGA 4NEQA 1A8PA 5FUYA 3ZWQA 1GRVA 5AW1A 2P6RA 4AJNA 4EKDA 1CZOA 1YVDA 2WSSA 3OE5A 3S8YA 3PUXA 4P7BA 5FIUA 3UZUA 4C6TB 1PTJC 3E3LA 5IYZA 3IDFA 3AB3A 3GVXA 4L08A 3ETLA 2VPQA 2VQ3A 1KI6A 2H51A 3FPFA 2WJYA 4GBMA 1F60A 2FPKA 1FFEA 4TUYB 4Q9LA 2JAPA 3K1ZA 1TVMA 2YH2A 3QK7A 4BX2A 4MUEA 5C37A 4ISCA 1U1IA 2Q5QA 3AM3A 1H5QA 4Y18A 4X3CA 2PFGA 3VBEA 2Q8QA 3P8ZA 5DT2A 2I1QA 5ICFA 2ZBGA 1U63A 5JNWA 4LJKA 3I9MA 1E9AA 3UMBA 3KC2A 1G3MA 1VLQA 2G1PA 5EQDA 1YACA 3QVGA 3WISA 2FSSA 5EE5B 2ERXA 4C3OB 4D8VA 4Z4HA 3HU1A 3ZD8A 1N78A 1KDPA 4ED9A 4L4ZA 2W6CX 3CJRA 4FMBB 5BMOA 1PWYE 1YZNA 2NUPA 3JQGA 3TQTA 5BW8A 3IJPA 3HCRA 3W8NA 4DG8A 3FKJA 3O73A 5LC1A 4JAVC 1HEIA 1M2WA 1ZNXA 1L1EA 4KE9A 4W6QA 4Z1MD 3FPHA 5AKGA 4W5QA 2QJRA 2M2IA 4H0FA 1FK8A 1CUVA 5F52A 2R87A 4ZYYA 2L69A 5C3MA 1L4NA 1N8SA 2J5XA 2WM2A 3ESBA 1FRNA 3D7SA 1BKSB 2NV0A 3FF4A 3Q5DA 4G56A 4KXMA 4QJ5A 3HYSA 1FUYB 5DYTA 5SY6A 1E3WB 1A9XB 4KXVA 1NNI1 1Z17A 3FNBA 4NIMA 1DKQA 1VL1A 2GLXA 3D8NA 2ERCA 1K92A 3OKFA 1S6YA 4OMCA 4XX1A 2JGEA 1L8OA 3ORHA 3SIPA 3OT1A 3ZWKA 3DMHA 1JHZA 2FAXA 2WHXA 2Y0PA 1BCSA 2ZAIA 1FFBA 1JU3A 2BBWA 4H7HA 2Z9CA 4WBXC 3JPYA 4LFCB 1ZITA 1CETA 4KO8A 3UJBA 4EWLA 2MSDB 3T12A 4FYMA 4IO1A 1PWHA 3F49S 3UXYA 5L6MB 3HCPA 2ZRBA 4K88A 3U7QB 4YO8A 2GRAA 1O4WA 3EGDA 1P44A 5CG2A 4IVQA 1A27A 1ADGA 2D2FA 2P4QA 3GP3A 3VTKA 5G0VA 1RQ7A 3MWKA 4OI4A 3B52X 3SC2A 1QG4A 2XJ9A 4L3VA 4BZZA 1NTOA 3LHIA 4US0R 4DLAA 1VPDA 4EM6A 2C8JA 2IUEA 2CHUA 2QP3A 3O4RA 1SQ0A 4LMAA 4G1EB 4QE3A 4RGYA 1XEWX 4JP3A 3FSGD 3A1WA 1VCMA 4M9UA 1Z0KA 1P5JA 3ORYA 2FA9A 2PFKA 1Z0SA 1QO9A 2UVPA 1H8ED 3H2YA 3WLIA 4PYKA 4E0BA 4RMGA 1TZJA 1G59A 3E23A 1G38A 2JI4A 1ORIA 3KDAA 3HKCB 3PYXA 4JJEA 4DV6B 2YWHA 1UJMA 1ZI8A 1E66A 2NM0A 1THTA 4MP8A 3W5SA 2FYTA 3ETGA 2WSBA 2ZTVA 4JUIA 2IPLA 1J97A 3I5UA 121PA 1FNDA 1ZWLA 3KOZA 1TRHA 4H3KB 1VDMA 3CEHA 4PF1A 3NVAA 3QVWA 5KYYB 3K72B 2IGTA 3JASA 1OX4B 2O2ZA 1PJSA 1E2JA 3IP9A 4GBED 3DMYA 3W05A 3V4SA 3BGVA 2G6BA 3PNVA 4WUVA 3ZNQA 1QAMA 3IS3A 5KHAA 2QTBA 2C5GA 3D2AA 1BE8A 2QP4A 1P77A 2PUWA 3DDWA 3T9DA 5KYGA 2IC5A 4ETNA 2P5TB 4U2DA 4AJIA 1Q1BA 2A9FA 4C88A 5EJ5A 2W8ZA 5U1PA 4R41A 3BE8A 4ND6A 1XF9A 4JQZA 4U4AA 4TWAA 1D9XA 2H85A 4HY3A 1MU0A 1PP4A 4LE2A 2BKAA 4G0ZA 1O0BA 3AVYA 1KIMA 2VH1A 3NRJA 4IILA 3AHFA 4BO7A 3T38A 3FRIA 5AI0A 2ZDQA 4F2GA 1MQAA 5IN4A 1SVLA 1DINA 1XTPA 2FN4A 3DOEA 3JVDA 2B34A 3MEQA 3Q98A 4KGVA 4OIMA 2PHZA 1LC0A 2OBLA 4CGYA 4X97A 2PVSA 3MCTA 5CB8A 2FCRA 1ICIA 1ZH0A 5HK9A 5FUXA 5FFMA 5HF8A 2I8AA 3GRRA 4FHZA 4GQAA 1U6JA 3H6KA 2CNBA 4KI7A 5CIWA 4Y2SA 1C0PA 2ZBDA 2AFIE 1EQ2A 5CJJA 1IMJA 2P9ZA 3U61B 2OCIA 4BP1A 2I6XA 3U1TA 5C1BA 3NGLA 4A26A 4U6QA 2QSZA 1E3JA 1UM9A 5F7OA 1RAAA 3GAFA 1T26A 3FOBA 1P2VA 2XE6A 3V32A 1Z36A 3IO5A 4UPVA 2QTRA 3WGVA 4J0QA 4R69A 1MJGA 2OGWA 3PNQA 4C0JA 2Q1XA 4O1IA 3USCS 2JL1A 3N0RA 5KTTA 1T0HB 1F7UA 1T6XA 2NX2A 3G17A 1GVNB 5T4FA 3O8CA 4CKXA 5FTNA 1IK4A 3E53A 3OH8A 6ADHA 3BBPA 2EW8A 4IGAA 3S44A 4L22A 1VYHA 1D2HA 1SG0A 2IBSA 3FG9A 1FNBA 4MUKA 3CGWA 2VSQA 4ZMBA 4X62B 3LYHA 3DQZA 1J2RA 5K0LA 3CF4A 3TSWA 1TYEB 3DL4A 1UF9A 1MHTA 2G3YA 3ILVA 1BDBA 1CHDA 2C00A 3CZAA 1IY9A 2FMHA 3NWEA 5SZIA 2V8BA 3LC2O 4OI1A 1S2GA 1JHDA 4LA4A 5HCNA 4GYWA 3JZAA 2XTMA 3OTIA 1Q74A 4UDXX 4Z99A 2XX3A 3L8GA 4Y1RA 3DCIA 4GWGA 4H15A 2UYYA 3RS8A 4AP6A 4CMJA 2CJWA 5JAZA 3WJAA 4AX4A 3VU3A 1YNOA 1QP0A 4PN3A 2WG1A 2AUMA 2W2LD 3SM9A 1MC5A 1KKUA 1MX3A 2R8BA 1X80A 2LWIA 3A3NA 4F56A 2GFIA 1DC8A 3KUKA 3HB0A 1G1AA 4KR0A 4MPTA 4RKYA 4G0VA 4JENA 2FQYA 3EGCA 1US8A 1QDLB 3ZYZA 3N8DA 3LSYA 1WE2A 4RKFA 4Q24A 2HR1A 3LH5A 5FJIA 2QU8A 4L57A 3PE3A 3RC1A 1T4BA 3BXGA 1MJ5A 3BWYA 3JQPA 4FKBA 3UFXA 3VPAA 3FDIA 4IDGA 2PLAA 1H85A 1USVA 2A86A 3KZCA 1L5LA 4JOSA 1VIVA 5DYNA 3VKHA 1UMBA 1TF2A 1AT1A 4ZMSA 3F2IA 1QGZA 3QW2A 4OK6A 3UGQA 3R3XA 3HUDA 2FY8A 1NF9A 4FYPA 4A0FA 2FHSA 3R6WA 1JPUA 3JQQA 4RQTA 1GKYA 2HPVA 2YC2C 1KE2A 1Q3HA 1WX1A 5IAJA 1KXZA 1E3SA 2VSYA 4I1YA 4R9RA 4JGBA 5IAKA 3WBKA 2MSEB 3K0KA 1PO7A 4D9FA 3Q8LA 1USWA 1T5BA 2JIZA 3B78A 1EM6A 3DUWA 1K7EB 4GI3A 4HBZA 5C7OO 5EWMA 5I7OA 4A16A 1A7KA 2JS7A 3QKIA 3ONVA 3CRMA 2JAXA 2EFCB 5H1YA 4AZ3A 4YEDA 5EP1A 4QYIA 4OYRA 1JEOA 1C81A 4E5NA 5IC6A 2OFPA 3I64A 5KDOA 2CJXA 5HBRA 3NBZC 4DCVA 2H2IA 2P11A 3JQDA 4FYHA 5DOZA 1Z12A 1S2LA 3BMCB 2FWPA 2X0NA 1GCUA 3C5VA 1DRJA 3S1AA 1I2AA 4BUCA 4HAVA 3ETNA 4MWGA 4GXNA 5K0GA 1BH6A 1UBHS 2IYLD 3NAMA 3QE2A 4CEIA 4HH1A 4CKEB 3A8TA 1VZ3A 3R9KA 3TRDA 3N5CA 1UADA 4CHTA 3LY7A 5E3HA 1Z47A 2EKPA 3TTYA 3R0JA 3FXAA 3CG0A 2ATEA 1F8FA 2QRUA 3CU5A 1WSWA 1JDSA 3AXSA 3NHZA 3GRPA 1JMKC 3RIEA 4F1WA 5MF6A 1EUQA 1P7WA 3C7AA 4BVBA 1P9OA 2WF5A 1K7XB 1P73A 2ZRCA 3UV6A 4MUFA 3B3JA 5DYWA 1PJ2A 2AUTA 4TMZA 3ZKWB 4EJ6A 4FEAA 2ETXA 1QUEA 4GECA 4II3A 2HV9A 3BMOA 1A9TA 1XIVA 5AQEA 3BD9A 2GTIA 4MV4A 3MAAC 4E4RA 3CKKA 1EB9A 3ECAA 2BFEA 1QG0A 2XW6A 4IIUA 3CCBA 1FDSA 4IH9A 2PMBA 3SXPA 4A3SA 3D2BA 4DJAA 4JXXA 2B4QA 4ETMA 5B1YA 2BLNA 4LZNA 2QT9A 1WUKS 3H2JA 1NGSA 1Y3IA 1NR1A 1JV2B 1WXFA 1V2GA 2KYRA 1LPMA 4YR7A 5BT9A 1I8TA 2JGMA 5CFZA 2DERA 3F9CA 1DX9A 4G5FA 4CG1A 1CD5A 2O0LA 4KPUB 1SQ5A 1DAMA 5BWNA 1K0UA 2REOA 5E1MA 1ULBA 4QJ3A 5LZ7A 2GM3A 1XLWA 3BMNB 1SHKA 3T5CA 2VWQA 3A9UA 4QA9A 3O3OB 1URPA 4U7PB 4WLEA 4BRZA 3IC5A 5JPIA 1PS9A 6AT1A 3HY4A 3CPJB 1GNPA 5TF4A 4R1UA 3WB2A 5G4KB 4C4SA 5LYJB 3DZJA 1Z13A 2G7ZA 3ZU3A 5LR6A 3RRMA 2IF2A 2WJVA 1G63A 3GYBA 3W1EA 3SX4A 3EAGA 5DSXA 3GLFE 1PJQA 3O90A 1ZCJA 1DEKA 4HXYA 4S1NA 3WGGA 1K0FA 1PI3A 2ET6A 3INNA 3FLAA 5TPWB 4YJ2F 4J1TC 1SHTX 1FNSA 3OLCX 4I46A 5ALYA 5LBUA 3SJAA 3HBLA 4F3CA 3NBAA 4KDRA 2QIOA 4RMHA 5DI3A 2CEKA 2QTTA 4QSMA 5EIXA 1B0UA 4DZRA 4Y8VA 5EZYF 1VP9A 4RVDA 2WABA 1Y34E 2QUAA 1B0ZA 1YZTA 1ENZA 2YVUA 4LCBA 4OAOA 1QIJA 1KU6A 5JC1A 2YWDA 2QMZA 2I0FA 3NWJA 5JXHA 2VBFA 4B4WA 2AZXA 3DBVO 4E6PA 3DNFA 4CTJA 3ZWWA 1DCKA 3ROTA 1FTGA 4N03A 3U17A 3TZBA 1O6BA 5FHRA 1H05A 1QR6A 2GK6A 4WFKA 3IUBA 1SVIA 2I54A 3IODA 1OX5A 1C7EA 2I76A 2DB3A 4BMZA 4AULA 1TAGA 5FA5A 3ZIUA 5A62A 3HYRA 3TXXA 2DFDA 1SZDA 2VL7A 4D4GA 1FDVA 3OPNA 1JR2A 3QF7A 4XD7A 1A9OA 3FPAA 2AW3A 3OLYA 2C7PA 1M6VB 1KYYA 1CY2A 3V4VB 2DE0X 3LA8A 4J1SA 2NXJA 2V7BA 1OXXK 3RABA 2O0HA 4XIYA 4U2KA 4INZA 3VJRA 4C0LA 3CNQS 4DA8A 2VAPA 3GU3A 1QKKA 4R2KA 4M9RA 1P1RA 4ZA2A 4U8GA 3G8AA 5EHZA 1AQJA 4YP6A 2OHOA 1VA5A 2N47A 3DEJA 1LLQA 4FZ3A 3ZTTA 4BMYA 4EF4A 4XX0B 5DWDA 4Y6GB 2IIQA 2BZSA 4UUBA 2I67A 3U9SA 3IOYA 3REQB 3IQGX 2H1CA 2B82A 4B8WA 1VLVA 4PHHA 3TL6A 1OV4A 4RZSA 2DPYA 2WUWE 4ND3A 4EYKA 1GPBA 3OTGA 1QE3A 4HR7A 1USKA 3IKVA 1QX4A 3L4BA 1OA0A 4UMVA 3RSZA 3SEFA 1DAFA 1XB2A 2ZS7A 4ZJZA 1X7ZA 3R6DA 4DSOA 1V8ZA 2VAWA 1A50B 2YCBA 4PAMA 4Y67A 5DWVA 2JGIA 3CXUA 4GYKA 5AQ1A 3PLAE 3CNOA 3RHZA 2QE7D 2AWOA 1ZH8A 5HA5A 1JQ5A 3EVAA 3QV1A 3QM1A 1DJLA 3J80A 4DYHA 3IRVA 4PICA 1OFUX 2YDYA 2I7DA 4JQOA 1PZMA 3KALA 3G9UA 2IWRA 4F9GA 4ZJYA 1MT3A 5TT1A 4C07A 1IAVA 4HX9A 1RLOA 3T9CA 3PFKA 1NG9A 3FVVA 1ZL2A 3C3EA 4XQEA 1XTQA 4NV0A 1W5FA 4FHCA 1EZ1A 3SQDA 3KWJA 3I2IA 1EFRA 4WLNA 3RYCB 3O1HB 3K4HA 1XJQA 5SYMA 1J0CA 3R7AA 4CJXA 5B37A 2VUIB 4KR6A 1UQRA 2HQOA 4KOEC 1XQWA 3UH0A 4GX1A 1JHYA 4RH1A 1FDTA 1MTZA 1T8YA 2F9MA 3ID6C 4ZVVA 4U7HA 5BT8A 1E3TA 1U8XX 5LP6B 4DXDA 3QSGA 4D8YA 2WAMA 3IB6A 1Z6TA 3RJMA 3V9AA 1MJFA 3VTZA 2VYCA 3VVCA 1QFYA 2VK1A 3B6IA 3U4MA 3Q0TA 1YHYA 3A6EA 3RIMA 4BOYA 4HRAA 5IXYA 2JJMA 1YRQA 2EARA 4QAJA 2BDEA 2QENA 1WB5A 3PIDA 2XYRA 2QTNA 4GZ5