2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
1QE3A 2H9YA 3MGAA 4TVKA 1FFCA 3UUEA 2O7VA 5DTIA 4E14A 2XQKA 2ZYIA 4QDZA 1ZI8A 1CUIA 3YASA 5LZ4A 4UHDA 3M83A 5IVDA 2BJHA 4GHWA 4KJXA 4QA9A 3I6YA 3HC7A 1EB8A 3WIBA 4YPVA 1PJAA 2Z8ZA 5A71A 2UZ0A 1SC9A 2JGEA 1CUBA 3ZLUA 5ALJA 1AURA 1DU4A 2PSDA 4AO8A 4MYDA 1THTA 5BV7A 5FDFA 2XUQA 2VA9A 3LCRA 4UFPA 3PUIA 4BP9A 4CG1A 1LBSA 2AJ8A 3C45A 4WDRA 3DOIA 3U0VA 2C58A 2ROQA 3TRDA 3O4GA 2C5GA 2XQGA 4H35A 5AOBA 2HA6A 5AK3A 1XZFA 4UHBA 4X92A 4DMFA 2HU7A 3EQ7A 5ALRA 5LIPA 1MN6A 1WOMA 4DMHA 4G4GA 3D4LA 1L7RA 3DQZA 4BDSA 3FLEA 3QMMA 2J4CA 2V96A 1TCBA 4RPCA 1YCDA 3I2GA 4KAAA 3DYVA 1CEXA 5CMLA 2EEPA 1P0PA 3VVLA 1JJFA 5C7YA 4E11A 5HF8A 2Z5GA 3MUNA 3D0KA 4RGYA 4BRZA 1ZD3A 2JGJA 1EXWA 2BCEA 4AN1A 4U2CA 4L72A 4B0PA 2QXUA 3IUMA 4I4CA 5T4EA 1XRRA 1DQYA 2WIGA 1LPAB 4Y2UA 1LPOA 1YS1X 4WY5A 1FSSA 5CTAA 2OCIA 5CH3A 5FOQA 1QIJA 3BIWA 4BC1A 3V1MA 1ZICA 4G9GA 5AOAA 3QMVA 1PV1A 4X97A 1A88A 4ETWA 4JH0A 4K6KA 5ALVA 3ZLVA 3IULA 2D5LA 2FJ0A 4C89A 4RE6A 3CCCA 1XROA 3HJUA 3AZPA 3AZOA 2Y6UA 2JBWA 3KXPA 3IB3A 1ZD4A 4H7KA 2QM0A 3SWWA 1J06A 3WYNA 2O7RA 2J3QA 4XIIA 1ORVA 2BFNA 2DR0A 4DTCA 3EIOA 4DSZA 4UBKA 1XRQA 4AXBA 4CG2A 2GYVA 1ZGCA 4Y2RA 3WZLA 5JANA 4OU5A 2DSNA 4V2IA 3STWA 5JZBA 1JMYA 5DYWA 1ZD5A 5ALFA 5LZ7A 3LS2A 3NUZA 1AKNA 1VE6A 4HXGA 3DL7A 4Y2PA 3FLBA 2VJCA 2XMQA 3BL8A 3V48A 4S0XA 2XUJA 1BN6A 5ISMA 1LPSA 3QYJA 5AI0A 2JGLA 1ODTC 5IVIA 3G0CA 4EUSA 4J7AA 1DWOA 1HDEA 1P0MA 3HYSA 2HA4A 1ZIXA 4B84A 2QS9A 4FNMA 2YYSA 1LZKA 2PU5A 1WCYA 2VAVA 1XZMA 1LGYA 2ACEA 4B82A 2VJBA 1EDBA 3R3WA 4Q1VA 2WHQA 3LIPA 2OCKA 1CFJA 1U2EA 5ALHA 2B20A 4X85A 2I78A 5HK8A 5D3KA 4CI9A 3F67A 1B41A 1NX9A 4HRYA 5I9IA 3W9BA 4EY6A 1E5TA 2PBLA 1QONA 1SCIA 1AUOA 2VAXA 4U2EA 4H7IA 4J0IA 3GROA 4DNQA 1AX9A 1Q0ZA 5K5EA 5AKZA 1W76A 2QOEA 1E8MA 3BJMA 1G66A 1F0PA 4F60A 2WU4A 5AM2A 3OC0A 3QPCA 4B85A 5AKGA 1BROA 2XMCA 2XLCA 1XRLA 1QIIA 1H2ZA 1ACLA 1S8OA 4BTLA 1UZAA 5EHZA 3C8DA 3VDXA 4UBOA 4GECA 6YASA 3AIOA 1QIEA 3C6XA 4Z49A 4U2GA 4BB0A 3C5WP 1QIGA 3FSGD 5AM5A 5AI5A 1CUJA 3WKEA 4X91A 3R40A 4W9RA 4ROTA 4Y2VA 1M33A 3DNMA 4WFKA 4I3FA 4BAUA 1IMJA 1GPNA 2DHCA 4C87A 3UMJA 2FX5A 3WL7A 3WWDA 5LP1A 2PM8A 5C8XA 4W1SA 2WJ3A 2Z3ZA 5KBYA 1GPLA 4BZWA 1QZ3A 2QR5A 4K2AA 1W52X 4GEGA 4UHCA 2WG0A 4BE4A 1ETHA 5YASA 5C8VA 1GT6A 2Y2UA 2QUBA 5AJHA 3IUQA 2WTNA 3AFIA 2VJAA 2G4LA 4X94A 2BGNA 1F6WA 2H7XA 1ODSA 3ESDA 5JZSA 5AICA 1K5PA 2OLEA 1SCKA 2HHAA 1XZDA 3AZQA 1UOPA 1CUGA 1FFBA 2Z3WA 4Y2TA 5IH7A 1XZAA 3QH4A 5CT5A 2V98A 1EVEA 1XLUA 2XQFA 4KRYA 5BWCA 2Z8XA 1AQLA 3ZI7A 1CUFA 1P0IA 2XLBA 1VA5A 3R3UA 1R3DA 2PSJA 3I2KA 2CMFA 2I3DA 1TAHA 3I28A 1AMNA 3R3XA 1VZ2A 4ARAA 1DQZA 4UHHA 4YX9A 4NS4A 1YAHA 1U8EA 2RAUA 1YA8A 1F0NA 1J1IA 2OQIA 1FJ2A 5ALGA 3FCXA 5HF6A 1CUVA 3I1YA 3B12A 2HU8A 3D7RA 2GYWA 1YSCA 3WWOA 4BAGA 2JEZA 3FNBA 3RARA 5C81A 2LIPA 3ICVA 3BXPA 5T4BA 2GBGA 3C6ZA 1CQWA 5EFZA 2ZVDA 1ZI9A 4KE9A 1TQHA 1QFMA 3A2MA 2JGMA 3K9BA 1TIBA 5ALSA 1XKLA 4FHZA 3ZWQA 3E0XA 2HM7A 5AM0A 1RWQA 3R41A 2HA7A 3L1IA 1CUYA 2XUHA 3AJAA 4W63A 5D6OA 1CUUA 2C7BA 4L9AA 3WK4A 3WK6A 4BP8A 2WLSA 4LHEA 4W1QA 1VJ5A 4K6HA 4UHFA 1A8SA 1MT3A 1G4HA 1W4LA 1N5RA 3A2NA 4XJVA 4ZI5A 2ZSHA 3Q0TA 2CEKA 4JUIA 3E4DA 4K5QA 3IURA 4AMYA 4OYLA 4C4ZA 1W75A 5AH0A 3BE8A 4AO6A 4J0KA 1YB7A 4KAFA 1DT3A 5DJ5A 1SCQA 3FYUA 2VT6A 3WK5A 4AX4A 1E66A 3B5EA 2ZYSA 3BWXA 1L7QA 2WJ4A 1KU6A 4UBMA 1XQYA 5HFNA 2WTMA 1BRTA 3FYUB 4J0CA 1MNQA 4GWLA 1VKHA 1HQDA 4ZGBA 5K3EA 5AIAA 4X6YA 2ACKA 1W1IA 1BEEA 4WCVA 1MNAA 4PNZA 3FYTA 4Q3LA 5H3HA 1CR6A 3H2IA 5J3JA 3BJRA 4KEAA 1IUNA 2JIDA 5JAOA 2DFPA 3W06A 4BVLA 4B83A 4QWWA 2YH2A 4HXFB 3K2IA 2PVSA 1DTEA 5K3DA 5JAUA 4BTVA 3DJYA 3H1AA 5BOVA 3FSGA 3P2MA 5AHXA 3ESCA 4NZZA 1EH5A 4N8EA 3DD5A 4F0JA 1ZIYA 5FV4A 5JASA 3WKAA 5IVKA 5AO9A 2HL6A 2HFKA 2QJRA 2VEOA 4X7BA 1XZEA 3HACA 4H7JA 4PF1A 3D2CA 4X6XA 1CV2A 4D9JA 4B80A 3STYA 4GXNA 1UK9A 5ALZA 4EBBA 5ESRA 1OCEA 1TKRA 2CKMA 3FOBA 2XMRA 4FTWA 3HXKA 3QMWA 3D59A 4UFNA 4JNCA 1USWA 2RHWA 3F98A 5JALA 3ILSA 2VQ6A 1UK6A 1EA5A 3MVEA 1MU0A 3EBLA 4BRSA 4X93A 1FFEA 3WK8A 5HZGA 2HA0A 3VISA 3VVMA 2WUEA 5ALYA 3O95A 1SFRA 4BATA 3MUOA 2XUDA 3I6ZA 3O4IA 2HIHA 2VF2A 5FPQA 1JI3A 3F9CA 5CURA 4PSCA 1LBTA 3WZMA 1QTRA 1AGYA 4B9AA 5FUMA 2OCLA 3WL6A 2K2QB 2R11A 4ZV9A 1HKHA 2WSLA 5KREA 2QRUA 1JFRA 1EHYA 4NVRA 5KWIA 1Q84A 2PPLA 1G5FA 2FUKA 5K3AA 2C5FA 3WKDA 1F8UA 2GZRA 1XRPA 2ZJ6A 3ESBA 2HA3A 5DNWA 1EB9A 3I2HA 3I1IA 4BBZA 1MO2A 2WIDA 1ZOIA 2WG1A 5A7FA 1K4YA 3CCBA 4E46A 4H0CA 2RHTA 2XUAA 4KR0A 4OCZA 4QLAA 5D3ZA 4ZRDA 2QJWA 4JEIA 4X6UA 4LIPD 1WM1A 4Y2SA 3FYUC 1HPLA 1IZ8A 5EIAA 1KU0A 3S8YA 4BYMA 2H7YA 1O6FA 2OAEA 3G0IA 3VJLA 4F5ZA 2NW6A 3AILA 2XMDA 5ALLA 4Q3KA 2RONA 1H22A 2AXEA 2QUAA 3IUNA 4TPKA 1R50A 2R8BA 1EVQA 3ED1A 4GW3A 2XUPA 4AZ3A 5AKIA 2XMSA 4UBJA 4YASA 2I3ZA 3OPMA 3JW8A 2O2GA 5AI9A 2X76A 3O9VA 4GDMA 5K3CA 3W2TA 3C87A 3WWPA 1UKCA 5CXUA 2WHPA 1CUXA 5AM4A 5AKXA 5EHQA 1A7UA 4EHBA 3WLAA 4P92A 3FAKA 2WFMA 3RK4A 1H23A 2WUFA 4CIBA 2WHPB 4BAZA 2OCGA 1B6GA 3OM8A 4DLNA 1VZ3A 1X70A 2CB9A 1C4XA 1CUCA 4M0EA 3D5EA 5JD5A 1NU8A 4RE5A 4P93A 5AKEA 3C43A 2YXPX 3WQHA 1LPNA 5JD4A 3W9UA 4BCBA 3GZJA 2ZYHA 1W6RA 2GYUA 4LXIA 5CT9A 2QTBA 5HF5A 3NWOA 5AIBA 5FPPA 3R3YA 1Q0RA 1VLQA 5AKHA 4LYEA 4XVCA 4A23A 2OPHA 3STVA 3WWCA 3IIIA 4RNCA 2WFLA 5ALDA 1CUDA 7YASA 3L1JA 4XWGA 3BIXA 5ALEA 2IIVA 1E3QA 5JAHA 2WFLB 3QPAA 3QZUA 5ALTA 5EIEA 2XMZA 4W1PA 3R0VA 2WILA 3X3HA 1N1MA 4BVJA 3H19A 1LPPA 1CIJA 2W22A 3DOHA 1DT5A 2AJBA 3G9UA 4LXHA 1TCCA 4L3WA 1WB4A 2CJPA 2IX9A 3C5VA 4ZREA 4AMZA 3H04A 3F8SA 5FLKA 4EY5A 5HKAA 4FLMA 1XZCA 1MX5A 4AQDA 4WY8A 2WJ6A 4PSUA 4FFVA 2FJPA 1QO7A 3BF7A 3QM1A 4WFJA 1WB6A 5AKYA 4QWMA 1XZLA 2XUOA 4ZV7A 1UWCA 5EI5A 3Q8WA 3VJKA 4A16A 3GUUA 1MAHA 1P0QA 1BE0A 3STUA 2PL5A 3PF9A 3FCYA 4DNPA 1QIFA 1C7JA 3D3NA 4DSAA 2QXTA 1ACJA 5CW2A 1WHSA 2WHRA 3STXA 2DQYA 4G9EA 4ZXFA 5ALWA 2H1IA 1XQWA 2PX6A 4GLBA 2XT0A 3KWFA 4PW0A 4IH1A 5DTJA 3WJ2A 3DL4A 1EDDA 3EF3A 3WL5A 2C0QA 1YAJA 1WB5A 2BUCA 1FFAA 3M82A 4Y7DA 3WKCA 4PQEA 4J0JA 3U1TA 3HLKA 3WA6A 4M0FA 3IUJA 4WFIA 3WJ1A 2JEYA 1EINA 3DKKA 5KWJA 1I6WA 3A6ZA 2X8BA 5FRDA 5EGNA 3DEAA 1R88A 1Y37A 3H2KA 3O4JA 1EI9A 4HAIA 1LPBB 4DYHA 4OB8A 3G9TA 4PV7A 5HF9A 1FFDA 5HKBA 1MPXA 1CRLA 2X5XA 4EZIA 4FMPA 1XZHA 1QIHA 1QLWA 1CUSA 4C88A 5EHXA 3GELA 5HFAA 4CIAA 3QITA 4LYDA 2XMGA 1QOZA 1A8QA 2G5PA 5SYMA 1YASA 1EK1A 4G8DA 2Q0XA 1JT2A 3C6YA 5CT8A 3M3DA 2DQZA 4KE8A 3WI7A 1H2WA 5ALMA 2WIKA 5SYNA 1YB6A 2OGSA 2HADA 3HZOA 4X90A 1QFSA 1DWPA 4HTAA 1LPMA 4CFSA 4DNFA 3QVMA 5AK6A 1JKMA 2PSHA 2ZSIA 3C70A 3CN9A 1MJ5A 4PO3X 1ORWA 1QIDA 1VOTA 4G8BA 1YS2X 4AB1A 5HCUA 2DHDA 2V97A 2Y6VA 3V9AA 2XE4A 3PF8A 1EX9A 3KWJA 4GI1A 4JYMA 4J0GA 4CCYA 3GA7A 1WPRA 2ONCA 1XZBA 3WK7A 3OTQA 4KAJA 3E1GA 4X95A 3HABA 1PFQA 1XZIA 4CCYB 4BVKA 1OILA 4OSEA 5LZ9A 5JIBA 3AINA 3NOXA 2OGZA 4UFOA 3G9ZA 2HRQA 4F21A 5AI6A 1BCSA 3RLIA 1K6EA 3WMRA 1TK3A 5LYYA 5LZ8A 1DINA 5FP0A 5A62A 4J3JA 3G02A 3A70A 2WUDA 3H0CA 1MX9A 3I2JA 3G9XA 1HBJA 4OPMA 3C8HA 2GBIA 1QJ4A 2XDWA 5CRIA 4DNOA 1Q83A 3EQ8A 2DCMA 1VA4A 4U2DA 5IVHA 4J0DA 2XQIA 5D7BA 1Y7HA 3ZV7A 1LZLA 4G5XA 5IKXA 1MTZA 5ALUA 1UT6A 3I6MA 3R3ZA 2OAGA 4N5HX 3N2ZB 3DDUA 1YA4A 3PFCA 1UOQA 2QMQA 1CUZA 1GZ7A 2HA5A 1VXOA 4UBLA 4FFWA 4EY4A 3KSRA 4EY8A 4LXGA 5I8PA 1OXMA 3PFBA 1X2BA 4H7DA 4OYYA 1GKKA 1R9MA 1CLEA 4G4JA 4N8SA 3N0TA 4LKOA 5DWDA 4OU4A 5ALKA 2C4HA 5ALQA 4H77A 1LNSA 2WQZA 4C6HA 1CUHA 2QT9A 2RI6A 4HRXA 2QZPA 5K3BA 4Q05A 1MAAA 2RGUA 3A2LA 4EY7A 2PUJA 2HFJA 4X71A 4J0HA 2BUBA 4CCWA 3O0DA 3WA7A 5A6VA 1N5MA 5AOCA 5AI4A 4WDQA 3TJMA 5CT6A 4HZGA 5AM1A 5JAPA 2G5TA 4BCCA 3PI6A 3HSSA 5HK9A 3CXUA 5AP9A 2AJDA 4UHEA 3V1LA 1ZJ4A 2AJCA 2PUHA 3G7NA 2B9VA 3G0GA 4OD0A 5A7GA 4UBIA 5LKAA 2WIJA 2ZYRA 5CXXA 4MEBA 4U2FA 1X2EA 3WKBA 2WKWA 3KDAA 2YASA 2WUGA 2BKLA 5E4YA 2CZQA 4QE3A 5AK5A 3GFFA 5ALIA 1D07A 5HQ3A 2J3DA 5ALXA 3BDVA 5A2GA 1R4ZA 2EDCA 4MEAA 3L1HA 5HQ3B 4FKBA 2VJDA 4N8DA 1ZI6A 4OUKX 1JU4A 3DCNA 2JGIA 3TGLA 4JYPA 1IZ7A 3KOOA 1E89A 1R9NA 4MQMA 5ALOA 1LLFA 4FNGA 4ZWNA 4HVTA 2BGRA 4KYVA 4MYSA 3VKFA 5DNVA 2WM2A 2AJLI 3H18A 5JZ9A 4H18A 4Q82A 2IITA 4B9EA 2DHEA 1VXRA 1C7IA 1EK2A 3HEAA 3G0DA 1IUPA 2Y2VA 4WJLA 3FVTA 4IHAA 2G63A 5K3FA 5JARA 1CUEA 3BF8A 5DLPA 2H7CA 2GBCA 3WWEA 3SX4A 1QTIA 1GQSA 5FXMA 2EDAA 2V9ZA 3ICWA 2XB6A 5K3FB 2GZSA 2JF0A 2OQVA 1BEZA 2I03A 4FBMA 3VJMA 4TGLA 4E15A 1MX1A 1UXOA 4I19A 4Y9SA 3S2ZA 4INZA 5E2IA 1TRHA 4AZ0A 1WPXA 2WU3A 3OURA 3PICA 4ITVA 4B6GA 1JJIA 5FKJA 5DNUA 3LP5A 2RIPA 2WG2A 1JU3A 5LKRA 1T2NA 3FLAA 1Y7IA 2HU5A 4B0OA 1EDEA 4C4YA 4H7HA 2PU7A 1RP1A 3JYHA 1BN7A 2XQJA 3T4UA 4FOLA 4C4XA 3ANTA 4QDUA 4YK7A 1UKAA 2XUIA 3OG9A 5JD6A 2ES4A 1BS9A 4BCDA 5DYYA 1BU8A 1GGVA 1K8QA 3IDAA 3B3QA 5CT4A 3I2FA 4QEKA 4GBGA 4B7ZA 3WYDA 1H2XA 4UPDA 1DX6A 2PKYX 3FBWA 2B4KA 1YR2A 3GBSA 3DLTA 2XUKA 1A8UA 1XZKA 1GQRA 1UFOA 2VATA 3PUHA 1XRNA 1IVYA 3UUFA 1J07A 5EHNA 3SC2A 2E3JA 3HRHA 3W05A 1GXSA 5E4TA 1ODCA 4W1RA 3AIKA 4MWSA 4O08A 1THGA 2PSFA 2O2HA 4B81A 5E4JA 4FWBA 1DX4A 1GKLA 4KACA 5I7UA 2OXEA 4HXEB 4BDTA 1IUOA 3FVRA 2JGFA 1U4NA 3ESAA 1L7AA 5EIHA 5BWBA 5AKJA 3V1NA 2XUGA 1WHTA 1UOOA 1ZJ5A 1XQXA 4U2BA 4P9NA 5LZ5A 1ZGBA 3M81A 2CUTA 1R1DA 3JWEA 4X00A 1K63A 1AC5A 3QPDA 4L0CA 3VXKA 3W04A 4BZZA 3R3VA 3V1KA 2O2IA 4G8CA 4MJ3A 3G8YA 4DMCA 4MQLA 1JMKC 2GBFA 4QZVA 1XQVA 3IVMA 3D2BA 3H17A 4UUQA 1XLVA 3ZLTA 5AI8A 1HL7A 1XLWA 5CH5A 1CQZA 1G42A 4OB7A 1XRMA 3T52A 3K6KA 1CPYA 2HDWA 4IO0A 4IH4A 4AN0A 4BC0A 3WK9A 5AM3A 2C0PA 4EB0A 1HLGA 1QIMA 2ZJFA 1E8DA 4Q34A 2XI4A 4FLFA 2OGTA 4A5SA 5JATA 4PSDA 3EQ9A 3PE6A 2QVBA 4Y2QA 3F97A 3QBJA 3FWHA 3NGMA 2CBGA 3IA2A 1VE7A 2W6CX 4DGQA 1UK7A 3H2HA 3RM3A 1N8SA 3WIOA 2P8SA 5JYCA 3O9MA 3AIMA 3LIIA 4HS9A 1E8NA 5JADA 1QIKA 3D2AA 4Y2JA 4DM7A 4QNNA 4EA6A 3STTA 4QDOA 3DS8A 3C6BA 3IBTA 1XZJA 4Y2XA 2D0DA 4BE9A 2XMBA 3I2IA 3SK0A 4UBNA 1QGED 1AZWA 4KE6A 1ZD2P 2XUFA 1H2YA 1KEZA 3BDIA 1QO9A 2WFZA 1UK8A 3KD2A 4NMWA 2BUAA 3HI4A 4X3CA 4MXDA 1CUAA 3DYIA 5C8ZA 5A7HA 2OG1A 3ZPXA 4K6GA 1JJBA 3DKRA 4G1FA 3G0BA 1CUWA 4IQ4A 1T4MA 2HA2A 2ORYA 1ISPA 2B61A 4H7EA 4P08A 1BCRA 4KE7A 4M0MA 3ANSA 5AKKA 2HRRA 1RYYA 3H2GA 2BAGA 1NU6A 4Y2YA 5T4HA 4MWTA 5T4FA 1XKTA 4FLEA 4Q3OA 5AKLA 1O6GA 1GPKA 3PDCA 4QDTA 4FDMA 5ALNA 3OOSA 5CBKA 3H1BA 4H7FA 4OB6A 1UKBA 1Z68A 2VTVA 3O4HA 3H2JA 3LLCA 1SOMA 5F4ZA 3F96A 4C01A 3CN7A 2QKYA 4QLOA 5LZ2A 2J4FA 2JGKA 2VT7A 4J03A 4DIUA 5LLSA 4AO7A 4QDXA 1XZGA 4DMKA 1U65A 3AUKA 1DWQA 1J2EA 4G4IA 2PSEA 2ECFA 1XFDA 3E3AA 4KRXA 1TCAA 5AK4A 2WIFA 4CG3A 4FBLA 5CH8A 4N5IX 5DYTA 5ALPA 2ZJ7A 2VSQA 4XX1A 4ARBA 3RKSA 1CVLA 3TEJA 3WL8A 4IH9A 2Y1KA
chains in the Genus database with same CATH superfamily
4YAIA 1DADA 3RC8A 3AUXA 2BFOA 1HQCA 1NZJA 3H1TA 3MGAA 3HCRA 1BX3A 4GC9A 4K05A 4MJ7A 3VU8A 1EP1B 4B75A 1YZHA 3OJCA 2GHQA 3M0EA 1KHHA 1QZZA 2XQKA 1SXJC 3I9LA 4OLHA 4GZMA 2RD2A 4QDZA 4FWTA 4ER3A 3YASA 4MV1A 5LZ4A 4WRRA 2P1ZA 2F4NA 4GFDA 1SELA 2DQSA 3M83A 2H1VA 4U6QA 5HP4A 2RFLA 2VTEA 1VSUA 3ONDA 3U7QB 1BE8A 1QJCA 1Z0AA 1KZ9A 3DAPA 4JLSA 1H2HA 2AYZA 2RAFA 4XYLA 5KQLA 4KJXA 4QA9A 1KMMA 2F7SA 2VYVD 1GR1A 1TEVA 3HC7A 3I6YA 1EB8A 1P5HA 1GPJA 3IP6A 1XNJA 2C2OA 3QKIA 1AZTA 2P5TB 3CRVA 4P98A 1CZOA 2R6HA 2F1RA 3IDOA 3AEZA 4NAVA 1SC9A 1U0HC 3NEJA 3HY4A 3FWPA 4RHUA 2GN6A 2ZR8A 4WECA 4AT1A 3I61A 5REQA 1TA4A 1VMEA 1XO1A 5E9AA 1NXOA 3GAAA 2PSDA 4AO8A 1MC4A 4OQDA 3UJ3X 4UNQA 4D97A 1AUVA 1Q50A 1THTA 4MYDA 2OBLA 2JAOA 4GR4A 3RF7A 1O7JA 4PBRA 1CRQA 1YD7A 3G5TA 2Q4TA 4KIFA 4MV0A 1VL0A 2VF5X 1LBSA 2XAAA 1E1QD 1Y1SA 4I50F 4WZBB 5AW0A 3MM4A 3U6BA 1JPUA 4HX9A 4G37A 4LC0A 4R3NA 1M7GA 2UV8A 4CPDA 3C45A 4NAHA 1M1NB 2DPHA 3DEYX 4OJTA 1CIPA 1UEXC 2XCTB 1ZRNA 4YJ2F 1QP0A 2VF8A 5DLQC 4OMDA 1F06A 1GVHA 2JHFA 3IDSA 1Q1BA 1DIAA 1ZIDA 1Y9ZA 2ZWOA 3KL2A 4PIVA 4X41A 4H9GA 3TRDA 3ZHXA 2YHUA 2EERA 3UA4A 2C5GA 1EA7A 2RGGA 2W2LA 2HK8A 4M9ZA 5BN5B 2ON6A 2XQGA 4BX3A 1H4VB 4NMHA 2HA6A 4HI0E 1NVTA 3PPIA 4EKGA 3MC1A 1G8FA 2EKBA 1R3UA 1W88A 4HFRA 1XZPA 4NZOA 1O8CA 4X92A 5ALRA 3PHGA 4QXRA 2CV2A 4G4GA 3D4IA 3OFVA 2DHQA 2J5RA 4Q9JA 5L3SA 5E1OA 4QO8A 3UB2A 5C7OO 3D4LA 4ZVKA 1YHYA 3KKQA 2UU9B 1E3SA 1DLIA 1L3IA 5M3BA 4BDSA 4NE9A 2RE8A 4AY5A 1CCWA 4LC1A 3NOQA 4J0QA 4HH0A 4JLUA 5E0KB 3FLEA 1DAKA 2OVFA 4RXTA 3T7DA 3BREA 1C1DA 3TSAA 4NMLA 3GGCA 3WLIA 1LTHR 1MGPA 4DT1A 4AF6A 5BUZA 3A06A 3QMMA 1XYVA 4L5IA 4ZVQA 1HG0A 1U7DA 1EM8B 4M99A 4G0XA 4QFMA 2V96A 2OV3A 4EHHA 2XIJA 1D4FA 5G3YA 3RVRA 4K6CA 4RV5A 4FCVA 3RO7A 2FTKE 4KAAA 1EZ4A 1NVGA 4Y1EA 4Y9RA 4ZHQB 1CEXA 5B2FA 3KJZA 3LSYA 3WMEA 1SKUA 5DN9A 2ILTA 3GVPA 5CMLA 4JL8A 2JC3A 4NQRA 5BWOA 3T94A 1A8PA 2XXJA 2DBRA 2C4MA 4NK4A 3NDBB 4GU5A 1M2VA 3UAWA 1EFPA 3F5DA 5T6MA 2C3OA 2CHEA 1K8RA 3AHCA 3MUNA 5HF8A 2O6HA 5ICMA 3P9ZA 3HDVA 5TQVA 5KJ1A 1HFKA 1M2OB 2LDXA 1VJGA 3UMVA 5BW4A 2IZZA 5EP1A 2A9OA 3ZVMA 3ZLBA 3S27A 1QPZA 3ZCPA 3T3IA 1HF3A 2HEIA 4U2CA 4WADA 4L72A 1E0SA 1G6HA 1KK1A 4GI3A 4EY3A 3I8OA 4QDKA 2C7VA 1GGKA 1VPVA 1QBGA 2DY0A 3VRHA 4A0RA 2RB5A 4FMDB 4RD3A 5J4KA 1W25A 1L4KA 4RA9A 2IX3A 1YJ8A 1ISIA 2II6A 1JTEA 4OHFA 3ZD8A 4P80A 4BWGA 4EP1A 3QBEA 2C1XA 1EX1A 2RBGA 4P36A 1FS4A 4ITUA 5EE0A 3EPHA 3TIVA 4OF4A 1PVDA 2WIGA 1UJMA 5BURA 2O3SA 2V45A 4YR7A 4RMJA 2HI0A 2O8BB 1Q5PA 2PV7A 4LPSA 3NG1A 2O3UA 5E3IA 5TXGA 4BV3A 4CI0B 1XNGA 3FMGA 1RYDA 1NSYA 2QYHA 4L1KA 2PIAA 3H2YA 3K20A 4BFTA 2D1YA 3JASA 1N9ZA 4M89A 4CIVA 4B43A 1MAWA 3OZVA 4TMYA 4BGUA 4XA8A 2M6KA 5K0GA 3MTEA 1N25A 4BO7A 3E7XA 1YK0A 4JBHA 4R7ZA 1M34A 1A88A 3ETCA 3HM2A 4ZAWA 4ED9A 1YJBA 4ETWA 5G0WA 4JH0A 2FW7A 4M1QA 5GGXA 4TVOA 5K0TA 3O8RA 3ILXA 3IOBA 5ALVA 1W30A 4PZDA 1V48A 2WZDA 1G8KA 1KO7A 3QP9A 5ELXA 1L7DA 2GXUA 1ZHFA 2QQ0A 2QN3A 1N92A 1ZUHA 2JH3A 3A0RB 3Q7PA 1P62B 1MH1A 2FMUA 1RT9A 4IIBA 2B4QA 4WESB 2PSSA 4FMCF 2P0EA 1Z88A 1Z0ZA 1SK9A 4B8WA 1A96A 1JLSA 3OD1A 1GDHA 3PDHA 1EGQA 4YMLA 4L4RA 1ZMTA 1KZHA 4BGVA 1ZXLA 1UR5A 5L7YA 3AZPA 1XWWA 1J8MF 1YQTA 3AZOA 4EYEA 1U0OC 3G13A 1KVSA 4KIJA 2JBWA 4D6XA 1TM7E 3IB3A 4IZOA 1QOPB 3CU5A 4R40A 2NAFA 3MK31 8ABPA 2CE7A 2ZAMA 2QM0A 1WVMA 2NXNA 1F0KA 5FA5A 1IHOA 4IHJF 3SKXA 1YR9A 2H63A 2BFNA 5K8VA 1AHNA 2DR0A 2CL5A 3I5MA 4MQ6A 4YA6A 2CDNA 4UASA 1FNBA 2QX9A 2IQIA 3EIOA 4WBSA 4MX8A 5J40A 4G5QA 2C3PA 5I7AA 3A1FA 1G3RA 1PW5A 3GLGA 3RFXA 4ZOQI 3ZLJA 2BEVB 4XLZA 1GUZA 2VHUA 4MYRA 5DMHA 1XC7A 4C43A 5IARA 2A0YA 1KY3A 2ZIVB 5FAKA 4OX9B 4CG2A 1ZHOA 2GYVA 4D8UA 5FTKA 3QKRA 4Z9FA 1ZGCA 3HKBA 2FPGA 1Z9BA 4OU5A 4DMLA 1E2LA 2VJKA 4DM3A 2BCGY 1ODLA 1LK7A 2N75A 3STWA 4W5TA 5A1JA 4WMLA 5JPCA 1DX9A 1JMYA 4TZ0A 3INGA 1P29A 5AW4A 4YRIA 1VTKA 2NT3A 3QW4B 1TYAE 3RYIB 1SMKA 1Q14A 1KMHB 5ALFA 1E94E 5TX7A 4TMFA 1SB9A 1BA3A 3A14A 3DEIA 4Z4CA 1AKNA 3IRUA 4GRAA 1KQGA 3DL7A 1E6CA 5KU7A 4FR2A 4F9EA 2RK4A 4HDNA 2QL6A 2XMQA 3TOZA 4MI9A 5M04A 4ZEXA 2H17A 1BYUA 5A6SB 5E1DA 3RUCA 4PLHA 4QT4A 4O29A 2HTEA 1BN6A 3OZGA 2FK7A 3N76A 1L4EA 4LY0A 3ADPA 1GL7A 2AZMA 3D8NA 2JGLA 1UOEA 1RXEA 3BE5A 3HU2A 1ODTC 1ZJZA 3HJNA 4JB2A 3HBJA 1LF5A 3FPSA 1I01A 3NYRA 4TL7A 1JG1A 1MORA 2HK9A 3AGPA 1HDEA 1P0MA 1YQGA 2ET6A 5ICCA 2HA4A 1ZIXA 2HV8A 4OHCA 4DEXA 3F9RA 3A9VA 3MMSA 3P52A 3MILA 3OX1A 5K2OA 3U9SA 5TMDA 2A5LA 1TOAA 4CMJA 1G16A 1WUJS 1DP4A 1JHXA 3RPEA 2JCSA 5A4IS 1LZKA 4V1CB 4C30A 3HB4X 1WCYA 2ZKLA 3NPMA 4OFWA 2ZWPA 1OLSB 3PDIA 2ACEA 3LG2A 4QL3A 4EEKA 5K45A 5LD2B 4MS1B 2EX4A 1RKXA 2E1PA 2HV9A 3W7VA 5JYBA 3B3JA 1IHPA 1O0SA 2GPWA 4EO9A 1OIWA 4EF5A 4JLVA 4JVOA 1R0RE 1E64A 3DMRA 3SP1A 1WZNA 3QIVA 4FIZA 5DKFA 4JMLA 4QFDA 3AVWA 2OCKA 1CFJA 4RMIA 1U2EA 3TAXA 2B20A 1CY6A 3D6MA 1SXQA 4BO0A 3K9FC 3JQAD 3LC0A 3QOFA 4GNKA 3AFHA 2P6OA 4CI9A 2JLWA 1MHTA 3F67A 1B41A 1NX9A 1VI2A 4EM6A 4EY6A 3N1UA 4E2WA 2VAXA 2NXJA 1DCFA 2QTZA 3IH5A 1D0VA 4K0RA 3TQQA 3UT5A 1JHQA 1XTIA 3PJRA 3ACCA 1WLSA 2J5XA 3ORFA 2OV4A 2XB4A 2VQSA 3KHSA 4RK6A 4LYFA 3FD8A 3ER9A 1SAYA 1RE0A 1FPQA 3GMSA 1P74A 1S7GA 1L2TA 2XNJA 4MYCA 3BJMA 1B8OA 4F60A 1OZGA 1P8AA 4J1SA 2WHYA 4MH0R 4DQUA 2OK8A 4J16C 5LQUA 5AM2A 1BJKA 4R9UC 2O8FB 3QPCA 1NIPA 2LXNA 3SJ7A 5BRAA 5B58C 4KVGA 1E7QA 3K09A 3KQVA 1GAEO 2XLCA 4PRYA 1H2ZA 1ACLA 3JRXA 3HB1A 3LDHA 3LLUA 3FNFA 1GCAA 2AL7A 2B4YA 3UJNA 1PX0A 4KDFA 1CZKA 1FOEB 1KFKB 3Q8XB 2JLRA 4D02A 5BP7A 2P6NA 3GUYA 3EIQA 1X86B 5AJZA 2IH5A 4Q6WA 3R6LA 3C5WP 4LE1A 3NOVA 1Z18A 4MRMA 4E5SA 3BERA 1C0KA 5P8WA 5F3WB 1DKOA 1DC6A 3ORHA 3OFSA 3IQWA 3WBJA 5AI5A 4C4RA 3LX5A 2VDPB 4JJ4A 5EZSA 2ZJ2A 5IJ0B 4ROTA 1U80A 1ENOA 4IZHA 4ZJYA 4WOBA 1M33A 3ZZ0A 5IBPA 4Q4HB 1IPFA 4I3FA 1IMJA 1AY0A 2LVBA 3UIEA 1U7UA 4C87A 2F67A 5J4VA 3WGUA 2PN1A 3COVA 1XZNA 1DBIA 3QBVA 1MO5A 4IEFB 2VSOA 1CZRA 3T9DA 1NJ8A 1U28C 2I6TA 1NVFA 1M66A 1KYVA 4KGXA 4Q9IA 5GQSA 5LP1A 1VHQA 2O54A 2C8JA 2HHHB 3M9LA 1CDOA 1J90A 2CXPA 5ICEA 3ZOKA 4EATA 1OLUB 1VSQA 1XMJA 5AW7A 1FQWA 1T8PA 3NHZA 4RLQA 4I4NA 3V4ZA 2JKZA 3HXTA 2ZYDA 3QEKA 4YWHA 4LZAA 3N6XA 2HYDA 4JBWA 4RESA 4UDYX 4ZVUA 3ABRB 4CV0A 5JJ5A 4LGMA 5TQ0A 1HEIA 1XP8A 3OY2A 3RVMA 2CB0A 3E7FA 4KQFA 2PXCA 1YI8A 4I8DA 2Q5IA 2CFRA 4KVAA 2CNBA 1PLLA 3SIWA 3L0SA 3VGJA 1P9NA 4ZZ3A 2P9QA 1ZD1A 4MGYR 3EFOA 3FF4A 3JAKA 2GYYA 1KFCB 5YASA 1HDZA 1XT6A 3JWGA 1OA1A 3RVOA 4A2CA 4RPLA 2BW0A 5C8VA 2GHRA 7ADHA 4MDFA 2MSNA 3V1TC 2IXBA 4FGSA 4DIDA 3E7WA 2IFTA 4NCHA 2DJIA 3CH5A 3WMWA 1B8UA 1QX4A 2FZ4A 3T3HA 3GGDA 4DWVA 1FFYA 1E7RA 4N6OA 3DEJA 1IOVA 2B83A 2CXSA 2WTNA 1RBQA 3I8SA 4YAUA 2W6OA 1JIXA 4Y30A 3PNYA 1OC2A 1Y3DE 4P33A 2NADA 5JG7A 3RF6A 2JI7A 2M2IA 1S4MA 1BXGB 1FJGB 3EAFA 4LW8A 3ESDA 1E9FA 4QBTA 5CXSA 5IT5A 5DYNA 2W9XA 2J6IA 4D80A 1YCGA 4CQMD 3THXA 4MI3A 3GF4A 2OLEA 1LJUA 4AZTA 3E9MA 3CKYA 1KDVA 2G04A 2I2WA 2HSJA 1PP4A 3D6AA 1UOPA 1CUGA 2AS0A 2FV8A 1J21A 1D2EA 1F2TA 1XA0A 2Z3WA 4US0R 1MFPA 4BOYA 2IDZA 1A50B 1RYEA 2VAMA 3C41J 3CLTC 2BLLA 3O0TA 3O75A 4KKXB 5J2UB 1NMEA 2OHOA 5KHOC 1ZJ6A 5H5JA 2ZYGA 3PC8A 4AJ1A 1OH6A 4MUYA 3AGQA 1QV7A 2X1VA 4QULA 2H4WA 1V2GA 521PA 2FETA 4EIWA 2V98A 3SEAA 4Z8YA 3G0HA 2IEIA 1OFVA 1ZUWA 1WY7A 2Z5VA 2ETVA 1CY2A 2HO5A 3TPFA 1P7PA 1QDEA 3ZWPA 5AESA 1Q11A 1DHRA 1RQGA 3TKLA 4EYGA 3ENVA 3FTCA 3GPBA 3PKJA 3PQCA 5CB4A 5P21A 3PXGA 3W5VA 3BL5A 3AFGA 3OKCA 4E94A 2FLWA 3ZI7A 1THZA 4IIJB 4W82A 4WLVA 3PFNA 1VA5A 5HYVA 4OKIA 1R3DA 2PSJA 3WP0A 1K1EA 2O8CA 1FFXA 1TAHA 2O52A 4YTEA 1WL8A 5M29A 1H94A 1SVKA 3R3XA 4RH0A 1NXSA 2YWRA 1U7XA 4PEVA 1T8UA 3U1BA 1RQXA 3ND9A 1ONSA 2ISCA 4YX9A 2BFDB 2ZYWX 4GPTA 1OPXA 5DCUA 2ZUVA 2AF4C 4WLEA 4MVJM 2VHJA 3CNNA 4QLBA 4ISCA 4II2A 1VM6A 3BTOA 5FA8A 1QUFA 3OLVA 1NFQA 4HB3A 1PCXA 2I34A 1GTZA 3GJTA 1AU9A 4P82A 3U7HB 2YZMA 1E32A 4AJJA 5IX8A 2HU8A 3P71T 3L0CA 1WA5A 3KO8A 1XHFA 4M9RA 3QE4A 2GN9A 3ROEA 3GGJA 3LH5A 5G0UA 2OPBA 3RTBA 5J5CA 4BLUA 2ZSBA 1ENPA 5BV8A 1M72A 1KC3A 4QYIB 2RAVA 1A77A 1PEAA 3AVTA 4IYJA 3WWOA 3D6UA 2IYLD 5LD2C 5C81A 3HDYA 2I4RA 3AM3A 2EC5A 2R44A 1WBDA 3BXPA 1ZOOA 1A2QA 3BHMA 4LHWA 5KYTA 2GBGA 4PC7A 5C3MA 4HFMA 5CAEB 1CQWA 1WXFA 2F00A 3TTVA 1ZI9A 4BVAA 3D5QA 1NP6A 4KE9A 1ZS9A 4QHTA 5TQ2A 3BORA 3MFYA 1C7ZA 2HLPA 4NABA 4WN9A 1OYWA 1TIBA 3LUFA 1LEHA 4KHZA 1VJTA 3VR5D 3WADA 1DZIA 1T5IA 4QU5A 4RU1A 2AEMA 4N39A 1FY2A 1KJ9A 3MOGA 3E0XA 2JJQA 4CF6A 4QTUB 1VBNA 3HUTA 3KLPX 3VHXA 1LS6A 1W96A 1XMXA 1QTQA 2EATA 2NXCA 4TZ6A 3GCDA 2FA9A 3OICA 2RJOA 1SU8A 3P2KA 4OQFA 5FL7D 3W77A 2Q29A 5AR1A 2F8TA 2O2EA 2VPYA 1BW9A 3N70A 1KIAA 1LLCA 2VYNA 3OX3A 2XUHA 1YH3A 3MOSA 5ESDA 3AJAA 2WZCA 1A9XB 1R0LA 1WS6A 1EVZA 1LTQA 2C7BA 1J6UA 4IVPA 4MP6A 3SS8A 1DBVO 2N9UA 4YJGB 3VR4A 2HPZA 4L9AA 4UDXX 1D3AA 4W5JA 5HPYB 3EDQA 2EKQA 3O92A 1NBHA 5CYFA 2C59A 3KLMX 4P4LA 3WK6A 1E2QA 3I53A 2FCRA 4EYKA 2GCPA 3VO9A 4Q4AB 1K27A 2A2ZA 3WG9A 2H92A 2XKAA 4BP8A 1EFVA 2C8VA 3FUWA 2WLSA 3KLBA 4A1FA 2WJIA 2BC9A 3G82C 3QWIA 4ZYYA 4O25A 1ID8A 4RY2A 1VJ5A 5JQGA 3H84A 2YHBA 3B2NA 3L6RA 3QI2A 4K6HA 1NN5A 4NZ9A 4UJ5A 1W4LA 1O54A 1PZFA 2CF6A 1VSTA 2AC4A 3E5MA 3G49A 4JFAA 4FDTA 1G7TA 2C9YA 3A2NA 1YZVA 2VNKA 2Z58A 4UCXA 5HS4A 2PX3A 4YP6A 3EVZA 1OIXA 1GRNA 1P75A 1YVEI 2CMGA 1WXDA 4F2WA 3L1VA 1FXWA 5FPYA 4QQNA 2VP9A 3N9IA 1TGYA 2X3FA 1FP4A 3NIDB 4BJ3A 1MH9A 3GFQA 4HK4A 3ZWYA 5CFMA 1W75A 3OPYI 1MUUA 5BQ5A 5AH0A 4ZEOA 4P4SB 1R4MB 3B8HA 3ILVA 1T9CA 4IUDS 4BNIA 2H2FA 3S2SA 3AC0A 2H07A 1DQNA 1ZL2A 3FKQA 4J0KA 1DEOA 3O21A 4KAFA 4IMRA 2KLHA 3B1FA 3QFTA 2QP4A 2QF7A 1Z5ZA 4JLPA 2E37A 2OSBA 3WIDA 1U5CA 3GG2A 4Y1GA 4JB0A 3NOOA 4JKIA 3QELA 4JQZA 2VSXA 1E66A 4NJOA 1IEQA 2CBXA 4X7MA 2CW5A 2IVFA 3IERA 2ZYSA 5FPHA 3VC1A 4AJ9A 3SQWA 4UMEA 3QSYA 2WYUA 2B8WA 2QMYA 4BFXA 2WJ4A 3OTGA 4JOQA 5CNMA 1VMAA 1IYZA 2X2OA 5HFNA 1DS6A 2H0AA 5JZOA 1BRTA 1SO8A 4AP9A 4PE5B 2ID9A 1Y1LA 1G20B 4OL0A 5A4DA 4ZCQA 2I8LA 3V8BA 5AIAA 1Q21A 2O8EB 1XU7A 1D9ZA 2I7VA 2FG7C 1Y5MA 1W1IA 2QMEA 4OQQA 3UOWA 3GLFB 3PC7A 2XXAB 3QUSA 4P84A 5GOZA 2RH8A 2QTWB 4IG9A 1SC3A 1V71A 5ICSA 1MNAA 4IVNA 2AQHA 2IZ6A 5LQAA 1NF8A 3NPAA 3KU1A 4ZPXA 4MUGA 1COZA 1ZN9A 5H3HA 1N2XA 4H3HB 4M8NE 1J1UA 2ETXA 1UEJA 3TFQA 4ZMRA 1EUCA 3PQ2A 1E5VA 3AMVA 3O1HB 4NNJA 1J22A 4G0ZA 3HXQA 3QEBZ 1SBNE 1E3JA 3R2JA 1UT5A 3RS2A 3ST7A 3W06A 2YV4A 4Y6SA 1U3GA 4BVLA 3T41A 1P2GA 4A5OA 4P83A 4I4TA 4IIHA 4B83A 5H82A 3S0JA 2YC4C 4BGEA 3ZWAA 4RTNA 2IPNA 5MF6A 4BTVA 1ZD9A 3CLRC 2VN8A 2NO5A 3DJYA 3MINB 4EPXA 2ESRA 3FSGA 1R18A 5ADVA 5F2NA 3P2MA 3GJYA 5K3SA 1CY0A 1NBOA 2CJXA 3UB3A 3VBCA 4H7PA 1AQIA 5KYWA 4N8EA 3DD5A 5M5BA 4GOKA 2ODWA 3W1WA 3EWIA 5JVDB 2V5VA 5E3HA 3OZFA 4EZEA 1X1TA 5ARDA 4F0JA 1ZIYA 1P1JA 4AK9A 4YRMA 2HQOA 3PZBA 2PT6A 4MDHA 5IVKA 3AK4A 3K96A 4QPCA 2AN5A 3Q1LA 4K8RB 3KETA 1MRNA 3OQ6A 3OWXA 3EUEA 2ONKA 2QX8A 4QTZA 3BWYA 1U5BB 1EPUA 3FWNA 2QJRA 3JALA 3LBNA 1COWA 2K7ZA 4XIJA 1DTSA 3MGCA 4G5RA 3R7FA 4X7BA 1FDOA 4H7JA 1RTKA 2B82A 3A3OA 1R5BA 5JCOA 4PO1A 1HA3A 3R8CA 2V3WA 5SICE 4DWJA 3BMNB 3Q0EA 3ZE2B 4TMVA 1CDEA 1XWIA 4G26A 5IRCD 1UK9A 1K88A 2EXXA 4EFLA 3LFUA 2V7EA 2GZAA 2RGAA 3EVTA 4PCUA 5ALZA 1Q57A 2CFCA 4ZTBA 4EHDA 3B78A 2P6RA 3OESA 3O93A 2CKMA 5FAXA 3N53A 3H0KA 4IXWA 3MXTA 3ZVKA 2XMRA 2A3NA 3H5LA 1D2GA 3P45A 3HXLA 1IJEA 3UXHA 3K71B 4PM4A 5IU6A 3B7PA 3ESRA 4RZQA 1FBNA 1NVWQ 3PHJA 3QMWA 3D59A 1R9JA 3HUFA 4N41A 5EJIA 5CLHA 1KS9A 4INAA 1RZRA 2B21A 2AF3C 2A59A 2FSVA 4OFXA 4ALKA 1OQAA 2RHWA 4KQIA 1GG2A 3C8MA 4QPZA 3S2GA 4X60A 3TCXB 5LMNB 2YV3A 3LCUA 4JBNA 2EL9A 3P5BA 4OHKA 1J00A 1GNSA 1OTHA 4EYSA 3D7MA 4IDBA 5GV8A 2GHTA 3ZZNA 5LQRA 1EA5A 5ERXA 3KQOA 1I4LD 3AG6A 4LNAA 5JSHA 2FP4B 1L7MA 1MW9X 2VHZA 5I3ZA 3SX0A 1QU3A 4K26A 1WQ3A 3SBDA 2JD1A 5FT9A 2E5FA 4KX3A 4CR7A 5LYJB 2BVNA 3PA8A 5B3LA 1LV8A 1XJ0A 4MQ4A 1TQ6A 4BRSA 1J97A 3LRPA 3T54A 3BEDA 1LLDA 2JFWA 2HA0A 4WA8A 3VISA 2FI1A 3IEUA 5EJAA 2O7QA 1CP3A 1T9GR 2R8ZA 1HDIA 4PYOA 4YAKA 5AUNB 1CQIB 4S1TA 4Q4JA 4QFBA 4BLSA 4Q01A 2Q3HA 1K89A 1OZFA 2NACA 4LY6A 1AIPA 4EOGA 2PZKA 2P6UA 4BATA 1S2NA 2PV0A 2PT9A 2XUDA 1EVIA 3QU5A 3LQQA 1YNSA 2F3QA 2JB9A 2QN7A 1U28A 2FZWA 3QEOA 5G3ZA 4GXRA 5TB5A 2CCJA 2ZREA 2YIDA 4YC7A 5CVUA 3G6KA 3F9CA 3M9XA 2CJFA 3UM9A 3LWNA 1R27A 5CURA 2ZT6A 4PLCA 5ECWA 4KQ1A 3FB4A 5HZMA 3Q6MA 3WZMA 3UJ6A 1R2QA 3D9QX 4M0PA 4RF3A 3NVAA 3PX3A 4LWPA 2Q49A 2P9YA 3BIFA 5HDQA 4AJLA 4S05A 3THWB 1PX2A 3EZFA 1I3OA 1EWKA 2AEFA 5TVKA 1EVYA 2IP1A 4WZAA 3Q3IA 3TM4A 1US8B 4EYQA 3CUWA 5KREA 4EUNA 2QGZA 3H4MA 3QVJA 4EGQA 5K5EA 3B52X 2V5UA 3SICE 5MDHA 4NVRA 2PYZA 4G3XA 4NJEA 4WPGA 4WWHA 5TEVA 4IVRA 3PC3A 3FRHA 5KTKA 1G5FA 3EUWA 5ECYA 3DG9A 3FCSB 3JTMA 5SZHB 1Y8ZA 1B3RA 1IHYA 3ZNQA 1XRPA 4YNBA 2R8OA 5LL6P 3M1YA 4OXIA 1YVUA 1AUQA 4JP8A 2C7PA 3ESBA 4E31A 1EUZA 1GUBA 2BISA 3MB5A 4MVJH 3ZCUA 2IEAA 2G36A 3E2PA 4GKAA 3BHJA 1ABFA 3DBLB 2WG1A 2JCGA 1SOAA 3AF3A 3MPUA 4GL4A 3L41A 1X9HA 4H0CA 4V0LA 2QRVB 3IAAA 3DHNA 2QGNA 2O3QA 2W00A 3TXYA 3VUFA 1RWVA 2V6GA 3EEBA 4KR0A 4C0AC 2D2XA 4DLAA 2JBAA 1IY0A 1QS0B 1FMLA 1XF1A 4QLAA 3S99A 1BTOA 1V1MB 621PA 1TECE 3OE4A 3PU6A 5CVCA 5D3ZA 5LN1A 4D4MA 2Q1WA 2QJWA 3TZLA 5KZMB 4CEJA 2FW8A 2C3UA 4JEIA 3TZKA 1FXUA 5G02A 4X6UA 3LUJA 1VI5A 1NV8A 2BDEA 1JAHA 2FUG6 4ND6A 5IVPA 4LIPD 5DHAA 1VKOA 1WM1A 5DCYA 1NNEA 1QV9A 4RANA 1FPMA 2H5EA 3IBSA 5JD3A 3IKVA 5ES3A 5KINB 3V8MA 1Z2AA 4C0JA 2QVYX 2W43A 4DR5B 1N2IA 4YJKA 4ZO4A 3IPCA 2BHRA 1O6FA 3TX6A 4ZT6A 4B6QA 4LF6B 1EQUA 1IOLA 1YZYA 2B6HA 4HBGA 4HDSA 4Q9NA 1E5XA 1SUWA 4DVJA 4F5ZA 2YYAA 3GC6A 2PVPA 2A9KA 4DSUA 4UUPA 4N3CA 1KMHA 2B7LA 4Q3KA 3HLTA 3EGCA 1H22A 3K5IA 5I4CA 1PD0A 4F84A 1MBZA 2CC2A 2QUAA 1M1UA 2G1KA 2R8BA 3ZDZB 2JIZA 1O95D 3EWNA 3GRPA 2XUPA 4QHSA 1VJRA 4RPKA 1SKBA 1KAOA 1PFGA 2GJ8A 2Q1XA 3FGZA 4IG4A 1VG8A 4WVLA 1CR1A 2A92A 3VO8A 2YVLA 4JCCA 1NI5A 1VYTA 4FX5A 3RJ9A 2I3ZA 4MQFA 1ZUNA 3OKFA 3OPMA 3RYFB 3VAYA 4JI0B 3OE7D 1I2DA 5EJ8A 4NF2A 3LLVA 3IJRA 3TW0A 1OV4A 1W29A 2X76A 1UKZA 2CBZA 3PJFA 4Q03A 1H9CA 2H5IA 3OZRA 4DC1A 1GNLA 2DLCX 2HGSA 4D4LA 4O8CA 2J9GA 1C41A 1VPDA 2YMPA 2AE2A 3C87A 4HQFA 2O0MA 2RHOA 3TAUA 2I4NA 3EW9A 3I0MA 5KYXB 2NXEA 3KSZO 4E03A 5B3JC 1M0TA 2JFZA 3NBKA 3HSYA 4NTZA 2OBFA 4RM3A 1QSGA 4GF5A 5G0VA 4AZSA 5IXJA 2Z4TA 2JCYA 2YY5A 1CUXA 3QU7A 4RPHA 3I45A 5AKXA 3OLQA 1A7UA 1JZQA 4NJMB 1X7WA 1MOSA 2AC2A 2H8GA 2M9MA 3F8TA 3VJRA 4TTIA 4BJ6A 4C6SA 3L1KA 4AECA 2IELA 4UM9B 1W93A 2O23A 3N2GB 4LQLA 3U0BA 3SC6A 2RGXA 1H23A 3QHQA 1WXEA 5IBRA 3WIEA 2VZ8A 3IEPA 1CS0B 3KOWA 1U81A 4EVSA 1KDZA 3CH7A 3WQSB 4HZUB 4F4DA 3GD5A 4TQAA 2ZG6A 4YECA 3NC1C 1X70A 4ZANA 3WICA 4NLLA 3V3TA 2WMNB 4ARZB 2Q99A 3U44B 4BEWA 1KR2A 2X86A 5DTMA 3JQPA 1CB0A 4H6PA 1VYUA 2B30A 3EG5A 4FOSA 4RE5A 3VX3A 1TTPB 2YJGA 4UAGA 3GLHB 4HJXA 5HILA 1CNEA 2CNLA 1SXGA 3A3YA 2VDKB 2NMVA 1SIOA 3WQHA 3TZBA 1GSOA 2V58A 1EWTA 4HUTA 1NXWA 4HOYA 4I1PA 2ZU6A 1Z4NA 1KMNA 2BFFB 2ZIAA 4A10A 5CG1A 1SZJG 3DZBA 4RD0A 5T5QA 4YV0A 2H4YA 4B3JA 1NOIA 2WJHA 4BU0A 2HDNB 3ELBA 5B36A 4D4IA 4HSGA 1FUUA 2QTBA 3OOJA 4RQUA 3NWOA 1P1IA 5AIBA 1FYDA 1WMBA 3R3YA 4N3GA 5FPPA 5K8JB 2IXAA 4XVCA 4RIGA 3NAZA 1DVRA 2Q8NA 1NP7A 3WWCA 1M2KA 2WTAA 3IIIA 1N2CE 4DMUB 2R751 3D02A 3RODA 1PSWA 3LHFA 2HIGA 3UQZA 2ONJA 4XPIA 5AVWA 3NDJA 3RC1A 4OA8A 1QGDA 1K68A 2C88A 4Q3DA 3BIOA 3RRMA 4XWGA 3L0BA 5KJCA 3OI7A 2IIVA 3JD3A 4BKQA 3AY0A 1K9VF 2FPPA 3I4FA 4G1UC 1K7YA 4M8SA 4PYMA 4UPVA 2F64A 4YJHB 2WFLB 4GBED 2Z1MA 1I7DA 1R8QA 3H4VA 5HUHA 3RWMB 2YJNA 5EJMA 1Q3TA 2ZLBA 4A6DA 5C5DA 2Q0SA 4RF4A 4XJXA 4DQVA 3KWMA 4S24A 1TT5A 1GLVA 2PTGA 1UQUA 2XMZA 3L6UA 1CF9A 1XQ6A 3NV9A 2A1IA 3NHSA 4RK1A 4W1PA 4DTIA 3HK2A 3KQUA 4B31A 3NXSA 2WILA 3WGTA 4OMFG 2ZUDA 3ODPA 2B8NA 1JH8A 1EK0A 1RXCA 2VWQA 4EECA 4LGYA 4HWTA 4BVJA 1GZ6A 4KSCA 3H8WA 4UTPA 4B4UA 1UDCA 4YRZA 1FW8A 5JHGB 1OLOA 4HLCA 1BH6A 2FMXA 4YXWD 5IJXA 2GD2A 3K1ZA 4L3WA 5EKUA 1E3MA 1S02A 5JNVA 1BXZA 2WPNA 1FLNA 3JQ8A 4LWQA 4XQ0A 2QLTA 3DBOB 1HLDA 2JD2A 4ZREA 2A4KA 3H04A 3VR3D 4UTNA 3F8SA 2ZIFA 4TXMA 4DKXA 4L8YA 2DKFA 4HP8A 4ZAFA 4JI5B 1IMOA 4MR9A 1JSXA 3P9KA 3TDNA 2QBYB 4K9LA 1MX5A 1G6Q1 1TZKA 4NEHB 1BIFA 2CHQA 4M37A 2OB2A 5DP2A 3HCAA 1QTNA 1U2QA 2WJ6A 3RS4A 4ALJA 2R79A 1YQDA 5H7XA 3MSXA 1YS6A 3ZXXA 4CE6A 3F3SA 3B1ZA 1SWVA 1V11B 2J6CA 4IDEA 4KQJA 4URHA 3SHQA 1ENYA 2IYPA 1DQSA 2LKCA 2WAYA 1N4AA 4DZTA 4OAOA 4YP7A 5K0JA 2GM3A 2HW8A 3BXFA 4C7OA 4DBLC 1EGAA 4CKEA 4KQGA 5BT8A 4BVEA 1XZLA 4K9RA 1T43A 4G0VA 1FDRA 2XUOA 3LNCA 3CZMA 3MGBA 4DABA 1E59A 1W2GA 3FNRA 1XU9A 1GPDG 2Q4DA 3I3OA 2GQ0A 4TTPA 2ZIWB 4JDUA 4M1SA 3M4ZA 3I4CA 5NULA 1IHDA 2PQ0A 2DWOA 4P4TA 3KZVA 4OJNA 3K94A 4GNRA 3ILHA 3VU9B 3PQFA 3L6DA 3ET4A 2QVLA 4DNPA 3UUWA 5EXTA 1QIFA 1C7JA 2YRWA 1IY9A 1I2BA 4NFYA 1VHJA 3HO1A 4DSAA 1OHHD 2P2SA 3LDUA 1T5SA 2QXTA 1Y8AA 3PWZA 1ACJA 4IQGA 3QYPA 1PEKE 7ABPA 3I5XA 3HWRA 4MVCA 2VUSA 2WHRA 5HXAA 2VLBA 3CUUA 3STXA 4CLDA 1GEGA 1XDBA 3RBAA 9LDTA 2O19A 2YR0A 1NBMA 1LA2A 4WLFA 5I5GA 2W8BB 2D06A 3FYSA 2HIAA 4M6WA 2PX6A 3KWFA 5ADWA 1N2OA 2WZBA 5DTJA 4DR1B 5BVHA 1KJZA 1S1CA 2C5SA 2FOLA 4QUIA 4JKYA 2Q6IA 4QREA 3TRFA 1DCTA 2DMRA 5BNTA 2MSKA 2ZS9A 2FN4A 3D6VA 1B26A 1YAJA 1WB5A 3AF2A 1YQQA 3PHCA 4J2TA 2BFWA 1FFAA 1D4AA 2FK8A 2VWGA 1NF9A 3M82A 1RADA 2CNNA 2ISSD 1EBUA 2R6FA 3MWDA 3EVFA 3U1TA 2CKDA 5CVVA 3MQFA 1EE9A 3O4VA 1VSBA 3QUQA 5IDYA 5GJBA 3DAGA 4WZ6A 3EDCA 1E96A 2H51A 2E85A 3OETA 1H1LA 4RTQA 2CXOA 1N2HA 4PYQA 3KJGA 3RRJA 3UPUA 4LJSA 2JFXA 4PINA 3DLIA 1KPIA 3LQ2A 3V8NA 1WCIB 1IE3A 1LDYA 4X3OA 3DTTA 1K8YB 1OFUX 5E6SB 5GONB 3A6EA 4BNFA 4I6GA 3JQ9C 1R88A 1Y37A 3EF0A 3GY0A 1L5QA 3H2KA 1PGOA 4CQLB 4KDRA 3TPZA 3SCZA 3LK6A 2HLNA 3RRNA 3GIWA 1FUKA 4KIGA 2ONYA 2O48X 3IILA 5DXFA 4AMUA 1BHJA 5IJZA 1NN0A 5JLJA 1T3TA 5G4LA 4JLNA 4UUOA 4E4YA 3VNBA 1JJVA 3W2IA 2WOOA 4EZIA 5AXDA 4LJ5A 5EESA 3NYWA 1BXRA 4FR5A 1V6SA 3IO5A 4Q4DA 3UXEA 4Q7QA 5HSGA 2FRXA 2EF0A 3LHDA 3PEWA 1N9GB 2WUVA 1KRWA 4C88A 4J1QA 4CV1A 3PHBE 4C4PA 5A4FS 4KR6A 1C9MA 1B3BA 4CIAA 2H2WA 1SKAA 3QITA 1LW7A 3CLHA 4QGHA 2C4VA 4GKJB 4KV7A 1A8QA 3QQ5A 3CCFA 5BR1A 5FO1A 4FC7A 2NO1A 3LA8A 4UEWA 1ZBDA 2KBEA 3IODA 3HKEA 1PV2A 3ZY6A 5J23A 2UVPA 2VDRB 2Q0XA 4G8DA 1VFNA 5J59A 1VIYA 2B2NA 4AULA 4R0NA 5FWNA 4R54A 1CP2A 3FOCA 5SZKB 1YL6A 2EP5A 3PUWA 4UVDA 2CEAA 4HQ6A 2OTCA 4ZQFA 3GR6A 4ZVMA 4CMBA 4TV8A 4J7UA 5SYNA 5IULC 4G0NA 1OY1A 5GZ1A 2OGSA 2XRZA 3HZOA 1D8TA 3KU4A 2VK4A 2F3UA 4HADA 4RL4A 4X90A 4BN0A 4R7TA 4EJSB 3G1TA 1E4VA 2H54A 3IYLW 3NYQA 2Z30A 1XA4A 4F04A 4XD7A 3LDAA 4M9UA 2AG0A 3UMYA 3ND5A 3UH1A 2PH3A 4CFSA 3HKDA 5G1OA 4A7PA 4JN6B 3DLAA 1P7YA 3FOEC 5AK6A 4RIHA 4B33A 2ZUFA 1FRZA 4IIDA 3SBXA 1EZZA 2VZLA 3OKPA 4D4KA 1K3UB 1M2EA 2D5IA 3CHYA 1GP2A 3E2IA 1SEPA 3NT5A 1MA3A 5DM2A 4AYWA 3C70A 5M7EA 4UC0A 1RKUA 2X22A 4I1UA 1I7SB 2F1OA 1NVXQ 2MYTA 4JENA 4MIEA 3ZS8A 1QIDA 1QVZA 3R9XB 4WA7A 1D6MA 1YS2X 4AB1A 5BPFA 1RW4A 3WVNA 5EZ6B 3NV7A 4AUNA 5DFAA 3RC3A 2P2GA 2ASVA 1PF7E 2C4UA 1G2OA 1EX9A 2E18A 3EG9B 3FGOA 3KXLA 5TMPA 4G0UA 2PLFA 4WCFC 4MGKR 5GP1A 4I8XA 2XTMA 4F1KA 1G7RA 1VG1A 5JS6A 3ZWWA 1G0OA 4XIYA 2NUTB 2BTEA 3D1LA 2VVTA 3GK3A 4HEQA 3ZYCA 1SH7A 4HPWA 1XZBA 2C9ZA 3K0KA 1LWNA 3OIDA 3PWTA 1L7VC 1XTUA 1NATA 2ZAGA 1N8NA 3K30A 4QD3A 4WOKA 5IJWA 2NZJA 1HGXA 3ENNA 3LPLA 4KYUA 4TSFD 4EABA 2NSHA 2NVWA 5H3LA 5JZMA 1KA9H 2WABA 3KVRA 2OV1A 3K1TA 5I9BA 1W85A 4N5LA 4EG4A 1N2BA 3QNWA 3L46A 1KHTA 4WK4B 1OILA 2VC2B 4OSEA 2IZ7A 2OCBA 5ELLA 1GZVA 5TRTA 3WOHA 3ZH9B 4BQIA 5BSHA 2C29D 5KQSA 1ZK1A 1HX7A 1PKEA 1WV1A 4CN9A 2IUSA 1BRMA 1NQVA 1S9DA 1ZX1A 1OXXK 1J5EB 2FG6C 1Q7GA 3IELA 4ICIA 4BFLA 2WTXA 2XTAA 3OJ0A 3PIDA 1G63A 3PLNA 2DKOA 3G8CA 3BB4A 3ISVA 4WLNA 4DHEA 1M8KA 2YFHA 3MHPA 1I32A 4H60A 2WYHA 1NLFA 2QV7A 3PEYA 2Z08A 4XGQA 4C7KA 1M0WA 1IY2A 1S2LA 1GGMA 2ZB4A 3G02A 1UDAA 1LWOA 3EGVA 4YDSA 3J7TA 4HO1X 3N3BC 5GOTA 4IKPA 5IKEA 2GBIA 1Z36A 1YTUA 3TQIA 2C94A 2QAGC 3IEIA 4UE3S 3WYAA 1LUAA 5LR6A 5FUQA 3IQHX 5CRIA 3ANXA 1TUBB 1E63A 4QBGB 5BN4A 4CU2A 3DBVO 1DRKA 4B6EA 2FE4A 1SVSA 1XBTA 5ARCA 1S4QA 4U2DA 1V9LA 3L8MA 4ZODA 1LX6A 4ZV4A 1FNCA 4MPPA 5D7BA 2OFXA 3KALA 3IIJA 4TWAA 4C0KA 4KQ2A 1U3TA 4AG5A 3CW2A 1CY4A 2UVDA 3FFTA 3K8OE 4ZVPA 1SY7A 2HK7A 2UYGA 1LD3A 2QZJA 4NOLA 3R3ZA 2OAGA 4QAQA 3BFKA 3JCZA 3N2ZB 3ZR4B 3PC6A 1YA4A 3WSWA 4REQB 5FOUA 2QMQA 4PLWA 4X24A 1CUZA 4OY3A 4HLQB 1XKQA 5BUSA 5TJHA 3U2QA 2R9VA 3FJ1A 3R5HA 4FGJA 4MV6A 4D44A 1SHZA 1QYIA 4HS4A 3G2KA 4BMSA 3QJYA 4YAJA 5HJ2A 5LDHA 4N0MA 2Q9BA 4MHOA 5HGXA 3SQDA 3BGOS 2RBEA 1RCFA 2PZJA 3CRW1 3H8VA 1MZVA 5BQOA 3TCKA 5GJCA 4CU5A 4AD8A 3LTEA 3UH0A 4EY8A 5JC8A 2GN8A 4TMKA 1RCUA 1CLEA 2ZIUB 4N8SA 1V5IA 2QTHA 5L53A 2H2AA 1NRJB 2R96A 3Q85A 2P4QA 4HWSA 5DWDA 2XOXA 4YXFA 4LDPA 1V6AA 1HO3A 4OU4A 4CIDA 2Q5CA 4JROA 4CM8B 2NVBA 1QF6A 2KHZA 5ALKA 1G5HA 1MQ9A 1PFWA 5ALQA 2MIIA 4XKJA 3ZXYA 1R74A 1MJNA 1CUHA 1D2CA 1XDZA 2ZRJA 5D5HA 3Q7QA 1XJQA 4GBMA 2OVBA 2CL0X 4HRXA 4I0WB 5E9JA 3SLGA 3WGGA 3WSTA 2P5SA 4LNUA 5T41A 1USUA 2C5BA 3R20A 1JWBB 3CR3C 4ME6A 1TRKA 2EFYA 4MROA 2RGUA 2OMKA 5H4HA 4EY7A 4PZAA 4ZO9A 1U6JA 1KYWA 1X7ZA 2PUJA 5CA0A 1P2BA 4FIDA 4J0HA 3TW8B 1Y6GA 1XNRB 1RXIA 5H83A 3UHAA 3LVRE 2BUBA 5CYOA 4EPYA 2FWBA 1ML3A 1WMFA 3O0DA 4H2DA 2GXAA 3T9EA 3WA7A 3UJCA 2JLAA 3OTHA 3ERCA 2QL5A 4RTPA 1ODJA 2W48A 4CKWA 2PWZA 3L7BA 4FW8A 3RAGA 5CB4F 1BS1A 1V6CA 4OFBA 5JCXA 3LQKA 4BWFB 2PL9A 5BN3A 1HNNA 5AVYA 5AI4A 2XJ4A 1JDJA 3LGXA 3ZWBA 2HF7A 5EXEA 3TJMA 3W5IA 5CT6A 3AX6A 1KSHA 2GRUA 4HZGA 4U2KA 2I67A 4PCAA 1Y8RA 4EG3A 1ZU4A 3MOIA 3OVMA 1G18A 5DX8A 2OXCA 2Z2KA 4EQ6A 3W3AA 3IQGX 5BYBA 3UG7A 1XVLA 3N6VA 4JOCA 4O2LA 4RQBA 3TMKA 2WD7A 5M34A 2WB4A 4J8PA 3RB8A 2ZIZA 3DBRB 4MA5A 4P7FA 4YIKA 1ORDA 3THRA 2F3SA 4NG4A 1M2GA 1XHEA 4IAOA 3LBFA 5GJWC 1EP2B 2NU9B 3IR6A 3OO1A 4D96A 3C4JA 4PLGA 4R2JA 3DCJA 4DDHA 1JVNA 4A8TA 1KEPA 5HK9A 3CXUA 4RJLA 3F49S 5DBIA 2D8AA 3T1TA 1A5ZA 3G7NA 3QVOA 1I13A 3KT3A 3UAOA 2ZYVX 1K3FA 3WHKA 5KSZA 4XVQA 4H6WA 4LYYA 3F71A 2O50A 4OD0A 2BP7B 2IYYA 3CNHA 1FJXA 3RYHA 1S2IA 2APJA 5C4GB 1US8A 5CXXA 2FW9A 1MR3F 1KI1A 1OXSC 2Q6LA 1ZXBA 1R0WA 4HD8A 3K1AB 3NNNA 2FGKA 4MUXA 4UU0A 1T9DA 5AJYA 4ZQGA 5F52A 4UEJA 4CJXA 3ADKA 1W5TA 2XVXA 3BB3A 5LQCA 4C1NA 2Z2YA 3KDAA 2VDNB 2VPXA 1EE1A 2ZSEA 4C78A 2WR8A 4B3TB 1G9SA 1TEHA 4QE3A 3KZNA 5AK5A 3GFFA 4CLXA 1MB2A 3N0VA 1AHHA 2ZJYA 3GWZA 4TTSA 5G0SA 4FUQA 4CNBA 1TVMA 3JYOA 5HQ3A 1V45E 2XCRB 1Z4KA 2BR5A 3ITNA 2YWCA 5L7TA 5JCJD 3CPSA 1NG1A 1RWBA 5D85A 1GU1A 3MBIA 3OCJA 1PT5A 2HB6A 3EDMA 1REQA 4YRCA 3SIPA 3TZ6A 1Y82A 4EGAA 1U02A 2BHNA 3NHLA 4V0QA 1ISFA 3HFJA 5A0FA 4PCVA 3GZTB 2WVJA 4LHVA 4JP1A 3RDPA 2K2WA 3WYCA 1A1VA 1LH0A 3B36A 4YJFB 2YJ3A 4K6FA 4I3GA 1V3TA 2QR3A 1GKUB 3RSZA 1JWAB 4LN1A 1WMDA 1FQJA 2Q2WA 4OUKX 2F3RA 3NIFB 1BDMA 3GAFA 5LDDC 3NEPX 1DC7A 4D74A 1H6AA 3TGLA 3KV3O 3K4PA 5FNVB 1Q7EA 2VPPA 2A0WA 4XB6B 1Q3HA 4JBIA 3ZWMA 3A27A 2GVDC 3OCVA 5K0LA 5JAZA 4GP9A 1DJNA 2FMTA 2M1ZA 1DDIA 1IDN1 4XGNA 3SSMA 4ZWNA 1QWOA 3U3XA 4GKKB 2BGRA 1JYEA 1T5DX 4RQTA 1XTTA 5F5NA 1GU0A 3DE0X 4B3HA 4C4SA 2FWRA 3AOEC 4MGEA 4DRZA 2GO7A 4JXKA 1J70A 3PK0A 1JHRA 3W6ZA 2PFGA 3TLMA 2XNHA 3OQPA 4G1EB 4Q82A 1JG2A 2V7XA 4ID9A 3NVKI 4YLEA 3BAFA 4B9EA 3DVSX 4FHFA 3MJTA 1PJLA 4V3CA 2V6MA 3FDJA 4N5NA 3G0DA 4OQXA 5HOQA 1FXWF 1A9PA 3QVGA 5JLAA 2OD2A 5PNTA 2Y2VA 1LBQA 2EJBA 4D4GA 4RY9A 4BLVA 3A26A 1NR5A 1FIUA 3HBMA 1DG1G 2ZOSA 5A5DA 4TM7A 3BF8A 5HIAA 3PR1A 2O1XA 4MK4A 3VC2A 5DLPA 2HDHA 3OE5A 3E70C 1OBHA 4PLTA 4X1KB 1P91A 3FWKA 3FZYA 3M6WA 3LA6A 4J1TC 3SX4A 2IY8A 4JS0A 3EPKA 1GQSA 1K08A 4LJRA 3OEHD 4BFSA 5LQNA 4KN8A 3ICWA 4MUMA 5EEHA 5K03A 1DMRA 2GZSA 3AJDA 4OFZA 2OQVA 2CSXA 3BMOB 4HYEA 3ZDDA 1PFVA 1BEZA 2RJ3A 3AEUB 3DMFA 4AWAA 5A03A 1MXFA 1APBA 2AMVA 3NBUA 1L8XA 3WLMA 5T7BA 3DT8A 4TGLA 5KC9A 2GF9A 2JAUA 1UJ6A 4GLFA 1UXOA 4Y9SA 4FC6A 3JQ9A 1LSSA 3WB2A 3W5DA 2PBFA 4AZ0A 3U60B 3UA3A 3L8HA 2LNDA 2FZEA 3AFMA 3LCMA 2WU3A 2FPIA 3P1JA 4WKOA 1PG5A 4Y6PA 3ZX4A 5BSFA 5EE9A 3PICA 4PG8A 3GNLA 1G291 1TDJA 2PBRA 3UFXA 1TKCA 1IEVA 4ZYXA 1GQYA 2I8CA 5DNUA 4I5EA 2JJ1D 1H42A 1NPDA 2UVQA 2W2TA 2RIPA 3MBKA 4IEIA 4W8HA 4X9XA 1IN5A 1YUMA 5JSKA 1W59A 1HI9A 1JB9A 3G2LA 2WG2A 1JVSA 2W93A 3SFTA 4CNQA 2ZI6A 1Y6JA 4ZK6A 2WAMA 3FLAA 2QMOA 4M9QA 3U1VA 3JXEA 1GCGA 3HCPA 3SZUA 1J8FA 4B0OA 4IIEA 3LV8A 2PU7A 1OT5A 2WWFA 1TC2A 4CL0A 3T4UA 1SUFA 2IYFA 2NU7B 3RUDA 4YK7A 3K9QO 3D0OA 1IJKA 4YT8A 2XUIA 2YY6A 2C1EA 2Y93A 1GPAA 1YRYE 5JD6A 3LY5A 3KJHA 1TL7C 1JEOA 5C8YA 3PCRB 2W5UA 2PAFA 4KN9S 4I4TF 4K1LA 1NOJA 4URFA 2GTIA 2HRDA 1D1TA 3F78A 1H8ED 3IV7A 2DRIA 3L18A 3B60A 2D4HA 4MP8A 1EWRA 1EFLA 6NULA 2QP9X 1KARA 1PTJC 1RZVA 3H2ZA 2F4VB 4B4OA 1T36A 3IDAA 2H85A 1P77A 1Z35A 4X84A 3JQBC 1J33A 1QZUA 2HLHA 2JAWA 3EXEA 3E53A 4N40A 1IXZA 4QEKA 4B7ZA 2ZP1A 4XXHA 4GR5A 3GXOA 5AJWA 4R8SA 3V4LA 4B6PA 4D3DA 1DX6A 3ELYA 2PX8A 1HQKA 1SVOA 2B4KA 2XCIA 1A2BA 4L78A 4MYTA 1BC5A 1ODFA 1WJGA 5BVGB 1YR2A 2NU6B 5A3RA 4L27A 3TDMA 4DRXA 4B3IA 5C32A 4CM7A 5C5EA 1L6IA 1I6MA 1JEQB 5G53C 4YJHA 5CNJA 1XZKA 3QX3A 2YWJA 3ZVNA 1GQRA 1Y81A 2JRCA 4HWGA 4OQPA 1A2OA 1RXSA 3E6AA 3PI7A 3TW4A 1FS6A 1XD2B 1XAGA 2J0VA 2R1TB 1KAGA 3EMVA 3FKSA 4Y2GA 3SOZA 3E23A 3UUFA 3C3CA 1RAAA 2EZ9A 3OFNA 4X3PA 3W05A 4CV3A 2WHEA 4DQ0A 1GUAA 2F48A 4CM6A 2WJPA 4WCFA 2ZE7A 5CLGA 4CUKA 1VBKA 1AF7A 2J08A 3Q2OA 5EL0A 1CWUA 1AHIA 2W0MA 4FYXA 2CF5A 3E03A 4W1RA 4BRWA 3MGGA 4BUJA 4YO8A 2VHTA 3ONNA 4X6LA 3LVQE 2C7QA 1YT5A 1VDMA 1TUGA 3KQSA 1NUAA 2IS4A 3HU3A 2I29A 1OU0A 4EF6A 5FYDA 5BSTA 4G81A 4TV9B 3WL4A 3BRSA 2IE0A 4NARA 1W34A 1IG3A 5FR2A 3B6EA 9LDBA 5LNK1 4N7JA 3DDWA 4TSKA 4LBWA 5CG2A 4FWBA 4Q9LA 4UQPA 2Y1FA 1K2WA 3A28A 3GQBB 3D4PA 1KJIA 4PX9A 4R05A 4GVPA 4R41A 3A9RA 5BQXA 1D2AA 2PLAA 3ZOZA 4RTOA 1HKUA 4H4EA 3AB8A 5DBFA 5HDBB 3V2IA 3LUCA 1V41E 4BQSA 1EQAA 1YCHA 3KEMA 5KNLA 2UYYA 2DVMA 1DAIA 1U8XX 2VDQB 3PHHA 4B3XA 3S1SA 5CJPA 2O3TA 1YZFA 1NULA 2INGX 4LG1A 1IUOA 1PR3A 2VSYA 3FVRA 1MPTA 1XTRA 2VJYA 3KC2A 2P11A 4L8FA 4GD3Q 4FM9A 1ZG3A 1GYPA 2D8MA 1Y8CA 2ZT8A 3EXIA 1JB1A 1SVIA 4RVUA 4N6GA 1HLFA 3BSYA 2B37A 4X1YB 3GJ3A 3KTAB 4MITA 2Q5FA 3EQ2A 3VZPA 4V1CI 3PE4A 3MYYA 4IFIA 3PQ6A 4YRJA 3QHPA 1J1ZA 2JFHA 3N28A 4Q39A 1UOOA 3O2SB 1MENA 2YMQA 4OI2A 2BRUC 2QAGA 3I9MA 4CFZA 3RBXA 1D4OA 1HXHA 4PIPA 3MT9A 4UDNA 4GR9A 4JA2A 3QY0A 4LJKA 4DIMA 1UJ5A 3GDHA 3OPNA 1UEIA 2BI8A 2AFHA 1UAGA 2SKDA 4LRYA 1K98A 4QBIA 1ATIA 3VI3B 5IC4A 4Q21A 3ZW9A 2HJHA 2YJTD 3TTYA 3JWEA 1PQ4A 3AF6A 3PQ7A 4OV6B 5D3MB 2W2LD 1AC5A 3CWZA 5JUWA 2FPWA 3HNRA 3ZE8A 2F9FA 1WP4A 3AETA 2YV2A 1ZAKA 3A6GA 3I1JA 2QG6A 4LECA 4MV3A 3OEWA 2WSSD 4MHSA 5IJAA 1J8VA 5JJBA 1OH7A 4LEIA 2W4MA 5DTRA 4MUBA 1LSUA 2HQSA 4MQLA 2YHSA 2VNAA 2IK8A 1AV6A 3ZCRA 4QZVA 2C2XA 3IVMA 3ZDXB 1HYQA 4DSTA 3RVPA 2CVZA 3ZLTA 2PD6A 3TAHA 1BXKA 2R5FA 4CLOB 3M6LA 1QVAA 5LJLA 1F51E 3NBFA 2OFFA 3BGSA 1RXWA 5AI8A 3V4VB 4G1BA 2Q9AA 2DKNA 3BG5A 1VB5A 3L8FA 1H05A 5CH5A 1CQZA 1P5ZB 2C2WA 3JD1A 1QYRA 1HR0B 1XRMA 1I7PA 2HAEA 2G7MC 3W1EA 1TTQB 1V7ZA 3TI7A 3JX9A 3C48A 4L3OA 4W4TA 3QVSA 4K9DA 8MHTA 2X7HA 3HZHA 3PCTA 4HB2A 1KZ6A 4GICA 3TG2A 1SKMA 1K6IA 4LZWA 2Q7DA 1P2VA 3H4TA 4BMCA 2DETA 3WK9A 4XWTA 4BPBA 2BGLA 4ZOLB 4B3GA 1QIMA 3V32A 2UXCB 1YACA 2WP0A 4BIIA 1DO8A 2OGTA 2H11A 3EGEA 3IB6A 1MJFA 4FFBA 2ZTMA 2AEJA 3HVUA 5CJJA 4JAVC 1B7GO 2NUPB 2J6HA 4O0LA 1SHJA 2ENUA 1WCIA 3EQ9A 3PE6A 3PFIA 3SM3A 4Z4HA 4AQ7A 1T0BA 1X9IA 4Y2QA 1N2JA 2W2PA 4NHEA 2FOXA 5EP3A 2EQAA 5INTA 5JS2A 1ZAYA 3NGMA 4PLVA 5FORA 1U8YA 3EAQA 3OU7A 3QKTA 4H1TA 4X66B 1V96A 3JRNA 4J75A 2D5CA 3OPQA 2AVDA 1USGA 5KAMA 3VPCA 3VV3A 1UK7A 3RM3A 1GPH1 4HWOA 1Y3BE 2PUWA 2Q8QA 1N8SA 4BLOA 1EUQA 2H59A 2Q6VA 4KFRA 4DR4B 1DOZA 1I3CA 4DCVA 1YOBA 4RTLA 3KB6A 2GXQA 2ILVA 4H1HA 5KWEA 2X3UA 3RJZA 3A8TA 4P7KA 4XX0B 1OFTA 2F1KA 3O9MA 4XVRA 5HG0A 1X7YA 2C2HA 4RK5A 1W47A 3GFPA 1TFUA 4HS9A 1DIRA 1KQNA 3ZQJA 1QIKA 2WPDA 3GL9A 4DM7A 5JADA 2YKGA 3HBLA 1GEEA 1NQUA 2QLMA 4I08A 2IKSA 4QNNA 1YHNA 5CM9C 4YRSA 1T1GA 1KORA 3C6BA 3DS8A 1GZ3A 4FQ8A 4HEA1 3S3TA 4Y2XA 5ITZA 5EQDA 2LP4Y 3I2IA 3SK0A 1FFGA 1OAKA 1ZVJA 3K9HA 3C3BA 3GFVA 1P4SA 3K6SA 4KE6A 1AZWA 4J43A 4O2BB 4R84A 2PH7A 5JTTA 1ZVKA 1H2YA 1YZUA 3HS3A 3CXRA 3RWBA 1Z0KA 1QO9A 2C2BA 3AR9A 2HC9A 4G97A 4HXYA 4OGFA 4ZQHA 2BUAA 5KYYB 6GPBA 1NW8A 3HI4A 1ZGZA 4PPQA 4R1NA 1J7JA 1UM9B 3BDAA 3DYIA 4R1MA 1L5VA 4ZO8A 4RC9A 4JI7B 2Y8EA 3EZ9A 2ZR9A 1JA9A 4OHBA 4XGKA 1NVKA 4FX2A 1E61A 2CV0A 4HQOA 4PXAA 2ZWAA 5I9SA 2F43A 1JJBA 2R00A 4ER7A 1BHO1 4G1FA 4L07A 2XVYA 2OZPA 2YQ4A 1CUWA 4GPAA 1T5HX 2I99A 4JQYA 5EVCA 2R84A 2C7OA 4B47A 4LBZA 4N1AA 1GZ5A 2AQKA 4L4SA 3VNVA 4K1XA 1FTSA 1VYVA 3E1SA 3H3XA 3SSAA 2C42A 4JY7A 5HVNA 2B4AA 4KE7A 3ZCQA 3ZDFA 1E3IA 1HT1E 3ANSA 3HA5A 3OCWA 5AKKA 4ZI7A 3LPDA 1RYYA 3HJHA 4HRAA 4K9PA 3FTDA 1MVLA 3G7SA 4LRTB 2XV1A 4MWTA 4CM9A 3U4GA 4Q3OA 3DBIA 1SC6A 4FLEA 3LYUA 4YFYA 3FIJA 4RJIA 1O6GA 3BN3A 2VYCA 1GPKA 3EZLA 2G88A 4QDTA 2A14A 1RC1A 2EV9A 4RLSA 4RPIA 2FHPA 5CVJA 3MUFA 2CZCA 4TQ9A 2QY9A 3CB2A 3ZNPA 4B09A 5CBKA 1Q7RA 3GBPA 3OZDA 5KYUA 2WM3A 1IJBA 1SOMA 1TO6A 2VRWA 5SZJA 4NPCA 1NBEA 1CSEE 4FFPA 1N5IA 3P4XA 1U2GC 2P5YA 4ZN6A 2AKYA 3OOYA 3OE1A 4HH3C 2QGFA 1RKBA 2CXUA 2XBMA 4WJZA 3HYCA 3W4JA 3K8QA 3AOEA 2GA9A 3E22A 4JP3A 1SU4A 1F7UA 1U9IA 2ZUUA 3W8EA 5F51A 5D86A 4DV1B 3QX8A 2XGMA 2QYSA 2HSWA 2V0GA 1Q0HA 2ZKIA 3RAPR 5K8TA 3E5RA 3OY7A 1C4KA 5CHEA 4AO7A 1PYDA 2WHXA 3B2EA 4B73A 3I9KA 3DTVB 4F45A 2AKAB 3KYCA 3AUKA 4PXSA 3O84A 4GLJA 1C3LA 3M5CA 4HX5A 3IXLA 1Q19A 3MAAC 4N76A 3K1YA 3LWZA 3QEJA 4BO8A 1WQ1R 1K0UA 1JA0A 1H9BA 2QLJA 4BXOB 4XUCA 1BWQA 1L1RA 1ZCZA 4GPZA 5ARBA 1HURA 2ZB3A 3FWZA 4J1TA 5BQ3A 4K3UA 3E9YA 3C3AA 1EDZA 1AVTA 5DIZA 1GV1A 1I4WA 4PSAA 5HIIA 5EA2A 2FU5C 2C99A 1Y63A 2QIPA 2YV5A 4B4DA 3OKAA 3OC6A 5KDOA 1GA6A 4LOAA 2PBZA 1KK2A 1VGQA 2OKGA 3RK0A 1GA4A 1RXYA 3RKSA 2QRJA 4G25A 1A1SA 4LY9A 2QSJA 1MFZA 3OHSX 3IXMA 1HZZA 1ZMOA 4E13A 3B3GA 3C4VA 1IY1A 4URUR 5FI3A 1N6NA