2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
5C8XA 3FYUC 1CRLA 2FX5A 5EHNA 1CVLA 3I1IA 1YR2A 2WG0A 5IVDA 1SC9A 4BP9A 1CFJA 1L7AA 4FDMA 4X7BA 2GBIA 1TAHA 3P2MA 1OCEA 4JYMA 2WIJA 4DNPA 3V9AA 2ZSIA 4HZGA 3WL8A 1EDBA 3EBLA 2X5XA 3R3YA 3DOHA 3CXUA 1XRLA 3HYSA 4LHEA 2HHAA 4A5SA 1JU4A 2C0QA 5HKBA 3K6KA 2W22A 4RNCA 1GKKA 1CPYA 4QDTA 2AJ8A 3VDXA 5A6VA 2CKMA 4Y2TA 4BB0A 1I6WA 5K3EA 5CT8A 4N8SA 4XIIA 3QPAA 5AKIA 1GQRA 4CG1A 4JYPA 2J4CA 4DNQA 3IUMA 4FKBA 2DCMA 4AO8A 5DTJA 3S8YA 2HA7A 2DR0A 1UK9A 2PUHA 4AO6A 4C6HA 3WK5A 5AHXA 1HKHA 1XRPA 3FAKA 3ZLTA 1WM1A 3BDIA 4K2AA 1H2XA 3O4JA 5JANA 3Q8WA 3V1MA 2O2HA 1AUOA 4OB8A 2G5PA 1WPXA 4K6KA 3L1JA 1QIMA 3STTA 5A7FA 5FKJA 5AI8A 4X91A 2V97A 1LZLA 4OUKX 2XMCA 5J3JA 2OGZA 2PSFA 2VJBA 3RKSA 5ALHA 3WKCA 4ZWNA 4OU4A 5LZ2A 4WDRA 4H18A 1QJ4A 5HF6A 1FFEA 3D4LA 1K4YA 1XZCA 3LIIA 4MEAA 2YASA 1YA4A 2K2QB 5AIBA 3TGLA 2WFLA 4GHWA 4AN0A 2VAVA 4XVCA 5KBYA 1DTEA 3W05A 1K8QA 1Y37A 4HXFB 5AOCA 4UHDA 3IUQA 4G4JA 5EIHA 1CV2A 1GQSA 2R8BA 1CUGA 1GT6A 1W52X 3PFBA 5LZ4A 4BVKA 3SWWA 4GBGA 2XI4A 1T2NA 3N2ZB 3IIIA 4UFPA 4I3FA 3IDAA 3OTQA 4P92A 3C6XA 4U2BA 4J7AA 1XQXA 3C5VA 1UOQA 3QPCA 4G5XA 1VA4A 1QIHA 4G8BA 5DNVA 2PL5A 4U2FA 5ALZA 3D2CA 5DLPA 3H2HA 4QWWA 5AICA 1THTA 1U65A 4P08A 5A71A 1YB6A 3PI6A 5JAHA 1ZGCA 2EDAA 1SCQA 4M0EA 1XQWA 4Y7DA 3ANTA 2QJWA 1N8SA 4FTWA 2JGLA 3LCRA 3QMWA 3AINA 4QLAA 2GZRA 1O6FA 1EXWA 5JALA 4CCYA 4YASA 1CUUA 4C87A 4AO7A 2WFMA 2BAGA 3AZPA 4H7FA 2VT7A 4J0KA 1X2BA 1P0PA 2BJHA 2OQVA 2BGNA 4X71A 3C8HA 3WL7A 1JI3A 1OILA 1EB8A 4IH1A 5JIBA 1EB9A 3G0DA 2OXEA 1MO2A 5CH5A 1ZD4A 4LKOA 3DKKA 2XMQA 1CIJA 5CMLA 1LPSA 4BRZA 2WHPB 1AMNA 3ESDA 5ALIA 1ZIXA 1K5PA 3W06A 5EFZA 1PV1A 5AI9A 3ILSA 1E66A 1ZI9A 2QMQA 2Z3ZA 2HU8A 4UHBA 2Q0XA 1QO9A 3I6YA 4Q3LA 1R88A 4K5QA 2AJLI 4BYMA 3PF9A 4AMYA 1YA8A 2PU5A 1D07A 1F0PA 5YASA 5K3FB 3G0CA 4DTCA 3R3UA 1MAAA 3QMVA 4GEGA 2JIDA 1X70A 3TRDA 1U2EA 1ZJ5A 4X90A 4B80A 1LBSA 2HADA 5AKEA 4ZXFA 2Z3WA 2V98A 1Y7HA 1GPLA 2V9ZA 3NOXA 4WFJA 4H7DA 3AZQA 3OOSA 4C4YA 2D5LA 4UHFA 4B6GA 2HM7A 4BAGA 5K5EA 3E1GA 5CXUA 2BUAA 5ALTA 4WJLA 4C01A 1G42A 1W6RA 1S8OA 3F8SA 3H19A 2GZSA 1W4LA 4MQMA 2ZYIA 4IHAA 1R1DA 2PSEA 4Y2YA 5EIAA 3M3DA 4EA6A 5HFAA 2WIGA 5AM0A 3GBSA 2QM0A 3DYVA 3F98A 4H0CA 1FFBA 1G4HA 2QVBA 1IMJA 1XFDA 4B84A 2Y2VA 3LLCA 1VA5A 1CEXA 2JGKA 1GZ7A 5CT6A 3W2TA 1UT6A 4QDZA 3FYTA 4H7EA 3DL4A 5C81A 4IH4A 3QH4A 4HXEB 1WHSA 3WIBA 4FHZA 1CLEA 5C7YA 3WKBA 5CRIA 4BTVA 4J0DA 1XZJA 1EHYA 1HQDA 4X00A 3EQ9A 2Y2UA 2OQIA 4BCBA 3BE8A 3BIXA 3E3AA 1BN6A 4DMKA 3VJMA 1BEZA 4Y2UA 5EHZA 4B83A 1DX4A 4Y2XA 4CFSA 1CUSA 4H77A 1A8SA 5HFNA 4UBLA 1ZGBA 4QDUA 2OAGA 4GW3A 1CUHA 3WJ2A 3WWOA 3C8DA 4MXDA 4DSZA 3NWOA 2HA5A 1XLWA 2XQKA 1ZD3A 1CR6A 1VJ5A 5JASA 3VJLA 4C89A 3WK7A 1JMYA 4E46A 3V1KA 4BCCA 4N5HX 3DOIA 1ZOIA 4FFWA 4E14A 5HF9A 1XZAA 2QS9A 2OAEA 1TCBA 3E4DA 2WG2A 2QUBA 4XJVA 1CUEA 1QIIA 1DQYA 5LKAA 1TCAA 2WHQA 2XMSA 5AKXA 3PFCA 1XZFA 4X95A 1MJ5A 1IZ8A 3FSGD 5ALPA 4B0PA 1HLGA 2OGSA 1XRRA 2PSDA 4J0IA 3I6ZA 5IKXA 1XZHA 4L9AA 1M33A 3QPDA 3I2KA 4WCVA 1A8UA 3QMMA 4DLNA 3HRHA 3G9TA 1R50A 4GDMA 4I4CA 1YS2X 5ALJA 4DSAA 4C4ZA 4DNFA 4BP8A 1CUDA 4MJ3A 4KRYA 1JT2A 2RIPA 3FLBA 4KR0A 2PKYX 3TEJA 2XUKA 5AOBA 5JADA 5HK9A 5DNWA 4AZ0A 5SYMA 4LXIA 1LPBB 5ALOA 3AZOA 5AM3A 5DNUA 4A23A 3A2MA 3ZWQA 4U2EA 3D0KA 1XZMA 2WUDA 2VAXA 2WTMA 1CUCA 2Z8XA 1ZI6A 4UFOA 5AKHA 2CBGA 2YXPX 3TJMA 4QA9A 2AJCA 2E3JA 2QJRA 6YASA 4J0GA 5HQ3A 1EX9A 1FJ2A 1MNQA 4DNOA 1IUOA 2Z8ZA 4W1RA 3HZOA 4FLMA 4AQDA 4KE9A 2JEYA 2XUJA 4CCYB 2QTBA 3DS8A 4ITVA 4K6HA 4X6XA 3QYJA 2ZVDA 4G9GA 2WIDA 1MX1A 1NX9A 1YB7A 2AJDA 2PX6A 4UHEA 1GGVA 1MU0A 4J3JA 2XMBA 2PSJA 3ZLUA 2I3ZA 2VJAA 1ODTC 2ZJFA 5BWCA 2CB9A 4IO0A 1C7IA 1EI9A 2B61A 1N5MA 4N8EA 3AIMA 4J0CA 4ROTA 1KU6A 2I03A 2HA3A 4BZWA 1QIDA 1F0NA 1MN6A 4MYDA 1T4MA 4O08A 4HRYA 4V2IA 4X93A 3QZUA 1AZWA 1BS9A 5D6OA 3YASA 5AIAA 4B82A 3WYDA 5E4YA 1E5TA 2O2IA 1SOMA 3KOOA 1W75A 5A2GA 3BL8A 1UKAA 3QBJA 1XQYA 4N5IX 2XUQA 3H1BA 2G4LA 4M0MA 1UK7A 3WMRA 2C58A 1O6GA 3EQ7A 4Y2QA 5EIEA 1AQLA 1XZLA 4AXBA 1A7UA 2ROQA 4GLBA 4AMZA 4W1PA 4NS4A 4X85A 5ALMA 2PSHA 1GPKA 4G4IA 1FFCA 2JEZA 4BZZA 3FOBA 4EY4A 5HKAA 3UUEA 4NVRA 5LZ8A 2C7BA 2GYUA 5EHQA 2XUFA 4DGQA 1CUBA 3WK9A 4OYYA 3C87A 3HABA 3WJ1A 1AX9A 5AI4A 2ONCA 4X97A 1LPPA 3KSRA 1X2EA 5JARA 4PO3X 4HRXA 4WY8A 2O7VA 2Y1KA 2W6CX 1YAJA 3QVMA 2ZSHA 5E2IA 5AM4A 1MT3A 1E8MA 3OG9A 3M82A 3FSGA 3AILA 4DMCA 2DFPA 5FDFA 4EY5A 2OCIA 4MWTA 4BDSA 2WUGA 1WHTA 5JAUA 5LLSA 2GYWA 2GYVA 2G5TA 4EUSA 4OYLA 2XQGA 2BKLA 3C45A 4QNNA 3T4UA 4Z49A 3M81A 1QGED 5LKRA 4H7HA 1W76A 1J1IA 3H2KA 2CUTA 2XMDA 4X6YA 1A8QA 3LP5A 4DMFA 3WA6A 4QZVA 3A6ZA 1E89A 5ALLA 4KJXA 2WFLB 3O9VA 5JAOA 1WCYA 2C5FA 3PDCA 5JYCA 4D9JA 5JD5A 1DWQA 3EIOA 4EY7A 2XUHA 3ZI7A 3R0VA 3ZPXA 2RHTA 3B12A 4KE6A 1U4NA 1H2ZA 1IZ7A 4G1FA 2WFZA 2Y6VA 3A2NA 2Y6UA 3PUIA 1EVEA 5ALXA 2DQYA 1ACJA 4OD0A 3R3VA 1ISPA 1VKHA 3C6ZA 4FFVA 5HQ3B 2G63A 2H7XA 1MX9A 1UK6A 4W1SA 2DSNA 5ALDA 5LYYA 1U8EA 4ZGBA 3D3NA 4CG3A 4FNMA 1VE6A 2LIPA 5AKGA 4J0HA 1G5FA 1JKMA 2HL6A 2JGJA 4KAJA 2WIKA 1OXMA 4TGLA 5CT5A 1CUAA 4CIBA 3MUNA 1DQZA 3FLAA 1EVQA 1CQWA 3GFFA 2BGRA 3DCNA 5KWJA 5AKJA 5ALEA 4H7JA 1WOMA 4TPKA 3AJAA 1QIJA 1XLUA 4F0JA 2VJCA 1YSCA 3PF8A 4P93A 1XZBA 3H0CA 1JJIA 4NMWA 2XT0A 3HJUA 1XZEA 2IIVA 4I19A 3SK0A 1IUNA 1ORWA 5F4ZA 2AXEA 4HXGA 4KEAA 5K3AA 2DHEA 3ZV7A 2XQIA 5AM5A 3ESAA 5HF5A 5I8PA 1XQVA 3W04A 3I2JA 3VJKA 2H9YA 4Q3KA 1XKTA 4RGYA 4E11A 3WLAA 2OG1A 3L1HA 2EEPA 2WQZA 3RK4A 5JD6A 5KREA 1H2YA 3STVA 3F97A 1H23A 3D7RA 3HLKA 5JAPA 4X94A 3H1AA 2WLSA 3DNMA 5LIPA 4PSUA 1NU6A 3PICA 1H2WA 1XRMA 4BBZA 2XQJA 4PSCA 5ALKA 1CUZA 2AJBA 3R40A 4F60A 3PE6A 4ZV9A 2J3QA 4GXNA 4ZRDA 4YX9A 4LXHA 2XMRA 4JNCA 4LXGA 3O0DA 1L7QA 2ACKA 4BAZA 2WJ4A 3GROA 1QONA 1RP1A 5K3FA 4MYSA 4HVTA 5DYTA 3KWFA 1QLWA 1E8DA 4CCWA 2C5GA 4PNZA 2FJPA 5K3CA 2CMFA 2ZJ6A 3HI4A 1QIKA 1R3DA 5IVIA 1ETHA 1JFRA 1JJFA 1YCDA 2X76A 1EDDA 1VXOA 4ZI5A 1TKRA 3I2FA 4H7IA 3KD2A 3RLIA 1GXSA 1CUYA 1IVYA 3OPMA 4EHBA 1UZAA 5I7UA 1Q83A 3G9ZA 3DDUA 3DJYA 1KU0A 2QRUA 4PV7A 4TVKA 4AB1A 2HFKA 2Z5GA 4J0JA 3A2LA 1AKNA 5FUMA 1QE3A 4GI1A 3WWEA 2ECFA 3JW8A 5DYWA 3T52A 1G66A 2QOEA 2HU7A 1LPMA 4UHCA 2VJDA 1ODCA 4HS9A 1DU4A 3FWHA 5CXXA 3D5EA 2B4KA 4MEBA 4BATA 3VXKA 3MUOA 1AC5A 3C6YA 3VKFA 1QFSA 1ZJ4A 5CURA 2ZYHA 5BV7A 3IB3A 2BFNA 2WKWA 2QR5A 4OSEA 5T4FA 4PW0A 5SYNA 4WDQA 3SX4A 1VOTA 1EH5A 3FBWA 1C7JA 3L1IA 4KAFA 4EB0A 3G9UA 4JUIA 5CT9A 2O7RA 2GBCA 3BWXA 2NW6A 3GA7A 1MNAA 4LYEA 4Y2RA 2HDWA 5CTAA 1TRHA 1JJBA 1Q0ZA 2VATA 4LYDA 5I9IA 3DQZA 1XZDA 2XUIA 3DD5A 4BRSA 5CT4A 1P0IA 3HXKA 5JZBA 1E3QA 2XMZA 3H2GA 5AI0A 4FWBA 1VE7A 2H1IA 5AH0A 5JD4A 1QO7A 4WFIA 5DWDA 5DTIA 1AURA 1CUVA 2QUAA 5AJHA 1UWCA 4H7KA 2J4FA 2B20A 4C88A 4KE8A 5FRDA 1EK1A 4Q34A 4BE4A 5K3DA 4UBJA 4BTLA 5ALYA 1J2EA 2RI6A 2C4HA 2QZPA 4QEKA 4L0CA 5FP0A 3IURA 3WKEA 5CH8A 2HU5A 4FNGA 1UKCA 2WIFA 5AK4A 4Q82A 3WKDA 4F5ZA 1VLQA 2XQFA 4G4GA 3STWA 3G9XA 3I28A 5AI6A 3SC2A 4CIAA 4BVJA 1MAHA 3HEAA 7YASA 1HBJA 1DWPA 4Y2JA 2JGMA 3WWPA 2XB6A 1USWA 3H17A 1SCIA 4DIUA 2XUGA 2JF0A 4ARBA 2IX9A 4N8DA 3V1NA 3E0XA 2HA6A 1EA5A 1JU3A 3FYUB 4ZV7A 3EF3A 1LPOA 2JGEA 5HF8A 5AM1A 3QM1A 4FOLA 4EZIA 3WZLA 2I3DA 4XWGA 3ESBA 3RARA 1EINA 2VA9A 1TIBA 1VZ3A 2WHPA 5H3HA 5FLKA 3IULA 4A16A 3CCCA 5AKYA 1CUJA 1F6WA 3NUZA 1J06A 4FLEA 2HA0A 3IUNA 5HCUA 4KRXA 3STXA 2D0DA 3FCXA 1WB6A 4C4XA 2J3DA 3VVMA 2DHCA 2JBWA 4X3CA 2RONA 3DYIA 1C4XA 2QKYA 4FMPA 4Q1VA 1H22A 4G9EA 1F8UA 3N0TA 3NGMA 4B81A 2QXTA 3KWJA 2FJ0A 3GELA 1ZICA 2O2GA 5D3KA 2RGUA 4PF1A 3O9MA 1Y7IA 2JGIA 4B9AA 5JZSA 5D3ZA 3VISA 1P0MA 5AKZA 4G8CA 3KDAA 3IVMA 4YK7A 3C43A 1Q0RA 4AX4A 2VTVA 3W9UA 3OURA 3DKRA 3LS2A 2HRRA 2WJ6A 3A70A 1XZIA 5CH3A 4IQ4A 3OC0A 1XZKA 3K2IA 1NU8A 4U2GA 3STYA 4CI9A 3BF8A 1CUXA 1L7RA 5KWIA 4KACA 1BE0A 1K63A 4ARAA 1ZD2P 2RHWA 5AKKA 4Y2SA 1QIEA 5FPQA 5BOVA 5D7BA 4AZ3A 4S0XA 5AK6A 4RPCA 3FLEA 3BJMA 4OCZA 5T4BA 1EK2A 1PJAA 4RE5A 3H04A 1SCKA 1DX6A 2WSLA 2ORYA 3HACA 3ICVA 5K3BA 1VZ2A 1SFRA 3V1LA 1UOOA 4UBKA 2OCLA 5IVKA 5ALWA 2CJPA 4L72A 3AIOA 4FBLA 4QLOA 5LZ7A 4GWLA 4OB6A 3BXPA 5HZGA 1KEZA 4KE7A 1A88A 1BRTA 4BE9A 3F9CA 5ALUA 5E4TA 3ANSA 4JH0A 2C0PA 2ACEA 4P9NA 4Y9SA 2WG1A 2HFJA 2DQZA 2UZ0A 5JZ9A 2H7CA 3WIOA 2VT6A 5LZ9A 2PBLA 4QDOA 3OM8A 4ZREA 3S2ZA 1QOZA 5EI5A 4DMHA 4B85A 3B3QA 3VVLA 5C8VA 4EY8A 3I2IA 2VQ6A 4Q05A 5T4HA 4MWSA 1ZIYA 3UMJA 5FPPA 3WK6A 4HTAA 4UPDA 1WB5A 4W1QA 2PUJA 1YS1X 1QIGA 5E4JA 2OGTA 3MGAA 2HA4A 4KYVA 3BIWA 1AGYA 5AK3A 2WUEA 5AP9A 4QDXA 1DWOA 1LPAB 3AUKA 5CBKA 4OB7A 3FYUA 4KAAA 1Q84A 3FVRA 1BCSA 5EHXA 4FBMA 3C5WP 1LBTA 3LIPA 3EQ8A 2HRQA 5C8ZA 2BUCA 2VEOA 3FNBA 3KXPA 3G02A 3MVEA 1IUPA 5LZ5A 3C70A 5ALQA 3O95A 4GECA 2XLBA 1HDEA 1LZKA 4W9RA 1UFOA 1ODSA 2YH2A 2OPHA 2I78A 3RM3A 4UFNA 4ETWA 3BDVA 1FSSA 1VXRA 1QZ3A 1UXOA 5AKLA 3H2IA 2H7YA 1MX5A 3IBTA 4Q3OA 2XLCA 1FFAA 1CUFA 1R4ZA 1TK3A 3O4GA 3H2JA 5EGNA 2WU4A 2OCKA 3WWCA 3DL7A 4PQEA 3BF7A 4UHHA 4BC0A 1CUIA 2XDWA 3I2HA 1TQHA 5T4EA 2OLEA 5FV4A 4B7ZA 2PU7A 3G0IA 1UOPA 2WILA 3G7NA 4FLFA 3WKAA 3DEAA 1XRQA 3X3HA 5AI5A 3AFIA 3PUHA 2WUFA 4UBNA 4BDTA 1QTRA 5BWBA 4MQLA 3STUA 5ESRA 1XLVA 4YPVA 4EY6A 2YYSA 4XX1A 5ALNA 3D2AA 1XZGA 3B5EA 1WPRA 3R3WA 2WTNA 1N5RA 1HPLA 5A7HA 2GBFA 1YAHA 2WJ3A 1QFMA 2JGFA 4CG2A 5JATA 1UKBA 1E8NA 1LLFA 4BAUA 2PVSA 4G8DA 3F96A 4BCDA 4BC1A 3F67A 1LGYA 5IH7A 3WK8A 4QE3A 4U2CA 2B9VA 4M0FA 1B6GA 4F21A 3C6BA 3QITA 3V48A 1JMKC 4U2DA 5ALRA 3JYHA 2WHRA 4OU5A 3BJRA 5ALSA 4Y2PA 3U0VA 2XUAA 3R41A 2VF2A 2P8SA 3FCYA 1FFDA 2XE4A 4EBBA 1DT5A 3CN9A 4WY5A 2WU3A 5A62A 4K6GA 5CW2A 2BUBA 3G0BA 2ZYSA 3K9BA 3ESCA 1RYYA 3HSSA 3D2BA 4UBOA 4B9EA 1XRNA 3WYNA 1MTZA 2HA2A 4UBMA 1WB4A 3H18A 2XUPA 4H35A 2XUDA 2WM2A 3ZLVA 2IITA 1B41A 1BEEA 3R3XA 3WWDA 2ES4A 4WFKA 5ALGA 1R9MA 1QTIA 1LNSA 2CEKA 3IUJA 3WL5A 1J07A 2XMGA 3FVTA 3O4HA 4JEIA 2V96A 4J03A 4E15A 1XROA 1CQZA 1XKLA 1GKLA 2RAUA 4IH9A 3ED1A 1YASA 5LP1A 3R3ZA 4UUQA 4DM7A 3I2GA 3I1YA 2XUOA 3CN7A 3WZMA 1N1MA 1EDEA 2R11A 1UK8A 5ALVA 2GBGA 1K6EA 2ZYRA 5DJ5A 3HC7A 1DINA 4HAIA 1ZI8A 2VSQA 2QXUA 2CZQA 1LPNA 1BCRA 3GUUA 1GPNA 4B0OA 2ZJ7A 3UUFA 3WK4A 1DT3A 4QWMA 2PM8A 3JWEA 4Y2VA 3IA2A 3I6MA 1CUWA 4L3WA 4X6UA 1QIFA 3O4IA 4RE6A 3Q0TA 4LIPD 1HL7A 5IVHA 1BROA 5ALFA 3D59A 1THGA 2EDCA 2QT9A 1ACLA 2HIHA 1RWQA 4X92A 3WA7A 1BN7A 1Z68A 3W9BA 1W1IA 1MPXA 3ICWA 2FUKA 3WI7A 1TCCA 5FXMA 3DLTA 2BCEA 3AIKA 5HK8A 4BVLA 1PFQA 3U1TA 4UBIA 1P0QA 2OCGA 5AK5A 5ISMA 3GZJA 3WQHA 4INZA 3CCBA 5AM2A 2X8BA 3G8YA 4OPMA 1ORVA 3WL6A 5DYYA 1BU8A 1ZD5A 3G0GA 4AN1A 5AOAA 2PPLA 3M83A 5A7GA 4NZZA 4W63A 4PSDA 5FOQA 5AO9A 4DYHA 1R9NA 2DHDA
chains in the Genus database with same CATH superfamily
1DRWA 1UXHA 3FYUC 1CRLA 2FX5A 4XVQA 4EGCB 3I09A 1OYVA 3CUYA 5LA6F 1KHTA 1W9HA 4B6PA 3A04A 3DCYA 1F3LA 2IFTA 5EUQB 1UBSB 1N6KA 1AIPA 1WSAA 4J2TA 2AN9A 4O3FA 1CYDA 2WG0A 1LJUA 1ZU4A 2GAJA 1S7CA 2XAAA 5IVDA 1XMIA 4CIYA 4RWZA 5C5CA 1CFJA 4ED9A 3HDGA 4IRXA 2OHGA 2YWXA 2AF4C 3A9SA 3R3SA 2GBIA 1D2CA 1BYUA 1AS0A 1TAHA 1DE0A 4X1KA 4ZANA 2BI7A 2HJ9A 2X2FA 4PYRA 1JA9A 2MSLA 2PIAA 2YWGA 1DXHA 4GMFA 4JXKA 4YJKA 4GSYA 4ZVUA 1DAHA 2WSSD 3H1GA 1QTNA 2BI8A 5EFOA 1J2YA 1JEEA 1QWSA 2CLFB 3HH8A 4TYNA 5K6AC 2UVDA 4U7PB 4EYGA 2J09A 1OIVA 3FVQA 4TRMA 1IY2A 2B4YA 2H17A 2Y0DA 4HZGA 4LNHA 3SKVA 3ZD6A 1J1UA 4G0ZA 1TKAA 5J47A 1E3LA 4LN1A 5CB6A 5DTEA 1UMDB 1G7RA 1X1CA 1EFPA 4FYVA 4GNKA 2GTIA 3QI2A 3RYTC 1ZESA 3TYXA 4RH1A 3LQ2A 4D6PA 3CXUA 1KY5A 3F2IA 3OESA 2IOFA 1M10A 3LZDA 4RHTA 1N2XA 4PHFA 4QPCA 2RJOA 3GVXA 4N0QA 2Z4TA 5A06A 3GN1A 4R31A 4MS1B 1ZJYA 5LQNA 4LF8B 4ZKEA 1JSXA 1HG0A 3TRJA 1T2AA 4RABA 3K6KA 9MHTA 2YWEA 1DAGA 2JBAA 3TW4A 1SURA 1N5DA 4ZU3A 2XA9A 3FPGA 3U4GA 1Z5ZA 5JSFA 2AL7A 1WUKS 2GA9A 3PQDA 4R7GA 4QOSA 4JIMA 1LX7A 3FOCA 2JL1A 4LV8B 1PD0A 3KAPA 3P71T 1R00A 3PL5A 3B3AA 4YDQA 1G6Q1 1JVBA 1R6TA 3PE3A 4X54A 5FBRB 3ZGLA 1NYTA 4AJLA 4GOLD 4L8VA 1WMSA 1P8JA 4LNAA 5I9SA 1I6WA 2Q50A 1UPCA 3OQ1A 3VZQA 3G5UA 4FMBB 5CLJA 3L0ZA 1CT9A 3NM6B 1PJLA 1S5PA 4N8SA 3NYRA 3UCEA 1ISFA 1SXJE 1DQNA 1USGA 4I4TF 2I2AA 3U7QB 1IJFA 2ZWPA 4HWOA 2D1SA 3OAAA 5AKIA 4GNRA 4AKEA 2QY9A 1GQRA 4LMRA 3LY7A 4V02A 3CX4A 3WDSA 4LZLA 3CUWA 4M88A 3ZEIA 4F6RA 2AR7A 2JASA 2Z08A 2GB4A 1PKXA 1XTQA 4EG0A 1QORA 4MWGA 1T3SA 2IH2A 2GD2A 2D2FA 2VJMA 2OV2A 3GLQA 2IDKA 4BGVA 5FWNA 3UGJA 3BKXA 2ACWA 4M7RA 2BKVA 5DTJA 2X9VA 1ESZA 4W5NA 1JIJA 2A9KA 1NL3A 2EGGA 3N86A 2HA7A 1V2GA 4MIOA 3LQYA 3WLRA 4AO6A 4ER5A 5AVSA 2WC1A 4TXJA 4XVUA 3VNRA 3NRJA 3F47A 1OV6A 2PBRA 1XRPA 2QWXA 3FAKA 4W82A 3WTBA 4DZRA 1XTJA 3BDIA 4PYKA 1WCIA 1CNMA 1H2XA 1L7BA 3MTEA 5DV9A 1WETA 2NYVA 3FKSA 1FQOA 4UE3S 5DGDA 3MJSA 5KVSA 5EIFA 4FCVA 1W36C 1E4OA 3ZDAA 2C4MA 1E6EA 2I1WA 3NEPX 4NU6A 3U31A 2X13A 4ZT3A 4ZCTA 4YT8A 5B1YA 3RFVA 4XJXA 3TW0A 2CXQA 5L40A 3SC6A 3EWIA 2FV8A 3GCGA 3I0MA 3JQQA 5EL0A 2X9GA 1WPXA 1X8XA 3U7GA 3JS5A 2QIPA 4BNDB 1H0KA 1OLXA 1PTJA 4DA7A 1T0HB 3RJMA 1SHKA 4YJFB 3STTA 3P32A 1U6KA 1CG6A 2DE0X 3PVSA 1JR6A 4JSTA 1SQ5A 4O2BB 3SP1A 5IVPA 1R12A 1XA4A 4QTZA 2XMCA 3R20A 3U80A 1QX4A 4PPGA 5EMJA 3A32A 4PX5A 3WKCA 4MUMA 4KGZA 1QBKC 3ORHA 3PQ8A 3ZDRA 5I7RA 4OU4A 5CD9A 1O6CA 1R6UA 2MSDB 4AJ1A 4BMZA 1QJ4A 3EXG2 1FFEA 4YUVA 2AE1A 5AVZA 2C83A 2Z6QA 1YA4A 3WYCA 1DEAA 1NZJA 2QZSA 1RRPA 3ZD9A 3LBYA 5B7NA 5JO0A 4LJAA 3F5QA 3IO5A 2VP3A 4GHWA 5AW7A 1OB5A 2PGLA 4V03A 1FDSA 1X9GA 1V5IA 4IKPA 4AN0A 3KOMA 3KOZA 5JMWA 3FMPB 2GD0A 2W6JD 1XU4A 5KBYA 3SHTA 2WD7A 3MWJA 4PYNA 3CVJA 5IASA 2CCJA 3TEFA 4NDAA 1Z12A 2YV4A 3RANA 4EZBA 4QPDA 5E1MA 4GQBA 3SJ7A 2VOJA 1GSIA 4BV8A 3ERCA 3GEDA 4ZT5A 4FYKA 5F23A 5EMNA 4KB5A 4ACAA 1S8AA 1CUGA 3GPBA 4WIAA 2DFLA 4EKYA 5TRTA 3NP9A 5EZYB 3Q7SA 3T9DA 1P2FA 1SVLA 4LHVA 4R1TA 3WQQA 2DBQA 5KTPA 4XGNA 1SA0A 4XQCA 3DAHA 2QTFA 4G81A 3L7NA 1P72A 3RASA 3WIEA 1ECPA 3W6OA 1W19A 4ENQA 4ZYYA 4A4DA 5L3SA 5M5BA 2XI4A 3A1CA 1E2IA 2I65A 1UM8A 2A30A 3IRVA 4E2YA 4FDUA 3SBDA 4C4RA 2XA2A 1E2FA 1X1TA 2AOTB 2LVBA 2PH7A 2PGOA 3P9YA 4LOLA 4TT3D 4PHTA 5JS2A 3V5NA 2PD3A 4PGFA 3C6XA 4I5IA 3USCS 2UXBB 1GCOA 3TMYA 2CXXA 2IS4A 5BO5A 5CDGA 2UUOA 3C5VA 1SG9A 3WVNA 4KYTA 2RH9B 1FXWF 4LXUA 3WGTA 3WLMA 2FW6A 1OC4A 3QFFA 1BZYA 3LCUA 3R9WA 1JI0A 2AH5A 2EYUA 2MTBA 3BG5A 1VA4A 5ER9A 3ZS8A 1F9AA 4XTCS 3DV2A 2YWDA 3JQRA 3ZV4A 4KFUA 4MHOA 4U2FA 1P4SA 3V32A 1Z33A 2YS6A 3ANLA 4LZZA 2QMOA 1NQWA 2WF7A 4RF2A 4REMA 2WE8A 3KC2A 3Q40A 3H2HA 4YGYA 1OC2A 4ZAXA 1THTA 1U65A 4O0MA 4X1YB 4P08A 1D7OA 4ZQHA 4R69A 4RV5A 5GJVC 1YRQA 3GJ3A 3BGSA 4JODA 5JAHA 1NFRA 4NXNB 4AUMA 5H80A 3GQBB 1AXRA 1SCQA 3KPUA 1M75A 4JR0A 4YHHB 2VQDA 2W4MA 4UTNA 4MO9A 2IY9A 1BOFA 1A50B 2CUKA 2XNDA 1ONNA 2CHEA 3ECAA 1UJNA 3JYLA 5KJFA 4FTWA 1FK8A 3LCRA 1M6VA 4BASA 3TCKA 4QLAA 3LY8A 3PKJA 4YJ2F 1EXWA 1KSFX 1U1EA 2VDKB 1O57A 4CCYA 1I4OA 1NE7A 3SZLA 5HRCA 2PWZA 4JJ8A 4JL6A 3JQ9C 4MHTA 3MSCA 2ZU0C 4YASA 4EDFA 2QAGC 1OF1A 1YIOA 3O4RA 3T9AA 4H4DA 3CF6R 1TVKA 4WV3A 2C1ZA 4D2IA 3ZHQA 3NGXA 4YP6A 2NAFA 1EFLA 4RK0A 2GLUA 3ZU3A 1NYRA 1LS1A 1L3IA 2O2XA 4DCGA 3UOAB 4DWVA 1FW8A 1WZ2A 5CP8A 4ZIRB 2XCIA 1C4WA 4HMOA 2OESA 4H0FA 2R6FA 3G2OA 2FSIA 1ULAA 3O31A 1XLTA 3OFJA 4X65B 2EX0A 3ZWWA 2GEBA 3AR3A 3R6GA 2VCHA 3WAGA 2ON6A 1P0PA 3C3EA 2BJHA 3L8ZA 4RKQA 3UXEA 4HZIA 4JR2A 4X71A 3HN6A 2RI1A 4QPNA 4P3YA 1QDUA 2BMEA 2GS9A 1K6MA 2W4IA 4C0LA 4HWPA 4DMRA 3L40A 4KQFA 3B1XA 1U0JA 4J6FA 4IH1A 1RWMA 1H3EA 3VSDA 1CZOA 4B2IA 3TIVA 4CMGA 1BX3A 2QDKA 1ABEA 3NDIA 2QMEA 2EHDA 5CH5A 1E2BA 2NG1A 2VIIA 4V3BA 3DOEA 5CB4A 4KRFA 4DYVA 1EKXA 3DKKA 1NVDA 3ER6A 3FWKA 3ZYZA 3K9WA 3GJ4A 5H5JA 3NTVA 4HDMB 1DLJA 1WMBA 5BQ3A 4BRZA 1B1CA 3RT7A 2WHPB 4BS9A 4UU8A 4RU1A 2X4DA 4A0FA 2LV8A 5ALIA 3K09C 3ROFA 1P1KA 2QN7A 4EI9A 2BE9A 3ANYB 3RBXA 4FZ5A 3DKIA 1TUIA 2PDAA 3GEHA 4TYPA 3S5UA 3CX6A 3GLTA 3S1LA 4PZDA 1HI9A 5ILGA 4ZOBA 3KOWA 3ZXYA 2IE8A 3KQOA 1DP4A 2YRFA 3ELDA 3ESXA 3FOWA 4DY6A 5HUQA 3G0HA 3N2GA 4RYDA 5FPYA 3TSZA 2EV9A 3KAKA 1NR1A 4UMFA 1CIPA 2FWMX 4ZVPA 1JFSA 3H4VA 2P4SA 2CXUA 3M4JA 4P31A 1S4QA 1YRYE 4GLLA 4YDSA 4MMYB 5KTMA 1QG2A 3DZHA 2WIBA 5KSPA 2I22A 1K98A 1N9ZA 4G97A 2BW0A 4GMHA 2PYIA 4EW1A 4K5QA 2AJLI 4BYMA 5LC1A 4EJ0A 4LE1A 3P8ZA 4GOKA 4B09A 3L92A 1KJIA 1D07A 1Z39A 5FX2A 3SE7A 5YASA 2ORED 3ZVMA 1E4EB 1YJ8A 5K3FB 1XDZA 3COJA 2FK7A 4RJLA 2VDPB 2QT0A 4EB6A 3HA7A 3V7FA 5E7MA 4KXUA 3DV0B 3R3UA 4DILA 1I2AA 5JJCA 1H1LA 3DLIA 4GR4A 4PPQA 2FR0A 2PMBA 4FGKA 3VVCA 1J2TA 1I94B 4O5OA 5FFFA 1SH7A 5K0EA 2JIDA 5H7XA 4I14A 3W7BA 1YVDA 2I7CA 4L0DA 2OHIA 2HK7A 2IHBA 2IZ7A 3GDHA 3FGOA 4BPBA 1U2EA 1ZJ5A 2O0HA 4X90A 4D3FA 3GEEA 1Y4DE 5EZYA 2O5RA 3BTUA 2HADA 5DSXA 1NUTA 1Y6RA 1DIOB 3TTYA 2I8LA 3OPXA 1Q57A 1G291 3I05A 4L15A 4Z7JA 4QO7A 1QKIA 3TVYA 2ZWAA 5HCNA 3TIXB 4CGYA 2AHRA 1I2ZA 1UFQA 5FI1B 4H7DA 4GAEA 2ZM6B 1MFZA 2N0SA 4N5LA 3TH5A 1GARA 4DQ0A 1RIIA 1H1TA 3H4IA 3AQ4A 1XYGA 3CC8A 5FULA 3SVZA 4C4YA 5CFNA 5F7XA 1N0HA 3FA2A 3DC7A 3OTWA 1JH9A 2Q1YA 2PJUA 5KJ1A 2XR1A 2GLXA 3QV1A 1VCIA 4MLZA 3E1GA 1LDBA 2Y0EA 1I2CA 1Y1TA 3TNYA 4PN3A 1JQ5A 2BUAA 1T5TA 3D6AA 1ZISA 3CX7A 5ALTA 2FFJA 3EEOA 1QV7A 4QUIA 1TECE 3N6XA 4M9QA 2ZXUA 1G42A 4GL2A 1RC8A 4X8MA 5KOHA 1H9BA 3GLGB 3A1EA 1SOUA 3EF0A 4JXJA 2AKYA 2GZSA 5JH7A 3KZKA 1OYOA 3W8DA 3W5BA 2C2YA 5CDHA 3OCCA 5LOVF 4LSMA 4M21A 1L5MA 1P29A 2WABA 1HY3A 5IKEA 4M8KA 5FT9A 4J0QA 5J59A 3NALA 3EUEA 1RJDA 3IOCA 3ZV5A 2WZBA 2H0QA 2PLRA 2IKQA 3EMVA 3F49S 1FXUA 5AM0A 1XXHA 3PHBE 1WCIB 3KQTA 4HUQB 5JNTA 1NI3A 4MWBA 4R5HA 4BJ3A 3DTNA 5FAKA 1A9OA 3LXRA 4IIUA 1DCFA 2I5PO 4G4SO 2FJUA 2FEKA 2QVBA 3OPNA 4MITA 2G25A 2JGRA 4OJYA 3CZ4A 4BZPA 2DBRA 3ETGA 3KXDA 4BQIA 3BXOA 1A69A 1XFDA 1DKLA 3IQIX 1Q0PA 3FDXA 4NZ9A 4AY4A 1QGZA 3EX7C 2HLDA 3NBYC 3NTXA 1P19A 4XUEA 4MRVA 7ADHA 3I4LA 4RKFA 2H7VA 3A9WA 3PNVA 4WK2B 5CT6A 3RRJA 2BEVA 4I0WB 4QDZA 2WINI 4H7EA 2YXDA 1JILA 3DOUA 5EXDA 3OLZA 5L3SB 4C1BA 4IH4A 5C81A 2FPPA 1VFPA 1XRSB 2I76A 3FYCA 1IJBA 1RKUA 3SDSA 3TVDA 3F78A 3BMOB 5C52B 2C4NA 2O8BB 3VH2A 2A1TR 4NYJQ 3OCZA 4J0DA 4WNAB 1FX1A 2HSGA 3AFGA 4YMLA 1KBOA 3ND5A 5JRJA 1J1ZA 1HQDA 4HRVA 4X00A 3CVWA 3AF0A 1UODA 2G4CA 3NORA 4BMPB 3AUSA 1A9XA 1UBOS 2G4VA 3B5IA 2L42A 4A6XA 3ZCUA 4YRMA 1GQ2A 1E7SA 2C2HA 3LHFA 1DEHA 4INJA 1Q7EA 1C8BA 3BE8A 1X87A 4NNJA 2A14A 3EXEA 1NVEA 3TVTA 1BN6A 4BIIA 1F1JA 4MQUA 1XTRA 2NIPA 3PUJA 1PFKA 2Z2JA 1XKQA 4PO9A 5EMKA 3WSVA 3JWIA 2OQRA 2XWJI 4B83A 1T0IA 4Z4CA 1EA7A 2CMDA 5INTA 1N5OX 1F14A 2QORA 4MVJM 1CUSA 1GA1A 5C0OE 3NT4A 3O92A 4ICIA 2ZDQA 5HFNA 3TZQA 4D8UA 4YAIA 1Z2CA 3I04A 1YO6A 1I3LA 3KT3A 2A33A 3ZQ4A 4P84A 3T7SA 1CUHA 2ZZMA 2Q5JA 4JJKA 4D1YA 1FSZA 3WWOA 3U40A 1UJMA 1Z73A 1UCFA 1XEFA 1MOQA 4O4IB 4I1PA 1DEKA 2FSVC 3IAS1 1X13A 2HA5A 3OPYA 1ZD3A 1GTZA 4MUGA 4OK3A 3F4LA 4DIKA 2QZ4A 4UARA 8ATCA 5JASA 4C89A 1FNDA 3RLFA 3IIJA 3NFYA 5G0SA 4OQZA 2OHHA 1K8RA 4E46A 4Q4DA 1MA3A 1V8OA 2QN6A 3KKKA 4WOJA 1APBA 3SJAA 2J7KA 4EG8A 1REQB 1ZOIA 3P9RA 2Q3LA 4E13A 1ZQ9A 3KKPA 4E14A 2G70A 3JQFA 5JZOA 4QBIA 1NUAA 2QS9A 1CXZA 4ASUA 1FUIA 2OAEA 4AVYA 5LLTA 4YFVA 4BKUA 4I6GA 3EBPA 3ZU4A 1G4UR 1OR8A 4UVHA 1AKWA 1IPEA 2BMWA 1MORA 3V3TA 3ZVRA 2G04A 4KPGA 2IK8A 5IX8A 4ZVVA 2Z4SA 3INTA 5B53A 1BTOA 4ND8A 3UAYA 1IK6A 3V2GA 4EUNA 4K81B 4LF9B 3TIIA 3O26A 5KDDA 1TCAA 2PTHA 4TTJA 4ZI7B 2DGDA 2GCIA 4Q4LA 1IB6A 1SB9A 5GONA 4HVCA 5K8JB 1SBIA 3PFCA 2C9MA 4KFRA 1BMDA 1D9XA 4PZ0A 5A2QA 1RRFA 1QGUA 1RYMA 1VL2A 1M7HA 3DMNA 4CL8A 2BKAA 1SB8A 1U8FO 1G9TA 3Q0IA 1YE3A 3GLGE 1W5TA 1JBKA 3FSGD 3JQAB 5ALPA 4LEIA 3WB1A 4B0PA 3EISA 2OGSA 4BV2A 4DV4B 1XRRA 2PSDA 3U44A 3TSWA 1V41E 2ID4A 4J0IA 3DBIA 3E7FA 2WJYA 3X43A 1TYCA 4DXHA 1TO2E 2D8AA 1DHTA 1TK2A 5KOYA 1DCTA 2F3RA 1PFYA 1YIDA 1E2EA 3QPDA 5E6RA 4I1VA 4OK6A 1O4VA 2ZIXB 3GD7A 3MCTA 2RK4A 4WCVA 4CF3A 4DA0A 1Y8CA 3SG0A 4DLNA 1OWMA 3KLNA 5HXAA 2WFAA 5JV5A 3FFBA 2C00A 2N1BA 1E0JA 3HRHA 5HEKA 5CBPB 3GJ6A 1Z4KA 1JECA 1CDEA 3ISJA 1YS9A 2YJ5A 3PZBA 2C9YA 3IDZA 1XC7A 1V4NA 1SELA 1YS2X 2NQTA 3I3SR 3OSZA 3PDIA 5ALJA 4EQZA 1YFKA 2F48A 2I2BA 3HBFA 1WMDA 1PVDA 1CUDA 2SKDA 4M36A 3AEQA 4NCKA 4EW6A 3ZDEA 3HSKA 3JAWA 4ZP1A 5LA6A 3HXMA 2PS9A 4RD1A 1JT2A 1NC3A 1KJ8A 4KO3S 4PCAA 4DLYA 4ERXA 3FOFC 5TE9A 1KZGB 2VDQB 4QYIA 1XQ6A 2J59A 3MRXA 5M3BA 1QCDA 3CPJB 3OQ6A 4E03A 2HV9A 2XTNA 2QAJA 4REQB 3T9CA 1PF7E 2XUKA 2BDEA 1RRGA 2B35A 2P2SA 1YD7A 3E4CA 1A9SA 2AK2A 1KO5A 4LXQA 4MVJF 1HO3A 3GFTA 3OU2A 3WLJA 5HK9A 2C4KA 5LXTB 4OI0A 1X7GA 4JFRA 3MTDA 1YL7A 2ZATA 1GHTA 3O9ZA 1S96A 3Q7IA 4P36A 1AUVA 5COQA 2QD1A 4DSTA 4EWLA 2RAPA 1E69A 5ALOA 4HB3A 2GSWA 2ZBVA 3ADOA 4JN6B 3ZWQA 2XNJA 3HY6A 4CM5A 2IYRA 2FPRA 4PTZA 1U7UA 4C7VA 1XZMA 3SC2B 2D00A 3IDQA 1XPOA 2UUPA 3Q6NA 3T7AA 5K51A 2WTMA 1UXGA 4R05A 1QS0A 4YCDA 1X19A 3NTQA 3C3KA 2N9UA 1QAQA 1VPTA 4OHBA 3VH3A 3Q7TA 4DXAA 2YXPX 3PGMA 5AMXA 4GMKA 1PVVA 3TJMA 4EVIA 4QA9A 3EVAA 3RT1A 4M1WA 3A3YA 2QJRA 1CETA 6YASA 4JI0B 4JITA 2Q5HA 3PJRA 5K20A 2DPMA 2VT2A 2WTBA 1NVGA 3IOBA 4YUZA 5IXJA 1YBMA 1LBHA 1ZKDA 2VTKA 1MNQA 4QOHA 1OIXA 3MJ4A 2QF7A 5H81A 4C7JA 3WQRA 1E60A 1JH8A 4DNOA 2Z8ZA 3HI6A 3RS4A 3OM1A 4ARZB 4AY6A 3AVWA 2ZTHA 5JBNA 1K92A 4R7ZA 1O77A 1ZBDA 3TXAA 3H8VA 4BO5A 1LW7A 4V0OA 3DFIA 5B3AA 3T5BA 3F3MA 3CUVA 3MN1A 2XUJA 1FP4B 5FBZA 4BFCA 1MCZA 3DS8A 4DCJA 2JBHA 1J5EB 4LDRA 4X6XA 4IHKA 2ZVDA 4RVFA 2ZUEA 4IDAA 2JHFA 3C5HA 4HLDA 3ETNA 4LRUA 4CFZA 1MX1A 1E18A 3FF1A 4E70A 3ND6A 3UKJA 3P0FA 2EBUA 1ZIPA 1GUZA 4UHEA 5LP6C 2DKNA 2QR2A 3FFXA 3IJ5A 3EXHC 1KYWA 1FQWA 1MU0A 4J3JA 2QTNA 2B8EA 2BHTA 2XMBA 5LQSA 2GZDA 3RVKA 3KLMX 4HLUC 2VJAA 5BWCA 4E94A 4LGMA 4NHOA 4O4HF 5TQ2B 1L7XA 1EI9A 2B61A 1V5WA 1X86B 4N49A 3HWRA 3T5TA 1BWQA 3A3KA 2QMZA 3KXLA 4BO8A 3JARB 4E12A 1EFVB 1Z45A 4AYWA 2W0MA 1N1DA 1RKQA 3GFVA 2ZE5A 3LUKA 1KU6A 1TQ2A 3P0EA 4HUQA 4WMLA 5DI9A 2HA3A 2WU1A 4O08A 3QKWA 5DK4A 1RRVA 3L46A 3L93A 3GL9A 3B51X 1HNZB 2WD9A 4YVFA 2BHLA 2R6R1 1NMQA 2ZW9A 3OE1A 5I9TA 2SKEA 4JHXA 1VJ1A 1VBNA 4M6WB 2YWRA 2PGIA 1KQNA 3TLCA 1PFWA 3O2QB 1DI0A 3OPQA 4KNVA 4TTAA 3O0TA 2VDJA 1U5BB 1ZO8A 2EJWA 3QJGA 1W94A 5DCYA 1Y8RB 4PSKA 5CEJA 4QEZA 1SOMA 2FEOA 5IBQA 5E3IA 3EA0A 4MQEA 1Q5PA 2Z9DA 4H3SA 2I2FA 3ETHA 1UKAA 3ZY3A 5KQSA 4N7MA 3QBJA 2SBTA 2F1HA 2OILA 4RF4A 4RY8A 5ELMA 5IEJA 4MW2A 1C9DB 2P9FA 4TKMA 4AZTA 2XZTA 1YA6A 2ZSAA 5B3JC 3PEYA 3COWA 3H1BA 4C20A 1X94A 4M0MA 4Z9BA 2I9PA 3TB6A 1A5ZA 2VAWA 2H06A 3WMRA 4F8YA 1Z6GA 5HKKD 5JFTA 3L0OA 2DCUA 3L06A 3ZH9B 3EQ7A 3I73A 2PCLA 2I6UA 3DO6A 4XIYA 3RSLA 1AO0A 5AW3A 3KJQA 1KZ4A 2VOEA 1SJ9A 3EGDA 2PH3A 1BWPA 1NNUA 2O9JA 2ROQA 4S1VA 2XGGA 3OCYA 3Q1LA 1XAHA 4GLBA 4UCFA 3ZWCA 1HOXA 3HPRA 2RGXA 1E77A 1QJCA 4FT4A 5I5GA 3LHSA 5LJIA 1PDOA 4WQMA 1M2KA 1U8YA 1TVMA 4QSMA 1RPJA 4X85A 1E1RD 1VJRA 5REQB 2EKZA 2UZ3A 5F78A 3NP7A 4AJPA 3FBTA 3I0NA 4XSHA 3KQMA 2R87A 4V1CB 1JRLA 1JYSA 5BW5A 4BZZA 3FOBA 4F2PA 4J3FA 2I2WA 4DV6B 2VNAA 3TQQA 2HPZA 3AR9A 4BGEA 4TKZA 5IWCA 3UUEA 4HN4B 4WZAB 2GCNA 3BB4A 1LUAA 4G6ZA 2GYUA 2X22A 1QK5A 2ALJA 2Z04A 3Q3VA 5JXJA 2AN4A 1G7TA 1NMXA 3NDJA 4Q1BA 3ZTYA 2GFIA 1P60A 1Y1PA 3WK9A 1IPHA 2B8NA 4G0PA 3C87A 5C3UA 3BWEA 2AHOA 3WFIA 1XTBA 1MHTA 1BFKA 4MUNA 1XIVA 1WDKA 1ZITA 2DSTA 3WJ1A 4CF4A 2C95A 2XW6A 1UZLA 2ONCA 4AKTA 1CRQA 2AD1A 3JQFC 1LPPA 3CIOA 1NW7A 1SCNE 5JMOA 3V2HA 1BCSB 2YJZA 1N5JA 1PS8A 5JNRA 4OA8A 1UJ6A 1X0XA 2VSOA 5JARA 4BNFA 3QTBA 3LT0A 4WY8A 1JFTA 2E5WA 2Y1KA 3C6MA 1EMDA 4KR6A 2QD3A 4R8VA 4TWRA 4KFTA 1NN1A 1YAJA 1L8OA 3O8RA 3LX6A 5E2IA 2QTZA 5AM4A 4MGEA 1N6LA 4LY6A 2AE2A 4KJZA 4KBYA 3M5CA 1M1UA 3KZVA 1I2DA 3OG9A 3H9QA 4KK3A 1O8BA 1GIAA 4XWOA 3K4HA 3AILA 4KX3A 3I9FA 5KVAA 4Y6OA 4RLFA 2C9CA 1TPYA 2ZZNA 4OIFA 4EA8A 2WVHA 2MJLA 3M6VA 1FRQA 4NWIA 5FDFA 2FDXA 2OCIA 5ILQA 1WXWA 1XWIA 2YZMA 2XTAA 3NTLA 3GAZA 4BDSA 1GGFA 5IBPA 3GNTA 1TVEA 2WUGA 5GAJA 5JAQA 3EXFA 3IQWA 3NATA 3LW7A 4Y1FA 2GYWA 5LLSA 4B3XA 4BO6A 3IPCA 4NYMQ 3WBFA 2GYVA 1WABA 3P26A 4EUSA 1YACA 2AFIE 3DOCA 4OYLA 2JLYA 4P5DA 2GFQA 3LA6A 3PG5A 4QNRA 2WA2A 1BJRE 3JASA 4CQNA 2QD4A 3RU9A 3MQ4A 2J87A 1X0VA 3D31A 3RS8A 2A9VA 2OO5C 2RGNC 2D2EA 2ONJA 2A9OA 3IP3A 4JVLA 4G0QA 4PY2A 3L6UA 2WRZA 4GYYA 4GR5A 1TTQB 3T7KA 3GH1A 3UVEA 2AEMA 4DBZA 1VSUA 1L7VC 1Z7YA 1N7JA 1KBQA 1QC5A 1GNPA 2NGRA 3AXTA 2FQWA 4O8ZA 4QQNA 3MCVA 1CS0A 4OYHA 3UENA 1BYIA 2GAFA 2VYFA 1C1YA 2P2CA 2J32A 4TX1A 3TINA 5LQJA 4WXPA 2PL1A 3R5HA 1GYRA 1FJXA 3A6ZA 1XX6A 4MS3B 1EP9A 5D5QA 1UDXA 1YI0A 4L4ZA 1YOVA 4YRTA 2FDRA 3BMCA 5HA5A 3NTRA 1F1BA 3JSXA 3LH5A 4S0ZA 4JX8A 2OEPA 4CUJA 4B3RB 3TBHA 1UQTA 1R6XA 4GM1A 3CW8X 1RI3A 2EG9A 4RADA 4XW2A 5BYKA 4D9JA 3DO8A 4YO7A 1Q7RA 3CGGA 2NZXA 3EIOA 4L22A 4EY7A 1C0IA 3AGPA 5G41A 4CYMA 1AA9A 2BDTA 5FNZA 1OX5A 1WLSA 4PE5B 1W87A 2O50A 3A6JA 2HT1A 5H8WA 1Z2DA 5FBWB 3W34A 1J24A 1U4NA 3IIEA 5EVJA 1Y4SA 3GGJA 2AG0A 1BJTA 4HBZA 3TD9A 3P0JA 1JWAB 1OXXK 1KO8A 3AESA 4X3PA 3BN3A 4BNJA 4DAEA 1RM4A 3A2NA 4S1PA 2Q4TA 1GTG1 2QTVB 1UPXA 4DIOA 4TLMB 1A04A 5ALXA 5BMVF 2PUTA 1G3MA 4OD0A 1TMKA 4ZPXA 4LRWA 4URYR 5C1DA 4K9PA 1Q6YA 3ZE0B 1OI2A 4KXNA 5M34A 1L7NA 1P7CA 1CF2O 4FR5A 4KREA 3RVOA 5KSZA 1BHJA 3ETDA 4UULA 5HQ3B 4WI1A 2XDAA 2HF7A 2OFPA 2X5KO 4IDDA 1AKVA 1GZUA 2H7XA 4WN3A 3WNVA 4Y6RA 2W8ZA 2DSNA 5ALDA 3DT6A 1JLKA 5LYYA 5CX4A 4OLJA 4Q7JB 1K7XB 1RD4A 3ND9A 1DC3A 2PO7A 2RBKA 4HUTA 3UMYA 5EYPB 1C7ZA 2DMRA 4JC4A 1U2DA 4J0HA 1NY6A 4LXTA 2ZUFA 4KITB 1FLVA 1O8CA 3WADA 5DBHX 5IT9A 1P5FA 4N18A 4KAJA 2GCEA 1G8MA 1HRKA 1GVNB 2FRDA 3E05A 1N3YA 2VDMB 1FFGA 5J63A 4F5EA 4D9CA 2YYYA 1T8WA 1CUAA 2LDBA 4XJSA 2C7QA 4XEHA 2IELA 2MOKA 4CIBA 1FA9A 3MUNA 4J2OA 1KS9A 2EX4A 3H42B 4TLAA 4YIKA 3R7SA 4IF6A 1EVQA 1Z17A 4A2CA 1BSVA 3ZNQA 4Z3KA 1PP4A 3TI9A 2FUG6 4BLQA 3ZHRA 2OKGA 3E2PA 3HJCA 2JFYA 3LK6A 3WC4A 1A5TA 1O5TA 2WPDA 3IQDB 3KU1A 2ODTX 4W7IA 2OBFA 4B7CA 4IXNA 1HV8A 4KIUA 4XR9A 4V1CI 2O8DA 2BH9A 2YOHA 5IRCD 4RTOA 2ZJ8A 1ZK4A 1EZ4A 1X77A 4Q93A 2R47A 2NU9B 3IAEA 3ZJYA 4YRGA 8GPBA 2OPBA 3PF8A 5K6AA 1E6CA 4OKNA 1Y4ZA 1BDIA 3H0CA 4R9NA 1ZUNB 1E2JA 1CY1A 4HDSA 5C4GB 4FFBA 2FXIA 2IPNA 3HJUA 3RREA 1IXRC 4I19A 3B70A 4FI3C 1PJQA 4HDRB 2AOTA 4Z4IA 1ORWA 3PQ2A 3EODA 1NATA 3AYZB 2OM2A 3IR7A 4KEAA 2JHPA 2VJNA 3PWKA 3U7FB 2YNMC 2Q8PA 3VKGA 4RA6B 2QTHA 5BVGB 3N0RA 3FHTA 2XQIA 1XRJA 1D04A 1TW2A 3MWEB 4TMFA 3ESAA 2GESA 2Q4EA 3QSGA 4Q7EA 2CC2A 3DBVO 3H1TA 3M6FA 4UUAA 2AVDA 3X1YA 5LQMA 4TVBA 1HFEL 1PE0A 4Q66C 4EFMA 2Z6VA 2GOYA 2SCUB 4YXWD 4I8XA 3A26A 4S1WA 1RVDA 5I7FA 4JL8A 4F2WA 5K01A 3L8GA 1SCBA 1L5HA 1JZQA 2WQZA 3A6HA 3BEDA 4DUGD 1C9NA 1YZKA 5FUWA 1AQ6A 4OATA 5JD6A 1YNSA 1PYDA 3AR8A 1R0RE 2PD4A 1KXJA 3PXEA 4F6RB 5PGMA 3H9CA 3PR3A 2VZEA 4Z99A 1W4CA 2O2SA 4X94A 3DVAA 3PNLA 3THYB 1JX6A 1NVUQ 1WCWA 1XTPA 1KFEB 4J0EA 1W36D 1M83A 3H1AA 3E3LA 4BJ6A 3PQFA 2A5YB 4BTEA 5IJXA 2BMFA 3D8TA 3TI7A 1DBQA 2X77A 4V24A 2RHOA 2AK3A 1D2GA 1YL6A 3KKMA 3HNPA 3IHKA 1XRMA 1CY8A 2VHZA 1SUAA 3LC7O 1XCGB 3ABOB 4PSCA 2DWUA 3HGTA 1IWOA 2J0VA 1USIA 2C2BA 3OF2A 3R40A 5DWQA 2YJGA 2ZE7A 2WW8A 2SICE 3UUGA 1WXFA 2CNKA 1FUEA 1JPJA 3OKPA 4ND6A 3CKYA 3QV2A 1KI1A 3SFZA 1DUSA 1OOEA 4GXNA 4QXRA 1ZOPA 3HB0A 2XHEA 3MLEA 2P4EA 3UANA 4LXHA 2YQZA 4CM3A 1B2LA 2C2GA 2Z09A 3AHCA 3JPWA 1Y5MA 3JWHA 3WHLA 2QVLA 4G5HA 1OYYA 2ACKA 1Y9EA 5KVQA 4DHEA 4C6RA 1NP6A 1JR2A 3PUZA 1QONA 2OFXA 3TSOA 1ZS9A 1GL7A 1LLDA 2VF5X 2OXCA 3G6KA 3GGGA 4PYIA 4RMGA 4UU7A 3TLEA 2GF0A 2VYND 3LBAA 7GPBA 2UV8A 3L04A 2I4OA 1F2UB 1NBOA 2P68A 3FNFA 4L16A 5KHOC 4ZXPA 5T41A 3DAOA 4QYXA 2ZPUA 3H9UA 1OT3A 1SQ6A 1F8GA 1ZRSA 1T1SA 2V74B 3CRZA 5BT9A 1KYZA 5DYTA 1DO0A 5K0GA 2I66A 3KXIA 1QLWA 2YICA 1WTCA 5JYEA 4Q0MA 1D5CA 1JKIA 1HT3A 5IZ4A 5CR9A 1QG6A 3GT3A 4RTNA 3VNAA 2O1XA 4PNZA 1XI2A 4US1R 5L53A 2Q4BA 2XYGA 2F00A 1DC5A 2FJPA 2NXCA 3ZIDA 1NASA 3HI4A 1YRWA 3EGXA 4NOLA 4RD0A 5A3RA 3H16A 1JFRA 1JJFA 4OUDA 2HBRA 3U4HA 1EDDA 1C3OB 2BFDA 4WUTA 2ZJ2A 2P7HA 2X9QA 4K46A 2VWPA 1B26A 1PBTA 4RVNA 4H1HA 3VDMA 4HZUB 4W5QA 3E9RA 3G2IA 4I8IA 4C22A 3C1UA 3DKPA 3U7QA 5AXAA 3DBRA 1N3LA 1NPTO 3T1QA 3BJIC 3N3BC 4C0BA 4CI0B 4U6QA 1QZXA 5AVYA 5H59A 1KJWA 3RLIA 4OHKA 3L7LA 1C30A 2J08A 2G77B 4MX8A 3ZWNA 4DQXA 4NE9A 2P79A 2PUCA 2ODAA 1BXRB 3I9OA 1SCUB 2ZFUA 1J21A 1GPDG 3N7TA 5JS7A 3DMYA 1KRWA 2KBFA 2WYOA 5BRNA 1VB3A 3D8BA 3DDUA 4MB6A 2XSZA 5KINB 1EU1A 3WGNA 1KAQA 2QN9A 3KVVA 4GZ3A 3TM5A 4A0RA 5B4VA 1H6DA 4DRZA 2RHLA 2I6XA 1N32B 2X4IA 4EI7A 1XJWA 3ZBPA 3DJYA 1KU0A 3PNSA 4PFJA 5CLIA 3SSMA 4PV7A 3ZWVA 1FU4A 4ZV7A 4OGWA 2I3BA 4DLTA 1G8YA 3RAEC 3VHXB 3N2GB 1NJ6A 5C46F 4GG1A 4U3JB 1D5WA 1GQOA 3A2LA 4I66A 5HP4A 1SVWA 1FSGA 1MRNA 1D2RA 1E0AA 4GI1A 4WNYA 2Z8YA 4BQQA 1VMIA 3KXKA 3SLGA 1AQYA 3B9PA 4HWKA 4IDQA 4C3UA 2AFHB 4Z51A 5BSGA 5FLXA 3ZZNA 1WCXA 3T52A 1C2YA 2GO7A 2NO6A 1RI2A 3VZSA 4BNVA 1G66A 4DFDA 5DX0A 2HU7A 1LPMA 3QOFA 4UHCA 4CDNA 2YS7A 1CULC 2VJDA 4JB0A 1VPDA 1P3JA 1C7RA 4HS9A 4LC9A 4CTKA 5K9ZA 2Q0QA 2F1OA 2B99A 3D4OA 2B4KA 3KJNA 5IXSA 3K9CA 3MUOA 1AC5A 3FIUA 1P9LA 1TYBE 1V11A 1R2QA 3WGHA 1JE0A 2YFQA 3G8AA 4DLBA 4V0LA 4E1VA 3DMTC 2BFNA 2FFAA 1T9GS 2AUNA 4YRJA 3UOGA 5C8YF 1HDCA 2QPAA 3Q6IA 2FEMA 3ND8A 4OSPA 4U9HS 4WDQA 4HEHA 2WAOA 2CYBA 3OQVA 4HL6A 2REXB 4LISA 4PLCA 3LPAA 1P39A 1KARA 4RQUA 5F2KA 3UWSA 2F1IA 1QAMA 4FYIA 1EH5A 3TQRA 1QV6A 3ZOKA 2IVZA 2RGYA 1LSSA 1Z5VA 3L1IA 2EQBA 4KAFA 1XEWX 3OP1A 2W98A 4KVAA 4WBSA 821PA 3BWXA 4RHCA 1B0ZA 3GA7A 5EY5B 4IDEA 4H3HB 4B3BA 4X44A 1MNAA 4LYEA 3SS7X 1Z4JA 5JHGB 5FWXA 5CTAA 2MWMA 3THOA 2SECE 3UICA 1NG1A 1Q0ZA 2XH8A 4RCYA 4WLEA 3CUSA 1L5GB 2J45A 4ES6A 3KVNA 4HH4A 4DANA 3AVYA 4NS1A 4E5UA 5B1SA 4QXOA 3N70A 1LA2A 1XVTA 4IP0A 3GMDA 4XEUA 3AUUA 3Q9LA 1RBQA 2FWPA 2H1FA 3AR6A 1ECLA 4BY9E 3TD2A 2FSGA 4B45A 3AMVA 1EVYA 1ZCFA 1Q21A 1N25A 3U9TA 3AB3A 4ARUA 4FEGA 5T6MA 1LEHA 3OPYB 5DCLA 1U7XA 1JHYA 3LOQA 3FN4A 3F73A 1Y9JA 3B2EA 1Y4UA 4YRDA 5HDBB 1BOOA 2BDUA 3QVLA 1T2EA 1KJYA 4A5OA 1XU7A 3SEAA 2X8LA 4FWBA 1XMJA 1VLVA 3D6TB 3IQFA 3I01A 2II6A 5AH0A 3RVMA 3TBKA 2IU4A 3DPSA 2O2YA 3MMSA 5IJAA 5BOSA 1QO7A 4R5MA 4JGIA 4RQTA 2JANA 4FONA 1ZUNA 3RDPA 2DFVA 3PP8A 1CUVA 3LQKA 4II7A 4ESEA 4L5YA 3QSYA 4ZT7A 2C1XA 1R5NA 3SZRA 3IOEA 4QUEA 3QK7A 4IRUB 2NXJA 1T35A 1DC7A 3MFYA 4C88A 3A1DA 1ENOA 5F51A 3RVNA 1KEVA 4EUHA 5K8UA 1DO8A 2N3ZA 4JQSA 1RDFA 4G85A 3K70C 2HF8A 3PI7A 1XEWY 3CG4A 2NO0A 2LGJA 2XTJA 2O57A 3TTXA 4ECEA 3GCWA 1AKUA 1MG0A 4BE4A 1A82A 1LI7A 1QK3A 4KXLA 4WEOA 1TM4E 5K3DA 2PZLA 2AMJA 3TGPA 5ALYA 1OWLA 1AKRA 1W8IA 3A0UA 4H1WA 1KF0A 3QVGB 5EHGA 2C2KA 2IOYA 2WKPA 2WJVA 2ZRPA 5T3YA 1XMVA 1D2EA 3N0XA 3OIYA 3RYFB 1SZCA 3MTIA 4PWYA 3ZTWA 4F3TA 3CO0S 2BF4A 2QLFA 1QP4A 3LTNC 3AL3A 3DF7A 5AK4A 3H9JA 3JD0A 1FYXA 2WNSA 3LRPA 4YS6A 1NYQA 4F5ZA 4IXWA 4YV2A 4Z8YA 2XQFA 1URPA 2ZRIA 4QQRA 1TEVA 4DLVA 1XK6A 1WU7A 4X9XA 1FDTA 5CHYA 4Y7CA 3EN0A 3P94A 5AI6A 2VJOA 1G7CA 2R8RA 1HYBA 1PHPA 2WA1A 4TT8A 4CIAA 2HHJA 1MAHA 1PWXA 2F55A 4D82A 1HA3A 2EJVA 1RZUA 3OIFA 4MQ5A 3GWZA 1CRPA 3TLYA 4WA8A 1XPRA 5GOZA 3VSAA 3V1TC 2ZPAA 3NANA 2CBZA 4FMCF 4CUKA 2IOFK 4IG9A 1PJRA 4ENTA 3EW7A 5KX5B 1QF7A 3JR3A 1NXQA 1I6MA 3O8DA 1E2HA 3AF2A 5E7QA 3VOSA 3H17A 3CZCA 1WDMA 5HS4A 2O8EB 4N12A 4C7OA 3DE0X 4TQUS 4A2PA 2ZI5A 2VUIB 3A31A 1VYVA 1BC5A 4N8DA 5LYJA 4WKCA 2HA6A 2J5RA 4JBXA 4I55F 3H8SA 4PYLA 1S4MA 1N5IA 3PFHA 3DUFA 5IN4A 1IN1A 1YZVA 4INAA 1JQEA 5HWSA 2QTVA 3RC8A 3P9PA 1ULHA 5A5DA 2I62A 5F9HA 2P5TB 3B9QA 3DE5X 3TSYA 3VAZA 5BMVB 2CZCA 2I3GA 2P90A 2XOKD 4URVR 3ESBA 5JD4A 4H17A 1CSEE 2BSAA 2GVNA 4RM2A 4HVLA 1ZR2A 1L5HB 4UATA 1TIBA 1VZ3A 4K9DA 3ZHCA 3GLHB 4D96A 2D5BA 1AHHA 1BDHA 5IM4A 3MINB 4A03A 1MB2A 3ELBA 221PA 3ZUPA 1F6WA 3U16A 4NFHA 1J06A 4YRIA 3D6HA 3VPGA 3AEKB 5D00A 5TMBA 5CXQA 1TGYA 2Q41A 4N5DA 3R5KA 1JHUA 2NTVA 3AWIA 3IUNA 3LK7A 3FCXA 4WK0B 1W4AA 5DMHA 3W5UA 4O2AB 4CN9A 1G59A 3DTVA 5BSTA 1ZGGA 4R40A 5HQJA 3CRRA 4F4UA 1L4YA 2RONA 1SBHA 1F2TB 1C4XA 1UJ4A 1GRRA 4PPNA 2HB6A 5G0UA 4IPTA 5CUQA 5KHAA 3FROA 1F9EA 1VL1A 2WVJA 3MCZA 2IODA 4JLPA 1EVLA 1SVOA 3N0TA 4L2IB 4B81A 1M2VB 1Y34E 4B7UA 1HZZA 1VB5A 3DBRB 4MGYR 3WIVA 1CR0A 1ZRMA 2YL2A 5DN6D 1JEYA 1BS2A 5C31A 3U19A 2I1VB 1SO8A 1P4JA 1CEYA 2O2CA 4H7PA 1FP6A 2O2GA 3WFZA 4E5YA 1RYNA 2JIZD 3O9MA 3PFIA 1Y7IA 1Q6ZA 3DHEA 4P81A 2YW9A 2WWHA 4RFSA 1COWD 1ZW1A 2ODNA 3L0CA 1SM4A 4RA9B 4MINA 4UXHA 5T8KC 3O8LA 2ZB2A 3DFKA 3OCVA 2B0CA 2NZVG 1C8LA 4MDYA 4EYEA 1RYFA 4OQPA 1JTFA 5K8LA 3C7CB 3QXHA 1ZWLA 4F9FA 3F3YA 3ONWA 4NOMA 1JZSA 1XZ8A 2OXIA 1P1BA 1ZG3A 2Y9PB 3O94A 3PXXA 5AJUA 1P7ZA 4NBUA 5H16A 3IVMA 3ROXA 3LRXA 1ID1A 1Q0RA 2FPKA 4Y8VA 1BQ3A 1EXNA 3EC2A 4LHXA 3ZZTA 3GLIE 3ZI4A 4AX4A 5LBIA 1DJQA 3MJEA 3ORSA 4RMIA 1VJTA 4ESHA 4AP6A 3HB7A 4ZOLA 1NF8A 4MDEA 1VJGA 4FDAA 4X64B 4D4JA 2O8CA 4AJ4A 2QUHA 1UWVA 5DBIA 5FORA 2FKAA 3PYXA 5JOQA 4Q1FA 4EHIA 2GN6A 3EUWA 2FSFA 4HYQA 1JSRA 3QWFA 3U9SA 4A91A 3DULA 2QLNA 5DGXA 1TJYA 3JWGA 2HRRA 2DWOA 2J48A 4K3UA 4JI8B 1XZIA 1PKEA 4BLOA 4C4OA 5KQLA 3RC9A 4IQ4A 1PJCA 2EP5A 3EG9A 5K4AA 1ECFA 3EZ9A 4CQMD 3UAZA 1C1XB 3HYLA 4U6SA 2F4VB 3AOEC 4JK3A 2ZP1A 3LUFA 3E22B 3OLXA 1WZIA 3BF8A 3ENKA 1EQ2A 4MRNA 4CI9A 1RNLA 5IJ9A 3HUEA 4D3XA 1M8FA 1UMDA 5FUXA 3TL3A 4RWEA 1SNYA 2YDYA 3L84A 4JOBA 1LD3A 3G5LA 2W2MA 2X9NA 4IIJB 4Q9NA 3UJ6A 2PZAA 3K05A 5KNDH 2E4VA 1GPBA 4BQRA 1RZ3A 3GIWA 3AKDA 4J6EA 2FW0A 3M4YA 1P77A 1G98A 1QIEA 2HCJB 2IQIA 4RV9A 5BOVA 2AX3A 3BC1A 3RVPA 4S0XA 3NWEA 2P2DA 4Q37A 2CHFA 1Z8NA 5EAIA 1SVMA 3AHHA 4MLPA 3BJMA 1U80A 1ZVKA 4YI3A 3Q3IA 5I9BA 1I3NA 3UHPA 3UH0A 4U9UA 5FR1A 5DOZA 1PJAA 2BFEB 4TL7A 4LRSB 5AXDA 5U4QA 1AHPA 4ZFNA 1DX6A 5IHXA 1GGEA 1G2IA 5ADHA 3CNQS 4NXMB 4MCHA 1FYVA 1V9SA 1II8B 3K0BA 5K3BA 3ZXSA 4DV2B 2Q1WA 2RHJA 1TLLA 1KORA 2CFRA 3PV0A 3KQSA 2R6AA 2XCSB 3H0KA 1ZUIA 4MW6A 4UBKA 3RJZA 1H6AA 1YFLA 4KU4A 4LOIA 1SIBE 1MO6A 5DEOA 4AS3A 3QY0A 1HDIA 3DGEC 3LLVA 3O90A 3VV3A 3W3AD 4D7AA 1C50A 2C7OA 3T9BA 3IMGA 4UE2A 1KK3A 1BS1A 3BL5A 3R0JA 2X1VA 3EOBI 5CITA 2CJPA 4F9GA 4L72A 2FSPA 3WSTA 3AIOA 4YGXB 1YFJA 3L0IB 3RVRA 5GONB 5EA2A 4NZMA 4ZYTA 1E9CA 5LIRA 1T91A 4UZEA 5IWAB 1DAMA 5HZGA 2ZB8A 2QHXA 5KYWA 2BJWA 2WSBA 1ZN8A 1ESCA 1T5BA 3ITEA 3LP8A 4RPIA 5ICFA 4YCCA 3ZE2B 1QRUA 1AGNA 2QX9A 2IY8A 1A88A 4IEEA 3S4YA 1ZR4A 1EXDA 1WMFA 2R25B 3ODGA 2KW5A 1NR5A 5EQTA 1TB4A 3QKTA 1NP3A 3S28A 2AR9A 2ETVA 4YCSA 2I2CA 2AEFA 4JHLA 4P9NA 3AJ9A 2YBDA 3EGCA 2WPNA 2DUNA 2HH9A 2QXYA 1JJVA 3DR3A 4M22A 4L5IA 3BJEA 2GK6A 5A1TA 4BMSA 4M6WA 2YHBA 5JI3E 1JL3A 3QEAZ 4RXTA 4MLCA 4FILA 4D3SA 1PJSA 5F7OA 4MVJH 3DLAA 3QF4A 4ZC8A 1BXKA 1ZVQA 2AFIA 1JKFA 3UH1A 5IULC 1P2TA 5EIWA 4NQZA 2BIFA 5GY7A 3VR1A 2O2DA 1C81A 2JDID 4PQYA 3UV6A 1U3GA 3QVGA 3NU1A 1W0CA 4X8HA 4ZMBA 3K1JA 3UB4A 4ZREA 4RSMA 1MO5A 1D1PA 1BW9B 3T5CA 5DW3A 5GV7A 2C03A 1RXIA 1RBMA 2QLBA 1NURA 3BL6A 3AR5A 2NTEA 3INNA 4JUAA 3ZVKA 3RYHB 2EJBA 2WAXA 4WNCA 3QENA 4A36A 3MMPA 2X8AA 1QQ6A 3DMTA 4NNPA 1ICEA 4WUVA 4C7KA 1GM5A 2A0FA 4AKGA 1N6RA 1U2GC 4WL0A 3VVLA 1FFSA 4A6EA 4BNLA 4W5WA 2IXBA 2X15A 2ECPA 4FE4A 2BFFA 1GCUA 2QNBA 2WP8J 4IEIA 4M4SA 4A1FA 2ZETA 3I2IA 4J16C 4WBNF 4Y0NA 1KI8A 5HZMA 1RLMA 4Q05A 1BA3A 1NDHA 1UADA 2EZ4A 4I55B 5HCIA 3JYOA 1NGSA 5CLQA 2V5VA 1G1MA 4KNYA 4IF4A 3N8IA 2KLBA 2E4UA 4RDIA 1IZ9A 4MSUA 4WGFA 1O5OA 5ELLA 4MGZR 4LQ4A 4W1QA 3OCJA 5EINA 1SN7A 2PUJA 4QRIA 4V1CA 1QIGA 1UXIA 3E0QA 3MGAA 1O0BA 4MPJA 2I9KA 1DJMA 4JEUA 2CKDA 3CLRC 1HE3A 2XIJA 3KOYA 3LPDA 3NAZA 4FE7A 4N4AA 3H1PA 3O7WA 4QDXA 2JJ2A 1IG0A 1DWOA 1LPAB 2BWJA 2QAGB 3SC3A 6GPBA 4AZSA 5GP1A 3DEFA 3FVRA 2ISSD 1JIIA 4FBMA 3C5WP 4X3OA 4ZVTA 5TX7A 2B94A 5AVXA 1VP3A 1G8GA 4BMNA 4J1NA 4GX5A 1LBTA 1P45A 5DBFA 4BFXA 5JAIA 2OY0A 2VBFA 4U4AA 3OIVA 1XDGA 7MDHA 2HRQA 2R96A 4DCTA 4FEYA 2QLMA 2GUGA 2H0AA 2BUCA 3MGCA 1BKSB 3K0CC 2R6HA 1MT0A 1OUMA 5CLLA 4L4YA 3CUEF 5LLDA 3GPLA 1V71A 2FPGA 1IUPA 3I52A 4HAUA 3ZTTA 3V00A 4TS3A 1U0NA 3C70A 4MJ7A 4ZOCA 1JJAA 4CMIA 1UFOA 1W85A 3QY9A 2F90A 1UXJA 5HG0A 2V7TA 3J7TA 5K2OA 1FF9A 2CXRA 3PTZA 2OPHA 3TRFA 1PU2A 2CLMB 2I78A 2OXRA 4KOEC 3RM3A 4M8LA 3BDVA 1CZNA 1FSSA 1KHHA 1VXRA 5AT1A 2EW1A 1PFGA 4E7OA 1QZ3A 2HEGA 4N65A 3TTSA 1VI2A 2Z2KA 1TOAA 2QYTA 1LVHA 3ICEA 3IJRA 1JHAA 4U7JA 1EFHA 3KHTA 3AVQA 3Q9SA 4NFLA 5DTRA 2HPVA 1ISSA 1ILWA 3T12A 3DDHA 4F8JA 1COWA 4KQJA 1UDCA 2BR5A 1NYLA 1WDLA 3Q98A 4PTLA 1TK3A 5BRJA 5KQMA 3O4GA 3DT8A 4PNEA 1M3SA 4IZOA 1NE2A 1K8XB 2WU4A 3EXFB 3JYNA 4NK5A 4PQGA 4R1QA 3PHHA 3A1NA 2OCKA 5SYAA 3WWCA 3DL7A 1HZJA 4PQEA 4Z2YA 5JCZA 1DDIA 1HDXA 4G0XA 1KEWA 3OZIA 1T9ZA 4LVUA 5IK2A 4QOFA 1VYTA 3QU9A 4X60A 1EFKA 3OY2A 1Z9BA 5AQEA 1S2LA 5GM1A 5T4EA 3ST7A 3FTEA 2OLEA 5FV4A 3HXTA 4L75A 2VQFB 2R9VA 4L57A 5EQDA 5E6UA 3UHOA 2YIJA 3JQBC 4FLFA 3F6SA 1PYOA 1L5VA 2LKDA 3HGMA 3JRXA 3K94A 3PYLA 3ILYA 1Y6ZA 2Q3FA 4WJZA 3SBEA 4YUAA 4F3NA 4RY9A 3GJSA 4NJMB 2GM9A 2ZRFA 1TXGA 3AFIA 1SQFA 3H6KA 1Z4PX 4MV1A 3VOBA 4EA9A 3PUHA 3GGSA 4YLYA 1OFVA 2EKBA 3T5GA 3DD1A 4N6NA 3JU3A 1I7LA 1Z0SA 1YR9A 4JVOA 3STUA 3ZU2A 5B12A 1TM7E 5JDCC 2IIPA 5ICEA 3O75A 3GGCA 4WWHA 1JHDA 3KRTA 1N0IA 3ITNA 4XX1A 3KSMA 1HMYA 1FFXA 2H92A 3BQNB 4FDLA 5JCJD 4BP1A 2WY2D 4E32A 3BSYA 3ZWOA 1WPRA 4L8YA 1U81A 2WTNA 4PO1A 1AKEA 1N5RA 1SXHA 1LQTA 1T9CA 4MMXB 5TQ0B 1ZONA 1B16A 4CLXA 5IAAA 4AT1A 1BDJA 2Z3VA 4KLNA 5F5NA 2O3RA 1L6IA 2OHXA 4DMLA 4J4BA 1TLTA 2PRKA 4WH0A 3ZX4A 5CVJA 2JAXA 4K9SA 3RJTA 5KNLA 4DM4A 1U0RA 3GAMA 5A4IS 1CHNA 2CLCX 1MD9A 2BI4A 3S27A 1JDTA 5JATA 4D8WA 1WHSB 1K3UB 3NVMB 1H2AS 1R6AA 2O5EA 1UP7A 2FE1A 5KNDD 3BIFA 4J1TA 2YFYA 4KKXB 3ZCRA 2BH2A 1KQ3A 3NHSA 3PFWO 2AUTA 5CM9C 2RGRA 3A2KA 4XTRA 3GH3A 3QUCA 1PZEA 5HE8A 1YJCA 3A14A 3KM0A 3WK8A 5BN3A 4U2CA 1N2OA 4M0FA 3Q8MA 1CVIA 2IHZA 3OQIB 4DC0A 5BORA 2CL0X 3REQB 2RGDA 1MAVA 1V6AA 4QUHA 5TEWA 4B6OA 2VZLA 4BQNA 1PAUA 1SRRA 4TMWA 4HX2A 3JQAD 5EWLB 4XYMA 1V5GA 1GSHA 3UFBA 2J4DA 4IW3B 5FI5A 4JV5B 3V48A 2BM0A 4YMTA 3KPJA 3STHA 4BMCA 1VGVA 1G1AA 4S24A 1EM8B 2AFHE 4OU5A 3WLKX 1G20A 2OLKA 1NXTA 1UPUA 4JMLA 5ALSA 4QVIA 1RXSA 2R2GA 2JAQA 3LLMA 2G0AA 5P8WA 1GADO 1GKIA 2ONZA 3GEIA 4NR0A 2ZUVA 3BD6A 2FMIA 2P8SA 1WG8A 2IXAA 4P4TA 4B8ZA 4AJ2A 3G3EA 5JMTA 2PNFA 3FOEC 1YR6A 4QXMA 1T4GA 3T99A 3U62A 1TA9A 1W46A 2IDJA 5TGTA 5KYUB 3EY4A 1XNJA 5A62A 3ONDA 2ZUCA 2BTEA 1ZKMA 2BUBA 3GEMA 4Y6LA 2RK3A 2OCPA 5KCMA 4A82A 3ESCA 1MQ8B 4BUJA 4CV0A 1RYYA 2P9EA 4GSKA 1JHZA 1MMFB 4LCJA 2Y1CA 3D2BA 5HJ7A 3X2EA 1YZQA 1IXKA 4BUCA 4FN5A 1T5IA 2HRCA 1BH6A 3EVEA 3ZOZA 5CA0A 3PYMA 1WIWA 3ZK8A 1XRNA 2ZLBA 3K9LA 3PVCA 2UZ1A 4NSNA 5FBQB 1E1RA 1KDRA 2G17A 3JY6A 4J43A 1YOBA 1XVVA 4RH3A 4B4OA 4BB9A 2PRZA 1HK7A 4MW0A 2XECA 4TSKA 4UNIA 4C21A 1KFCB 4OP3A 5ENDA 1P9OA 4E7PA 1MZVA 2I6QA 3HDTA 4TZ0A 4XWAA 2NZJA 2VPIA 2FEAA 3A7EA 5JD3A 3EPPA 5HRAA 4WXYB 3IP1A 4WZBB 1EJ0A 4JI6B 4ALKA 9LDTA 2XUDA 4AL4A 2GHQA 2WM2A 1PL7A 3NCTA 3E84A 4Z7OB 2AEEA 2BMVA 1EAYA 4HPWA 3V3KA 4GMGA 3DP7A 2R7AA 3TX2A 4DE5A 1EK5A 1NT4A 3LXXA 1EGQA 3WY9A 1TO6A 3UW1A 5L3RA 1A77A 1Y7PA 1OI7A 3A9UA 3OFNA 5ALGA 4D0RA 3IUSA 5CFQA 4FM9A 2ZJYA 1YFZA 1UT5A 4PBSA 3KV1A 2AB0A 1HSZA 3AUXA 2HJVA 2D7DA 4YRZA 4AM8A 2WSYB 3U4AA 2CEKA 3I45A 4AJNA 1WA5A 3IUJA 3WL5A 1X80B 1Z37A 3KJHA 4ZHQA 4J03A 4JZKA 3D1LA 1T26A 1Z47A 5CK4A 4C5CA 2FFQA 4EARA 4D9GA 1DTWB 1XKLA 2BJVA 2VUSA 1U31A 3D3JA 3PNOA 4M60A 4OVKA 5CNIA 3JQ8B 1W44A 2VBGA 2QB5A 4EGSA 1SK9A 1YASA 2VR1A 4DABA 1VKJA 5LP1A 1U3VA 2PMDA 2VDNB 2A5FA 2W2PA 4KQGA 2EERA 5AXBA 3UCXA 3UWMA 4ESOA 1IONA 5FTKA 1KH1A 1PR0A 2BVNA 4TZ6A 1PDWA 4DM7A 2AWNA 1N36B 4XAQA 3I2GA 2XUOA 2EZ9A 2P2LA 2O6LA 2VSFA 4LHWA 1NHWA 1XWWA 1X7HA 4BNYA 3T4EA 3RFTA 1H8EA 4OGFA 3L0PA 1M1YB 4QO8A 3KQUA 1OZFA 2GHRA 2EFGA 4KDEA 2BSQA 2GEJA 1EBFA 3CLSD 1Y6GA 3L4BA 3FFTA 4NFSA 1NV9A 2R11A 1UK8A 1CZRA 1TM3E 1W30A 2HGZA 2GZ3A 2C29D 3A3NA 5ALVA 5CB4F 1NXWA 2QUJA 4M83A 3LSYA 1W96A 1DINA 4HAIA 5A5FA 3KQKA 3T3EA 5HUJA 1XG5A 4P0QB 2X23A 2VSQA 2Y1OA 1WHTB 3I8SA 4HNSA 3TOSA 2AFHA 2I29A 1J8MF 4KDRA 4RVDA 5SV2A 3CM0A 1JXAA 2FN4A 1KJ9A 2D5AA 3DBLA 2DY0A 3GUUA 3LTEA 1FFYA 4QUBA 2ZJ7A 1HNNA 2EFYA 3CSDA 1K2WA 3IPAA 4MI6A 1HDZA 1RM3A 1Z5NA 4MKRA 5FOTA 4BFLA 5JSKA 5KYTA 3JWEA 5AW1A 2B98A 4PPYA 3OQJA 1CUWA 2EOAA 2PSSA 4X6UA 1GCAA 3L7YA 4QGSA 1QIFA 3O4IA 3WBBA 2YZGA 4KR3A 1I6KA 1T4BA 2MYUA 1NMSA 5DIFA 1RQ7A 2FFRA 4X20B 3Q10A 5A04A 5IVHA 2B3DA 2WVAA 2O4CA 3GYGA 3D59A 1KWGA 1GAWA 1BVRA 3I5MA 4F84A 1RQRA 5KTSA 1KO7A 2CLEB 3P2JA 3OBBA 4GO1A 4M0DA 4IOKA 4NENA 5D3MA 3KPWA 1YQGA 3B1VA 1IY0A 4RXMA 5EZSA 5BR4A 5KKCA 1SUEA 1RWQA 4X92A 4Q5IA 2CV1A 3PEUA 1PR1A 1E1DA 3QUBA 3GJRA 4K88A 3WA7A 1TJ3A 1UBRS 4F04A 5BVHB 3U1VA 1WAMA 1B7GO 1Q50A 2ZRHA 3COSA 4G86A 1SCUA 5H68A 2XCLA 4W9NC 3WI7A 2ZIFA 2F3QA 3DLTA 2ZTVA 2ZR0A 4BQFA 3FHOA 4YR9A 5D86A 2FQ1A 1R9JA 2RHHA 5CX1A 1IN7A 3B2QA 3WRYC 2RB4A 1UP6A 2ZJ3A 3W6PA 1XWFA 2OCGA 2ZS7A 3MBOA 4B8YA 1GU0A