2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
b'TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
1G4HA 3FAKA 3H2JA 4UFOA 2XI4A 4J0KA 5HF6A 4H18A 4ZI5A 1ORVA 3WA7A 1WOMA 5HQ3A 2BUAA 4N8DA 4EUSA 1EX9A 2QKYA 5ALJA 4FLEA 3I2IA 4RE5A 3LCRA 5AKZA 4EY8A 2JGIA 1XZFA 5BWBA 4CI9A 1CR6A 2CEKA 1VJ5A 4ETWA 4H7EA 3C8DA 4KE9A 1UWCA 1EK2A 2H7XA 3ZV7A 5FOQA 1QJ4A 1KU6A 1F8UA 4HAIA 3U1TA 2VAVA 5CT9A 4QLAA 1BEZA 1MT3A 4CG1A 4PNZA 5AI6A 4C4YA 2GYUA 1FFBA 3LIIA 1QFMA 4PQEA 3R3YA 4AZ0A 4C01A 1TCAA 2OCKA 3DKRA 2D5LA 1IUNA 4PW0A 3GROA 3KSRA 5CT6A 5ALMA 1H2WA 2FJPA 1UOOA 3D3NA 3I1YA 1XRRA 2HADA 4EA6A 5FPQA 1UOQA 5SYNA 2BAGA 5ALNA 4F5ZA 4YASA 3CCCA 5HF9A 2GBGA 3ESAA 3GUUA 1JJIA 1HPLA 1L7RA 4BBZA 1WHTA 3FYUB 3TGLA 4BAUA 2AXEA 3I28A 4MXDA 1ZD5A 4H7KA 4Y2JA 3O9MA 4Z49A 1EH5A 1Q0ZA 1JFRA 1G66A 1XZBA 5AM3A 1SCKA 2WTMA 3AZQA 3IVMA 4M0EA 5EHZA 3STXA 4J0CA 4FFVA 4UBNA 4FTWA 5JZ9A 3EQ8A 4OB8A 1W4LA 3OURA 1VXRA 2V9ZA 4DYHA 4WFJA 3OG9A 4UFPA 2WTNA 1E66A 5JD6A 3AUKA 4FBMA 2ACKA 2QT9A 2DCMA 4BAZA 4GWLA 2OQIA 1LBSA 4UHEA 3DYVA 1QIHA 4BCDA 1VA5A 2FUKA 3C6ZA 4H7JA 4X94A 3BDIA 2WIGA 4ZV7A 5KBYA 3ICVA 5CURA 3TEJA 1IZ8A 3R41A 4AO8A 4ZWNA 1P0IA 3I2FA 3NWOA 5HK9A 3ZLVA 2X8BA 3G9UA 4UHDA 5LKRA 1XRNA 3MVEA 1YR2A 2VATA 2O7VA 4KRXA 1TCCA 2CMFA 1Y7HA 2PM8A 1VXOA 2WHPB 3AILA 3MUOA 4DMHA 4OYYA 2RONA 3HEAA 4EHBA 1CUGA 4G4JA 1TK3A 5E2IA 4XWGA 5HFNA 5DNWA 3P2MA 3WYDA 1LBTA 1Y7IA 5FUMA 4OB7A 1GPKA 1WB6A 3I6ZA 4C87A 4CCYA 1BS9A 1VE7A 1CUXA 1JI3A 2XUJA 2OG1A 4ITVA 4DMFA 4AMYA 3ZI7A 4DMCA 4KAJA 3MUNA 5FPPA 1CUZA 1CV2A 2FJ0A 5F4ZA 1CUJA 1CUSA 1RP1A 2WU4A 4B82A 4CG3A 1EINA 4FDMA 2JGKA 4GEGA 3HYSA 2QZPA 3QH4A 2HA6A 1MAAA 3IDAA 5ALDA 2WUFA 4N5IX 1A8QA 3ANSA 2HA7A 5HF8A 3I2GA 4CCWA 2XUGA 3FVTA 2PUJA 3B12A 4B85A 4B84A 1CUVA 1CUUA 4FOLA 2GBIA 3QPAA 2VF2A 5T4BA 3DEAA 4IQ4A 1NU8A 1Z68A 4LYEA 4KACA 1VLQA 2XUHA 5LIPA 4IH4A 4WFIA 4PV7A 1E8NA 1VZ3A 1OXMA 1N5RA 4IO0A 3R3VA 1CUWA 4B81A 2I3ZA 2WUGA 4BC0A 1JJFA 1GKKA 3BE8A 2O2IA 4G8CA 3IUQA 1EB8A 3N0TA 2VTVA 2Y6UA 1HKHA 2PU7A 3D5EA 3FYUC 3WL7A 1THGA 1WB4A 2EEPA 3BF8A 2QS9A 1FFCA 3HRHA 3FVRA 5JAUA 2CB9A 3FOBA 5E4TA 4LYDA 1DWPA 5ALPA 3CCBA 4MWTA 5DNVA 3T4UA 2QUBA 2ZYSA 3KWFA 2AJCA 4UBMA 4LXGA 3TJMA 4I3FA 3O4IA 5D6OA 5DYTA 4AX4A 1XRLA 1QIFA 1LPOA 1CPYA 4M0MA 5FDFA 5JAPA 4PO3X 5JYCA 1E8MA 5D3ZA 3WK7A 1J2EA 4UBJA 4BP9A 3BXPA 3EF3A 2BGNA 1YAJA 1IZ7A 3FLAA 1H2XA 5J3JA 5A7HA 4DSAA 2HL6A 1JMYA 3CXUA 1THTA 1W76A 3QPDA 2I03A 3G0IA 2JF0A 5IVIA 3F9CA 5KWIA 1GQRA 1K4YA 2WIFA 4WJLA 3G0CA 5T4FA 5AICA 5HF5A 1YASA 5BOVA 1WCYA 1XZMA 3RM3A 2HIHA 4G4IA 5HQ3B 5CRIA 4DNQA 3G7NA 4GBGA 2XQGA 4QWMA 1UKBA 4W1RA 1QE3A 4JUIA 1QONA 5DYYA 3V1NA 3IULA 1LNSA 1GQSA 1XFDA 3W2TA 1HBJA 5DTIA 1AQLA 2XUFA 1H23A 3G0BA 5C8VA 5I9IA 3ED1A 1R9MA 1VOTA 1UK8A 1EK1A 2OAGA 3FBWA 4L3WA 2XQKA 5HKAA 5I7UA 3HZOA 3FLBA 1BN7A 3D7RA 3PDCA 3QBJA 1LPAB 1QOZA 2WQZA 1ZIXA 4HRYA 4P93A 4XX1A 3B5EA 3I2KA 5ISMA 3VDXA 3OC0A 1FSSA 2NW6A 1N8SA 4CG2A 3HSSA 5JALA 3Q8WA 1QZ3A 2DQYA 2WHRA 3Q0TA 5ALIA 2ROQA 5LKAA 2QTBA 5K5EA 1UZAA 2ONCA 4DNOA 2HA0A 2QVBA 3ESBA 3MGAA 4KR0A 5AK5A 1IVYA 1CFJA 3BL8A 4XVCA 2XMQA 1ETHA 3AIKA 5EGNA 4G8BA 2IX9A 4AQDA 4Q3LA 3RLIA 3WLAA 3G9TA 4CFSA 3YASA 4FHZA 1C7JA 2PU5A 4GI1A 3QMMA 1EI9A 5AIBA 1ZD2P 1QIJA 3E3AA 4J0JA 5AK6A 5T4EA 3C5WP 2ECFA 3DD5A 4PSCA 5A71A 2I3DA 3STUA 4BYMA 2JGMA 2JGJA 3BIXA 4G4GA 2AJDA 5BWCA 2DSNA 5HCUA 2Y1KA 2ZYRA 5AI8A 3FSGD 2PX6A 1X2EA 4BE9A 3IURA 5IH7A 1RWQA 4DMKA 5A6VA 3C45A 3HI4A 3AIOA 3F96A 1E8DA 2DR0A 3ZPXA 1U4NA 5FXMA 3KOOA 4CIAA 2JEZA 3B3QA 1A88A 4UBLA 2GYVA 3ZWQA 1ZJ5A 2C5GA 4J03A 1EB9A 3PFCA 1YB7A 1N1MA 3S2ZA 1XLVA 3GA7A 4QA9A 3KDAA 5LZ4A 4FFWA 4JYMA 2QXUA 3O0DA 4KJXA 3N2ZB 3WK4A 2QUAA 1GPLA 4YPVA 3HACA 4DIUA 4X85A 3SX4A 4EB0A 3AINA 4J0IA 5JIBA 3CN7A 2VA9A 5ALEA 2AJBA 2HRRA 4H7DA 3HLKA 1CUCA 1MNQA 2VT6A 1CUIA 5AM1A 1O6GA 2BUCA 4C88A 3IUMA 5A7FA 3K6KA 2CBGA 4ZXFA 2GBFA 1LGYA 1SCIA 1UK9A 1OCEA 1XROA 1YS2X 1ZICA 1T4MA 1CIJA 4DNFA 6YASA 5AKXA 5A2GA 1R88A 1W6RA 4K6GA 3WWCA 2PUHA 4E14A 2WU3A 3PUIA 2G5PA 1AZWA 2BKLA 5ALKA 4GW3A 1UKAA 2HU5A 2XUPA 1Y37A 1YA8A 3PE6A 4BZZA 3WJ1A 3WQHA 1U2EA 3KXPA 2CZQA 4X97A 2HHAA 3VVLA 1JU4A 3X3HA 1GKLA 2YXPX 4X00A 1CUYA 1DT3A 3VJKA 3RKSA 2QMQA 5ESRA 2HA5A 1IUOA 2ZSIA 3SK0A 2G4LA 2Y2VA 3QPCA 4QDXA 1FFDA 4BDTA 4IHAA 5AKEA 3PF8A 3W9BA 1ZI9A 5LYYA 3C87A 2XUDA 2ZJ7A 3WK9A 5JATA 5IVDA 4BB0A 1YCDA 3I2HA 3FNBA 1E3QA 2G63A 2W22A 4BVKA 2XMSA 2ZYHA 4WY8A 1JMKC 1VZ2A 1QIDA 1QIIA 5CTAA 1CUEA 3G8YA 2ZSHA 4Y2TA 3M82A 4U2GA 4LIPD 3AJAA 3AZOA 1U8EA 5AOAA 2C4HA 3WKDA 1TRHA 2J3DA 1SOMA 3KWJA 2WG0A 1O6FA 3H19A 3QZUA 4MQLA 3ZLTA 2VJBA 4JNCA 1P0MA 5DLPA 4I19A 2B9VA 1YAHA 1BN6A 3C6YA 1A7UA 2GZRA 4B0PA 4UHHA 4L0CA 5A62A 1J06A 4S0XA 4XJVA 1BRTA 4WDRA 2C0QA 3FWHA 3H2GA 1TAHA 3I1IA 5KWJA 4ZRDA 1EXWA 2XDWA 2H1IA 4DLNA 4HTAA 4MYDA 3DKKA 4OPMA 5CBKA 2OQVA 4BZWA 4Y9SA 5CT4A 5DTJA 4FBLA 3G0DA 2V96A 4WY5A 1XZDA 3V1KA 5AH0A 4OYLA 3STYA 1QIKA 3VXKA 4BVLA 1CQWA 1XRMA 2C58A 1ODCA 2R11A 5AM4A 2HA3A 1XZKA 4AN0A 4FNGA 5K3FA 2YH2A 1EVEA 4HVTA 3V1MA 3O9VA 5K3CA 5ALWA 5C7YA 4HRXA 4BE4A 1EDBA 1GZ7A 2PPLA 1QO7A 5CH8A 3OM8A 5AK3A 4V2IA 7YASA 5FV4A 3WZLA 4AO7A 5HKBA 1AUOA 4W1SA 5AKLA 2RIPA 1IUPA 1HLGA 2ZYIA 5K3AA 3JW8A 1AGYA 1ACLA 4UUQA 1NU6A 2HFJA 4X93A 5ALHA 4OU5A 2C7BA 3U0VA 1AC5A 3E4DA 4EZIA 5EIHA 5AM5A 3W9UA 4LXIA 2XUIA 3KD2A 3R3XA 3G9ZA 3WWOA 3H18A 4QLOA 1JU3A 4GHWA 2JEYA 2BFNA 1R1DA 2PSHA 3UMJA 1CUHA 1DINA 1C7IA 1ODSA 3F97A 3D2AA 4OB6A 5SYMA 4JYPA 1AMNA 2J4FA 4AZ3A 1BCSA 3WZMA 4O08A 2VSQA 2UZ0A 3IBTA 4QDTA 5CH3A 2OPHA 5D3KA 2C0PA 5K3DA 3SWWA 2HA4A 1DTEA 1XZEA 3WK6A 1MNAA 4BATA 4X7BA 2WFLA 4RPCA 1G5FA 4UHBA 5EHNA 5ALXA 1WM1A 3PICA 2O2GA 4B0OA 5EIAA 4GECA 5AI5A 4DTCA 4EY5A 2RI6A 1H2YA 3CN9A 2B20A 4AXBA 4ARBA 4PF1A 1TIBA 3QM1A 1EVQA 3E1GA 4WDQA 3WKCA 5IVHA 2QJWA 3WWPA 4PSDA 5AM0A 4U2DA 1MX9A 1MPXA 2B61A 1YA4A 2PSEA 4Y7DA 2BJHA 1LPNA 1XZCA 1QLWA 2Y2UA 2VEOA 3O4HA 4Y2RA 3VKFA 4KE8A 3ESCA 4K2AA 4BC1A 2H7CA 3WWEA 3H1BA 5LLSA 3DCNA 2VJAA 3QITA 3WA6A 2XUOA 1LPBB 5FP0A 1L7AA 3QMVA 4M0FA 5AKJA 5H3HA 1QIEA 3D4LA 4UHFA 3VJMA 4H0CA 3EQ9A 1BU8A 3JYHA 5LZ7A 2WHQA 3WKAA 1XRQA 3S8YA 2C5FA 1XZIA 2WILA 3WIBA 2XMRA 3HXKA 4FLFA 1XRPA 2CJPA 1H22A 5HK8A 1DQZA 4FMPA 1XLUA 4C4ZA 5E4JA 4JH0A 2O2HA 3OOSA 1IMJA 4RE6A 4U2FA 3G02A 1PV1A 1ZGBA 2OGSA 4B7ZA 1VE6A 5ALSA 1CUBA 2V97A 1BCRA 2OXEA 2WUEA 4H7FA 4DSZA 5EHXA 4H7HA 1UOPA 4UHCA 1QGED 1H2ZA 3IUNA 3ZLUA 1DQYA 3PUHA 1K6EA 1G42A 2OGTA 4NS4A 5JAHA 3D0KA 5A7GA 2XUQA 1PFQA 4EY6A 3I6MA 1UFOA 2XMZA 1EDDA 5ALGA 4GXNA 2WFMA 2CKMA 3FCXA 2Z5GA 4PSUA 4KE6A 2OLEA 4E11A 3A70A 3TRDA 4TGLA 2ZVDA 4KAAA 2ORYA 2HA2A 1TQHA 3FLEA 2B4KA 2V98A 4FLMA 5CMLA 3HJUA 1AX9A 4EBBA 5AKKA 1BEEA 4TVKA 3L1JA 3UUFA 3IIIA 4BRSA 4QNNA 1R3DA 4DNPA 2XMCA 1ZIYA 2DQZA 5JAOA 4AO6A 3DYIA 3DL7A 1ZGCA 1SCQA 3DNMA 1P0PA 2ZJ6A 4G5XA 2PVSA 1YSCA 3G0GA 1WPRA 2VJDA 2R8BA 3C6XA 3I2JA 4X3CA 2I78A 3DDUA 2Z3WA 1XQWA 4J7AA 4OU4A 4UBKA 3ANTA 3ILSA 1L7QA 4BTLA 5DNUA 5DWDA 4BP8A 1EA5A 4B6GA 2XLBA 2K2QB 2Q0XA 3IA2A 5AHXA 4N5HX 5JADA 3E0XA 5DJ5A 3BJRA 1R50A 1J07A 2Z8ZA 2XB6A 1DX6A 5ALLA 3A2LA 1DX4A 5ALRA 2GYWA 5C8XA 1VKHA 5K3BA 5FLKA 2JGFA 4J0DA 2Z8XA 4H35A 2Y6VA 5ALOA 4HXGA 4C6HA 4BCCA 1XZJA 4BTVA 4L9AA 2WIJA 3LS2A 3WI7A 4HXEB 1UXOA 5I8PA 1HQDA 4HS9A 4J0HA 3VISA 4Y2SA 5EIEA 2YASA 1EDEA 4W1QA 1JKMA 4AN1A 4QEKA 4TPKA 1ZOIA 4YX9A 2DHCA 4QDUA 1MO2A 1LLFA 3QYJA 5ALYA 3R0VA 1JJBA 2E3JA 5IKXA 1CRLA 3V9AA 2HU8A 2RGUA 3C8HA 4KRYA 4GLBA 5K3FB 4F21A 1ACJA 3T52A 4Y2UA 3EQ7A 1X2BA 5ALTA 4CCYB 1D07A 1UK6A 3NOXA 3AZPA 4J0GA 3R3ZA 4B83A 3L1IA 2WSLA 1WHSA 4BAGA 3OTQA 2XUKA 2CUTA 5CW2A 1K63A 2QR5A 1SFRA 4FKBA 3DQZA 3A6ZA 3O95A 4HXFB 2FX5A 4G9GA 5JASA 2HU7A 2PBLA 5JD5A 1J1IA 2IIVA 4A5SA 3QMWA 2JGEA 2W6CX 2HM7A 5AKYA 3WL6A 2J4CA 4KEAA 1ZJ4A 3NUZA 1BROA 3WWDA 2PSDA 4ZV9A 1X70A 3GZJA 4Y2VA 1QTIA 1USWA 4UFNA 4C89A 5JANA 3V1LA 4WCVA 1MN6A 5FKJA 1W1IA 1A8UA 4RGYA 2WFLB 2DFPA 2RAUA 3WL5A 4OD0A 1KU0A 2AJLI 3LIPA 2AJ8A 3D59A 1DWOA 4QDZA 3JWEA 4UPDA 5HFAA 2XUAA 1UT6A 5ALQA 2QJRA 2O7RA 2OAEA 1CEXA 1QFSA 2EDAA 2P8SA 5K3EA 2BGRA 1WB5A 4OSEA 4X91A 1E89A 5C8ZA 4CIBA 1R4ZA 3K9BA 3HABA 2XLCA 2VQ6A 4KYVA 1XZHA 4X90A 3H0CA 4NZZA 2HDWA 4HZGA 4LXHA 4B9AA 1CVLA 3BDVA 2WM2A 1S8OA 5AI4A 3A2MA 2XQIA 3H2KA 4Q34A 5FRDA 4B9EA 1MX5A 2WKWA 2RHWA 1CUAA 1ORWA 3FCYA 5EFZA 2QXTA 3STWA 5JZSA 1Q84A 2VJCA 3L1HA 3EBLA 1F0PA 4QDOA 1FFEA 4DGQA 1XQXA 4P9NA 5JZBA 4YK7A 3R40A 3O4JA 4BRZA 4X92A 1CUFA 5JARA 3DL4A 4MEBA 4K5QA 4QE3A 4Y2XA 1FFAA 1SC9A 2ACEA 3C5VA 1MU0A 2JIDA 3C6BA 4Y2YA 1PJAA 5AO9A 2WUDA 1LZKA 4MYSA 3F8SA 4AB1A 3W04A 1KEZA 2EDCA 3STVA 4BCBA 1GXSA 2QRUA 1YB6A 2WJ6A 2PSFA 2WFZA 4Q3KA 3HC7A 5AKIA 4K6HA 4G8DA 2OCIA 1JT2A 2RHTA 4BVJA 3ESDA 4MEAA 3V48A 3K2IA 1LZLA 1CLEA 2WIKA 4ZREA 3PI6A 2BCEA 1CUDA 4H77A 4LKOA 1XZGA 4Q1VA 1DU4A 5AOBA 1B6GA 2OCGA 2WJ4A 2YYSA 1U65A 1FJ2A 3WK8A 3D2BA 4E15A 1QIGA 3OPMA 3FYUA 1A8SA 3IUJA 3DS8A 4XIIA 1ZI8A 1B41A 4BDSA 4F60A 2GBCA 3BJMA 3H2IA 5AI0A 4UBOA 5T4HA 4A23A 2GZSA 3SC2A 4P92A 2DHDA 2WLSA 2X76A 2XT0A 1ZD4A 3WKEA 4Y2QA 4GDMA 4C4XA 2XQFA 1LPMA 1K5PA 4E46A 2H9YA 1DT5A 1E5TA 5ALZA 1HL7A 1AKNA 5CH5A 1XZAA 2WG1A 2DHEA 4D9JA 4IH9A 5AJHA 5EI5A 4IH1A 3EIOA 3R3WA 5AP9A 2WJ3A 3GFFA 4WFKA 1DWQA 2ZJFA 4AMZA 3H2HA 4Q82A 3GELA 2PL5A 5KREA 1HDEA 1MAHA 3DOHA 1GT6A 4NMWA 3H04A 1ISPA 3DOIA 1UKCA 5LZ2A 4QZVA 4B80A 4RNCA 2IITA 4KE7A 2Z3ZA 5YASA 2OCLA 2X5XA 4QWWA 4UBIA 3FYTA 3C70A 1K8QA 4H7IA 3I6YA 3M83A 4MWSA 3O4GA 2WG2A 1OILA 4KAFA 2QM0A 3AFIA 1XQVA 2XMDA 4A16A 4N8SA 4EY4A 3WKBA 1XZLA 1XKTA 2QOEA 2LIPA 3QVMA 3RARA 4G1FA 1YS1X 3D2CA 2G5TA 2WHPA 2XMBA 1QO9A 4L72A 4OCZA 4J3JA 4NVRA 3H1AA 4DM7A 3H17A 3GBSA 5C81A 4K6KA 5AI9A 1T2NA 1F0NA 3WMRA 3ICWA 2HRQA 4U2CA 4W9RA 1UK7A 2JBWA 1RYYA 3WYNA 5HZGA 1Q83A 3LLCA 1F6WA 3AIMA 1TKRA 3M81A 1XLWA 4U2BA 2OGZA 4X6YA 1QTRA 4G9EA 1WPXA 3PF9A 4P08A 2XE4A 4LHEA 4X71A 1TCBA 4ARAA 5DYWA 3NGMA 2H7YA 3WJ2A 2D0DA 1R9NA 1C4XA 3UUEA 1ZI6A 5ALUA 3WK5A 5AK4A 4F0JA 1N5MA 5AKHA 5LP1A 3A2NA 4U2EA 3W06A 3DLTA 1XKLA 1MJ5A 2VAXA 4OUKX 5CT8A 1XQYA 4FWBA 3VVMA 4Q05A 5LZ9A 1VA4A 5AKGA 3C43A 3F67A 4MQMA 1EHYA 5LZ8A 4INZA 3G9XA 4Y2PA 5EHQA 5CXUA 4MJ3A 3BIWA 3W05A 4FNMA 2XMGA 3WL8A 1MX1A 4ROTA 4X6UA 4ZGBA 5IVKA 3STTA 2J3QA 5D7BA 1QIMA 1LPPA 5CT5A 3RK4A 1LPSA 3R3UA 5AIAA 2ES4A 1GPNA 5BV7A 5AOCA 5LZ5A 1W52X 1I6WA 1W75A 2WIDA 5CXXA 3LP5A 5ALFA 4I4CA 5JD4A 1ZD3A 1Q0RA 5AM2A 1M33A 4EY7A 4W63A 2PKYX 1GGVA 3M3DA 4X6XA 3F98A 2BUBA 2PSJA 5ALVA 1CQZA 2VT7A 3WIOA 3DJYA 4JEIA 2JGLA 4Q3OA 3FSGA 4W1PA 3PFBA 4N8EA 2HFKA 1NX9A 3BF7A 3BWXA 2XQJA 5E4YA 1ODTC 1BE0A 3VJLA 1MTZA 3IB3A 4X95A 1P0QA 1AURA
chains in the Genus database with same CATH superfamily
4DEYA 5K8LA 1MCZA 2P6OA 3FAKA 3ZKWB 3B20A 3AUUA 3G2KA 3PNOA 3V2GA 4J0KA 1BE6A 1OTXA 1KMQA 4H18A 3GG2A 5HF6A 3F1KA 1SKQA 2M6KA 3T1VA 6REQA 2DPYA 2B21A 1WE2A 2OBXA 2YOFA 4HVCA 2QMYA 5I8WA 1JHPA 2DBRA 2WMYA 1WOMA 3G2QA 3JXEA 3T35A 3LPMA 1U2QA 3RJ5A 2P9ZA 2FY8A 4MUMA 1P7ZA 3C85A 2AEJA 4N8DA 1P7PA 3U80A 3AF4A 5BVGA 4CTNA 2G76A 3F90A 4BWFB 4EUSA 2F3PA 2SKDA 4KI0A 1GY8A 3HHEA 4PZYA 4V0KA 3AHCA 4UE2A 1PTKA 5ITVA 5HIMA 1G1MA 4DR6B 3LCUA 3MPOA 3H9JA 2P1ZA 3PXGA 3I2IA 4Z4EA 1JLHA 3DDWA 4LGYA 3HR8A 2JGIA 4OHVA 1XZFA 1ZCFA 2O8VA 3L7OA 1DKUA 3LVFO 4PQGA 4XQ0A 1IHPA 3KQSA 1ZN7A 5T64A 2ZWOA 1M2GA 1FDIA 5BWBA 1RPZA 5ECYA 2VXCA 3AG5A 1EDOA 1O6ZA 3A4LA 1E3TA 4WK4B 5EWJA 5EXEA 5KSWB 3TNDA 5J4LA 2OSBA 1EK2A 5IBCA 2XR1A 1BMTA 5B64A 4DDMA 5FTKA 1F8UA 4RZQA 1WBDA 3K53A 3L06A 1LDMA 3RC3A 2OE2A 1XK7A 3HH8A 1KO8A 4N0EA 2BJVA 1QFXA 1CJBA 3GI1A 3FPSA 5IDYA 4B17A 4W5WA 1ZX1A 5HVNA 5LP6A 3ET5A 3AR9A 1TYCA 3M1IA 1O08A 3KCQA 4HLUC 1GZDA 3MJDA 4KVFA 4QLAA 3JQBC 3ZDYB 5F3RA 4QOGA 1ZNQO 3MLAA 5B4VA 5EMNA 4R1LA 1RRCA 1SCJA 1MT3A 3PCTA 4YRPA 2ZUTA 5P8WA 3SAJA 4CG1A 6Q21A 2IIPA 1J7KA 3LFHA 2IXBA 5KU1A 5AI6A 4M98A 3LPAA 2GYUA 4ZYWA 4YN3A 1N2HA 4Z3OA 4PQEA 5SZJA 4KQWA 3PNLA 1QZUA 3WZ2A 1BFDA 1MLDA 3NR2A 2GM4A 2D3WA 3DE7X 5KKCA 3PTAA 1XP5A 3GLGE 4LZOA 5AW1A 2ZT6A 1K7FB 5TPWB 1A72A 1H3FA 1JR2A 2FFJA 3EF0A 3EPRA 3L7CA 4RA6B 3VGJA 4EW6A 4EFMA 4IX1A 1E1RA 4PW0A 3GDHA 5REQB 5D5HA 2XZDA 5CT6A 1KVQA 1OGIA 2CMKA 2UVPB 3WQRA 3ZVLA 4AROA 9ATCA 4TXHA 3SQXA 3ONNA 1DG9A 4Y0AA 2YZNA 2HTFA 2WW8A 4ODIA 2ZIXB 3SHTA 1UOOA 2Q50A 1J56A 1OX6A 3GAZA 2ZVPX 1XDUA 3FUVA 7ABPA 1XF1A 5EQTA 1FS5A 3FPLA 1A8IA 4CG0A 3PS9A 1BOFA 3DE1X 5SYNA 2OHVA 4KIUA 3N8HA 5JRJA 3O2JA 4C06A 1QDLB 3A1TA 1A8HA 4BMSA 3OI7A 2H9IA 2H9AA 4YWJA 4EJSA 1U1GA 4JC4A 4CKYA 3SZ3A 3A6KA 3NP7A 3CLHA 2ATEA 3G5LA 4RGBA 5I47A 4DV0B 3DBRB 3CCCA 4J76A 4K0RA 4TRMA 3W8DA 2XTMA 4C4RA 1US8A 2VF5X 3BMQA 3E05A 4JGBA 2HHCA 1YQGA 1BMQA 821PA 2I55A 2C7GA 3LXMA 3IAEA 3L41A 3LLVA 1YFKA 3ESAA 5I7FA 2OO5C 5LJLA 3WYCA 2Q46A 1Y4ZA 1Y7TA 2PZMA 4JKOA 1T0JB 1L7RA 2Z95A 1JWAB 4BBZA 1Z2OX 4I81A 1ULZA 2EP7A 4JODA 3USZA 3W1EA 3TG8A 1MEJA 5F1YA 2OMKA 3V4ZA 4BAUA 2FZKA 1CG6A 1BYIA 2IYWA 4Q3EA 4DLTA 1KAGA 3BMXA 4Z8YA 3B7WA 3N2YA 1M6YA 3RRBA 4DLKA 2XHEA 3O9MA 2MT9A 3PBKA 1JDPA 2WSSA 3SF8B 4COOA 1JFRA 3U13A 5BSEA 5FPHA 1XYYA 2GJ8A 1SA0B 3IRUA 4LX0A 4BKMA 3ZVMA 3CEPB 4ABTA 4EMUA 3EGXA 4K7JA 3JQ8B 3EWAA 3BC1A 4BEBA 2QTTA 3U61B 1A3CA 3DDOA 3EVBA 4L5JA 5EHZA 4D97A 1XEWX 3BXGA 5TEWA 4AY2A 4JQOA 3RRZA 3UXEA 3I34X 3IJ5A 4BL5A 5JPDA 4MNTA 2AVNA 4XUDA 4HBZA 3E23A 2VAWA 1IJBA 3U40A 5L3QA 3KPJA 3OURA 4X6LA 2A78A 2V9ZA 2RE8A 1V45E 3OG9A 4GS5A 4UFPA 4LZWA 4E1BA 1APBA 2HIGA 1F48A 3AUKA 2XTJA 3Q88A 4RKRA 2QNBA 4UDXX 3EXG2 2C9OA 2E5WA 2QT9A 1XMVA 1SOWA 2CCGA 4FFPA 1XGKA 5EPOA 5A5DA 3PNKA 4D8XA 3HPQA 3KV1A 1CF9A 4N0MA 2SCUA 8AT1A 5AQ1A 2F3QA 2JAHA 1GEGA 1ULTA 4UTRA 3DOFA 5D84A 1LUAA 1UM9B 3PQ4A 1CY1A 4CU5A 2XOKD 4PLPA 3AFNA 3C4VA 4BCDA 2H5LA 2NPOA 2FUKA 1D2HA 2HB6A 2QG9A 1Y6QA 4FFRA 2X9VA 3LBNA 4JJ6A 1KOFA 2G5CA 3D6VA 1ZM4A 2ZWMA 3QV2A 5JJIA 1ZCJA 1T2FA 2LE0A 2XCOA 3CR7A 3INYA 2R00A 3AERA 2TMGA 2OBMA 1JP7A 4YRLA 3WTBA 1GZVA 3OQJA 3ICVA 3KXKA 3L0OA 1ECBA 7AT1A 1G6OA 1J2UA 3PJDA 3LVQE 1ZD8A 1ISMA 2ZS7A 4UAJA 5DVZA 1RYMA 4AO8A 4V1CA 1AN0A 1R8JA 2JLAA 3PK0A 4WKPA 2P68A 1UEXC 4LDQA 4Y1RA 5THQA 3J81A 5JWHA 3RC7A 1BA3A 4LOHA 4MYHA 1OB2A 2IZ7A 3ST7A 4I55F 2Q5HA 1OX5A 1IPEA 4O02B 1GPUA 3I2FA 2OAQ1 4JJAA 2YV4A 1JG7A 1BWRA 3ZLVA 1DC3A 5JAQA 4LMAA 4Z2AA 1E32A 4MZXA 4UHDA 3O1HB 4KSYA 4F6RB 2C4KA 5KHOC 4A6DA 1NMXA 3PXXA 4ZI7A 1R0ZA 4Y0VA 4B6FA 5JYDA 1FP6A 3MWDA 2CN1A 1RDFA 5B7NA 1NRWA 5KTKA 4UNNA 3EOAI 3TR6A 1TCCA 4BO1A 1HNZB 3EDOA 3H3FA 5F78A 5KOYA 2ZE8A 1NLMA 4K6FA 3JSAA 2W2XA 2PM8A 1DMRA 3EXHC 1ZUWA 1LDGA 4Y9TA 1IBCA 4BNXA 3GP8A 5JS6A 4M7OA 3MUOA 4NAVA 4OV6B 4HGRA 2BGWA 3IBCA 4HDNB 4LZLA 4BX2A 2IU0A 4BFWA 4JU8A 3L07A 1XTSA 4L1KA 1O8CA 3BORA 5DT2A 2RONA 3WMEA 4GZ5A 4P3OA 2WF9A 1Z22A 2EX4A 3T0FA 2AFHB 4OTZA 2CEAA 2YV3A 2RAPA 1IZ9A 2WINI 3R24A 1LBTA 2GEVA 2XRFA 1Y7IA 1DJQA 1GARA 2VLIA 4OB7A 3QXCA 1WSBA 3OETA 2RKOA 4ZDJA 1C0LA 4MQ4A 3MWKA 5KWVA 1VE7A 3ZHSA 4DBLC 3B85A 3DXXA 1MENA 1E2GA 4UU7A 5DLYA 5DH9A 3NONA 4DMFA 4QOSA 4KVZA 4HXYA 5BMVA 4XDZA 1NQWA 4XVRA 4UCXA 3PZRA 1E9CA 1PQ4A 3RNOA 2NVUA 4N0DA 1M7GA 3GF4A 4X7MA 1GN9A 3MUNA 4HQLA 1ZQ9A 1GFWA 2YXBA 5FPPA 3EBPA 5BVHB 1S3GA 3GNLA 1K8ZB 3SGLA 1EGVB 5CFQA 1RWVA 5F4ZA 1NA5A 3BK1A 4FI3C 1SVNA 3FDIA 1RWKA 3MT9A 3PL1A 4RCZA 4U0KA 3S8MA 8ATCA 4CG3A 1N9GA 1EINA 4O59O 1RE0A 1HOXA 1KAMA 2GVNA 2EG9A 2R65A 2NU7A 1I2AA 4EGAA 4F2DA 1XN4A 2RGYA 2HA6A 4LJ4A 1AHNA 5G3YA 1MAAA 2QXYA 4EHNA 4N5IX 1E94E 4X3PA 4MW7A 1RAGA 5HQTA 1JEOA 2GFQA 4J2TA 4KIWA 1JJAA 2ATIA 5GJCA 4X63A 1JPUA 4XSGA 1U0BB 4M6WB 1S3FA 5K6TA 4EQZA 4MHSA 2BFDA 4X8OA 3UK7A 3GLKA 4YCSA 4CCWA 1JEEA 1E1LA 2PUJA 3AHJA 3FVTA 4CV1A 4PYJA 2H4XA 5AVZA 3QQPA 1M8FA 2VDVE 1UMKA 2AZXA 2JDIA 1ESEA 1VSVA 1CUVA 2I99A 4XIFA 3UAGA 1C3XA 1N4DA 3WIVA 3EZGA 3NAQA 3C4QA 2B92A 2NUAB 4DQKA 4HJRA 5AK0A 2GJ4A 2G8LA 2CLHB 4GYKA 4IQ4A 3S68A 3SYTA 3T41A 3UT6A 3LUKA 3EEFA 5TS3A 3TKAA 1SHUX 4UQOA 3ZWOA 2A8YA 1NDHA 4KFTA 3VNSA 4PV7A 3TGWA 1X1BA 2O20A 1VZ3A 4XIGS 5BSFA 1QP4A 2QQFA 1QOPB 2BFPA 1N5RA 3KKMA 5GQSA 4ZEVA 1A9SA 1E1QA 4HEHA 3VV3A 3UJHA 3R3VA 3HDYA 4B81A 1MH9A 2NIPA 4B8WA 2BSAA 4Y9UA 1V5GA 2I3ZA 1M2HA 4MPTA 1JVBA 2VQSA 3AEQB 1SELA 3ILXA 1UDCA 2B30A 4GSKA 2V4ZA 4E94A 3MN1A 1EIZA 2Q0QA 4JP5A 3Q2KA 2QSYA 3CR3C 5CDFE 4JX8A 1L4BA 3PU6A 1XYGA 3D6FA 1EB8A 1TF2A 1RM4A 3SX2A 3N07A 1EA7A 1HKHA 2HD4A 3F5MA 3OCYA 2UV8A 4DDKA 1B0PA 2IU6A 2KPOA 3CF2A 3JZIA 4ALMA 3D5EA 4PXSA 2P2CA 4QGSA 2FYTA 1VDZA 2ZE7A 3QQ5A 4P35A 4YUVA 1NJSA 1WB4A 1WAMA 3AEKB 3IQHX 4MUYA 3LKBA 2BFAA 4RD6A 2JKZA 1TYAE 1DC5A 1AHIA 2FSSA 4GXRA 4J29A 1YQUA 4KG7A 5BSTA 1NRXA 2OC4A 4PHTA 3MAJA 1NYLA 2ZIFA 1OZHA 1Y8ZA 3IP7A 2V6MA 2PZKA 2PNJA 2VZ0A 1RJDA 3ZKAA 1XCLA 3ILYA 1YULA 4LXTA 4ZDIA 2GCOA 4E30A 1T9HA 1X80A 1J5PA 2XVYA 1I32A 4RSRA 3CCBA 3R7FA 2ZM6B 4OQFA 1WXIA 2GF0A 4PFSA 4ZVTA 1SQ5A 1U9JA 5CYPA 2R7NA 2V7TA 2ZI4A 3KWFA 2AJCA 3IR7A 2H85A 4UBMA 1D4FA 3CRMA 3WHPA 2HK9A 1FYVA 2V6GA 4UCQA 4F3RA 3HXOA 2YV2A 3TKLA 1NVMB 5KJ6A 2C1EA 2GDJA 2QPLA 2Y92A 3DAHA 6PFKA 3GVIA 5D6OA 2PD6A 1ULAA 2NWQA 1BGXT 4PZPA 4AX4A 5B4TA 3BS4A 3L0SA 4S1VA 3NYQA 3WLKX 2XBUA 4JGGA 3RT7A 1Q21A 3HY6A 3RUCA 5FDFA 1EGQA 3E15A 4J49A 3X2EA 3DCIA 4QDJA 2Z43A 4ZQGA 3GJ4A 3TBFA 5KSPA 1E8MA 4I2NA 4M60A 5A2QA 5D3ZA 5P21A 3H3XA 4LRTB 2YJGA 1J2EA 3AI3A 3PXCX 5DNCA 3RAEC 1P75A 1NQVA 2Q2NA 3H87A 2GHTA 1S6YA 2ZYWX 2ADMA 3H3JA 1AGPA 1YAJA 1U81A 1HSZA 1IZ7A 2LPMA 3PRKE 5J3JA 1I1NA 2KMLA 5A7HA 3RRJA 4DSAA 4ENQA 1KDRA 1J23A 1THTA 1W76A 1XU7A 3HN7A 1KKLA 1RXEA 3QPDA 3SEFA 5CJPA 2I03A 5FWYB 3G0IA 2R7MA 1XDDA 2JF0A 1WXGA 1Y8CA 4KTVE 4KVAA 3EMBA 3UWDA 1GQRA 2W6PA 3MTEA 1NUQA 5FBWB 1EFAA 2WQ6A 3C74A 4UMDA 4WJLA 3G0CA 1L2TA 1WG8A 3P0RA 2G28A 2QN1A 4U9UA 1YASA 3ZJYA 3JQFC 3KXIA 5K51A 3T7JA 4ZJYA 1JHZA 5LMNB 3SXJA 4O5OA 1Z0IA 1RQLA 4TYMA 4DMRA 3ZZNA 1BU5A 1WCYA 3BKWA 1Y8QA 3CUSA 2AXNA 3H9BA 3U4QB 2HIHA 2R1UA 3G49A 4CIVA 5HQ3B 1A8PA 1N33B 1JE0A 4JR0A 1VPLA 1N2SA 4YJHB 3TLKA 1PR5A 4ATNA 2UYOA 3FMFA 4MUAA 4JI4B 3HVRA 4UMVA 4A0QA 4BQEA 2R8RA 4RL6A 2IT1A 1PBNA 1LI4A 1TUEA 2AF4C 4X66B 1ZYUA 3JQEA 2PD4A 3H5LA 4ISBA 1E6CA 2X3YA 3TDNA 3AF2A 1QE3A 5JJLA 2ATVA 1AKRA 4TLDA 3I4LA 1DB3A 1U2GA 3AR7A 1K7SN 5BRAA 2ZI6A 4EO4A 1PO7A 4PC6A 5I5GA 1OLXB 1UFKA 3GFRA 3D4PA 4GPZA 4ZVUA 3GVXA 2CXQA 4L85A 3BCUA 4XQCA 2P2GA 2AGVA 1N25A 2FUCA 2QR2A 2O8FB 4TMTA 1HBJA 3R3JA 1V41E 4RVNA 5AVXA 1C9DB 3H4MA 5CVCA 5DHFA 5H3CA 3ZWKA 3WNCA 5DTIA 2EFEB 1RJ9B 4X45A 5KCMA 4DNXA 1N5KA 1H23A 2OG2A 2XUFA 3EVAA 3G0BA 4MITA 4QXRA 4D0GA 5C8VA 1RWMA 2DSTA 3ETJA 4OJQA 2CDBA 1J4AA 1LVHA 1GDDA 3TEMA 5I9IA 1CHNA 5LQCA 1JHAA 1RRFA 2CL0X 1R9MA 1I3LA 1WNTA 3MT8A 4JT9A 1BAPA 4YJGA 1UC9A 1EP3B 4PYQA 1F0YA 1S4QA 2C04A 1ZH2A 2R97A 3NBAA 2D2VA 2PKQP 3ESYA 5I7UA 2KB0A 4P84A 3HZOA 1M9NA 1GFSA 3FLBA 2DJIA 3AUYA 3NIDB 4LOJA 3OQMA 3PPXA 2RGEA 4HNSA 3TPFA 2VSNA 4COKA 1LPAB 4IX9A 1YUMA 3MXTA 1VCMA 1ELOA 1ZIXA 2TRSB 2GZAA 1WXWA 2JAWA 1I4OA 4L2IA 3RIXA 1P3JA 1C7ZA 2ZJYA 3UJ9A 5DBGA 5EJ8A 4WXPA 3Q72A 1UDRA 2NZWA 2X2PA 3K6RA 4UREA 3JAKA 2X9LA 4G89A 4EUNA 2GRUA 3F6SA 2FP4B 4W5TA 4YXFA 4RENA 3I2KA 4JUFA 2WKPA 3O90A 5ISMA 2H1VA 1F7UA 1CETA 5IJWA 4AZ0B 3B8EA 3LX5A 3ENWA 1NBIA 4YJ2F 3UATA 4OSOA 1W4CA 4IILA 2CVZA 1L3CA 1O1YA 2CDCA 4L73A 5GGYA 2J9GA 3KPWA 2YYYA 3FLMA 1OOEA 1V16B 3H9QA 1TZMA 1CP3A 1RLMA 2JA1A 3DEKA 3T3OA 2QD3A 5D1HA 2PIAA 3ASVA 3UJAA 2NZUG 1E1NA 2CNNA 1ATZA 4DCPA 3LECA 4D0LB 5JNLA 4IXNA 2BBSA 4DSOA 4F5WA 3H2YA 1MAWA 2DQYA 1K2VN 2ZUVA 1WKCA 1Q7BA 3G0OA 4IVPA 1FB5A 3QWHA 3T7KA 4E3WA 5KYWA 1H4QA 4UUOA 5LKAA 1WXFA 3RVDA 3DOJA 4KQJA 1YQQA 3ESBA 3H4VA 3MGAA 4BLRA 5IBRA 3REQB 1O97C 1CW2B 1I0LA 1NLFA 1SBYA 2MSEB 4R2HA 5AK5A 2UYYA 1UWVA 3SDBA 2Q1SA 4IS3A 3H1TA 3BL8A 1OIXA 4XVCA 3EPKA 3ZWPA 3D1LA 4BJ1A 2OCPA 2XDQB 3LO8A 2XMQA 1DC6A 2YUTA 1Y1PA 2UDPA 2Y1EA 3BD7A 4AJHA 4AJ1A 3KUKA 3AFGA 4G8BA 4DBVO 3KLMX 5A1JA 3AW9A 4IHKA 3FF4A 3A9WA 3GV0A 2QG6A 3WLAA 1ZUD1 1LWOA 1KH3A 4FHZA 1C7JA 3IIMA 1TYZA 4BO7A 5LA6F 2QYHA 2B99A 5DEIA 3QMMA 3T7EA 2J7PA 2X6TA 3U3OA 3DR5A 1OWOA 3FD8A 2WT4A 2VWGA 4BKOA 4J0JA 5AK6A 1TZ2A 1DBIA 1ZNYA 5LWHA 2GBPA 2XNJA 4WBNB 2OXFA 5A71A 3RRFA 5JW6A 3JQ9C 2JGMA 3O8LA 5DHUA 4BYMA 4F86A 1L5FA 2G7ZA 2ZIAA 3O94A 5FAXA 1F8GA 3Q6IA 1JRLA 1U3FA 5BT8A 1ZOLA 4RK7A 2HRZA 3KKEA 2YNMA 1CNEA 2AJDA 2HNBA 2LGJA 5HCUA 5IUJC 2PD3A 1ADJA 4B6EA 3TLEA 2DUWA 3QFSA 3R44A 4RK1A 1JSCA 2PYDA 1T43A 1O4VA 2FPIA 1X2EA 2Y93A 3B36A 3BGDA 2HBRA 4HDOB 4HDRB 3RSZA 3VYSB 1V5IA 1F8YA 1Q95A 2AEMA 2BFBA 4GI7A 2A0FA 2VNSA 4D4HA 1L4UA 3IURA 3F9IA 3VDQA 5IM4F 1UAAA 1Q7TA 4C7OB 1H2AS 3T7AA 4IDHA 1TQ6A 3AEXA 5EXSA 3DDHA 4D6XA 4DMKA 4RS4A 3F96A 4A0SA 4YCAA 3NAMA 3EYWA 4XLLA 2XTAA 2DR0A 5EMLA 1U9YA 3RJTA 4M0CA 4RMNA 2VEDA 1QRAA 5FXMA 1Z62A 3BXHA 5TB5A 3RC2A 4Q4CA 2JEZA 3FTFA 1ZIDA 3KBOA 1JYEA 1KI6A 5FPSA 4X24A 3EUEA 4MOWA 4F8EA 4U8HA 1PK7A 3ZWQA 3NT4A 1ZOPA 1OJ7A 1GNQA 4RFSA 3I9MA 3RKRA 1LC3A 2RH5A 3IUYA 3BT7A 4LTMA 5FHRA 1DEOA 3ZK9A 1W0KA 2FPKA 3NDJA 3B13B 1PD1A 1N1MA 2GM5A 2YVKA 3AF0A 4MEJA 4XOUA 2EOAA 3BMCA 2OQ2A 3EHEA 1A9TA 4LY3A 5ENDA 3WLHA 2A30A 3D8HA 5C31A 1COZA 2EXXA 4GC5A 3CZ9A 5T67A 3FCOA 2WI8A 4JYMA 4W9MC 4MQUA 3JQGB 2ANBA 2P5YA 4ZHSA 1L7NA 1TUBB 4OM8A 2IYOA 4PLFA 4AUEA 4GX0A 3A1WA 3GH3A 5FOTA 2G83A 3N2ZB 3WGGA 4IZIA 4KWCA 2P9QA 4GUAA 4OQZA 5JC1A 1SD1A 2JATA 3L8MA 4JJZA 3HACA 4IP0A 4KIJA 3DXZA 5FULA 4FFOA 1QX4A 1P5ZB 1Z06A 4DSTA 2YXDA 2PFKA 3LK6A 2BRUC 5DTEA 3AINA 3P9NA 1DEXA 4EB0A 3REFA 5CFOA 2YFKA 5DOVA 4CF7A 1T34A 1U0TA 1JDJA 2QG4A 4FT2A 5ALEA 2EQBA 1X8XA 3EXEB 1V4VA 2IA5A 4TTTS 3VSBA 4KXFB 4X8LA 2V7PA 4GZ6A 2LVBA 3MAAC 4XZ3A 1VYUA 3OZFA 3V4PB 2AOXA 4BUCA 5LUAA 1PZNA 3DFIA 3FAZA 4RORA 2CBGA 2JFBA 2H08A 4MA0A 3BYZA 4UJ5A 2CXOA 1T10A 5HUJA 1M7BA 4EG0A 4L27A 1NW5A 1OCEA 2AT1A 1ZY2A 2Q6KA 1XNHA 2XPCA 1QV6A 2J59A 2YQZA 1KAQA 3FUXA 1ZM9A 4IIXA 4LZJA 3S55A 4M0PA 1L5HA 2C59A 1R88A 4I1YA 3LOQA 4O2AB 3LWDA 2PUHA 3WWCA 2GF2A 4R84A 1E6KA 2C3YA 2NZYA 2NUPB 2R2AA 2WU3A 4ENWA 1ZD1A 1Q50A 4C21A 3KQPA 2YUIA 1U7OA 1ZVMA 4HNGA 1Y1LA 1QHFA 2QM8A 5JAIA 2WWRA 2EQ5A 1AZWA 2O6HA 1YS9A 3BH7A 1EX1A 4UNIA 1SU4A 1G4UR 3BTUA 3IMEA 4I1VA 3FOWA 3R4CA 4MUNA 2D4AA 2AOUA 3WLQA 2PUBA 1GFZA 1E4EA 4KUEA 2IOFK 3N86A 1BWSA 2F43B 3PE6A 1GXSB 2GAOA 3PT9A 5CA1B 5KS2A 2G1PA 5BRJA 2NN3C 3OPVA 1RYDA 3NEJA 1U2EA 4ESHA 3EPJA 2DLCX 4LQ4A 1WBJB 2AR0A 2CZQA 3W3AD 3KSDO 3AP1A 1JJ7A 1YZFA 4UD2A 4E5KA 1GV1A 1JU4A 4AW9A 1INLA 1WNFA 1MABA 3MBKA 4G5SA 5J5AA 4B7AA 3W1WA 1VRVA 1L7VC 1R4MA 3VJKA 2IYPA 4B43A 1IY1A 5ESRA 3UAWA 2R8EA 2W0SA 1XNGA 1WLYA 2C78A 2ZYVX 2ZSIA 3BFPA 4G4SP 3QELB 4NCJA 1OYOA 4Y67A 1VB3A 5JSZA 4FHDA 5E6SB 2Q07A 4MRPA 2ZR8A 3QPCA 4K9NA 3DG9A 3EZ6A 1FFDA 2NNLD 3UGJA 3P9QA 1N6OA 4BDTA 3EG9B 3UMMA 2FUG1 3PYXA 3OLYA 2W70A 5IANA 5AOVA 1U2RA 3ZJTA 1YC2A 4HRVA 3Q0IA 2NTVA 5LCXA 4AG5A 1ZI9A 4WAUA 3CG0A 3NT5A 4EEKA 1J99A 2XUDA 1T2UA 1VI2A 2ZJ7A 3CWCA 3NJRA 3A0RB 3G3EA 4XIJA 3WK9A 3ZWCA 3RWOA 1YCDA 4BB6A 2PXAA 2XXAA 4RZSA 3FNBA 3WO0A 1UC4B 1E3SA 3WLSA 3GGPA 3TLZA 2AA3A 3SEZA 4NDNE 1NMEA 3AEUB 4F71A 1C2YA 5BSKA 2G63A 2W22A 2VDRB 2E4WA 2QAGC 2PZ8A 1ZCBA 4M7RA 1F3LA 4R2MA 5T8KA 1JA9A 1LTQA 1VMAA 1OBVA 4KK4A 4J2HA 1UFQA 1JMKC 3SBEA 3G8DA 3ISVA 2YDYA 2OESA 4JLAA 1QIDA 2O7QA 4RTRA 3AM1A 2HCRA 5HZKA 1UBSB 1NXOA 2YWRA 4WZAA 4DXDA 4HNRA 5ERXA 3OMLA 1E1CA 4ZO8A 1JKIA 4FFBB 1JBKA 4FYXA 2EJBA 1C1DA 2PQ6A 2XA1A 3JZDA 2FMHA 4RL4A 5TQ2A 3UG7A 3U7IA 1FXWA 2GEFA 3GMTA 3ORRA 2MSNA 1SVOA 2QTNA 3ITNA 1L9KA 4MMXB 4U2GA 3AJAA 4XLZA 4XSVA 2FPGA 5E6RA 1AB6A 2VH1A 3PEYA 3AU8A 1W6UA 3SOPA 2G8NA 4GPAA 3RYHB 4M1MA 3KQKA 2BEVB 2J3DA 1SBNE 3ZVNA 1ZHOA 1T1GA 2WG0A 3I6BA 3L0YA 2GXSA 3KT8A 4UNQA 5DCYA 5IJXA 1V5FA 5JLAA 5BW6B 3UW3A 3KVVA 1LTKA 2CXUA 2RMKA 1CHDA 4GXTA 1Y33E 3QZUA 4CEIA 3QY9A 2JCSA 4HWRA 4RHXA 2JI7A 1QBKC 3K8OE 4OQMA 1FTNA 4KIFA 4JNCA 5GGXA 3SJBA 1P0MA 1P72A 2MJLA 4FC6A 3VPDA 4QODA 3KVRA 3O92A 1YAHA 4TWJA 1BN6A 2ZSBA 2JFGA 3FMIA 2I2AA 1NVUQ 2R86A 3QEOA 4JUCA 3WGIA 4UHHA 3UCFA 3UJ7A 2CJWA 4IEEA 4L0CA 1QTNA 4TRRA 1G8SA 3SIPA 1VDMA 4FFDA 1PZGA 1SOVA 3D7KA 3L93A 2H4HA 3SF0A 5DNYB 4XA8A 3VU1A 1NR5A 4R1PA 5JPCA 5L6MB 2Q0SA 1BC5A 1JKJA 1Z8FA 2CXHA 2VCYA 4S0XA 4D9BA 5HJEA 1Z2EA 3HR7A 2IY8A 4XJVA 5KSZA 2IYAA 2D4HA 3A05A 9LDTA 3SKVA 4DT1B 1Q2UA 5L7WA 2ARKA 5EIBC 2G6TA 3QBTA 4G0QA 1RVDA 2J09A 1MQSA 2C0QA 5DULA 3TVTA 4CDRA 2P41A 1OROA 3ZZ1A 1NPTO 4LPKA 3HY3A 3IELA 1PZMA 1IBLB 1TAHA 2Q1UA 1OGYA 2WKQA 2GN2A 2GZ2A 3BA6A 3GFTA 3I1IA 4I4TB 3A10A 4L6CA 1C1XA 1EXWA 1G1AA 2XDWA 4ZRDA 3D4IA 4MROA 4WZBE 4A1OA 4YRZA 1DXOA 4G63A 1P2GA 3MMXA 5BSGA 4NOLA 3HO1A 3Q7SA 1S3SA 4ENSA 4PZLA 4CKEB 4KDEA 1YBAA 2OQVA 4KGXA 3X2SA 4EZBA 1GQQA 4Y9SA 4JB3A 4UVDA 3VA7A 4RTSA 1WW3A 3PENA 3OPYI 2B82A 5HNKA 2OZPA 3PJRA 1EEHA 5AHWA 2R7AA 2RH4A 5B12A 1PR6A 2VYFA 3QVOA 4B4DA 1C0PA 4FBLA 3G0DA 4P3PA 1B16A 2H2FA 1D04A 5TMDA 4X62B 1KBZA 3B3GA 3S2UA 4Q6BA 1W93A 1N1GA 1JDSA 1OZGA 1RAEA 4L4RA 1TKCA 4N6OA 4O2LA 4QOFA 4YRTA 1B43A 5CHYA 5FYQA 2NU8B 3TRJA 4LWZA 4C0AC 3K0EA 1CQJA 2QL7A 3QKRA 4BVLA 5U9CA 2IS1A 4W7HA 2ZBVA 3DLPX 1YR7A 4JLKA 3CVUA 1XRMA 1X87A 1Z08A 2G1AA 1D8TA 3HVUA 3MMPA 1D9ZA 5FWNA 1KMMA 3HNRA 1XZKA 2OXCA 3N0RA 2WABA 3KFXA 4I9FA 4UXJA 2PRIA 4J7XA 4AN0A 3KE8A 3CLVA 2Q5OA 4PAWA 2IW3A 1QDEA 1EVEA 4EKEA 2FMKA 4JL5A 4JLOA 4OO3A 3LYHA 4RETA 4OQQA 4WEQA 5JDCA 4HRXA 2WA1A 5CDTA 1GZ7A 3ONVA 2OHOA 1S2GA 1KZHA 2VJQA 5AK3A 1TOAA 3OJLA 1EK6A 7YASA 2J08A 4H6PA 1P3DA 1RM5A 2JVKA 1X7HA 1AUOA 2IYYA 4RELA 3PJGA 4W1SA 3R7AA 3RHTA 4ZDKA 1IHXA 4L02A 2I33A 4PNHA 2V5VA 4M7PA 3DLHA 1K6MA 3TD2A 2YWBA 1HLGA 2XKAA 3R5JA 2VR1A 1X9HA 5E6UB 3VHRA 4D3XA 4DDWA 1Z75A 2CT8A 5KYXA 3HY4A 3RVSA 3DZ8A 5ICSA 4TYYA 2IEGA 1DPFA 3K16A 2WV7A 3RWBA 1DBWA 3EVCA 4KQXA 4NZOA 1QHNA 4PINA 1Z6GA 1NU6A 5TY0A 5HA5A 3UPTA 1KEVA 4P81A 2VHCA 2ATXA 3U0VA 1EU1A 3IUEA 4EF4A 4MW6A 3HVHA 1SQFA 3R0IA 4XGQA 5IPFA 2ZR7A 1DADA 1AC5A 1NLYA 4UULA 3A1FA 2R6HA 2UVPA 3UK0A 3QVJA 2ISCA 4EZIA 1W7AA 1ZBDA 1IEXA 2W43A 2YHIA 3E3NA 2JDID 3PQCA 4OYHA 4W4TA 5EIHA 2Y68A 1A7KA 2QRNA 1FA9A 2Q3MA 2JA2A 1NNEA 1V71A 4NHEA 3V4OA 3WWOA 1F6DA 1MXHA 3I3OA 1OBCA 2GPJA 3H18A 2E87A 1DFHA 3OESA 4ZU1X 2B8WA 1URPA 4PLWA 1JU3A 4QLOA 1XF9A 1FNBA 4GHWA 2RBGA 4QUJA 3U3RA 1R1DA 2E21A 2O06A 1WD5A 3WP0A 1E1QD 2PSHA 3G13A 1MRZA 4HWKA 1NBHA 1FMTA 4REOA 1GSOA 1AKUA 2NADA 4Q3BA 1CUHA 3BHMA 1N36B 1Z7GA 1ZDMA 2P4SA 3R5SA 2X8JB 2EJUA 3BTSA 1CE8B 1Q3HA 4GVXA 2C7PA 3WICA 3F97A 1KFCB 4W82A 3D2AA 3BN3A 3FI9A 2ORED 5DDIP 1BW9B 3DC2A 1KTVA 1TUGA 3GK3A 4FR2A 2RHCA 4AJKA 4QREA 4ERXA 2PZAA 3QLEA 3TFOA 5KQLA 4ZHQB 2IYEA 1GQOA 1KVTA 3W2HA 3HL0A 4QDTA 1KI8A 2F3UA 5D3KA 5DMXA 3G59A 2GERA 3BSWA 4RO0A 5B2EA 1ZP6A 5EMHA 1W49A 3JATB 5IM5A 5K3DA 1L4YA 1OX4A 1W8IA 1EXMA 1X7XA 1I4EB 2QMUA 3AI2A 3DWGA 2FEOA 1WCIB 3LQ4A 4FOOA 3N2GA 4HBGA 4KQ2A 3I9LA 4O4IB 1YS4A 1UMBB 5JXWA 4FEYA 5A4JA 1JHOA 3DZCA 5G3ZA 2DUMA 3WK6A 4B3TB 2C7VA 5DHSA 2D8MA 4R98A 4BATA 5CEFA 4X7BA 4C5BA 1WX1A 4AJ2A 3J7TA 3MB8A 4DQUA 2E82A 5B30A 1ODJA 5H8WA 3CM0A 3GDGA 1H5QA 1ES9A 1RHRA 3HKEA 3KUUA 4PXYA 1P8JA 2QD5A 1GGNA 2V5AA 3D8UA 5LA6B 1VJCA 4B0OA 2F6RA 1QFJA 1REQA 1JG2A 1T4GA 3EE6A 4WXRA 3KHTA 4FBGA 5EIAA 3HYLA 5F2EA 2ZJ2A 1QO0A 1H2YA 2H06A 1NOIA 2W2KA 3ZX5A 5H5JA 1XTZA 4ESOA 3MS7A 1MHTA 1T1SA 3EGDA 4WT7A 1YR1A 1CXZA 3H5TA 4ARBA 4K05A 1IG3A 2AK2A 1SXIA 3QM1A 4N47A 4LXQA 4WDQA 5IABA 4DFDA 4OXKA 1UAGA 2BKXA 4MS3B 4GMHA 3CKMA 3RFCA 2X22A 3PNQA 1YDEA 2RFLA 1AVTA 4C6TB 4U2DA 2B61A 3VVCA 1EGAA 1GU7A 2CVQA 2GD0A 2IEIA 1H2BA 2PKXA 5EKSA 3V4SA 3F73A 2X7XA 2ZWIA 3IVXA 3LLSA 4XWWA 1LF5A 3A04A 1M6WA 4Y7DA 4PIVA 4PYMA 2I4NA 4HNTA 5JNWA 3PLAE 2Y2UA 2VEOA 3O4HA 5LXTB 2PMFA 2VYQA 2YHBA 4D02A 2R1TB 4KE8A 3KBBA 4DV6B 2BZSA 4DV7B 1NDQA 3W79A 2H4WA 4JL6A 4IDBA 3CV3A 1MFPA 4R7TA 4BC1A 1RPJA 2H7CA 2X86A 3ZJVA 1GAEO 4N01A 3DCNA 4UVIA 3IBYA 3QVXA 2BBTA 5HCNA 5K4AA 1FYDA 5TLSA 3OMWA 1EFPB 3QITA 5CA0A 2MSWA 2EYQA 3P27A 2ECQA 3E6AA 1JTFA 5KC9A 3VR4H 1AKYA 5EZQA 4EHHA 4ZVRA 2XVMA 2OQRA 3QMVA 5FO1A 4M0FA 2X9NA 1KZ9A 4S35A 5IEJA 4MUJA 4OXIA 2A67A 2AOWA 4QGFA 4CIWA 1PBTA 3I8XA 5JAZA 1V6AA 4L9SA 4MV4A 2I80A 2SICE 4Q16A 4F2WA 4HNHA 4UHFA 3VJMA 4UTNA 3TXXA 2VXYA 3GFOA 2ZITA 4JOQA 2JGNA 4EB6A 1S2IA 4FXPA 3NWPA 1V8BA 2NO1A 4IXMA 3NIGB 3FPFA 1FUEA 1YVPA 3KQUA 3D5TA 4IDAA 4BBJA 1Y9ZA 5J5VA 2CGEA 2W6ZA 2C5FA 1XZIA 1BIFA 5LFAA 4FCVA 1JW9B 2FU5C 2WILA 1C9JA 2PGAA 4JJGA 4AUMA 3IXLA 5IAAA 3WIBA 4RCYA 4A9AA 4LF6B 2XMRA 5AR1A 1I7QB 4YJ3A 3DTNA 1NW8A 4IDPA 4LVNA 2D59A 2VH5R 4D9MA 4E31A 3KSBC 1G3UA 3LC2O 3A2KA 4JJ8A 5HK8A 3ZLJA 4BYGA 1ONBA 4C20A 4GOJA 1M1YE 5A0TA 1HE1C 3D5QA 1MV8A 1Z0DA 3D6TB 1FNDA 3E03A 1MQ8B 2O2HA 2VT3A 3R5HA 5LU8A 2LKCA 5FF9A 1XTJA 4TLCA 5TNXA 4IKOA 1A9RA 1W44A 1WABA 2QRQA 2YJ4A 3OA0A 3R6LA 5CD1A 3TW0A 2GGSA 4DYVA 2HMUA 4KODA 4MAMA 1G8AA 1TC1A 4WH0A 1KARA 4ZOAA 3U9LA 4C3OB 4CTMA 4R2KA 3UWKA 4G6ZA 1CUBA 2P2SA 4CT4B 2FMTA 3F6RA 5EVCA 3QA9A 3ITKA 1BCRA 3JYOA 1DDOA 2MIIA 4AYTA 3DBVO 4OKSA 1Q91A 3ZK8A 3R0ZA 1SXJA 4H7FA 5EHXA 3AL2A 5AVYA 1MDBA 1NBME 4O4HA 5BV1A 5C8YB 3AVWA 1FXUA 4M37A 3THYA 3IBGA 3NOOA 1YZQA 4ZA2A 2O52A 1HDIA 3IIKA 4P4SA 1HQKA 1SPXA 2FX3A 2PZGA 3BWVA 1G5IA 4Z3KA 3GRRA 3FJOA 5CYFA 2HDOA 1ST2A 4LE2A 1QHHB 4QICA 3KUXA 1VYVA 2ZIVB 3DVAB 4OMUA 3PEFA 4XJSA 1FU8A 1T2CA 3SIWA 3D0KA 1PK9A 3O93A 4M6WA 2FNAA 3H4IA 4CR6A 3I6MA 4J1NA 5TMEA 2UUAB 5G53C 4YT2A 1MOPA 4P7GA 2XMZA 2A9RA 3UYKA 4BLSA 3VYVA 5EQJB 2JIZA 4GXNA 4HGNA 3ROKA 3HB5X 4NCAA 3C41J 5EZ6B 2ISSD 2YVQA 3WGYA 2WFMA 2B5WA 3FCXA 3QX7A 4BRUA 1KHHA 2Z5GA 3HCBA 4B3IA 4EL5A 3H5NA 3OWOA 4PSUA 1FMCA 2Q5CA 4LI3X 1NNSA 2OLEA 4KQKA 4GPTA 3ABSB 1V9CA 3GL9A 5FI0B 2ORYA 3EIXA 3U0BA 4DLSA 2H1FA 3GCWA 4MTCA 1TK9A 2VYVA 5CIYA 2Y3IA 4WCFA 1U3WA 4FLMA 4Y0NA 5CMLA 2CUZA 2EARA 3OHSX 3VKWA 5JISA 2AEEA 4EBBA 4GFDA 5AKKA 1FU4A 2IUYA 4TWAA 1Y5LA 3KQWA 3L1JA 4GIBA 4IWNA 4TVKA 4OKNA 4NG5A 2B94A 3AEQA 4MKXA 2DX7A 3CQ9A 4FCCA 4QNNA 4EYKA 2WMDA 1U9CA 2GLTA 4C4TA 4EUHA 1ZWLA 3QUTA 1LFDB 4G5HA 4AO6A 3R8XA 3WADA 5AD1A 5JAOA 3MK31 1GUBA 4JSTA 2AV6A 5E0OA 4DLBA 4XYEA 4WNIA 3FPHA 2OHFA 1R00A 3B6ZA 4BGUA 1P0PA 3DWFA 2ZJ6A 3HRKA 1EFDN 4G5XA 1A1VA 2XYHA 1ZC4A 1HLPA 2GT1A 2V0NA 1FP4B 3A8TA 3EGCA 2PV7A 3ZXYA 2DTXA 1L8AA 1NPYA 2IY9A 3BSSA 4P33A 1NJ8A 3I2JA 4E6PA 2OXTA 2QTFA 2W0MA 4DN6A 4AWAA 3IVCA 1W48A 3FVQA 3DDUA 4ZKEA 3WRYA 3GJYA 3NETA 3UVEA 4DIFA 1VGVA 1YL7A 1F2DA 3A11A 5JECA 3CUVA 1PI3A 2G1JA 3B3FA 1E63A 2C9ZA 3GY0A 4YR9A 3P8ZA 1PSDA 4F1KA 5KTYA 1T4CA 1ITZA 2XIJA 3ILSA 4FGJA 4G5YA 4M99A 3KYCB 1I6KA 1L7QA 4Y9RA 4BTLA 4IUYA 1U63A 2O8EA 1X39A 2Q0HA 1TU0A 4EQ6B 1FP1D 5DNUA 2RG1A 1JUDA 3RYCB 5DGHA 1EA5A 4AF6A 1A4XA 1OVMA 4CFZA 2RAFA 1LDNA 2Q0XA 1QC5B 1F2UA 4NBUA 1WLSA 1IRIA 3IESA 3O84A 3SD7A 3LFUA 3OX3A 1JBQA 1X15A 2ET6A 3BMNB 3E0XA 4AY3A 5ES3A 5JJKA 3F9RA 4H9GA 4A7PA 1YKSA 1VSTA 1AZTA 2I91A 2F1RA 2YBEA 1W0KD 2IXEA 3PHBE 1A5SB 1E92A 5BYBA 3R9XB 4WUVA 2IYFA 2ZBUA 1VL0A 2Z8ZA 2BHRA 2C2HA 4IGFA 4ZCLA 4DQVA 5ITZB 5TS2A 4RTJA 3MWGA 1DIOB 2ZSKA 1ISSA 1AS0A 3V7NA 2J87A 4AUNA 1FLDA 3GCZA 4MUIA 2YRWA 4IXTA 2AX4A 4UUMA 1G8KA 2DQSA 3VUEA 4FW8A 2ZREA 3A32A 4OL0A 5TARA 3VNAA 1ISHA 3K1YA 4QG3A 3IEMA 3SQLA 3PNMA 3V1KA 4F4HA 1N75A 4MW0A 4HO1X 1FLNA 2QGFA 2C2GA 4YP6A 2GJSA 9ABPA 4QFDA 1QGDA 2ZIWB 5A9RA 1HMPA 3CT6A 3QLTA 3TI7A 4BMVA 4C6HA 3D9QX 1PW5A 5TDHA 4L9AA 1ULSA 2J3MA 3P19A 3P9CA 1CU1A 4Q1CA 3WGVA 1KGDA 2GPYA 1V8OA 5H4HA 5JVDB 2C0CA 2IX3A 2DLNA 3GXBA 2I87A 3A6LA 3GJ3A 5B7GA 1A4UA 3MG9A 5I8PA 5B3JC 3KTFA 2QW0X 3GGSA 1ZL2A 4AMBA 1AKEA 1J2JA 4UUBA 5HE8A 3DW3X 2NSDA 4GI2A 4X84A 4BV9A 5MN6A 3DBIA 1D2GA 4IF6A 4P86A 3RR2A 3VISA 2DPLA 3DWIA 2QT0A 4NBNA 4Y2SA 5EIEA 3BMOB 1XNQB 2YASA 3WJ7A 4E7PA 1EDEA 3BH6A 1GUAA 3LUPA 1MIOB 4M7WA 2XEDA 3E7FA 4D4GA 4Z8XA 1QMPA 3EUFA 3UICA 4ZGGA 1A9YA 4LSGA 4U3JA 4G1CA 1E1KA 4AN1A 3KQVA 2PLFA 2ZRAA 3I5UA 3NYIA 4GSLA 2H00A 4QTXA 5U1PA 1KO7A 2PXCA 4F4IA 3HE3A 5G0SA 3IP1A 5B1IA 4GI5A 4E5PA 4MINA 1ORIA 5K0EA 4JOCA 3ZVRA 4YX9A 5CB4B 1SXGA 4R9RA 4AWXA 4QDUA 4QD3A 2HBQA 1XVAA 1WMDA 1JHRA 4QHTA 4U8GA 5ARBA 4UEKA 3R0VA 5EWMA 2R8PA 1JJBA 1T36B 4RQTA 2WB4A 3BE5A 4AZWA 1ZGHA 1L7BA 3T7SA 1HMYA 2RGUA 4JGIA 4MCAA 4TQUS 3KZNA 2HUPA 3R7WA 2P2YA 3SPXA 5HM6A 3X1WA 4BO3A 3BFJA 1P18A 1ACJA 4UEQA 1YZUA 4JBGA 5G2OA 5A9TA 2AR9A 1N34B 4RQBA 3Q0EA 4GL4A 1J39A 4OHFA 5CBPB 1MQAA 1D07A 1DBVO 5JI3E 3AZPA 3E9DA 4F8YA 1XDBA 1IVNA 1TAGA 1Z16A 3B1WA 4S1WA 1VB5A 3ZE2B 5IUKC 3OT4A 3OZDA 1Z73A 3DFUA 3DEIA 4YP9A 4EKNB 4AKEA 3IOYA 2OFWA 2WHEA 2XGMA 1RQXA 1ZLXA 2FP4A 2WSLA 2YIVX 1WHSA 3O4FA 4LFCB 3ZIUA 1U0LA 3Q7RA 5DHAA 5HRCA 2YRXA 4G56A 3PX2A 3GDWA 4QASA 5CW2A 3DBLA 4E4YA 2B4QA 5CX1B 1EWKA 4IQ8A 3ZU4A 2J9FB 2VHXA 1MO3A 1Z5OA 2YFYA 4N76A 2YN4A 5J9FA 2QR5A 1SFRA 3DP9A 2PZLA 3IEXA 3CURA 3DAOA 3QVGB 1JGTA 1L7XA 3EXFB 3COJA 2A9KA 1DTWA 4YLEA 3PRJA 1U0NA 3A6ZA 1PJCA 4WESB 1XMPA 1GPMA 1S8NA 1DBSA 4KN6A 4M1TA 1G21B 5F3DA 2NV6A 2GBLA 2P6NA 4RIHA 1SKBA 1HE3A 2BFFB 3EJ6A 4LECA 4NCXA 3GOHA 4KGVA 1CCWA 5T6BA 2HU7A 2VPQA 3E22B 5THXA 1WU7A 3WLMA 2X58A 1ZMXA 1QFZA 4DW8A 5FUQA 5IT9A 3EB9A 2FDRA 4TKVA 4E2XA 3BGVA 1T2DA 1VE1A 1LKZA 2JIQA 2D0IA 2O2XA 4RJKA 4ZYVA 5LUBA 1Q1GA 2Y0PA 1PT8A 1MB3A 2HYDA 1MC4A 3VNBA 2WMOB 1LW7A 1AB5A 5KVVA 2UXBB 1XRSB 4OHUA 1IJFA 2C07A 1GNLA 4OBEA 3J81k 3NYWA 1XN1A 5EJEA 3SMVA 3WNZA 5IDVA 4DG9A 4KLNA 3LX4A 2NV2B 421PA 4ROSA 4WLOA 1KIAA 3UUGA 2FFHA 5DT9A 4DC1A 6NULA 2JD2A 4RK0A 2JJ2A 2HT1A 4PNPA 1X70A 3PYLA 4M9SA 3WNBA 5IAEA 4HFJA 2A0YA 5EIBD 4BMOB 2IEAA 1I30A 2JRLA 2ZTVA 1UPTA 4UFNA 4NCNA 2MCFA 1XC7A 4Q3AA 3P32A 3V1LA 1OU0A 5JANA 2YWHA 4JBYA 1R0XA 3C3XA 3EXIB 4TSFA 3FY4A 3VPXA 1SGWA 5LR6A 5DGCA 1JAHA 3GFPA 5KOJB 1XU4A 1WF3A 1TF7A 4ZV4A 2C8KA 2W4IA 3OQHA 3U56A 1P1RA 4OF4A 2DY1A 5HKLA 2X0JA 1OJLA 4P2GA 4B3FX 5GONB 3TNJA 1Z07A 2RAVA 5KEIA 1WZUA 4EMTA 2NVOA 2J0QA 1NV8A 3WNQA 4EATA 4EHFA 5AW3A 1UDWA 4LZNA 5L3RA 2XBLA 3WLRA 3LIPA 3ZU5A 4C0WA 3U4MA 1XD8A 3HCDA 4GKKB 3DKVA 3JVDA 3I37X 1Z8DA 4YMHA 1TNDA 3D59A 1KERA 1SWWA 3IVAA 3OCXA 4ZVSA 2RSLA 3DTVA 3CG4A 3Q6NA 3HWSA 2IS2A 3JWEA 2Q1YA 2XUAA 5LB4A 2XSZD 2VF4X 3P2KA 4M4SA 3RVQA 4EG1A 4WEOA 2OCXA 2O7RA 2OAEA 4KV7A 2YXEA 2P8SA 4JXJA 1RLIA 4RSGA 5IYZB 1JDNA 2XY4A 5ECGC 5K3EA 3OO0A 5DGDA 2RB4A 3NNDA 5C8ZA 4YRNA 4UAGA 3EF1A 2KM1A 5A05A 2OZVA 3K9BA 1Q6YA 1FMLA 2FR1A 2HSEA 2R25B 4MRAA 1WUYA 4UOEA 5JRZA 4KYVA 4X90A 3OCCA 1EUZA 3ECSA 4IIJF 4NZZA 4ZD6A 1WCV1 1NC3A 4F2GA 3U19A 2EU8A 2O6LA 2Y71A 4YUAA 2H17A 2D13A 1OIWA 1SMKA 4RHCA 4XVHA 4B9AA 1GRNA 4X1IB 2YZ7A 3BDVA 1S89A 3C15C 1X7YB 2ZDQA 2VCEA 4H31A 4OIFA 5J1SB 2I6FA 3CH7A 5AI4A 4U39A 3WB2A 1C80A 3KR1A 4Z9YA 5KTOA 4KWIA 4DR3B 3ZW8A 1H0SA 3OQ1A 1IXSB 1GU0A 4B9EA 1PLLA 4QPNA 4RK4A 3CF0A 3CUWA 8LDHA 4R2WA 4GYWA 4TOIA 3TS1A 1U6JA 4CDNA 4JHLA 4CLHA 1P1CA 3WL4A 3A9CA 4EITA 3FCYA 4ND8A 3K0KA 4ACAA 1ID1A 5GV8A 1NXPA 1Q84A 3STWA 2DR3A 3U49A 4NEGA 1JDBC 1EXDA 2VJCA 3H5OA 1KOGA 4I55A 1GCUA 1XYVA 1IM2A 3W4JA 3MT7A 3EBLA 3NEAA 1HM5A 1YVUA 3S2EA 2GNOA 3LHKA 3U5ZB 4O2BB 3PXAA 4DGQA 4DCMA 3QF4B 3NHRA 2J4DA 4LJLA 2UYQA 1Z18A 4M22A 1IN6A 1TA4A 3GRPA 2G5GX 4NEHB 4WQMA 1EBBA 1H94A 1XMXA 2ZE5A 4U7TB 4DLNA 4PO9A 4NXMB 1O77A 1ZK0A 1D6MA 1DAKA 1W46A 3KZKA 4L4YA 1E99A 4DCTA 2C4TA 3OM1A 2HQSA 3LXXA 3OUTA 3PNSA 1K8YB 2AB0A 1DKLA 4MEBA 4Y8VA 5KQMA 4DJDC 4IR7A 3EEYA 3LAWA 4MK4A 1DRVA 2HQBA 3VR6A 1Y6JA 4RKQA 3WGUA 2ZRQA 4URFA 4DUZB 1RZ3A 3L77A 3NC0C 4ZAZA 2UZ1B 3I64A 2JAOA 3O74A 1SC9A 2IPAB 4PTLA 1KK0A 3LUDA 5CVDA 3WQSB 4BO9A 2PWPA 1SJ9A 3SQMA 3T1TA 1ISIA 1KEEB 3GEMA 4XASA 4WRRA 4G81A 2C7RA 1O0SA 2JS7A 2FWAA 3A7DA 3M6AA 2Q28A 1C3EA 2CNWA 5HMMA 2BGKA 1HDRA 1LZKA 3A25A 2JJQA 4MYSA 3F8SA 3NHLA 5IK2A 4F45A 4WCDA 1KEZA 1I6MA 2ZUCA 3F3SA 4X20B 3V00A 3STVA 3SFTA 3CZ5A 3RVPA 3VNUA 3GPDG 2DETA 4BCBA 3DDSA 4I6GA 4OQPA 1GXSA 4UXIA 1UMCA 2O07A 3BGIA 1Z4NA 1PGOA 1V7PC 1P9NA 3BTVA 3NHZA 4HATA 1UBNA 1AKVA 3HC7A 3IV6A 3R3SA 4BKPA 1P5HA 3I23A 4LHSA 1Z13A 5IJZA 5A0VA 1DRJA 4K6HA 2AI2A 2NO0A 3QMPA 2RHTA 4BVJA 4J7UA 3LW7A 4V0LA 3LGSA 2J5KA 4Y6RA 1KE2A 3V48A 3K2IA 2R5NA 2AYZA 1CLEA 1QYIA 2GKSA 4LPSA 3I72A 3VR5H 3S8EA 5LL6P 4QPZA 1MEOA 2FZ5A 1F2VA 3G2PA 2RARA 3ZDRA 5JBQA 5KNCH 1ZU4A 2AZMA 4WA8A 1OXVA 4QLBA 1QH8B 3G9QA 3TUJC 4DM3A 4PG6A 1QR2A 4RTQA 2FDCA 1LVGA 2SKEA 1RYNA 3NT2A 4UMEA 3EVNA 5KNBD 2FG7C 3SVLA 1RAAA 1Q0TA 4MI3A 1M72A 4Q1VA 1PNVA 4LYJA 2Y1XA 2OGWA 1DKNA 5EJGA 3ZTWA 1YZNA 4G01B 1QH0A 1CEQA 3KHSA 3OH8A 5HJ2A 3HDGA 2ZSAA 4OKIA 3OVMA 3CC8A 1MR3F 5DBEX 3LUHA 4JI2B 1MRNA 4RM2A 2ZAOA 2OUKA 1A4IA 1OXKB 3FYUA 1IOZA 3L8HA 3IUJA 3DS8A 4XE5A 3H8JA 1ZI8A 4EPWA 1HNWB 1UBRS 2GBCA 3DT6A 3A6FA 4F60A 4D2IA 3HCRA 3FUWA 1JWBB 2GZSA 3KJFA 4UJ3A 3BUSA 5TF4A 5DMHA 4IHJB 3S7ZA 3QVWA 3VTFA 2DHDA 1V39A 4D99A 1RNLA 2WLSA 1YBMA 1W47A 3MTBA 2AZTA 2AN3A 2G72A 3PKZA 4NPHA 3H99A 2IZ5A 4YV2A 3WKEA 2JGAA 1WA5A 2BMWA 2RI0A 2G1UA 2FSGA 3BICA 3IIEA 3BJIC 1NUTA 5LQNA 3PQFA 3GHYA 3M5DA 1W8DA 4OAPA 2W11A 3OQPA 3PTLA 2RKWA 5U4QA 2R44A 2VHQA 2XITA 3A6JA 1WEHA 4E46A 1SUFA 3L7KA 2H3EA 2IQIA 2H9YA 1HL7A 1OYVA 2GHRA 3L9XA 4Q3DA 3H84A 3W2IA 1XZAA 4OXRA 1DGQA 1Z33A 1AQ6A 2WG1A 3I39X 3L1VA 3CUEF 3KQQA 4ITRC 2DHEA 2E6UX 2JFNA 4IH9A 5F2NA 1CZRA 3DDZX 4MAAA 1DP4A 4I36A 4UAVA 4MUBA 2P1DA 5EY5B 3RS2A 3WGHA 4UM8B 1XCPA 2I4LA 3W9SA 2F4VB 5K0TA 3BK7A 3OICA 5EI5A 1HZZA 1PEAA 4IH1A 2H1LA 2WJIA 3L05A 1Y48E 2Q5EA 1YVRA 5EJ2A 4NCBA 1K3FA 3VUFA 4NENA 4J43A 4NEQA 4BJ5A 4BZXA 2NXCA 4WUTA 4WFKA 5ELLA 4Q15A 1RBYA 4OYRA 2H2IA 4G41A 1RC8A 1Z6PA 1L8OA 3E48A 5DU2A 1I36A 4Q82A 5G4KA 1ZAKA 2BGMA 2PL5A 4IAOA 1QP7A 3F3KA 3BRWD 3H04A 3IO3A 5H68A 2QI9F 1ISPA 4CIDA 1SRQA 4QZVA 5LJIA 2XKJE 3D3EA 1CRQA 4U5QA 4R8RA 1Z4OA 2W8BB 4KLRA 4TQAA 3LDHA 2OCLA 1ICIA 3L0DA 1ZA2A 2H0AA 2L42A 3FYTA 1TIKA 1EG7A 4HTFB 3BSYA 1A50B 3VOTA 2P4UA 1AN9A 2IL1A 3RK1A 4A0GA 4EJ6A 1G7RA 3KWLA 4Y6OA 2A2ZA 3M83A 3D8RA 3O4GA 2WC1A 3FUTA 3WDSA 1WUJS 3AFIA 2I6SA 2Q8PA 1JQKA 3BQ9A 3L8FA 1E9SA 2CCJA 4ZEOA 5CIQA 4HN2A 4ZT5A 3IPLA 4C0KA 2ICAA 4L6IA 3V8MA 1JLSA 1XZLA 3AVPA 4ZQEA 2ZYDA 5DRYA 3V3KA 1SRRA 4C05A 2B5OA 1H1DA 4PCVA 3SEQA 3ZJ5A 3BL6A 2VRWA 3I4CA 3QU7A 3ZZTA 3QV1A 1RP7A 4DQXA 3DMYA 3VDMA 3SIXA 3L6DA 3JRWA 1F5NA 5AVKA 4BECA 2XMBA 4R5HA 3O3MB 1VIMA 3BQNB 3SHVA 6GPBA 2YWCA 3GXOA 3OF2A 2VPTA 3IGFA 4M1YA 4J3JA 3G5UA 4NVRA 4QQRA 1Z3IX 4UE3S 5LN1A 5IMSA 4P54A 3F4BA 3KQOA 1UPAA 1NOKA 3WMWA 3U48A 5I6DA 2QRJA 3H17A 2G77B 1TPYA 5C81A 4K6KA 5AI9A 1T2NA 1F0NA 1N5JA 1W5TA 3PZBA 4EG3A 5EOVA 2J3JA 3K05A 3EDQA 3HFRA 4RS3A 5AXAA 5C34B 2IHNA 4ND7A 4NWIA 3TINA 1SXJD 2PJRA 4Y9DA 4R81A 4WL0A 2K5UA 4ZQHA 3K9QO 5JXIA 2FLWA 2W6JA 3R2JA 3PLNA 1E98A 1WU8A 4YFVA 2M98A 4GZ3A 4ZK6A 4QYMA 1QGUB 2ABWA 4Y6LA 4ZT3A 1TJYA 3TF5A 1HV8A 1Y4AE 3FRHA 1JTEA 4OHZA 4GOLD 1SAYA 2QTVA 1K6IA 1LH0A 3L0PA 5AUNB 1NXTA 4KR2A 2NACA 2DF8A 3ABOB 5E3IA 3DKPA 2G4VA 5FA5A 5HMLA 2ZXFA 4ALJA 1W5BA 5CLLA 3AI1A 4MCIA 4FWTA 4CYMA 1EQAA 1C0KA 2UAGA 3PF9A 4JB8A 5GIPE 4IBOA 2ZDGA 1UXJA 2XE4A 1U5CA 4P08A 1W5AA 3NHJA 4PPGA 4YRMA 2Q9AA 4ARAA 5EWLB 3NGMA 2NTYC 1ADBA 1V3QE 3N74A 2PAAA 1RHQA 5GY7A 1UJ6A 3B3AA 4N40A 3S3TA 4C3VA 3DZIA 1R9NA 5JNVA 2FVYA 3EIQA 5JS1A 5IU6A 2XCLA 4H7PA 3UUEA 4WACA 3C3JA 2J6BA 2DBZA 5CXQA 5ALUA 1T8TA 5BQFA 1VSUA 4CHTA 1A2QA 2POQX 1B8PA 2X5KO 1NF2A 3KTDA 3D43A 2VYVD 3U37A 1N5MA 4WJZA 3WGNA 4C29A 1BH2A 4U2EA 1GPDG 3V8QA 1JB9A 3KAPA 1DO0A 2ZWAA 3TRIA 3WFJA 1T29A 4P0TA 4PGFA 2VDOB 4XYBA 4XVQA 3O47A 3VVMA 3QUSA 4G24A 1O5TA 1W29A 1JIQA 3Q9LA 2FEXA 5K3OA 5LZ9A 4YJ2A 3L7JA 2X8JA 2IDJA 2PUWA 1CE8A 4RIEA 4DCJA 4ISCA 1Q0SA 3EK2A 3LVRE 3O8DA 4IUDS 1T5LA 2ODNA 3PDIB 5LZ8A 4BMXA 1M2EA 1DEKA 2WWTA 3CZQA 3O3OB 1PG2A 3LK7A 3NIWA 1QF7A 4FMDF 2MHCA 2EL9A 3ZE1B 1M0TA 1GITA 3HSYA 5CDSA 3I45A 3U6KA 2B7LA 3G9XA 3TW8A 2DXIA 1FMFA 4RVFA 4DV3B 2Q7OE 3P9RA 4MJ3A 5HS6A 1DAIA 1EJBA 1WCWA 2Q49A 3WIUA 1GQ2A 1LJ8A 3MHPA 1PGJA 4FNMA 4XWOA 3JATA 3LPNA 1RRVA 5DK6A 5LVAA 3HXQA 5J40A 3PE3A 5D5PA 3Q8LA 2OV6A 1GTMA 1DKPA 3IJPA 4OMFG 4ITUA 4ROTA 1U0FA 3E1KA 3OHPA 3OMXA 4X6UA 4IFBA 1W0JA 1WQ1R 2J6CA 1PJRA 1UJ5A 1JSZA 1PU2A 4FDLA 4QJ3A 3GLGA 1Q3TA 4IDOA 3STTA 3ZXSA 1RJGA 3QE9Y 4Z0PA 2J3QA 3WGJA 1G20B 3OKPA 4URZR 4BX3A 4P3KA 4KITB 2H8GA 1QU3A 4PR0A 3ZR4B 1QWSA 2NSJA 2HDNB 1VIVA 4IG4A 5B1YA 2CV0A 2ZUBA 3GYGA 4JXKA 4A8JB 5LA6A 1EFVB 1EWRA 3AJDA 4DAEA 2OOSA 1WZIA 5KJFA 2XCSB 2EEZA 2MSLA 2VDJA 1GTZA 3HFJA 3KTAA 4QIHA 3Q10A 4UU1A 4JEHA 4YAOA 5AOCA 3RSLA 1Z47A 4BNDA 3UPDA 3NVDA 3T4PA 4D9CA 5DYNA 1LNQA 3D7MA 3VU0A 1I6WA 2F8TA 2L0XA 2IE8A 3TLGB 4E21A 1EXNA 1GN8A 1PN3A 4QBGB 4HUQB 1TDJA 2V7GA