2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxylesterase
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
2XUIA 1GQRA 3ZPXA 2XMBA 2VSQA 3P2MA 5AK4A 3STVA 5LP1A 1QIFA 1MNAA 1Q0RA 3FSGD 4AO7A 1SFRA 4OB7A 4XX1A 4JEIA 1BS9A 1QIMA 3VISA 3WWEA 1JMKC 5ALYA 1ODCA 3I2IA 2OCKA 3AJAA 3C6XA 1AX9A 5AM2A 1UWCA 3IUQA 1HQDA 4ROTA 4B83A 4PV7A 3G0BA 3VVLA 1UZAA 1R50A 5SYNA 1FFBA 4D9JA 2WIFA 2BFNA 2OAGA 1YSCA 4YPVA 1XZJA 1XZEA 4JNCA 1UT6A 4KE8A 4BP9A 2YXPX 2YYSA 3PF8A 5EIHA 1XKTA 3W9UA 5CXXA 1GKKA 1GZ7A 2WIJA 4H0CA 2GZRA 1WCYA 4B82A 4CI9A 2DHCA 2G63A 2CMFA 3F98A 3HYSA 1K4YA 5FRDA 4UFPA 3FOBA 4FTWA 2H9YA 5ALVA 2VAXA 3STTA 2J4FA 5K3AA 3C43A 3KDAA 4RPCA 4BTVA 1MAAA 2WILA 5A6VA 1M33A 2WU3A 5ALLA 5AI8A 4G4IA 3OPMA 2WIKA 3I6ZA 5ALTA 2XQFA 2XUGA 4EUSA 5KWIA 3STYA 4KAAA 2XLBA 3D5EA 2CB9A 1QE3A 2EDAA 7YASA 1FJ2A 1VKHA 4AO8A 4Q34A 5ALPA 2ZSIA 4WFJA 4A23A 2Y2VA 1ODSA 2XUJA 4DNOA 3H2JA 4GECA 3MUOA 5AKEA 2WFMA 2AXEA 5AM5A 1XZIA 4X00A 5AKKA 1AQLA 4M0MA 5AI9A 3PFCA 5AK5A 1NX9A 2I3DA 4FLEA 1Y37A 1Q84A 4G1FA 2Y6VA 2WG0A 4IH1A 4J0CA 4RGYA 2HU8A 4UHDA 4K6HA 1E66A 2XMZA 4BVJA 2DQYA 1XZDA 5HQ3B 1CUGA 5LKRA 1LPBB 1AKNA 1U8EA 4ARAA 2D0DA 4GW3A 5K3BA 1YS2X 5CRIA 3C5WP 1QLWA 5CT5A 4XVCA 3O95A 2O2IA 3FYUA 3D59A 1CUBA 5EHNA 1YA4A 4OPMA 1BCRA 1EDDA 1CUAA 3G8YA 2YASA 3DJYA 2BUCA 5ALKA 1SC9A 3PF9A 4FMPA 2K2QB 4Y2VA 3B12A 3DOHA 1JMYA 2QUBA 3F9CA 4HZGA 1K8QA 4BZWA 5DNVA 3QMVA 3ESBA 1Z68A 1WOMA 5DNUA 1P0PA 1ZI8A 5IVHA 1XRNA 3R3UA 1HKHA 5D3KA 1H2WA 1HL7A 4QDUA 4PSUA 3O4HA 3D7RA 3VXKA 1TCBA 5JAHA 4X93A 3WK4A 3DS8A 3FLBA 3T52A 1UOQA 4X85A 5ALJA 1L7RA 4CCYA 1H22A 5ALEA 5A2GA 2JGFA 3G9TA 3SX4A 1N5MA 4QDTA 5AK6A 4EB0A 1XRPA 2HADA 3ESDA 1CUVA 3AINA 3C8DA 3I2HA 5SYMA 1VA5A 1J1IA 2PL5A 4C4YA 3H2HA 1SCQA 1VZ3A 1VE7A 1LPPA 3TRDA 2X76A 4WDRA 2B20A 1VZ2A 5A62A 5CT9A 4B85A 1ZD5A 1N8SA 4HRXA 4FFVA 4FLMA 4F60A 4H7HA 5C8VA 2OG1A 4B9EA 2EDCA 2VEOA 5CMLA 3O9MA 2C5FA 2ZSHA 4ZREA 5EFZA 5IVDA 1UOPA 1R1DA 4BVLA 2Z3ZA 3CN9A 5FKJA 3G0DA 3QPCA 5ALIA 2HA5A 1CLEA 3BDIA 5D7BA 4BDTA 3PUIA 2FJPA 5JATA 3WKDA 3HACA 1E8MA 4UHCA 1X2EA 1XZCA 5HK9A 2PX6A 1AURA 3FWHA 5JZ9A 2I03A 3DL7A 1DX6A 2QXTA 3H2IA 4BZZA 3CXUA 1DWPA 2XLCA 1LPAB 3HLKA 4OSEA 1E3QA 3PDCA 4IH4A 2WG2A 5DLPA 1IZ8A 4C01A 1HPLA 3C6YA 3WKBA 3JWEA 1JU3A 2QKYA 3H1BA 2B4KA 4G9GA 2RIPA 4PF1A 3FAKA 2HA2A 3GFFA 1E8NA 4KRXA 2GBIA 5EHXA 4MYSA 2G4LA 2HDWA 5E2IA 3ZWQA 4ZGBA 4M0EA 1JFRA 4B0PA 1A8UA 3R3ZA 2JGIA 3G0IA 4DMKA 4QE3A 2WUDA 4I19A 1VLQA 4GDMA 2XUQA 4PW0A 4X97A 3C8HA 4BRZA 3IB3A 4KE9A 1CEXA 5JZSA 2JF0A 5DYYA 4FHZA 4EZIA 4HXFB 4GXNA 5HQ3A 4AN0A 3ZI7A 4QLAA 1CUDA 2DFPA 2VAVA 2WFZA 2C4HA 5CH8A 3NUZA 4B84A 3IA2A 2Q0XA 5EI5A 3QH4A 4BCDA 3TGLA 2VQ6A 1R9MA 2WIGA 2H1IA 2XUPA 3DOIA 4EY4A 4J0KA 2JGEA 1MX1A 1G5FA 2XQGA 3BF8A 3D4LA 4Q3LA 3WK5A 5FLKA 5A7GA 1DWQA 4PSDA 5AK3A 1GKLA 1QTIA 3OG9A 5JALA 4GWLA 1Y7HA 3DLTA 1CV2A 1W75A 1LBSA 3DKKA 1JU4A 1A8SA 3WWPA 3HI4A 5BWCA 2G5PA 1DQYA 4GEGA 4IQ4A 3W9BA 3D2AA 4AO6A 4DSZA 5T4BA 1F8UA 5AOCA 1GT6A 5ALNA 1BN6A 4KR0A 4JYMA 2HU7A 4L9AA 3K2IA 4NS4A 1A7UA 4QLOA 4QWMA 5FPQA 1EH5A 1ACLA 3V1NA 4CG2A 2IIVA 1EDEA 4Y2PA 5FXMA 1MX9A 3WA6A 5CT8A 4LXIA 2VT6A 4FOLA 5LZ8A 1CUXA 3EQ7A 4FBLA 3LCRA 3S2ZA 3HJUA 1EVQA 1RP1A 2GYVA 2WJ3A 1MTZA 4AMYA 4J7AA 3ZLVA 1OILA 3W05A 1GPLA 1TAHA 1UK6A 4J0GA 5ALDA 1JJIA 2GYWA 2QXUA 4BTLA 1JT2A 1W6RA 5AM1A 2IITA 3BIXA 3NGMA 1DU4A 1R88A 4G8DA 1F0NA 3L1IA 3V48A 1ZJ5A 3WZMA 3AUKA 3F8SA 4IHAA 2C7BA 4QDXA 1XRMA 3OTQA 3WKEA 1QGED 2OQIA 4DYHA 2BUBA 1U2EA 2JGJA 4DGQA 2J3DA 1N5RA 3HRHA 5JAOA 1R9NA 1KU6A 3A6ZA 3FCYA 4H7DA 1XQXA 3O4JA 2PBLA 1UKCA 1Q0ZA 4GI1A 4I4CA 2PU7A 4HXGA 1BE0A 1WB6A 1HLGA 5AKYA 3M81A 3NWOA 1LPMA 5JANA 3WLAA 4EHBA 4EY7A 1CUUA 5JD5A 1UK9A 4Y9SA 1C7JA 2V98A 4MYDA 5DNWA 4IH9A 5AOAA 1LZKA 1XKLA 4C4ZA 3G7NA 2C5GA 3AFIA 4B7ZA 1EHYA 5JAUA 4MWTA 2DR0A 4QDZA 1QOZA 2HA4A 3EBLA 1B6GA 1YS1X 4F5ZA 4H7IA 3B3QA 4G8CA 3ESCA 2XT0A 2PPLA 1N1MA 5LZ2A 1QO9A 5HF9A 2RHWA 2Y6UA 4LIPD 5C81A 1UK7A 3VKFA 4QDOA 2CJPA 2QMQA 3RK4A 2PSFA 1AMNA 3AIKA 1G42A 1ZJ4A 4K6GA 3T4UA 1J06A 2X8BA 2J3QA 4I3FA 1Y7IA 2ZJ6A 5IKXA 4L0CA 3QVMA 1QJ4A 3SK0A 4J03A 4OCZA 1CFJA 3UMJA 1G4HA 1DINA 3HXKA 5ESRA 4QWWA 5JZBA 2GYUA 2VT7A 3C5VA 4P9NA 3C6BA 1LPOA 3MGAA 1FFAA 2DCMA 1VE6A 3GBSA 2D5LA 4BE4A 2VJAA 1XZMA 2XMSA 2OLEA 3DKRA 4GHWA 4FLFA 2JGLA 1QIJA 1ZGCA 1OCEA 1WB4A 3E4DA 5AI6A 3R40A 3V1MA 3GUUA 1BCSA 3WL7A 1ZD3A 3BJMA 1J2EA 3K6KA 2Z5GA 3VJKA 4X71A 4WFIA 5AOBA 5ALQA 5HFNA 5I8PA 1K5PA 5EIAA 4MEAA 1XZKA 2OQVA 3I6MA 4P92A 3STUA 2QJWA 4DMHA 3QZUA 1XRQA 4WFKA 1CUIA 2V96A 4K2AA 2ACKA 3BE8A 4Q1VA 2WHPB 4U2CA 1ORWA 1TIBA 2E3JA 3WIBA 4DNFA 2PSEA 4F0JA 2I3ZA 3H2KA 1R3DA 3DEAA 1WHTA 4BATA 3NOXA 2XB6A 3OOSA 5KREA 5HF6A 3SWWA 4G4JA 5FOQA 1CRLA 1ORVA 3DYIA 4N5IX 1MO2A 4UHBA 2DSNA 3PUHA 3FNBA 2QVBA 2WG1A 4Y2UA 1O6FA 2GBGA 5LZ9A 3U0VA 4KACA 4C89A 5CW2A 3BWXA 1CUEA 1W1IA 4J3JA 2RONA 2OGSA 4X92A 4QA9A 3F96A 1IUNA 2ZYRA 5IVIA 1C4XA 4BVKA 4HXEB 4Y2SA 3Q8WA 2CEKA 3GA7A 4Y2JA 3W04A 2O2HA 4BE9A 3BL8A 3WL8A 2AJLI 2FUKA 3VJLA 4E14A 3M3DA 4H7FA 3IDAA 3BDVA 3R3VA 4CIAA 1JKMA 4INZA 3WWCA 1QIHA 1FFDA 1YA8A 2PUJA 2C0QA 5T4FA 5ALZA 5I7UA 3ZLUA 1L7AA 1GQSA 5FP0A 3X3HA 4AZ3A 3STWA 2BUAA 2CZQA 3CCCA 2VATA 4X3CA 1MAHA 1VXOA 2BJHA 1CUYA 1TRHA 4HAIA 4O08A 2WFLB 3VVMA 2JBWA 5LKAA 3QMWA 2XUFA 2R11A 2VJCA 2QOEA 2W22A 1YB7A 3SC2A 4ETWA 3GELA 2WIDA 2XQJA 4QEKA 4HS9A 1FFEA 5HKAA 5FV4A 4J0IA 3HC7A 2YH2A 2C58A 2LIPA 4XWGA 3E0XA 2WU4A 1ZICA 2XMDA 4AB1A 3WK6A 3L1JA 4X6UA 1WM1A 1XQVA 4W1SA 5CH3A 1XZHA 5T4HA 4BB0A 2HA3A 3KOOA 1AC5A 1XROA 3DNMA 2X5XA 3IUNA 1P0IA 2HM7A 1QIIA 3OC0A 3LIPA 4HRYA 4TGLA 3ESAA 3ANSA 4CG3A 2EEPA 1QFSA 2OCIA 1QIDA 4WJLA 4EY8A 2O7RA 4MWSA 3WQHA 4QNNA 4EY5A 4DLNA 3G02A 4OU5A 1VJ5A 1VXRA 1TKRA 1CVLA 3H2GA 4Y2TA 4NMWA 4AN1A 3AZQA 2Z8XA 5AJHA 3UUEA 2CBGA 3C6ZA 5ISMA 3R3WA 5CTAA 3AZOA 3WK7A 4ZWNA 3ILSA 3IUJA 5BV7A 1MPXA 5AH0A 4DMCA 3QPDA 1JJBA 5EIEA 2AJ8A 5FUMA 3N2ZB 3WWOA 4S0XA 2BCEA 1WPXA 4U2BA 3IUMA 3WYNA 2GZSA 3HZOA 3M83A 1XLWA 2OPHA 1UKAA 2H7XA 1U65A 4EBBA 1XQWA 3WK8A 2AJCA 1QZ3A 1CUCA 1IUOA 3IBTA 4GBGA 1QFMA 5E4YA 3O4GA 5ALFA 2QZPA 3WIOA 4UBOA 3H18A 4LXHA 2WHPA 1MN6A 4X94A 5IVKA 1BEEA 3QBJA 2QTBA 1LGYA 1I6WA 1LPSA 1EINA 5ALMA 3EQ8A 4E15A 4XJVA 4CG1A 5ALXA 3WKCA 3A2LA 1WPRA 5EHQA 3AILA 3ANTA 4U2GA 2CKMA 4WCVA 2HRQA 3I2FA 1ISPA 1ZD2P 1TQHA 2WSLA 1ODTC 1XFDA 4Q82A 5HCUA 2WHQA 2ACEA 2GBFA 2ZYSA 2OAEA 2JIDA 1DX4A 1QONA 2HA0A 5LZ4A 4NVRA 4MQLA 1EA5A 3KWFA 1YCDA 1YR2A 5LLSA 5JADA 5JIBA 4B9AA 4GLBA 2XUAA 1TCAA 4KJXA 3FVRA 4OD0A 4H7KA 5ALOA 3B5EA 2ECFA 1DWOA 4OYLA 5K3FB 4DMFA 5AKZA 3I1YA 2QRUA 3WJ2A 5CBKA 5FDFA 3AIMA 3FVTA 4FNMA 3UUFA 4L72A 5HZGA 2ZVDA 3C87A 4BYMA 2WM2A 1AUOA 3Q0TA 4AMZA 5JYCA 4TVKA 4EY6A 5KWJA 1BROA 5DTIA 3R0VA 5AHXA 3FLAA 4ZV9A 5JD6A 5T4EA 2ROQA 2RGUA 1H2YA 2VF2A 3WI7A 2VA9A 1XZBA 3F67A 4H7EA 4KYVA 1A88A 1CUWA 3WYDA 2V9ZA 1NU6A 5K3CA 3K9BA 3O9VA 4ITVA 1GXSA 2JGKA 3IVMA 2H7YA 4OU4A 3WZLA 4BP8A 4W63A 1ZGBA 3V9AA 1EVEA 1HBJA 4DIUA 4BDSA 3H0CA 1WHSA 3PICA 4B0OA 5AP9A 5I9IA 4P93A 5ALSA 3S8YA 4EA6A 1LNSA 4MQMA 3WA7A 1EK2A 4OYYA 4XIIA 4JUIA 4DM7A 1DTEA 2PKYX 3WWDA 4Y7DA 4ZI5A 3HABA 5IH7A 5AKXA 4MJ3A 4N8SA 3I6YA 2XMCA 4BAZA 5K5EA 4JH0A 1P0MA 3C70A 4Y2YA 3RLIA 1BU8A 2DHDA 4G8BA 5C8ZA 4A16A 4LHEA 1ZIXA 3O0DA 1JI3A 1BEZA 3GZJA 4B81A 3G9ZA 4LYDA 4WY5A 2PSDA 3RM3A 2HL6A 1LBTA 3VJMA 1EK1A 2QT9A 4U2EA 1EXWA 3EQ9A 2HRRA 2O2GA 3DCNA 3A2MA 1IZ7A 1K63A 1J07A 5AI0A 5FPPA 5ALGA 2OXEA 4AXBA 2OGZA 5AKJA 4N8EA 2PUHA 4M0FA 2DHEA 4Q3KA 1NU8A 1O6GA 3WMRA 3LP5A 5AKGA 2RHTA 4DNPA 1UFOA 5LZ5A 2VJBA 4RE6A 1TCCA 3V1LA 3FCXA 4F21A 4BC1A 1LZLA 3G9XA 5JD4A 4CIBA 1CPYA 2G5TA 2DQZA 2WUGA 2AJBA 1XZGA 4H35A 1T2NA 3ZV7A 3A2NA 1ZI6A 1QIGA 4U2DA 2AJDA 5HF8A 3LS2A 5DYWA 3ZLTA 3RARA 1XZFA 3M82A 5A7HA 4FFWA 2QUAA 4AQDA 2C0PA 4OB6A 4B80A 2HA6A 1OXMA 1W4LA 2B61A 4BAUA 4C88A 2XE4A 2WHRA 2FX5A 1UK8A 2XI4A 4FKBA 2NW6A 2JGMA 2QS9A 4QZVA 4BCBA 1X2BA 1F6WA 5LIPA 2WUFA 4A5SA 4WDQA 3VDXA 4YX9A 4UHFA 2H7CA 1CUZA 3OURA 4MXDA 4G4GA 1C7IA 1U4NA 2OCGA 3H17A 3DD5A 3TJMA 5KBYA 1A8QA 3I2JA 4Y2XA 2JEZA 3V1KA 1ACJA 1DQZA 3WL6A 3L1HA 1DT5A 4KE6A 3H04A 2RI6A 1E8DA 3JYHA 3PE6A 2XMRA 1FSSA 5ALRA 3KXPA 3AIOA 2Y2UA 4BCCA 5HF5A 4UBNA 5ALHA 5K3FA 4BBZA 1SOMA 1YASA 1CUFA 1XRRA 5H3HA 3IURA 3I28A 1GPKA 4Q3OA 1BN7A 1E5TA 3D2BA 4W9RA 1BRTA 2PU5A 3D2CA 1XRLA 4FBMA 3EIOA 1CQWA 2ZJ7A 4CFSA 1ETHA 1RYYA 2HA7A 1EX9A 4V2IA 6YASA 4UHEA 3R3YA 3BF7A 5DYTA 1VOTA 5A7FA 1W52X 3AZPA 2B9VA 2ORYA 4X95A 4X90A 5LYYA 3FSGA 1QIEA 3H19A 5CXUA 1FFCA 1ZIYA 2GBCA 5E4JA 1IMJA 5BOVA 2PM8A 4PSCA 5F4ZA 3RKSA 2Z8ZA 4RNCA 1XLUA 1MNQA 1PFQA 2XMGA 5DTJA 1USWA 4UBKA 5J3JA 2WJ4A 3I2KA 1D07A 4ARBA 1H23A 1MT3A 3N0TA 2W6CX 2O7VA 3BXPA 1CUHA 1ZI9A 2QJRA 3FBWA 3MUNA 5HFAA 2VJDA 1RWQA 5D3ZA 4IO0A 1YAJA 5K3DA 4UBLA 3STXA 4K6KA 4H18A 5A71A 1WB5A 3PFBA 4CCWA 4KAFA 4UBIA 3KSRA 5CT6A 4AZ0A 4MEBA 2WJ6A 3E3AA 4KRYA 5AKLA 2QR5A 5CURA 3C45A 1THTA 2R8BA 2XUKA 4JYPA 5LZ7A 4YK7A 4ZXFA 5JARA 5K3EA 3QMMA 1CUJA 2BGRA 2XUDA 4G9EA 4UUQA 2PSHA 3I1IA 3PI6A 4Y2RA 2JEYA 5ALWA 3FLEA 4P08A 3BIWA 1GPNA 1W76A 4OUKX 2XDWA 3WK9A 1CUSA 3D0KA 4C87A 1MU0A 4LYEA 1TK3A 4FNGA 2OGTA 1S8OA 4KE7A 1IVYA 4X7BA 1K6EA 1H2XA 2HU5A 1THGA 1EB9A 4E46A 1AGYA 2RAUA 2WQZA 1EI9A 2P8SA 3G0GA 3DQZA 2HFJA 2UZ0A 1R4ZA 2BGNA 1QO7A 2OCLA 3R3XA 4B6GA 4AX4A 3U1TA 4FDMA 3OM8A 1YAHA 2HHAA 4LKOA 5AI4A 2WKWA 2CUTA 4BC0A 1UOOA 3DDUA 4UPDA 5AI5A 3GROA 3JW8A 1KEZA 1H2ZA 3BJRA 3DYVA 3ICWA 2WUEA 3F97A 2ZYIA 3LLCA 3QITA 4E11A 3W2TA 5AIBA 5C8XA 3WJ1A 1P0QA 4PNZA 4WY8A 4BRSA 4UHHA 4DNQA 5CT4A 4N8DA 4W1PA 4ZRDA 4K5QA 5DWDA 2BKLA 1PJAA 4KAJA 3ED1A 4DTCA 3EF3A 1XZAA 5CH5A 4UBMA 3A70A 5EGNA 4OB8A 4W1RA 1QTRA 1LPNA 2ES4A 4C4XA 3WL5A 1MJ5A 2XUOA 4L3WA 4W1QA 3G0CA 2FJ0A 5JAPA 3I2GA 1ZOIA 4J0HA 3IULA 1HDEA 3YASA 4H77A 2XQIA 1CR6A 3QPAA 4NZZA 1DT3A 5AIAA 3CCBA 5ALUA 1XLVA 4PO3X 5D6OA 4Z49A 4Q05A 4DSAA 5HK8A 5DJ5A 2ONCA 4UFOA 4X6XA 4X91A 1XZLA 1T4MA 2HIHA 1KU0A 2ZJFA 3LIIA 4HTAA 1MX5A 3TEJA 1B41A 5AKIA 2QM0A 3D3NA 5AM3A 2Y1KA 1PV1A 3E1GA 4LXGA 3FYUC 5AM4A 4PQEA 1F0PA 1AZWA 4UBJA 1CIJA 4BAGA 1IUPA 4Y2QA 4C6HA 2I78A 2J4CA 1JJFA 3KWJA 1XQYA 2WLSA 2V97A 3IIIA 3FYUB 3DL4A 3HEAA 5AKHA 4YASA 1X70A 3KD2A 4U2FA 2PSJA 4FWBA 1L7QA 5AO9A 1UKBA 1G66A 4X6YA 5JASA 2XUHA 5AM0A 5AICA 1ZD4A 1EDBA 2PVSA 2ZYHA 2HFKA 1EB8A 3CN7A 3WKAA 3QYJA 4HVTA 3QM1A 4J0DA 2XMQA 2XQKA 2VTVA 5C7YA 4RE5A 5EHZA 1SCKA 1E89A 2Z3WA 4N5HX 1LLFA 2WFLA 3H1AA 1GGVA 4TPKA 2IX9A 3ICVA 5YASA 3W06A 4J0JA 4H7JA 1SCIA 4UFNA 2WTNA 1YB6A 4KEAA 1CQZA 3MVEA 4G5XA 1VA4A 2BAGA 3FYTA 5HKBA 5E4TA 3O4IA 1UXOA 5BWBA 3G9UA 3R41A 2WTMA 4ZV7A 4CCYB 1QIKA 1Q83A 3HSSA
chains in the Genus database with same CATH superfamily
2WWXA 3ZPXA 5IBPA 1E79D 3P2MA 5C51B 1AKEA 2P5TB 3U62A 4DEXA 3K0CA 1FW6A 2PFSA 1U81A 5BQ5A 5BY2A 2JJQA 3FMOB 4WNCA 2LDBA 4S1NA 4WFQA 4I8DA 6AT1A 3KT6A 1A2BA 1H4TA 1QIFA 2D2XA 2IZ1A 2C2HA 3PNVA 3RTBA 2OM2A 3VYVA 1VHTA 2PTHA 2EL7A 1QVRA 2APJA 4LWZA 3W78A 4HZUA 3SJBA 1JIXA 1OFHA 2BGTA 3OF3A 2H1FA 1G8JA 1L8XA 4EY3A 4GG1A 5JNVA 2QLTA 3K31A 2A5DA 2C5SA 2XZOA 1N7JA 4UAVA 3TXXA 1U31A 3CX3A 4G1VA 1NMEA 4RY0A 3NG1A 1N77A 2NACA 3I62A 1IZYA 3AJAA 3FWYA 4C07A 3L6RA 4E94A 2Q5CA 4KQXA 4YRJA 3PBKA 3VYSB 3ZBQA 3WMGA 3ORQA 1KZGB 1M1UA 2Y66A 3DF9A 2ZW9A 3IDZA 4K0RA 1M66A 2ZSDA 3ED5A 3FMIA 4A6XA 2J3JA 4QNMA 4GLOA 1FRVA 2QY6A 3D64A 1FFBA 1GIAA 3SFTA 1D6SA 3IPCA 3TD2A 5K6AA 2X1LA 1Q57A 4GL4A 3EGXA 2P9QA 5GVRA 2OAGA 3PA8A 2VF5X 3A6JA 2JLZA 1XVVA 4K1LA 1KXJA 3C4QA 4LXQA 1TYCA 3WS7A 3GD5A 4FC7A 4CM1A 4PLWA 2C2ZA 3CG0A 4BWVA 3I1JA 1TJYA 4G97A 3JALA 4KK4A 3PHLA 4FB5A 5KVAA 1XKTA 3W9UA 2ZKLA 1F48A 5ILOA 1GKKA 1GZ7A 4H0CA 4XB6B 3IEXA 4FYMA 1J39A 2IIQA 4OQDA 4QLBA 2FZGA 4UC0A 2YVKA 3ISJA 3MS2A 4WBXC 1V43A 4W5RA 2ZUSA 1R6BX 5KYGA 1UKEA 1ZUWA 2CMFA 3FOEC 2XNCA 1B42A 3KJEA 5FRDA 3FHLA 5B12A 3FOBA 1M8KA 4JXZA 4YQEA 2NU7A 2CK3D 4IHQA 3OTIA 4XUEA 3R0XA 2H9YA 3GL9A 2F17A 4MUGA 3TDNA 1QGAA 1KO1A 4NNOA 1OU0A 5LR6A 1GT91 1NLYA 1NW8A 4MR7A 4N3BA 5KVCA 4OGWA 2IYYA 4NONA 3TLAA 2DQKA 4RPCA 4A82A 4NC9A 3IPYA 3EXG2 1T9AA 3D3WA 5A6VA 1M33A 5EJGA 2WU3A 1WMDA 3ZGVA 2HQBA 3GD7A 4RZQA 1FTGA 1ORRA 3HA2A 4IMRA 1FS6A 3SY8A 1PX2A 1JEQB 2WIKA 1O9BA 1D7OA 4P58A 3A1SA 5ADUS 5ALTA 1AV6A 1OKKA 2ZAIA 4IJWA 1X7YB 2WZDA 4URYR 3IESA 3MTDA 1PJLA 1US8A 2OAQ1 4JY7A 2JHGA 5AHOA 3T7EA 4KAAA 1W0KD 5EQJB 5IFKA 1UAAA 3OA2A 3D5EA 3MWDB 1PJBA 4M37A 3TTXA 3VSBA 4XVRA 2GAIA 4KUEA 4WGFA 3AI2A 3Q40A 4BNZA 4YP9A 4L0DA 3RS2A 3O93A 2OO7A 4WKPA 2OD2A 5JY6A 1FJ2A 2ALJA 4F2WA 2HWKA 3AC0A 2YXEA 3KEFA 4MUXA 4M4SA 4FMDF 2F67A 4TS9A 3ZHTA 4N0QA 2DR3A 5ALPA 4WFJA 4AXXA 1S1MA 5IZCA 4CKYA 2OD9A 3AY0A 3GLHE 2JD1A 3HBMA 4NYIQ 3SIRA 5E6UB 4WACA 1R7RA 1OIWA 3BTUA 4GECA 4ZO7A 4B79A 4DARA 5AKEA 2MSDB 4EABA 5BYAA 2ASVA 2GTIA 4D02A 2HCJB 2BBWA 3NR2A 5KSZA 2P6NA 4A2WA 1JZTA 2PS3A 4BJ3A 1PU2A 2BKVA 5AM5A 2PMEA 5BXYA 1COZA 2A9RA 3ZDFA 1Q1ZA 5AI9A 4TL7A 4X45A 2H2WA 5AK5A 2VI5A 3WLOA 3UMCA 1YRQA 2LP4Y 3NHZA 3GCZA 1IWBB 1ONBA 1U2ZA 3ASVA 1E60A 3NHUA 4GWKA 5BSMA 3C3JA 1UUFA 3S55A 5ER9A 3NBUA 3ZHYA 1AUVA 3R3JA 1Y6GA 3NONA 1Y37A 1LSSA 4RY8A 1KEWA 1LJLA 2Q27A 4O5AA 3RE1A 1GCIA 1XZPA 4FS3A 4LVNA 3NOQA 5BN1A 2D59A 5IFLA 4ARCA 1KH3A 1W29A 2UYYA 1KC1A 4NF2A 3EWNA 2YHAA 3AUFA 1R64A 1NI3A 3DZDA 4LC9A 5EJ9A 2VNKA 1MAVA 4K6HA 4BGUA 2FWPA 3A9WA 4K9RA 1AQIA 2OXCA 3DBHB 1WUKS 1Z2AA 3UHPA 1BS1A 4F4UA 2XOKD 5FLYA 3TLZA 4D7AA 3K73O 1MGOA 1XZDA 5FD8A 4Q9NA 3BRCA 2PCJA 3PIIA 4O2AF 4LZAA 2B34A 1JVSA 4OJQA 3B2QA 1ISMA 3PC3A 1HOTA 3IC5A 2WWWA 2OWDA 3QENA 1REQB 3AWIA 1AKNA 2IE8A 3GNSA 2JGNA 3GZTB 4O4HB 3RYIB 1BWRA 1JAZA 3DZGA 3BHNA 3GGOA 3N2IA 3N9IA 4BFYA 2RJNA 3QF4B 4LN1A 5CRIA 3C5WP 5TY0A 1YBMA 4C4AA 2XYHA 2IBSA 3LOUA 1GSHA 3QWBA 5CT5A 4XVCA 3O95A 4XGRA 4RACA 4F2DA 2O2IA 3BGIA 2I2CA 3D59A 2C9YA 5DCLA 3OX4A 2WWVD 1CUBA 3EA0A 3M0EA 3A3NA 4WI1A 3UXMA 5C5EA 1MO6A 2ZCJA 3FZEA 4GSLA 4ILKA 5IDVA 4EUEA 1KZ6A 3WBJA 4F4DA 1CUAA 1CE8B 1THZA 4Z1MD 1BDHA 4L1KA 3VYWA 5LYJF 5FR2A 4TMTA 1AHPA 2FRXA 4MAFA 4BLQA 3Q9NA 1NVMB 1A71A 1YOVB 3B70A 3C6KA 3A8TA 1RPJA 3MAGA 3U61B 1YFLA 3N2KB 3UXHA 1RYEA 1F4LA 5CA1A 1T0UA 4MJLA 4D3ZA 1ZVKA 2ZPUA 2QUBA 3KU1A 3PHJA 1PIWA 3MTEA 2XBMA 3OQ1A 2GO7A 1RXEA 3LQFA 4CMJA 3F2IA 4MKFA 2XXJA 3GJ8A 2B69A 3TVYA 1DTSA 2HMVA 4C0HA 2DTXA 1GAXA 3NIWA 2FTKE 1HKHA 5JNUA 5JSQA 3X1YA 3MWJA 1SBCA 3FUWA 4RPKA 5KHOC 4J1NA 2IPNA 1MJGA 1HX7A 1XAHA 4JUDX 3F2VA 4R0NA 2HI0A 4LNAA 4L78A 4Y1RB 4OBBA 1W4CA 3UAOA 2ZULA 2GHTA 2VUHB 3IYLW 4L75A 1YUMA 4NCHA 1C8VB 3A6EA 3JAWA 1JKIA 3N2EA 1EE9A 3HR4A 1QRUA 2NTNA 2DWQA 1VECA 3WK4A 3DS8A 4QHTA 2GASA 3IP1A 1WXDA 1B14A 3T52A 4S1VA 4IM7A 3WGJA 5KQRA 3TPFA 4BQRA 3LT1A 3DE3X 3UN1A 5HM6A 1O9GA 2XNDD 1G7RA 2XRFA 4LGVA 1RVV1 3T9EA 4DC9A 4CCYA 5DZSA 4KR2A 5BP7A 5E7QA 2D7DA 3KK0A 9LDBA 4EG7A 5JSFA 3G8BA 1QV9A 5DGHA 3U3JA 1H6CA 2FMKA 4ZGWA 3F6SA 2SBTA 1H8HA 2Y1GA 1Y63A 3UT6A 2F7SA 1IQ0A 3NHKA 4DA0A 1YIOA 3M6VA 4QDTA 2FPGB 2QTVB 1KGSA 4BMPB 3CNQS 2HADA 3VKVA 3ESDA 4D26A 1RBMA 2JVIA 4R1TA 3EQ6A 4A2PA 4X1KA 1RZVA 1B8PA 3E61A 3P45A 3ASYA 1X9GA 1Z33A 1VA5A 4H1TA 1ADBA 4IIFA 1M1XB 5SYMA 4OLJA 1NMXA 1AJEA 1Y4DE 4RLSA 3GUZA 5L4NA 3MPUA 2FW6A 4PG6A 3ON5A 1CQIA 2O20A 4WZBA 4DIUA 4AF6A 2ZIVB 4IIHA 1M2OB 3Q3JB 2O8VA 3I58A 1BX1A 5DP2A 4BN0A 5B4TA 1SCQA 3RBAA 4MUFA 1VE7A 2CVOA 4HVCA 1Q1EA 3CUEF 3A25A 3W0LB 3CWZA 3H9QA 3SS7X 1B8NA 1YDGA 3MBKA 3Q7TA 2B20A 4MICA 5KPJA 4BN4A 4DWWA 5LQNA 1GRRA 2FFRA 1SK8A 3O7MA 4B85A 1KAMA 4IRUB 2DLNA 1ZHHA 1GAWA 2M2IA 3OT4A 4ZARA 3LVFO 4DHEA 2ZE5A 4WLUA 3HO6A 5KYYB 2Y0EA 3PPVA 4FFVA 1D8AA 3BFKA 3UH0A 4JFRA 5ER6A 2JGAA 3A1CA 3D8HA 3FCAA 2NO1A 4BNDA 4TS1A 3EFOA 3QVLA 4HOYA 4QHSA 2VN8A 3AJRA 3BWDD 3KUUA 4B9EA 1O95A 4JX8A 5KX5B 2LBPA 1UPUA 3MMXA 2BD0A 3KVOA 2FPUA 1AF4A 5LQUA 3AHJA 3C1OA 1XALA 2O1WA 4RQTA 3U9SA 5KTTA 3IAM1 1KA9H 1XA3A 2C5FA 1YJXA 3E0QA 2FWAA 3RHZA 1U5CA 3WSWA 4DDUA 2BEWB 2DPHA 4MQFA 3RREA 4AQYB 3R20A 1D0IA 3S1AA 4IRXA 4E5PA 1AK2A 2HTFA 4GBMA 4UEWA 3LA6A 4ZEWA 3CN9A 2PJDA 3BFXA 3HVJA 4NE7A 4QJBA 5C5CA 4Q7KA 4FHDA 4HLNA 8ADHA 4YAOA 1XA0A 2OUIA 5JSKA 4IDBA 5HS4A 4I1SA 1UBTS 3DHVA 4L07A 5T8KC 4U0KA 2AX3A 4R8MA 5C3MA 4IUDS 1NPDA 1AE1A 1OSNA 4EDFA 5JATA 3WKDA 1E8MA 1DCKA 3CLRC 4DLVA 5F7XA 1YU9A 3U3ZA 3ZWMA 3MQ2A 4C78A 4MB2A 1MIOB 3COPA 3E3OA 5BORA 1C8LA 1AURA 1GKUB 3A4NA 3AP1A 3FWHA 4MPDA 4MYUA 4PSAA 4GL2A 5JZ9A 3A9RA 1TQDA 3GRVA 4OA5A 1DX6A 4D0SA 2NYAA 2W2LA 3H2IA 4N7BA 2ZBDA 5GMOA 4B7UA 3OJFA 5L95A 2D0PB 3O4VA 1FIUA 4LV5B 4QAJA 1VE1A 3OEWA 1LPAB 3GC6A 3LK7A 5DK4A 1NASA 3FRJA 3VTKA 3ETNA 2ZT5A 3OMWA 4IH4A 4KGVA 1ABEA 2WG2A 2HCBA 3AL3A 3L84A 3Q15C 2NU6B 5DLPA 1CY1A 4K3UA 4C01A 5CFNA 5HP4A 1LEHA 2QTFA 4PRZA 4FYKA 1M5TA 4AG5A 4ENWA 3AONB 4J43A 1AKTA 3MWEA 1LU9A 2R7MA 3MBIA 1T0IA 3L4BA 4PLTA 2ZKIA 1PGPA 2X8JA 4N41A 1YDFA 1QB8A 2ZR9A 3IIJA 5FBZA 1A9OA 3N8NA 3NHAA 1C0EA 2OM6A 1GFIA 3Q7IA 2TECE 3DL2A 2RGYA 3P0RA 4UMFA 1VLHA 4NENA 4S1PA 5D84A 2R0QC 2IHYA 4TRMA 3WNQA 1YULA 3ABOB 1FZTA 1R0RE 1DNPA 1I4WA 3LG2A 1PJ2A 4ESOA 2JKZA 1C7QA 4GGOA 3V8BA 3INTA 2RH5A 1JHRA 5EHXA 1G5RA 3H9JA 4FYVA 4JC5A 4RC9A 4LNHA 4RS3A 2FQXA 2Y1CA 3UT0A 3O92A 5H83A 4F2GA 2QK4A 1ZGAA 4AIRA 2I4TA 3ZWQA 3V6LA 3L8DA 4ZGBA 2PLFA 3CF4G 1GPWB 2OILA 4WV3A 4W99A 4B0PA 4E6EA 5JXJA 3U39A 2NZ8A 2B6HA 2A57A 3FUVA 1O57A 2IEBA 3GOQA 3LMKA 5FORA 2M6KA 4EYQA 4YUYA 1L7PA 3EG9A 4DANA 1OV6A 3LP8A 4DMKA 3CLHA 4HLUA 3AU8A 3V8EA 5CA0F 2IH2A 4D3FA 5AW2A 4GDMA 2WU0A 2NP6A 1NX6A 2XUQA 4AMUA 1EJBA 1P8AA 2W6JD 4NNPA 4AYTA 2V7BA 2QNBA 1QYRA 2VUIB 3G79A 3R7SA 3VPSA 4YUXA 3C8HA 2NLOA 4FCCA 2PNJA 1SG0A 3GXOA 2G3YA 4Y2HA 3IB3A 1T43A 1FVOA 4EECA 1RKVA 4U39A 4L7QA 3SR0A 3AFGA 1J0BA 4N9WA 1QPZA 4FHZA 4UTNA 1YMQA 2B9EA 4GXNA 1G5HA 5IJXA 2XCTB 1N2GA 1WZIA 3B82A 1QZZA 2PMCA 4WOCA 4TVOA 2N9UA 3B20A 2VQFB 3ZKWA 2VAVA 4J7CA 5HOQA 4EG8A 2NZJA 4EUHA 2VK4A 2J3HA 2NAFA 2Z4RA 1JAYA 1RQRA 1Z0AA 3CLSD 2YZKA 3WBFA 1ENPA 1H9BA 1UJMA 3PD0A 4Y9TA 1UADA 1Q21A 3QH4A 4BCDA 2CJXA 2GERA 1DDOA 1PKXA 1T4DA 1SU7A 5C8YA 4NRDA 5IT4A 4AJ9A 2Q4TA 4D8UA 4BQIA 2WIGA 2H1IA 4GYWA 3CSDA 1OKKD 2FZEA 1X8XA 2YVQA 4AUMA 4IUBS 1F51E 2KBFA 2JGEA 5IBCA 2AEEA 2A78A 4GP6A 4DZZA 4LF7B 1DVRA 3L7YA 4RQUA 5EINA 1G9XA 1J8MF 1ES9A 1G5FA 4ZQBA 4M0PA 2AG6A 4EW2A 5AVVA 5BSUA 2R66A 2GYYA 5CDFE 1FMTA 3I4LA 3WK5A 1B8UA 3GPCA 3U7GA 2FSGA 5JZMA 5AK3A 4HNUA 2NO5A 4R84A 3AEXA 3HR7A 1U99A 1GKLA 1JIVA 3KVVA 4QUKA 3TE7A 4YCNA 5MF6A 3CVYA 1AMOA 1TEVA 1BMTA 1V37A 3KPVA 4GPZA 1Y48E 1Z5UA 3D1VA 5DNAA 3I37X 3BFPA 5HE9A 1N3BA 5CK5A 1VSQA 1FYEA 2UYQA 1MABA 3RAJA 1PZXA 3IAXA 3NM4A 1CK4A 4HX2A 5AUOB 1E7QA 2Q46A 3M1IA 3H6KA 3W9SA 1OUMA 2VKQA 5MN6A 3I9V6 4D99A 5BWCA 4MVJE 3R5JA 5I7RA 3N7UA 1DQYA 1FX1A 4J3FA 3W9BA 1Z8DA 4DSZA 5JHGB 5DM1A 2BT4A 5I7WA 1RRFA 3H1TA 2Y1EA 2VDKB 1M2KA 1YDMA 4FBGA 4DCSA 2O8NA 1QYCA 2BKAA 2WK1A 3BIOA 4YP1A 4EJSC 4BVFA 5AOCA 2QX4A 1KJ9A 2QRKA 2X6RA 2JFGA 3AM1A 4KL8S 4FNAA 5BWMA 2GOYA 1AKVA 2C78A 2C8KA 5AHWA 1JXQA 3N3BC 5TQ2B 1JW9B 5E38A 5ERGB 3VNQA 5LOVF 3T15A 5JMWA 1U3UA 2IZZA 2O5VA 4Q12A 3TTYA 5FUVA 1XCGB 3ZQKA 4H17A 4IAOA 4GLLA 3BSSA 4QUBA 1W0JA 4W9NC 3UB4A 3VDMA 2X0KA 3DJFA 2G0TA 3HZRA 3V7UA 1DG1G 1ZU5A 2CVPA 3GRCA 4QWMA 3D4PA 5FPQA 1PFWA 4CMEC 5KYTA 1WZCA 1TL7C 2ADFA 4QU0A 2D7JA 4CG2A 2NSJA 2IIVA 4NZ9A 4QGBA 1L5HB 2PUAA 1UF9A 2A0KA 3PQ8A 3OE5A 1MEOA 3FIUA 3TLGA 4RA6A 1N0VC 4EMSA 1I8TA 4JASB 1ID1A 2C9MA 3FXAA 2QUHA 1OXTA 1XYVA 2G28A 5HUJA 3FOZA 2DCUA 2BBSA 4WEOA 2QU7A 4LXIA 5K99A 3PTLA 3EXAA 2CC2A 2QVGA 4PPQA 4YBRA 2DECA 1TA0A 1G18A 2FPMA 2GD1O 2ZRJA 4F38A 3OM9A 3UJ9A 1A9XA 3UOAB 2WNIA 2RBEA 2G04A 2XWQA 3AB8A 3CEMA 3ADBA 3LCRA 1P29A 1W85A 4X1OA 5KIAA 4AJ1A 4P4SB 2H9IA 1FNBA 1D6NA 2WSBA 1J0AA 4EY5A 4A9AA 4BEBA 1EKXA 2BR5A 2OZLB 4M2LA 2VA8A 3F74A 2EX4A 4HJXA 3LUJA 2FP4A 3KZKA 5KB3A 1YQQA 3WLMA 1NSYA 3PNYA 2AE2A 4DBLC 2GYVA 2OK7A 4RA9A 5L53A 2PFGA 3PNKA 5BOSA 1JSRA 2QL9A 4J7AA 1W7AA 4KFTA 3LUCA 1OILA 3H4MA 4BX2A 3EIUA 5JRJA 3KO8A 4HWPA 4JOSA 5GAJA 4DYVA 4IZ6A 1GPLA 1TAHA 3G2JA 4KBGA 4ZO6A 5ALDA 5J4HA 3ZDDA 3K9CA 1R0CA 5H02A 5H4GA 1E6CA 1P1BA 2QXUA 4BTLA 2DEUA 4OL0A 2XYQA 1Q0PA 1U3VA 3DDCA 4JXJA 1GEEA 1PJCA 1OLOA 1SC6A 2GESA 1LS1A 4IDCA 1DO0A 1JVNA 2G88A 1VSVA 2RHMA 5FUXA 1WMBA 5F5LA 4QG3A 5LA6A 5C7IO 3CZCA 4HI0E 1NGSA 4NZPA 1XNGA 4G5HA 5CB4F 9LDTA 2ZZNA 5ADHA 1G5QA 5CM9C 1H4SA 2X0EA 3VO2A 3HNRA 3V48A 1JI0A 1P6QA 1E0KA 1JRLA 3AOEC 1F14A 4WOPA 3F6YA 4CQLA 2ZWVA 5LUBA 1EE2A 4CV3A 2VCHA 3HWRA 4ALJA 4CHTA 1HNZB 4CEJB 3P27A 4I1VA 3WNZA 1AQNA 3KIPA 2F8TA 2VDRB 3OCYA 4FVTA 3DOOA 3GIDA 3AJ8A 2W71A 5IF9A 4I0WB 3JQ6A 2WZBA 2AC7A 1Z9BA 2BGJA 3EXHC 2K6GA 1DAMA 1TX4B 4X62B 4B3IA 1NRJB 2PIDA 3CF4A 1QP0A 2X5JO 2XGJA 1YRHA 4M86A 3EXEA 1ZOOA 3ABIA 4E31A 5JAOA 1B16A 1KU6A 1LBIA 1AZLA 3FDFA 4RVFA 5F78A 4JB2A 5K0LA 4RTSA 1X39A 4PO1A 5I7OA 1ILEA 4R1UA 4RZXA 5FOTA 1ZONA 3TX2A 4H6WA 3I72A 4A26A 1ZBQA 5IJ9B 3IRVA 1I4OA 1SUFA 1VBNA 4RYLA 2YMLA 2CXNA 2PZGA 1XQXA 1H8HD 3B78A 5DRTA 1WNFA 2H65A 5G4LA 3ROEA 3ILXA 3VR3A 2DUJA 1Q0ZA 1RTTA 4JBLA 1R18A 2C88A 4OYHA 3EXHB 1I7DA 1QG0A 4JGBA 4U63A 1T2UA 3LA8A 4I4CA 4E7PA 4S35A 4ADSG 1TFRA 5HG0A 3QVKA 1KI2A 4FI3C 2EC5A 4RK6A 5JW6A 1E0AA 4XARA 1SB8A 3FDJA 4MWOA 4DOMA 2HMWA 3ESZA 1CP2A 1OAKA 3QFFA 1V5GA 3AETB 1U2GC 1HDOA 2BN4A 2BM9A 3BG5A 2XZDA 5FAKA 1ECBA 2C3OA 1GQ2A 3UXEA 1Q2UA 4OJNA 1PVDA 2EU8A 3MJSA 4EHBA 1UK9A 1DCTA 1M2HA 4NR0A 2V98A 3LXMA 3DDHA 3GQVA 4FK8A 5K7SA 1HT0A 2ARKA 3GFTA 1LZKA 5FQOA 3LGXA 4JUCA 2EBFX 1SR8A 2FETA 2WWFA 4UZEA 4JVLA 4KZKA 2P11A 3MS7A 4KHZA 3ZIAA 2C5GA 1DIHA 1FTQA 3SC2B 3AFIA 1XTUA 2QN7A 4NTZA 1IK6A 2OLJA 5DBGA 4YI3A 1VHJA 2VCYA 4IIDA 3UICA 4EG6A 1L4LA 4QDZA 4C3VA 1J0EA 2YYAA 1WDMA 1MORA 3ZE9A 5I5EA 1UPAA 2VJPA 4U7TB 2A92A 1V96A 2LUOA 2P91A 1B6GA 3R09A 4F5ZA 3OQIB 4NARA 1LB1B 3OF2A 1BAPA 3KHSA 3H8VA 1JYFA 4J94A 3JARA 3LXRA 3FA2A 2EXXA 2RJOA 1FYDA 1VFPA 3UB3A 4YT4A 2E4ZA 1O95D 1X3LA 2C82A 2ZRMA 3EUFA 2MMCA 4IV5A 1RWPA 5LD2C 5JE8A 2R1VA 2HZBA 3A9CA 4PGGA 4BBPA 4KFRA 1P2DA 1SHZA 1AM4D 3X2EA 5C81A 2FZWA 3FPGA 5FBLB 4DJFC 1SQ5A 1UK7A 1P45A 4WAUA 5F2KA 3D8TA 4WXPA 4QVGA 4R1LA 9GPBA 1W44A 2JJMA 4PHFA 4CFYA 2Q5FA 3PFKA 3L8HA 3UHFA 1DBWA 2IP4A 4GIBA 1K9VF 2GN0A 4DVGA 3R0ZA 3AIKA 2H08A 3KPJA 1VQ1A 4KQCA 4MVJM 4MZXA 2IHZA 1G42A 1WDLA 3PGMA 5KNCH 4K9QA 3SJZA 4HAUA 4K6GA 5A5DA 4O2AA 1T24A 3TH5A 1Y5RA 3QVUA 3OZIA 2EG9A 3FPJA 2X58A 1J06A 3ZEIA 1M0SA 2PUGA 2CDNA 2R4QA 4TZ0A 3FYCA 3I9OA 3OO1A 1KVUA 4ZOQI 1XJWA 2GGSA 3C3KA 3LZCA 3PPXA 1TGVA 3ITDA 1FQKA 1PV2A 4FFOA 4PCLA 3UUWA 2I1VB 1KDOA 4GMXA 4L0CA 3LNTA 5B1DA 3U2QA 4BFZA 2BFCB 3ENZA 3GN1A 4YCCA 3P2EA 5ARBA 5HUHA 1EJ2A 1E2MA 2NSLA 1Y1KE 3DHWC 1BKDR 1W4ZA 4FUQA 1SXQA 4PXAA 2W2LD 4BVBA 1J4AA 1HORA 2P2YA 4QDJA 5L8VA 3HYTA 2PQMA 1DINA 5GONF 2NIPA 1VJ1A 5MFZA 1P9NA 5BV2P 3P94A 1HLDA 5BQPA 5JZBA 5I6DA 1T0PA 1S8FA 2GYUA 4P2BA 4QBIA 3VKUA 1ORIA 2OKGA 3LBAA 3C5VA 4GWGA 5LYJA 2YJ6A 1EQAA 4AG6A 4CLXA 4F3RA 4M1MA 3V7FA 3MGAA 5DXAA 2P78A 3A26A 3FTNA 4IV8A 5J2UF 1LDGA 5BUQA 2IPXA 5KYWB 4RIEA 2RG1A 2YR0A 1XMIA 1XZMA 2XMSA 4IJUA 7ADHA 3DUWA 2AD1A 3GI1A 4HEA1 3C1UA 2VJLA 2NUPA 2PBRA 1UXKA 3KP1A 4LCJA 5SICE 5FF9A 2XHEA 5G0UA 1Y8CA 2GZDA 1OZ0A 4P7KA 3K0SA 3JD0A 1V6AA 4INJA 4DBLE 1ZGCA 1H9CA 1RHQA 4XIJA 4D8YA 1E0JA 2VWGA 1PD0A 1QBKC 1GGKA 1YIAA 1YZLA 2FQYA 3DMHA 1XD2B 2VXOA 3GRPA 4NQZA 4TMWA 3V1MA 1DB3A 4C7OB 1R4AA 2ORWA 4FOPA 4OI2A 4GI5A 4RV4A 1LBQA 2JCYA 4CM8A 2G0AA 4G36A 5GP1A 1JJVA 3E9EA 3DM9B 3A9VA 4MYHA 4DG5A 3Q7PA 5GIPE 3LY8A 3FJ1A 3EIWA 5CNKA 4HO1X 5BUSA 2F1KA 4IQGA 5ELXA 2A2ZA 1IOVA 2FRDC 5I8PA 3QOYA 3HL4A 1RXYA 4MEAA 5B7NA 1BSVA 1ISSA 3V2GA 5DV9A 3C41J 5F1OA 1BKSB 4WLVA 1F2UA 1EGAA 1HRKA 1T9BA 3RGWS 1QKKA 1Y80A 1R6TA 5IJZA 3NP9A 5IAKA 3R4CA 5HCIA 2OCYC 1L5NA 1YZUA 4UM9B 3QZUA 4FT4A 1QKJA 3MSXA 3A3KA 3LC2O 1Y89A 5I51A 3EPHA 2JZNA 1YB4A 3ZV4A 1WX1A 4UEQA 3K09A 3K70B 3MJVA 4LSWA 1NDUA 1SQGA 2BZ1A 4TYQA 5K2MA 4D25A 3LLSA 4V0ME 5IARA 5K8LA 1BVUA 3OTOB 3CSSA 1TQ4A 1IM8A 4MH0R 5IT5A 2G8LA 1YO6A 2HDOA 2YMQA 2YV4A 1KRWA 1F7UA 5K8UA 2NM0A 4Q1VA 4U2CA 4WE3A 2I6FA 2YXBA 2GAOA 5J4YA 1ORWA 3H5IA 3GNTA 5MGBA 3TK1A 4U7JA 2PXXA 1FRQA 2ZSFA 4DNFA 4OGLA 5B2ZA 2PSEA 4O4LB 3SMQA 4ZTZB 3TUIC 2PV7A 3PRHA 1CETA 2I3ZA 3C8UA 4N1AA 1ZOLA 2DB3A 1J8FA 4BUCA 4ZQGA 2O8EB 2H63A 1ZM3A 4K6OA 3B1VA 1SVLA 4BX3A 2O05A 4CLHA 4CR7A 4M99A 2DBVO 3V1TC 5BN5B 3ZE2B 2XHZA 1PZEA 8OHMA 1XB2A 4XCQA 3BGWA 3OOSA 3M4YA 3BHMA 3CTPA 4PGFA 5HF6A 2G4CA 1Y3CE 1J9EA 1KKMA 1NBME 2V5VA 3QLTA 4ON9A 3TQRA 5FOQA 4NYJQ 3DYIA 2FWBA 1YE3A 5D8DA 2DSNA 2TSYB 3RC2A 1RYBA 3WRWA 2YL2A 3L8YA 4EYGA 5CYOA 1Y3DE 3W1WA 2FOLA 2CXSA 2GSWA 2OORA 2ZSKA 1ZH2A 4P33A 2GM9A 5LJLA 1TT5A 3I0NA 2D5BA 4L08A 1Z5OA 4ZANA 2DXIA 5JJ5A 3GUHA 2M9MA 2HLHA 2A0WA 3PUXA 3B1FA 3BWXA 2VK1A 4Z9AA 5HJ5A 4R2KA 4RTNA 3RC8A 2JIMA 1JDBC 3KZNA 2RONA 3RVMA 4MHOA 1NDQA 1R6UA 2QAGC 3GT4A 3F96A 5A6SB 4H6VA 1ZZGA 3A1VA 4KV7A 1KTVA 1T1IA 3M4ZA 1ZGGA 4KQIA 2H5LA 1OXBB 2ZYRA 1A8IA 5E8JA 5IASA 4HXEB 2DG2A 3JVEA 3I30X 3OT1B 2C9CA 2JIZD 2IIPA 3VTFA 3DH0A 4CE6A 2JLWA 3EVFA 3GA7A 2RK6A 4Q3DA 3W6PA 1FUEA 4O8ZA 1L1FA 4XPIB 2Z5LA 1GADO 3BL8A 3G3EA 2YVAA 4L85A 4NK5A 5JNSA 5IS2A 4XOUA 3UMSA 5L3QB 3THWB 4HAZA 2BI4A 2LW7A 4IG9A 3WHIA 5HMLA 5IJWA 1JDBB 3Q98A 2P0YA 1A27A 2WKSA 4YAEA 1YZYA 2QAGB 4WH0A 5NLLA 3U26A 3VI3B 2CVHA 1EZZA 1LLDA 2AWOA 1U94A 2GM3A 3JWHA 5JS2A 3F8WA 4P3OA 1RM4A 3AEKB 3WWCA 3N8HA 3DOUA 2PEYA 3K9WA 4ES6A 3OC6A 1QIHA 4YVFA 5AWFC 3JTMA 1UWVA 3HB9A 3LW7A 5TQ0B 1YA8A 4KQEA 2HT6A 3NUGA 5IBRA 2GEVA 3V33A 5ALZA 2EX1A 4KV9A 5IPFA 5AUPB 1N5OX 2CXUA 2VG8A 4LXXA 3FR8A 1T3SA 4M9QA 3ZLUA 1W0JD 5CG1A 5JS1A 2V45A 5IK2A 3S4YA 4KYTA 3AHHA 1L4BA 5EC8A 2IY7A 5IN5A 3WOVA 1YV9A 1T5IA 4LQ4A 3NDRA 3FF4A 3EWSA 1DAPA 1UBRS 1MIHA 1GQSA 4ZHQA 2VUUA 3KZOA 1NM5A 3B9RA 4NG5A 3QEAZ 1DSSG 1ADFA 2B4RO 3GK3A 1XD8A 4UU8A 5EHIA 1ZISA 2QTLA 2XA9A 1ZUIA 4AZ3A 3V34A 4Q00A 1V26A 2J32A 2QD3A 2XPCA 4TL8A 4X3CA 2HLDA 4CR8A 2YRFA 4IDGA 5BUCA 4D9FA 5LQKA 1PR0A 4KUHA 1T5TA 3T6KA 5TMPA 4P2GA 1XKXA 1TO1E 3S40A 3PTAA 4HAIA 1R5NA 1RABA 4NDNE 1SVKA 5ICFA 1ZJJA 3FSRA 3PQEA 5LXTA 4GNKA 1LSJA 4HFNA 2O7QA 1H2HA 4D9HA 4CEHB 3GELA 1X1CA 4A7PA 2MR5A 1MQSA 1H6AA 4DJJA 2ECPA 2FJUA 3DVAB 2O6LA 4GGPA 4GQAA 3EA5A 1YQUA 4HS9A 3D6HA 1FFEA 4LOKA 5B6PA 3A3OA 3K0CC 3LHDA 4QUDA 4J0IA 2H4FA 1Z08A 1TZBA 5ITSA 4FJ2A 4BP3A 4D98A 3LFUA 3TNFA 3ZJ5A 3AEUB 1SHJA 1TA4A 2QT0A 4XWGA 4AJLA 1IBRA 3O3NB 1Q5PA 4HNVA 1PSWA 2R751 3EUWA 1GXSB 1N5KA 4NJMA 3GPDG 3HKDA 4KSYA 2I55A 4YYZA 4YAFA 2RC6A 3QTBA 1T9HA 3TD6A 3A37A 4LHXA 3V3KA 2XDQB 1VE5A 5CA0A 4D81A 1CS4C 1IQUA 5JISA 1UH5A 1NJ1A 3JS5A 1J8YF 3PQ5A 4RKYA 3U56A 5C3UA 4X6UA 1YK0A 4I1OA 4KSCA 2OV8A 2J9FA 1L3BA 1XCMA 4CV0A 3BGSA 5CH3A 3QVSA 2PT5A 1P3JA 4W5QA 4XQ9A 2B94A 3X1KA 2PYZA 2QYHA 1TW2A 4UARA 5FWXA 3VX4A 4CLEA 4BB0A 5HJEA 5KOJA 2QTHA 4K46A 3DNMA 1W34A 4YEDA 4TV9B 5L7YA 3UW3A 3ZE7A 3ZEAA 3DB1A 3B89A 3NHLA 1P0IA 1P4HA 2HO4A 3UAZA 4NCNA 5K6AC 2EKLA 1NVWQ 4J90A 4I2VA 1OZGA 1QIIA 1YQGA 2H4XA 4DM4A 4IOKA 4TGLA 4M0UA 4IS3A 3ANSA 2P7IA 4Q0MA 1QQ6A 4Q1FA 1P2BA 4G0PA 4DV1B 1QFSA 2OCIA 1QIDA 2QIOA 4EY8A 4KH0A 4MWSA 1JB1A 3RJ5A 1G55A 2XODA 3FHCB 3GJ5A 4EGCB 4QPPA 3ZHVA 4BBAA 3VR3D 2BSQA 1CZOA 1A9RA 3PQ2A 4Q1BA 4WINA 5DHQA 4F5WA 2JBAB 4AF8A 4IGFA 1MO5A 4LZJA 1EPUA 3H2GA 2Q1XA 3G6KA 1M2GA 2H48A 4KNVA 4X41A 4RJJA 3ZW8A 2GH1A 1MTOA 3JQCA 1GJRA 4TUYF 4OH7A 3EGDA 3DLCA 3MM4A 5AJHA 3JQQA 4Z9YA 3UUEA 1RFGE 3IELA 4B4KA 1O96A 8AT1A 2QTMA 3R3WA 3U7FB 4K9PA 1B43A 2ZQYA 1EP3B 1CJMA 2C94A 3GW8A 4ISCA 4UUPA 3SYKA 4O33A 3AZOA 4YV7A 4YCAA 5JXGA 2J87A 4MP8A 3T4EA 2GF0A 3IUJA 1RJGA 1NFQA 1J20A 3ZIAD 2FUNB 5BV7A 1EEHA 2BGUA 3R7DA 3TSWA 2J3KA 3DVLA 2FUEA 4BLTA 2REXB 2NU7B 3BK7A 2IDKA 2IEIA 3ZIUA 3O26A 3RTDA 4P1ZA 4D4JA 1KBOA 4L4XA 2JVKA 4W9MC 3VTAA 1A9PA 5EJEA 5JAZA 1JA0A 1MJNA 4F7WA 5C1PA 1QH8B 2HRBA 3GDHA 4JLNA 2Y9PB 3WWOA 3MEQA 1P5ZB 5B53A 1I5EA 5CUQA 1I13A 4S0XA 1RLOA 4EPRA 1TPZA 3BEDA 3MLAA 1KNXA 1WO8A 4RVNA 3TGWA 3RADC 1NW5A 4JKIA 1GVNB 3KSAC 1E99A 2A3NA 1LDNA 4UPVA 3GLKA 3WYNA 3ZTWA 2WD9A 1L5VA 3ZU2A 2GZSA 4BMOB 2QYOA 3EVCA 3N87A 3O47A 4B6FA 2OV6A 5IZCC 2UYCA 1Z4LA 3M1LA 1IJFA 3IUSA 1QZ3A 3IBTA 1JDZA 2O0JA 2GI4A 4E6PA 4R2IA 1W5BA 5ALFA 3WLNA 4EHDA 2ZANA 2MTBA 5K45A 2OBYA 3B51X 4X1IB 1V5EA 5DX1A 2QZPA 4UAUA 3WIOA 4J2TA 2PV0A 4UBOA 3ZCTA 4WN9B 5JJBA 3IQDB 2PR7A 4ALKA 1YKFA 2NPIA 2PA3A 3UVEA 2BY4A 1ZNQO 4XTCS 3JXEA 1WS6A 4X94A 2AGVA 3GVHA 4IXWA 4P5EA 4M1WA 4ZT5A 4BN5A 1YZNA 2FN4A 3T99A 2HY7A 3LKZA 5KKNB 2VIIA 1QORA 4RK4A 4D56A 4Q3AA 1QDLB 1CIPA 1CZHA 1I6WA 1Z4IA 4ONEA 2NSDA 1DIAA 1LPSA 1Y1QA 3QXSA 4CLDA 4OHUA 3QVWA 3K5WA 1XF1A 2HK6A 2Z9BA 4E15A 3UMVA 2FPSA 1O0CA 4C3OB 3ZJTA 4G1UC 3UAGA 5AJZA 1R27A 4PM4A 2X41A 1TAUA 1MX3A 3WKCA 4NH4A 4WESB 2VBIA 5IAOA 4RPIA 5T6BA 1A4UA 1QTQA 4YFYA 5EHQA 3MGKA 1MV5A 2P5YA 3DTVB 2OKCA 5B1SA 2X2FA 1JR6A 1LLCA 2MIIA 2HRQA 5CFLA 3QWAA 2BGLA 3AT1A 2W6OA 1UBLS 4GUDA 4YMLA 3DR3A 4G89A 3IKMB 4XYEA 1U2DA 4ZC1A 3T4XA 5JEDA 2WJIA 3B9QA 3FZQA 3M4XA 2A14A 1ZLXA 2RGGA 1KYQA 1YWGO 3IVRA 1U5AA 1F2TB 1THMA 1ODTC 3O0TA 5FWDA 1XFDA 3ZKAA 1PO7A 1GL9B 1FTNA 1KEUA 5J5AA 4C1BA 4EFMA 2ACEA 4ZCQA 4KXFB 2NTJA 3RYFB 3LXUX 2IOQA 2P9HA 2PVCA 4C9BA 4DMMA 2BMAA 4KAXA 1WCWA 1CYEA 1KYZA 3WG9A 1TTTA 2PUFA 2NQ2C 1JKJB 1PP4A 1X14A 4C0KA 3GH3A 4XFJA 3BQNB 5LZ4A 3ECCA 4EG4A 5TSDA 1KVSA 3RFFA 1SC3A 3TLCA 1ZHOA 1J7JA 4RF2A 4C7BA 1Y9DA 1Q0SA 3QHAA 1B26A 1G1AA 3L05A 4MRRA 4GX2A 4N3GA 1H94A 4L8GA 4QGGA 4YONB 2WI8A 5LLSA 2AYXA 2QLNA 2HPHA 4HAOA 4D5GA 5JQGF 5KQMA 4MV4A 1KYIA 4CKXA 5CB4A 4ESVA 1LF5A 2B7CA 1U1DA 4NQRA 4EL0A 3DEIA 4HEHA 4KJXA 2O3SA 5EJAA 3W8NA 1P4GA 1GGNA 3NS7A 4L95C 4KI7A 1SKAA 2A8YA 1TJNA 2PX4A 5DASA 4B33A 1G2IA 2QV0A 2FMUA 1UZMA 4GSYA 4MV6A 3REOA 4YRAA 4GP9A 5I01A 1QGYA 1QDEA 3K1YA 1WW3A 5HMMA 3IQZA 1DRWA 1QH1B 1P18A 2G09A 3V4FA 2W8BA 4I8IA 3NVAA 2JZOA 2P4SA 4PLCA 2OG2A 3RQIA 3OLZA 3ROFA 2Y93A 5AKZA 3FGNA 4HFJA 4PVCA 5H3LA 5BN3A 4NWIA 2QRUA 2D2FA 1VL8A 1W4AA 4RZIA 3T7JA 4E30A 3ZVKA 4NK4A 5LM3A 3JQ7B 2DKOA 3Q7SA 5KKCA 1DBPA 3UUFA 2G7MC 1O2DA 3HDJA 3I1FA 2FEOA 3BE5A 4BYMA 1E9EA 1L7OA 4LBWA 4OLAA 3BIJA 1KQPA 3BZUA 1ONSA 3NCTA 2F90A 4I08A 2XSZA 4XIFA 2HO5A 4UTVA 3PHIA 3DZHA 4KQHA 3PV0A 4AMZA 1YK1A 4MW1A 5IKEA 5JYCA 5JU6A 1IHPA 1YONA 4EY6A 1QUEA 4EHIA 3LO8A 2BVNA 1V3UA 1OBFO 2YWGA 5D1NA 1JZSA 3U7IA 4DLXA 2IF2A 4OJYA 1WXHA 1QHHB 4M88A 4RXUA 3LDHA 1PZHA 2QJOA 2H06A 1TLLA 1XV5A 3IAS6 3ZDQA 3ZY3A 3M6UA 2YJTD 3L01A 4GMFA 2C2OA 4UMVA 3DEFA 1UJCA 4ZV9A 1OD6A 2Q5HA 2Q62A 4P86A 1X1DA 3VAZA 1EK0A 2VF2A 5EJMA 3WI7A 4REMA 2J6CA 1I33A 1XZBA 2C2GA 2HUNA 1WMAA 2J3MA 2AUNA 4MX8A 4IZIA 3FB1A 4UTXA 5AJTA 1OIXA 3DDSA 4RJTA 4AKGA 4PZDA 3GRKA 3SHQA 2QTCA 2I7DA 2J3EA 1DKLA 2ZWAA 2I62A 1KSGA 2MR6A 4YI5A 4P81A 3ELDA 4PSKA 4NFHA 1LDMA 1KOJA 1LQ2A 3SF8B 3WICA 4DXAA 3E53A 4K81B 1FBNA 1NU6A 5FBRB 5KTKA 1H1TA 3WGKA 5K3CA 3R9IA 2WWIA 3F3KA 3RQSA 4B8WA 4DDMA 4JJ6A 4W4TA 3SZGA 3TLYA 2AZTA 3I8SA 1Z6ZA 4OU4A 1X1BA 3UT5B 4JJ4A 2IQIA 1SH7A 4GXTA 3SYRA 4BP8A 3THXB 4EUNA 4M8IA 3RDPA 4RV5A 1EVEA 1SUSA 2NVWA 3KQWA 4Y3UA 4AUKA 1S89A 4EOGA 4KXQA 2O5CA 4XJXA 3SLRA 1WHSA 5L3VA 3KJNA 1SU4A 4B0OA 5G0WA 2H31A 4J9UE 5REQA 1ZM9A 5T64A 3UUGA 2J3LA 3AGPA 1LNSA 3GMSA 4MQMA 1T5HX 2WY2D 3W2GA 4DM7A 4JUIA 1U0JA 2ZXEA 5E4FA 4LHYA 1TO2E 1I2BA 5BVHB 4X1KB 1CERA 3EWIA 1E5DA 1QB7A 4QUAA 2RHCA 4JBHA 2OHFA 4V0RA 4N82A 4Y7DA 4XGKA 1VDZA 2GN4A 5JFOA 3IIKA 4P31A 3BMNA 1KGDA 5FIUA 5H7XA 3CX4A 2VDNB 5KDOA 3JVVA 3DXZA 4DLUA 5ERYA 4ZT2A 5IH7A 3IB6A 4QSHA 1GFWA 1G8FA 4CMAA 4K26A 3USES 5AVQA 1RI3A 5EE5B 4JGIA 1QF6A 4BLVA 1JQKA 3DLAA 1O95C 1XWIA 4XTRA 4JH0A 1TAQA 5FUWA 5FX2A 3LCUA 3WWYA 4ACBA 5IK2D 1XRSB 1RXWA 2JASA 2XW6A 2GT1A 3AUUA 3I04A 2GN1A 3SDBA 4A27A 2H4WA 3KKEA 4YPFA 4AFNA 3KQLA 2QRMA 4I55F 4BMSA 1KYYA 2JBHA 4Q5IA 1E9CA 2PX3A 3UG6A 3HB5X 2O0MA 4Q3CA 3SX2A 3GFQA 4ZIRA 1EM8A 3DBVO 4KLCA 4URUR 3KOYA 3RLIA 1V1JA 4BNMA 4F2PA 3TIIA 3SQLA 2XZPA 2RHLA 4YCBA 4G8BA 3UK2A 4ECAA 3DFUA 1Z0IA 2Q29A 1KMMA 1GZUA 2DH6A 2CHVA 3EFOB 1ZIXA 5B37A 2HLDD 1JI3A 2AUMA 3BERA 2TMKA 5FUQA 1LC0A 4MV1A 1NJ8A 5M29A 3N5CA 1A96A 4I4TF 3OVMA 4WSOA 3G9ZA 3RO7A 2L0XA 2YHIA 2GBPA 2JHAA 1ZN9A 3P0IA 5D5PA 4EI7A 4OLFA 1LBTA 3O75A 4RMGA 1CNEA 1Q7RA 4C03A 4R5HA 2C3MA 1W2GA 1EXWA 1XTSA 4Q1DA 4RM3A 2HRRA 3UJ8A 2JIRA 4BNYA 4G0QA 4INOA 2WABA 1AT1A 4FJ1A 3G5LA 3U7QA 3DONA 1P91A 4GPBA 1E0SA 1LTQA 2HLPA 3DL0A 1PF7E 4GKBA 4JVMA 4MVCA 2PX8A 4P54A 3U44B 3S1LA 4ZVOA 2PRJA 4PICA 4XM0A 1R37A 3QKTA 1EJ6A 1SUPA 4AJNA 5ITVA 5JVDA 2NMVA 4M21A 4FN5A 2B5VA 4IRMA 4UJ3A 1AGNA 5JNRA 1NU8A 1TMYA 3VR6D 1O6GA 4H3SA 4DT1A 5KYKA 3S5JA 2C4MA 4MDFA 1WTAA 4ZYUA 3MJTA 4G41A 3ZD7A 1X0XA 3E2PA 3HRIA 5AKGA 1A9ZA 2QAJA 2ZBPA 3LHFA 5EP1A 4C2BA 1EFRD 1T5SA 1YRLA 2TS1A 2VRNA 2X0IA 4C0SA 4RFLA 3GP3A 4O59O 4DC1A 2XB2A 1Z2NX 4A8PA 1UFOA 3FMVA 5LZ5A 1KDZA 4K9SA 3CTMA 3V4SA 2VJBA 4MW7A 4TLMB 4DUGA 4Q4CA 3W5UA 4RSGA 1TCCA 3V1LA 4JITA 3JQGA 1NIJA 1ATIA 1ULAA 2RBGA 4BC1A 1M8FA 3M4JA 4XWAA 4JLVA 3GFSA 1JHMA 3LFTA 3K0BA 5DT2A 4XASA 4F6LA 3GJ6A 3W5IA 2JFHA 1WW8A 3QX8A 3WLIA 2GEDA 2P75A 2K5UA 2HWYA 2WP0A 3BMOB 2C42A 2WUGA 3OQNA 4DA4A 1Q3HA 1ZMBA 2X0NA 3G1WA 3GJTA 5C32A 2O2JA 4Y6QA 2GFIA 2R9VA 2J3IA 3GLRA 1HTWA 1QIGA 1ZI6A 2PZJA 2CXQA 1D0VA 2QD4A 3JQPA 3E7FA 3SYLA 2OO5C 4AK9A 2KM1A 4X65B 4B3RB 4P0TA 3H1GA 5DYWA 3ZLTA 2XD9A 4IMIB 4D3YA 4BNWA 3GLVA 4KYUA 4LJLA 1WVIA 4DLKA 4HLUC 1W46A 3WRYA 4JB0A 4CTMA 2P41A 2O0LA 4RMIA 2PX2A 3DAYA 4GR9A 1XPRA 4AQDA 1HYEA 4OB6A 1OVGA 4B80A 2HA6A 2XJ9A 3IMKA 4Y1EA 1OXMA 4UDNA 3Q8KA 2PMBA 2DWOA 1IMOA 3Q4GA 4G4SO 4BAUA 1NJSA 1QHFA 2HC9A 3MINA 3ND7A 9ABPA 3PUKA 1SHLA 1WCV1 2CDAA 3KSUA 4G0OA 4M1OA 5DPMA 1PYDA 3F9IA 3OY7A 3AF0A 5J59A 2V6IA 1C5KA 2H4JA 2Q3EA 3RVSA 4BQNA 4HT3B 5DGDA 2FX5A 4HNHA 1UJ2A 2NU9A 3HS3A 5T3YA 3T7IA 4ZVUA 2NZ2A 1JH9A 3CXRA 3PC4A 4MGZR 3WGGA 2HSZA 4MR8B 4PQGA 5DN9A 2O8CB 1U8YA 1CD5A 3KAKA 1X7DA 4Y1FA 3OFJA 2E1RA 2OBLA 3PYMA 1PLJA 4WDQA 1JDTA 1ULZA 2I33A 4UHFA 3HP7A 3JASA 4KXMA 4MXDA 3WY9A 4B6OA 3H17A 3V2IA 2XH8A 4OYRA 3PCXA 3K94A 3I6QA 4XM2A 3U4AA 821PA 1J2JA 1JDSA 3I2JA 4MQ5A 4XCVA 3MTJA 2JEZA 3GJ7A 1FMJA 1ACJA 1EVKA 1ZH8A 1MUUA 5IF3A 2Z30A 4WKNA 4PLVA 2VDPB 1KK3A 1UBSB 4YAUA 4KE6A 4KPEC 3FWNA 1X80A 2BBOA 2R5FA 5FYDA 4ZVPA 3SHVA 1XRJA 2I6QA 3JYHA 3ZCSA 4LV6A 2BGGA 4YRBA 2CMDA 1KERA 1SIWA 5ALRA 3G5MA 2EWMA 4H1UA 4YRMA 2EHJA 2P30A 2RARA 1WPQA 3SS8A 4BCCA 4HDSB 1BA3A 5HF5A 3RI3A 3P20A 3L82B 4UBNA 5M34A 3BD7A 5K3FA 4BBZA 1QO0A 4L5YA 4FXOA 2CNDA 2FMIA 1RIIA 3JYNA 2YWHA 3NBAA 3CH4B 5C1IA 3ZUGA 5JO9A 3BZWA 3GYBA 1NW6A 1NPTO 4FX2A 3KUXA 1AQUA 4LJ8A 3CB2A 3HA7A 2Q28A 3E81A 1GPKA 4G1MB 4Q3OA 1G20B 2WQ6A 4HEJA 1OWLA 1GTVA 2ZITA 2J7PA 4D4HA 4L9WA 3D2BA 4BMCA 3TWOA 2YS6A 3BA1A 3GGCA 3T5MA 1JSXA 2QMOA 3O9ZA 4F56A 2FMFA 3DXYA 3EIOA 1QMPA 1GDTA 2UVQA 5FEUA 3OZWA 1BYIA 2F9LA 3WISA 4BYGA 3QKSB 1N32B 4RNDB 1RYYA 3C2QA 1ORHA 4FQ8A 4WGGA 3V00A 5GWXA 4J0EA 1WPGA 3EDQA 3CW2A 1UC9A 1TF7A 3OU6A 1P80A 5KVQA 2XCRB 1L8OA 1JUDA 2B8NA 3OZDA 5ECDA 3CVUA 1EX9A 2ESRA 1Q91A 3OIYA 4N6NA 1K68A 4YT5A 2RB4A 1GGMA 3M9LA 3VV3A 3AM5A 4EJ2A 4JX9A 4BFSA 1V41E 4X7PA 4HQLA 5E3JA 3WFJA 1VKJA 4BTEA 1XDWA 4TKZA 1GGEA 1OMOA 4N65A 3PHHA 4FZVA 3TLMA 2BKUA 2EKPA 2JANA 2FZLA 1VP3A 2V4MA 2ZRGA 4IJVA 4LDZA 3NC1C 5A7FA 2AH5A 3AZPA 4DAOA 4OHYA 3FI0A 1J42A 4BNXA 5AVTA 3G5UA 3IOBA 4JBXA 2NNWB 5LYYA 3SZMA 1EVJA 3AXSA 1IB6A 4IIBA 2E4AA 1JHUA 1O5IA 1XTBA 3EZLA 3QEJA 2WT8A 2Z58A 1EP1B 2G17A 2QL6A 4HFMA 3DFIA 4AICA 3OOYA 1IMJA 1WCIA 4F85A 1UXHA 1F7VA 1TKAA 2SHKA 3KFVA 5BOVA 2HHHB 3H9EO 5MN5A 1FW8A 4A5OA 5CCBA 3AVXA 1DC8A 4ZJPA 4EYSA 4G6ZA 1R4MB 2ORED 3U4MA 1E1DA 1MNQA 2QORA 4NULA 2LVBA 3RT1A 4Z0HO 3WXBA 5D6NA 2HIGA 5BW5A 5IXYA 3W5CA 2EAUA 4IMPA 1YQTA 4LXUA 1N6LA 3HKBA 1W581 5GV8A 3HK2A 3EDYA 3D7MA 4QO7A 1S3SA 2WJ4A 1EFPA 2JA1A 3DWIA 3KBOA 3ILYA 2V3WA 3ONDA 1JB9A 2QQ0A 1ZK3A 3ZJYA 4ARBA 2BYTA 1ADYA 1BFUA 1M10A 2AXPA 2YWRA 5FBKA 1KJZA 1KWKA 3AUTA 3KQMA 3Q1KA 1WMEA 1MT3A 5L51A 3FPBA 1I10A 3BXPA 3TKLA 4LOHA 4X20B 4Z6KA 3ETJA 3CE9A 3FBWA 4DJ5X 3KG2A 3O21A 1SOVA 5HFAA 3JRWA 3GLTA 3NDJA 4YRPA 3SPXA 5KTRA 5D3ZA 1I2MA 2IXGA 5HKKD 1GZ6A 1OGIA 2YQ4A 2ZSJA 1VG0B 3ITKA 1YL6A 4LJKA 4YN3A 1NUTA 2IK8A 1E6KA 1A7KA 2GDZA 2B92A 4OXIA 4BVGA 2HJWA 4JOQA 4H18A 1SG9A 1WB5A 2IYNA 121PA 3EX7C 5SY6A 2RK3A 1UJBA 2TMGA 2QX8A 3E9RA 3PGJA 4FYHA 5K0CA 1JEAA 1ABBA 3JPYA 1W19A 2ZTSA 3NLLA 4PYRA 2FFQA 3L46A 2J9ZB 2BFBA 2QM8A 5FFMA 2PBFA 3LLVA 2PGXA 4TXMA 4XSVA 3Q87B 3ROXA 4Z5XA 5AVUA 2MT9A 1MFZA 5ESWA 1C14A 2DOKA 4NMHA 3P2OA 4F3CA 3DE7X 3HCWA 1X1AA 3ISTA 1N2CA 4IGAA 3T3OA 3J80A 1DJOA 1KKUA 1OLUA 3FYDA 3H9UA 3O8QA 4K9OA 2BHRA 4MARA 3L07A 4OQQA 4WXRA 2IDZA 3SQOA 3BWCA 3DMYA 2R8EA 3QFTA 2XRMA 1KI6A 1YR1A 5J1TB 1LRJA 7REQA 1FY2A 3C8MA 2QD1A 2XUDA 3BX1A 4OM7A 4CKEA 1XHLA 3MJEA 4OK3A 3SOPA 2F1JA 3T94A 2VUSA 3SGLA 2PSHA 5H70A 5JYEA 1LY1A 4GNRA 5B3AA 5IC6A 3I1IA 4EKGA 3RSSA 2P6MA 3TL3A 1YD7A 5ALWA 2JJYA 4G0WA 1N7GA 1CY0A 2K7ZA 3FLEA 3FWPA 4OQYA 4P08A 5IT0A 1O97C 3LGAA 4LYGA 4RLQA 3TXAA 2KJQA 4P82A 3ACCA 3SJAA 4BFVA 1T0HB 4N6OA 1OWMA 3LVBA 2SNIE 1W48A 1ZG3A 3R0QA 3ONEA 4JBNA 2NZWA 3VR4A 4ASUA 3WK9A 4UU7A 3T12A 2C7OA 4PAWA 3EOBI 2CCGA 1L9KA 2IXDA 1Q3KA 3RSHA 3ZXSA 3CUUA 4I50B 3CW9A 4HV4A 1TK3A 4C21A 2FP3A 1K8YB 4QOEA 1SHUX 3H8WA 1R5OA 1KZ7B 2OGTA 4FNGA 1RHMA 2GRUA 1J5XA 4GC5A 1IN8A 3GDFA 4KE7A 4XDGA 5HUQA 3IAFA 4X7BA 5JHHB 3K0FB 2P2LA 3T9DA 2QMUA 3SKXA 1FUIA 4E1AA 1NV8A 2HU5A 1P19A 3EMDA 3JX9A 4JL6A 5DXFA 1JR2A 2CXPA 4E46A 3H5NA 1PW7A 1G20E 3GGDA 1UDAA 1ZN2A 3BOSA 1CR1A 1PJ3A 3AY3A 5KDDA 2POQX 4LZOA 3CISA 4UMEA 2HSGA 2YZMA 3ZZMA 4MHTA 2PUTA 3Q5EA 2P8SA 1UQUA 1G21B 5LBTA 1CW2B 3EGWA 1XXHA 3T3PB 2DFKB 3WLKX 1P2VA 1ZPDA 4KTVE 2RGXA 3KXLA 3R3XA 4M7OA 5T5QA 3DAHA 3F1LA 1MV8A 3TLKA 2PWPA 3L0DA 1XC7A 1TD9A 1K2WA 1GPAA 2ZP1A 3F0TA 5HKLA 3UGKA 1W36B 2I7CA 3NX4A 3L4KA 4DIDA 5FBHA 1YZHA 4PHGA 2V65A 4TKMA 4O0LA 5DLEA 4J49A 1PL6A 3ZCQA 3AHCA 2FZ5A 2NOAA 4TXLA 1J33A 4K7JA 5TRTA 3B3JA 2QGNA 1IPEA 5EEHA 2W0SA 2YCLA 3DDUA 4U7FA 4UPDA 5AI5A 5F9MA 4HGZA 3AEQA 1XPUA 3LHIA 1K6XA 4TKUB 3AR3A 2AR0A 1U1GA 3CNEA 4IKEA 4B1FA 5F9HA 1YKSA 3ICWA 1Y82A 3RV3A 3V6MA 2H85A 4CDMA 4E5KA 4W5TA 2ZYIA 1Z37A 2HDNB 2XGMA 3LLCA 1FTYA 3MAAC 1LSOA 1WF3A 3R7NA 4E11A 4UQLA 5IUNC 1RIFA 2E89A 3ZGOA 3G5AA 1A50B 4L5CA 4XDHA 4AJEA 5AIBA 1QLHA 1IY8A 2YJ5A 3PFWO 4BRSA 1A4XA 4C5AA 4N8DA 4WERA 1ML3A 3L4JA 4ZRDA 2R1VB 4IDPA 2Q4DA 4P34A 1RAEA 4I7EA 4KAJA 2HHCA 3O31A 3T95A 1FX0B 2WKQA 4DS3A 3KXIA 3X2SA 2IHNA 2YWXA 1YS6A 3SN6A 3EF3A 3LT2A 4D41A 2V55B 4YWHA 3KZ1E 3LM8A 3MD0A 3PCRB 521PA 1BH2A 4OQFA 4UBMA 2YBEA 2NO0A 5EGSA 3GDOA 4FFPA 2WYIA 4GI7A 1S8AA 1ZOSA 1H8EA 1H66A 4MB6A 4XGQA 4A2CA 4NFLA 2B8JA 1LPNA 2ES4A 4ATNA 1UDWA 5HZMA 2BR4A 3AESB 2XUOA 4XWKA 4FR0A 1RQLA 2RHOA 3JU3A 2IODA 4M1YA 3CNNA 4C20A 4DIOA 5JQGA 4E70A 1QHXA 2JZCA 5HQTA 5JNLA 5JAPA 2I2XB 3NPMA 3SS9X 3A06A 4JP8A 2Z6VA 4P7BA 1LDBA 1KZ1A 4HYYA 3MUFA 3IH5A 3C3WA 4QJ5A 4DUYB 3TXYA 1VYTA 4BX8A 2EKZA 2HKIA 2WSMA 1MEEA 3GGJA 1O0BA 1CR6A 2NO7A 1A0OA 2PKWA 4RKWA 4DUGD 3Q9UA 2C7RA 3ADCA 1RC8A 2EV9A 4NZZA 1V5FA 2CD7A 1DT3A 3H13A 3JQFC 3PENA 4HN4B 3ZWNA 2FOIA 3CCBA 2DUNA 3FLMA 4JHLA 4YCJA 4PN3A 1NVAA 3Q7QA 5EKSA 4HGPA 5K4GA 4HDCA 5DMXA 4R98A 1K7FB 1YBAA 2XR1A 4E22A 3NM6B 2ZJAA 2VLIA 5HIKA 1EWTA 4G0MA 3PUYA 4CN9A 4Y67A 4R40A 3KXKA 2Y0BA 1GRNA 5THQA 1YH3A 2YFYA 1VG8A 3B5JA 4MR9A 2JIPA 3I42A 3JZFA 1F1BA 3QP9A 1DXOA 2ODPA 3LCVB 2W6MA 1GG5A 4WBNB 3NBMA 4YAKA 2PLWA 4ZVVA 2C2MA 5DJ5A 2WTUA 3MELA 1A9QA 2NXWA 3A6PC 2RKBA 4X6XA 4X8OA 2CL7X 4FC6A 1XZLA 5BNFA 1L7DA 1TTHA 2C96A 2OC4A 3VDNB 2YWCA 4HTAA 3S99A 1LI4A 2FZCA 1QK5A 5AKIA 1II8A 3N2LA 4NKRA 1LLQA 3QPWA 1FP1D 1W49A 4IHJB 5AM3A 2Y1KA 4FOSA 4WA7A 2CL5A 1KQFA 4YMHA 3QXJA 2YOGA 3FYUC 5AM4A 4A73A 4F1JA 1AZWA 1E7WA 1Q6ZA 4FQ5A 2X13A 4LY3A 4O4HF 2W6NA 3A9UA 4NE2A 2C4UA 5MFPA 3CMCO 1I4DD 1X13A 4WCFA 2BFAA 2PNFA 2RCYA 3F5DA 3OZGA 3R6LA 4IDQA 4R3WA 4R0MA 5K09A 4IDFA 2CV0A 3B6KA 4EYOA 3PJFA 4XB1A 1X7XA 4N0PA 1ZSNA 2I78A 2QL5A 1ONPA 4MPTA 4Q7QA 5IDWA 3AP3A 2OVBA 4XRRA 3CZ4A 5EMKA 3KZCA 3RT7A 4BBJA 3H7AA 2WTXA 1XQYA 3P0HA 4DTIA 3DO5A 3PCTA 1ENOA 3WJAA 4PR0A 4B6QA 3BM5A 2D7CA 2V97A 4L8LA 3IIIA 3FYUB 5BNTA 1LQTA 3HJRA 2ZRDA 2NXNA 4QOSA 2PSJA 3K9FC 4Z7NB 5CVEA 1WU8A 5CLFA 5AO9A 2R79A 1UKBA 4HXYA 2Q9AA 4UCFA 2I1WA 1Z07A 1JT9A 5JASA 2Q3BA 4HDMB 1T1SA 3K0AB 4IIVA 3WL4A 1C7ZA 2GEJA 1B0ZA 1EDBA 2F1HA 1C4OA 1LV7A 2PVSA 3KVYA 3QE3A 4L0QA 1NQTA 3ZZNA 2ZT7A