2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
5DWDA 2VT7A 2V97A 4E46A 2PM8A 2XMGA 4BAGA 4V2IA 4C87A 1WM1A 5ALJA 1XRMA 1XZDA 2QUAA 3H2KA 2Z3WA 5HF6A 4B85A 1CUJA 1FFBA 1EVEA 4GDMA 4C89A 4Y2XA 2BGRA 3FCYA 2WJ3A 2XMRA 4XWGA 4NVRA 1ZD4A 3DDUA 5C81A 2V96A 2Y2VA 1ZIXA 3K9BA 3A6ZA 4UHBA 1Y7HA 4FLEA 2H7CA 5JD4A 1FFEA 5JATA 1SOMA 5AK3A 1QIDA 3FYUA 1G42A 3CN7A 1QTIA 2RHWA 3FYTA 5AKGA 1EA5A 1SCQA 1QFSA 5CXUA 2ZVDA 2WG1A 1WCYA 5DJ5A 3H18A 2C4HA 4H7HA 3EBLA 5ALOA 1CEXA 2D5LA 5EHQA 1N1MA 4Y2TA 4FFVA 2B4KA 4WY8A 3WI7A 1VXRA 4BRZA 5AJHA 1IUPA 1OXMA 5ALSA 3R41A 3ANTA 3DQZA 1QZ3A 3D5EA 2WUDA 1MJ5A 3QH4A 4I19A 1EHYA 2C7BA 4EY5A 2PVSA 1QIGA 5JARA 2XMBA 3WK7A 4HAIA 2WFZA 2XE4A 4BVKA 3EQ7A 2BFNA 2QKYA 4G9GA 1U4NA 2GBCA 4UUQA 4KE7A 4PNZA 4EBBA 1N5MA 1WHTA 2OLEA 1CUEA 4GI1A 1VE6A 3DOIA 1QIJA 1YB7A 1GKKA 1GQSA 4MQLA 1EB9A 2QT9A 4UPDA 5ALHA 3I6ZA 1XQWA 1CUIA 3HJUA 1AUOA 1D07A 2XUOA 1CUWA 3G0DA 5AOAA 3QMMA 4LYEA 1ZI8A 3WWOA 3E4DA 2AJDA 4KE8A 1XQVA 2AJBA 3QPDA 3WIOA 4DMKA 4P9NA 3VXKA 5LP1A 3ESBA 1CQZA 2QS9A 1JJBA 2O7VA 2LIPA 4KJXA 4WFJA 3QPAA 4MWTA 2BUCA 3EIOA 3V1LA 3F8SA 1XRPA 3V1NA 1ZI6A 3C6YA 3KDAA 5FXMA 4BCBA 3WQHA 1CUBA 3FWHA 2JEZA 3GUUA 4F5ZA 5D7BA 2WUEA 1ZICA 4IH4A 1E3QA 1MX1A 4A16A 4DIUA 2PU7A 2PKYX 5LKAA 4B9EA 5AK6A 5LYYA 3H1BA 4X94A 2C5FA 4Y2QA 1VA4A 3AZPA 5FP0A 4J0KA 1VA5A 4FTWA 4B6GA 4N8SA 2XLBA 2PL5A 1BCRA 5AM0A 2XMCA 3R3YA 1ZD2P 3R3XA 1AKNA 5CT8A 3N0TA 1CV2A 4CIAA 4OD0A 4JYPA 2XUDA 4H35A 4QDXA 4WCVA 1X2BA 1MX5A 1DWQA 2YXPX 1AMNA 5A2GA 1RP1A 1UK7A 1T4MA 1P0IA 2ZSIA 3IB3A 1ACLA 4G4GA 3IULA 5HF9A 4Q82A 4KACA 4U2FA 3G0CA 4Y9SA 5LKRA 3LP5A 2HA6A 1EDDA 1YA4A 4OB8A 3HZOA 4BE9A 1R4ZA 3VJKA 1WB5A 2BUBA 4MJ3A 5ALLA 4A23A 1XZJA 1R3DA 1G4HA 2UZ0A 3QVMA 5JIBA 2X5XA 1MAHA 1N8SA 4J0IA 5LIPA 2JGFA 4G9EA 3WL5A 5EFZA 3LS2A 1UWCA 1XZHA 2YH2A 3VKFA 2XT0A 5KWJA 4MWSA 1TIBA 3PF9A 3H19A 5EGNA 3V1KA 5ALIA 1GPLA 4W63A 3JW8A 4UHCA 4OYLA 4KAJA 1JI3A 5HF8A 4DSZA 5T4FA 1XZLA 1TCBA 3QITA 4HTAA 3Q0TA 2VJBA 3STUA 5KBYA 2HA3A 3DNMA 5BWCA 2OCLA 4F21A 4RE5A 3V9AA 2VF2A 2HU8A 5CXXA 4NS4A 5EIEA 2Z3ZA 3T52A 1DT3A 1CUSA 4FMPA 2ONCA 3WKBA 1YR2A 4UBMA 1YS1X 4K6KA 5LZ5A 1XKTA 3BJRA 1Q83A 1DT5A 2VEOA 2XQFA 3R3ZA 4E11A 5A7GA 3HEAA 4Q3KA 4UBJA 3BE8A 4WDQA 4LHEA 4BP9A 4AQDA 3HACA 4HXFB 4X95A 3BF8A 4H0CA 5CTAA 4U2EA 3AINA 2WJ4A 4G8BA 4DNOA 2FX5A 4FLFA 5DNVA 1DU4A 1LPSA 4FNGA 3F67A 3O95A 1F6WA 4BCCA 2RHTA 5K3BA 2RGUA 4OSEA 3EQ8A 5HQ3A 1YS2X 3E3AA 5AM4A 5K3CA 3PUIA 4BC0A 1UK6A 4RNCA 4ZV7A 1LBTA 2WTMA 1GZ7A 5JASA 1XQYA 3O4IA 1RWQA 1LGYA 1XKLA 4W1QA 3WJ2A 1W1IA 4KRYA 1MTZA 3DYVA 5LZ2A 2HFKA 2ZJ7A 2ZYHA 3OPMA 4MXDA 2X8BA 1QONA 2PPLA 4DTCA 5AI5A 3DOHA 2VJAA 3SX4A 4Q05A 5EHNA 1U8EA 5BWBA 1JT2A 4QWWA 1CQWA 3U1TA 2WFMA 4JH0A 3W9UA 5HK8A 4K5QA 3DEAA 2IX9A 1BEZA 4Z49A 1C7JA 1BRTA 5A62A 3AJAA 1QIIA 1DQZA 4BYMA 1H2XA 1EK2A 2OQIA 4JUIA 4YPVA 4ZWNA 2BCEA 4F60A 5E4YA 4FKBA 4CCYA 1IUOA 5CURA 1H2YA 5ALMA 2GBIA 1O6GA 1XRRA 3PICA 2QXUA 1EDBA 1GXSA 1C7IA 2PUHA 4P92A 1AX9A 1ACJA 3HABA 5BOVA 2IITA 2P8SA 3OM8A 1H23A 2WUFA 3BDVA 4J0JA 1S8OA 3WWPA 4BAZA 1MN6A 1THGA 1DX4A 1CPYA 4AXBA 3R3UA 3WWEA 2HA2A 2OCGA 3KXPA 4QDTA 3WWDA 4X6UA 3UUEA 1H2WA 3I6MA 1IUNA 1TK3A 1P0MA 2GYWA 3G9XA 3R3WA 1LPBB 4WFIA 2X76A 5FRDA 2E3JA 3KSRA 3I2FA 2QMQA 3QBJA 2R8BA 3I6YA 1A7UA 3FBWA 4HVTA 3WLAA 3DJYA 4Q3OA 1B41A 2VAXA 2OPHA 4DMFA 1TQHA 1CR6A 4X6XA 5K3FA 4QDZA 3RARA 1DWOA 5LZ9A 1JU3A 3FLAA 3ESCA 1PFQA 4UBOA 5JAUA 4ARBA 7YASA 3GFFA 4Y2VA 1W76A 2WLSA 2QM0A 5A6VA 2XUQA 4TVKA 5HZGA 4CG3A 1CUGA 5DTJA 3PDCA 4CI9A 1I6WA 4Q1VA 2WU3A 2G5TA 3C6BA 5ESRA 1E89A 4QLAA 3E1GA 1XROA 5CH8A 3LIPA 1DTEA 4B0OA 2AJCA 4U2BA 3WK8A 1QFMA 5AHXA 4HRYA 4F0JA 4EA6A 4N5HX 5C8XA 4NMWA 4MEBA 1R9NA 3D2BA 1ZJ4A 1W4LA 4C88A 1P0PA 1GGVA 1CUYA 3O9MA 5AI8A 1JU4A 2OG1A 4ZV9A 2GYUA 4X85A 5AO9A 3DL7A 2WUGA 2QR5A 5YASA 4QDOA 5FDFA 3ZLTA 3STWA 2RONA 2WHPB 3HLKA 1XZGA 4MYSA 4MYDA 1QIMA 2JGKA 1C4XA 2C0PA 2QVBA 4DMCA 1R88A 4DNQA 4LKOA 4JYMA 1UKBA 1HL7A 5JAHA 4KE6A 2V98A 3B5EA 5AOBA 2XUGA 3C6XA 4UHDA 4QDUA 1GT6A 2WTNA 3QMVA 5AM1A 1QTRA 3N2ZB 4KYVA 3STXA 2IIVA 4Y2RA 3WL8A 4BC1A 2ZJ6A 2WFLB 4BZWA 1J07A 5JYCA 4DSAA 2B20A 3ZV7A 3AIMA 1USWA 1J1IA 5K3AA 4UFPA 4EHBA 1JFRA 2OQVA 2QOEA 4CG1A 4E15A 3K2IA 3X3HA 2DHCA 5JALA 3FLEA 4KAAA 4H77A 4B83A 3IIIA 4H7EA 4CIBA 2JIDA 3P2MA 2I03A 3LCRA 5HF5A 5I9IA 3FYUB 4X7BA 2QTBA 1A88A 5CT4A 5JAOA 1BROA 3BWXA 4HRXA 3WKEA 2I78A 1O6FA 5AI6A 1QO7A 3H2GA 1M33A 4DNPA 4P93A 1FJ2A 2VSQA 1PV1A 3FNBA 3O0DA 1X2EA 3SC2A 1BN6A 2XUPA 3JWEA 2NW6A 1YSCA 5K3FB 2O2IA 4CCWA 3F98A 3Q8WA 4X90A 1P0QA 4HZGA 3C5VA 1CUFA 1JJIA 4B7ZA 1A8UA 1CUZA 3STTA 4PW0A 4AB1A 1SFRA 1VZ2A 1UKAA 4AMYA 3IVMA 4X71A 4K2AA 5IKXA 4PSCA 3QMWA 3G0IA 1QIEA 1ZGBA 2QJWA 5F4ZA 1ISPA 2J3QA 4X93A 1WPXA 1CUVA 4X92A 3H2HA 2Q0XA 3ICWA 2WM2A 4AN0A 5J3JA 4H18A 2JBWA 2OXEA 1VLQA 1WHSA 3QM1A 5IVIA 1AQLA 4WY5A 4J7AA 2GZRA 2C0QA 3VJLA 1A8SA 4Y2JA 4LYDA 1EDEA 3G9ZA 3I2KA 4YX9A 1UKCA 5CH5A 1VZ3A 3CCBA 4BP8A 4OYYA 1IMJA 3WKAA 2PSFA 5I8PA 3GELA 4YASA 2JF0A 4C6HA 3H17A 2JGIA 4YK7A 2O7RA 4MEAA 5AP9A 2XQKA 3WJ1A 4N5IX 3SK0A 2XMSA 3I28A 2WHPA 2ACEA 1YASA 1UXOA 4LXHA 2VJDA 4AO7A 4B9AA 3ZI7A 3H0CA 2HRRA 4FWBA 5HKBA 1X70A 2DQYA 3RM3A 1QLWA 3WZLA 3STYA 3FSGA 3FVRA 3AIKA 5ISMA 3G8YA 4INZA 4W1SA 2QXTA 3D59A 2O2GA 4X00A 1J06A 4H7FA 4U2GA 2OGZA 1ODCA 3VVMA 2PSHA 5HFAA 2XMDA 2CZQA 2PU5A 3WKCA 5FKJA 2O2HA 3B12A 1JJFA 1UK8A 1WOMA 1XZCA 3F9CA 4U2CA 1CVLA 1ZIYA 3BF7A 4W1RA 1W52X 3BJMA 3I2JA 4H7KA 4DGQA 4FFWA 5AM3A 1BN7A 5ALYA 4UBNA 1U65A 3AUKA 6YASA 1ZGCA 2WIGA 1FFDA 1HQDA 2ROQA 4H7IA 1DINA 1E8MA 1AZWA 4L72A 1U2EA 3WA7A 1QE3A 1CLEA 3ZWQA 3LLCA 4J0CA 2HL6A 4D9JA 2ACKA 1Q84A 1R9MA 5SYMA 1IVYA 1MPXA 4PV7A 2Y6VA 3ZPXA 2V9ZA 2DFPA 3GROA 1XRLA 5CW2A 5KWIA 1EK1A 1L7AA 4C4YA 1B6GA 3GZJA 1MT3A 3CXUA 5ALKA 2GYVA 2XQJA 2YASA 2WIKA 1XLUA 1BE0A 1ORWA 5AH0A 2HIHA 2OGTA 4XVCA 1JMKC 5LLSA 3I1IA 2FJ0A 1XFDA 5ALFA 1JKMA 2I3ZA 5T4EA 2XUIA 1YCDA 1XZKA 4UBLA 5AM5A 4FNMA 3L1JA 4PSDA 5AK4A 2XUFA 3VJMA 3ANSA 2PX6A 1H2ZA 3IUMA 5ALRA 4EUSA 5D6OA 1MAAA 2DCMA 1XZAA 3H04A 4ZREA 2PSJA 4N8EA 3UUFA 4B80A 2BGNA 2BJHA 5AKIA 4BDTA 3M81A 3GBSA 2CMFA 1EVQA 2AJLI 4EY4A 1EINA 3AFIA 4Y2UA 5AIAA 1YAJA 2BUAA 3D7RA 2CKMA 4K6GA 3MUOA 5E2IA 1E8NA 4GHWA 4L0CA 1XRQA 2VQ6A 1UZAA 1EXWA 1Z68A 2Y2UA 1LZLA 1G66A 4AN1A 3BIWA 4FLMA 3YASA 3DKRA 1YAHA 3IUNA 3M83A 1QIKA 4IH9A 4J0HA 4UHEA 4OU5A 5ALTA 3OURA 1HKHA 1YA8A 4DM7A 2XUKA 3HC7A 4G8DA 5A7FA 4XIIA 3PI6A 2DHDA 2ES4A 3FOBA 1H22A 1JMYA 4M0FA 1GPNA 3B3QA 5AI0A 2QZPA 3OC0A 1WB6A 5EHXA 4GW3A 5CBKA 5DYTA 3WA6A 2VAVA 2EDCA 1KU6A 2HA7A 2WU4A 1K8QA 2GBFA 3A2LA 4GEGA 1A8QA 4GWLA 3NUZA 2XUAA 3G0GA 2HA4A 1KU0A 4BB0A 1DQYA 4J03A 3KOOA 4PSUA 2Y6UA 1PJAA 2VT6A 2XQIA 3BL8A 4S0XA 3WKDA 3R3VA 2ZSHA 3IBTA 5CT5A 5EIAA 1QOZA 2H7YA 2DR0A 4NZZA 2EDAA 3WK5A 3C45A 5A7HA 5AKKA 2JGJA 4AO6A 4BCDA 4IHAA 1EX9A 3D2AA 2PSEA 1XZIA 1W6RA 4RGYA 3WWCA 5DYWA 4BTVA 3ESAA 2H1IA 5BV7A 1LLFA 3C6ZA 3FYUC 2RIPA 2D0DA 1HLGA 3MGAA 1Y37A 4FHZA 1ZD3A 3OG9A 5AKHA 1YB6A 3S8YA 1VOTA 1THTA 4FBLA 1FSSA 2JEYA 1AURA 4QNNA 4AMZA 2I3DA 1NX9A 4RPCA 5C8ZA 1LPOA 4Q34A 2WG0A 3O9VA 1ETHA 4M0EA 1NU8A 1K5PA 5CMLA 2ZJFA 4AO8A 3FLBA 3I2IA 4B0PA 3AILA 3EQ9A 1QGED 2HA0A 4JEIA 3FCXA 1F8UA 3NWOA 5JANA 2GBGA 4Y2YA 3D4LA 1TKRA 5E4JA 4BTLA 2B61A 4X6YA 5LZ7A 4IH1A 1FFAA 5HQ3B 1AC5A 3WYDA 1ZJ5A 5ALUA 4X91A 1ORVA 4CG2A 1GPKA 1Q0ZA 3ESDA 2FJPA 3PE6A 1CUAA 4WJLA 2WG2A 3G02A 3R40A 5JADA 5DYYA 3F97A 2AXEA 3OOSA 2XMQA 1QIFA 5CT9A 3UMJA 3TRDA 3T4UA 5ALQA 3TGLA 4G5XA 2CEKA 1EH5A 4U2DA 5AKLA 3QYJA 2WSLA 4DYHA 4L3WA 2J4CA 1LPAB 1KEZA 4KRXA 4QLOA 4EY8A 4KEAA 5AIBA 5D3KA 3S2ZA 1XLWA 3M82A 4JNCA 2EEPA 4H7DA 3AIOA 1VKHA 1LZKA 2XB6A 3KWFA 3RLIA 2Y1KA 4L9AA 2XMZA 4W9RA 1R1DA 1LPMA 1QIHA 1VXOA 2ZYSA 3RK4A 3WMRA 3IDAA 5K3EA 4WDRA 2W6CX 4GECA 5DNUA 3A2NA 1WPRA 2HM7A 4BDSA 5ALWA 4LIPD 1QO9A 3WK6A 1ODSA 3IUQA 1CIJA 5K3DA 5T4HA 5LZ8A 3G9UA 5KREA 5ALDA 3MUNA 2G5PA 2WIFA 3MVEA 1XZBA 5E4TA 3DD5A 4Y2SA 4DMHA 3HRHA 4EY7A 2JGMA 3DL4A 3PUHA 4W1PA 5AK5A 2ZYIA 3AZQA 3C87A 1R50A 3FVTA 4M0MA 4DNFA 4HS9A 5FOQA 1UOQA 4Y2PA 3WL7A 2K2QB 1HPLA 2HDWA 2WJ6A 2Z8ZA 4Q3LA 4ETWA 2H7XA 4TGLA 2AJ8A 3ED1A 1GQRA 4PQEA 1RYYA 1ZI9A 4C4XA 1AGYA 4A5SA 4FDMA 4CFSA 4LXIA 1N5RA 3QZUA 5HK9A 4K6HA 4LXGA 5DLPA 4BVJA 4EZIA 3TJMA 4J3JA 1E5TA 4UFNA 2OGSA 1K63A 5AM2A 2QRUA 2HU7A 3C8HA 4IO0A 4BATA 5FPQA 1CUXA 1OCEA 3ZLVA 2ORYA 1VJ5A 5A71A 4B81A 2G4LA 3W9BA 1WB4A 4GXNA 1E8DA 2VATA 3I2HA 2QUBA 3DS8A 2XUJA 3F96A 3KWJA 5FUMA 1XZMA 3ZLUA 3H2IA 2QJRA 4OU4A 2OCIA 3STVA 1UOOA 2XDWA 2OAGA 2VJCA 2OAEA 1L7QA 5C8VA 2WKWA 4ZXFA 1CUHA 2HFJA 1K4YA 5CT6A 2H9YA 3L1IA 1TCAA 4TPKA 5IVHA 1UK9A 1BCSA 2WHQA 4E14A 3HI4A 3I1YA 5IVKA 3G9TA 4C4ZA 4PF1A 1XZEA 1K6EA 3DLTA 4QZVA 2DSNA 1SC9A 3W06A 3FSGD 3D0KA 3IURA 5AKJA 1F0PA 1SCIA 2VTVA 3A70A 4OCZA 5JZ9A 1NU6A 5JAPA 2DHEA 3O4GA 3EF3A 5AI9A 3IUJA 1CFJA 5CRIA 4EY6A 5JD6A 5JZBA 3WZMA 1TAHA 3WK4A 5EIHA 3W2TA 3K6KA 2VA9A 4B82A 1GKLA 3FAKA 2BAGA 1Y7IA 4BE4A 3WK9A 2CBGA 2WIJA 2J3DA 3V48A 3C70A 2YYSA 5FV4A 3W05A 3W04A 4AZ0A 3C43A 4ZGBA 2HU5A 1TCCA 3HXKA 5ALVA 4QEKA 1OILA 2JGLA 2WFLA 4QE3A 5ALXA 2XI4A 1CUUA 1L7RA 3H1AA 4RE6A 3DCNA 5FLKA 3PFCA 4GBGA 3BDIA 4FOLA 4GLBA 4PO3X 2R11A 4G4IA 1XLVA 3VISA 4OB7A 3D2CA 5ALGA 4H7JA 2XQGA 1CRLA 2RI6A 3WL6A 1T2NA 5EI5A 1MU0A 4UHHA 3JYHA 4J0GA 4HXEB 4ARAA 2CB9A 1UT6A 5AOCA 2W22A 5AKZA 4BVLA 3G0BA 4UBKA 3HSSA 3R0VA 1EI9A 3DKKA 3OTQA 4Y7DA 5D3ZA 5JD5A 3GA7A 1UOPA 1J2EA 3E0XA 1IZ8A 1CUCA 4IQ4A 2XUHA 3O4JA 4XJVA 4G1FA 4ZRDA 3L1HA 4J0DA 2JGEA 5AKYA 4CCYB 4I4CA 3KD2A 5DTIA 5LZ4A 4OUKX 4KE9A 5HFNA 5AKEA 2HADA 4AX4A 2WILA 3CN9A 3NOXA 4ZI5A 4G4JA 4UHFA 2WHRA 3TEJA 3H2JA 1MNQA 4MQMA 4N8DA 2B9VA 3BXPA 1BEEA 1BS9A 3ICVA 4HXGA 3WIBA 2HHAA 4BAUA 4WFKA 5ALEA 5AKXA 5IH7A 5C7YA 1DX6A 5DNWA 5SYNA 1ZOIA 1FFCA 2C58A 2Z5GA 5FPPA 1HBJA 5I7UA 3I2GA 1HDEA 2PUJA 1XQXA 5CH3A 4OB6A 1MNAA 2HA5A 5JZSA 2WIDA 1EB8A 5K5EA 3V1MA 1UFOA 1LNSA 4O08A 5H3HA 2G63A 1W75A 2XLCA 3A2MA 1MO2A 1VE7A 2FUKA 5ALPA 3WYNA 3ILSA 1LPPA 5EHZA 2ZYRA 3D3NA 3VVLA 1IZ7A 2PSDA 2WQZA 1DWPA 4BRSA 4XX1A 5IVDA 1MX9A 4UBIA 4EB0A 1F0NA 1LBSA 4ROTA 1ZD5A 3SWWA 4C01A 3IA2A 1CUDA 5AICA 1BU8A 2C5GA 4KR0A 2DQZA 3DYIA 4AZ3A 2Z8XA 4P08A 2J4FA 1SCKA 4KAFA 4DLNA 4OPMA 3BIXA 5ALNA 4I3FA 3M3DA 1QJ4A 3AZOA 2OCKA 2HRQA 4B84A 4BBZA 3LIIA 4FBMA 1G5FA 3O4HA 3RKSA 1TRHA 3CCCA 5HKAA 1E66A 3HYSA 2CUTA 3VDXA 4G8CA 2PBLA 4QWMA 2BKLA 5ALZA 3NGMA 2RAUA 3C5WP 1XZFA 3G7NA 3U0VA 4X3CA 2GZSA 3PFBA 2CJPA 4X97A 5HCUA 3QPCA 3PF8A 3C8DA 5AI4A 4QA9A 1XRNA 1LPNA 1Q0RA 1ODTC 5T4BA 4BZZA 4ITVA 4UFOA 2ECFA
chains in the Genus database with same CATH superfamily
3ICOA 5DWDA 2V0GA 3RWBA 1DOZA 1LS1A 3G2LA 3IJRA 4E46A 4DB2A 2XMGA 4JLPA 2HDHA 5EE5B 4OP2A 1JG1A 2ET6A 4XLZA 5K6TA 3EPLA 2YUTA 4MQBA 2IU0A 1I2AA 3QKUA 3AP3A 1XZDA 3MMSA 4HSEA 1VPLA 4DJEC 2I3GA 2Z3WA 4XIYA 4ZD6A 2ADOA 3KEFA 5KJEA 3CB2A 3JALA 5HF6A 1U3TA 3ZWMA 4B85A 1YF3A 1O0SA 1GDDA 3GJQA 3NRCA 3PA8A 3ZHXA 2F7SA 3LK7A 3BREA 3PFWO 1VP3A 4L8LA 3FDIA 3GAFA 1CUJA 3KHKA 1RMYA 5K99A 5DX8A 3E61A 3CBGA 1UJCA 3MB5A 5DHFA 1L4LA 4HNGA 1D2AA 2G06A 4IJ6A 4Z4EA 2GNOA 5AW9A 4HQNA 1VKNA 1Z4MA 2QR3A 1VBFA 1Y3AA 4ILEA 2Z3VA 5AYVA 4S04A 3MWYW 2WJ3A 3R7AA 4TSFD 1OROA 2F8LA 3EQZA 1WP4A 4FWIB 1YACA 1SGWA 4F2GA 4LWZA 1Q3HA 4OATA 1NVVQ 2QAGB 3GLGE 1EHIA 1XPOA 2H8KA 1G3IA 1QCYA 1V1MB 1C1DB 1Y1KE 4O4JF 4PXYA 4W7IA 1PR6A 2V96A 1U0GA 2I33A 2A7QA 4LBZA 3RE1A 5C1OA 2C9MA 5F9HA 3N9IA 5CD1A 3K4HA 1T2CA 2ODPA 1GCOA 3K9BA 4BNWA 4F84A 3IOBA 5KYYA 4HI0E 4N0MA 1Y7HA 1GV0A 2DFVA 3NVDA 4HNAB 4XIGS 3QI7A 1GQYA 2I4MA 4BQSA 2Y1OA 1KBZA 1RBQA 1YDMA 5JD4A 2PUBA 3LPMA 3GN2A 2PGDA 3NKFA 4RK6A 4HWSA 2QSYA 4HFNA 2X3YA 4DLLA 5TEWA 3CN7A 4GPAA 1V9LA 4XTRA 1TPZA 4YRSA 5IWAB 4E0BA 5JRZA 5KVAA 2P9HA 3LJKA 4Z0TA 1G6KA 1QTIA 3ENKA 1RRGA 3I4FA 2K7ZA 2QV7A 1BGXT 4OFWA 5AKGA 5DV9A 1Z0SA 3LX6A 1QFSA 3CO0S 4IX1A 2NUAB 5FULA 4PC6A 3ZZ0A 4EZBA 5JU6A 4U63A 5CXUA 3QXGA 3VBCA 4ZJPA 3VSCA 1XU9A 4IQFA 3FNFA 3G2IA 3NM5A 4UAVA 4Q18A 5A4AA 4LOIA 4QOSA 1LSSA 1WCYA 5DJ5A 3H18A 5J4HA 2P2DA 3LFHA 2C4HA 2JATA 1RWPA 2B3DA 4H7HA 1SXPA 2C2GA 3NVAA 3G0HA 2WAMA 4P2GA 4H4DA 2AEFA 2VTDA 4L9RA 3KKLA 1AM4D 1TJ4A 5DU2A 1NLUA 4MVWA 4C22A 1SB8A 1TT7A 4B73A 2D5LA 2HDOA 1N1MA 3WGNA 2IYVA 5BXQC 5I9TA 2NNWB 1Y3IA 3G2QA 2J1LA 2WWVD 4DUGD 1XDSA 4W5JA 2HPAA 2W5UA 1P74A 3DEFA 3JYQA 5GONA 5CW1A 3RCBA 3NOVA 2AOTB 4ARZA 3WOHA 4KC0A 1G5TA 1ORRA 3NJ4A 3L0OA 3OFKA 1DI0A 3VJRA 4BRZA 4FSDA 4XDZA 2DFDA 2DCUA 4Q9DA 4QVKA 1WCIB 3PITA 5KNBA 2YWGA 4BXOB 4L0QA 1DP4A 1KMCA 1YI1A 2G28A 2YQ4A 1CP2A 4HY3A 3ZBPA 5F98A 1EGMB 1H3NA 2XGSA 3R24A 3KNZA 1Y8RA 3G3EA 3R7BA 2QTFA 1MJ5A 2WUDA 3QH4A 4RK0A 1ZVVA 2IEDA 3BCSA 5F5XA 1DTWA 2C7BA 2KS6A 1YMVA 1IHOA 1XXHA 2XE8A 1VIYA 1DXOA 5SZKB 4X7RA 3B70A 4P7FA 5JSQA 4HYYA 3JPWA 4TKUB 2XE4A 3T4XA 3T7CA 2DY0A 5TQVA 4GQIA 3DV0A 1K86A 2VYND 2FETA 2GBCA 4G9GA 4K87A 4PNZA 4UUQA 4EBBA 1TVMA 3I12A 4RIHA 3W8NA 2P3LA 1H2RS 1WHTA 3GFRA 4MVJH 3RU3A 1G0NA 5L4SA 3HM9A 1GN8A 4Z3OA 4PLVA 1OFUA 3EVEA 4QFCA 1K6XA 2JIBA 4KKXB 4ZEVA 1ENYA 1CUEA 4GI1A 4NBRA 4UUOA 1DTSA 1GFSA 1M76A 2X9QA 1T0IA 1VE6A 3OCCA 3H2ZA 2VP2A 4IEIA 4GU5A 1INLA 1FP6A 3AVYA 1NNLA 1GCAA 1E94E 1KBQA 3LC0A 4QXQA 1GQSA 1NY5A 1OJLA 1NOIA 1EB9A 4MQLA 5ALHA 5KOHB 3AL0C 3JQ7A 3L06A 3ZVRA 4LXUA 2MIIA 2R65A 3EUFA 4MUFA 2D1RA 2VK4A 2ZJ1A 2JLBA 2O3SA 3NM4A 1AUOA 5JLJA 4FX5A 4AYWA 5HIJA 1CUWA 4K0KB 5GM2A 5L3SB 4Q0MA 5JMTA 1MFZA 1YZVA 3IQHX 2FH5B 4Z9AA 3WVNA 2C20A 2IEAA 3NTXA 4FYJA 3ON5A 3O3NB 1M67A 2XOXA 4LX0A 4RLFA 3QA3E 3O8QA 1JSRA 3DLAA 4WXMA 1ZI8A 3HKBB 4UCQA 5FI0B 1P1BA 5T5QA 5EJMA 5TXGA 1REQA 2EBUA 2H18A 4UJ3A 1G1MA 1GRQA 2WJHA 1IH8A 1R3UA 1XQVA 1Y5MA 2MYTA 3IAS6 2KB0A 4GIBA 4RM2A 4A0FA 4DMKA 1IULA 1JEDA 1GZVA 5LP1A 1UKYA 3ESBA 2QAGA 3L9WA 3OZAA 3BFVA 2GBLC 2I1LA 3M2PA 5HDQA 1E2HA 1TUGA 1C1DA 1TVCA 3JRNA 4MW7A 5EIWA 3U6BA 1FNNA 3ZC3A 1RHQA 2QS9A 1OVMA 3RASA 1P19A 2ZUEA 2OCYC 3O2SB 3EGXB 1ZGAA 2LIPA 2ZYWX 3FNGA 2I55A 5EVJA 4N3NA 4IHJB 3R7NA 1G6OA 3U44B 4MWTA 2FR1A 1GPDG 1HE3A 2ZAIA 4GVLA 3ZEIA 3ECCA 4I5IA 1MDBA 1NKVA 4ZKEA 3PTZA 5IABA 2O54A 3V1LA 3F8SA 2B0CA 2GERA 5F3WB 1XRPA 4EG3A 2R2GA 1ZI6A 5SV2A 5D7NA 3DEKA 4IEEA 4AK9A 3WSTA 1XXHE 4AJKA 4Q19A 1R18A 3UV3A 4Y1GA 3JASA 3DH0A 4ZXPA 1NHGA 3DP9A 3VOTA 3ZWKA 3VTFA 1QR2A 4D3XA 5K3OA 3VPHA 3WBKA 1DAKA 1EK5A 3UHFA 1ENZA 4HADA 2FQXA 3V1YA 4C5AA 1FMCA 1JQBA 2BBSA 3BWEA 3CSSA 4MYCA 1FCJA 5IHPA 1KZ7B 1PJ3A 4NNJA 3O4FA 3B13B 2WUEA 4IH4A 4UVHA 4L50A 3TGWA 1MX1A 5AD1A 2C8VA 9LDTA 3EXIA 5GPBA 3EFEA 2BEWA 4YCSA 5DP2A 2Y67A 5CUQA 3KKOA 1IDN1 1H2EA 4DIUA 4G0NA 1NSTA 4IQ0A 2PU7A 4ANFA 3PUYA 6AT1A 3DPSA 1I14A 1KYXA 2H17A 3P7MA 4PQRA 4EW2A 1LNQA 1FQOA 1ULSA 4R0NA 3OTHA 5LYYA 4RORA 3TDMA 2HWKA 4XA8A 4Y2QA 3TW6A 4CM3A 4M7OA 2CE2X 1CJMA 1ZITA 1UZLA 2RGDA 4TYNA 2G0NA 5GZ3A 5FP0A 2BELA 2X8JA 4UTNA 2EC5A 2KQUA 4JJIA 3ZJVA 1KAEA 1PHPA 1YL5A 2BHTA 3U7JA 3UJ9A 1WLYA 4G36A 4TWIA 1RWWA 1LF5A 4IGIA 1ZD2P 4G56A 4JX9A 3LLVA 1GG9A 4ARIA 2C2MA 4JI6B 2J31A 2W2MA 1J8QA 5I45A 2EIXA 3P9CA 2NP6A 5D5QA 2J0UA 2R8ZA 4DZRA 1CHDA 2DLCX 1DEHA 4CDRA 1C3XA 1CV2A 4V2UA 4TMYA 2QZ4A 4YDHB 4O4JB 5B37A 4AAYA 1F9EA 1FVOA 1MORA 4LJ8A 4NHOA 3P20A 1C9YA 4PG4A 1NF8A 1Z4KA 4QDXA 5EP1A 3HO6A 4RVSA 4BLVA 1U98A 2YBEA 4LHYA 4Y30A 4JGBA 5JNTA 1DWQA 2YXPX 3IUSA 3MGBA 1Q0UA 1QGZA 4JROA 1FFYA 4EMUA 1C41A 3OF3A 1OGYA 5DTRA 2ZSIA 2J87A 4LYAA 1ACLA 2GA9A 1S1MA 2IXAA 2IYOA 1Z5GA 2IGTA 2FWAA 5JCOA 2FUNB 1ZC4A 3NGLA 3IRVA 1N6KA 4FUQA 1YBAA 4Q82A 1IY9A 2R6CA 3GGOA 4HDKA 4X1IB 2P77A 1GTG1 3WMGA 4Q15A 1P7YA 1B0AA 4CKCA 5CXQA 1F1BA 2VSOA 1JPUA 3F9IA 2HA6A 4AZVA 3VKHA 1U1IA 1G8YA 1VI2A 3IV7A 4FX2A 4OB8A 4PZEA 3H2YA 3T3NA 4Y9TA 3T5MA 3B3JA 4E6PA 1DHRA 1ISHA 4YT5A 4E4TA 4FFDA 1MD9A 1S8AA 2O59A 3RHTA 1GAEO 4TKVA 3TLBA 1J8YF 1PEAA 4ABTA 1OLOA 1Z83A 4LHXA 2FPLA 4CTNA 4ND1A 2GN9A 5B36A 1SVMA 2UYGA 3WNDA 4C0KA 1T8RA 5JOQA 3T12A 4OHBA 5FFMA 4A10A 4MJ3A 1YV9A 1P5JA 3PNPA 4AP5A 4XW2A 2Q7OE 1HDCA 1HZZA 3OX1A 2HDNB 2RJ3A 1BD3A 1MMFB 1NW6A 1XZJA 2C8LA 4RHTA 4DCSA 2UZ0A 1G4HA 3QVMA 3RYCB 4OHWA 1JILA 1G9TA 4F1KA 3HR7A 3A6PC 3WO0A 4Z99A 3TVTA 5IJ9A 2X5XA 1YBMA 4OM8A 3IKMB 3OLVA 4J0IA 4HT3B 4ZEWA 1A27A 3FTQA 1PV4A 5LIPA 3SMVA 3LUCA 1UFRA 3L05A 3LDUA 3RU7A 4DUGA 3HU1A 1ISMA 4L3VA 4QXRA 3FZEA 3RB8A 5GJBA 5LU8A 1X7HA 2XTZA 3Q7RA 1XZHA 2V7WA 4BBAA 2XKJE 5KYXB 4Y1RA 4WGFA 4B8ZA 4CQMD 2Y9MB 3HR4A 3QLTA 3ZHCA 5HWSA 1Z2NX 3WNCA 2IKSA 4MPRA 3B1YA 1NUQA 4M1MA 4N48A 3BQ9A 4QREA 4F56A 1Z25A 2PD3A 1MCZA 3ZS8A 5M5BA 2DJIA 1UPTA 4IRXA 2SKCA 2ZQZA 1GGFA 1V1JA 1GYRA 1JDZA 5JBNA 4TV8F 5EIBD 1N2OA 2R5FA 4DV1B 1MG0A 4JVOA 4NYIR 2E4ZA 4OYLA 1KPHA 1XZQA 1OF1A 4NEGA 1J20A 1JI3A 3DW3X 1NF9A 4D4IA 4Z51A 3H8WA 3NIGB 1R0CA 3QUAA 4OOFA 5IRCD 2CZCA 2JHAA 1NI4A 3OWHA 1AK9A 1TCBA 1XZLA 4ZO4A 3QITA 4S2EA 2BKEA 3N05A 4JJZA 3CX8A 4NZMA 4QULA 3GC6A 1E7WA 2QEQA 1SIBE 3S5JA 4NY1A 4B83A 3V9AA 4AXXA 1NP6A 3VPSA 5E38A 2I4LA 5EE3A 5C5IA 1G5PA 1NUTA 2VXYA 4FZRA 4NS4A 5D85A 5BN1A 5EIEA 3Q9UA 5AJUA 1XJ5A 5G53C 3BVPA 1UL1X 1SQGA 1HNXB 2CZGA 2P3QA 4HEQA 4DN6A 5J59A 1EFCA 3AB7A 1VC2A 3W6UA 1D7AA 3W2EA 2ONCA 3WRWA 1YR2A 1NBOA 5LSAA 2PZFA 3PZRA 3UAGA 4MWBA 1QRSA 3BILA 1YS1X 3H1FA 1GZ4A 2IZ0A 3ROXA 3ZI4A 3IQZA 4JI7B 1YNSA 2RI1A 5I8ZA 5BV8A 5KSWB 1EVJA 1LQTA 4H3VA 2V5AA 1SKYB 1NLYA 3GJSA 3I01M 2C99A 2ILTA 4DBVO 4EARA 2BFWA 5G3ZA 2EJTA 1JR4A 3MMNA 2ZKIA 3HA5A 1D6MA 3OJWA 3R3ZA 4HRAA 4LBVA 4NRDA 4E11A 1Z16A 1MTOA 4OTZA 3OX3A 1CJBA 1DJNA 3KZVA 1YJ8A 4CM9D 1SU4A 1J8VA 1CVRA 1DBWA 5IMBA 4YT4A 1T6BY 7YASA 4OL0A 3SZRA 3BE8A 5FOXA 4WDQA 4LHEA 4BP9A 3VKUA 1TC2A 5AJXA 4QNRA 1KS2A 3ELDA 3N0VA 1SQFA 1KO5A 2AF4C 2WWWA 4PZUA 4KBYA 4XVQA 4H0CA 3DLHA 3EVZA 1OREA 4IWYA 3OT5A 3KZKA 4JBYA 5C0OE 3WL3A 3DHYA 3TRKA 4ZQCB 1V2HE 5G4KA 2LV8A 3PNYA 4EF5A 3GVPA 2R66A 3FGPA 2QRMA 4YT8A 2FPIA 3H05A 2IIQA 1U3VA 3F67A 3TLXA 1OPXA 4UEJA 3HUUA 4IDDA 2AG5A 2VHUA 5FA6A 1H2HA 1VIMA 3A14A 1ZRSA 4CLOA 3FWYA 2PEYA 3HHEA 4OSEA 3E3AA 2PCLA 2EYUA 5AM4A 1OPRA 5A3JA 5IM4F 2B30A 3C3EA 3NRBA 3TM4A 4BC0A 5GIPE 3K0FA 1SBNE 2HREA 2JA2A 4RK5A 4ZV7A 2VQEB 1KAHA 2J9YB 3ER6A 4IGEA 4I1RA 4WI1A 1XR3A 4FR0A 3OIDA 4KL8S 1ZUD1 2A3NA 2C03A 3FTPA 5EXPA 3O4IA 2C2BA 3QXXA 4C6RA 3VHXA 4D96A 2R6ZA 1LGYA 1TAQA 2C5BA 2DPYA 1DIRA 4W1QA 3VR3A 3ZCSA 4KRYA 1A96A 2O8DA 3BCHA 4QRDA 3GJ8A 1A71A 1QPGA 4QSHA 5D1HA 1CBUA 1P75A 2FOLA 2VUTA 4TYPA 3VVBA 3ZHZA 3O5AA 2WHYA 2JJQA 1A8PA 2ZYHA 3HI6A 1NYLA 1SY7A 1TJYA 1JR3D 2X8BA 1ABBA 3SQWA 1OH6A 4EGAA 3F5FA 5BSRA 1QONA 3BWMA 3C8MA 3K70B 4AKTA 3OUTA 5G0TA 1QU3A 2PPLA 4JLVA 1JDBC 4QQKA 4E5VA 3DOHA 3LBHA 1QG2A 2OV6A 2VJAA 4QFBA 1L7MA 1HX7A 3T54A 1E9BA 1H0KA 2QRNA 2HWWA 1E98A 1Z3IX 2W6PA 3QYFA 4Q05A 3IVXA 4Y18A 2NU8A 3OP1A 4N3BA 2YV4A 3ZU6A 4RS4A 2Z08A 3DVSX 1KQFA 5EJ8A 1N2BA 4P4SB 3UEOA 5BN3A 1EP9A 4QWWA 5BWBA 1W6UA 1RLJA 4EUHA 2J5XA 3ND8A 3U1TA 4L7VA 1DXHA 1GADO 1X7ZB 4G67A 5E1BA 3GF4A 3ZY6A 3ZVNA 1XNHA 3OECA 2NQTA 4RDIA 3T5AA 2A0YA 3MLEA 3U3RA 2FW6A 2JZOA 4K5QA 3VAAA 4EW6A 1V41E 3G2PA 3JYPA 1WA5A 5DDIP 3MWKA 3E81A 2IX9A 2IGBA 3KSMA 1MOSA 2K2WA 1T2AA 5M04A 3V8MA 4EEZA 3G7UA 2G5CA 3W7AA 2PL3A 5BYBA 1C7JA 5FBRB 2B1JA 4ZI7F 2XCOA 4O4IF 5MDHA 1Y9JA 3KVRA 1VHDA 2C9ZA 1L1FA 2MCFA 3ZIAD 5A62A 2ERYA 3ZQ4A 2HBRA 1OHHA 4PQYA 5FTLA 1EK2A 2E0IA 1G2IA 4PCUA 2C4VA 3CKLA 2OQIA 2RGBA 3FNIA 2BH9A 3DO5A 2J8ZA 3EZLA 5LQUA 2Z9DA 1SOUA 3EAGA 4XM1A 4KV7A 5ADHA 2GGSA 2ID8A 4FOOA 4X8MA 3IPLA 3O84A 3MWJA 4W8GA 3RYFA 2NUPB 4JGGA 1YL7A 3ZXYA 5CURA 3JZDA 4QUHA 4ASUD 2AA3A 4WZAB 4A5OA 4FCWA 2O7NA 3NTOA 1O6GA 4FDLA 5E0OA 1SK8A 1VMEA 2EL7A 3O75A 3RVMA 5KMGB 5U4QA 3NONA 1F4LA 2E49A 1W46A 3RSCA 1GFIA 2HHHB 1AX9A 3KUDA 4JP3A 1IAVA 1PV2A 2ESRA 2CXHA 2WZBA 5E6SA 4WSOA 4TMWA 3ASVA 5G40A 2OZLB 5BOVA 3LFTA 3H2SA 4R31A 2P8SA 3OM8A 1EVIA 2QMHA 2JC3A 4ZJUA 3EVAA 4XEUA 4QIHA 3SF8A 1XDZA 2CV0A 4L4SA 5JH7F 2ID7A 4BAZA 3QVLA 2E87A 2JI6A 3A3OA 4XUDA 3K2EA 1QV7A 2GTHA 1THGA 4G65A 4QO7A 3TBKA 5GJVC 1JHQA 721PA 3OUUA 4IXMA 1NG1A 2YJ5A 2ZI6A 5HG0A 1BDHA 1EAMA 1SR8A 4IHJA 4ALJA 4A36A 7ABPA 2BN4A 1KWKA 2H8GA 1E3IA 1K1EA 4X6UA 4RMNA 1ZL0A 4F12A 3AXSA 2FRVA 1IUNA 3DUFA 1TK3A 1P0MA 5IULC 3VV2A 4R6XA 1Z8DA 2FZ4A 3DOOA 3KZCA 2QJFA 1IWPB 2FPUA 2X76A 3KKZA 3MBOA 5FRDA 1Y8AA 1EFKA 2E3JA 3PTAA 3Q72A 1UJ4A 4MRSA 1UMCB 4IRMA 3RODA 2IDKA 4D6PA 4R41A 3KSRA 2EJWA 3LPLA 4ZCQA 3IV6A 1A9SA 1RHRA 3KTAB 1TQDA 1PF7E 3JD4A 2H1OA 4M49A 2C4UA 1XD2A 5EKSA 1W4RA 4TT8A 2A9PA 2CD9A 3N7AA 2R7LA 3EIUA 1QDLB 2NXWA 4J1TC 4O4IA 1A7UA 3WLAA 4A92A 3FBGA 4DEVA 3ZVMA 3PV0A 4F8YA 5LP6A 4TXHA 1ODKA 4PAQA 1LRJA 3UAWA 4HRVA 1NV9A 2VAXA 4N6OA 3SN6A 2OG2A 4OJQA 1TTTA 4URHA 5E2BA 1EWKA 3QOFA 3FWPA 7AT1A 1GZ3A 2R4QA 1RW4A 5EPUA 5BNIA 1N5LA 2ZB4A 4KGVA 1IWOA 2RGNA 3OESA 4RYLA 4ZVMA 3Q2IA 1N2JA 4QXOA 5FWXB 1YOVB 2RHMA 3JQQA 4A2PA 1GTVA 2I6GA 1MVLA 3K96A 4MAAA 5L6MB 1V7CA 2DSTA 4FMDB 3FLAA 4ZT4A 2QP3A 2YXBA 3OM0A 5C7OO 3THRA 3K20A 1V1MA 3IBGA 4UBOA 3SR3A 3ZWBA 1OI7A 4ECEA 3VGPA 4N3AA 5KKCA 1CP3A 3ENVA 3M9WA 1RPNA 4PCLA 5DHPA 4KH1A 2XWBF 4PONA 3MJ4A 3RO7A 1JNYA 2O3QA 2F2TA 2QMZA 4XARA 4A3SA 1NXQA 2JFZA 3I30X 1D6JA 3NEAA 4XD7A 4ZTBA 1WSBA 1DLJA 1XXLA 4HDKB 4E2XA 4Y2VA 3UJPA 1MVNA 2WLSA 2QM0A 4RIGA 5A6VA 3DWIA 4GPIB 2PZLA 3WLFA 1PZMA 3JQEA 3PDCA 3V2UA 3WLLA 4L1KA 2X6RA 4P83A 3UC5A 2WE8A 3B2QA 3LNTA 2WAXA 2O1WA 4R3UC 1VFNA 3BXXA 5ICGA 5LPNA 3C6BA 3LT0A 4IFTA 2JLQA 3ETEA 4R68A 4AKEA 4NMMA 4MP3A 4QLAA 4RLHA 1SG6A 5JSFA 4U7DA 1SWVA 1G20B 1XROA 1DXQA 2B4YA 2NN3C 4B0OA 1IUKA 4MV8A 2AJCA 1T9GS 1XV5A 4TTTS 4U2BA 5JD3A 4I9GA 3P9SA 4L8GA 3HBFA 4CKWB 4CU2A 1E6MA 3LY9A 4NG4A 4EITA 5B55A 3U7HB 3MILA 2A14A 5CDFA 3RC7A 3OZTA 5JHGB 3A11A 4ZYXA 2AGVA 3KVVA 1Z47A 3P0RA 1T0BA 4LOJA 1QQAA 5TPZD 1LSJA 2WB4A 4YXFA 1CDZA 3FW1A 3HXPA 4ZVKA 4BNDB 3VZRA 1Q20A 1I7LA 5IG2A 3A3KA 4RHEA 1WZEA 4DTIA 2Y1LA 1XF9A 1B8VA 1OD6A 1AS2A 5EKUA 3SQNA 2AH5A 2Z6VA 4KQEA 2OPBA 4UU0A 5KO2A 3FPEA 5KYUB 3PLNA 4L85A 3AO0B 4OKSA 2P41A 2BMJA 1P0PA 1Q0QA 1GGVA 1X74A 2EJCA 3GL9A 3O9MA 3UJ6A 1JU4A 4A0GA 4EJ2A 4WKCA 5HGXA 2Q4DA 3WL4A 4A0SA 2AN4A 4TTQA 1SUWA 4X85A 5AO9A 3RSZA 2EGGA 3SQOA 2ZGVA 2C5LA 2P6UA 1OA1A 3QELB 4FMCF 1SKMA 2C4WA 1RABA 3DB1A 5YASA 1UPBA 3PUKA 3W6ZA 5FWNA 2O8CA 4LUCA 5FDFA 1NBME 1EKXA 2FGKA 3MNFA 5LOVA 1QVVA 1XMIA 4RXTA 1KSHA 1R8QA 4YCJA 4LXYA 1KEWA 2PLAA 2ZT6A 5NLLA 3NYRA 3WLOA 3D6JA 3FY4A 1X9GA 4L2IB 4MYSA 1MP0A 1VHJA 2GCEA 1Q44A 2JGKA 2NSYA 2HQRA 1MIOA 5TARA 3V00A 1L8OA 2A1TR 3AVVA 2AN9A 1BFKA 2VDUE 4DNQA 1JL3A 1P8JA 2NVBA 1FY2A 2V6GA 2VXCA 3GGCA 1G8FA 4LQLA 1ZJWA 1KZGB 5HKOA 3AVUA 3SIRA 4DQUA 2VPPA 1X15A 1GO2A 4TXNA 1B6RA 3IP3A 3LWNA 4Z7NB 5AW6A 4NZNA 5H02A 2BBTA 1G3RA 2V98A 3B5JA 4V0MA 4OHZA 2AFHB 4BMZA 5ITWA 1EP1B 4QJ5A 2QX9A 3FPCA 3OEHD 5L3RA 2ZE5A 2ZJ5A 3C6XA 1XD2B 4CNQA 2VZ0A 1XTUA 3A25A 2WTNA 5AM1A 1QTRA 2IEZA 2DULA 3G7SA 3N2ZB 1JFFA 3RRJA 2I7TA 2GEFA 4KTVE 3K1TA 4BL5A 4KYVA 3P9PA 3STXA 3OLQA 1YQTA 4GVPA 2ONYA 3ZYCA 4LK2A 5J58A 5BYJA 3AGQA 4PGGA 4ETNA 1J07A 5EMNA 4EHLA 3RSGA 1BXRA 1EUYA 4ZT7A 1KYVA 3JWGA 5ENVA 5CFPA 1E2NA 2YNMA 2JAHA 1USWA 1Z8HA 2XR1A 5FL7A 1J1IA 3F3SA 1IBCA 3HJTA 2VFAA 3KQQA 4W8OA 1W2GA 3WFJA 5KJ1A 3FUVA 4OOEA 4CV3A 5TT0A 1VYHA 4A9AA 1P2BA 1YQUA 1L4FA 3R9KA 1PWZA 3K2IA 5B7PA 1HE1C 2PXAA 5FUWA 3X3HA 2SCUB 1PSDA 5JALA 5EVCA 2VXBA 1PEKE 1Q1QA 1FDVA 2ZB3A 1XL0A 4PS0A 4QOIA 1EVLA 1ZSYA 4B6PA 4QOGA 4EHFA 2FUG6 4KYIB 2JLSA 4A0RA 2VRNA 4CIBA 5IKPA 2JIDA 3EBPA 3P2MA 4GPTA 4GPZA 3GMDA 3WZ2A 3GB9A 4JS0A 4M9RA 4E32A 2PFSA 3GFGA 4KSCA 4U6QA 1JFSA 1PT5A 2CNWD 1HZJA 2VHWA 1KPGA 1TA4A 2BCGY 1WS6A 3P4XA 4OXKA 1CFZA 2PZKA 3KQYA 1G2OA 2X7JA 3KXKA 5B64A 1WHTB 2VEDA 3KVOA 2GT1A 4CFZA 4HRXA 2YZMA 5CA0A 1TT5A 4QUBA 2FR8C 3FUCA 3GLHB 1L7NA 3OEYA 4BRWA 2X15A 4YRJA 2CNWA 3GUCA 4QRIA 4CMAA 2ZANA 4LZPA 4BQIA 1O8CA 4TWRA 2JFOA 4IYRA 1ZJZA 3KB2A 1X8XA 1QO7A 2YQ5A 3QF7A 1BHSA 1ZCJA 4EGQA 4OXRA 1ULTA 2GILA 5ERXA 1M33A 1EFUA 2YY5A 5LYJB 4BGDA 1V43A 1DGQA 3O73A 5I47A 1ZM2A 1FJ2A 2Q6TA 1PV1A 4O8CA 3FNBA 4WN3A 3O0DA 4HJXA 3A6GA 2HK9A 3GNSA 4GRAA 3VHXB 4E3ZA 5BYKA 2WJAA 3HJAA 5HVNA 3FCEA 4FKMA 2GUGA 4J43A 3GCGA 5L7TA 1OKKA 3JAKB 3UMSA 4DA4A 4A8JB 5FL7D 1JEEA 5FV7A 5K3FB 3ANNA 3A7DA 4RKRA 2O2IA 3L6DA 1CRPA 4P4UA 1QUFA 1UBTS 4PBSA 2FZKA 3BMNA 4PLCA 3QLVA 1KK3A 2BZGA 5HRUA 4P82A 1HYEA 3C5VA 4B7ZA 3RYFB 1A8UA 3SJUA 1CUZA 4XQEA 4JV5B 2FPXA 4Q9HA 4HVLA 5FWYB 1LFAA 3KBBA 1E6UA 1U0OC 4PSVA 4RL4A 1NMYA 2ZR0A 4E4RA 5C2JB 1AHIA 1SFRA 3EF1A 4WV3A 1UKAA 2FN3A 2B1RA 3AB8A 3E3NA 5JY6A 3GFTA 4UVIA 3WNZA 3R74A 1SXQA 2JFXA 1L5LA 4C1NA 5K9ZA 3VKGA 5FPSA 2QK4A 4DLYA 5F23A 4GI7A 3THWA 1HEUA 3E53A 4ZMSA 4RF5A 1XTSA 2Q27A 2BW0A 3G5AA 4PPGA 2YMPA 3CLKA 2BCJQ 3BM5A 1QH1B 3N2EA 4YRBA 4HF7A 3EG5A 3QWHA 1OVGA 1Z7GA 2ATVA 3L7OA 3RVOA 1CZKA 4JIMA 4NYMR 4N7BA 4B7XA 4GQBA 1D2HA 1H2BA 1IEQA 3D7LA 3G0IA 4OUDB 2EZUA 1ZGBA 4MI6A 4RZUA 4GP7A 2XB4A 4TUYF 5DKFA 1ISPA 3CZ9A 3D4IA 4IOMA 4X93A 3B78A 1NJ2A 4MWDA 3N7UA 2I4OA 2AE1A 3SXJA 2E1PA 2Q0XA 3ICWA 1Z37A 4IQGA 1GNPA 1TRKA 1SUEA 4JL6A 5JVDA 4B3GA 3COZA 4HZIA 4ZT6A 2O5RA 4H17A 2VL7A 4XI9A 4S1TA 4RNDB 4Q5IA 4DLWA 3RW9A 5K0BA 4RMGA 1WHSA 3QM1A 4JVSB 4HX9A 1CG6A 1Y7PA 3HP7A 4PGHA 4TRMA 1AQLA 5IVIA 4WY5A 4BEJA 3A9SA 4UCFA 4KYUA 2QPLA 5IT5A 1W59A 621PA 2O8FA 3EGDA 5DNYB 1JIIA 2GZRA 3EIWA 4Z9YA 3ZNOA 4AKGA 3VJLA 1TI7A 2AK3A 2J7PA 1A4XA 1EDEA 3G9ZA 4H4EA 4Y2JA 1W73A 1PR1A 2PUAA 5HE8A 1PS0A 1HWYA 4P54A 1PNVA 3AR2A 3I45A 5KSOA 1MDFA 3GJTA 4MUJA 3WKAA 5BR1A 2IU3A 3FFXA 5DNEA 1L4KA 2QMOA 4PC7A 4R16A 5FHRA 1ISSA 5H82A 1NM5C 4W82A 1EEHA 2WK1A 1UFVA 1RM0A 1NPTO 1PKXA 2YMQA 3U3ZA 5ES4B 4MEAA 2JHCA 2XQKA 1CJUC 5K0CA 3DDZX 3MTDA 3R1IA 3GEHA 4ZIRB 3FOZA 4BGVA 2B4AA 4DANA 4O1IA 3O93A 5AVRA 2C2XA 3Q7QA 1RRFA 1QSGA 3V97A 1RQGA 4G4SO 4DCOA 2WHPA 2ACEA 4JI2B 3NW9A 2IHYA 2Q2WA 1WZUA 4AO7A 4KVZA 5BNZA 2PGIA 3HN7A 2ONKA 1P0CA 2VHEA 5JR3A 1XA4A 2PEZA 4KK3A 1X70A 4NBUA 4NYJQ 5K8JB 3I62A 1N7IA 2GQ0A 1TNDA 2PWAA 3RM3A 1MW9X 3FXAA 4RQAA 3E3OA 3HB7A 3L84A 4H1WA 3R7WB 4GRDA 2BE7A 3D8HA 4RJ2A 4RFSA 2EKQA 4ZDWA 4BVEA 4FFOA 1LSOA 1D5CA 4OAPA 5FADA 4RDHA 3TL2A 1SZDA 1R0YA 1FUIA 3U4IA 2G9NA 1HTTA 4YRCA 1YRQA 1DKLA 4NNOA 2M98A 4ZDJA 3U3OA 4BWVA 3USCS 2XY4A 1UBRS 1JHVA 3SJBA 2WQ7A 4NFLA 4TLAA 1JHRA 4CUZA 2FDRA 4GOXA 1HI9A 2H57A 3D59A 3LOUA 5I3CA 1N2SA 1RLIA 4H7FA 4G0UA 1Y6JA 2UUOA 4U2GA 4IZ6A 1VSBA 3E18A 1NUSA 1J6UA 3VVMA 4I1PA 2PSHA 1GNRA 4A8JA 5HFAA 1XGKA 2XMDA 3M4YA 4HX2A 4K9DA 3TX6A 2DGDA 4YJ3A 4LDAA 4JZKA 4A03A 3C1TA 2Y1CA 4L0DA 5E6UB 4JI3B 2FMHA 2X9LA 3A28A 2IY7A 4QYXA 2IS1A 1M6WA 1NLZA 1KF0A 2O2HA 2UVQA 1O3YA 3LQ2A 1EJ6A 3H4VA 3PQ5A 1TEVA 4JR0A 3MIIA 1Z34A 4OHKA 1HSZA 4XPZA 1UK8A 4KFUA 4RCYA 1X1RA 4C6TA 2G4VA 1NR7A 5DK4A 4HQKA 1CVLA 4FZVA 3U4AA 3QVWA 1UPUA 4W1RA 2HQOA 2J0SA 4OX9Y 4B3MB 3BJMA 3MTAA 5FWYA 3BEOA 2M1XA 4H7KA 1AN9A 3KQHA 1WNFA 4FINA 4GRIA 1V1RB 1MJGM 3FDXA 3QVOA 4UXHA 2CXSA 4AY5A 3ZNNA 1JB1A 5AM3A 4YMTA 2P8JA 1JV2B 4AMBA 5EJIA 1RJFA 2ZJBA 1E5VA 4I0WB 4M46A 4MITA 2R4UA 1A7AA 3ZQKA 1U1EA 4DA7A 3TFOA 5J2TA 2H63A 1R9GA 1A9YA 1WXQA 1ZGCA 2IC5A 4RIIA 3C3AA 2WYIA 2WIGA 2X0RA 3U60B 1FFDA 1UXJA 1F2TB 4URZR 2PO5A 1WG8A 4MRVA 3R8XA 1Q50A 2ROQA 5I5EA 4DV7B 3UB4A 3CNOA 2I4TA 3AF2A 2YINC 4GE3A 3TKLA 1VMIA 4L72A 3IMCA 3RTCA 5KTMA 2VTBA 1VJ0A 1LK0A 1CLEA 1VJCA 3HVIA 4J0CA 4KU4A 1X39A 1DS6A 1A9XB 1O9HA 2NO1A 4M0PA 2HL6A 4RY2A 1U8FO 4YMLA 3ZUPA 5EA2A 3DE0X 3WQQA 3A1SA 4EPVA 3H9CA 4FYWA 4TS4A 5SY4A 4CRWB 1S2GA 4U00A 4QECA 2DG2A 3DBVO 1L1RA 4PV7A 4LTMA 1S2OA 3C3XA 3FKSA 4R01A 4RD1A 3UAZA 5JQWA 1VHWA 1BEUB 2V1UA 3GROA 4JENA 4QEDA 3VTKA 1E1LA 3A4VA 3VKWA 2E4WA 4IOKA 3K9LA 4EGJA 3PXGA 2BC9A 2C83A 3AI1A 4CEHA 4AQYB 1SCDA 2XIQA 4R2IA 2O6LA 2GNPA 4C4YA 3A3YA 4HDNA 1RNLA 3TTUA 4JYCA 3CUTA 2Q3EA 1M2VA 4GLJA 4EFMA 4K7JA 5GJCA 5H4GA 3PEWA 2JJYA 3GZJA 3TQSA 3JQ8A 4UU1A 4OQMA 1IC6A 1VCNA 1D3AA 2QE7D 2N47A 3CXUA 4EVQA 5ALKA 1S2LA 2YASA 1I0ZA 1WP9A 4WMLA 2ZU6A 1G55A 1XLUA 3CISA 4WL0A 3GJ0A 2HIHA 1NN5A 4EB3A 3ZZMA 3FYDA 2C2ZA 1JALA 5CLJA 1I1OA 3NWBA 1NBAA 1FNCA 1QHYA 4X41A 1V37A 5TMBA 5T4EA 2VDVE 1Q6YA 4B8WA 1YZNA 2PZEA 2DFTA 1YCDA 3OQMA 3I32A 3Q9NA 1D6NA 1MB0A 4FNMA 4JB2A 3SMQA 4A1OA 2EX0A 4ZCTA 5KQLA 5K0FA 2SECE 2W2LD 2VLBA 1HQKA 2XUFA 2ZDGA 2QT0A 3MZ0A 3ANSA 4I1OA 3VJMA 2YTZA 1Y9ZA 2B7LA 2HK8A 5ENDA 1YZKA 1H2ZA 2OAQ1 3I9LA 1UJ6A 3JZAA 4ZJZA 4J91A 4YEDA 5A3QA 2CD7A 3E27A 4GZ5A 4YCLA 3RC8A 3NOQA 1GPH1 3V4PB 4OKIA 1D4ZA 3T7SA 4BLSA 1ILWA 2HNKA 5IC6A 4F5YA 2ZYAA 1TECE 1R9JA 1U6JA 2PXXA 1XMJA 4RTLA 4UTXA 3UUFA 1G9SA 1MZVA 5B3KA 3U3KA 4G5YA 2BGNA 4BNVA 3ASUA 5I8WA 1UBSB 4CMEA 2JGRA 3TB4A 1N2IA 3CLRC 4QJIA 3UWKA 1BMDA 2LD4A 4P2BA 4EBFA 1LBEA 1QHGA 3C15C 1ADYA 2Y4OA 4NV0A 4ZZ3A 2GD2A 1E5DA 3I9JA 1Y6FA 2CMFA 1IM5A 2WU0A 3JQFA 4IUDS 4K03A 1T91A 5BSKA 4NBVA 1O57A 3QU9A 2B8TA 1JPNA 5CJ2A 1ZJJA 5EC8A 4XDYA 4LDZA 4TOIA 2Z5VA 3RQSA 2DWQA 5DEIA 3AI3A 2V7TA 1N33B 3BTUA 2JL1A 4PWYA 5DBHX 4KO1S 4F85A 4PAWA 4MLZA 2AR7A 2R84A 5K6RA 1JKFA 5C31A 1RT9A 2EQBA 4DAEA 5KYUA 3KOZA 1VJGA 4HEA1 5JUWA 3JU3A 2BH2A 3RWMB 5JCZA 1Z2CA 2EF1A 2H31A 4I5EA 1M34A 2BUAA 1CZNA 2OBYA 3HU5A 1KIAA 2OO5C 4RPIA 4UREA 5PNTA 4K6MA 4B3FX 4YAWA 2IY8A 3NQ41 5L40A 2WAYA 2Y1EA 4YMHA 1E8NA 5DNCA 2E1RA 2GZ3A 4J49A 4GHWA 3OY7A 3I05A 1JFVA 2P4QA 4ZYYA 3A8TA 4W4TA 2Q9AA 5DT9A 2LTAA 3FH0A 4BFVA 1VPDA 2CGEA 3OD1A 3RYIA 5EHIA 1PFWA 1G66A 3L6CA 3BIWA 4IMJB 3T3MB 2OBXA 3RVKA 5C53B 1VCOA 4FLMA 1J1ZA 2FW8A 4J29A 3I72A 1JJAA 3IUNA 2FY8A 4OXXA 3H5LA 4OBBA 3AHDA 4X54A 1XTIA 2AXPA 5CBPA 2FSUA 4G1BA 5I7RA 3U19A 2EX1A 1YA6A 1FP7A 2X5NA 1KJ9A 1JIUA 3RUHA 2ZWOA 1EMDA 3UYKA 4RF4A 3IH5A 3K4QA 4WA7A 1HRKA 1E1RD 2DH5A 2E9SA 5KVSA 2FB9A 5CTJA 1EXNA 3IYLW 2XUKA 1E5XA 3D9QX 3HC7A 3OA2A 5ECYA 5A7FA 1TF2A 3L7AA 2HJVA 2QRZA 1XDWA 1DB3A 3C98A 3KE9A 5K7SA 1UZNA 3H6HA 2W2XA 5CLIA 4YRDA 3LQYA 4KW7A 5FH9A 1UPFA 4MGKR 3VC3A 3SZUA 2JW5A 5IF9A 1DC3A 3NXKA 4ATNA 4GKKB 4NZYA 4S35A 1KY5A 3VTAA 4EF4A 1XWFA 2R8RA 2E82A 5BSUA 2H5LA 1I1NA 1OU0A 3IMKA 1SOVA 1E4OA 2GWHA 3MBIA 4HN9A 4Z4CA 2X4LA 3B3QA 5BVHB 4RAQA 2H4XA 4Q7MB 3VR6H 1ZKDA 5CBKA 3IKJA 2AI3A 2C1XA 1NT4A 2JJMA 3CVJA 3F8TA 1GVHA 1P9WA 2VH1A 4P58A 5JAQA 1ECLA 2Q5CA 1YUMA 2CY0A 2EZ9A 2HCJB 4J2OA 3GHYA 4JI8B 1PWYE 1AK2A 4BX9A 2CWWA 4KP7A 4QUDA 1YJQA 3G0GA 3NS7A 2FG7C 3CF0A 2P4HX 4N82A 4RX1A 2VJPA 4GL4A 3TKYA 2NSJA 3JYLA 3PSAA 2JFNA 2IH5A 3M1IA 1KRWA 1W36B 4IDHA 1CY4A 4MULA 1XMXA 3K0HA 1M5RA 4RV9A 3H3JA 3DT8A 1QVWA 3MJRA 4R81A 5E9JA 1QQ6A 4BJ3A 3LFUA 1PJAA 2JAPA 2WF8A 3HN6A 4RK4A 3WWYA 1HDIA 1Y80A 5TE9A 2ZBFA 4PG8A 1IVSA 4C2BA 1DKUA 1B8UA 3MINB 1AQIA 5HRCA 2ZSHA 3OOWA 2BFDA 2EG5A 1Z88A 5GTDA 3BX1A 5CT5A 4ZVUA 3DTNA 3E8XA 2DR0A 4P98A 3UXYA 2OWDA 4RA9B 2VPQA 3HCEA 2GA8A 4LKRA 4KQ1A 3EZNA 1EHCA 2IYYA 5EY5B 5KYKA 2VUSA 3BDAA 4TVOA 3VHRA 3OTWA 2RBKA 3BXHA 2OV2A 3IVAA 1FZTA 1I7QB 1B4DA 1CJTC 4GMHA 3CUKA 3F8WA 2G77B 4N0QA 2FKNA 3PWZA 4XPIB 4ZA2A 1KAQA 2NZJA 1QJCA 4IMPA 8OHMA 4JYAB 2Z6QA 2YW9A 2BJWA 4I1UA 4YI3A 5F7ZA 4OL9A 1IOWA 2VDWA 3F0TA 3WWCA 1RI3A 2BI8A 4WTOA 2P35A 2FQYA 3UJHA 4BTVA 2H1IA 2JKVA 2PHZA 5IUKC 2WM9B 2C7RA 1ESCA 1LLFA 1YE3A 3C6ZA 4JJAA 1O7JA 3LSTA 4XX0B 3W6NA 5DXFA 3IT3A 4TROA 3F1LA 1ZYUA 2DAPA 4YJ3B 1GEEA 2HW8A 5F21A 2R96A 4LI3X 4G2NA 4DCTA 3FDZB 5DGIA 1T9BA 1Z75A 5ICEA 2XCLA 3AR7A 5DBFA 3BGWA 1LCIA 3UGTA 2IDMA 2YZ7A 3IS3A 3KOUA 2HUPA 3EZ9A 5DGCA 4KOEC 2AYXA 3W8FA 3WS7A 4QUEA 4NEHB 2B34A 3ENQA 3U48A 4NL4H 3PX7A 3J7AC 1AURA 2ZKLA 5ADUS 1C4KA 2X6QA 1LTKA 3W9YA 4EEKA 1LJUA 2IZZA 2YWXA 4LRWA 1FLVA 2J30A 2OFXA 5FAXA 2WG0A 1Z26A 3ECSA 4ZVLA 1QQ5A 2OGUA 3T5BA 4ZYZA 3IJ5A 4M0EA 1UFQA 4CPDA 3PRYA 2GCGA 3BRWD 1BW9A 1GCGA 4AO8A 4FGUA 1ESZA 3WGYA 4RW0A 4D6XA 3EJ6A 5LM3A 3MRTA 3CNBA 2JCSA 1ML3A 1UJ5A 1HK7A 3EQ9A 3HYLA 3W8DA 3I9KA 1QGED 1JE1A 3C3DA 2HA0A 1J2YA 4X63A 3DWEX 5M3BA 3R7DA 3BMXA 3IC5A 2NXEA 1O58A 3K31A 1F8UA 3NWOA 1U6KA 1F9AA 3LQKA 1RPAA 1PYGA 3FZNA 2H1HA 3WMWA 4HV4A 1OAAA 3EWIA 3PQDA 1U2QA 4FYHA 1ISFA 4JT2A 1PFYA 3H1GA 2ZPTX 3M1YA 4I9FA 5ETJA 1CR1A 2B61A 3AETB 2NSDA 3PC7A 4IG4A 1LBHA 4X6YA 3RIMA 4YT2A 1P9RA 3UHPA 3GLIA 3PG5A 4JAVC 3MWLA 1AC5A 3MOIA 3FUWA 4YDRA 3O8BA 5DF1A 2WVJA 3W2HA 1DDOA 2VPWA 4JWTA 4BQRA 1ZJ5A 2HZ7A 4X91A 1C3OB 1OBFO 1AKYA 3QFFA 1MC5A 5FFNA 4CQMA 5CIQA 3ZWCA 5BO5A 2L17A 2P2CA 3ULKA 1G8KA 3RUFA 1QRRA 1T2DA 2FJPA 1U0HC 2R7KA 3PE6A 5JJIA 5H70A 2W58A 1JHDA 3SSOA 1DEKA 1R00A 3MWEB 4NF2A 4WJLA 2IYWA 4MKZA 4YJGB 2WG2A 1JG6A 1O95D 1F17A 3NNNA 2XA2A 4WNAB 5LOVF 4I4TA 5JADA 3RJTA 5EYPA 1CNMA 3L5KA 4FEYA 4IF4A 5DYYA 4BV9A 1W94A 5JG7A 1TQ6A 1V1RA 1PT8A 2AXEA 2O52A 1QIFA 1YDGA 3MOSA 4C07A 1CS0B 5CT9A 2OZVA 1D4OA 1YHYA 2WJJA 1MO4A 3IBYA 4WJZA 1R0WA 3O8LA 4E1BA 3TGLA 3W5CA 2VDLB 2WWTA 2POCA 1PSZA 4GNKA 4Z53A 1R2QA 2WYHA 4J0FA 1T5IA 2FF7A 4TL6A 3OZGA 2QL9A 4YJ2F 3EWNA 3BE6A 3S70A 4E03A 1QF6A 2O8CB 1QAOA 4Q9JA 2XSZD 5K0JA 1BDBA 4C0QC 4E1VA 5IXSA 4ZHSA 4LYJA 1M72A 2P62A 2PJUA 3V8NA 3WLHA 5TMPA 3NBXX 1QPBA 1M1NB 1U4OA 1MQ8B 1QK5A 1XTPA 2AEMA 1E1CA 4YAEA 3W4KA 3RFXA 2J4CA 1Z08A 2PKCA 4IOLA 1KNQA 1AG9A 1LPAB 4KRXA 3NC4A 4MQEA 4Q12A 2HBZA 2IYTA 3SHOA 4DMRA 1RC8A 3T9CA 2MSDB 3Q7IA 5B3AA 2XCIA 1XZNA 4EY8A 4DCPA 5AQEA 4W7HA 1DZ3A 2CDCA 2R1TB 2JFYA 3DHWC 5J4LA 1XVLA 1P3Y1 4TZ6A 2JAOA 3B7PA 1QKKA 4M88A 5U4XA 3M82A 1G8JA 1XWWA 3BH6A 3OZXA 3U3DA 3VYTB 4ARVA 1VKHA 3UV6A 4QHSA 3KWFA 3JQRA 2ACWA 1VSTA 4OLHA 2DPMA 3P71T 3PEYA 3IUYA 1LS6A 3R5KA 1OJ7A 4LHSA 3ZW9A 4M1ZA 4C2AA 4EPYA 2CBZA 3AHCA 4EQ6B 3PHGA 2XMZA 1NW8A 4L9AA 1ZMOA 3AJ9A 2Q1SA 3L8YA 1SBTA 1SD1A 3WG9A 4XZ3A 2I6FA 4DDVA 2NYUA 3KJFA 4C2UA 4HGOA 3FROA 1F06A 3FDZA 4FI3C 2UUAB 4O4LB 3TVDA 1Y98A 2NTYC 3JAKA 3E1KA 1IHUA 4XX0A 4CMJA 1QFXA 3OBIA 1M1UA 4F3NA 4B7CA 3ZR4B 1TFRA 3HA2A 2QE6A 3OLXA 2W6CX 2PT5A 2RGXA 3IOMA 3QYAA 4GECA 4NAHA 3REQB 3VFDA 4BKMA 1PVOA 1S9DA 2HM7A 1TZCA 1ODJA 3A4TA 1K97A 3OKPA 2XCUA 2Z0MA 4ZQGA 5ALWA 4CZ2A 3W5AA 1KGSA 3AEYA 3OPNA 4CTMA 3ASZA 1R6DA 4NPAA 3WLSA 3NPAA 4EABA 5T4HA 1NDHA 2PR2A 3CNEA 4BY9E 2OXFA 2IQIA 1UKEA 3KQSA 3BGVA 3T7IA 5G2OA 3ZDEA 5KREA 1R66A 3B3GA 2V0CA 4AIIA 2O19A 4KR9A 3RTBA 3ZE6A 4RVHA 4WEQA 4OJKA 1VYVA 3KYIB 4CT5A 1VGRA 3B6EA 4O3FA 2GX6A 1M1XB 2J0EA 5GOTA 1XZBA 4M3NA 5DBGA 1BHO1 2ZBPA 3DD5A 3KTDA 4Y2SA 5J5VA 5C3UA 3TOVA 3QKSA 4DMHA 3BEDA 4IZHA 4PC3A 3HJRA 3S27A 4LMAA 3D0RA 3DWFA 1W1WA 3PUHA 4W1PA 5DRTA 3T38A 3G2OA 1BGVA 2NV0A 1MB4A 4IJMA 2CMKA 4TYMA 4ZGWA 1QNFA 3RH0A 4FMDF 2G07A 5C8YB 5DXAA 1ZWLA 4DNFA 1R50A 1J8DA 2IYQA 2VHTA 8ADHA 3LTNC 4K9PA 2C07A 4QBHA 4H08A 2OBLA 3WL7A 5IHXA 3D4BA 3PIRA 4XSVA 4NE7A 3SDBA 1RM4A 1HPLA 2F1JA 2K2QB 2Z8ZA 3MWDA 4Q3LA 2YJ4A 1E4YA 3E5RA 3OPYB 2AJ8A 3M3HA 1GQRA 1RYYA 1EG7A 1UBLS 3OZDA 1AGYA 4JLDA 4A5SA 4DPMA 5F51A 1U9IC 2OHVA 3ZX4A 1M2VB 3K9QO 1AZTA 1N5RA 2OBFA 3L0DA 5TMDA 3T9FA 1DRUA 1U8CB 4V0RA 3A1NA 3GLTA 4MTLA 2G1PA 5EE1A 1YH3A 1SK9A 1EE2A 4TN1A 3TG2A 3HDTA 4K6HA 4KDRA 1E3WA 4WLFA 3RUDA 3V9PA 4EKYA 3J81A 1PNRA 3LQFA 1S3SA 4TLLB 3WGHA 1VLMA 1U7WA 3ACCA 1ZJYA 4XH9B 1WZIA 4DHEA 1O4WA 1JPVA 1T6YA 3OT4A 2P30A 2C2HA 4KLZA 2QX4A 4HS4A 4WEOA 2DUJA 3PGKA 4WESA 5H5JA 4OREX 1J09A 2HU7A 1JEQB 1NI5A 4YRFA 2XVZA 3MEQA 10MHA 2K5UA 1DKNA 1PDWA 3A1EA 1L5WA 1XE3A 1Y8RB 4FIZA 4Y6RA 5ECGC 4J1SA 1M1YA 3UTDA 3TB6A 5B3JC 1I36A 5BQ5A 3ZLVA 1TQ4A 3BSWA 1OR8A 4N76A 3WLPA 2HGZA 3R5JA 4H1UA 3KB1A 4JDPA 5GM1A 3T1OA 3P52A 4B81A 3E48A 4YP0A 4WCDA 1M54A 3CRMA 4NBKA 2PGAA 3KV3O 3W9BA 1B16A 1O54A 1G5RA 4YFVA 1F2UB 1R5BA 3JQAB 1JBEA 3NT2A 2YWCA 3FJ1A 2H1FA 4MW4A 4ZOQI 1YFZA 1AMUA 5K0ZA 4RH1A 4DARA 3BUSA 4V0QA 1PYDA 5PGMA 2QBYA 2XUJA 3DL0A 3LHSA 3QXHA 4X7MA 4B43A 4MR7A 5FA8A 3KB8A 2XTMA 4Q02A 5KWSA 4F1WA 4ZGGA 5TV2A 2EZ8A 2QGFA 3LW7A 2UXCB 4NPHA 1IXYA 1RU3A 1V0JA 2VDQB 3K73O 4WCFC 4GC9A 4OU4A 3R0QA 1E32A 2HMAA 1J00A 1CE8A 1MHPA 2PS0A 3HM2A 4LN1A 5DW3A 2OBNA 2H29A 4ALIA 1T1EA 3OJEA 3GRPA 3B9BA 3GP3A 5LJIA 5FQOA 3CH6A 2OAGA 2VJCA 1JQAA 2OAEA 1L7QA 2AFVA 2M2IA 1NVGA 1TYZA 2JKYA 3IVGA 1VM6A 3PFIA 3N0XA 5CA1F 2WKWA 1CUHA 3O1LA 4NNPA 3RBAA 5ADWA 1WXDA 1YVEI 3V2HA 3W34A 1B0PA 2YICA 2PKQP 5C5CA 1W25A 3RSQA 3ASYA 1HFJA 4M37A 4D98A 2PH3A 5JNVA 4Y2GA 1GRCA 1JPJA 2FMIA 5BWOA 1U90A 1TCAA 4FMCB 1NW9B 5B4VA 1AO0A 1PDOA 1BCSA 2ZSBA 4V0SA 1RTTA 5CG1A 3I1YA 4IJWA 4YQEA 3VX3A 3GX1A 5KQRA 1Q7BA 2E18A 4C4ZA 2WIBA 1VMDA 5K0LA 3SC4A 4OG2A 5A4DA 1L6RA 3BD8A 5CFMA 2AD1A 2HOQA 1ZQ9A 2OK8A 3MSXA 4MVYA 3FSGD 1Z5WA 1U2SA 1F0PA 4FYPA 1R8JA 1YDHA 2NV6A 3CUUA 3LZDA 1UBKS 4XXHA 1BH6A 1L8XA 1NVDA 3FPHA 4OCZA 3O38A 5B30A 3MCUA 3GEEA 4G37A 2JGDB 3R6TA 3RHSA 1Y1PA 3TTXA 4EDFA 3U17A 1Z6YA 4MP8A 2DHEA 3T95A 2W6JD 2FPWA 4B32A 3R7WA 1Q0LA 4IIEA 1Q0HA 3UBTA 5JW6A 1U2GA 2QENA 3CW2A 4HLUA 3M0EA 5JQGA 1GAJA 2W0MA 4MDYA 4EYGA 5JZBA 1R6TA 1TAHA 4L3OA 3UWOA 4CL2A 4WKOA 4FCTA 4P32A 5JYDA 3DO6A 4HTFA 5AK0A 3TF5A 2NOAA 1EQAA 3CLSC 3OQHA 4ALKA 1B8OA 3DKIA 4YWJA 4RTQA 1H2FA 2HF8A 1GKLA 2VAWA 4FN4A 3K7EA 4J3FA 4LJ9A 4PRLA 3OE7A 3P9NA 4MUIA 3FAKA 4MKFA 5CK5A 4BE4A 4MIYA 1IJKA 2BP7A 3C1AA 3EG9B 4FYYA 1NLFA 1WETA 2OLKA 2A8YA 1YQDA 2PX4A 1CLUA 2YN2A 3A7EA 3KTFA 1Y8QA 3LCJA 2KX7A 4HWRA 4I46A 1QP8A 1FTNA 5IYZB 1LLDA 2NIPA 4UVDA 4X65B 2X22A 2O8BA 4AMUA 1RPTA 1Z4QA 2H1RA 1F4VA 2O8DB 3ETHA 1Q17A 1TUEA 1KK2A 2O5EA 5AVXA 1IEWA 1UADA 5F12A 3KVNA 1Q15A 3AETA 3TLMA 2FE1A 5ALVA 2I7DA 1GCUA 2FZ5A 2ZWIA 2JCBA 3KD3A 1YDEA 1A9OA 2VPZA 4FHEA 4R05A 3VU3A 2RHHA 3CJRA 1JDSA 4O6VA 1H4VB 1XSEA 1ZCFA 4FHFA 4LW8A 1SG9A 2Q3JA 2Y71A 4IS3A 2C0CA 1T9ZA 4J16C 4RA6B 2NYVA 4RK1A 2FHSA 5D5PA 5FNVB 3LK6A 5G02A 4C3UA 4D4MA 2X8JB 3KPYA 1CQIA 3S1AA 2HYIC 1UBEA 3HYRA 1I4EB 4Z7OB 2PFGA 4RE6A 1UAGA 2WJGA 1PR5A 3VYRB 3W0LB 1DC4A 3OU6A 5FLKA 4G89A 3AEQB 4AYXA 4PAOA 4ZHQF 4GBGA 3KQPA 5TB5A 1XNRB 421PA 1Y6GA 4Q1DA 3SJZA 3UHJA 2C2WA 5KU1A 4Y9UA 1RJ9A 1J99A 1YULA 3NH6A 5F77A 1WXEA 4IM7A 2MT9A 2FXIA 2CYCA 2WYWA 1PWXA 3NRJA 5C7LO 3AEKB 2G25A 3HCBA 3AVWA 3JQ7B 2AOUB 2CEAA 2GF0A 3GOQA 4UOEA 4Z4FA 5EI5A 3U26A 3JYHA 4FP9A 1TMGE 4GAEA 1A95A 2Q7XA 2WC1A 3GFOA 2WZCA 3KT8A 3SHFA 1C7ZA 2QV0A 4RSMA 3QTBA 3PX2A 1IN7A 1PGNA 3S28A 3G0BA 5A0FA 4FSHA 1YGPA 4U3JA 1ECJA 3TD2A 3OMWA 3R41A 3EISA 2VOEA 4QGHA 4DW8A 2PH5A 3P9YA 4S05A 1EBFA 1JUDA 5D3ZA 2XXAA 4INOA 3GA7A 5CX1A 5CDHA 2WABA 3RFVA 4PWZA 2QT1A 3E03A 4JCCA 3A6FA 3KPJA 4K1XA 4EVRA 1IZ8A 3UT5A 2W83A 3NASA 3K6SB 2WF7A 1CUCA 2ZIWB 3DE5X 4IQ4A 3O4JA 2A9KA 3PT9A 3UAYA 3QG1A 3CVUA 1RPJA 1B76A 4XR9A 4PYQA 5B1EA 3L1HA 4LI0A 1P7WA 2CF6A 4PLFA 4WNAA 3W4JA 2A0KA 1H1LA 2HMVA 1RWKA 1RJDA 5B12A 3HCDA 4OLBA 5DTIA 4Z9FA 4LF5B 4WACA 1P60A 1P4AA 4B31A 4ZDIA 4QODA 4Q3DA 4ILKA 4UUAA 5FD8A 3DPIA 3O4RA 1JX6A 4UPVA 4AX4A 1T9CA 2CFOA 2YW2A 2ZBVA 3EPPA 1NQAO 1K68A 3LM8A 5EIBC 1QF7A 1FX0A 1ZXLA 2Y0PA 1QDEA 1C9DB 2JAUA 4KO4S 4FN5A 3RAEC 1HEIA 3QXCA 2MSCB 5GWXA 5H16A 1NULA 3U0BA 3B1KA 3DMTC 4I55A 3OSZA 5TGTA 5DGHA 4C7VA 3AVTA 2I1WA 3ZV3A 3LY8A 4M89A 1S3IA 3MTGA 4H31A 1P2UA 3NATA 3DBHA 4M9SA 4PINA 3D3JA 4Q9LA 3S6JA 2D7CA 3AVXA 2FWIA 5AVSA 3QOYA 1MNQA 2UVDA 1W96A 1TT5B 4PBRA 3D4PA 1BEEA 1BS9A 3PQ8A 3CF2A 1OFGA 1J2RA 1NVKA 5IH7A 3U7RA 5C7YA 1DX6A 2P9GA 3OQVA 2B1IA 2J9FB 2WHEA 2OA0A 3ZQJA 3OZRA 1H4TA 4B40A 4QLBA 2LGJA 5DGDA 2GJKA 2HLDA 3D7MA 5SYNA 3WNVA 3LL7A 1X3SA 1M2EA 1HBJA 1NSYA 3H42B 3BMOB 3INYA 1IU9A 4REMA 5AUPB 1NR5A 2WNSA 1OFTA 2V3VA 4M1QA 4U7JA 5H0IA 2PUJA 4ASUA 3SCZA 3HVHA 4ZYTA 1EP3B 4J9UE 3SOPA 1XQXA 4R1SA 3BORA 4HVAA 4GNRA 1ULUA 1EWRA 2Z2IA 1FDSA 1N0UA 1VE9A 3JQDA 1U2RA 3HXTA 4OB6A 2VIIA 3LA8A 2YS7A 4IIJA 2OV4A 1D6SA 3GARA 5AVOA 5JZSA 1ULHA 1KRXA 2J9RA 1A5TA 1TM4E 5K5EA 4UNIA 2ZJ0A 1VRCA 4OFXA 4OLFA 2H2HA 3W78A 5FAKA 1OH5A 3RT9A 2IPOA 1LNSA 4IX9A 5F7JA 3CX3A 4HEJA 1SNYA 2WT4A 1W75A 4RY9A 5K2MA 4JBXA 3N2YA 4J7UA 3UK6A 3PHCA 3A2MA 2HSDA 1NRWA 5KWVA 2DLDA 1MO2A 5ALPA 5AHRA 1LPPA 2BEJA 2N9UA 4O2BA 4CTOA 2BGGA 1SRQA 2ZYRA 4KBFA 4O4LA 3QEBZ 1HE5A 3LVFO 3VVLA 5IKEA 4JEHA 2VHJA 2NG1A 1VB3A 4KZKA 3URKA 4HL6A 3I3OA 3MJFA 1H3FA 3ZU2A 5EL0A 3FIJA 2NO5A 1C0PA 2BMFA 1HLPA 1WSWA 4MGHA 2IXEA 3QYPA 2V3CC 4MV5A 2Q9BA 4EG5A 2XE6A 2YL2A 4ID3A 4ENSA 5HYVA 4I08A 1IXRC 2B7CA 3BD7A 4EB0A 4BNTA 4OP3A 1U5BB 2ZSFA 1L9KA 3H4MA 5IARA 4F9FA 5DW0A 4IXWA 1FF9A 2Z2XA 4XM0A 4WVFA 4QQNA 2CFSA 2A78A 2DQZA 3DYIA 5G0VA 1WY5A 4P08A 3P32A 1NPYA 2NUAA 3L8EA 4HB3A 3TEFA 4HDQB 5EZYF 1SCKA 2GM3A 4TLBA 3GRZA 3WB0A 2GN6A 2AG6A 4OMUA 4U2KA 2ZIUB 4OPMA 3HCNA 1MC4A 3S2EA 3RUPA 2JFGA 4GXQA 3SBEA 5IAGA 2BPOA 1F1JA 5ALNA 3PZBA 3GG9A 4NAVA 4A4DA 1QHHB 1N3IA 2R8XA 1ZGZA 1G6HA 1NYQA 1Y82A 2FK7A