2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
1BRTA 2PU5A 4J0KA 5AM0A 1EDEA 1Q0RA 3E3AA 2YH2A 4Q82A 1DT5A 3LIPA 1CUFA 2OGSA 3L1HA 4W1QA 3TGLA 5C7YA 5AO9A 2GYUA 3VVLA 5CURA 2WHQA 4KE8A 2DFPA 1ZIXA 3KD2A 3CN7A 2J3QA 3O9VA 2ECFA 4QZVA 5AKXA 2VT6A 5JZ9A 2QM0A 2Z3WA 5ALTA 3BJMA 2Y2UA 3KDAA 3G8YA 1XLVA 2Z5GA 4B85A 1J06A 5IVIA 4G9EA 3I6MA 1A88A 5AOAA 4OYYA 4AO6A 5I9IA 3WIOA 1B6GA 5KWIA 3V48A 4BZWA 3D2BA 3OM8A 4Y2JA 4IQ4A 1E8NA 1DWQA 4N8DA 1GXSA 1P0MA 2YXPX 3D2AA 3A70A 2H7XA 1X70A 1NU6A 4B0PA 5I8PA 5DLPA 3QITA 5ALSA 4E14A 4YPVA 2XMCA 1XRNA 4C4ZA 1JMKC 2Y6UA 1GZ7A 2C7BA 2WFMA 1QONA 1CLEA 3V1LA 5IVKA 1YA4A 1Z68A 1QJ4A 5HFAA 3IB3A 5K5EA 4Y2QA 4C6HA 3G9XA 1CUSA 3B5EA 4EY6A 3R3ZA 1UOQA 4KRYA 1JJFA 2WUEA 4ZWNA 4UPDA 3AILA 5K3FB 1QGED 1C4XA 5EHXA 2C4HA 1H2WA 2D5LA 4DNFA 4DLNA 3O4IA 5JIBA 5ALWA 5D7BA 1IUNA 4QDUA 3EBLA 4KE6A 4QNNA 4FTWA 3DLTA 5AI8A 4JYMA 2C0PA 4UFNA 5KWJA 5ALUA 1MAAA 4KR0A 3SX4A 2XUAA 4H0CA 3EQ7A 4IHAA 5ALGA 4BCCA 4UBOA 1QIDA 3VJLA 3GZJA 2WIJA 3TEJA 1CUIA 4K5QA 3GROA 2B20A 4AX4A 4EUSA 2E3JA 5AH0A 3F97A 1SC9A 4Y2XA 3FNBA 2HA5A 4BATA 1GKLA 4B6GA 4OPMA 2J4CA 1Q84A 2WUGA 5KREA 4OB6A 2WUDA 2JF0A 2VJAA 4PNZA 1WPRA 2VJDA 5K3DA 2Y6VA 4Y7DA 2WIDA 3RLIA 3VJKA 5BOVA 4H7IA 4QDZA 4J0JA 3FVRA 2ZJ7A 4QDXA 1WHSA 1WCYA 3VISA 4X94A 2AJDA 2OQIA 1R9NA 2B4KA 1YR2A 3G0CA 3K6KA 4HXFB 3FYUB 1UFOA 1FFEA 1LBTA 4F5ZA 1XZDA 4EY7A 2HRQA 1E5TA 1P0IA 3F9CA 3KWFA 4C4YA 4P93A 3QPAA 4WY5A 5DTJA 3DKRA 3M3DA 4Y2UA 5CW2A 5FV4A 5FOQA 1MX9A 4UFPA 4LXGA 1XZCA 2RI6A 4DTCA 4L0CA 3BDVA 1LPOA 5JAHA 4Y2RA 1JU3A 1G42A 4HAIA 4FBMA 4X71A 4KE7A 3DNMA 5D6OA 2XUFA 1ODCA 4W1RA 3STWA 4AB1A 4B81A 5AI0A 1O6GA 1IZ8A 1XKTA 2HU7A 1LPBB 1VA4A 4JUIA 1R3DA 1CRLA 5IKXA 1EX9A 1SCIA 3M82A 2OQVA 5CRIA 5JADA 1QO9A 4M0EA 5HF5A 5ALZA 1UKAA 4DMFA 1EH5A 2GBFA 3WKDA 4AZ0A 4PF1A 1XRRA 5LZ2A 2XMZA 4QE3A 1UWCA 3WA6A 4UBKA 5A7GA 3WKAA 4K2AA 3RARA 4X00A 4UBIA 1VXOA 2O7RA 5BV7A 1AQLA 1H23A 2WQZA 5LZ9A 4DSZA 1ORWA 3A2MA 1Y37A 1HPLA 4OB7A 1VOTA 2WKWA 1I6WA 1ZOIA 1XROA 2QUAA 1GQSA 3O95A 1EB9A 4AN1A 3O4HA 4Y2SA 2QZPA 1XZLA 5AK5A 5FPQA 4CCYB 2AJ8A 4MYDA 5ALFA 3DOIA 3KOOA 4BTVA 1RYYA 3OPMA 4CFSA 3C6BA 3DDUA 3JW8A 1LPNA 4BBZA 4G8DA 2HA7A 4YASA 4ZV7A 1GT6A 1YCDA 1E8DA 1QIHA 5K3EA 5EFZA 3HZOA 1CEXA 3TRDA 2ZYHA 2PBLA 3WI7A 3BF7A 3KSRA 2K2QB 3E1GA 2HA2A 3BIWA 2XUPA 2WLSA 3C5VA 1E66A 2HU5A 1ETHA 3T4UA 4DIUA 1THGA 1UKBA 2BUAA 1VLQA 2HIHA 4BC0A 3STVA 1ZD2P 4J7AA 3G9ZA 5EHZA 3WK9A 5CBKA 3HC7A 3CCCA 2EDAA 2RAUA 1SCQA 4QDOA 3EQ9A 1W52X 1QO7A 3K9BA 3QH4A 2W6CX 6YASA 5ALEA 1AC5A 1GKKA 4J0HA 4F60A 2PM8A 4LYEA 1DWPA 5HFNA 5ESRA 2V96A 1UT6A 2GYWA 3M83A 4CIBA 3IURA 3D2CA 3R0VA 1DT3A 1VXRA 2PVSA 2DCMA 5ALRA 4UUQA 5JATA 2WU3A 1UK7A 1KEZA 2XMRA 4X93A 3R3WA 2H9YA 3OOSA 4Q34A 3SC2A 4ZGBA 1VE6A 3R40A 4UHBA 3C8DA 3ILSA 4UBLA 5JAUA 1XZBA 3WKBA 5AKEA 3R3UA 3HI4A 3IUJA 1FFAA 2XQJA 5E4TA 3JYHA 3C45A 3ANSA 4KRXA 3F98A 1QOZA 4KYVA 2Y1KA 4FLMA 4B7ZA 1XZJA 2WUFA 4UHDA 2CJPA 3W04A 1FFBA 3QPCA 1UK8A 2D0DA 3A2LA 1DU4A 3H19A 5CH3A 1TCAA 1MT3A 3AFIA 3AZPA 1GPKA 4RE6A 3VXKA 3AUKA 5JALA 3WZMA 4U2FA 2GBIA 1NX9A 5JD6A 1VZ2A 4K6KA 2O2HA 4AO7A 5LYYA 3G0GA 2XUQA 2CB9A 3C70A 4MEAA 1HL7A 4V2IA 4G8BA 3W9BA 1QTIA 4FNMA 3D59A 1CUVA 4W9RA 3GELA 2VT7A 5ALOA 4G4GA 2FJPA 1K4YA 4QWMA 4W63A 4ZI5A 4QA9A 1BU8A 4KACA 3EQ8A 3OC0A 1CUEA 2HM7A 4H18A 4PO3X 4X85A 3HLKA 5JAOA 1YS2X 1PV1A 1R88A 3I2FA 2WJ6A 3I2IA 5JD4A 4B83A 3DKKA 2QXTA 3C5WP 4AO8A 4H7KA 2JGEA 2NW6A 1WB6A 5HQ3B 1W4LA 2DSNA 4N5IX 1EA5A 3E4DA 4HVTA 4JYPA 1PJAA 3WJ1A 3QYJA 3FSGA 1FFDA 2LIPA 2RIPA 4BAZA 4BCBA 2XQIA 3OURA 5SYNA 2PUJA 4QLOA 2G4LA 2VA9A 4BVJA 1XLWA 3G0DA 1U65A 4MEBA 1RWQA 5ALPA 2RHTA 1LBSA 1XZGA 5CT8A 5AKHA 4E46A 1P0PA 3PF9A 4NVRA 5C8XA 1UOPA 4MQLA 1FJ2A 2CKMA 2OCLA 5DTIA 4YX9A 2HHAA 3WL8A 3WYNA 1KU6A 2GBGA 3PDCA 4FNGA 4PQEA 1FSSA 4EY5A 1KU0A 2WFLB 3Q8WA 2WTNA 5HF8A 1CUYA 2V98A 5KBYA 4KEAA 1VJ5A 3CXUA 4G4IA 3L1JA 4MQMA 3QPDA 1BCRA 2O2IA 5I7UA 3H2HA 2XLBA 5FKJA 3FYUA 3DL4A 1S8OA 3WL7A 3N0TA 1CR6A 5D3KA 1F8UA 1ACLA 1WB5A 4GI1A 5BWCA 2WG1A 2HADA 5LKRA 4AMYA 4M0MA 4OYLA 3VKFA 5ALMA 3BJRA 5ALHA 1E3QA 4LYDA 5DYYA 3O4GA 5FLKA 4XWGA 4X6YA 2AJBA 1G4HA 2HA4A 3AIOA 4XX1A 3ZWQA 3HACA 4Q3LA 5ALIA 1VKHA 3I2HA 1CUZA 4W1SA 1LLFA 1CUBA 3G0IA 2ES4A 5AK3A 4PW0A 1AUOA 1JKMA 1Y7HA 1A8UA 4GDMA 1MO2A 3NOXA 3G9UA 5LP1A 3MVEA 3DQZA 1D07A 5FP0A 1H22A 2QKYA 1FFCA 3IA2A 3FLBA 1QIMA 3C87A 1MAHA 2JIDA 4C89A 2OLEA 1EVQA 2R11A 2HL6A 1GPNA 4FHZA 2QRUA 4MXDA 1K6EA 3IUQA 2BJHA 4ARBA 2DHCA 3D4LA 4XJVA 5A71A 2C5FA 2WHPA 4QEKA 1DINA 1ZD4A 2P8SA 3R3VA 1W75A 4QLAA 4ZXFA 4M0FA 4G5XA 2OAEA 4Q05A 3QM1A 5EHQA 5C8VA 1NU8A 4LKOA 1XKLA 3QBJA 3WKCA 1MNQA 3DEAA 3LP5A 4GBGA 3HYSA 4Z49A 2DHDA 4NS4A 2XE4A 4DMHA 5LZ7A 2ZYIA 2QJWA 3IUNA 2DR0A 2X76A 3H17A 3BF8A 5LIPA 4U2GA 2FJ0A 3ZLVA 5AK6A 4EHBA 5AP9A 1QIFA 1N5RA 2JGKA 4DYHA 1TKRA 4EZIA 4K6GA 1G5FA 4I4CA 3WKEA 2ORYA 3I1YA 3GBSA 1ZJ4A 5A62A 4NZZA 5AI6A 2VAXA 4BCDA 5LZ4A 2OGZA 2O2GA 4FBLA 1WHTA 5AI9A 4UHCA 3F8SA 4JNCA 3WK6A 2O7VA 1MU0A 3WIBA 3FYTA 4B84A 5AKLA 3WA7A 1HQDA 1L7QA 1Q0ZA 3G0BA 1C7IA 2XDWA 2QMQA 4UHEA 1ZI6A 4Q1VA 3WJ2A 3ZPXA 2V97A 3HEAA 3ESCA 3I28A 5T4EA 4AZ3A 2WJ3A 5AIBA 4A16A 1J2EA 1N8SA 3VVMA 1YA8A 3F67A 4CCWA 1XZKA 4N8EA 1AZWA 2XQKA 4PSDA 3WMRA 2IIVA 3I6YA 1SFRA 4CG3A 4P92A 5ALDA 5AM2A 3V1MA 3OTQA 4BTLA 4J0DA 5LZ8A 5JZSA 3GA7A 4C87A 2WG2A 4IH9A 3C6XA 1LPAB 3HSSA 2BGNA 3BE8A 4FFWA 1XZHA 3Q0TA 4AQDA 4X6UA 1R50A 4S0XA 1ZIYA 1C7JA 5AJHA 5LKAA 4H7JA 2VF2A 3EF3A 3IIIA 5FXMA 1O6FA 4Q3OA 1BEEA 1QZ3A 4FWBA 2ZJFA 4C4XA 2HA6A 2XMBA 3H2IA 4J0GA 2BFNA 3FCXA 4X6XA 1A8SA 4JH0A 1DX4A 3BDIA 2RGUA 3NUZA 4ZREA 5J3JA 2OCIA 4BZZA 1AKNA 4DMCA 1A8QA 4BP9A 1T2NA 4ROTA 3FOBA 2OXEA 2VEOA 1W76A 1BCSA 3ZLUA 5CT9A 3ANTA 2UZ0A 5DYWA 2I3ZA 1EB8A 2WJ4A 3PI6A 2ZSHA 1IMJA 4Y2TA 1CUJA 1L7AA 4X90A 1GGVA 4D9JA 3KXPA 5ALNA 3FSGD 4XVCA 4MWTA 2WIKA 1XQYA 4L9AA 3ZV7A 3G9TA 3WL5A 5C81A 5AM5A 5BWBA 4ZRDA 2WIFA 2HA3A 4BC1A 1OCEA 5AOCA 4BE4A 4EBBA 4Y2PA 2OAGA 3ZLTA 3TJMA 1B41A 4CI9A 3ZI7A 1F6WA 3A6ZA 2YYSA 1CUXA 4IH4A 1XZIA 2V9ZA 1JT2A 5FUMA 4X7BA 3HJUA 5AKKA 1DTEA 1VE7A 1XZFA 2JGMA 3DCNA 3H1AA 5EIAA 3ESDA 4UBNA 3I2GA 4U2EA 2J4FA 2AJLI 2QJRA 2ZSIA 4ZV9A 4EY8A 4RPCA 3UMJA 1TIBA 4OCZA 4DMKA 1WOMA 2WHRA 4FLFA 4PV7A 4DNOA 2DQYA 4E11A 1CQWA 1XLUA 2QR5A 2XUDA 4U2CA 5FRDA 3DYIA 5T4BA 4G8CA 1UXOA 5AOBA 1CUGA 4GLBA 4Q3KA 2G63A 2VJBA 1LNSA 3AZQA 1UKCA 1UK6A 4F21A 4HXEB 5IVDA 4L3WA 4A5SA 3FLAA 2XUJA 2VSQA 3H2JA 4PSUA 3FVTA 4OU4A 4WFJA 2WFLA 1VZ3A 2QXUA 2C0QA 4B82A 4L72A 3WWEA 1R1DA 4INZA 3STXA 2WM2A 5ISMA 1U4NA 3B3QA 4X3CA 4BRZA 1EDBA 5CH5A 4G1FA 2DQZA 2PU7A 3FWHA 1XQWA 3WK4A 3LLCA 4HRYA 3STYA 1MN6A 2OPHA 1AMNA 3CCBA 1QFMA 3DD5A 2HU8A 1X2BA 3WWPA 3HRHA 5DWDA 4GEGA 4C88A 2X5XA 1ODTC 5K3FA 3R3YA 4LXHA 4E15A 3RKSA 1QIIA 3HABA 4Y9SA 3T52A 1N5MA 4AXBA 3NGMA 1TCCA 2QT9A 4J3JA 2RONA 4LHEA 5HKAA 2PX6A 2GBCA 3H18A 4WY8A 1MX1A 1EVEA 5A2GA 1LPSA 4G9GA 3PFCA 2B9VA 3KWJA 1MJ5A 3R3XA 5ALKA 3JWEA 1MTZA 2DHEA 5EHNA 1CIJA 1JFRA 5DNWA 1EDDA 4N8SA 3MUOA 2OCGA 4H7EA 4H35A 3ESBA 3WWCA 1LPPA 4WFKA 5ALQA 3WK5A 2WSLA 4O08A 1A7UA 1H2ZA 3LIIA 4RNCA 5K3AA 1J1IA 1BN6A 1VA5A 3I2KA 4BB0A 4QDTA 1ODSA 1RP1A 3B12A 4BP8A 3V1NA 3L1IA 1QLWA 3PUIA 1ZI9A 2RHWA 4KAJA 5JZBA 1XQXA 4I19A 2ONCA 1MNAA 3C43A 2XT0A 4H7HA 1CUAA 3PF8A 3CN9A 1F0PA 5AKYA 1QIJA 5JAPA 4JEIA 4TGLA 2PL5A 2WILA 4C01A 2PSEA 1ZGBA 1BS9A 5CH8A 5HCUA 2ACEA 3O4JA 1X2EA 2H1IA 2R8BA 3WWOA 3IDAA 4KJXA 3WK8A 1HKHA 2HFJA 3FCYA 2XUHA 3HXKA 3UUFA 1UK9A 1ISPA 1HDEA 4RGYA 1HLGA 3IBTA 4MWSA 3NWOA 2H7CA 4X97A 5ALLA 2GZRA 1IVYA 5A7FA 1TCBA 5C8ZA 1QIGA 5T4HA 4OD0A 3LS2A 2GYVA 2JGLA 1Y7IA 2HDWA 3LCRA 1DQYA 1W1IA 2JGIA 4UHHA 4B9EA 3VDXA 1YAJA 3RK4A 1QIKA 2QTBA 2VJCA 2XUOA 5FPPA 4FLEA 3U1TA 5AICA 2XLCA 1XRLA 3V1KA 2BAGA 3QMVA 2JEZA 4AN0A 4HS9A 3W06A 4X95A 4UFOA 1T4MA 2PUHA 4P08A 3H04A 4Y2YA 4CG2A 4KAAA 3O9MA 4OU5A 3STUA 4WDQA 4NMWA 3IULA 5CT5A 1EK2A 1QFSA 1CUWA 1LZKA 1DQZA 3ICWA 4MYSA 3STTA 4ETWA 5IVHA 5ALYA 1CUCA 5JANA 3PICA 2JBWA 1UZAA 4UBJA 4H7FA 4HZGA 5HK9A 4DGQA 2ZYRA 5AI5A 4BVLA 2CUTA 5A7HA 4FMPA 5EGNA 1TRHA 2CMFA 3AIMA 4YK7A 4CCYA 1XZAA 1LZLA 1WB4A 4GECA 2Z8ZA 1YSCA 3QVMA 4H77A 2JGJA 1USWA 1SOMA 1UOOA 1CVLA 3SK0A 4UBMA 3W9UA 2Q0XA 5CTAA 2G5TA 3WYDA 2WTMA 5ALVA 3SWWA 3G02A 5DJ5A 3PE6A 2XMDA 5JASA 2I78A 5AKJA 5AKZA 1EI9A 3S2ZA 3ED1A 2JGFA 1SCKA 4P9NA 2PKYX 1BE0A 1YAHA 2CZQA 3S8YA 2XMSA 3C8HA 2XMGA 4DNPA 2IITA 3GUUA 1ZI8A 1XFDA 2YASA 3BIXA 1EK1A 4MJ3A 5ALJA 1CUUA 3FBWA 4KE9A 1MX5A 2QUBA 2X8BA 1R9MA 1U2EA 5HF6A 3DYVA 5F4ZA 1ZJ5A 5IH7A 4EY4A 3C6YA 1R4ZA 1JI3A 3U0VA 2AXEA 5AIAA 4Y2VA 5HF9A 1U8EA 5AM1A 5HK8A 5E4YA 5SYMA 3O0DA 1K63A 5LLSA 1F0NA 4FFVA 1JJIA 5JARA 1PFQA 3BWXA 3I6ZA 1DWOA 2WHPB 1K5PA 5ALXA 2BGRA 1HBJA 3ICVA 1EHYA 3AINA 1WM1A 1AX9A 4HRXA 4CIAA 2EDCA 1IZ7A 1OXMA 1ZICA 2WIGA 4BYMA 4J03A 2VAVA 1P0QA 1Q83A 3D5EA 3F96A 1EINA 2XUGA 4HTAA 4BVKA 2ZVDA 3FLEA 3MUNA 2FUKA 5AKIA 3IVMA 1BEZA 1XQVA 3W2TA 3WWDA 3RM3A 4I3FA 1K8QA 5E2IA 5AKGA 4G4JA 5E4JA 3P2MA 2I03A 5CT4A 3N2ZB 1EXWA 3FYUC 1GPLA 3D0KA 3QZUA 3AIKA 3VJMA 5DNVA 2J3DA 2Z8XA 5HZGA 3D3NA 5AM4A 1IUOA 4WDRA 1LGYA 3MGAA 1L7RA 5LZ5A 1XZMA 2I3DA 4OSEA 1XRQA 2JEYA 2C5GA 2WU4A 1TK3A 1BN7A 4W1PA 2VTVA 2QS9A 5A6VA 3PUHA 1XZEA 1QTRA 3R41A 4FDMA 2GZSA 2QOEA 3GFFA 3M81A 5AM3A 2HRRA 3EIOA 3UUEA 3A2NA 1THTA 2XUIA 1ORVA 5CT6A 5EIHA 2PSJA 1ZGCA 4TVKA 3DS8A 4LXIA 4PSCA 5AI4A 1CUHA 3YASA 1JU4A 4J0CA 1JMYA 3AJAA 5DYTA 1BROA 1ZD3A 3BL8A 1XRPA 3DOHA 4LIPD 2OG1A 5YASA 4OB8A 4DSAA 4B80A 1N1MA 5EI5A 1ACJA 3I2JA 4J0IA 4BAGA 2CBGA 3WQHA 2HFKA 3H2GA 3QMWA 1M33A 4BAUA 5EIEA 1J07A 3I1IA 2BUCA 1JJBA 1YB6A 1E8MA 4BRSA 5K3BA 4GW3A 2ZJ6A 4K6HA 1AURA 3W05A 5CXUA 4A23A 2AJCA 1E89A 5K3CA 2CEKA 3K2IA 2VQ6A 4F0JA 1LPMA 3ESAA 2B61A 4WJLA 1XRMA 4BDSA 1H2YA 3WLAA 2BKLA 5D3ZA 3WZLA 4U2BA 4OUKX 4FKBA 1YB7A 4HXGA 5JYCA 5HQ3A 4H7DA 2XUKA 2PPLA 1AGYA 2Z3ZA 4N5HX 4ARAA 4IO0A 5AK4A 4CG1A 7YASA 1CPYA 2FX5A 1G66A 2XQFA 3WK7A 2PSHA 2PSDA 4AMZA 5DNUA 4B9AA 2OGTA 4KAFA 3AZOA 3D7RA 4GXNA 4QWWA 1WPXA 4UHFA 2BUBA 5CMLA 2PSFA 1QIEA 2XI4A 2ZYSA 3C6ZA 1CFJA 3PFBA 4FOLA 1YASA 1IUPA 2EEPA 4X91A 2XB6A 4EA6A 1OILA 1TAHA 2BCEA 3DL7A 1QE3A 1MPXA 2WG0A 2WFZA 1DX6A 5T4FA 4RE5A 1CV2A 3QMMA 3E0XA 5AHXA 2XMQA 1YS1X 1ZD5A 5JD5A 1TQHA 4BDTA 4TPKA 4IH1A 3X3HA 3H0CA 2ROQA 2Y2VA 3OG9A 4U2DA 2HA0A 2QVBA 3H2KA 4GWLA 4DNQA 1W6RA 4X92A 3G7NA 3FAKA 2H7YA 2G5PA 3BXPA 2W22A 4GHWA 4ITVA 5CXXA 5HKBA 5FDFA 2OCKA 3IUMA 4BE9A 5H3HA 2XQGA 4XIIA 1H2XA 3WL6A 4EB0A 1CQZA 4DM7A 1CUDA 2VATA 4WFIA 3H1BA 4B0OA 1GQRA 3DJYA 2IX9A 2C58A 3V9AA 2ACKA 4WCVA
chains in the Genus database with same CATH superfamily
1REQB 4CM4A 4KTTE 3JALB 1SQ0A 2XKAA 1VE3A 2F3TA 3PEUA 1OBFO 2RSLA 4LZNA 2E48A 3PL5A 1O95C 4U00A 2VWQA 5ERXA 4P33A 1U2DA 5E9JA 5KX5B 3M1AA 3BIOA 4X65B 5I9TA 2AE1A 3E3AA 1NNLA 2LGJA 4R2JA 5IAJA 3SS7X 4L73A 2QPOA 4Y7CA 3JZAA 4YMUA 4Q82A 5FAKA 1B8UA 1Q1QA 1DT5A 2DY1A 2JFQA 3LUJA 3NYIA 3LIPA 4MV4A 5E95A 5IXSA 4TWRA 2Q3FA 3QU9A 3OX3A 3EVFA 3EB9A 4IWNA 1IPEA 3SMVA 4DT1A 3M6VA 3L1HA 3JQ9A 5CAEA 1X7YA 2GS9A 3RJ9A 1UOEA 3MUEA 1I2MA 1D4AA 2RAPA 2XWJI 3AEQB 3OLCX 1ZSNA 5AO9A 1FSPA 2P8JA 1B1AA 4NWIA 4B6RA 4CR8A 3COYA 3L0OA 5IKPA 2AV6A 2WHQA 3RJZA 3WGMA 3ZHBA 4C0BA 1ZAKA 1Y5LA 1JJAA 2O0MA 3MZ0A 2E4YA 4HFJA 4KC0A 3HKBB 4DCOA 1USUA 2SHKA 3F5DA 4JZYA 2ZETA 4MGHA 4DC1A 4IMPA 3U2QA 2RHBA 3IMGA 1VFNA 5CB4A 2X23A 1E1MA 1GFSA 5HKOA 3WMXA 2BISA 3R8CA 1EVZA 4GRDA 2OE2A 1U8TA 3I1FA 4MPTA 1XOIA 1M2WA 1GYPA 1EIZA 3BJMA 4ZYUA 1NYLA 3F6RA 4G25A 5FWAA 5GGXA 5TR9A 1NRWA 2ZYWX 5IAEA 4QHTA 3SXPA 3L40A 2JLBA 1PSDA 4ZJYA 5BNZA 1L8OA 3VJRA 1OFIA 4H60A 3AV3A 2C2OA 4ZALA 2I29A 1QHSA 4QFDA 3AT1A 2CLSA 2OCDA 1LB1B 4QAJA 4S3MA 3L8EA 4ARUA 3NASA 2FZEA 3AWDA 4KMOA 5LP6C 1B6GA 3GRFA 5KWIA 4MR8A 4TWIA 4BZWA 1Q0SA 2FOLA 3OM8A 4GT1A 3ZX5A 1EWKA 1E8NA 2ID9A 3K0EA 3LGSA 1TX4B 1GXSA 1PNVA 2FQXA 3E3LA 2F64A 3SOPA 3ZHVA 3HE3A 1E2QA 1O94D 2I0FA 3LGAA 4WH0A 4C5AA 1DPFA 3D2AA 1VRVA 3DBRA 4MA5A 4ENUA 1UBSB 1O8BA 1S2MA 5DT9A 1FP7A 2QT0A 5IT5A 4KVAA 2VAWA 3VYRB 1T9ZA 3GN1A 4BAZA 1NU6A 2WZDA 4PYLA 3O8RA 5I8PA 4IUYA 3V8RA 1FFXA 1TZKA 2ONZA 5AVOA 1OB5A 1C3LA 1A4UA 2DKFA 1OBCA 2C77A 1FFGA 3WHPA 3X1DA 3W9SA 1JLKA 1T8UA 2R8PA 5IH3A 3RBZA 1YZGA 2WHYA 4PSKA 5ESWA 3EZXA 1XRNA 1JDSA 2JHAA 4C4ZA 1W49A 2RKWA 4B7UA 1JLLB 1H0HA 4MVWA 1C3XA 1IWBB 5GADl 1F2VA 4RZHA 2NSJA 4I3GA 1GZ7A 3IVCA 5D8DA 3K7EA 4I08A 1UP6A 2RE8A 4ND1A 3CR7A 3IHKA 3QY9A 1MOPA 4NNPA 1UEIA 1YA4A 3JQDA 1QJ4A 1SVSA 3Q4GA 2ATEA 5KU1A 3IB3A 5KTTA 4AIRA 3P96A 3N2NA 2PT9A 4DB4A 3JD1A 3OCXA 4YRSA 3VR4A 1CUSA 2QG6A 3TOVA 3MOSA 4RTLA 3UZUA 3OF2A 2RK6A 3LMKA 2VDMB 4GVXA 2ZBFA 3DP7A 4A1OA 1JJFA 1FDIA 2QRKA 2VZLA 2WUEA 3CE6A 1U2GA 3CWCA 3Q15C 2HGSA 3B1JA 4JA0A 2KWIA 3MBIA 4M21A 1QGED 4UPDA 5E6RB 1XDUA 1F2DA 1UKYA 2XA2A 3LD9A 3PWTA 4GX0A 2WMNB 5KB3A 3TR0A 4B3TB 3VR5A 3WP1B 2CBZA 1A27A 2GYYA 2OGWA 5DWQA 4DNFA 2CN1A 4EDFA 1A72A 3KNZA 3UPTA 4Y1RA 5FI5A 5ALWA 4WNYA 4HATA 4ADSG 2B1RA 4OHRA 3AG5A 5HSGA 4FGZA 2GSDA 4MA0A 1J2UA 2D2FA 5KYYB 4D41A 5DISB 2Q3MA 2AQHA 4B3FX 1J8VA 2HMWA 3GLHA 3WWYA 5MN6A 4RABA 1GU7A 3ZK8A 4AF7A 2OR3A 2V4MA 2XGGA 3AR7A 4JYMA 1KP2A 1JEJA 1S3GA 1FP4A 1NPTO 2CNNA 2QN9A 4NENA 4P98A 4WACA 4XIYA 2CLHB 5KYGA 1U5CA 1OFTA 4LY0A 3WWZA 2PUWA 2O4CA 4KR0A 1LTHR 3FFBA 1I2CA 3ZHSA 4AY6A 2GZAA 1WKBA 4OHWA 1QGUA 2D2EA 1RS0A 2XUAA 2YY7A 1IJKA 4IVNA 4S12A 4JL8A 1ONSA 5FJJA 4BV3A 1CULC 1PGNA 2LE0A 4BCCA 2O8FB 1DO0A 1PJ3A 3Q3HA 2IPXA 1W581 3A7EA 4Z4HA 2W4IA 3AU9A 1W9HA 5FFMA 4G0ZA 3TEJA 2VHUA 4EMUA 5JH7B 5JU6A 3K92A 1BE6A 5K1ZA 4ISBA 3RRNA 1GN9A 3D4BA 3WDMA 4PC7A 1ZWKA 2O0HA 2FY8A 4ENTA 4D4GA 3MRVA 3KOMA 2R1TA 2XTNA 2RGWA 1ZVVA 4ZCPA 1KYTA 4L95C 1YMVA 2R6HA 4D5EA 1RMTA 1DEOA 3BN3A 3OZWA 3N70A 3RRJA 1XWWA 1YB2A 4NYJQ 3AI1A 1QCCA 1KL7A 5DZSA 1E1QA 3CF4G 4BX3A 2IYLD 4MS1B 3QXJA 3VNBA 4JL5A 3TQOA 2UUOA 4BP3A 5KQMA 1SRQA 1S8FA 2OY0A 4MRAA 5F4BA 1XG5A 3FNBA 2HA5A 3BSYA 4OFBA 4DQVA 1XP5A 1GKLA 1SCJA 3RQIA 2B2NA 1MAVA 2J4CA 2WAYA 4UVGA 1IFXA 3GD7A 1R37A 2H0AA 3Q3CA 2EP8A 4FZ5A 5ERGB 2GTPA 3TE6A 1JILA 1NP3A 1TYZA 3OMLA 3HVHA 2Y6VA 1KI3A 4P7GA 1VE5A 1RP7A 4A6EA 1SB9A 1L4BA 1A4XA 2XD9A 2NV6A 2FN7A 2IHVA 1J2JA 3FMGA 5BOVA 4KCGA 4H7IA 4PINA 2QRVB 1NFFA 3HUTA 1QHIA 2AUMA 1DOZA 2C2HA 4F3YA 4J0JA 2OD2A 4B6EA 5FWXB 3FVRA 4K87A 2W0SA 3VM6A 2Z6UA 5HW0A 2ZJ7A 3ACBA 2QX7A 1AK9A 5EVCA 4FC7A 3VISA 2P91A 1H9BA 1O3YA 3DZFA 4GUDA 4P2BA 4A0QA 4XWWA 4HAWA 3S2EA 5JFTA 1OMOA 3KCNA 1CZNA 4MDYA 3BCRA 5BRNA 2VT3A 3V1TC 1R9NA 1H0RA 2J48A 1YR2A 2RH4A 3P9CA 4WE3A 1B42A 5EWJB 5JPIA 2V45A 2WIBA 2PZEA 4KFUA 3K6KA 2BSAA 3TOSA 4HV4A 3SE7A 2AN4A 3ND8A 3BB4A 5FORA 1UFOA 3OA0A 1FFEA 3M70A 2ZT8A 2YWJA 4F5ZA 3T3NA 1XZDA 4OJTA 3DULA 3ADKA 2PS9A 3EW9A 3QV1A 4K6FA 5AXCA 4GX1A 4BHTA 3A28A 4W82A 4EEZA 1EP1B 2IH2A 2WF6A 3DEJA 1P0IA 3R5SA 3TZCA 2I6QA 3KWFA 4P93A 1IXSB 2Q4BA 5M5BA 1VSVA 3QPAA 4WY5A 3HO6A 1KPHA 3ZGNA 1TLLA 2X22A 3ETLA 3LSTA 2ZRPA 3OPXA 3UATA 1G5PA 2JNWA 2J9GA 3T94A 1J5PA 1Z36A 1SG0A 2F1IA 3WQRA 1UBOS 3FF4A 4H6WA 3WGYA 1JQEA 3MC1A 4YV1A 5JRDS 4C6RA 2TMDA 4G26A 4ZEOA 2P69A 4Q9DA 4Y2RA 1ISGA 4GZLA 1RLTA 2K5UA 2GM9A 3IAM6 5CVCA 4HAZA 2BT4A 2VF8A 3GFVA 4O4JF 3OMXA 2B7BA 3FIUA 4UULA 1CZOA 1MTOA 3ZE6A 4HAIA 4HPXB 4GZMA 4EL5A 1H94A 4UM9D 3UMFA 2DQSA 4RF2A 2I33A 5D6OA 2HWXA 2H2WA 3JQ9C 2X0NA 2CSUA 1BMTA 2NAFA 3MB5A 4X9XA 5GM1A 4U7PB 2Y1CA 2ASEA 1TUBA 2ID4A 4L28A 4MKZA 4WOJA 1RQXA 2VAMA 5E6UA 1AA9A 2OUKA 4AB1A 4AX8A 3VGJA 2C9MA 4RHYA 5DYGA 1YS7A 3SQMA 5AI0A 4N0MA 3R8XA 2EFJA 4H15A 4DY6A 3U7FB 2IHZA 1KDPA 3MFQA 3R09A 4KZPA 4BX8A 1M8PA 2R87A 2JS7A 4PHFA 2WYVA 2D4HA 3CG0A 3IH5A 4HGRA 1HQCA 4YCDA 7MHTA 3V2GA 1CEYA 5J5CA 3TTXA 4F6RA 2N3ZA 1JN0A 3WAKA 1A9OA 3WYFA 3TAXA 4YJGA 3ZXIA 2WYHA 1E4EB 2NQ8A 4RIIA 4UE6A 1PCXA 4HRAA 4UZEA 2X9NA 5HKLA 3SS9X 4MB0A 2PLAA 4CIVA 3GFSA 1U0SY 4WT7A 1K5HA 1AKYA 5HF5A 1X94A 2C61A 3Q2KA 1O57A 3NR2A 1HK7A 1VB3A 2C9BA 3WIDA 1W25A 5E1MA 2ZSBA 3KBOA 4BFUA 3K71B 3FTCA 3Q3GE 2FH5B 4JR1A 4LQLA 2JIMA 1EH5A 3IQFA 3MTBA 1E6MA 4MUFA 1NPYA 1RKQA 3WKDA 4K9DA 1RAHA 2UV8A 3IHWA 3RK1A 3IBSA 1M67A 1A8HA 4BP1A 3PPXA 4BVEA 1N5OX 5JROA 1MB2A 1SXJE 1GTMA 1UWCA 1O96B 3D3JA 1ZM7A 3WA6A 4CF5A 5MF6A 1JEYB 2D0PB 4JJ8A 5A7GA 3ZD7A 4F85A 3E53A 1QH1B 2MMCA 2VH2A 1ZM3A 2Y4OA 1EVJA 2JA2A 4K2AA 5I5GA 2EKDA 1Y4ZA 1VXOA 3ZU5A 1XZPA 2Q1WA 1IRXA 3S2YA 3SSOA 4EX6A 4DV2B 3KQTA 1H23A 1N0HA 5LZ9A 7ADHA 1SULA 3R7SA 2IHTA 4DSZA 1NY6A 1SIBE 1W8IA 2QTVA 2I4NA 3E05A 1ORWA 1JPNA 3IR5A 1YKFA 1HI9A 3DTVB 3HUDA 2ZU0C 3TX2A 3A11A 4R7GA 5CDUA 1G41A 5LXTB 4D1YA 1HPLA 3PFIA 2P6RA 2HK7A 3KP1A 2ZYUX 5K0SA 5ARDA 3L4BA 1UJNA 4F3RA 5BURA 1CK4A 1ZOIA 3HV2A 2P9FA 5E6SB 3EEFA 1QJCA 1WZIA 1JSLA 1ODLA 3O9ZA 5I4IA 4DUPA 5JO0A 2ADMA 1U0RA 2W37A 3O95A 3ZWOA 3FY4A 5EA2A 1ZH0A 3B9RA 4E4YA 2JFYA 3O4HA 1U1DA 4TSKA 2ZRIA 1YBMA 5KMGA 5IU6A 5K8LA 3JQ8B 1ZQ9A 2JZNA 1CR4A 1UDRA 2AJ8A 4MOWA 4MYDA 2VP5A 2NU8B 1P2VA 3DOIA 1TECE 4PZLA 3WGVA 4YHBA 5KNDD 1RYYA 2FPXA 4C76A 3BS4A 8ADHA 1BWQA 2MINB 4LQDA 2CGEA 1DG1G 1SC1A 2XRFA 3JR7A 5FR1A 3VVCA 3TZQA 1LPNA 1SHUX 1R6VA 1NXWA 1RRMA 2Y3IA 4QQRA 3SR3A 4Z4GA 4ND8B 1T9BA 2A5FA 1FVHA 1GT6A 3GH1A 1M7GA 2VF5X 3VH4A 2NLOA 4JLNA 3NDJA 4AJIA 3KFVA 2O7QA 4KQ1A 5IXYA 3ERCA 1VLHA 1A5ZA 1QIHA 4D56A 4F3CA 1JA9A 3Q88A 5EFZA 5ITSA 5IZCA 2PWYA 3NEYA 3UFXA 5F78A 4G01B 1T29A 2O48X 3QX9A 4S24A 2VP6A 2AMFA 4DMLA 4ZHQF 2P1DA 4DILA 1OWNA 1M2GA 3V3TA 1N7IA 4O33A 3BWMA 4ATNA 4YIHA 3NM4A 3OF5A 4Z2YA 3GOHA 5FOVA 4UU0A 4WK4B 4ZODA 4ZC1A 2OXIA 3U4IA 4OQZA 1Z5OA 3QKTA 2H54A 5H8WA 4H4CA 1J49A 1THGA 2ODNA 3NNSA 4CM7A 1JB9A 4J90A 2J0UA 3ZBTA 4BNJA 2F43B 3DMGA 2Z56A 1EBUA 2QN1A 4ZHSA 4DLSA 1WMBA 5LYJF 4EB8A 2HIHA 1NQAO 1VJCA 1XDZA 2B35A 5BN1A 3AXSA 4RDXA 5J4VA 1GZ3A 3JQPA 3MQFA 4JMLA 4QELA 3OE4A 4I50B 1FTWA 4JV5B 4GO1A 1I5RA 1VCHA 2D1FA 3G9ZA 3VPSA 3PQ2A 3UMRA 5EHZA 3BWCA 3LPMA 3E35A 1DSSG 2HRDA 2OG2A 4YAIA 5KSPA 1TM7E 3EVBA 4UZSA 2Z57A 3K70C 2OVBA 3HB9A 5FOSA 4KQJA 2PYIA 3S27A 3ETNA 1K86A 4N0DA 4BKMA 3H5VA 1OFGA 1WBJB 2GFQA 2C78A 3DO8A 2RAUA 2OC4A 4NC9A 4ANFA 2FQ1A 3S81A 4YPFA 2CNLA 1W52X 3I6QA 5DN9A 4R1QA 2I1WA 4B3BA 5DNYB 3P9RA 5H9WA 4TZ6A 1V37A 1V8FA 4MRRA 3HCBA 2QRPA 3QH4A 1IM2A 4HH0A 3WFJA 1C0KA 3U44A 4WVFA 4YT8A 3PX7A 5D3MB 5FHRA 1AC5A 1GKKA 4K40A 1ODJA 4LQ4A 2VLBA 3COJA 2JAWA 1E58A 3A25A 5KX5F 5C3MA 4NXMB 2A9QA 1L7DA 2XVAA 3E8SA 3O2SB 1JIUA 4RC9A 5J4LA 5B36A 1JPVA 3ZI0A 4FYJA 1U04A 4HP8A 1IOVA 1AKRA 5BNTA 4QTZA 1ZNZA 4ZVSA 2I7CA 1UT6A 5F7ZA 2GYWA 4N39A 5C8DA 1P74A 4HY3A 2W6JA 5KAPA 3NPMA 3MRXA 4FR0A 1XA4A 4IWYA 3TD2A 4PX3A 2GFHA 5EIFA 2NSDA 3D2CA 1DT3A 4YAEA 1VXRA 4W4TA 2WTEA 4LSZA 3N2KB 1TEVA 1WZUA 1Z4PX 2WSYB 1Y48E 2GMWA 4LDZA 4YRPA 2NUPA 4YI3A 3MWKA 4FHCA 5JAIA 2AOUB 4GMFA 4OTZA 1RCFA 5LQDA 1RBQA 1HNWB 2COEA 4ZQGA 5JSQA 3S7TA 3OFKA 5CX1A 1QH0A 2ZWOA 1OAKA 1YZKA 1AU9A 2L0XA 4EJMA 2F3UA 1UK7A 3GT0A 4C1BA 3U4GA 3ZD8A 4FVTA 2XMRA 1W35A 3R3WA 1DX9A 1Q11A 2XW6A 3VNAA 1SHZA 3OZCA 4I1OA 4P82A 1V48A 3DZDA 3NDIA 4V0MA 3KT3A 5GONB 1YNSA 4HGQA 4ZGBA 2G6BA 5EPUA 4YAUA 4M0CA 1OJ7A 1NWCA 1UM8A 2F6RA 3KVNA 4Y6RA 1GGNA 1MH9A 3AB8A 5EHGA 4DUYB 2BHSA 3C8DA 1L7NA 4JVLA 5D85A 2WKQA 2HO5A 2GLTA 2Q6LA 2ORVA 4M89A 4ODIA 5DHFA 4I1UA 1N3LA 2HJVA 1RYZA 5B4VA 5K8CA 2ZSKA 1XA0A 3O1LA 3WKBA 5JAUA 3DR3A 3R8FA 3VHLB 2G4CA 3HI4A 1AKVA 1N3BA 4FIZA 1MEOA 2ZW9A 3IUJA 1FFAA 4D02A 2EBUA 3JYHA 3NETA 1NUUA 3C45A 4G0OA 3VU3A 1PNRA 3RKRA 1QOZA 3IQGX 4IYRA 4RSHA 1YIOA 2Y1KA 3C97A 3CLTD 2IT1A 3H13A 2BR5A 2X6QA 4FLMA 4KKXB 1JQLB 3DF9A 3HA2A 1BVHA 4HEJA 2W2QA 2XZLA 4UHDA 2R1VA 3ZDXB 5KS2A 3KWLA 3PUZA 4LDRA 2H1HA 3UJAA 1Q7EA 2Z8YM 2AN1A 2ZPAA 1K2VN 1MO3A 5SICE 2JLXA 4AI6A 4M7PA 1W5SA 1ULAA 4D97A 1DKPA 2P75A 1VHJA 1TCAA 5BQ3A 3VZDA 5JPDA 3AFIA 5JAZA 1PKEA 1GPKA 3H9QA 4FFRA 1MEJA 1TL7C 2IXDA 1ZEMA 4US2R 4OK6A 4XUGB 4S1VA 5J2TA 1RXWA 4I0WB 4FFBB 4D3ZA 1UPCA 1J22A 3CKKA 3UHJA 5HM6A 2P5SA 3B5IA 4KLAA 3RJTA 4K6KA 4C14A 1ML3A 3R1IA 1NUQA 2CXHA 4JJFA 5BSTA 3JWPA 1E92A 3FUTA 1Z22A 2GHIA 5LYYA 3WHIA 2VC2B 1L4MA 2JLRA 3P9SA 5FA8A 1V5EA 2XTJA 4XYEA 1UC4B 1WU8A 3MCTA 1WW8A 2P77A 3HKDB 1LRLA 2H59A 3JZFA 1ENYA 2C59A 4X5OA 3KZMA 3ETHA 3MTQA 3ZNPA 4F9EA 2QA5A 3L4KA 2C9CA 4JITA 1CB7A 1HL7A 1HNNA 3EFOA 2FG5A 1RC0A 1NSYA 1T35A 1EUDA 4HGPA 1M1YB 3SYRA 5BSGA 3W9BA 1F48A 1QTIA 2FRDA 1EM8B 2FV8A 2IW1A 4W9RA 2VT7A 5BSVA 4PN3A 3PC6A 1F17A 4LRQA 5HKKA 1K4YA 1XMPA 1DJMA 3OIVA 1BRMA 4PAOA 1QQAA 2GEKA 2P41A 2FEOA 4J2OA 3H8VA 1SIWA 1BTOA 1TFUA 4GH5A 3SX0A 1ABBA 4BFWA 1RW4A 1IXRC 5LC1A 2C84A 4U0JA 1JPJA 1PI3A 1HDIA 2HM7A 3K53A 4LTNA 4OXKA 4QDKA 3HLKA 4X85A 4AC9A 1XD2A 2Q9BA 2I4OA 5I9SA 4MUMA 4OHMA 1NR7A 1YS2X 4RVUA 3TX6A 2A2ZA 2GCGA 3L05A 1PS8A 3LT1A 5GV8A 3ZXSA 4BWGA 3OOEA 2GEJA 4DA8A 2YWXA 4I5FA 2LDBA 3F6CA 3D1VA 4ZGWA 2H9IA 2IXBA 2VDPB 2J0SA 3C5WP 4UXJA 1KZ1A 4D81A 3LX5A 1JZQA 3OFND 4AO8A 4J49A 1KFKB 5HQJA 3TN7A 2PVPA 1JR2A 3DMNA 4MV1A 4CKWB 2C7VA 2ZSFA 2IQIA 1Z34A 1VDZA 3W8FA 1TGVA 3GF4A 4DUGD 3KOWA 4IVQA 4MYTA 4WZBB 1O5IA 4GSLA 5HQ3B 1SXPA 2DSNA 1L5QA 3PHBE 3BB3A 3MWLA 1EA5A 3LXXA 1Q1GA 4HNQA 4N5IX 5K7SA 4HVTA 3TD6A 1D2CA 2DBRA 3O8QA 1NVEA 4ZAYA 1G20B 3HCWA 1Q12A 3HYLA 1JBQA 3FSGA 1QX4A 1FFDA 1S4MA 1U8YA 2LIPA 4U3JB 4BCBA 5ED4A 1JHOA 1XTUA 3D7NA 3DL0A 4K9OA 2M6LA 2E82A 4QLOA 2BCJQ 1YZTA 1U3CA 2BFDA 2G4LA 2J07A 4YJ3B 1L4FA 2YZKA 2OSBA 4RXTA 1IAQA 1KO1A 5DYNA 1N6RA 4TTIA 3ORSA 2K4MA 5IZCC 1R8JA 3F1KA 3HO8A 4ESOA 1DOAA 3O2NA 3IT3A 5EUCA 1NMXA 4P0QB 3A1FA 3A6DA 3AJEA 3K9WA 1P3Y1 1WG8A 2VBFA 1DKUA 3M4ZA 4R01A 4D6YA 3DFUA 3T3EA 1ZGGA 2E6KA 2QJTA 1GEGA 4LI3X 3V00A 3QOWA 3FWNA 2GXQA 3U6BA 5DTIA 2MSDB 1GR1A 5JTUA 1P6UA 4OV6B 4RCVA 5J63A 5AW3A 4YROA 3LDGA 1JUDA 1KMHB 1XAGA 3PDCA 4FNGA 4PQEA 3ASZA 4Y18A 1AUPA 2W43A 1S2OA 3EAQA 3QSYA 4K1XA 5KYWB 4HDNB 3UWKA 4HPWA 1C9DB 4MUBA 3CVUA 3ITNA 1AKTA 1MQ9A 3LQ1A 4UEJA 1WAMA 3B36A 3UY4A 2QL6A 4NEGA 1L7VC 3QNMA 4A1FA 4EGJA 4OKSA 5HF8A 2VDWB 3L6OO 3TQIA 4IKPA 2HX1A 2Q49A 1CD5A 3GGCA 1YMUA 4IINA 4KEAA 2VQFB 4H9GA 1BIFA 5DCUA 4AY2A 3VH1A 4PZ9A 1GUDA 3NBXX 1DG9A 2OD9A 4G4IA 4RK1A 4KPEC 3L1JA 1ZW6A 2O0LA 2QTWB 3BWDD 2R47A 3CUWA 3KAPA 4RLQA 3U4HA 1NFQA 1M2NA 3OOJA 1HFWA 3KLBA 3ROMA 1OZGA 4D46A 2V5VA 3BRWA 4TYMA 2ZP1A 3AVXA 4R7TA 1UC8A 4XDHA 1Z63A 4OQ4A 4KO1S 3HEMA 4BNIA 2UZ3A 4PXAA 1Y8CA 4LE1A 1BXGB 5IVPA 3GLFB 1E2BA 1II8A 2PIAA 2QUHA 1GQ2A 3T41A 3B6EA 1KP3A 4QPZA 1LDBA 2Z5LA 2H1VA 2H08A 2X15A 1QHYA 1QXSA 3BAZA 1ADBA 5FTWA 4D92A 1G5IA 3MJHA 5U4QA 4O4IB 1Z6YA 4LOKA 3HYTA 3A6FA 5BWCA 4WZAB 2PV0A 621PA 5DBIA 1T9CA 3REFA 1A7KA 5G53C 4R3UC 3HDQA 3HVIA 2EFEB 3OP4A 2QUZA 4AY5A 2K2WA 1VP3A 4OYLA 5JZVA 1XZQA 3BJRA 1BXRA 3FBTA 2X0FA 1YJBA 1NV9A 4MCHA 3LXUX 4OBBA 1PT8A 4JLKA 5B3AA 3TUIC 3VUEA 2AX3A 4BQFA 2JFWA 1VMEA 4BXOA 4L4YA 5DHSA 3M0EA 1E3IA 3A4VA 3ORYA 2YYYA 1SEVA 1VKHA 4OSPA 3W7AA 1DRUA 1OE0A 1T5IA 4V0QA 1RLMA 1ZSVA 4IRXA 1FU4A 3DHNA 3I2HA 3LKBA 3RW9A 3ONNA 1FX0A 1V3QE 1I3CA 5G1PA 5JV5A 5HR5A 4EMTA 4W1SA 2OHHA 1EZ1A 1JFVA 1F9EA 1U0GA 2HXSA 2Z1NA 4M1YA 5AUPB 2J0VA 4KWIA 2AK3A 3OT1B 4EELA 4ARVA 2QT1A 1JKMA 3IQDB 3F9IA 4JOBA 4BWYA 3QPBA 4X1KB 4A0HA 5JXJA 3I37X 1MO2A 2NO0A 4GMHA 4UJ3A 4MVCA 1EBBA 2UUBB 2P9JA 4JEUA 5ECDA 5LP1A 1Z15A 3DQZA 4HK4A 4M22A 3L9WA 2JFVA 2PXXA 5EKXA 3AY7A 5K4GA 4CFZA 5EYPB 4HX5A 2MYTA 3EH1A 1GIAA 1P7WA 2LTAA 3AEXA 3DOFA 3FLBA 3IA2A 3IERA 4DYDA 1S5PA 1Y6JA 5E9AA 2WHEA 4CIXA 3BIJA 1F3OA 2G36A 1BKYA 3SJAA 4TT3A 1M8GA 4CL2A 1I5OA 4OQLA 4I8XA 3OPYA 1Y8RB 1UP4A 2AHOA 1EVQA 1WMSA 5K0NA 2PY6A 1ESEA 1Z4IA 1NNUA 2VJNA 4QULA 2EBWA 4N3NA 1OXTA 1VL5A 2VAPA 4C4PA 3KQNA 6LDHA 1PQPA 4AKIA 2FPWA 2IOYA 1XK6A 1HG1A 4IIHA 2AQIA 1M1NB 1Z7YA 1OV6A 2YHAA 1A9QA 1SQSA 3D4LA 2CNWD 1NKTA 2C5FA 5U9CA 5ESXA 4ZVUA 1SMKA 4IQGA 1J20A 5LXTF 2VRNA 5AJXA 1B1CA 3EXHA 1LDMA 1HYEA 3C5EA 1P17A 3QF4A 4RY0A 5C53B 1YTLA 3F6SA 1U9ZA 2DBYA 4G1VA 2Q5FA 1L7XA 1B3RA 2JKYA 3DVAB 3P9YA 5DK4A 5KVVA 4XCVA 4C05A 4DJTA 2GF2A 1DINA 3R5HA 5HDQA 1VIDA 1ZD4A 2BDTA 2WTBA 1OBVA 1VE1A 3G2IA 3R3VA 1W75A 4PZDA 3EAFA 4JVOA 1PJBA 4HGOA 4YRDA 3B1YA 4M0FA 3K09A 1KEWA 3LQFA 5FL7A 3VH3A 3N6RA 5JDCA 1TUEA 2C94A 3EPJA 2OAEA 3KZKA 1PDWA 2B82A 2FZ5A 2IOHA 3FI9A 4EP1A 3C3DA 1DE0A 1P77A 2AEMA 5CK5A 4IXNA 3IV9A 1QM5A 3GGDA 3X1YA 2AD1A 4LKOA 1JQ3A 221PA 1XKLA 4N82A 3L8GA 3Q2OA 3S2SA 2A1TR 4CF4A 4JI8B 2W6ZA 4NYJR 4YGXB 3WC4A 4JLUA 3CM0A 5I9NA 5BXYA 2AWNA 5ICEA 4DRYA 2FZLA 5ITVA 2O52A 4E22A 3ZXXA 1G38A 4NS4A 4DMHA 1KFEB 2P0AA 4CKEB 5LZ7A 4DSTA 1V0JA 2EOAA 2RKBA 4QQ8A 2CVHA 1EE2A 1P6XA 2DR0A 2VSNA 2YC4C 2ZIXB 3BH0A 3OBBA 2DBQA 5LIPA 3N76A 4C0AC 3U3DA 3WBJA 4LISA 1R4AA 3ZU4A 1V45E 3H0EA 3GVIA 4TZKA 4TSFD 5B55A 2QSYA 5AP9A 1E2PA 1VJTA 1N5RA 3NM6B 2YV2A 4FSDA 4QBGB 3ACDA 3TTUA 4N48A 2ZZNA 1VL6A 2ETVA 3OOWA 16PKA 1F20A 4IICA 5HPYB 4RVCA 3IEXA 3BXFA 4ME6A 4K6GA 2H4XA 3AKCA 3A1CA 2EX1A 2IP4A 3NJ4A 2ORYA 3I1YA 2PAFA 3QMPA 4R1NA 2Y76A 2OV3A 1L5LA 5A62A 5IN4A 1TEHA 3FROA 3B9QA 4OBXA 5IJ0A 5AW7A 2XF8A 3C74A 5AI6A 3TDMA 1WCWA 1XMIA 3SYKA 1KZ6A 4OK3A 3C3XA 3W2HA 1IQPA 5KC8A 1VI2A 5HE9A 3EC7A 3GFBA 4FBLA 4I50F 2YQZA 2PBZA 1ZCAA 4NHOA 2A4KA 1WUYA 4N12A 1I6KA 4NFHA 1F7UA 4FYHA 1ZJWA 2O5RA 1MVLA 1V1JA 1GILA 4J3NA 3BK1A 2ZR8A 1O4WA 4QYIA 3K9FC 1UPTA 4IR7A 1WCIA 4NE7A 3HCDA 3OZTA 3ZU3A 3WIBA 3FYTA 4B84A 4L22A 3NDRA 5AKLA 4EMSA 5HWSA 2I4RA 3FDJA 3ABIA 5CLHA 2Z2XA 4GC5A 4UVHA 2CNDA 3G0BA 4NEHB 1QCYA 5LQRA 5LWQA 2XDWA 2QMQA 4UHEA 1J99A 1M66A 3LY9A 3OWHA 4QJ5A 4S2UA 3PC8A 2AOWA 1TXGA 1PN3A 3MXTA 3T7SA 4WNAB 1CEQA 4IFBA 4LOIA 4ZI2A 1GZDA 3ZYCA 2NVBA 3DFZA 3ONWA 5IF3A 5TJ9A 4UD6A 4OP1A 2IYNA 2W2MA 4I55A 4TUYA 2JAHA 3O7WA 3UXHA 1FPQA 3TFWA 2VNIA 4B47A 4BKQA 5E8RA 1C9EA 2AI1A 1KYYA 4A16A 1AXEA 3IP1A 2YN2A 4YAGA 4M0UA 3QF7A 1J2EA 4KR9A 3FMVA 3EVGA 2VP0A 5AW4A 4I7EA 4BEWA 3CEJA 2BFOA 3L77A 3OOYA 2ZRGA 4B5LA 1EFPA 2BKXA 2AQ8A 4AUKA 1QHEA 1G3IA 1TM3E 4RTKA 3GBVA 4KDRA 4PSDA 3S99A 1GNLA 4R3NA 4ZOAA 2C54A 4BQQA 2QU8A 4RMJA 4ZCSA 1XWFA 2ZR0A 1S2NA 2I80A 2P67A 3KYIB 4U7FA 4IRUB 4XSVA 3ZKWB 3BWVA 5HCIA 1VRCA 5HJ7A 4ZU1X 1YQQA 4P92A 2ZWVA 3OCWA 2UUCB 3MTAA 2XR1A 4G65A 4D9KA 1T8WA 1N6OA 4HZUA 1CHNA 4BTLA 1G0OA 3KJFA 5JZSA 4L6AA 3AESB 3GA7A 1MHPA 1PNTA 2CWDA 2V54A 3BD8A 3I2YX 1G5TA 3RREA 2WG2A 4IH9A 3ZXYA 1EZZA 1QUEA 2XWPA 3EXFB 3ILXA 5TJHA 3GO4A 1RBYA 3C6XA 3QU2A 5IT9A 5DTEA 3FETA 4ESHA 2FN8A 2DULA 1KETA 2VDQB 1JGTA 3TR6A 5CJJA 3ZE8A 3KT0A 4FFWA 4RHEA 1XZHA 3O8OB 1NRXA 4YACA 4B3XA 3ECAA 3HI6A 3TI9A 2VDNB 3ZWYA 1Y0BA 1ZIYA 2ZS7A 3BD9A 4TMTA 2JGRA 2GUGA 3FPEA 1PHRA 1PUXA 4TL6A 4IXTA 1YACA 4JP8A 1BHJA 2YHIB 3N1UA 2VF2A 2ZYTX 3IIIA 3HMQA 3GLGA 5EESA 4OATA 3S8EA 5IJXA 3ZCXA 3JQGA 1QZ3A 5DBEX 1HT3A 1K8ZB 2WTAA 2H63A 1SOAA 1ZYUA 2F8LA 1OV4A 4C4XA 2CLCX 3LA6A 2KPOA 1VPTA 5KI6A 5B3JC 1E99A 1EHIA 3KELA 2WU0A 4AZSA 4J0GA 3BEOA 5FBVB 3AR8A 2B9EA 3AC0A 4K03A 4DAOA 5CBPB 3WLNA 4EG5A 4HN2A 2CZGA 4IJMA 4NCBA 3MBOA 3G0HA 3BDIA 3N3AC 4YRFA 3EMBA 3SE0A 4QGGA 3DZGA 3VPDA 1MX3A 4TKUA 3ZE1B 2ISSD 1XEWY 4L8GA 2D0OB 1ZISA 1PQWA 2OV4A 1A8QA 1IATA 1F5SA 1OGJA 3FZEA 4M83A 5H83A 3NH9A 3ZR4B 1VPEA 4BP9A 4BQIA 1N6LA 1XVUA 3DO6A 5LJIA 2PGAA 2YW9A 4DCMA 3HZHA 3FYSA 4RLSA 3BX1A 4IQFA 2J9FB 3GFOA 3DC2A 3BE4A 5FOUA 3IFSA 2HCFA 1DXOA 2C4NA 3NTQA 3Q9LA 1PT9A 2D7DA 1VKZA 1YS6A 2H0RA 3T5CA 4CQJA 3N9IA 3PNMA 3FR7A 2I3ZA 1C1DA 5CLIA 4ZHQA 2WJ4A 3KK0A 3A9TA 3HDVA 1H1LB 3K72B 4UUPA 1C80A 4OG2A 4X1IB 3UCFA 4BLSA 2DUNA 3HY6A 1LXCA 1FXWF 1EE9A 3QKRB 3W5AA 1TA0A 2PFSA 2WK1A 1JWLA 4Y2TA 4MS4B 1CUJA 3DXFA 1DIBA 4TV9B 3ROFA 3GEBA 1BWSA 2CXUA 5DI3A 3MHPA 4LWPA 2GESA 1P4GA 4CL8A 2AC2A 1FZQA 4PLCA 4NECA 5ALNA 3WHLA 4H31A 4RA6B 2XOXA 3LBFA 3VSBA 4XVCA 1XCOA 4MWTA 5CHYA 2ZPTX 4OHPA 2V6MA 5DV9A 1XQYA 1QTNA 3FDZB 4LBWA 3G9TA 1JHVA 2ZCVA 3ZV7A 1AS2A 3FTFA 4ETMA 1E3WA 3R2JA 5LQAA 4IF6A 3WL5A 2JLWA 1G3UA 3QI7A 5C81A 1ADCA 1JDTA 4GMXA 4R5MA 1NR1A 1QC5A 2H3EA 4JJKA 2KBFA 2IUUA 1JDPA 1Q14A 5FDFA 4IXMA 5AW9A 1I7DA 3FHTA 4O59O 1N78A 4B4WA 4JXXA 1KBZA 3C3JA 3DW1X 1PJLA 3MT7A 1T5OA 1TIPA 1T5LA 2WHXA 3EXHC 5C5IA 5KZMB 2GARA 2NX2A 3EVTA 3LL7A 3IPXA 4FHGA 3F46A 5KYXA 2O07A 1UUFA 3TLYA 4YECA 4P84A 5GOZA 2RH9B 2P65A 1KY4A 3MWYW 3CLHA 3MJEA 3TJMA 1B41A 4IOJA 4FOOA 1G7RA 4KN5A 4D0SA 1FTQA 1JEDA 4EF5A 1J9EA 1DAIA 3OEHD 4RTJA 3QBEA 2NYRA 3EZNA 3JALA 1XZIA 5A3SA 3SR0A 1TPZA 2V9ZA 3OLVA 3SN6A 3VNQA 3TLBA 4Z86A 2C31A 5KX5A 5AKKA 3KQLA 4DIMA 1JBKA 1ZN7A 4QU0A 2HAEA 1H5QA 1VE7A 2CK3A 3HCCA 4INAA 4F93B 4V0NA 1XCLA 4DXAA 1C7QA 3HB0A 3WGKA 2BW0A 1WF3A 2REQB 5FBLB 3OE1A 1JFFA 2WU8A 3CUSA 4X3PA 4YJ3F 1JDBB 4OAOA 4BFYA 2CJWA 2CDBA 2D1YA 4A03A 3ZWAA 1EPUA 4AL4A 1OIWA 1TU3A 1J25A 2RGNA 4EY8A 3GEEA 1HO3A 4PVCA 1XNJA 1X1RA 1KAEA 3KXDA 1MG0A 2JW5A 2V7WA 4OCZA 2WYOA 5EUMA 5AD1A 1X74A 2GJAA 4DMKA 4ZANA 4QO7A 1W2GA 5DHUA 1JMVA 4FW8A 2PWBA 2Q6VA 2BTQB 2G70A 2QL9A 4WHMA 2WHRA 3T1OA 1Y7TA 2RGRA 3KR0A 4DR4B 4O4LB 5K8VA 2P9EA 2IYYA 5KSYA 2Q6OA 4ZT5A 1C5KA 1NF3A 1Q7BA 1NW3A 1XLUA 2QTLA 2XUDA 5CVVA 1X8LA 2ZS9A 4BFSA 5B57C 2XVYA 1NI3A 4MJ7A 5K6AC 1SBQA 4K6OA 2HSEA 4HDCA 5KYNA 2CKDA 2EGGA 1WMAA 1X80B 1UXOA 1DTWB 2EHJA 1YR3A 2QI9F 3HA7A 3LDAA 4N01A 1CUGA 4GLBA 5AOBA 3RHSA 4XZ3A 1I13A 3RT9A 4DW8A 1Z13A 1JKXA 3KQSA 2YN0A 4P1ZA 4UCXA 1Z75A 3RKUA 2B37A 4ND2A 2G63A 1PZHA 5JFGA 2VJBA 1T6NA 2EKQA 3AZQA 1Z29A 4WWHA 1GV0A 3NRJA 4LY9A 3FFWA 5FA5A 4BMXA 3H87A 1A0OA 1X86B 2FZGA 4HXEB 2PGXA 4L3WA 5IEBA 4F21A 1Q19A 1QMPA 3FR8A 1QYXA 2JCVA 3DE5X 3OZFA 2Y1OA 1NJSA 2ZIGA 4F7DA 1JQKA 1X7ZB 2HTFA 2PA3A 3FOZA 1BOFA 3EODA 2IF0A 4MQEA 2A6PA 3TEMA 2BH2A 1U0HC 4PSUA 5IN5A 1JFSA 3W5VA 1BDBA 3F3SA 1C7RA 4NPAA 1IZZA 1PZFA 1CY7A 4LHWA 2W6PA 5F9FA 4RZQA 3FPSA 1ZIPA 1D6JA 4WFJA 2Y1XA 4X7PA 3GWZA 4P5PA 2C0QA 3KB8A 3ZWWA 4JBGA 4C0QC 3OZ7A 3T0GA 3IPCA 4AZTA 2R7AA 1G8GA 1Z4MA 1BKSB 3SD7A 1M34B 4A8HA 4C6TB 4C7OA 2DUJA 1CBUA 3UOWA 2CSXA 4RETA 3L7OA 1R1DA 4BNZA 3STXA 1C8LA 2CL0X 2Z83A 4E0BA 2WM2A 4HBGA 1U4NA 3TIGA 3O1JC 4MW1A 1DAHA 3ZDYB 4KLZA 4B3RB 1JLLA 3H2ZA 2V7GA 2IY8A 4G1FA 1RADA 4O4IF 3D4NA 1POXA 4PZUA 5FTMA 1JR3E 1WV0A 1CJBA 2AG1A 3AQ4A 4R16A 5EPOA 3AF6A 4Z0HO 2JLQA 3NUQA 4I4IA 3OEED 4RMIA 3V8EA 4IS2A 1TUIA 3EXIB 3QWHA 1Z45A 1L7PA 2C2MA 1QZZA 2D8MA 1WW2A 3DE4X 3HBAA 4IXDA 1MRNA 2OCXA 4HRYA 4JP3A 4MGYR 3WK4A 3THWB 3PD1A 4OQNA 1KDYA 4P2GA 1DBVO 3DZ8A 2JEOA 3FKJA 1QFMA 1ZNWA 2HU8A 3H1EA 5JZ9A 2C83A 4EA9A 1PVOA 1PJTA 2I65A 2ALJA 2Q0SA 2XZDA 3DFFA 3HP4A 3Q7EA 3ROPA 1BS1A 4BLVA 1PTJC 1JH9A 2CV1A 3E3MA 2GPNA 3QLUA 1I33A 1NL3A 4JB3A 3MF4A 4UTVA 2J7PD 5E6RA 3AM1A 2R5WA 1O2DA 2PZBA 1XHLA 2OO3A 3CMMA 3NVDA 2FA9A 1P4SA 1Z7GA 1DB3A 3PXEA 3R3YA 3RSHA 2LWIA 4J1NA 3WRVA 2RCNA 4ZI7B 4ENRA 4GOJA 3NTRA 4Z53A 4IGFA 2FW0A 3IDOA 4UM9B 3LVRE 1NXVA 1JLHA 1U0JA 3ETGA 4M1KA 1Q3KA 3VR0A 2HMTA 2VBCA 3HABA 3Q41A 2JI7A 2HIGA 2YZ2A 1M6EX 3AFOA 4Y9SA 5JCOA 2X7HA 3T52A 4A10A 4JHLA 3A4MA 5KYYA 1UBFA 1DJOA 2GRJA 2RONA 1NF8A 1W2WB 3RYHA 5HKAA 2RH8A 4CM8B 2AI2A 2Q5IA 3T5BA 4AJ1A 1TJ3A 3OJLA 1FVFA 1XBTA 4NJMB 4HDAA 4ZT3A 1OREA 4WY8A 4G41A 1B8OA 2TYSB 5C4IA 1EVEA 5A2GA 1QGAA 4N7BA 3CNEA 4E31A 3DKVA 3KWJA 3PDWA 4MUNA 4MJXA 4OUDB 1E2DA 1LK5A 4PRYA 1D03A 3F6BX 4M8KA 1Q77A 1ENPA 1FBNA 1BHSA 1JDVA 1S7CA 4F2DA 1YA6A 4UDYX 5ALKA 4KGZA 4V3BA 4FFSA 3VR2A 1G8AA 2BHRA 2C8VA 2O9JA 3G2OA 2DHEA 4PLYA 1JEEA 5JG7A 4RSMA 1ZSYA 2O8FA 2ZLBA 2AFHE 3LV8A 2R4UA 3MUOA 2V3WA 3GVCA 5BV2P 3H6GA 1ZJ6A 1QZTA 1UBNA 3ESBA 2XUZA 2EKLA 5HTKA 3MT8A 3T6KA 5TF4A 5JH7A 2PGIA 4D98A 1NNI1 2BKEA 5EKSA 2G06A 3KBBA 2F4VB 2ZSDA 1Q1EA 2W5UA 1RRKA 3LW7A 4NOLA 2OZLA 3NIDB 4BZXA 3M4YA 3ANYB 4UCWA 4KPUB 4X84A 1BGVA 1KJIA 2QN7A 2W8ZA 3B9PA 4IIGA 4W8OA 5A3VA 2C5SA 4B1FA 2GR9A 1N2SA 3DVRX 4IWXA 3IIKA 4OFZA 3FCEA 4B8YA 3I2KA 3RVMA 4LZAA 3T9EA 4BB0A 4QDTA 2X86A 1TMOA 3K2EA 4QQNA 2IZ5A 5NLLA 4ZARA 4NICA 5IABA 4RHTA 1QLWA 2I6XA 3ESZA 3AM4A 3IOYA 1BSVA 1ZI9A 2ENUA 1QYWA 3S4YA 4PZZA 2VUSA 2P9HA 1P1IA 2GQ0A 4JP5A 1PD0A 1Z8FA 1WE2A 1NVGA 2ZKLA 4JODA 1SVMA 3UNXA 4DZZA 5K01A 4JI3B 2VYND 4D57A 2ATVA 4BJHB 3UB2A 1U63A 4KVGA 4XM1A 1XX6A 3WGOA 5K9ZA 3BE5A 4YAJA 1KIAA 1M6NA 3L6EA 3FI0A 3GJYA 4U0KA 5EWLB 5JAPA 1IK6A 4JEIA 3I32A 2GERA 4C01A 4LAFA 4P7JA 3ZHOA 5A5VA 1ZGBA 1Z9BA 3JQAB 1TTHA 3C48A 3GLVA 4AWAA 4D82A 4ABYA 2JGNA 2OSVA 2VYVA 3MGBA 2ACEA 1W0JA 1LLQA 1EFRA 2GK7A 4LECA 4TTPA 1L4GA 5FWXA 3R76A 3T5PA 2R8BA 3N74A 4FN5A 1RYNA 3EULA 1HKHA 2N0SA 3L7IA 4FFLA 3W5IA 1WRBA 4DQLA 4HB4A 3TRFA 1UK9A 2AIRA 2H3HA 3A1TA 1RZUA 2RHGB 1ISPA 2WYIA 4RHCA 5EWJA 5TGTA 3IBTA 4TV8B 2HJWA 4FFMA 1SK9A 2ZI6A 3NWOA 1G5QA 1YS4A 4MA4A 1TKAA 2W83A 5ALLA 2H0QA 4U8HA 3ONVA 4P8RA 3LT0A 5H4HA 1DADA 3RFFA 2Z2ZA 3EOAI 2Y0EA 3QVVA 4BMNA 3HK2A 4TMWA 4KRFA 4KPFC 2B1IA 1OZHA 4HAYA 1DKQA 5C8ZA 4G5HA 1ESZA 1ESDA 3SLRA 3D7KA 1QF9A 3R5KA 1QOQB 4LV8B 1QIGA 5L6MB 3OLYA 5T4HA 4ZTZB 2NACA 1U3WA 4M1MA 2GRUA 1JS1X 3OTWA 3MJFA 4OD0A 5M34A 3IP7A 1RU3A 3IDZA 4FFOA 4GZ3A 2IH4A 3C8MA 3AH8A 2YOFA 4WASA 1XJCA 2Q6TA 3EDQA 3EVZA 3U7RA 4IJ5A 1D5CA 1C9JA 4YI5A 2DFLA 3P2IA 4NOKA 1JHPA 2B3DA 1Y7IA 3L6RA 1M72A 2BRUA 1JA0A 2XOKA 1DQYA 4ZVKA 1YI1A 1W1IA 4L9RA 3S1AB 1JB1A 2IUYA 1F4PA 4KDFA 5CEFA 2MMGA 1U0FA 3GVXA 4WOCA 5F73A 3QENA 5BN3B 3BB1A 4YRIA 2QVXX 4E88A 3DP9A 1B14A 3PIDA 4E13A 3JQ7B 4HD8A 1W87A 2O6LA 1NBMA 1Y63A 1DZ3A 2NTJA 3C3EA 1GRVA 3FWKA 1EMDA 3A8TA 3VAAA 4W5QA 4K86A 4B9EA 3SSAA 3EA5A 4XVHA 1QIKA 2VJCA 3EEIA 1E69A 5KQSA 2BBWA 3QE3A 3ET5A 1C7ZA 3N2GA 3Q40A 4GP7A 3U1TA 1ZUNB 4BQEA 4UU1A 2F90A 2XKJE 3G2HA 4BVGA 4G5GA 2I2AA 1U0NA 1NJ1A 4XJTA 3TZKA 3NV9A 3UEOA 3L4JA 3P5SA 1A5SB 4YR7A 2L18A 3ENQA 2Q50A 2G1KA 1YI0A 4OI4A 5U4XA 1CZKA 3KKOA 1OSNA 3L49A 4IQ0A 4X24A 1RTKA 2MWMA 3IE2A 5EWMB 3RAFC 1JHYA 3QUQA 1T4MA 1NYTA 1IZ9A 2X7JA 1D6SA 3P45A 4KAAA 3O9MA 4KVFA 5KTNA 3PCRB 3CUEF 2PO5A 3OZAA 5FWYB 2GA9A 2J3JA 2WM9B 3E1KA 3M1IA 1G4UR 5DW0A 3OU7A 1EFUA 3PQ3A 3IULA 3KG2A 2VBIA 1T9AA 1PG2A 2JANA 2ODWA 3DSRA 3VDRA 5BVGB 3GUZA 2QL5A 4KYIB 4M1WA 1JEYA 1IDN1 1RCUA 1KY3A 2ON6A 1P9OA 1QLHA 2AEEA 3L7MA 2QD4A 4EITA 1RLJA 2XCRB 1SQ5A 2GCNA 4MYSA 3STTA 4EPRA 4ETWA 2A33A 3LC0A 1P4HA 4HC4A 2ZI9A 2IVZA 2H52A 3ONEA 4XX0B 1HT0A 5KQPA 3H05A 3OAAD 5LXTA 4HLDA 4D3SA 1TM4E 1D2NA 1IEQA 1U7PA 1X6VA 4ZZIA 5H4GA 5JXWA 2O3JA 1PR0A 2QQ5A 1HDZA 4H7FA 4HZGA 4WGGA 4AECA 2PH1A 3PXBA 4BRUA 2CDCA 1YTUA 1FU8A 3PKJA 4DGQA 5AI5A 4BMPB 2P4SA 1TM2A 2ZWAA 4LBYA 4QX6A 2JI6A 3PXGA 3T3DA 4C6SA 5EGNA 3O5AA 3U6KA 1E32A 1NC1A 3O91A 1TRHA 3ONFA 1VBMA 3FX2A 3LUDA 1JECA 4TMXA 4CDNA 1XD8A 3JQ8A 2GZDA 2WJJA 4FDAA 1SOWA 1V6AA 4DLZA 4EG3A 5I9BA 4KR7A 2NU8A 5KHOC 4QPDA 1XXHB 1W8DA 1RMYA 2GETA 3LNTA 5DBOA 1ECPA 3W7VA 4F56A 4RK5A 4QQFA 2MINA 3RHTA 3CJTA 3GPDG 3GYBA 5KC9A 1VJRA 4FZ3A 1EUQA 3VOBA 4QBFA 2QG9A 4H77A 2JGJA 4IPTA 4RY9A 2GEFA 1UOOA 3QLUC 3ELWA 1V8ZA 2C4VA 4ND8A 3GW8A 4ZT6A 3AL0C 1XL1A 3GLTA 5GOTA 2ZROA 2ARKA 3PT5A 3CZPA 2OZEA 2GN8A 2JCYA 2J45A 4WOBA 1KTVA 2Q0XA 3A04A 1UWLA 3MS7A 4ARSA 4C5BA 2G5TA 4LPKA 3WYDA 1QE0A 1OC4A 3RIEA 4PLVA 2HJGA 4DJEC 5E7IA 1MP0A 4FB4A 1W5AA 1A2OA 4GGPA 4DBLC 4ZDWA 4UPVA 2IXEA 4Z0PA 5H16A 5JASA 5JI3E 1HDOA 3F0TA 4HDKB 5JCOC 2W2KB 3PXXA 3K15A 4YRTA 5HUQA 1WB9A 2IWHA 3N0VA 3TTSA 1BEUB 5AKJA 1NLFA 2XSZD 3RS4A 2HJ9A 3OP1A 4WLOA 1YUBA 3S2FA 1TF5A 1ZD9A 1EVKA 1P81A 1Y8AA 7REQB 1MZPA 1SU4A 4LSGA 1JJ7A 1KE2A 1AQYA 1Z5PA 1WA5A 1YAHA 3BTVA 3SEQA 3MILA 2XMSA 1ZHHA 5HQTA 2Q45A 2XMGA 1ZD1A 1T2DA 3HEBA 3TO5A 3CUTA 3GQBB 1N2ZA 1QB8A 4TVSA 1PBNA 5I48A 2QTTA 3AGPA 1INLA 1XFDA 2J4DA 4UASA 1MVNA 3WGLA 3BIXA 4PFQA 2Z4SA 1EK1A 2QD3A 4MJ3A 1T2EA 2VP3A 3RT7A 3ZX4A 3BMCA 6Q21A 4OXNA 3PVCA 3KVOA 5TE9A 5DXFA 4DA4A 3B6MA 1N2HA 4X41A 2VNSA 1R9MA 1I7QB 3VDQA 3IR7A 1JH8A 1N5DA 3PGA1 4W99A 5FWDA 1GYQA 4REMA 5F4ZA 2H2FA 3TGWA 2YJ4A 1UC5B 3M1LA 4J16C 1KMMA 4M46A 5G41A 2FHSA 3WIUA 4DOMA 3L7CA 4BPBA 4K81B 3U1VA 4EY4A 2YNMD 2XECA 4PLTA 4QATA 3JASA 2OOKA 1JI3A 4Q15A 3TKLA 4L7VA 1N1GA 3U0VA 2CXTA 1R64A 4OBWA 3JWIA 3IPAA 5KVSA 4DIDA 4F8JA 1J5EB 4Y2VA 1U80A 5FV4A 3I92A 5L95A 4C4TA 5BV0A 3BK2A 1K63A 4UCFA 3N2YA 1X1TA 4ZK2A 3KAQA 3OEWA 1E9VA 2O2ZA 2WOJA 3LY7A 4GPZA 4DDUA 2JC3A 3I04A 4WBSA 3SC3A 4JI7B 2O3UA 3CPHA 3CRMA 4E70A 5K0GA 4KX3A 1GVNB 4U1RA 3FUWA 3SJCA 5F76A 4I5DA 2FE1A 3ZLJA 1AOXA 3LUPA 4D0LB 2QYSA 3I4FA 3TXXA 2PRIA 3AINA 1MIHA 4IMJB 2EG5A 3UGKA 5G2OA 4CMIA 4NYMR 1BNCA 3NHJA 3HU5A 4HYEA 4CMEC 1T9DA 2WC1A 5LQUA 1XLTA 1NLYA 4O3FA 1SELA 2JASA 2NZJA 2PMCA 3KT8A 2YRXA 3N2KA 3Q1LA 2VAVA 4J03A 3TEFA 1GGHA 2GJ9A 3W4KA 1CRWG 5EIWA 5C1BA 2AOUA 1CERA 1XTBA 2ZVDA 3FMFA 3M6XA 1NUPA 3FLEA 1VGVA 4MWGA 5DNCA 3RYFA 2FUKA 5AKIA 4X63A 1P5RA 2H4JA 1V8DA 2CMDA 1R6DA 4AJ9A 2BFCB 1FQKA 2C4WA 4MW5A 4N47A 1NC3A 5IBQA 1K8QA 1M5UA 3LCCA 4FQ5A 4E5VA 2Z1DA 3BQ9A 3WDKA 3I8OA 2Q4EA 3PWSA 3JD4A 3P2MA 2Y92A 4L75A 4MITA 3N2ZB 4RQBA 4WKBA 1EXWA 2O8DB 3KUDA 1YXMA 1XR3A 1RNLA 3TMAA 3VJMA 1OFHA 3UMMA 1BDIA 4MWBA 4UE2A 1C4KA 5G0TA 4AY3A 3K1JA 5FPTA 1G8SA 2XBLA 4DR5B 3RK0A 1GQYA 4FZRA 1LDEA 1UJBA 4II7A 3D3NA 3WTCA 5HZGA 2IOFA 4DFDA 3O0TA 3W6UA 4WADA 2JGDB 3G5TA 4UTNA 2I3DA 1NONA 1IBKB 3MHTA 1QTQA 2FF7A 1JW9B 1HH4A 5DHAA 3FE2A 1H05A 1G7CA 2B99A 3LOPA 5DO9A 5JS1A 2V6FA 4MO9A 4BGDA 4MCJA 1LNQA 3N5CA 1TK3A 4KO4S 1BMFD 3A05A 4R9VA 4CUJA 5J5VA 4B33A 3UT6A 2AC4A 3L02A 1TRKA 2VTVA 3A3KA 5JFOA 1AA6A 5G0UA 4B09A 2OXRA 2QVYX 1UJ4A 3QHAA 1IE3A 2JVJA 4EKEA 1QFZA 5A6VA 4YWHA 1AB5A 3ZK9A 2HT1A 3GZTB 3GI1A 3GMTA 1XU7A 1R66A 4FDMA 2ETXA 3GFFA 4QTYA 2HRRA 3EIOA 5HOQA 2YXNA 1Q2UA 4ASUD 3OZIA 1TJPB 4KUEA 3TTTA 5DASA 3A2NA 2B69A 1GKYA 2R48A 1THTA 1U8ZA 4BNWA 5LWHA 2HOQA 2CMGA 3B70A 5IUJC 4RTPA 1ZIOA 5I7AA 1RI5A 2Y1DA 3HFGA 4LMBA 4TVKA 3FKSD 3SJ7A 2YOGA 1PYDA 3SBDA 3GPLA 4FFBA 2VXBA 1KERA 2W6NA 5AI4A 3TLMA 3PE4A 1X7DA 3W1WA 5J4KA 5JC1A 3VR4H 3OQJA 1CUHA 5ENZA 2R8ZA 5BQOA 4D8XA 2WV9A 4MPJA 5IYZB 1ZLXA 3KRTA 4NQZA 4H16A 4IYJA 3LPCA 2Y77A 1X8JA 4NX2A 1STOA 1JMYA 2BBTA 2IIPA 1HG0A 4Q01A 5J2UB 4RJTA 4Z51A 1AMUA 4G07A 2GCEA 9ABPA 3ANXA 4MQ6A 4ZKEA 3ZNQA 3NIWA 3BL8A 3FSRA 3U17A 1LBEA 3LLVA 3JV7A 1L0BA 3WLMA 4KU4A 1DAKA 1DBSA 3KJHA 5DE3A 4ND4A 1HDRA 4Y0AA 1P5JA 3VR5H 3ZV3A 4DSAA 3L8MA 4Q4LA 3VSEA 2C29D 1P2BA 4J1QA 4Y30A 4BAGA 2CBGA 1HFJA 2FSVC 3WQHA 1A77A 2P62A 3EWNA 4ESEA 1M1YA 4HUJA 3SU8A 3H2GA 4LJ5A 1M33A 2W6ID 2YY6A 4RAOA 4WKCA 4AZ3B 4ZI7F 2BBSA 3CY6A 3MRTA 1U4SA 5C7OO 1NQTA 3IXLA 4AZ0B 1YB6A 1S7GA 5KVQA 2ERYA 2H1LA 5K3BA 3V46A 4H1UA 4GW3A 3M34A 4Z9YA 2FFHA 1CQIB 2KQUA 4YMHA 1SU7A 3SFZA 1ESNA 4RVNA 3DDCA 1W47A 1P91A 3W05A 5KCMA 3ASUA 4N0EA 1OVGA 1W0KA 2I7VA 4A23A 3L4SO 1YL6A 2CEKA 5CFNA 2CXQA 3IVXA 1W59A 2BEWB 4LCJA 1L7EA 4F0JA 2WA2A 2NZ2A 4WJLA 4YR9A 1EXDA 1P1FA 1XRMA 2VTKA 1YE5A 1WL8A 4JC0A 4CETA 1M0SA 3OQIA 3CVOA 1AE1A 3VHXB 2XZOA 2GCPA 2GASA 1XHFA 1IQUA 5E4FA 2VHXA 3AERB 4PZPA 3ZDAA 3V7FA 2H2HA 5C52B 4U2BA 3T1NA 2Q1XA 2VCHA 1KJWA 1E6CA 1MMFB 4IIBA 3FOEC 1QBKC 3L46A 1GGMA 1WVGA 3DFKA 4TXJA 1ZC3A 4L5BA 2IK8A 3CMCO 4D9IA 2ZE6A 1KNXA 1YB7A 3OQPA 2GN0A 1NUAA 3QWIA 4R1TA 5HQ3A 5JYCA 4NCNA 3W34A 4BBJA 4QXRA 4IGKA 1U99A 5CP8A 2ZJ8A 1FJGB 3KDPA 5AVXA 2Z3ZA 2X41A 5FLYA 4OY3A 4R83A 3RANA 4AQYB 1XNGA 1AK1A 3U3XA 1G20A 2ESRA 4ARAA 4IO0A 5AK4A 2HCBA 1ORIA 2OC9A 4FXPA 4U3JA 2V59A 3D6MA 3RTBA 3UAXA 3Q5EA 3W8RA 3L7DA 5IUKC 1AV7A 1K7EB 2PMWB 3WK7A 5K0BA 2PSDA 4Y0VA 4GVPA 1IMOA 4OLJA 4PYQA 4AMZA 5KQRA 1UZMA 2ZUUA 2O23A 1NW8A 3K0AB 2VDVE 4WINA 1SA0B 2H57A 1T6YA 4LOLA 2HREA 2F59A 4NG4A 4XAQA 1JLSA 3EF0A 4UVDA 1T5HX 3B6KA 1QFJA 2OGTA 4D26A 4A15A 1SOUA 2GEBA 2XCLA 2ZBGA 3D7RA 1WPXA 1G6HA 2BUBA 4BQOA 4MICA 4YJ2B 2RCYA 1QAOA 3QPWA 3NMUF 1ST2A 1LDNA 2FHPA 1U2TA 2WB4A 4FDTA 2ZYSA 1A7JA 3K6SA 4E5KA 3PFBA 3FDFA 3UJ8A 2C1XA 3QOFA 1E5QA 4NZ9A 3AHFA 4K7JA 1ZR2A 2HMUA 4ITUA 2EEPA 1AF7A 1KJ8A 2QTMA 3OU6A 4DCNA 3K73O 3FGZA 3NC1C 1JE0A 1OILA 4YUYA 3T7TA 1LF0A 3AVQA 2BCEA 2IEBA 3KYDB 2AB0A 3AUSA 1MPXA 1MQAA 1KMHA 1RQPA 2WFZA 3OTHA 4OM8A 2ONYA 4C7VA 2OBYA 4GGMX 5H70A 1KYQA 3GUHA 4G6ZA 1CV2A 2GSWA 4JASB 2Q21A 1G4AE 1BFUA 4NL4H 3I6IA 4W7HA 5TMDA 5JDIA 2C3OA 4N76A 4DDHA 3IOBA 5JD5A 1A5AB 1FMTA 2VDWA 3ROQA 4TV8F 2Z0MA 3OE5A 1ZO8A 2Z43A 4I9UA 2IEDA 3O75A 4IH1A 4TPKA 4W5WA 4KXNA 3UAZA 1Z73A 4BBAA 3H0CA 2ROQA 3ZVKA 1Z7BA 3DB2A 2J6HA 5H3CA 3TZ6A 3OG9A 4C0HA 4RQUA 3IT1A 4U2DA 1E2IA 2G9VA 5DHTA 3CUKA 2Z2KA 3TVYA 3JR3A 1KQOA 4WA7A 2WF5A 4PPYA 4AMVA 3A37A 4X92A 1NI4A 4CLOB 1I0LA 2OXFA 2G5PA 2W22A 2F17A 3WMGA 2EWWA 5IANA 3GJQA 3AEYA 5DBHX 1K3UB 1JZTA 2BBOA 4MWEA 3RVDA 4YUWA 1ZH2A 1Z4KA 4Q4HB 1H8HD 2PXHA 3LSYA 1NI5A 2OCKA 4N5NA 4MW9A 1BXGA 5ILQA 1EYZA 1V4VA 3KUXA