5EVJA

X-ray crystal structure of crarsm, an arsenic (iii) s-adenosylmethionine methyltransferase from chlamydomonas reinhardtii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
b'APPPAVRAALADVPTEVKEKFWGCGNPIPAGIEGLRVLDLGAGSGRDAYVAAKLVGEKGSVTGVDMTPAQLEVAISHADAYARDKLGYGKSNMTFIQGEIEYLDRAGLEDSSFDLVISNCVINLSPDKARVLSEAYRVLAPGGEMHFSDVYVDRRLPQSVRSHPVLLGECLAGALYNNDFIRLARKVGFTDPRQLEAEEIQIHDAELRDQVGEARFYSITYRLFKVPGQIEDLAEDYGQVAVYKGTIPGHSHAYDLDDHHRFVTNKPMLVAGNTASMVGESYLAPHFTIIGDRAVHYGQFDASGPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenite methyltransferase
molecule tags Transferase
source organism Chlamydomonas reinhardtii
publication title Crystal structure of CrArsM, an arsenic (III) S-adenosylmethionine methyltransferase from Chlamydomonas reinhardtii
rcsb
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5evjA01
5LSAA 1KXZA 5T67A 3LHDA 4ER3A 3NW9A 3MQ2A 2QY6A 3UJ8A 2NXEA 3BUSA 3P9CA 5EIWA 4LG1A 2P1DA 1XJ5A 3AWIA 4OBWA 4QDJA 4XUCA 2PT6A 5K03A 1XVAA 2ZTHA 5E9JA 2O57A 4KDRA 2O0LA 4QQKA 5HIIA 1KYZA 4X1OA 3FTFA 4MHTA 5EGSA 2PJDA 4CTKA 3FTCA 1VL5A 2NP6A 1RI2A 3KR1A 5E1MA 2EJUA 2I6GA 4XUEA 1IY9A 5BP7A 3FUXA 3UJBA 2A14A 4YMGA 3SSOA 1L3BA 1JTFA 4PIPA 5CM2Z 2K4MA 2YVLA 2ZIGA 3Q7EA 5EMJA 1NV9A 3KQQA 3LL7A 4ER7A 1VP3A 3KQTA 3R9XB 1L3CA 3ME5A 5E8RA 4DQ0A 3KQWA 4FSDA 1VIDA 2B25A 2NXJA 4M37A 3BWMA 4RTRA 2AVNA 2GS9A 4ZTBA 3E05A 1VBFA 2DULA 3BGIA 1BKYA 5ICGA 1QAOA 5K8VA 3G2MA 2O07A 4PGGA 3MB5A 4RTLA 3HA7A 5G02A 1WY7A 2JH9A 2P3QA 3A4TA 1HNNA 3F4KA 3OE4A 2DPMA 2R6ZA 4C04A 4POOA 3GCZA 4YMHA 4FT2A 1KPHA 3B5IA 3G5TA 4OBXA 3TR6A 5BW5A 3FTEA 3IEIA 4R05A 3FUUA 3UJ9A 4PYOA 4EQZA 5ICEA 5B1SA 3RW9A 5C1IA 3TM4A 4HC4A 5EPEA 4C08A 2ZSUA 3ID6C 1BOOA 2YUIA 3TMAA 4KIFA 4CTJA 3BKXA 4XUDA 3LCVB 3UA4A 3JWHA 1G6Q1 1WG8A 3VC2A 1IM8A 4E2ZA 4AZVA 3BXOA 5F2OA 4KIGA 2CL5A 4MTLA 3EVGA 3WSTA 2GH1A 3TQSA 4FGZA 2IH2A 4PCAA 3G8AA 3A27A 5D1HA 4RX1A 5E8JA 2JHAA 3X0DA 3HCEA 4R8SA 1SKMA 3ERCA 2PSSA 5T6BA 4P7KA 1QAQA 3EGEA 1ZKDA 3PFGA 4BLUA 1YFLA 4L7VA 5LQJA 1ORIA 3E23A 4HGZA 3PT9A 3P9NA 5HEKA 4OQDA 2PX4A 3K0BA 2IH5A 3R6TA 2P8JA 2IH4A 2P7HA 3VYWA 3R3HA 2Y1XA 3LSTA 3GU3A 3UFBA 4AUKA 4E70A 5K0NA 4ATNA 3SSMA 4EK9A 5K0FA 3FPEA 5CUQA 3I58A 4KW7A 3M6UA 2YXDA 3TFWA 2UYQA 4QVGA 3SM3A 2G8NA 1AF7A 3KPWA 5LQUA 1RI1A 3TPZA 2PBFA 3LCUA 3O4FA 5E2BA 3TLJA 3UBTA 5EZSA 3ANXA 3C6KA 3MGGA 2PXCA 3KQSA 4HGYA 2ZIFA 3A7EA 1DUSA 4HTFA 1ORHA 5KQSA 1ZG3A 2E5WA 3G8BA 3LDGA 3ELDA 1JG3A 1JTEA 2BR5A 3DMFA 3LPMA 3M4XA 4HSGA 5E9QA 4EKIA 2P7IA 4O29A 2ONYA 3NWBA 3PB3A 5E2AA 3KQVA 3MTEA 3TKYA 1I4WA 2G1PA 3UJDA 5FCDA 3PVCA 4MWZA 4EVIA 5IH3A 2NYUA 9MHTA 4F86A 4GC9A 3HCFA 5CVVA 1R6AA 3V97A 2QRVB 4FR0A 3CCFA 1YZ3A 4OA8A 1MJFA 1FBNA 4QPNA 4KDCA 5FWAA 5HOQA 3Q87B 3KR2A 4IKPA 5K09A 3GRZA 3OE5A 1L3IA 1RI3A 2G72A 3A26A 1WXXA 3KU1A 3PX2A 3KKZA 4KWCA 5EIFA 4E31A 3G2QA 4RYLA 5D1NA 1NBIA 1MHTA 1ZGJA 1NBHA 3MAGA 1H1DA 5EOVA 5EKUA 4LWPA 2OXTA 4WXHA 4PCLA 4GC5A 1NKVA 2BR4A 4RVFA 2PT9A 5E9WA 3FUWA 5GM2A 5H02A 2XVMA 2JJQA 4RTJA 2ZBPA 2ZBRA 3HP7A 1V39A 2OB2A 2ONZA 4GUAA 2ZWVA 1B42A 2AN5A 2WA1A 3EVZA 1FJXA 4IV8A 2WK1A 1IXKA 2ZULA 4RVHA 4YUZA 5BW4A 4WVLA 2BM8A 5EKXA 3PLAE 1L1EA 4E2YA 2PWPA 1D2GA 3DULA 1O9GA 3CC8A 4BP1A 1XDUA 3B3JA 5K05A 3NJRA 1M0EA 4RTMA 2ZZNA 1N2XA 2IGTA 1KP9A 4CKBA 1KIAA 4MQ4A 2Q41A 4HTFB 2O06A 5M5BA 5MHTA 1KPIA 1RJGA 4BY9E 5HIKA 2OY0A 2ZW9A 3D2LA 4RTSA 1JG2A 3A25A 3PS9A 3MCZA 1RJEA 4QTUB 2VDUE 1DCTA 1VPTA 4V0RA 5EEGA 1RI4A 5EMLA 2HR1A 2VP3A 2IBSA 3UJ6A 5K0BA 5LR6A 1SQGA 5GIOE 3EGVA 2FYTA 2P3OA 3L8DA 3MTIA 3THSA 4K6MA 1VQ1A 1R8XA 2VS1A 1U2ZA 2YX1A 3OU2A 4YV2A 5KYGA 4X61A 1L9KA 3KPVA 4BLVA 3MCTA 3HVIA 4IWNA 2CMHA 3DXZA 2BR3A 2IP2A 5DRTA 5FHQA 1PJZA 3T7SA 3UJAA 4PNEA 3MHTA 3NVKI 5FTWA 3KQPA 3LBYA 4PYIA 1JSZA 2XYVA 2PY6A 3ELUA 4FT4A 5HILA 3P71T 3KQYA 2ZCJA 3SGLA 2OPBA 2FK8A 3DUWA 4MIKA 3LDUA 3EMDA 2AOUB 3OFJA 1YFJA 4P7JA 2ADMA 1M6YA 2PX5A 5FWDA 5F2KA 5GIPE 4DA4A 3FPFA 3UZUA 3KPJA 3KHKA 4X60A 3FPGA 3NTVA 4R6XA 4RV9A 1XCJA 3EPPA 3FPHA 3OPNA 1X1AA 2B2CA 3UWPA 3EVDA 3SMQA 2CWWA 3MERA 2ZZKA 2B3TA 3HVHA 2C7RA 1XXLA 2C7PA 2B9EA 3PFHA 2AOWA 2BH2A 2R3SA 3FYCA 3GXOA 2FK7A 1X1BA 7MHTA 1WZNA 3I5UA 5KS2A 4U7PB 2AVDA 2UZ4A 1AV6A 1UWVA 2AR0A 2XYQA 3CJRA 5CVJA 1R74A 2AS0A 2YTZA 3EMBA 4GQBA 3OU7A 3FUVA 4QDKA 3HCCA 5E1OA 1QYRA 3FPJA 3I53A 3TKAA 1AQIA 3T7TA 1AQJA 4OA5A 5K0CA 1JR4A 1INLA 5DM4A 4PYKA 1XCLA 2PLWA 1JG1A 2PXXA 1EJ0A 3DMHA 3HM2A 3K6RA 4LECA 2AOTA 4V0QA 10MHA 2OO3A 1KYWA 2PXAA 1BC5A 3AY0A 4AX8A 1TPYA 4YV0A 3GGDA 3LECA 3CGGA 4RSRA 4GBED 3O7WA 3RIEA 4QPPA 1SQFA 2IPXA 4PYMA 5FHRA 3EEYA 3P2EA 1NW5A 2OZVA 4FSXA 4PGHA 5DSTA 2HV9A 2QRVA 1X1CA 3AJDA 5C0OE 4YUWA 5DTQA 3FRHA 1P1BA 1I9GA 2YQZA 3B3FA 3SX0A 2ESRA 2OBFA 3GWZA 5DM0A 4F85A 1P91A 1OR8A 2WA2A 2FHPA 3FRIA 3V8VA 3P8ZA 4A6EA 2P41A 3LCCA 4YV1A 3EEOA 1FP2A 3P97A 3HVJA 3BGDA 3BWYA 5K0GA 2UYCA 3UJCA 1EQAA 3DMGA 3HEMA 1NW7A 2Z6UA 4M38A 1BHJA 2P40A 2V74B 5LQKA 1Y8CA 2PX2A 3CJQA 3EVCA 1DL5A 1JQ3A 5CIYA 1RJFA 4PINA 4UOEA 2G70A 4KRGA 2EG5A 3PTAA 5FQNA 4EKGA 2AN3A 2JH8A 4GF5A 1NE2A 5CVUA 3M6VA 3C3PA 5DTMA 3ER8A 3NMUF 3C6MA 2ZVJA 3NDIA 4C4AA 1ZHFA 4CKCA 4P7FA 4E32A 2PV0A 4AZTA 3KQOA 1NV8A 1JG4A 2BM9A 2AOTB 4PWYA 4Y2HA 5LQAA 5LQRA 3DP7A 4G56A 4KVZA 5HZMA 2P35A 1YB2A 2NNWB 2AOVA 1Q0TA 3BZBA 4Y30A 5GWXA 3P9IA 5EEHA 3E8SA 1ZGAA 3FZGA 3TOSA 3U81A 2ZWAA 4DCMA 1JSXA 3OU6A 3R0QA 1EG2A 4YUXA 3M33A 4C05A 4E30A 3LX6A 2H11A 2QM3A 4FP9A 4NECA 4X41A 5DX1A 5EMKA 3S68A 5F2NA 4PONA 5GINE 3THRA 4A6DA 2XVAA 3TRKA 4FZVA 1NW8A 2IIPA 2GLUA 5E1DA 1XDSA 5EMMA 1YF3A 2ZBQA 2YXLA 2NP7A 1G55A 4RWZA 2HWKA 1N7JA 1PRYA 1R8YA 2I7CA 1X19A 2PWYA 3HCBA 2I9KA 5ICCA 5EZQA 3AXTA 3KPUA 2F8LA 4E2WA 4PIMA 3CBGA 4X63A 4IV0A 3BWCA 1NW6A 1HMYA 5EHIA 2EJTA 2VZ9A 3B89A 3ER9A 5K0JA 3VC1A 5CCBA 1KHHA 2C7QA 4XCXA 2QYOA 5DPMA 1R00A 3EGIA 3O31A 4RVDA 3NDJA 4RTKA 3M6XA 2HMYB 3GIWA 2OKCA 2P3LA 4C06A 1JQEA 5BXYA 3B3GA 1D2HA 2LD4A 2VDWA 4PYQA 4ISCA 3GDHA 4C03A 3BGVA 3DTNA 3GNLA 3AXSA 2UYHA 1EJ6A 3DH0A 4DF3A 3FTDA 5P8WA 4FS8A 3M70A 4P58A 5CCXA 3ELYA 2CMGA 4DKJA 4ER6A 2I62A 1D2CA 2OB1A 1QZZA 2B78A 2H00A 3CVOA 4DCGA 1EAMA 4DM3A 3FYDA 5CVEA 3LDFA 5K0LA 3HCAA 5EC8A 2FPOA 1KR5A 4ER5A 5LQNA 2XYRA 3GJYA 3HCDA 4GOOD 5GOZA 5FA8A 3KQMA 3JWIA 2H1RA 1JQDA 1G60A 2PX8A 3GRYA 3IV6A 4M7RA 5K0EA 3PX3A 4QTTB 4EMSA 2GB4A 1KPGA 1RJDA 3CJTA 3G89A 5K01A 5C9ZA 3UJ7A 2JG3A 5FA5A 2PVCA 3A7DA 3EVAA 4YUVA 2C7OA 2IFTA 4DMGA 3HVKA 2G71A 5DX0A 2NXCA 3LBFA 1G38A 5HIJA 5HIMA 5U4XA 4QQNA 2AZTA 3BWBA 3EVFA 4U7TB 3OZTA 4BP3A 4E2XA 4E33A 1QAMA 1RI5A 2HNKA 1NW3A 1F38A 3IYLW 3QOWA 2Y1WA 4P7GA 3DXXA 4JXJA 3P9KA 1O9HA 5DSXA 3T7RA 5KQRA 1WXWA 4GEKA 3UA3A 2XBMA 3NWEA 5FULA 2GAFA 3QV2A 5DM2A 3DLCA 1TW3A 2AOXA 3ORHA 3KR9A 3DXYA 1SUSA 3GO4A 2FRXA 4GOLD 3G2PA 4PYLA 4QVKA 5ERGB 4RTPA 3SSNA 3JWJA 5EG5A 3GRUA 3BT7A 3E7PA 4F84A 2FCAA 3KR0A 4RTQA 4CWAA 4AZWA 3M6WA 8MHTA 2AN4A 2GPYA 1R18A 3I64A 2PGXA 3HA5A 5JUWA 1UFKA 2QE6A 1YZHA 2V7EA 3QOXA 2UYOA 4AZSA 4C07A 5JR3A 3HTXA 1XTPA 5GM1A 2EX4A 1I1NA 5DXAA 3JWGA 1SVUA 1O54A 5E1BA 1Z3CA 2GA9A 5DWQA 4OX9Y 1P1CA 5IKMA 4PYJA 3H2BA 1FPQA 5DRYA 2BZGA 1WS6A 5GP1A 4ER0A 5FADA 3BKWA 3LGAA 3OZRA 1FP1D 3IHTA 3LKZA 3NVMB 4OQEA 5HFJA 2EFJA 1QANA 4Z2YA 3SR4A 3B7PA 1M6EX 5ICFA 2IDJA 4HG2A 1X1DA 3OFKA 4B17A 2ZZMA 1VP9A 1Q0SA 2PKWA 5DT2A 3TM5A 3EVBA 4HRAA 4BLWA 4R6WA 3P2KA 3REOA 4RVGA 2Z6QA 2OYRA 2Z6AA 4GOND 3G7UA 3VSEA 2ZIEA 2KW5A 3GRVA 3GRRA 2CKDA 3P2IA 1T43A 1P39A 5DM1A 4R8RA 4H0NA 1YUBA 3I9FA 5EHGA 1G8AA 4DZRA 1ZQ9A 5CD1A 1SG9A 1TW2A 2AOUA 2IDKA 1NT2A 3CKKA 3DOUA 1EIZA 3DR5A 2JHPA 3ELWA 3HA3A 2ZFUA 4M36A 5LQCA 5DTRA 1F3LA 2YR0A 5EQJB 3G2OA 3C3YA 3G5LA 1SUIA 1VLMA 1XDZA 3R24A 2JHCA 3HNRA 5DLYA 3RODA 5KVAA 3T0IA 4HH4A 3SXJA 1N7IA 5DXJA 4LWOA 1VE3A 3LKDA 3G88A 3C0KA 2N47A 3EVEA 3KPYA 3OCJA 2IBTA 1UIRA 4CKEA 2ZLBA 4CXMA 4RTNA 5DX8A 2NXNA 2YXEA 3DLIA 3FUTA 3OZSA 2ERCA 4PYNA 2HTEA 3SVZA 2O05A 5EVJA 1G8SA 5FUBA 4YUYA 4GOMD 4RTOA 5CVDA 2ORED 5FQOA 2VDVE 5T64A
chains in the Genus database with same CATH superfamily
4YBRA 5ALMA 5AXCA 5THXA 4MW1A 3TEMA 2HA3A 3U3RA 4Y6GB 5C3UA 3L7MA 2GTHA 4G26A 4KLCA 3P9CA 4P22A 1H2XA 4LG1A 2CVZA 1GKLA 3ESDA 1NQXA 2NU6A 4NBKA 1OUMA 1L7DA 4QDJA 4LOHA 3T54A 4BKUA 1OT5A 4R4JA 4GI2A 5DNYB 1Z37A 4P84A 2AMJA 1IY2A 2J5KA 1MH9A 5ARCA 5F23A 2NYRA 2Z3ZA 3FKQA 2V7VA 4YDRA 5KTTA 1NI5A 3GLIE 1PZHA 2DU8A 3OTIA 1U80A 2R48A 3VJLA 1IYZA 4EZIA 2CNBA 2EFCB 3F2IA 1Z9BA 2HA2A 5CX1B 1WB4A 3H2SA 3USZA 4L95C 3AF6A 4HH1A 3NHJA 3V2GA 1EVJA 2YHUA 4XTRA 4KR9A 4U5QA 4MQLA 3DL2A 2ST1A 2ROQA 5CM2Z 5EIXA 2PUBA 1QZ3A 2HCJB 2VRBA 1VP3A 2OOSA 4GSLA 5G3ZA 3U9SA 3CVXA 4L0MA 3EQZA 4DEVA 5LCXA 4DQ0A 4ZHQB 4GZMA 2JJ8A 4U6QA 1I3KA 1Q44A 4E1BA 4AKEA 3WK4A 3O2JA 1SHUX 4QOHA 4ZAFA 3Q6NA 3QOFA 5FDFA 1PX2A 5AI4A 3GIDA 3QVOA 5E3HA 3GZJA 2CY0A 4HB3A 1H0RA 3QX8A 4I2NA 1NVBA 5L53A 4RTLA 1OV6A 3R7WB 3O8OA 2OO7A 3LLMA 3BWEA 2H18A 5AJUA 3OCZA 3JZMA 1U1CA 2IHBA 1FS6A 3B9RA 4N12A 3OAAD 5IAAA 1B23P 2C9ZA 1G9XA 3IEIA 4GGPA 4HAUA 3FWHA 3QEMA 3F6SA 4MYCA 3PWKA 1GU0A 1QGUA 1E5TA 9LDBA 3M0EA 5A3QA 2XNHA 4CF4A 2H48A 3KSDO 3LO5A 1FMJA 1VPDA 1WUHS 2VQ3A 2WTEA 4I1IA 3WGYA 2CL5A 2WU1A 5GADl 4G5OA 3ND5A 4IV5A 4ZKEA 1OH5A 2HTFA 1N4DA 2CCGA 4AP5A 3WGJA 4QFBA 4R8SA 5JAOA 3NTQA 3ERCA 1CQJB 3N07A 4CT4B 4CHTA 1PLJA 1TUGA 2P6MA 5C8DA 4WGGA 3BL5A 4BLUA 2BBOA 5LQJA 1ORIA 1DRUA 3AR4A 3GFBA 2IS2A 1ECBA 2OCLA 1RKQA 3CEHA 3GAMA 2E1PA 4YCCA 3GUUA 3I9V6 2H5IA 4LWZA 4BYGA 4J7AA 1W4ZA 1E0DA 2V1XA 3F46A 5ER6A 1NONA 1IK4A 1XEFA 1YZKA 4G36A 3SM3A 3ASYA 1DV2A 2NU7A 2QZPA 3RYHB 5JALA 2O2JA 4Y7CA 1ML3A 2OCBA 3S27A 3DZIA 3RBZA 2PXCA 2VAMA 2AJ8A 2D3WA 1YI8A 3OZVA 1XZKA 4GL4A 3B20A 4N5LA 1PNVA 4C4SA 1FU8A 1ZN7A 1PVDA 2ID8A 1RRMA 3WR5A 1S8AA 1PI3A 2ZIWB 3LX4A 2HPVA 2JC3A 2XWJI 2Z9CA 3R40A 2PN1A 2W6NA 4OXRA 4A3SA 1N9GA 1J42A 1F5NA 3E03A 1E1RA 4Q4AB 4I9FA 3T3EA 4YRSA 3QVUA 5JXIA 3CT6A 5FCDA 1TIBA 3IO3A 1NX9A 4ZDJA 5I9IA 1ARZA 5H59A 5JBQA 3GT7A 3D8HA 1N5RA 3FI0A 5JSYA 1K8XB 3IQXA 1AQ6A 3SC6A 3FDZB 3AFOA 5DXFA 1R6AA 3S2UA 3AESB 3P2MA 4FR0A 1YZ3A 1HE2A 5FWAA 2BZSA 2JIPA 5DGDA 4C0XA 5BWMA 4CM4A 1IIBA 5I4BA 1K92A 1Z13A 5FL3A 5JJBA 5LU9A 4NPHA 4CMBA 1VBMA 2WJ6A 3QVTA 4L16A 4AECA 5EIFA 1CY1A 4LYYA 2I8CA 4RYLA 3HPQA 5EE0A 1TCVA 4E5MA 4EPXA 3MAGA 2GPJA 1VRVA 1Q7BA 5JSHA 1UT8A 2BDEA 4QRIA 2PMCA 5FPSA 5K6TA 1XZ8A 4L4ZA 4ZXPA 2DTXA 2ICAA 3AM4A 4BNHA 5E4FA 2QTGA 2BUBA 5E9WA 3PXDA 5EHQA 3BE5A 1TTQB 3QV1A 1ZBQA 1ESNA 1HG1A 4DLNA 1GFZA 1OC4A 4HAXA 4TWZA 5K8IA 2M2IA 3IVRA 4EENA 4PN3A 5TMPA 4TS1A 1ZIDA 3JQ9C 2ZI5A 4RXUA 4JKYA 2W6IA 3FMFA 3KOOA 2WK1A 2JW5A 2VHJA 4OXXA 5DYWA 4C7OA 1QHFA 2W8BB 3TLBA 1J9EA 3UWKA 4XQEA 1GNTA 1D2GA 3DULA 3NOQA 1CLUA 2ZJOA 3B3JA 4JBNA 1QDUA 1II9A 2YMPA 3KEOA 3KLBA 1KP9A 2HK9A 4ZHQA 3QFHA 1YRLA 3JYOA 3WLPA 1OB5A 2REBA 4IZOA 2MR6A 1QKJA 1ZA1A 1XPRA 2HEIA 4ZVUA 3U5TA 4DJ5X 2R8YA 1VKOA 3OPYB 5AK4A 3MOSA 1D09A 2H4WA 4XM2A 2RE8A 2B4KA 4U7FA 5JJLA 2H1LA 5BV2P 4NCHA 1EWTA 2R8PA 3BBPA 1B2LA 4KHPB 3RTDA 1JMKC 3HUDA 2B5VA 1T5TA 2FYTA 2Y1EA 4KQ1A 2P3OA 4XYEA 5I9NA 4KR7A 3CONA 4RF2A 1GQ2A 2Y8EA 3RTAA 2PPVA 1VZ3A 1XQ9A 2ZBGA 3HXPA 3QUAA 3ZGXA 3VH3A 4BYMA 4D8WA 3EH1A 4B45A 1YA6A 4LMBA 2EIXA 1CZKA 1WPXA 2AG0A 2QAGA 4FT4A 4LGCA 2V65A 3D2AA 4J8PA 4HQKA 3SGLA 3CPHA 3IIMA 4ZICA 4YRMA 2PIAA 1GA6A 5TIIA 2PYIA 5CDHA 3UGQA 4L0CA 4MVJH 2PU7A 1DWOA 3BYZA 3IJRA 2VDMB 3PEEA 4CM9D 3PICA 1WPGA 2IPNA 3MC1A 5AVQA 4QU5A 3E7WA 3WYDA 5ESXA 2P27A 1CJCA 1H85A 2GXQA 3BMCB 3KT3A 1X80A 3UWPA 2WILA 1QIGA 1V1RA 2DCMA 3ICOA 3E7XA 2ZUWA 1NYRA 4BNGA 1H5QA 2Y1OA 5BQOA 5J40A 5IZCC 5G0WA 3V55A 1T8WA 1NUAA 2G0TA 3W3AH 1ZMTA 2Z98A 4BLPA 3ND7A 1R74A 3WNQA 4EYGA 4JYBA 3FUVA 4JASB 5A9SA 3N05A 1YS2X 2IPMA 3I52A 2O0JA 4YPFA 1AQIA 2VQ6A 3TKAA 4OA5A 1Q7TA 3I3SR 3TRFA 4B82A 3FZEA 3RANA 3ZHVA 4FI3F 4RY8A 3VU9B 5IXYA 3UB4A 1US8B 3ASUA 3WNBA 4Z3OA 1GKIA 1OX5A 3EQ6A 3JSAA 3HNPA 1P77A 2FN3A 4O4JB 2B9VA 2WR8A 4D99A 2F4NA 3P2JA 1W52X 2IEDA 3OIYA 2GZSA 3EJ6A 2XTMA 3L01A 3NYWA 3W5AA 3GROA 1VL8A 1WETA 2QRGA 5D5QA 5FX2A 1L7NA 4L15A 2EZ4A 3FPLA 2OP0A 4O0MA 2BMEA 3GOQA 4C3UA 2YQZA 3SX0A 4DPMA 4BUZA 4EHAA 1TQ4A 3FXAA 1P91A 3V8VA 4A6EA 3K2BA 3P8ZA 2R1UA 5AKIA 4JGIA 3HZZA 1SOAA 4F1KA 2FFAA 4WWHA 4ZVKA 1P7CA 4R01A 2FN8A 1U5BB 4DN6A 4ENSA 1HLGA 4ODIA 2W4QA 1HDYA 1G4UR 4E4TA 4XLZA 3AKZA 1GSOA 3DV0B 5JNVA 3PNLA 2V55B 1Y5LA 2PX2A 1DL5A 4O2BA 2FGJA 3ZI4A 2RI0A 1AF4A 3H83A 1TYBE 4MLZA 4DLTA 3F1LA 4G63A 2JL1A 2OC4A 5B4VA 1ZBDA 2A1TS 3N39C 4MQFB 3M1AA 1N2HA 1U1GA 5EIOA 3ESYA 1IZ7A 2W4IA 4IMRA 5LQSA 2PTHA 4E32A 1VXOA 4C7OB 4RSMA 421PA 4CI9A 2O6LA 2AOTB 2QAJA 2C31A 5LQAA 1B8OA 4QQ8A 2WHQA 4NJMB 5HGXA 5HZMA 4MVJA 4KZPA 4Z49A 5KYUB 5J2UA 2B8TA 1B0PA 1Q91A 5B1IA 1R1DA 1LX7A 2C2GA 1OAAA 4FWBA 3AR2A 1ETHA 2WNIA 3JSXA 5BN5A 2CFCA 4P5DA 4O0LA 4KZKA 1VE9A 3ZV5A 2J9FB 1RQ7A 2QM3A 3KX2A 1SBHA 2ZJFA 1J5XA 1KAMA 3SYNA 2XKAA 5J2TA 1T36B 4QGFA 3DD5A 3VPCA 3QJGA 5EMMA 4L57A 1OH8A 1LBHA 4PQRA 1EGVB 3G8DA 1UINA 4GZ5A 4WOJA 4BNNA 1R10A 1II8B 1DIHA 5CXXA 3W79A 5BMVB 4TVSA 2PSFA 4EGQA 5FOVA 3E22A 4PIMA 2NU7B 2Y1LA 2R6GA 2PS9A 2Q2NA 1LSOA 3OZ7A 4MK4A 5TJ9A 4Y98A 3BD7A 1XL1A 2YUTA 2XMSA 1ETUA 3AX6A 1KY4A 3N2GB 5TX7A 4K87A 2C88A 1X7HA 1ZEMA 2EWVA 2VSFA 4PO9A 1KNQA 1PV1A 3PEWA 4DE5A 1XA0A 2D5CA 3ENQA 3HJNA 3RJTA 1ZD8A 4UBOA 3LHSA 3HB5X 3TTXA 2OKCA 2CE7A 3DE3X 2WAXA 5BXYA 1IZZA 4YMSA 1L5KA 4OHRA 3D8NA 1B93A 5G41A 5K20A 1YSCA 2FEKA 2XTZA 1C9YA 1GUAA 2XKJE 2G06A 1WUIS 3DSRA 3PEVA 4P08A 3ZTYA 1JN0A 4RLFA 1CB0A 1EGMB 3A6FA 3TPFA 1ZN9A 1C3OA 1A76A 1W2WB 2IZ6A 4DKJA 1JKJA 4Q9NA 4I66A 4PC7A 4RZXA 3MJVA 4BGVA 1A9OA 1GT6A 4E21A 2J5QA 3LDFA 4IP0A 1DBVO 3IHKA 2H3HA 2WP0A 2H31A 3OPVA 1ONNA 4MMYB 4I19A 1GVNB 4UJ5A 2VUTA 2AFRA 5HJEA 4PM4A 1XZPA 3IT0A 5DF1A 3L46A 2OBNA 4M7RA 5DW0A 2C1ZA 1OXUA 2ID4A 1RJDA 2WUDA 3V1UA 4BKRA 5A4MS 3IQFA 1E79D 1E4EB 1Z0ZA 2J59A 1HE4A 2ZVDA 2JAHA 3A7DA 3OIGA 2C7OA 1NQWA 3AONB 4FK8A 1JPUA 2J6CA 1CW2B 4KQCA 2NXCA 4Q02A 4R8KA 4M86A 1J1UA 5HVNA 4JIGA 1I3LA 1Z5UA 2AZTA 3TI7A 5IAOA 4H15A 1ESZA 2VPWA 4LJ9A 3RUPA 1TM4E 3LHKA 3H87A 3OZAA 3HKEA 4R8VA 1C7FA 4CMHA 3MGCA 1IHPA 3Q85A 4N9WA 5GJWC 1RYDA 2OLJA 2VP9A 2WWRA 3FHJA 3ROQA 1YK1A 2AL7A 1LXCA 3W5VA 2P4QA 4MP3A 1NP6A 2P4SA 4G0OA 1M34B 2YJNA 2INGX 2H29A 4HMOA 4XH9B 3UM9A 3NHRA 1GEEA 4OQXA 5CDFE 1EWKA 3EWSA 1D0VA 3GO4A 5JS6A 5KYYA 2FRXA 4ZJUA 2ZM6B 2VDPB 3MK31 4RANA 3HJBA 4B4OA 2CLOB 4KBGA 1RXCA 1I1QB 2BFFA 5JNTA 4IL5A 5D00A 1SHZA 4O2AF 3SEZA 5G1PA 4HO1X 1ZOPA 1XZMA 3OT5A 3CE6A 4ARVA 2AN4A 2YWFA 2HGSA 1VJCA 3QVXA 4YLYA 3K6SA 4JT8A 4Z99A 5KJ1A 4GR9A 4WMLA 5CNJA 4ZODA 1T2EA 3E8XA 3IPXA 4C5CA 3TQQA 2AZDA 3ODGA 1OBVA 3IE1A 3IUMA 5E6UB 1MVLA 1Z3CA 4GVLA 3LPDA 3ZGZA 5KJ6A 3MCAA 2YOGA 4MKRA 2VWQA 3KHSA 4ESEA 2WJAA 4RDIA 3A4YA 1GTJ1 3LKZA 4F4HA 1NJ5A 1DJPA 4BQIA 5MN5A 3CIOA 1XZLA 4N4AA 2YXBA 3REQA 4K6KA 5IC6A 1KJZA 2D6FA 2WJWA 2DR2A 1K89A 5DT2A 1Q0LA 1V41E 2RHJA 4KR2A 1PE0A 4FMPA 2AFHA 2OYRA 2NACA 2Q1TA 1X0VA 2GHIA 3A1NA 2GR9A 4WZBA 4Y6OA 4XWGA 4D02A 4ALLA 4OM8A 3O8RA 2CUNA 2OR3A 4HOYA 4XJSA 1YJ5A 3SBDA 3U09A 1QRUA 2BEJA 1X7WA 2DQYA 2HO4A 3DOUA 4HDMB 2XD4A 3K0AB 1XKQA 2WRZA 3C3CA 4PBRA 2ACEA 4MXDA 3D0OA 2RBGA 2X4LA 3IUSA 3G2OA 4L3VA 4LDZA 5FOXA 3KKQA 2PUAA 4KTVE 4G01B 3OMXA 2GJAA 3ZHZA 4OIMA 4GX2A 2F6RA 2XJ9A 1HFJA 3LGXA 5FUYA 6PFKA 1GP2A 1L4NA 3TLEA 1X2EA 1IHOA 1QJCA 2PKXA 5EZYB 3AU9A 3B6MA 5AK6A 4BZWA 3OCJA 1U31A 3DGEC 5I4IA 2OFWA 1JBQA 5IT9A 2BMFA 3UCEA 2CJXA 3U9TA 3ITKA 5CLHA 2HRRA 2NZUG 1KDZA 1BCSA 3FOWA 3WDSA 4RTOA 1QK3A 1U8CB 3A05A 3PUKA 1R0BA 1UZMA 5I9LA 2O1WA 4G25A 1Y82A 4H0CA 1QH8A 4QASA 3UJ8A 2VAVA 4US2R 2O8DB 3TIVA 2RK3A 3HHPA 3O1LA 1TDJA 3AWIA 3PUZA 4PU0A 1RLMA 4KQ9A 4RZUA 2ZKIA 1U1DA 4KGDA 2YRWA 4ZCIA 1NQ5A 5KIAA 2WQ6A 2ZTHA 4FEAA 5JQGB 2O57A 2E4ZA 1YRYE 2HKIA 3B6JA 3UJ3X 5KC9A 4AY4A 2WV7A 2YJZA 2XF2A 1EFTA 4F9TA 3BZUA 1QFZA 2X0DA 3SF8B 5BN3A 2W8BA 2I1VB 3SXPA 4C14A 2HF8A 4MI6A 5IKOA 4DCPA 4GMFA 2P2CA 4CTNA 3ZJUA 2RKOA 3W06A 1KEKA 1SZJG 3H11B 4JI4B 3KIPA 3SSOA 1GPDG 4QT0A 2MSWA 1IXZA 5CGZA 4P4SB 2DR0A 3IVCA 5AVSA 2K4MA 5CA1B 3SHOA 5LNK1 4Z4QA 2SKDA 4BVFA 5DLQC 4PZPA 1J2UA 1CR1A 2NUAA 2RGGA 4RZ2A 1Q1NA 1QVZA 1YR3A 4QULA 4I36A 3CB4A 4IYJA 1LBEA 3Q7IA 3ZX4A 4G0YA 1HR0B 1JLLA 4UHEA 4FCCA 1QKIA 1ENYA 2DUJA 4UDXX 1L5SA 3IXQA 5JJIA 3R6LA 3FPAA 4WKNA 1S8OA 2WJ3A 2ZBVA 5EP4A 1O5TA 2HSZA 3EB9A 3SKYA 2G1KA 3OSZA 1DVRA 3F4KA 4KNWA 2HJWA 1YVPA 5D6OA 1L5MA 1RABA 2FCRA 3U7IA 3HRIA 1W9MA 3IPCA 4NYIQ 3U13A 3H17A 2XE7A 5SZIA 1QFJA 3ZJ4A 5ICEA 2GEFA 2GNOA 4OXKA 5DNUA 3NIBA 1CJKC 2XVZA 4LYJA 1X9HA 3NHSA 1WX1A 5LC1A 2IE8A 1CUGA 4JJEA 4PLFA 3AF5A 4ZO9A 4PAGA 1EQUA 3BKXA 3BDIA 4EBFA 3D8RA 3U7QA 4CZ2A 1WG8A 3WTBA 3ZU2A 2P6RA 4E5PA 1PSWA 2HIMA 3WSTA 3HI6A 4Q48A 2ZJ5A 1C8LA 4AMGA 4DA7A 3V4OA 4HRVA 4ETNA 4JLBA 5AJXA 4RX1A 4DNFA 4Y67A 4D0SA 3OCUA 1AH2A 4NU5A 4RQAA 3KB2A 2Q4BA 3MVEA 4NK4A 2NUBA 4LTDA 4OGWA 1CZHA 3GLHB 4DR7B 5JV5A 4MW0A 5CM9C 1X77A 1WDLA 1XHEA 3T5AA 2P7HA 2ZE5A 3LSTA 3B6IA 4YCMA 2YZMA 1Y3CE 2FFHA 3FM9A 1N9ZA 1MAVA 4F5WA 3FPEA 4KLRA 2PX3A 4KW7A 3LVQE 4YJ3F 1CUVA 3BMQA 1PFQA 3C3DA 1W35A 3TWOA 3ZXXA 5LUAA 2XE6A 2CCJA 3T5MA 1KOJA 3D02A 3ICQB 5H9WA 2PBFA 3OMLA 1VJ0A 1M0SA 2BKAA 4J4BA 1D4ZA 4MUNA 1GN9A 1K8QA 1SK8A 4HGYA 3C8DA 1LWOA 3X43A 4CLOB 5DYGA 3CF4G 4W9MC 1NVWQ 2ARKA 1Y7TA 2NZ2A 3M4XA 1HWYA 3E9ZA 4IX9A 1MV8A 1PR6A 5EE5B 2HEGA 2HSJA 4M7PA 1NI3A 5EY5B 5KDLA 4EATA 4ZOQI 1TUBB 3FNRA 2EARA 4Z4HA 3BMQB 3DLPX 3I05A 1R8SA 4D25A 3WIEA 1ZM4A 2E18A 1JHYA 1W4RA 3PVCA 4Z9BA 5DTIA 3URMA 3IEVA 3UY4A 3LTNC 1ORTA 4GC9A 4HUQA 2GBLC 4KWTA 1L4EA 1DOHA 5AVVA 2CW5A 1FJHA 2P67A 4JA2A 1ZRSA 4YECA 4DCMA 1PWYE 2IDMA 3CEAA 4G0PA 4LDAA 5HOQA 2XB2A 4JVOA 1XI2A 4X20A 3H1GA 4JD5A 1K66A 1KQOA 3FNGA 3MYRA 4KFUA 2A1UB 4W1QA 3A04A 5JZSA 2Y4OA 4EG3A 3HFGA 4ZOLA 1NBIA 1ULSA 5IS2A 1EWRA 1U11A 3F96A 1CUIA 4ZTUB 1ONOA 3A1FA 3BPSA 2OVBA 1TA9A 2V45A 1NKVA 4YRPA 5BORA 1SPBS 4Q4JA 3VU8A 3EOBI 4BQFA 3MCWA 2XOXA 4UQOA 5GY7A 4DVGA 4P0QB 1W0KA 3ISJA 4FCVA 3JZIA 3X1JA 1Y6FA 4G0NA 4J6EA 2C2ZA 3DCNA 3LZ6A 2GVNA 4QUEA 4CM8B 4G1CA 3IURA 4DARA 4G1VA 3TUIC 4WOPA 5FI0B 4ZDWA 4PQYA 2H7YA 2IIQA 1HNWB 4IV8A 4JOCA 1OB2A 3K92A 2BM8A 5DIZA 4IJ6A 4ZPXA 2XOKA 2G09A 3PGJA 4D9EA 1JJ7A 5JSZA 4GYWA 1ZZEA 1XAGA 1XPUA 1W2GA 5IYZB 1ADFA 2I4OA 3PQ3A 3K5HA 4RTMA 1A2BA 2QBYB 1G291 1ITZA 3VU3A 2V9ZA 4FYVA 1ZJ5A 1NVXQ 1ZD9A 1BKDR 3H4TA 1KIMA 3LC2O 4LX0A 3UB2A 3U4QA 3H75A 3UAOA 4REMA 4WOKA 4RTSA 2NUAB 3A1VA 4IDHA 5GGXA 1XEWX 3PS9A 4LC1A 4Z4IA 1IEQA 3ZCUA 1CQZA 3LLUA 4B3XA 3KSAC 1M34E 2X5OA 3DWGA 1S2GA 13PKA 3GT3A 4JA0A 3TLYA 4B33A 2DUMA 2EYQA 3L1HA 4KO1S 3KKLA 2VP3A 5CIQA 2QF7A 3UJ6A 3FB1A 1SQGA 1M2FA 4EJSB 4ZJZA 3ZIAA 4DLYA 3TGWA 1K8RA 2R5NA 4FCTA 1DC6A 1R6DA 3E27A 3VPSA 4E13A 1L9KA 4WECA 1BSVA 2RJNA 4TRRA 4TTAA 5HKBA 4OUDB 3OSUA 2IYSA 5FUXA 4AY6A 1KAGA 4XYGA 4C9BA 5KYTA 3VR3A 2VDLB 4ZAZA 3B7GA 4J0KA 4JX8A 3I34X 2AXQA 4EQ6B 2R96A 2QKYA 1HTBA 4FJ1A 4L9RA 2JLAA 4U00A 1M66A 5DO9A 5TQ2B 4JLDA 4B8YA 1YFJA 4MEJA 1M2GA 4GLBA 5DGHA 3DF7A 3AF3A 3OC0A 4OXQA 2HMWA 4PG6A 3R0JA 3UZUA 3QYAA 4Y1RB 4X65B 1F2UB 1A5TA 3CNLA 3ZJVA 1EJBA 4CEIB 5EZYA 1HFKA 4ZPJA 4ZJPA 2C7RA 2YKGA 2O8FB 1ZM9A 3PFHA 1YMQA 3F74A 3X1KA 1FW6A 3OX1A 5D5PA 4KP7A 2R3SA 2V96A 3EN0A 3MTBA 3PNKA 4EJ2A 3BTUA 2TYSB 4MKHA 1TOAA 3NWJA 4TWIA 2YWXA 1P61B 1B0UA 1PWHA 1QJ4A 2AS0A 1AS0A 1XZJA 4GQBA 2Y3IA 3OT1B 3INRA 3AIKA 2PUWA 3I61A 4WT7A 1LS1A 2FUCA 4DJDC 4URFA 3DNFA 3JAWB 3M5CA 3IULA 1T5IA 2J3IA 1DKPA 1XD9A 1BX3A 3IOMA 1BC5A 2JBHA 3I42A 2HYIC 5ENVA 5AW3A 3AUUA 4GXTA 3ABRB 3KAPA 5AP9A 4DHWA 3FFAA 1BVUA 1I6LA 1DS6A 3DL4A 4GI5A 4QPPA 3ETJA 2VKQA 2CVOA 4UNNA 4HTAA 5IRCD 5IFLA 4ND8B 2JKYA 1E8MA 1NVFA 4KWEA 3SICE 3RAGA 1KAHA 2BHTA 1UT6A 2C5FA 2HCRA 1IQRA 2JGAA 3B3FA 3VKHA 2WKWA 3GG9A 4FLEA 3GWZA 4F85A 1OR8A 1SC1A 1DQSA 1ZITA 2JGDB 3M9XA 2OV8A 4OK6A 2Q5QA 4BC1A 2BYTA 1QQTA 1ABBA 1KVQA 3HVJA 4UCQA 5ULLA 3SF0A 5KHLB 5HMLA 1EDOA 4H7FA 3EF3A 3C43A 4ITUA 4RH0A 3GRFA 2CLHB 2VR1A 4ZRNA 3AR8A 3S7ZA 4DC0A 1Z6GA 1MZPA 1QV6A 2YS7A 2ZG6A 4MR7A 2O3TA 3BWXA 1E3QA 1C1HA 2WMYA 4U2EA 4FYJA 4G09A 3E7FA 3B5JA 1OXBB 4X0EA 3A3OA 4KRGA 5AFSA 3K1AA 5C35A 1S3FA 3SJ7A 3UT6A 2IGBA 4E7PA 3X1XA 1I6KA 2EF1A 2Q99A 3OQMA 4Q9JA 3K8OE 2E6UX 1KI6A 4C7MA 4CL2A 1RPZA 4P7FA 2JVJA 1OLXA 4ZANA 3TYXA 4WZAE 3UENA 4TWJA 3SJUA 1SCNE 3AU8A 4FBGA 3FROA 2XTJA 1K8YB 3WAGA 3PD0A 3RVDA 2FPXA 4DJEC 5LPNA 1U3VA 2AEJA 4C2UA 1NUUA 4RVUA 1FJ2A 1GSAA 5LOVA 1SVIA 5BW5A 3BEDA 2QV7A 5ELLA 2IHVA 2FQYA 2NUPB 4UEJA 3GMTA 4MDHA 2VT6A 5AI5A 3U7HB 2R9VA 3EPLA 1R8QA 1RWPA 2YYSA 4FP9A 2GYYA 5FTJA 1ZIPA 3OZUA 4GS5A 5LP1A 3QKTA 2XVAA 4I55A 1R4ZA 1LSSA 3HY6A 3IP7A 4L8WB 2RGEA 2CYAA 3BQMB 3F3SA 4FPXA 3A6EA 4YI3A 2G9NA 5IANA 2E4YA 3UKOA 2O7VA 1EHIA 3CRNA 1EU1A 3AW8A 3HCBA 2JVIA 4G37A 1OCEA 3KPUA 3IAM6 2O2GA 2H92A 1JVBA 1XLUA 1Y5IA 2DVMA 2P62A 2VJMA 3EJWA 3ICCA 1M83A 2D1YA 3JQ7B 4PV7A 5HF6A 1L5HA 3QQ5A 2PUFA 2WB4A 2WYWA 5LXTB 6YASA 1CUAA 1T0BA 1J07A 1R00A 4IJQA 2KSQA 2UUAB 1GAWA 1CY6A 1M2VB 1WDMA 3M7IA 1EBFA 1OKKA 1RYZA 4OHPA 4IKEA 2HD4A 2J9ZB 2PZJA 2RHHA 1LD3A 1FDIA 1H2ZA 4RKRA 1U7TA 2W2PA 1XN1A 2HMSA 1Y4SA 3CNHA 4ISCA 5IVKA 4C03A 4TXHA 1DXOA 2XNKA 1G2OA 1PT9A 1DXYA 1XALA 4D3XA 2FW0A 3DWIA 4BX9A 2I80A 4HP8A 5EJEA 3LQKA 3P19A 1H66A 2F00A 1HLFA 2I62A 4LSGA 4ER6A 1D2CA 4BMOB 4DCGA 5IEJA 3QFFA 3RHZA 3WYEA 2FEPA 4EJ6A 4NG4A 5DBFA 4TM7A 2D7CA 5HF9A 3WGNA 1O2DA 1V5FA 3NHKA 5AIBA 5GONA 4NTZA 4D0RA 3WK6A 2ZBFA 3EY9A 4IJ5A 2FNAA 3EXEA 1G60A 3M1IA 5LUBA 5EYPB 2PVSA 2FP3A 8LDHA 5K0EA 5L3VA 1SC3A 1M7GA 3TS1A 3DVRX 1YRAA 1KPGA 4EW6A 5TC4A 4OPMA 4Y2SA 1KZ1A 4REQA 3NBUA 3NETA 4A8JA 1ZCFA 3BXFA 2ZXFA 3VVLA 3I4FA 4PX5A 2AQ8A 1JPJA 1K68A 2J85A 2R47A 2WSMA 4MQUA 3F9RA 2C2XA 4Q39A 4TV9B 2PYDA 4E2FA 2CNNA 5FOSA 1YR6A 2P3SA 2MYPA 2PRKA 2Y1DA 1KZYC 4E2XA 3K0SA 3ANNA 3GYBA 5ALHA 5ITVA 3DE4X 4HQ6A 2NT3A 1LF5A 5CITA 4MR7B 2XCRB 3K31A 5CT8A 3WDMA 4EZBA 5KQRA 1PJQA 3UWDA 4BATA 1XN4A 3LPCA 3IVMA 4I1OA 2VF8A 3C6XA 1J8QA 4Q1VA 2B92A 4KXYA 2FPIB 2PQ6A 4RL6A 3JPWA 4COOA 1ZK0A 4L1KA 5LBTA 3U4AA 2WG2A 4F9GA 5ALFA 4X3PA 2EX1A 3D81A 2OAGA 5K0ZA 2IOHA 4IDNA 1JILA 2NUTA 3BE4A 4EUFA 4XVRA 4TX1A 2Q2QA 3P0FA 4O8CA 5TGZA 5JUWA 3A6JA 3QOXA 4QSMA 2UYOA 2J0SA 5KNCA 4OAOA 1X7GA 4E09A 4B34A 5JD3A 2G67A 1OXXK 4XYMA 3OPQA 1X3LA 3OLVA 3ZI7A 2ZB4A 1WU7A 2JFUA 3V1NA 1ILWA 2EDCA 4K8RB 5IKMA 2EVWX 4BJ5A 1ULBA 1CE8A 4J0JA 1UJ4A 3H2BA 4QYXA 1IEXA 2CLMB 4O4IF 1B41A 1QX4A 1WSWA 1ZC4A 4RSHA 5AM3A 1H69A 1PV4A 1JDSA 1UK8A 3TCKA 1FP1D 2HDHA 1BD3A 2J0UB 3F5QA 1DXHA 4UHKA 4X62B 1FPMA 4S1OA 3N0VA 4FLMA 3D7NA 2VBFA 1PUIA 1E6CA 3ESQA 2QG9A 4GBMA 1B6TA 3WLIA 1QSGA 1QQ5A 4G8JA 5DT9A 1CCWA 3EVBA 1UKAA 3MIIA 5LMZA 2Q21A 1HF3A 4M1OA 4RVGA 2Z6QA 1BN7A 1RACA 3CEJA 2D1RA 2KW5A 4CPDA 1SZCA 3D6MA 3FCCA 3HO6A 4CEIA 3LWDA 4KFSA 3IMGA 1MB3A 3QG5A 4JJFA 5I3CA 3MLBA 1Z2PX 4YAJA 1NT2A 2JFVA 2LDXA 4D45A 1WXQA 1HE5A 3MRTA 2AE2A 5YASA 1EE9A 3C3YA 4M99A 1KSGA 2C4NA 1SUIA 2EKZA 3B8HA 1XDZA 5A6VA 5B64A 2R65A 5DTJA 1UDRA 1QO0D 5IAJA 3RODA 2GJ9A 3UJ9A 4BV3A 1R5BA 4X8LA 3HLTA 1U0LA 1LNZA 4ZQGA 2AKEA 2IBTA 1EB8A 4CXMA 2A35A 4RTNA 3R7LA 1RFLA 4OJKA 3WLHA 2PVPA 2AG1A 1Z47A 2FXIA 3PQ4A 2AK3A 4MLCA 1W29A 3HLYA 1ZXBA 3BIOA 2O05A 1JIKA 5FUBA 2GN4A 3PU6A 1QC5A 1UAGA 1YR8A 2Y1FA 3N0TA 4IY1A 3L6OO 3WWOA 5A4JA 3F73A 2F8SA 3MLAA 2CVFA 1O1YA 5D7NA 2FWMX 3BSYA 3CB2A 1JFRA 3VNRA 3CLTD 1WJGA 2JEYA 2ZRBA 3HUUA 3NIWA 4Y0AA 4XGNA 4X95A 4DLLA 1PK9A 3U44B 1L5LA 3EHDA 4G85A 1ZD4A 3VTKA 1YBHA 2CK3D 4YP0A 1Z56C 1YFKA 3MWEB 4H7PA 4UOQA 5HIIA 3V6MA 4NBVA 4BTLA 1GQRA 2G7MC 4EW1A 3QNUA 3MJ4A 1OMOA 1J8VA 3EHEA 5FPHA 4O2RA 1I1HA 1NQVA 4XUEA 2PL9A 1P2VA 2XRFA 3PSHA 5IC5A 1P19A 3H4MA 3ZE1B 1Y1LA 4AULA 1JQKA 1X86B 3CZMA 4EGAA 1USVA 3S29A 4Q3NA 4BO3A 2XCLA 4EJSC 1IK6A 2G9VA 3IBFA 1G3QA 3LL7A 4J7UA 4NSNA 1PHPA 2RI6A 5EXDA 5AQ1A 4PZLA 1VI6A 4QLBA 2JGJA 2EP5A 1GPMA 5CIWA 2XQKA 1YRWA 1T8PA 4W5TA 2P90A 1QAOA 5K4AA 3U7GA 3KVOA 1CVIA 3F49S 1XA3A 3IAAA 2IL1A 5B7PA 5M29A 5FI5A 4ZP1A 1YE5A 2RAVA 1KZ4A 4C87A 3CZCA 5CXSA 1UBJS 2NX2A 1MLDA 3OFVA 1ENOA 2GBCA 3K94A 3G5TA 3MTJA 5K6AC 4JYPA 3P27A 3A9RA 3WWEA 2VXYA 4L0DA 5LXTF 3KFLA 3RKSA 2VYND 4LNHA 3RARA 3GEHA 4HC4A 4BX0A 5DLDA 3ID6C 4HRXA 1KI3A 1RAHA 3SOZA 3QELB 3HXKA 2IODA 1Y4UA 2DJIA 2QOEA 2F3UA 4E2ZA 1D1QA 3QPDA 4MWGA 4M60A 1Z0AA 2C99A 2NSYA 4YO8A 1YZLA 1GYQA 2Z57A 3PPVA 2VUIB 2HLNA 4L5YA 1C3VA 1KI4A 2Z1MA 5CEFA 5K45A 4LHXA 1OFVA 3VNBA 5BN3B 4BJ6A 4F12A 5JWHA 1XRNA 2D7JA 3GPBA 1QAQA 1K7CA 5F9FA 3PFGA 4RE5A 4CLOA 3CNOA 3PR1A 4R1MA 1GTRA 4AMYA 1U9CA 2PUCA 1JDUA 3P9NA 5ESDA 3W6ZA 1AMNA 3R6TA 2YZ2A 4DZZA 5EVCA 1R4AA 3B1ZA 3ET4A 1GO2A 2GZMA 2WTAA 3GN1A 4ATNA 1PLLA 3Q12A 4D9KA 2CJWA 3V1MA 3E2PA 4WN9A 1N9GB 3FPSA 4R2XA 2A9RA 3VPBA 3AHDA 1T2DA 2JAXA 1ISFA 4DMMA 2JCSA 2BMDA 1ZOLA 2ZIFA 3UMJA 3IUYA 1T1RA 1QYIA 4TQAA 4TV9F 1MX5A 2ONCA 1LI4A 2A6PA 5CBPB 5J2TB 2QUKA 1JLMA 3AF4A 3GLFE 4R16A 2R1TA 1TKCA 3IAM1 1VA4A 1WXHA 1P3DA 1QGOA 1ZYUA 2A1IA 1KY2A 3STTA 3IVXA 5HR5A 1P2UA 4U7DA 2W70A 5TEWA 2QN3A 2CEAA 3IV7A 1JHDA 3ULKA 2QDXA 3N5CA 4BVGA 4EG8A 2G6TA 3ENWA 2PFGA 4QLOA 3KZXA 3OFSA 5DBGA 4DLRA 2XMQA 2I5PO 2YIJA 2FPMA 1KEVA 3ZE0B 2EEZA 1F51E 2C0QA 1RI3A 4LJSA 5ALVA 3G9XA 2GT1A 4S12A 4LMRA 2QRQA 3G2QA 3QXSA 3PKJA 1JEEA 1FYFA 2CLLB 4JZYA 3PFIA 4EHJA 2RHTA 1HDIA 4QEKA 2CXRA 2VO1A 4TSRA 3TEJA 5JOQA 1K06A 4CN8A 3ZDZB 2X3FA 3OP1A 5DGCA 4EMTA 4OQLA 2AFIA 2PT9A 1OI7A 1MO3A 1PU2A 4R2WA 1CG6A 2W90A 2WPDA 4BV2A 3N1UA 2ONZA 2PKYX 4N76A 3MA0A 3JR7A 2KPOA 4BO8A 4AJPA 2Q28A 4WJLA 3CKMA 4E2YA 5ECYA 4ZT2A 4EITA 1O9GA 4RPGA 2QPTA 3NJRA 1X7ZB 5CW2A 1B8PA 1JW9B 1OD6A 3DCJA 4I1RA 3VNUA 4NE9A 3MPUA 2VWPA 1T8YA 3QUSA 2JJ2A 3N8NA 4Q03A 1AS3A 1RQGA 1E58A 2QM0A 3BGWA 3VR6A 1SURA 3WRYA 4E4RA 4EIWA 4J0QA 4Q3AA 1IXSB 4DQLA 1MRNA 4YAEA 1BRMA 1DX4A 1GG2A 5CT9A 3IALA 1GOTA 1ZKMA 1VPTA 1DCTA 1V11B 2VYQA 3GCXA 3QLVA 4IGIA 4Y1FA 1A7UA 2X0FA 1OH6A 1YMVA 2P0AA 1F48A 2DOKA 3OPYI 1CZRA 3Q7TA 3GDGA 3HKEB 4JBGA 2VCHA 1IHDA 3EDRA 1YBMA 2GHRA 5F7OA 3KJGA 3PPIA 2NW6A 1HEUA 1OXSC 2JHFA 4U7WA 3VTAA 4V1CB 1U2ZA 2JDIA 5B2ZA 3KS9A 4ECAA 4YV2A 1FSGA 3H5NA 4PLHA 1FB5A 3BF8A 3S2SA 1HDCA 2CMHA 4Q4JB 4PRLA 5DTEA 4J1NA 1GQOA 1KKMA 2IA5A 2QSUA 3R7SA 3UC5A 2OVFA 2W6OA 1WQ3A 4RK0A 4ZALA 3KQPA 5A0FA 3RC1A 4HYYA 3Q7QA 1E1NA 1N92A 1QGDA 4KAAA 3X1MA 4EG6A 3V3TA 5FBVB 3EIFA 3L92A 3RIGA 4ZOLB 4F5DA 3ED1A 3UAWA 3WMWA 2DWPA 3RWMB 4IYRA 4AKTA 3JYLA 3SNHA 3V8MA 1TFRA 4K6HA 5NLLA 2ADMA 2Q3BA 2JFOA 2ZPAA 3QPAA 4X3CA 2VPYA 4BVBA 3A6PC 1LV8A 1BMDA 1E9RA 3BREA 3KTFA 3LT2A 1SFRA 2G76A 3OCYA 1L4LA 1XMQB 1LK7A 2WOOA 4JQZA 1KAQA 5D87A 2ODPA 2ZR0A 2YWJA 1RKUA 3F2VA 4BNIA 4YXWD 4JP1A 3CGWA 3OJLA 2HJVA 3DMTC 1I1OA 3IBTA 5A0TA 4HWKA 2DPGA 4L9AA 2R5WA 1USKA 5J2UF 1U7WA 4OQYA 1AB5A 4HDCA 1N5IA 5B3AA 1ZVKA 2AR0A 2XYQA 4GGMX 3T9DA 2GPSA 1CQIB 1EPUA 4PEVA 4GSYA 4MB2A 1O08A 3ZHSA 2AEFA 3SHTA 1ZSYA 3VKUA 3NHLA 3SC2A 1A7JA 5C46F 2P2SA 2XUQA 2EZTA 1G64A 1EJ0A 3HM2A 1L7OA 1ZUIA 2F1OA 1PDOA 2Q07A 5E7MA 3W0LB 5ILOA 3ZEIA 2FJUA 2JIDA 3G9QA 1BW9B 4NX2A 2IXTA 4MRSA 2ACVA 3R7FA 4AJ1A 4PX9A 4YCDA 3OICA 2B8EA 1EVEA 3HK2A 3QVWA 1VLQA 2IPXA 4B4DA 1L6RA 5JZMA 3L41A 1IZ8A 2AUNA 4MUAA 5C0OE 3N9IA 4JLUA 3O2NA 3W1WA 5G53C 1HDOA 1I0LA 2QR5A 1M2NA 3SDZA 5HK9A 2UUPA 1L4UA 3I6YA 2OBFA 2QZJA 4DY6A 3H2HA 5IJAA 1KI6B 4P4LA 5REQA 5J5AA 3ANTA 4Q4LA 3T5TA 3ZZ0A 1IWPB 2K7FA 4LGVA 4LOAA 1TTHA 3I2FA 1F4PA 1DO8A 4TLBA 5EKTA 3QENA 1HZZC 5EXTA 2VQEB 1XMXA 4M76B 3V00A 4RV4A 3F71A 1IH8A 3WK9A 4NEQA 3KWJA 4FMCB 4HX2A 1ZUNA 1D4OA 1KGSA 3DVSX 4B6OA 4R1PA 5HS6A 1KU0A 1W5FA 4QOGA 4EA9A 1W2HA 2NZWA 4XCQA 3RV4A 6NULA 4Z7OB 1Y7HA 1AT1A 2JFXA 2QN8A 4HB2A 5DTMA 5EIBD 4D3YA 4RBNA 1LC3A 2XGMA 1KJWA 3AV0B 3FSJX 4O59O 3SIWA 3OQIA 1NIJA 3LQQA 2UVDA 4G5FA 4MW2A 4AG3A 5BQ3A 5DYYA 1FMLA 3UGKA 2ZUDA 3JU3A 1Y42X 3PA8A 4R81A 1Q84A 3ZTWA 4Y9UA 5BOSB 1D1PA 5I7EA 1BXGB 4LF6B 5LIRA 2JIZD 2Y77A 3P9IA 3E8SA 3OEHD 2ZB8A 4I81A 3FZGA 2WTXA 4HADA 3VTFA 3PQFA 4XB6B 3H2JA 5AVZA 2AHRA 4WPGA 3VKFA 1JAXA 3LX6A 1M72A 1S7CA 1UJNA 3VKGA 3WYAA 4TV8B 2BEUA 2H08A 3FTQA 2M98A 4FZVA 2IIPA 1L7RA 2P9EA 3KZVA 4P83A 5REQB 3W7VA 3GCDA 4FZ3A 4NONA 2ECQA 1WQ4A 1BEUB 5TGTA 4A0FA 1XTZA 3HDHA 2ZI3A 4I08A 2CHUA 4CM3A 2COKA 4IQ4A 1LLDA 4GWLA 5HQ3B 5FOUA 4M0PA 2ZAMA 4DDWA 5BWCA 1JTVA 3IO5A 3UT5B 1W88B 1YS6A 4AROA 5A5VA 4C6HA 3BGOS 2F55A 1P2SA 4XCXA 1IB6A 1XELA 4DJJA 1NMXA 1RPJA 2J9GA 2QU7A 4WDQA 4ZIRB 4YCSA 3QM1A 5EIHA 5F3DA 4HDRA 1A2KC 3PQ6A 3SEFA 4LQ4A 4RA9B 5TVKA 4D9FA 2FH5B 4G0XA 3B3GA 4TRMA 1U9JA 1V6SA 2OCIA 2OOKA 1DI0A 2WHEA 1IOLA 4DLUA 1W87A 1LPPA 4CL0A 4G8CA 4B09A 1MPXA 1E6LA 5HJ7A 3MJTA 4HNAB 2P9TA 2MMCA 3F8SA 1RAEA 3RJMA 1NRJB 3RIYA 3AINA 5ALNA 4RMIA 2O1SA 3SE0A 1S01A 5DI3A 1QZZA 2X4DA 5CVEA 3DHEA 1IDOA 3HO1A 3P2YA 1NG9A 2WIKA 3D7KA 1MIOB 3IUQA 4MRMA 3W04A 1JQDA 4DV5B 1AZWA 1CUYA 1P0PA 5L3RA 3SBXA 1HGXA 3UHJA 3ZXYA 3Q2OA 5ALQA 1Q1GA 4C3ZA 5A02A 2V0GA 2GB4A 1Q6YA 3O5AA 3J81A 2VC2B 4FHDA 4JSYA 1FK8A 3B9BA 1BQ3A 3K8ZA 4JS0A 4HVTA 1F5SA 5HCNA 3VSCA 3EIXA 5HX7A 4LVNA 1YKFA 1E77A 2IY9A 1KVRA 1QUFA 2QTBA 2I8LA 2JJMA 3LRXA 5LVAA 4EG1A 2BFEB 3P0JA 1TKRA 2A78A 3ETGA 4QUHA 1RWVA 3D6UA 1SKAA 4XQCA 1V25A 5K9ZA 1JAHA 1O9HA 1VDMA 2AI1A 2P5TB 3T7RA 1SU8A 3AR9A 4C0BA 4GM0A 5KSPA 1P80A 3IEPA 3KUKA 4M6WA 5B4UA 4EF5A 3BTSA 1V1MA 4C1BA 4XX1A 3IDFA 3IKVA 3EGWA 4YJGB 3QLUA 2YWRA 1OY1A 4HUJA 4PY2A 1VPEA 4W82A 1OSNA 3PNMA 1WXFA 1C4KA 2X8AA 5TF4A 1NMQA 2JA1A 3IX7A 5CVCA 1B8UA 3RSLA 1T5SA 4NPCA 4QBHA 2PGXA 5B3JC 4F60A 1UQTA 5TT0A 4PSDA 2AR7A 3EVTA 3EBOA 3IUPA 4AZSA 4B32A 1EXVA 4FFMA 2CXSA 4DT1B 1FUUA 1O54A 1BE1A 3FHLA 3WKDA 4WBNF 3ZD7A 4Y2QA 1KI8A 2R751 3F6PA 3JTMA 1FPQA 1OC2A 1EHYA 2VN8A 2PS0A 3OE7D 4TLMB 1YKSA 4NRDA 4B35A 1Y6GA 1HT0A 1QIKA 1TK3A 2WWHA 2AE1A 2PANA 3A9SA 3OHSX 5D7BA 4EHFA 3STXA 3AG5A 2WYIA 4TKVA 1ZI6A 1W4CA 4L76A 5B1EA 1NJ1A 821PA 3WL7A 2GPTA 1Y3FE 3FCUB 4HG2A 1GAJA 3PUJA 2FI1A 5CFZA 5IT0A 2XMPA 3UXHA 4NCIA 1EFKA 4YRDA 4DPKA 4URWR 4YT8A 2OHFA 1TCBA 3U48A 4WCVA 4EG5A 2R00C 1KO4A 4Z1MA 3GLKA 2F1HA 4L2IA 4NP6A 2G25A 3QITA 2CB0A 3NEPX 3RLIA 2Q5CA 3RRZA 2JD2A 2EOAA 4DZRA 4RY9A 5CD1A 1NFFA 2EAUA 4HDRB 5FFMA 3VMFA 3ELWA 5D1HA 1FUIA 4EI7A 2M32A 2VNIA 1D1TA 2WIDA 1E32A 1YB1A 3H9BA 3KEFA 4QTXA 2JHCA 1B14A 2W83A 5DLYA 1ECJA 1QYVA 4CMCA 2EZUA 4YAUA 5J3JA 2P68A 3GB9A 2BE9A 3ZGYA 3QU4A 1EVLA 2OHOA 4P54A 1CJMA 4LGYA 2PUVA 3DOFA 1TU4A 1N33B 3LYHA 3WE7A 4OHZA 1G4AE 4TLLB 3AESA 2ZLBA 2PZ8A 1W5TA 5DX8A 2TS1A 5LM3A 2WIAA 4JL8A 3U0VA 4DUGA 3K6JA 3UWSA 4R8LA 4DDUA 1UP7A 2DETA 4YUYA 3L84A 4HRYA 4HB0A 3TZBA 3RAEC 4JMPA 1RR6A 3OOWA 5IN5A 1FYWA 1QHEA 4OSOA 1S2IA 2ZRMA 5GOTA 2XBUA 2XUZA 3ZD8A 4NU6A 3O1HB 1Q21A 2JZOA 3LGSA 2A0UA 2CDCA 3CF2A 3DA8A 4NOJA 5TS3A 4MZXA 3DMTA 4NNOA 1RTKA 3H1EA 4OBWA 2ES4A 1P9OA 3S2GA 2ZYTX 3KCNA 1AD2A 2WUWE 4V0MA 3S28A 1XCGB 3FHOA 4MW7A 1HDZA 3UANA 1VL5A 1EP1B 1KMNA 2NP6A 1GPYA 3KR1A 4HR7A 3MN1A 4HBZA 4GX5A 5LA6A 1IY9A 2J3QA 5IVHA 3FUXA 2A14A 1ZCBA 3CTMA 4GQIA 3IMFA 4PXYA 3V42A 1BS2A 3QLVC 5JAMA 1MAHA 3CO5A 3DDWA 5B12A 1XQWA 1JKIA 1VHQA 4D8UA 3SYRA 2QYTA 3G85A 2J6HA 4DM7A 2GS9A 4RMNA 1E8NA 4OYLA 2JEOA 1TT5A 3OQIB 3PG5A 3DL7A 1ONPA 1C3LA 3QUQA 5F5LA 4MKFA 4V0NA 3QUCA 4XYLA 3ROXA 4WBXC 3MB5A 3ENKA 4G81A 2BGGA 2RHGB 4QUIA 4TLAA 4Y2GA 1RRVA 3OE4A 4XIJA 4B6FA 5CYPA 3PQ7A 4CFYA 3B9QA 2VJBA 4OMFG 4C0SA 1XMIA 4LGMA 1ISSA 1IN4A 1L7MA 1T3SA 4FT2A 4LXIA 4ZQIA 3TR6A 3AJRA 3AILA 3L7AA 4U9UA 4WNCA 2P78A 1KFBB 3MCVA 4H2DA 5DCUA 5B53A 5CAEB 3T4EA 1RP1A 4Z0TA 2I4RA 3K70B 2FHSA 1N2CA 3S2YA 3Q0EA 3D6AA 3FOZA 3HV0A 5FLXA 1GQYA 2QAIA 4DUYB 1GU1A 3INNA 4CMIA 1JXOA 1TO1E 4KIFA 2EQAA 1DE0A 4MV5A 3OIWA 1BWSA 1NX6A 3TXYA 1QNLA 4AZVA 1CIJA 1X9GA 2QPOA 2FVYA 3G02A 4O2AA 4B84A 1PVOA 1AURA 4KOAA 5BUCA 3GRAA 3NDPA 1U8EA 4NMLA 2Q6LA 2OO5A 2RGUA 1VSVA 3MYYA 5DNVA 4Y6LA 4BE7B 3TI9A 4H60A 3J7TA 1F8YA 4OATA 3WKCA 2ORVA 3VX4A 1ZM3A 3CWQA 3OHPA 5EJ9A 1OHHA 3PXGA 4BNYA 4N41A 3NH9A 1N0UA 3C8UA 4OQDA 3K0BA 2D54A 4UM9B 1DKNA 3SS7X 5CX4A 3ZWWA 2CXOA 1D8TA 3EIHA 3WISA 5CR9A 2FSFA 1J00A 4HWSA 2ZITA 1OPXA 3N5KA 1SQ0A 4URZR 4LJ4A 2GWHA 1RI1A 3MT0A 1WULS 2JD0A 1W1WA 3KT0A 3M9LA 3QEJA 4JR2A 4A26A 4EYSA 3ML1A 3DO6A 2OK8A 4F6RB 2HT6A 4GRAA 2WIFA 3CQ9A 4FQ7A 3UJPA 3BD8A 1XTUA 4MGZR 2CXNA 4J76A 1Y7LA 2PBZA 2BR5A 5KTNA 2I3BA 5L8VA 4UNPA 2OP1A 1RJ9B 4O4HB 4CIBA 1XV5A 3INYA 3PB3A 4IMJB 4KAFA 4R71A 5HSGA 3DQQA 4W8OA 2DBYA 4V39A 3RJ9A 4DC9A 3O9MA 2J3JA 5LYJF 3EK2A 1SR8A 1I7DA 1E3TA 3IEXA 5HM6A 1JJAA 3W8DA 2AJBA 4P4TA 1LTQA 3N76A 5C81A 1C9KA 2PZKA 1V45E 5BUSA 3PGMA 4CF6A 4QQRA 1OV4A 2OBMA 3H0CA 3GJQA 4QJ3A 1V11A 3IUEA 3MPOA 1UPXA 2QRLA 4JCOA 5FL7A 3CCCA 3E35A 1ODIA 2TECE 2VTEA 4JP5A 1EFAA 1MHTA 4UUAA 1NBHA 1RZ3A 2ZT6A 1XX6A 3AUAA 4JR0A 3VSAA 4WNIA 2NO0A 1SKUA 1IN1A 4J1TC 3LYLA 2D0PB 1JWLA 5KNCH 2D2FA 4MRAA 4RL4A 4I5IA 2QLTA 3V32A 3FUWA 5H02A 3WGVA 4D0LB 2JJQA 4AB1A 3RDPA 2WI8A 5KWSA 2XT0A 5EGNA 3G2LA 3E3OA 3UW1A 4BWGA 4YJGA 1CIVA 1F0KA 2LCIA 2WA1A 1ISGA 4GOKA 3JAKB 4NCJA 4OSPA 4PC2A 2HNAA 1VE1A 2GJ8A 3CRQA 3PUWA 3QWHA 2PO7A 1EZ1A 1TMOA 3A4LA 1VKJA 4JJIA 3N3AC 4MCHA 1Z73A 1LZKA 3GP5A 3NCTA 2VRNA 2GK6A 1M6VA 2XTAA 4OGLA 3FLBA 2PR7A 2P2GA 1DKMA 2V6BA 5I5GA 4YAFA 5CVTA 3RRFA 3JQAA 2HREA 1U65A 2FWNA 2OY0A 3C87A 1JG2A 1W8IA 1XYVA 5D84A 5EJFA 3WRXA 4EX6A 1OAKA 1RJEA 2ZIZA 4QTUB 5ALZA 3RRXA 2WU3A 4G67A 1THZA 3ITEA 4KWIA 3SM9A 4ZOCA 2O8CB 4BZQA 4KGVA 2VPPA 5K0BA 1RC1A 3W2TA 4NZMA 4KNYA 1HEIA 3AVPA 3K20A 2OECA 4R98A 1N34B 2A9VA 2GM4A 5IULC 4Q1FA 5JT1A 4PLCA 2BD0A 1Y8QB 2RGNA 1XMOB 3W1EA 3TRIA 2P6OA 3C8HA 4ZO8A 2IU0A 4DMCA 3LCMA 1M9NA 2IP2A 4ZVTA 4UATA 1DEAA 1MAUA 3DONA 3O7MA 1WV0A 5CCEA 1QYXA 2R6JA 2O8EB 2VFAA 4BMXA 2ZM5A 3I9KA 2RBEA 4D46A 5K8UA 2R68A 3E1GA 2NTYC 1MQ8B 4OGFA 2I99A 5DHFA 1FFBA 3K09C 2Q4RA 2JGLA 4FZ5A 5B2FA 4UQLA 4KPYA 5I8ZA 1W5EA 2VH2A 1HFEL 4F93B 5BWLA 2WINI 5KREA 1JI0A 2ZYRA 3NALA 4JAVC 1ISHA 1P2GA 1AUXA 5HGJA 4KKXB 3U17A 2XUIA 5F5NA 3MB8A 2NNLD 2CWWA 3OTHA 4X1YB 1T8UA 4RLHA 1BA3A 5K51A 4HYEA 5SV2A 1XXLA 3W4IA 1SY7A 3ZKWA 1OXKB 2JRCA 4IF6A 4K40A 3L0SA 3R3YA 3PFKA 4V2IA 3I5UA 8ATCA 1E0AA 2XBLA 1AV6A 1UWVA 4JU8A 1Z6AA 3L1VA 4G23A 2GXUA 2Q1XA 2HF9A 2JKVA 1KIFA 1UPUA 2OUIA 3HYSA 3OU7A 1CY0A 4G2TA 4WEQA 4LK2A 2H1OA 5CXQA 3QMPA 3O6VA 1U3UA 1JXQA 1UXJA 1ZK1A 3IPRA 3PGKA 4D92A 1JG1A 1U2DA 10MHA 3T7KA 1KFCB 4M8LA 2JFFA 1TUBA 4QYSA 2OO3A 3BN3A 4UFOA 4UJ3A 1ODTC 4NZNA 3EUWA 3CF0A 1RHRA 3AUYA 3MXTA 2PMFA 3O91A 5KOHB 3OEYA 4Y3UA 3F97A 2HSDA 3AYXB 2B4AA 1JFLA 2CDAA 2FSVA 5J1SB 1OBOA 2J9YB 2NO1A 3LE8A 4UPVA 3SJBA 4CLHA 3LF2A 5DCYA 4NENA 1JB1A 3NORA 3BSFA 1BXGA 3AFHA 4QQFA 4D4JA 1I9GA 2YN4A 4R41A 1KYTA 4ID3A 1U2EA 1CUFA 1A9RA 1G3MA 1QLJA 4RKQA 1R0LA 4QXRA 2R4QA 2IOYA 4LY0A 3EXHA 1D04A 2EFGA 1UP4A 3HNOA 1TCCA 5JH7F 1I80A 2V4UA 2ZSHA 3I4LA 3RVQA 5K0GA 3KJXA 4RPIA 2QN6A 1S2LA 1A9ZA 1MOQA 4MEAA 1E6WA 4QGHA 3TOXA 1QS0A 3KKEA 3MSCA 5L4LA 1YAJA 2EFEB 2IQIA 3AY6A 5F7ZA 5JO0A 3V8EA 3RFCA 2PH3A 1IB0A 2V74B 4C20A 1Y8RB 3EPHA 1MR3F 3KD2A 2XZPA 1M0WA 4UZSA 2GZDA 1A71A 3S2EA 1TT7A 2JLSA 3H3JA 3L6EA 2IBMA 3L6CA 4AMBA 3EAGA 4INOA 4FS3A 5HP4A 5JI2E 5BV0A 1BU5A 1E5QA 4X6YA 1JIIA 2GPWA 2P9JA 2WFMA 3RWOA 2DG2A 2PV0A 2ZU0C 1VL6A 4JKIA 3RC3A 4LI3X 4BB0A 2GM9A 5J23A 3BL6A 3R7WA 1A9XB 1X42A 3UHPA 3WMGA 4JI7B 3GJ5A 2PPLA 4MWSA 3ADCA 4H3KB 4KXNA 1PV2A 1H2YA 4O4JA 2IYRA 4LE0A 3D7LA 1ORDA 3BJRA 2HK6A 4QUJA 3A58B 4XEUA 3GJXC 5FBZA 2D00A 2B20A 3OU6A 2F3RA 2HA6A 4FHFA 3ZIUA 2R7NA 1ENZA 4A92A 1NN1A 2GHQA 3L7JA 3OWHA 5B1HA 2PEYA 4A6DA 2PUDA 2JZCA 2D0OB 2C4VA 3NYQA 1ZNZA 1P3JA 1XDSA 1Z0FA 3L7DA 4P4NA 3O4VA 5EHXA 1WVGA 2Q29A 4BPRA 2D1FA 1XNJA 2W43A 3ANSA 3FSGA 4ZXFA 3HABA 2WFLA 4OB8A 3WBKA 5IM5A 5LKRA 1DB3A 3WAKA 1D2NA 1CF4A 3NYIA 4DWVA 4P8RA 1RW4A 1JIUA 3I04M 3ZH9B 2EATA 1Q7GA 1WTCA 3VC1A 3U19A 3T15A 3JATA 4YP6A 5AW8A 3WGKA 3QEKA 1GFSA 4KACA 3OVMA 3THWA 4FGWA 1T0IA 3L4SO 3EOZA 5I45A 1JT9A 2ZJ0A 3A9CA 4LV8B 2P4UA 5KBYA 3I83A 4YYEA 4DV0B 3UN1A 4V0LA 1SWWA 4F5ZA 4EKYA 4QGSA 4HLQB 3OKCA 4RA6B 3NIDB 3UQYS 2NVOA 3GDHA 3L0OA 4O4LA 1JKFA 3AXSA 4ZI2A 1J5EB 2JCVA 1GQSA 3P32A 4HNGA 4H6VA 2CMGA 4CKCB 1N6PA 3ZWPA 4D4HA 4LRUA 2Y0EA 3WQBA 3OA2A 4XXHA 1AGRA 1HC7A 1NL3A 621PA 1LLCA 2VIIA 4QJBA 2J0UA 1ZGCA 3RO7A 4OVKA 2V7BA 1KYXA 1UXHA 2F9LA 3B70A 4LCJA 3X1DA 4DA6A 2YIDA 4MICA 4RIIA 1ZP6A 3ITNA 3RK0A 2XUKA 4M1YA 4B40A 4IDQA 2IP1A 4NZPA 2XHZA 4HSEA 3T1OA 1DDIA 1KA9H 1JR3D 3KYCA 1GA4A 2D59A 2NZXA 3DAGA 1DEXA 3WGOA 4UPDA 3F7TA 1F9AA 1L8QA 1R6BX 3MINA 3OAAA 3PZBA 3MJEA 4BKOA 1H9CA 1GR0A 3S5JA 4MPPA 2G71A 1FBTA 7ADHA 3LBFA 5EXEA 3SX2A 4FVTA 1J0EA 3G0DA 2C0CA 3PP8A 1H4SA 2DWOA 2WJPA 3GL9A 1PK8A 4YVFA 2MSLA 3TD2A 3L0IB 2G28A 5FI1B 2PGAA 1F38A 2EKDA 1SBZA 3OOJA 1EFPA 1N75A 3ROTA 1JQLB 2AX4A 3HEBA 5ALWA 3K9FC 3THWB 4H7KA 2YVKA 1QYCA 1RLUA 2FEAA 3OQ6A 4ZOEA 4CL8A 3DBHA 2RAUA 3PPXA 1XJQA 3URKA 4J9UE 5KWJA 4C3VA 2C9MA 3DXYA 4NMMA 4IIGA 3ZE2B 4DADA 4PG8A 4E88A 4US1R 3TF5A 3NIFB 1CUXA 3E53A 2JIZA 1I2CA 4OKIA 3BT7A 4Z7NB 4QG3A 4EH1A 2OXEA 4ZV7A 3QEAZ 2PLRA 3KHTA 2H0AA 4AZWA 1IJEA 3QLEA 1Z0JA 1XE3A 4B44A 4YAGA 4TVOA 4J6FA 1FY2A 3I12A 1EI9A 4ZYUA 2F43A 2ZQYA 1WZIA 2H0QA 2Z2KA 4FHEA 2AC7A 2VOEA 4V02A 4A8JB 4BWVA 2OILA 4F9EA 2RBKA 1BEEA 1MMFB 2WIJA 3PC7A 4QC2A 4U0KA 4XASA 2QM8A 2ISCA 4OX9Y 4TTQA 1XA4A 3L7BA 4NH0A 5DRYA 5T5QA 1KDOA 3BHMA 3OKFA 4IIXA 5GP1A 3H1PA 4DIMA 4DLKA 4M88A 1IQ0A 4GBGA 3D3JA 1V4VA 3IHTA 5HFJA 5TE9A 3WQRA 2R60A 2OZKA 5IASA 1ZLXA 3VR5D 3OLYA 2CF5A 4B73A 4RQBA 2MSEB 3KDAA 4UM9D 2IDJA 3WX0A 4V0KA 2ZZMA 2ATEA 3DUFA 2DR3A 3A6DA 3AFGA 4YI5A 1KOLA 3FF1A 5C8XA 4DZTA 1O94A 2C5SA 2EZ8A 3ADOA 1JSRA 1RFGE 2V54A 5DISB 3NUGA 1PHRA 1NN0A 1RAAA 2VZ8A 1I7LA 1MO2A 2RJ3A 1K7SN 3H5IA 2R1TB 1H4VB 3P2IA 5L3QA 1GLGA 5FKJA 2Q5EA 2XWPA 3BHIA 5FR1A 5LMUB 4RESA 1G17A 1NSYA 5JVDB 1KZHA 3RWBA 4DWOA 2ZUCA 2BLNA 1QIEA 5LQCA 4BB6A 1R9GA 1UP6A 3G2KA 4L28A 4AAYA 1K08A 2A7QA 4L3OA 4R1TA 4RAQA 3NOXA 4W9NA 1L5HB 3JQ7A 4LW8A 4BMZA 4BDTA 2TRSB 4Z1MD 1YCFA 2AFHB 2OL4A 3AIIA 4YWJA 3NT2A 5IAGA 4MV1A 5AVJA 4DQXA 5KKNB 3AIMA 5FNVB 1HTWA 1N8NA 4BNMA 4U2GA 5DXJA 5FJJA 2P8SA 4IFIA 4ILEA 1JX6A 3FNHA 3MOGA 1UIMA 1G41A 2J1LA 2P9CA 3WWCA 1FFXB 2GESA 2HTEA 4ADSG 2QI9F 2WUEA 1GGMA 1XAJA 521PA 3SVZA 5IBRA 4G9GA 1KPHA 1UAYA 1Z5VA 5FQOA 2KB0A 1C50A 1BDMA 3DMNA 2Q0XA 3RYFB 2ZJ3A 1P81A 3X1WA 1RYNA 4FNOA 2I7VA 1JDZA 1C7ZA 1TGYA 4FFNA 4QPCA 3FLAA 3LU1A 2QMHA 4O5AA 1CY4A 3LPAA 5K3FB 1THGA 3GQBB 1XEWY 2YV2A 4D26A 2PT6A 4CKZA 2H06A 1Y1TA 4S0ZA 4QQKA 5FTKA 1BHO1 1VHLA 2PSDA 4DUPA 2OD9A 4XSHA 5TEVA 3U5ZB 2C9DA 1VMKA 1F2VA 2O5CA 3ZXIA 3OLZA 2RONA 3RTCA 1XYYA 4W9RA 4OB7A 5DK4A 2I6GA 2OEPA 3IEMA 2HJSA 1XZAA 1P7PA 3EZ9A 1RKVA 3ZZUA 2ET6A 1FMCA 2GSWA 1TC1A 2I3ZA 1C0IA 2QMYA 4PIPA 4DILA 1M34A 1GD1O 2YVLA 3DPIA 2RC5A 3OOYA 4GUDA 5H9VA 2OPHA 2XITA 4UTNA 1UBSB 3KQTA 3L9WA 2CD9A 2LZ0A 5JXHA 2Z2XA 1W30A 2MYNA 2WC1A 3ROZA 2X5KO 5ITWA 2B25A 4M37A 1IN5A 4MVJE 2VHXA 3NHPA 4DNQA 3G7NA 2AFIE 2AG6A 3M2PA 1G21E 1P4HA 2N9UA 5AXDA 2HXYA 2REQA 4BTVA 3HM9A 4MRVA 1BDIA 1G6OA 3T1NA 1TA0A 3AM1A 2WZCA 1NSTA 1KH1A 1VDZA 4J7CA 2I3AA 3FCYA 4PGGA 3T3HA 4KIJA 1FFHA 2F64A 3N8KA 2Q9AA 3KB8A 4G5YA 5LWQA 2ATVA 3EQ9A 4WFQA 3O3OB 3DTVA 3GF4A 4PWZA 3EGXB 4WA7A 4OF4A 1VKRA 1TAHA 1WD7A 1P74A 2PO5A 4LYDA 4CQMB 3I62A 3OOSA 4U2CA 3IQDB 4OFXA 4AXXA 4NJMA 3WRWA 5IJZA 1TJYA 3TR0A 5F1PA 5BSVA 2PGDA 5CDUA 1NA5A 1GHTA 3GP8A 3CBQA 3N7AA 5I4KA 5J63A 5A4AA 1RBMA 3BXOA 5KTOA 5F5XA 4F06A 4KFCA 5LA6B 2FWJA 4QDZA 4Y7DA 3ZC3A 4I4TF 1OZHA 3KKOA 4O2BB 1JDBB 4I9UA 1A9TA 1EFHA 2IV3A 3ZV3A 1WEKA 5T6BA 1H2AS 4RPJA 1GEGA 4L07A 1TZKA 1YFLA 1A5BB 2BP7A 2CVQA 1LJUA 4NLLA 1JDVA 5EQTA 4IILA 1KJQA 2XCOA 3IIEA 5HNKA 1E89A 4WCFA 1U1FA 3VYWA 1K5PA 2NADA 3BCUA 5JSUA 4N39A 2D06A 4KRFA 1H42A 2LIVA 3ZCXA 1C9MA 3TCNA 5B55A 1SU6A 1XLTA 2I7DA 1NRXA 5AM5A 5T4FA 4Y2PA 2P9QA 1GDTA 1SVNA 2AGVA 4WKOA 3EODA 3LBIA 1FF9A 4CV3A 3H1TA 4PSCA 1AF7A 3G68A 4Q1CA 5HJ2A 2QQEA 3PDHA 5A4FS 5E2BA 3SZ3A 5KSOA 3I01M 4M9ZA 3GN2A 3JTEA 1G7SA 4CG2A 1AV7A 2MMGA 2YY5A 3FDXA 4HK4A 1ZR4A 1ZG3A 1G5IA 1R16A 2E5WA 2FFJA 2X5XA 1BO6A 1F12A 1WCIB 2ZCUA 3A2NA 3OOHA 5FYQA 2NTVA 1NE7A 3C5VA 4K6CA 3BBLA 1O57A 2EJWA 3ZWNA 2R6FA 3IR6A 4ZQFA 4IHAA 1JHRA 1CFZA 1I4WA 4E46A 1GAQA 4IZIA 2ZROA 1JZSA 1UC5B 1CRWG 4LE2A 4RZIA 4OV6B 4TN1A 4B3MB 3LP8A 4MQEA 5IFKA 5J4HA 1PG5A 2QRVB 4EEXA 2XXBA 1G1MA 3ABQB 4OA8A 3KQNA 5JLJA 3LUDA 5DGXA 3R7DA 3QNMA 4L2IB 4Q3KA 5LZ2A 1LDNA 2OM6A 1IU9A 4UHBA 5TMEA 1JU4A 2R44A 3H99A 3K0EA 1OI2A 2FMHA 1BZYA 5FUQA 3ZIAD 2WQ7A 3B1XA 1L3IA 1T5OA 4XLLA 1NUPA 3L4BA 4N5NA 1MOPA 3KU1A 4X8OA 3T35A 4TTSA 5FPTA 1ECGA 3SAJA 2YJ3A 3RU7A 2HJHA 2YZ7A 4IM7A 3TXAA 1P4SA 4GWKA 3A6KA 1M7BA 1XZEA 2HLHA 3JALA 3O84A 2NVUB 3WGTA 4YV7A 1W7AA 1N8SA 5GAJA 5A1TA 2XDQA 2PWAA 1TEXA 2A0KA 4NF2A 5AJYA 4CF5A 5C8YF 2QAGC 1S5PA 3FFTA 2BIFA 4FTWA 4A6XA 3RVSA 2R66A 1WP9A 1AKQA 2IEBA 1NLUA 1U7UA 1B42A 2JANA 2GTPA 1D2RA 4AK9A 2OM2A 2ZULA 3PYXA 1ZLYA 1DARA 2CXXA 1OLUB 2C58A 4HLCA 4TUYB 4D8XA 2BGUA 4YPVA 2XJ4A 4BP1A 4IDFA 1X8LA 1XDUA 3AWDA 2DT8A 3OD1A 1CK4A 4JT9A 4XD7A 3U1VA 4ALKA 1NHGA 4N40A 2VYNA 1WY5A 1AKUA 5HBRA 2FWRA 4MQ4A 1L7EA 3MTQA 4TTJA 3SBEA 4P36A 2WWWA 4H3SA 3HFSA 4ONEA 5MHTA 3OTWA 1UBNA 4YCBA 4D42A 3PUXA 4QECA 4NOKA 1T3HA 2HLDD 1VMAA 3WYG