2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
4UPDA 4NVRA 5CT8A 4ZRDA 1E3QA 1XZLA 3D4LA 1IZ8A 4Y2QA 2IITA 1N5RA 1WPXA 5HFAA 1TK3A 1ZD5A 3DL7A 3I2FA 2RIPA 2CB9A 3HXKA 3GELA 3PI6A 3ESDA 3F97A 5HF9A 5EHZA 2QR5A 2XLCA 3WKEA 3V1NA 4G8BA 3IIIA 1MU0A 2WFLB 1GGVA 1YCDA 1QE3A 3WIOA 5BV7A 1VE6A 2G4LA 1EX9A 2WIGA 5ALZA 2BGRA 3IBTA 5AI0A 4B84A 1CQZA 3WJ1A 4C01A 4Y2TA 3HLKA 4PQEA 1THTA 3C70A 3W9UA 1EVQA 4H77A 1GPLA 2Z8ZA 2XDWA 2VF2A 4P92A 4H18A 4B0OA 2ACEA 1UFOA 4WY8A 3FVTA 3DOHA 1CUCA 3FCYA 4FDMA 4DMFA 1EK2A 4KAJA 3F98A 5A62A 1ZJ4A 1ODTC 2D0DA 2VJCA 1YAJA 1XFDA 1XZGA 2HRRA 5ALOA 5EFZA 4FLFA 1H22A 2OGZA 1F0PA 4O08A 5FLKA 4N8SA 1DTEA 2BFNA 4FOLA 3M83A 5KWJA 2QUBA 4OYYA 1DQYA 1LPPA 1QTRA 1CUEA 4BATA 4X90A 3GA7A 3QMWA 3FLAA 3KDAA 2ZYIA 5IVDA 1CVLA 3G9ZA 4X85A 1IUNA 5D6OA 5K3AA 2OCKA 2OG1A 2CZQA 1L7RA 1G4HA 4HVTA 3DJYA 1TRHA 4ZV7A 3W05A 4Q1VA 3STWA 3BF7A 2VEOA 5DYYA 4Y2XA 1S8OA 4F5ZA 1JKMA 3PDCA 2WUDA 1YB6A 3BXPA 2ROQA 1EINA 3WL8A 5AK6A 2PKYX 1U65A 5K3FA 3ZWQA 3BIXA 5HK8A 2WIJA 1ODCA 5JD4A 1EH5A 5JATA 1A8QA 1HLGA 3T4UA 4FHZA 1BE0A 4CG3A 2ONCA 4ZWNA 1RWQA 2Y2VA 3OTQA 2QOEA 5I9IA 5ALKA 1IVYA 5HK9A 5AK4A 3TRDA 4WCVA 1QOZA 7YASA 1UWCA 1UK9A 2WILA 2ORYA 2XUAA 2CMFA 4QDUA 3LP5A 4YASA 3HYSA 3O9VA 4BB0A 4ETWA 4J0KA 1HQDA 2RHWA 5BOVA 1DWOA 4W1QA 2OQIA 3KSRA 3BDIA 2B4KA 2QXUA 3OURA 4ZGBA 4ITVA 3H2JA 3I1IA 4J0CA 1DWPA 4GWLA 5CH3A 2PSFA 4EZIA 3IA2A 5JIBA 1XRMA 4G9EA 5CH5A 5AI6A 5JARA 2XUOA 4L72A 3STTA 1Q84A 5JD6A 4AO8A 1ZGCA 5EHXA 2VSQA 3I6ZA 4GECA 3SK0A 3TGLA 4WFIA 4G9GA 2WUGA 4GHWA 4LXHA 2ZYHA 1QIDA 4UUQA 1UKBA 1MN6A 3BDVA 1Y37A 2WIFA 4FFWA 3QH4A 3DLTA 2XUFA 5AKXA 1QZ3A 3AILA 4WJLA 4ZV9A 1LZKA 2ZSHA 4QE3A 2XE4A 2GZSA 1J07A 4EY4A 4A23A 3I2HA 5AH0A 4V2IA 4N5HX 3V48A 2AJLI 3B12A 5ALLA 1W4LA 3EQ9A 1THGA 4LYEA 4OU5A 2WU3A 2XUIA 3PFBA 4C4YA 3A2NA 4OU4A 1XRPA 5H3HA 3RK4A 4XWGA 3KOOA 5JALA 3E4DA 1GPKA 4MQMA 1K4YA 1ISPA 1N1MA 1HBJA 2WHRA 4X92A 3D2AA 1EHYA 3BJMA 2GYUA 4B6GA 1QGED 3PFCA 2DHEA 1H2ZA 4UBMA 4U2DA 5LP1A 2XUJA 2V98A 4MJ3A 3WKCA 3OC0A 4BZWA 2HA7A 4AXBA 3G9XA 1XZBA 4QDOA 3JYHA 3KXPA 1UOQA 3QPCA 1C4XA 5CT6A 3VJLA 4Y2JA 5A71A 4G4IA 5K5EA 1CUIA 4DGQA 2PSEA 4AX4A 1CUDA 3H04A 1CUGA 2UZ0A 2HU8A 3BWXA 1MNAA 4EY6A 5CURA 2EDCA 3S8YA 4P93A 1E8DA 3O4HA 1QFSA 1K5PA 3IUJA 3K2IA 1HPLA 1MX9A 4H7HA 1HDEA 1XRLA 4X97A 1XKLA 4UHCA 1DX4A 1PJAA 2RHTA 5E4TA 2WTMA 3LLCA 3CCBA 3I6MA 5JADA 3H19A 5I7UA 5DJ5A 2BUBA 1JFRA 2AJ8A 4RE6A 2WIKA 3LCRA 1EB9A 3GBSA 5AM5A 2WJ6A 2CUTA 2CBGA 1LPMA 1ACJA 1EXWA 4CCYA 5KBYA 5KWIA 4C4XA 1AGYA 1ZJ5A 2OCIA 5ALXA 1GQSA 1QONA 3F96A 3E3AA 1JJIA 2Q0XA 3HJUA 5YASA 5ALNA 2PBLA 3IUMA 2WU4A 1JJFA 5ALHA 3AIKA 3MGAA 5C81A 3EQ7A 4X7BA 4YPVA 3E0XA 2B61A 5AK5A 3IB3A 1HL7A 3FAKA 5F4ZA 2OPHA 1G42A 1XZCA 2RAUA 3HEAA 3D59A 3IUQA 1XZIA 3IUNA 4LHEA 2WG0A 2DHDA 1VZ3A 5JZSA 1W52X 1LBTA 1GKLA 4HTAA 1CUJA 3GFFA 2C7BA 5AKYA 3OM8A 3JW8A 4EBBA 4FWBA 4FLMA 3TEJA 1A7UA 3G8YA 4M0MA 4C4ZA 3AIMA 4Q3LA 3I1YA 4GEGA 3Q0TA 3D3NA 4ZI5A 4BRSA 4XVCA 4HS9A 2VAVA 4PNZA 1DT3A 3AINA 3W04A 3EIOA 2X76A 1VZ2A 4DNFA 3NGMA 4BAZA 1AMNA 3QMVA 3UUEA 2WFMA 2XQGA 4KACA 2OCGA 2HU7A 2J3DA 3WWEA 1R50A 5DNVA 2Y6UA 1ACLA 2HU5A 3C43A 1ZIXA 2XQIA 3A70A 4WDQA 5SYMA 3IULA 2WG2A 1WPRA 4TGLA 1B41A 4BE9A 1WHTA 1SOMA 4K5QA 1XZFA 2WUEA 5JAOA 4X6UA 4Y2YA 2IIVA 1CR6A 1CUYA 3X3HA 3DYVA 1CQWA 2DSNA 5IKXA 3GZJA 4X00A 2JIDA 4C89A 2VATA 4X93A 1ODSA 4U2CA 1XROA 4C6HA 5C7YA 1EI9A 3VDXA 2OAEA 1H2YA 2HHAA 1JJBA 5AIBA 1U2EA 5DYWA 2XUDA 5LZ4A 2ZVDA 2G5PA 3HI4A 4J0DA 4IQ4A 2Z3ZA 3FYUC 3WIBA 4Q34A 3LIPA 5BWCA 1VXOA 5AKHA 3RARA 1EDDA 2QRUA 4JEIA 1XQXA 5ALEA 3LS2A 1GZ7A 5CW2A 3DDUA 4BC0A 2QXTA 2XMBA 4CCWA 1IUOA 3QPDA 3ZLTA 3WKBA 4B81A 1XKTA 4DLNA 3FCXA 4RE5A 4OCZA 4I4CA 5T4BA 4EUSA 1R1DA 4IH4A 2VT7A 3PF8A 5IH7A 3G0BA 5ALQA 4QWWA 3VVLA 1A8SA 3IDAA 2O2IA 2JGJA 3G7NA 5HF6A 4LXGA 3N2ZB 1CV2A 3RKSA 4G8CA 1H2WA 5EIHA 2J4FA 5LYYA 5EHQA 2QTBA 1LPSA 2JGKA 3H1AA 5AP9A 3ZI7A 1IUPA 2AJCA 4F21A 3Q8WA 4BE4A 1WHSA 3QVMA 2HA4A 3DNMA 2VJAA 3FSGA 1K8QA 2BGNA 5A7HA 5CT4A 1H2XA 2K2QB 4DSAA 2XMGA 4QDTA 1CRLA 4E15A 1O6GA 1ZOIA 4UFNA 4WY5A 4KE8A 4BVLA 5E4YA 2X8BA 3WWPA 1U4NA 4J0JA 1W76A 3R0VA 1NU8A 1YR2A 2OGSA 2DQZA 1WOMA 5EIAA 3FLEA 2QKYA 4EY8A 2FX5A 1R9MA 4GDMA 1UOOA 2BKLA 1YS2X 4S0XA 2XMZA 1ZGBA 5AM2A 1FFEA 5HQ3B 5AKJA 5FP0A 4H7EA 5CXXA 3L1HA 4XJVA 1XRNA 2GBCA 3GUUA 4KEAA 3UUFA 5AKLA 3ILSA 2Z3WA 4Q3OA 1W6RA 4OB8A 1DT5A 2QVBA 5EHNA 3D2BA 4E14A 2HIHA 3DQZA 4PSCA 1ZD3A 3VJMA 3ICVA 2HA3A 4OB6A 3KD2A 5E2IA 5FDFA 1LPAB 1Q0ZA 3HRHA 4OUKX 2WHPB 2B20A 3I2IA 4B0PA 1AC5A 2GBGA 4CG1A 1UK8A 4AO7A 3WQHA 4RPCA 3F67A 2JGIA 3DD5A 1CPYA 5FRDA 2XMSA 1BU8A 5D3KA 1TCCA 3K9BA 1KU0A 1GT6A 4FTWA 3STXA 4E46A 4MXDA 4BTVA 4GLBA 1G5FA 5J3JA 5ALPA 1LZLA 3ANTA 1AQLA 5T4HA 5DWDA 5JYCA 4CG2A 1IZ7A 5IVIA 2WHQA 3CCCA 3GROA 5AI8A 4PO3X 5ALDA 4JYPA 1T4MA 3O9MA 2WTNA 5DNUA 3PE6A 1W1IA 2WHPA 4KE7A 2OGTA 4CI9A 5LKRA 4GBGA 5CT5A 4DSZA 3WJ2A 3WWCA 3C6XA 1CUSA 3C5WP 1UK6A 4J0HA 5K3DA 4BAUA 3H1BA 2BJHA 1MX5A 3PICA 1D07A 2DQYA 4ARAA 2DFPA 5ALGA 4M0EA 1GXSA 1CUVA 2WFLA 3O95A 3FYTA 3D5EA 5ALVA 4QA9A 3M3DA 4CIBA 1AUOA 1TKRA 1TCAA 5LZ9A 5DLPA 4AN1A 3O0DA 3CN9A 3WK5A 4BDTA 5FUMA 2JGEA 4DM7A 4J03A 2JGMA 1ZICA 2O7VA 4IH1A 3M82A 4OD0A 1R4ZA 4Q05A 2HRQA 2ZYSA 1SFRA 1OCEA 3MUOA 1TQHA 5JAPA 1CUXA 4J7AA 5AM4A 3M81A 5FV4A 3B5EA 1XZAA 2OXEA 5FOQA 4FNMA 1B6GA 2AJBA 3WK6A 3G9TA 5DTIA 3WA7A 1WM1A 4K6HA 4PF1A 4UHHA 3V1MA 3K6KA 4MWTA 4N5IX 3WLAA 4AN0A 4WFKA 4W1RA 1XRRA 2JEZA 3I6YA 4NS4A 3S2ZA 3D2CA 2XB6A 4AMZA 3MVEA 3STYA 2WJ3A 3L1IA 3VKFA 2PPLA 1UKCA 2PM8A 1A88A 4U2BA 4AMYA 2FUKA 2BAGA 3VJKA 4AB1A 5HF5A 2D5LA 1QIHA 5ALJA 1FFAA 2GYWA 2V9ZA 1XZJA 1LPOA 1QO9A 1XLUA 4PV7A 3ESCA 5HKBA 1X70A 5HQ3A 2WFZA 4DIUA 4X94A 4UHEA 4H7IA 4P9NA 5AKGA 3DOIA 1EA5A 4U2FA 4OPMA 4EY7A 1N5MA 3OOSA 3H18A 4QLOA 5C8XA 5AJHA 2W22A 3JWEA 5K3FB 3ZLUA 4QLAA 1JMYA 2HM7A 6YASA 2XUKA 4NZZA 2JBWA 1EDBA 4P08A 1JU4A 4UBNA 4L0CA 4KAAA 2XUGA 4G4GA 5JD5A 1F0NA 3VXKA 1E5TA 1H23A 2HA5A 4FKBA 3FBWA 5HF8A 4H7FA 4B83A 4UBIA 1ZD4A 2VQ6A 4B82A 1F6WA 2VJBA 4EA6A 3C45A 2JGFA 1DX6A 3WA6A 1MX1A 1J2EA 4KJXA 4WFJA 4K2AA 4U2EA 5AOAA 5HZGA 3QPAA 3R3VA 5AI5A 5AM0A 3G0GA 3H2GA 1U8EA 3L1JA 2P8SA 2YH2A 4DMHA 4B80A 1MNQA 2QZPA 1VJ5A 2Y2UA 1QTIA 3G0DA 3T52A 2ACKA 5AKEA 1FFCA 3FSGD 3UMJA 2OCLA 1KEZA 5JANA 5ALUA 2XMRA 3WK7A 1TCBA 5ALYA 4LYDA 1QIMA 2PUJA 2PU7A 4XX1A 1UT6A 4ZREA 4RGYA 5AICA 1WB6A 3H2KA 5LLSA 5LIPA 3I2GA 1VOTA 2WSLA 5AM1A 4X6XA 5HFNA 3FWHA 1R3DA 4LXIA 1XZDA 5JZ9A 2I3DA 4QDZA 5ALFA 3H0CA 1BRTA 1P0IA 4C88A 4FNGA 4H7JA 3SX4A 3G9UA 1YA8A 1AX9A 2R8BA 4X3CA 3DKRA 4CFSA 1T2NA 4ARBA 3HSSA 4OYLA 1JMKC 3WL6A 2C0QA 4MEBA 1CUHA 2QUAA 2GBIA 4JH0A 2CEKA 1K63A 3W06A 2OQVA 3KWFA 4C87A 5AM3A 2XUPA 1Y7HA 1LLFA 3R3XA 1QIKA 2XMCA 2PU5A 4E11A 5AHXA 2ZJ6A 1VLQA 4PSUA 5AOCA 1CUBA 3C87A 1E8NA 2CKMA 4HAIA 1SCQA 3AZQA 3C5VA 2WG1A 3ICWA 5ALSA 2EEPA 4DNOA 1WCYA 2FJPA 1M33A 4DNQA 4CIAA 3BE8A 2LIPA 5DTJA 1PV1A 3C6BA 1VE7A 5ALMA 5LZ5A 1RYYA 1GPNA 4X71A 1FJ2A 3WKDA 4A5SA 4X6YA 3F9CA 4YX9A 2J4CA 4EB0A 2XQKA 4BYMA 1SC9A 1BEZA 2ZJ7A 3V1LA 3AIOA 2VJDA 4KAFA 4PSDA 3C6YA 4B85A 4ZXFA 3I2KA 5JASA 3IVMA 2ZSIA 3I28A 1NX9A 2XQFA 2YYSA 3R3UA 4HRYA 3WZMA 4OB7A 2PL5A 1DU4A 4UBJA 3AZPA 5IVHA 4UFOA 1MTZA 1WB5A 2BUAA 4G8DA 2V96A 4LKOA 5I8PA 2CJPA 3R3WA 4BCCA 3NWOA 1EVEA 2QMQA 4FBLA 3TJMA 5AKZA 4FLEA 5DYTA 1O6FA 4IHAA 5CRIA 3HACA 4I19A 4W63A 3A2LA 4UBOA 1Z68A 2HL6A 4BZZA 5D3ZA 1OXMA 2HFJA 3AUKA 3BF8A 2V97A 3ZLVA 1HKHA 1QLWA 2XUQA 3WK8A 1P0MA 3BL8A 3U0VA 2YXPX 4WDRA 2QM0A 3SWWA 1ETHA 2E3JA 1TAHA 1XZEA 1G66A 2H7CA 4L9AA 1QIIA 1UOPA 3HABA 3H2HA 3EBLA 1KU6A 3E1GA 4QWMA 2IX9A 4KE9A 4N8DA 1DQZA 4M0FA 4BVKA 5HKAA 4J3JA 4UHDA 1SCIA 1QIEA 2XQJA 5D7BA 4KR0A 1YSCA 2JGLA 1N8SA 2NW6A 2VT6A 2WQZA 4U2GA 2H1IA 4BRZA 1DWQA 1BN6A 2Y6VA 4H35A 3W9BA 4QNNA 3G02A 1TIBA 1ORVA 3BJRA 3YASA 5K3BA 1XZMA 5A7GA 5KREA 1OILA 4OSEA 3WZLA 2H7XA 4MQLA 2VA9A 2AJDA 3R40A 3DKKA 1MJ5A 1FFDA 2RGUA 2W6CX 2WKWA 4EHBA 5IVKA 1LPNA 2WM2A 1EDEA 4KRXA 4BP8A 4XIIA 4DMKA 4MEAA 5FPPA 5CXUA 4X95A 1MPXA 1XRQA 1AKNA 1YAHA 2HA0A 2VAXA 5K3CA 4BDSA 3WL5A 4BVJA 2WUFA 4RNCA 2HDWA 4Z49A 3G0CA 3P2MA 1CEXA 4UHBA 4PW0A 4Q82A 2Z8XA 1ZI8A 3SC2A 2C4HA 4NMWA 2J3QA 3DCNA 2XMQA 1J06A 5ALWA 3RLIA 1X2BA 1XZHA 1QIGA 2QJWA 1UK7A 1UZAA 2JEYA 5JZBA 2HFKA 1AURA 5JAHA 1CUUA 2Y1KA 1P0QA 4K6KA 3BIWA 2XT0A 2PSJA 4AQDA 2R11A 2YASA 4TPKA 1P0PA 1MO2A 4A16A 5FPQA 4IH9A 3CXUA 1ZI6A 1E8MA 1LPBB 4AZ0A 4HXEB 4F0JA 4Y2RA 3WWOA 3WL7A 3R3YA 2VTVA 2Z5GA 4EY5A 4H7DA 1XLVA 1Q83A 3B3QA 3WMRA 5SYNA 4GW3A 3FYUA 5CTAA 1XQWA 3ED1A 3V9AA 4DTCA 3A2MA 5CBKA 1SCKA 3VISA 1VXRA 3QZUA 2WJ4A 1XZKA 3O4IA 4DNPA 5C8VA 5A7FA 2G5TA 2HA6A 5CMLA 4KE6A 4LIPD 1QFMA 1J1IA 5JAUA 1XQYA 2ZJFA 3QM1A 2GBFA 1UXOA 1CUZA 4MYDA 4JNCA 1PFQA 1UKAA 4BCBA 1C7IA 4UBKA 3OPMA 4W9RA 3RM3A 2FJ0A 2PUHA 3DYIA 4K6GA 5E4JA 5ESRA 1YS1X 2XI4A 3DEAA 3STVA 3NUZA 1GQRA 1A8UA 1CUFA 5AO9A 4UHFA 5FXMA 2O7RA 1LGYA 3PUHA 1FSSA 3QBJA 4KRYA 1AZWA 4B7ZA 2RI6A 2DHCA 3I2JA 1ZD2P 3WI7A 4Y2VA 1QIFA 4HXFB 2H9YA 5EI5A 5ISMA 1ZI9A 4FMPA 3A6ZA 1X2EA 2BUCA 1F8UA 3WKAA 2DCMA 4KYVA 3WWDA 1I6WA 4GXNA 4QZVA 4BP9A 4GI1A 4HXGA 3FYUB 4G5XA 1JT2A 3G0IA 1CUWA 3D7RA 4G1FA 1JI3A 2EDAA 5DNWA 3R3ZA 3ANSA 5BWBA 4QEKA 4BC1A 1YASA 2QS9A 1ORWA 5AKKA 3DS8A 5K3EA 3IURA 4FBMA 5T4EA 4I3FA 1K6EA 3QMMA 3O4JA 2GZRA 5A2GA 1R9NA 2X5XA 4G4JA 1W75A 4Y9SA 2I78A 4FFVA 3WYNA 3R41A 5ALRA 5AKIA 4HZGA 1CUAA 5CH8A 5LZ2A 4BCDA 2WLSA 4W1SA 3NOXA 4H0CA 4X91A 3W2TA 1BS9A 3FNBA 3WK4A 2QJRA 4L3WA 1DINA 2XLBA 4W1PA 4AZ3A 1E66A 2O2GA 3KWJA 2I3ZA 1CLEA 4Y2UA 4Q3KA 2HA2A 1BROA 3PUIA 2I03A 5AI9A 1Y7IA 2AXEA 4ROTA 5ALIA 1RP1A 3C8HA 2ECFA 1BCSA 5FKJA 2WIDA 4JYMA 2C5FA 1QO7A 3QYJA 1XQVA 1LBSA 2ZYRA 4Y2PA 3DL4A 2PSHA 3VVMA 1EK1A 1WB4A 2OAGA 5LZ7A 1BEEA 3D0KA 3N0TA 3WYDA 4N8EA 2O2HA 3STUA 1VKHA 1C7JA 3C8DA 5AIAA 1USWA 3AZOA 3U1TA 4H7KA 3AJAA 4UFPA 4Y7DA 4Y2SA 1CFJA 1LNSA 2PVSA 5LKAA 2HADA 2ES4A 1BCRA 4DMCA 2C5GA 2OLEA 2PSDA 5T4FA 3O4GA 3MUNA 1IMJA 5AK3A 1YB7A 3HC7A 4DYHA 4QDXA 4UBLA 3ESAA 1CIJA 2XMDA 4IO0A 4J0IA 1QIJA 3ESBA 1GKKA 2C58A 5EIEA 2XUHA 4B9EA 2BCEA 3AFIA 1XLWA 5C8ZA 5LZ8A 3CN7A 4TVKA 3OG9A 4MWSA 5A6VA 2C0PA 3PF9A 3H2IA 3ZV7A 1JU3A 3EQ8A 1MAHA 5ALTA 2QT9A 4CCYB 1MT3A 4AO6A 1VA5A 1YA4A 3QITA 3FLBA 1E89A 1BN7A 1EB8A 3WK9A 1ZIYA 2GYVA 2PX6A 4BTLA 1L7AA 3LIIA 1Q0RA 3V1KA 4F60A 4MYSA 1L7QA 1NU6A 3FVRA 2B9VA 1FFBA 4HRXA 4BAGA 5HCUA 4YK7A 3EF3A 4D9JA 2DR0A 3FOBA 4B9AA 5EGNA 5CT9A 4JUIA 2G63A 2H7YA 3F8SA 4J0GA 5AI4A 3HZOA 5AOBA 2JF0A 4BBZA 3ZPXA 3H17A 1QJ4A 2RONA 1R88A 3C6ZA 1MAAA 1VA4A 4INZA
chains in the Genus database with same CATH superfamily
721PA 1SXJC 3ASUA 2YYYA 1O95A 2EJUA 3GCDA 3JWHA 4ZRDA 3A31A 3LQ1A 1E3QA 5IUKC 5TEWA 4B4OA 3DKIA 3JZDA 4AJIA 5FUBA 4FFOA 4ALIA 4A8TA 4JDPA 2IITA 1NT4A 1IN5A 1L7NA 1FDRA 2ADMA 2WIAA 3NTQA 3TZBA 4BO8A 1WPXA 4ERNA 5FYDA 5HFAA 4DDWA 3UWKA 3OO0A 3PWKA 3ESQA 4BFSA 2BTQB 4IIEA 1RKVA 1Y3AA 2BFEB 4MVYA 1Z6QA 4JT8A 3RS2A 2GM9A 4NWIA 4YYEA 3H4VA 3CLTC 4WKBA 3S81A 2A9VA 4OH7A 3WKEA 1IEQA 4YUVA 4DN6A 5CDFE 1H69A 2EKQA 5DOZA 3KB2A 2XVZA 3UHAA 4G8BA 5L4NA 5CIYA 1XMJA 2WFLB 2MYPA 3RK0A 1NVTA 2CXSA 1L5LA 1D4AA 4R3UC 5ERXA 4WZZA 2E18A 2PGDA 1ADGA 1A9XB 1LW6E 2RHOA 1XZPA 4G4SP 5GGXA 3WIOA 1TX4B 1P61B 3Q15C 2G4LA 1EX9A 1YE3A 1FJHA 2ATEA 5ALZA 2C54A 4OK5A 4JJ8A 1LWNA 2XTMA 4J2HA 5BMVA 3R6LA 1QP7A 5AI0A 2JGDA 3N2IA 3LDUA 1R6AA 3SZLA 3AFHA 3LXUX 3PEVA 3U7JA 1A95A 3NO4A 3KVNA 5C4GB 1IK6A 4Y2TA 3SIRA 3C1TA 1EWRA 4RD1A 2WJVA 4PLGA 5DGHA 3V2GA 4NZPA 1GZ3A 4JITA 1GPLA 4W6QA 1X38A 2EFJA 1A2QA 2FFJA 4OP3A 2OV2A 2C92A 2B35A 3EZ7A 3E2IA 5K05A 1E1KA 3IIJA 3HPRA 3D7KA 3U4IA 3BCRA 1ANKA 1RJFA 2CZGA 2NSYA 5EJ2A 2DXIA 3DNPA 3CZ5A 4EO9A 4OIFA 2E9SA 4P92A 2LKCA 1UZMA 3QU7A 4QO7A 1OFUX 3SI7A 5HA5A 3D81A 1B0PA 1OAKA 1UFOA 5GQSA 1XIVA 5JCOC 3UT0A 3QLJA 4QSHA 3FVTA 2X2PA 2VPTA 3HU3A 3BXGA 1NUAA 3DOHA 2NYRA 3KEOA 1Y8RB 3H4IA 2RH4A 4NYJQ 1GDTA 1BHQ1 4DMFA 4IUDS 2H2FA 4A8HA 1C0KA 1ND5A 4K8OA 4DQUA 2PJUA 4ZHQB 4Z4HA 2Y4NA 2BT4A 2VJCA 1K4MA 1YAJA 2W9XA 3KT6A 4BBAA 4ZMSA 1YCGA 4MVJG 5LYJF 3OZSA 4G07A 2X7XA 1CHDA 2AMFA 5DLEA 3A26A 1U8UA 5EFZA 3PC4A 3AVVA 2OGZA 2GJ9A 3A7DA 5FOXA 1M2KA 3W1EA 4YRCA 5BN5B 1CHNA 2I4MA 4MGIR 4PHFA 1F0PA 4O08A 1EGMB 3P94A 2D5BA 3NS7A 1VFNA 3PXEA 2BJWA 4B4DA 1GRCA 1KBQA 4N8SA 1TM2A 4YCAA 1T3SA 2BFNA 2CNDA 4GYYA 5K20A 3WWZA 3KEGA 1M2VB 4UHKA 3WC4A 4DG5A 1GTSA 4X5OA 1YRBA 5P8WA 1SVSA 4L0DA 3K4HA 2G1UA 3PK0A 1QOQB 2NZ8A 1L5YA 4U8HA 3C8ZA 1JTFA 1U0GA 1WZEA 3D7MA 4GXRA 4G0XA 4EHKA 1FTWA 3KLNA 1N7GA 4HB3A 2I67A 5K2MA 3DKPA 1FFWA 4K0KB 1V39A 3O73A 4MCIA 1DOAA 4Y98A 3AETA 3E5NA 4PE5B 4NAVA 4M0LA 2NYUA 1PKXA 2DUJA 2HXGA 1UJCA 2NSJA 5EJGA 1CLUA 1V2GA 3MTGA 5CVEA 1AIPA 3ONEA 3NIGB 1BHSA 5AHWA 4Z9FA 1SBHA 3HCOA 2CZQA 3W3AH 1F3LA 3EAQA 4YRTA 1QPBA 3ROZA 1L7RA 3WGGA 4Z54A 2C82A 3HA5A 1JHQA 3SX0A 1NSYA 1SKYB 2A5LA 3F3KA 4HC4A 5MF6A 1CQPA 4CEIA 2EX4A 2CFRA 4ZT4A 4YR7A 1Q0SA 2P1ZA 3DPSA 3SBXA 3W6OA 1NMXA 2GPSA 4OF4A 3BFPA 2FRDA 5DBHX 2Q0QA 3RIHA 4RY9A 4Q0MA 4E2ZA 2AS0A 5ALIA 1P44A 4NH4A 4ZV7A 1N7HA 1CR2A 3BAFA 2NT3A 1TKCA 5L7WA 1E5VA 3VTZA 3K6JA 1K7CA 2Y67A 2YRWA 4S1OA 2LTAA 3ZS9A 1LTHR 2E4ZA 1KSJA 1QG0A 4FK8A 3K35A 4JAVC 4TV8F 4DV4B 1X1EA 3M9XA 1GOTA 1WDWB 4LI3X 1W85B 1DPFA 3SCZA 3U3OA 1E2JA 2BEUB 2V55B 4F5ZA 3BK1A 3O47A 3PDCA 1Z4MA 1OV6A 3EZ2A 3JQ7B 3NTRA 4G85A 2X77A 1RCTE 3QVSA 4GUAA 4IIXA 5G0TA 3WDSA 3X1JA 3WL8A 4MUEA 1E4EB 4RD3A 5B2ZA 5FAXA 2JVKA 3GJRA 4LKRA 1DIHA 2Z6VA 4B3XA 5KYXA 2F9LA 5HK8A 2WIJA 3E18A 4X6LA 3DMTC 4W8HA 1ODCA 4TLMB 3TBKA 2R0QC 4RSRA 1JQ3A 3OVMA 4XVCA 3LKVA 2FVXA 4OHWA 4LOLA 4LQ4A 1HLGA 1JQDA 2OHJA 4FMCF 2QZSA 1WSBA 5EXPA 5HTKA 1P2UA 3ACBA 4X8LA 4BFTA 3QVVA 3T1NA 1QVAA 2ZDQA 2UYQA 4JT9A 2XYPA 3T38A 1SPXA 3TB6A 1ZXBA 2J9YB 4AZVA 4CG3A 1M9NA 4PC3A 5BN1A 4ZWNA 3ZW7A 5D5PA 1PJRA 3INGA 3NUGA 3ABZA 3N5KA 1DZ3A 4YLEA 1TADA 1QGDA 4FUQA 4NFSA 5EWMB 3SKVA 4A8JA 1PVOA 1IVYA 1JDTA 2G40A 3PHGA 4L6CA 2XNKA 4C6TB 3D5TA 4D9IA 4CEIB 4IIJA 4KLAA 2NU7A 3AUYA 4XJXA 2FNAA 5FBRB 2WHYA 3EFHA 1QOZA 1Z29A 1SG0A 3GT4A 7YASA 1LDYA 1S2LA 1JIIA 2IT1A 2IZ5A 2H2HA 2HXSA 3AKDA 3EH1A 3IOCA 3KR0A 4I1RA 2LW7A 4LX8A 3PEYA 2DE0X 2EJCA 4I5FA 2E4WA 1HZJA 2C8LA 3BULA 4I99A 2PUEA 4MZDA 2EYUA 2W8BA 2V6IA 1P4JA 1Z73A 3EY4A 3HYSA 3GDOA 3TMKA 1N75A 2JL1A 3G0OA 2ZDGA 4BB0A 3TR5A 2V5VA 5C1DA 3RU7A 4W5NA 3PNPA 4ETWA 4R8RA 3MTJA 1GFSA 2E48A 3AU8A 4I1VA 1ZRNA 4DCCA 5T5QA 3KKEA 4C0AC 4HX5A 4E6EA 2OQIA 3QU5A 4NCNA 1WF6A 3V1YA 3HO6A 1M1UA 2Z2XA 4ZC8A 4YXWD 1GA6A 4YLGA 4GP9A 4II2A 3GRRA 4BO9A 4JYZA 2O57A 1TOAA 2QXUA 1KO4A 2NGRA 1LJ8A 2E2WA 3K3PA 1K8YB 4OOFA 4G5FA 5EIBD 4ZGBA 2P0EA 2HBQA 3D7NA 5A02A 4GOJA 3VNBA 2L2QA 3ZY4A 5F9MA 2Q2OA 4MV4A 4CKEB 2KM1A 3SHOA 4RGQA 3DB2A 1XCLA 3HJTA 4YMTA 5IF9A 5K6AA 3QIAA 1FDTA 3E15A 3DUFA 4W5OA 1U2QA 3EEIA 1C7RA 1RJ9A 1U7XA 4QJIA 2HMVA 1F2VA 1XEAA 2VH2A 4P8RA 4RZ3A 4ZDJA 2YV3A 4Y0VA 3IBFA 5BV1A 5D01A 2FW0A 3KJGA 1YXMA 2OQRA 1IAVA 3GH3A 4EZIA 3PC7A 4U7GA 5JQWA 3SVLA 3U16A 5JIBA 5ALEA 4RXTA 1K2WA 1NAIA 1NSFA 4G9EA 5AI6A 1NF8A 2GN9A 4OQEA 5JARA 4RELA 3ZDQA 1R4AA 2LIVA 3RJMA 4ND3A 3RVDA 3C3WA 1KZ9A 2Z5FA 4L8LA 1Y9EA 2I99A 2H63A 1XZNA 3NUQA 4AO8A 2NUTB 5F5NA 4I4TA 1ZGCA 3QX8A 2W6JA 4TTJA 2YBDA 2VSQA 5KSPA 3N76A 1T34A 3DBVO 3I6ZA 4G41A 4GECA 5CVJA 3PHLA 4WFIA 4B1FA 3TGLA 2EBWA 2BGMA 3LV8A 2ZYHA 1Z4KA 3O2SB 5I8ZA 2OR3A 2A7QA 1JAXA 2JJMA 5EJMA 4LYAA 3BDVA 3MRXA 4KSCA 4B40A 4JB0A 4PZUA 4FFWA 5MGBA 5K45A 4B31A 2CK3D 3LTNC 2UZ4A 2XUFA 3UA4A 1R6TA 2AG5A 2ZIZA 4TLDA 4QATA 4PYJA 1L5FA 3GQBA 4XVHA 1QCZA 4ZV9A 4YRSA 1GQQA 1LZKA 3D02A 1W9HA 2FQQA 4GMFA 3R7SA 4QE3A 1FTGA 1RQRA 2XE4A 1NOIA 3FUCA 5G4KB 5A0FA 4LXTA 4UZSA 4CZ2A 1J07A 1SD5A 2H57A 3DKVA 4X44A 1L7BA 4C6TA 3GB9A 3I2HA 3QFRA 4F04A 3KL2A 1FLDA 4ND7A 3OT1B 1L5KA 1I4EB 5K6TA 4N5HX 3V48A 5LP6B 1KY3A 1WOYA 2GSWA 5ALLA 3DVRX 3WLNA 4Y1RB 3THXB 4OU5A 3D1JA 1CDDA 4Z7QB 5CCBA 2W6IA 4BV9A 3RQIA 2C5AA 2BFBA 5T8KC 3L02A 4C4YA 1T29A 2QBYA 4OJYA 3WGHA 3IMCA 1GNTA 2WM8A 2XA2A 5LDGA 1Z7EA 3TE7A 2E87A 1Z2OX 2B1IA 2YN0A 1KJ9A 2O0LA 2B2CA 5H3HA 3RC1A 4Y8VA 3NR2A 3X2EA 2VHYA 3OQPA 3KOOA 3CZCA 5A4FS 1A9TA 4N54A 2WTEA 1BW9A 4KDRA 1VLMA 4LOHA 1WCIA 2NV6A 3D6VA 2D4HA 1VBFA 3RB8A 5JALA 1RQLA 3CMCO 5D3QA 2NO5A 2O1EA 1ESNA 1VKJA 2Q5CA 3K1AA 3AC0A 1HBJA 2I66A 2WHRA 3D4NA 3HPQA 3D2AA 3LCUA 3A4NA 4X92A 3C48A 3TZ6A 4J16C 2JFYA 2PFSA 3HBAA 1CS0B 2ZSAA 4CUJA 1IBMB 2DHEA 2MYTA 4ZT3A 1Z56C 5LQKA 1CDEA 4ZCRA 3WKCA 3NJ4A 4BZWA 4AXBA 3GA0A 1PUJA 5B4UA 3G9XA 4HQFA 1L5NA 2A33A 2QTWB 1IB0A 3JYHA 4KG7A 1LRJA 1THZA 4FKMA 1C4XA 4GM0A 1XWWA 2CXTA 2EFEB 4PSKA 3UGJA 2P6RA 1K6MA 3C1AA 3PIRA 3VJLA 3ZH2A 5DH9A 4KBYA 1I4LD 3GRYA 4PZZA 5K5EA 4Q3DA 5DGTA 5T57A 3BOSA 5CD1A 5B6PA 5B12A 5TRTA 1U1FA 3UFXB 2ZULA 3K0BA 5AW6A 4WLUA 3T9EA 3FNQA 3E8MA 1N9ZA 2PX0A 5TPWB 4DZTA 4KU4A 2H4JA 3OCXA 3VFDA 1MNAA 2WMDA 2PNFA 2C2KA 3K1JA 2ZB4A 5CURA 2DBYA 1BVHA 2IUEA 3O2NA 3PZRA 5UKDA 4Q19A 4JOBA 4E2XA 2F3QA 1NX6A 2P30A 4IMRA 1K6XA 1XNQB 5JFGA 3U09A 4R1TA 2R7KA 2ZOSA 4TV9F 2TMGA 2XW6A 3SS9X 2YJ5A 1SA0B 8AT1A 3MJEA 1QFSA 1DBVO 3F3SA 3W9YA 3OM0A 3RSSA 2O23A 2PV7A 2ZSEA 3G1UA 5DIZA 4RVFA 3K2IA 2QM3A 2XXBA 1N2SA 3GFBA 1YR7A 3DZBA 2AUNA 1HDEA 1G0NA 2XTNA 4RX1A 1IZ9A 1XKLA 2GPAA 5DLDA 3ZBTA 3RADC 1DX4A 1WCIB 1PJAA 3X2FA 3O8BA 2WTMA 3ZIUA 1T3ZA 1TK9A 2CYCA 2PZJA 4P3NA 3VHXA 3A6JA 1F5SA 5DWQA 2ZI3A 4KIFA 2HMUA 2FEAA 5FOTA 1PZMA 2AJ8A 4P80A 2E21A 1JQEA 2WIKA 4ID9A 3W5CA 3LCRA 1EB9A 1GO2A 1P5HA 2ADFA 1TL7C 4JI3B 4DREA 4F2GA 1QC5B 4PICA 1GYPA 5DBFA 3QWIA 2P3QA 1EBBA 3Q3GE 3REQA 3THYA 3SGLA 2MIIA 1V16B 1OZGA 4LFBB 3W3AA 3UENA 3P9RA 5A4IS 3SS7X 1J4AA 2RJNA 1ACJA 1UBCA 4DNFA 2J5QA 3UHJA 3WB2A 3ZGZA 2ZROA 3OBIA 2ANBA 2V45A 1FDOA 3EZLA 1AGYA 2VK4A 3LCJA 3RV4A 4C4XA 2FJUA 2QX4A 5CYPA 4WMLA 1QONA 3KZOA 4KXLA 2CMHA 5DULA 5CB0A 3F96A 1QRSA 1P45A 3UK6A 4Q21A 3ISTA 1CZLA 4IIJF 1NXSA 2PKRA 2QP4A 2VJNA 3TNJA 4DSOA 2VJMA 4EGAA 1Z2CA 2CBZA 2QLJA 4IINA 3V33A 2I7DA 2QL6A 2AQ8A 3EJWA 3HJUA 1ODFA 2WD7B 3IO3A 1QHXA 3NAZA 1UDAA 3IBCA 3P2OA 4WVLA 3IDQA 6CHYA 3EZ9A 1ZH0A 3P96A 5CB4B 3IUMA 2X0EA 4DCNA 5L51A 2YFYA 3CWCA 5LOVF 4RACA 1T2FA 1ZLYA 3EVBA 5ALHA 4ZAGA 2RH9B 3RRNA 1JL3A 3FIUA 3MGAA 2Q9BA 5B6JA 2CFSA 2ZYVX 4ND2A 3R6DA 4X7BA 5C81A 1UBEA 3GGOA 3RQSA 5DWVA 4E03A 1RM3A 2E49A 5AK5A 2N3ZA 2J09A 1IOVA 3IB3A 1G1MA 3RVSA 2DWPA 4HDNA 3B8HA 3FF4A 4GAEA 3UW1A 1TD9A 4MB0A 2OPHA 1G42A 2IXFA 4FMBB 3W34A 1KI8A 5GTDA 2RAUA 2APJA 2ORWA 5SZJA 4CLDA 3OIYA 3UAZA 3IUQA 1ZFNA 5BP7A 1IATA 1WIWA 4IQGA 1JU9A 2J45A 1SQFA 1VZ3A 4BEVA 7REQA 2CLHB 1GTVA 2IEBA 4IRUB 5EZYA 1GKLA 2RI0A 1E2PA 2ZYAA 3B7WA 4NOJA 1Q21A 1OF1A 4L02A 2C7BA 4PR0A 4M0DA 5B4VA 3OM8A 4NZOA 4KH0A 3CF4A 2D3WA 5IN4A 4DLYA 4XVQA 2WYUA 5TXGA 2AG1A 2LP4Y 2IF0A 2BI8A 1H2HA 1KETA 4FWBA 5FPHA 2HR1A 1NXVA 2VDLB 4ZQEA 1XX6A 3GAAA 2JA1A 4PC7A 5DHFA 5SY6A 3TEJA 1LSOA 3VYRB 1IFXA 5HTOA 1EFDN 1HTTA 1JYSA 2PLNA 3QVUA 3FKQA 3ISJA 2Z2JA 2WPNA 1OWLA 2XNJA 1BMTA 3B6IA 4YJFA 4XW2A 1YS4A 3IPXA 4ZI5A 4BRSA 1QMGA 3JARB 3K9QO 1A7JA 2QRVB 2WU0A 1DT3A 1VKRA 2XDAA 5LD2B 4UXHA 4B45A 1QKKA 4KR9A 2I3BA 5HYVA 5CB4A 2ODAA 3UB2A 3ZJUA 1SUAA 3WNZA 2KX7A 3EH2A 2AFIB 3W04A 4MW5A 4WJKB 3DTVA 3OAAA 2X76A 2XB8A 1QFYA 1G18A 3SLGA 5M2QA 1NRJB 1T6XA 3B6EA 3CNNA 1G6Q1 3QMVA 3ZE0B 1I0LA 4LJ6A 5AUOB 3UUEA 3T5PA 2W70A 3AESA 2FN8A 2P3SA 1J5XA 1KA9H 2NVOA 2RC5A 4UM8B 1R50A 3T5GA 2RARA 1HDRA 5KVVA 3VYVA 1U3TA 1ACLA 1M83A 2PYIA 1WMAA 2ZBEA 4IDCA 4MUMA 4OKNA 2HU5A 1G17A 1PTJA 3FZGA 1LK0A 4W8OA 4BLUA 1UC9A 3GWGA 1M2OB 3H6KA 3JQFA 4L4SA 5ADWA 4HLCA 1J0EA 1ZIXA 3BMQB 3IULA 3QOYA 4PCVA 4UE3S 4DEYA 1WPRA 3DBRB 1ZIPA 4AG5A 4URZR 4TGLA 2QSJA 4Q24A 2BKXA 4MA5A 1WHTA 4IOMA 3VZRA 3IJEB 5JAOA 2WUEA 1H1LA 4NONA 4X6UA 5G1OA 4P98A 1VPVA 2R84A 1E2EA 1KARA 1NASA 2UVQA 5A4JA 4EW6A 4F84A 4Y2YA 3ZKWA 1XTBA 2ZTUA 3EOZA 1L2TA 3LUCA 4FGUA 1QYCA 4N5NA 4DMLA 5IEBA 4ROSA 4UTXA 4C30A 4I4NA 1CQWA 1D2GA 3EDOA 3G0HA 4P2BA 1EUDB 2C1ZA 2LR0A 4FOPA 2QSYA 4DAOA 4HFMA 3LOQA 3A11A 3B20A 1F8XA 3GZJA 2FDCA 4ND5A 1OW3B 3R6WA 1QH1A 4EWLA 1JGTA 2W2VA 1KZ7B 1WQ4A 4X20B 4EUNA 1EKXA 1NYQA 4C6HA 1KVUA 1MEOA 2Y1WA 4WZAE 2Y76A 2V5UA 4S0ZA 1IIRA 5I7RA 3ACCA 4UTRA 1M0WA 3QQ5A 4ZQIA 3K53A 4QUGA 1UM8A 4P4SB 4ZANA 1Q2UA 1I3KA 3LBYA 1L4LA 1T8PA 1H2YA 2M6SA 1DPGA 3CSDA 5EXXA 1JJBA 3I01M 1HYHA 1ZGHA 1U2EA 3FOAA 3QYAA 2J8ZA 5AJTA 5FPTA 5DYWA 1ZSYA 3NCHA 1JZQA 4UM9D 4LCBA 1YR8A 4JBNA 1U6JA 2FTKE 2G5PA 1DKMA 2Q5HA 1U0EA 2Z56A 3B1FA 4Z7OB 2E5LB 3B52X 1QDUA 3CZPA 2GO1A 4J0DA 5BMVF 3OLVA 4Q93A 2UYYA 4HYYA 2FVYA 3X1DA 3U7QA 3KQPA 2V1UA 1T13A 2MINA 3LIPA 4UOZA 1AKWA 1XMSA 4DSNA 5C80A 5C5CA 5JYDA 3QWAA 3RARA 1EDDA 5LQDA 4JEIA 2B25A 3EGXA 2R4TA 3NIWA 3OMLA 1XQXA 5C1BA 4A15A 1FP4B 1T4DA 3VNQA 2Y1GA 1LY1A 2HSEA 3J81k 4HFRA 4URXR 3AL3A 4FOSA 1QRDA 1NQAO 1WXGA 1N8NA 3MRTA 3D6MA 3G2QA 2IVFA 4TKVA 1DCMA 2Q9AA 4Q03A 2WVJA 1GZ7A 3VC7A 4BGIA 3R44A 4YIHA 1YJ5A 4NHOA 2OYCA 3U17A 1W29A 4C4AA 1KYXA 3PJGA 1O7JA 1Z08A 4V3CA 2PQ0A 1SR8A 1O57A 3VBCA 3PSAA 4ZRNA 5JROA 1A82A 3MINA 3ZLTA 1RRVA 4D0SA 3A04A 4MI1A 2FGKA 2I7VA 3O8OA 4U5XA 3T15A 2LPMA 1I5RA 3O1LA 4RULA 3W5BA 1FMLA 2F3PA 4XDGA 4DFDA 3R7WB 2JKYA 1N92A 4DLNA 4JMLA 1BJTA 2WJIA 3CX7A 4OCZA 4G67A 5T4BA 1D1SA 1TFUA 2J9RA 2FPIA 4PXAA 3WSTA 5I3CA 5DNEA 3PF8A 1LRLA 2H08A 4AD8A 4L08A 3KT3A 1IDN1 5HVNA 1PQ4A 1SGWA 5ALQA 1Z26A 4QWWA 1JECA 2IEGA 1AO0A 2HDOA 3NVAA 4WIAA 4DRZA 1A8SA 3I9V6 4O5OA 2JGJA 1II9A 4JJAA 1KDPA 2W00A 5HF6A 4LXGA 1A7KA 1WMEA 2PANA 2XZPA 1FQOA 3TNLA 1F2DA 1TQDA 3CUKA 3JCZA 4LYJA 5JTUA 1TXGA 2J67A 5E95A 1H2WA 2J4FA 4I81A 3TQHA 3NPAA 3K09C 1S4MA 3QFFA 1P8AA 1CRQA 3L7KA 3H1AA 4Q00A 4PYMA 2ZS7A 3DBHA 4EB0A 4BE4A 1G7RA 1EGAA 2G71A 3A3YA 1NNUA 3GLVA 3LYUA 3QVMA 5K0FA 3HKDB 4FR0A 3G7SA 3GAMA 4M9XA 4OGLA 4OKIA 1R8JA 4PRZA 5HSGA 1K8QA 4PLPA 4C76A 1PK8A 2BGNA 2PUVA 5GP1A 5CT4A 2H8GA 3PA6A 3PKZA 1R0RE 1P4RA 1Z0SA 4IV5A 3MFQA 1A77A 4LDAA 1FYVA 2DBQA 2RH8A 4R05A 4DSAA 1E3MA 2IU4A 2HPHA 3MBIA 2XMGA 5CDUA 1KO1A 1PNTA 5BNTA 4KE8A 2C2YA 3EVZA 3AJ8A 3WWPA 4GX5A 3IP5A 3AG6A 2E7ZA 2YZNA 3BXXA 3FHCB 4JFRA 4O4HF 3WMXA 1ZXXA 1F6BA 1LV8A 3HUUA 1H66A 3Q3CA 1BE6A 4UU8A 4GP6A 1Z47A 4L9SA 2J5XA 1E5QA 1M66A 1NY5A 1Q14A 1YR2A 3FZEA 3GZNA 4BQIA 3CZ9A 2Q6LA 4WOCA 4ZVNA 4TXHA 2VSNA 4UHJA 5EIAA 2ZRDA 4F6LA 1UFVA 3AQ4A 1BXGA 3RTBA 3FXAA 1J90A 1L5QA 3EGDB 1A9ZA 2QPTA 3IUPA 4MHSA 5MN5A 1SU7A 1KY4A 4I36A 3TSZA 3UPTA 2YWFA 1IDOA 4XOUA 2IC5A 4GDMA 5DASA 3S70A 4E1AA 3S1AB 1GNQA 1QB7A 3I45A 2BKLA 4AT1A 3LT5A 5IKMA 1NNI1 2KS6A 2B7LA 4ZQBA 3SHFA 3DMTA 1O94C 2GKGA 4XAQA 3KEQA 1K0UA 2QQ5A 2DLCX 4BNKA 4ZHQA 1GU1A 1XCOA 1ZGBA 1QYRA 3NDJA 3ZHOA 4YIKA 5I48A 1UBLS 4K28A 1DRVA 1KJQA 3W8RA 1O96B 3DO8A 4D74A 1F2UB 3G17A 4LVUA 5HQ3B 3OCYA 1E0DA 3TTUA 2ODWA 3KC2A 1QMPA 4IVQA 4RVUA 4W8GA 1PR4A 2GTPA 5DX0A 1X8XA 1ZZGA 3I30X 3L1HA 5CA1B 5ES4B 5ESWA 1CULC 5BV0A 3GUUA 3A32A 2O2CA 1SG9A 3GJ5A 3FJOA 5EJ8A 2UZ3A 3GPIA 2ERCA 3G68A 4BNMA 1KJ8A 4FEYA 4ER0A 3GD5A 2WPDD 2CFTA 1GRNA 5AKLA 2I2XB 5IANA 1KZYC 4BP1A 1DTWB 1K6JA 1GG8A 4WCDA 2GZAA 3B48A 1BS2A 5E7MA 1I7SB 1LS1A 2J9FA 3PUZA 4MVWA 4A2QA 3ZE1B 1T4GA 2IZ1A 2Q3DA 4O59O 5GJVC 1HDCA 4G36A 3DR3A 3L6RA 4HPJB 1AV7A 1UT5A 2AVNA 1TJ3A 2H9AA 3FYHA 4Q3OA 1JNXX 2XHEA 3RO7A 1Z82A 2FFQA 3IT0A 3QKUA 4FYHA 1HV8A 1A7AA 2HJHA 4HDKB 3EBOA 4PANA 2Q7DA 5ICMA 4OL0A 4DLTA 1KP9A 1VI2A 4KR2A 2H4HA 2PT9A 3T5TA 2WHXA 1VSBA 3D2BA 3K7EA 4U39A 2W4MA 1I3OA 4CMCA 3GAZA 5EWLA 4KBGA 3ONVA 1ZD3A 1AQ6A 2ZPAA 3NONA 3PE3A 4DLSA 1CE8B 2K6GA 1A4UA 1UBJS 4M9SA 3TD6A 1G7CA 1LPAB 1IVSA 3RAJA 4B6RA 3DDOA 4EEKA 4RA9B 3IQHX 2RJ3A 4K9MA 3BSYA 2DZDA 1G9XA 1AM4D 1C4OA 4Z8YA 5FWXB 5FWYA 2OORA 1XD2A 2F2TA 4KLRA 4I3HA 1ONNA 1HR0B 1ZJJA 3IQGX 3SF8A 1R8SA 3LXRA 3T1VA 3RYHB 5E2BA 3N7UA 3HJBA 3NBKA 4IDNA 3DCIA 4CG1A 3M2PA 1PS0A 2JLAA 1P17A 5IAAA 4LCEA 1L5SA 1KO7A 1DQNA 1X1RA 2BEUA 3CF2A 4IUCS 4N48A 1USKA 1HFJA 2C5BA 2Z08A 3N0WA 3UCEA 2PMBA 4D0GA 3LE8A 3ZD9A 1CCWA 1D0SA 2OCDA 5EIWA 2JGIA 1LV7A 1VJDA 3Q7IA 4LJ4A 2QAGA 4KVAA 4RCZA 3WDMA 5AW0A 4MV7A 4YY3B 3NWJA 1N6LA 3DLPX 3CNEA 5FNZA 4ZEWA 1VJRA 2VHVA 1EEXB 1VKZA 5LQCA 2ZAMA 1EM8A 4PXSA 4E3ZA 4RS3A 4C7KA 1Q1AA 1E9DA 4EQ6B 2JIPA 4E5NA 3STXA 2YVQA 1E2UA 3H6HA 4BUCA 1MO6A 1AY0A 1F4PA 3GPBA 4IYJA 4A8PA 3BB4A 4DLBA 1Z3IX 3SJZA 3ZJTA 1Y89A 3LH5A 4MXDA 4C04A 2IEZA 2BTQA 1MAWA 2BH2A 4IV8A 5LU9A 1EK5A 2GA9A 4YV7A 3C1UA 1NXTA 1H6AA 2PT7A 1G5FA 5J3JA 3ZYCA 1NE2A 1IY9A 1LZLA 2FI1A 2JCBA 1AQLA 2EARA 3O2QB 4R2MA 5F76A 5IH3A 5CGQB 5JS8A 3LGSA 3P5SA 2YWRA 3GN2A 1F2UA 1MPTA 2R6ZA 4CG2A 4DSTA 1A9YA 3KSBC 4IDPA 1TQ6A 2WIBA 3N5CA 1YO6A 1ACMA 4G2NA 2JIQA 1ZCZA 1COZA 2IOYA 3FFWA 2Y1XA 5REQB 4PO3X 3UAGA 1L4GA 2WDPA 4AJOA 3OQNA 3KEMA 5ALDA 2HCBA 3V4SA 5DNUA 3PE6A 2RJOA 2PMCA 3L4KA 5C51B 3IIEA 3R9KA 3Q12A 4UTZA 4IZHA 2CB0A 1YE5A 2A1UA 4ADSG 1OLSA 1RLUA 2LRHA 3A4YA 2G83A 4MMXB 4QU8A 4W9NA 5AESA 1RHUA 3OZWA 1TU0A 4YCJA 4HUQB 4MV1A 4U6NA 4C4SA 4CLXA 5J2UF 3RYFA 2MTBA 5BSEA 1DRJA 1ONSA 5TMEA 2B4TO 1UC8A 3Q6NA 1U2GC 4OYRA 1IM8A 1AN9A 2P1DA 1SVKA 4U4AA 2BJHA 5ARDA 5KU1A 2IV7A 3TF5A 3H99A 4YNBA 2PE5A 3Q72A 3PICA 4REMA 5KHOC 2NADA 4ZVUA 1EHIA 1Q92A 2NU9A 2RIRA 5FYQA 3W4IA 2WAOA 1D07A 2DQYA 3GZTB 5HPYB 4TYPA 4RVHA 3RT7A 3MSXA 5FNVB 3RFVA 4JLUA 4PFQA 4FGSA 5KVCA 3WYAA 2C4WA 2WFLA 2X0RA 3O95A 3IMFA 1PJSA 3CB2A 1ZVJA 2AL7A 3K9LA 4XPIB 3OP1A 4BJ1A 4D02A 3ZD7A 1DBPA 3TQRA 1ZD8A 4V1CB 3DE0X 1KDRA 4O8CA 4Q3BA 4QA9A 5JC1A 4ER7A 3CRMA 5JZMA 4DR2B 2HMAA 4P4NA 1GPUA 4M37A 4K3UA 1ZH2A 4IIFA 1TCAA 1TJ5A 4AN1A 3N8KA 2FWPA 3ZNQA 1L4HA 1JJ7A 3O8QA 1WMSA 3CLSD 4Q9HA 4B5KA 3NHYA 4INOA 1SK8A 4P1ZA 1K66A 1UBTS 4X1YB 1A97A 1SUFA 1XCPA 2BGUA 2J33A 3JALA 4X0EA 1JR6A 2JGEA 3LSTA 1OLXB 1WR8A 3AL2A 1FFSA 1ABFA 3QOFA 4LBWA 2VF8A 3CPEA 1VDMA 4C3OB 2NOAA 3VOTA 2QPAA 3HMQA 2O7VA 2REXB 5B53A 4AJNA 2QTVA 3OIGA 1U0SY 3GT3A 5E9QA 1FSFA 1JRLA 1BXRA 1R5BA 4IY1A 3HWRA 1E6MA 3DMHA 1GADO 2Z09A 3VKVA 2IEAA 3TJRA 2IS6A 3KFXA 3S6JA 1TQHA 1AKUA 1WULS 4OKSA 3WBKA 2BKVA 2CLLB 1FU7A 4FILA 4KQFA 3NRCA 4F5DA 2H1OA 1WDMA 2ZM5A 3ZU4A 4BRWA 4IFBA 3N0RA 1I30A 1XZAA 4N4AA 1C9DB 4HI0E 4G5RA 3D8NA 3GH1A 3A9CA 4FSHA 2ZIXB 4RPJA 2OXEA 1NKTA 3BGWA 1XVIA 3D8BA 4Z2YA 3HBFA 5A3JA 3EYAA 4FFPA 4ATNA 1TMYA 1JPUA 1N6IA 2IQIA 3E9QA 3TLAA 3UXHA 1K27A 3KPJA 3LVRE 4RAQA 5EZYB 4D9NA 4GM4A 3GLIE 4ACBA 2D1FA 3P1JA 3EXHB 5JT1A 3MELA 5AVTA 2PH7A 3TZKA 3TYXA 2W5UA 4CIYA 3DGFC 2FF5A 3ILXA 3VBEA 1DADA 3KDPA 2ZXEA 3T7TA 3UCXA 2A59A 5BSKA 1XRRA 4NFYA 5KWEA 2JEZA 4DQKA 1V11B 3W5DA 3D2CA 2O6HA 4V1CI 4UTPA 2ZANA 4YMLA 5U9CA 3MVEA 4LF8B 1W85A 4TWZA 4S3MA 4YAUA 1SXGA 1J33A 1WZUA 1PFGA 4BWVA 4C7OB 4B3CA 1XSEA 2VZ9A 1QG4A 3L5OA 3TQTA 3VKFA 4COKA 1I94B 2ZWAA 4GMHA 1L5VA 1E4EA 4IXDA 4EMBA 3NYQA 1H8HA 4X7PA 1O6ZA 4NE7A 2P4UA 4YQYA 3HYNA 1A88A 4QGSA 4KQEA 4ECAA 2BAGA 4C05A 1B42A 1NPTO 3BH6A 4E70A 4F1JA 1NMQA 3N39C 4M7PA 5IASA 3I09A 1X0XA 2X5OA 4Q9KA 3O3CA 3EOBI 1UPUA 3K0CA 4ER3A 2TRSB 3K0AA 3S2EA 2IGBA 3N2KB 2BFDB 1HT0A 5LQNA 5CYGA 1GM5A 3CWQA 4QUJA 2WTBA 1JAYA 1VSVA 4KYUA 3ZU6A 2ZSBA 3FGZA 4DQVA 4OSOA 2JH9A 1GZ4A 1X70A 3FPJA 3CKMA 4MYTA 4ZXPA 3U81A 1JZSA 1FUYB 2Q6OA 4NCAA 2VNKA 4B3MB 4HCJA 4H7IA 3MD9A 3DOIA 4LTDA 1GAEO 2OY0A 2CV2A 4MH0R 2X7JA 3N2EA 3N3BC 4OPMA 5G3ZA 4YJ3B 2OOSA 4MAAA 4WBSA 1K8RA 5IMSA 3GGGA 5COQA 4KLCA 3H18A 3UJPA 1ZN7A 5JSZA 1HRDA 3KVVA 4KNYA 1IN1A 2RKOA 3JWEA 1RBMA 4MMZB 4I55B 4OHOA 4R1QA 1A3CA 3LFUA 5HMLA 1T1SA 4FDAA 5JJKA 1A8PA 4IDEA 3PDIA 2C07A 5IT0A 3LYHA 3RREA 1UDCA 4FE7A 3KYCA 3R76A 4A9AA 1YACA 2XUKA 3CGWA 5A3VA 5BSGA 4NZZA 1VMAA 3HGTA 3IALA 1SPBS 2VNAA 1L4MA 4UBNA 1E2HA 4JLMA 3PT9A 3WGTA 5LQJA 3QV2A 3T3PB 1PLLA 2FUEA 2XUGA 4ZKEA 3ZNOA 3CVWA 1YK0A 1Y9ZA 1VBNA 1CY2A 5CX1A 4TV8B 1XMXA 1H23A 2OM2A 3LXXA 1MH1A 2C3MA 3LYAA 1OIVA 1RAGA 3OE1A 4RGVA 3TGWA 3Q4GA 1RAAA 4HNRA 4Z9BA 5HF8A 4DM4A 4EECA 4XQEA 1SOUA 1ZBDA 2WHEA 3H7IA 5C3MA 1N2EA 4WLFA 4YS6A 1GYRA 1BXZA 1VG8A 1JIQA 1Z7WA 3LY5A 4MYHA 4PYIA 4QNMA 1QTQA 4OHYA 1T8SA 4MCHA 3IBYA 3UJ8A 3EIWA 4KODA 5AW9A 1C3OA 1HFEL 5JMOA 2B5VA 1D2RA 3C45A 4RPKA 4NBLA 1J8QA 2YXDA 4P82A 4DCOA 3FTFA 1OR8A 1IHYA 3EWAA 1MX1A 1SKBA 4Q7LA 1JH8A 2A4KA 3RVQA 4AP5A 4E5MA 3DWFA 3L07A 2QN6A 5K1ZA 4U2EA 4B4KA 1NJ2A 2RHBA 1DRUA 5FUYA 1E1QD 5HZGA 3B5IA 2ZVJA 3FWPA 4ZDWA 1W4AA 1H8ED 1DO8A 5EWJB 2OCYC 5I7AA 4B8WA 3ND9A 2HMSA 1JR4A 1IOLA 4TXLA 4B48A 5JR3A 3L1JA 4FSXA 2P8SA 3C7AA 3E2MA 1XTQA 4DMHA 5HRAA 4B80A 5KNLA 3LZDA 2W43A 2AF3C 1QYDA 1MNQA 1N1GA 1RBYA 4DY6A 4O1IA 1YQUA 2CVOA 1KEWA 1LDGA 3AI7A 1XRSB 3HE3A 3RI3A 3M5DA 3NWPA 3AHDA 3DFMA 4D79A 3OE5A 2ZB3A 1B26A 5DHQA 3HCDA 3WDKA 3BKXA 4FW9A 5CA0F 5I7SA 1VJCA 4GYJA 1QTIA 5DCWA 3RUEA 4G86A 1A5ZA 3NIDB 2Q9UA 2NM0A 4DLVA 4RM2A 4HJRA 1RI1A 4PVCA 4WKOA 1G2OA 3DR5A 4CDRA 3F5DA 3U44A 2ACKA 3TR6A 3ELUA 3TLMA 3NAGA 3B53X 3HXTA 5H5JA 4CDGA 1DAFA 5KTOA 5LMUB 2JK0A 1RAHA 4GLLA 3UMJA 1Z7BA 2OCLA 3EXEA 4C7BA 2AT1A 2XMRA 1TCBA 1E2KA 3WK7A 2H1FA 5JWOA 4PTLA 1KXZA 1JKFA 1FC0A 3OZBA 3O7MA 1DC6A 1X8JA 2Q0SA 2PU7A 4ZDKA 4B3GA 2FOIA 3OT1A 4ZREA 1T3LA 3LCCA 4TSFA 4EVQA 4JB2A 1E9RA 1AN0A 1K97A 1M1YB 1ZG3A 3LC0A 4FDVA 2I1WA 3LUBA 4O2BF 3NETA 4M1WA 4ZAWA 4M46A 2QN9A 1NG1A 1G19A 3F74A 3Q3IA 4RD6A 5FOWA 4D9MA 3WAJA 3COJA 4N3CA 5C8DA 2EP5A 4WNCA 1OXKB 2FE4A 4MSUA 1DGQA 3DT9A 1J5PA 4YJKA 1VL1A 1BNCA 4O2BA 5E0KB 1WAMA 1RYMA 2R2GA 2G28A 4GGPA 2H59A 1XZDA 4Y6RA 4BNNA 4FWTA 4QBHA 2GCGA 4TM7A 1MJGM 1XNGA 2FA9A 5C32A 1ID1A 2FWIA 3PC2A 5WRFA 2ZJ1A 1JVSA 4RHXA 3TPCA 4RKRA 3U9LA 1EUZA 2C2ZA 3OE7D 4JCCA 4MVCA 1M2HA 1SCUA 3GT0A 2ORED 1FXWA 3GXBA 2ZM6B 3M70A 3MUEA 1JLHA 3H5RA 4BO0A 3A1WA 2VPZA 2QVGA 3AVOA 4AJHA 1TAUA 3OJEA 1DS6A 2V6BA 5FWNA 4FPXA 3N0XA 1G60A 1G21B 1ZJZA 1N5KA 2C2BA 4NBRA 1QHHB 2R47A 1ZISA 3OFKA 4WL0A 2F8MA 2OC9A 2UZ1B 3LVFO 1BXGB 1SCNE 1WNFA 2ECKA 4IL5A 3E8XA 2HJ9A 2P4EA 3L0DA 3FVQA 2Q46A 5D84A 2C0QA 3W2IA 1LDNA 1JHZA 1H8EA 1MT0A 1CUHA 1FDIA 1Y8CA 1R6BX 2QUAA 1GUBA 2GBIA 3IP1A 3GI1A 3QENA 4PLWA 5CJJA 4JH0A 1V26A 2CEKA 4DOMA 5TIIA 1INLA 2OQVA 3KWFA 5C35A 1G9SA 3BTVA 4E0BA 3UYLA 2XUPA 1Y7HA 2DPMA 3BJIC 1T3GA 3FFXA 1KJJA 1RI2A 3NBMA 3OTWA 5LM3A 2PGXA 1HSOA 1T5DX 2J6HA 2NVUA 3DTTA 4O3FA 4YO7A 3AF0A 2VZEA 2GEVA 1MABB 1Y0BA 3OCVA 5B2EA 1ZHHA 2WQ7A 2ZZMA 3HCBA 3EW7A 5HM6A 2PMDA 4PSUA 4PFSA 5AOCA 2XSZD 4L8WB 2ZTMA 5J59A 2G07A 5AR1A 3C87A 2AVDA 3KJHA 1GPH1 3DVQX 3B3GA 3B7GA 4NH0A 1FNDA 2HD4A 2HF8A 3K4QA 4Z9YA 1R66A 3ICWA 4PAGA 3MK31 1XK6A 4MUHA 4QG3A 4B75A 2HYIC 5KQPA 1ZGGA 3VPDA 5JJCA 1JWLA 3O38A 3EGIA 3G8AA 4QYXA 4DNQA 4MVJE 4CL3A 3UT5A 2VYCA 1OXXK 3WL4A 3PG5A 2F3SA 4JVLA 3TTTA 1V1MA 3BE8A 2P91A 3EF1A 2FW8A 3ON5A 1TF7A 3JR7A 3W7BA 4I4TF 121PA 3EZFA 3N0VA 1M54A 3WHPA 1I1NA 4ZYYA 4PYRA 2F55A 3J7TA 1QGYA 4TTVA 4WXRA 1ZK0A 3HNRA 1A4XA 3ZCVA 2CVZA 1RAEA 1VE7A 3C6BA 4HDRB 5ALMA 2GLUA 4EKDA 3JASA 5IJ0B 4CF4A 4JYBA 4WBNF 1V9CA 2V8BA 5F35A 1U0JA 2AZ4A 1TU3A 2IZ0A 2P7HA 2ZYDA 3PGLA 3QXCA 2XBUA 5FIUA 3W5AA 1ZBQA 2EP7A 4A5SA 4X6YA 4NE9A 3ZW9A 3ZTWA 1TVKA 1TJNA 2QUKA 2XQKA 1EG7A 3DHNA 3GW8A 4O8ZA 1YZVA 5GWXA 421PA 2ZJ7A 5CXQA 5KU7A 2H65A 1SKYE 1U6IA 1GD1O 3I92A 2JD2A 4KN5A 3UJ6A 4DJ5X 3ZR4B 3GHHA 3P26A 3EDMA 4ZJYA 2ONKA 1PNVA 1CQIA 3HVHA 1ECBA 4CCAA 2J9ZB 1V11A 4B85A 2P2GA 4KZKA 3A9VA 1PG2A 1IBRA 2CHUA 3M1LA 4C4PA 5JASA 3QK7A 4EAAA 1ULHA 2FEOA 1AZLA 3FW1A 4BE7B 2I4LA 1GPBA 3FLMA 2GPNA 2NVBA 1GKIA 3TD9A 4CQMA 4KX5A 2WWWA 1KIMA 2WE7A 4NMXB 5KC9A 1THMA 3HKCB 3QE2A 3BILA 4CV2A 1R0ZA 5K8IA 3EOAI 1OGYA 3OU7A 3WS7A 2BD0A 3VH3A 4BVFA 1N2IA 4A0QA 1QHHA 1ZW1A 2NSLA 2PIAA 2Y71A 5CA0B 3TKYA 3SXPA 4WLNA 2EL7A 2IUSA 1DU4A 4IVPA 4ZEVA 5BR7A 2OILA 3IGFA 1W59A 2G8LA 4JVOA 4FIZA 2Q8NA 4YUXA 2AXPA 1EDZA 4QJ3A 5EP4A 4JYAB 4D4GA 3NC0C 4IIBA 2W58A 2ZJZA 3BXHA 2FEKA 3EULA 5KTYA 3JAWB 1U4SA 2SKCA 3JX9A 4RJKA 4F38A 4D8YA 2RHCA 3UICA 2PH3A 4E07A 3U7GA 4MS3B 1D03A 5I9MA 1IY0A 4J1NA 1XE3A 1JAZA 1GTRA 4CF6A 3TWOA 1EVEA 2HUNA 3ETNA 3D0QA 3O26A 4HDQB 2OBXA 3EIHA 5B7PA 1E7QA 2BFMA 2ZJ5A 4MW7A 1MQ8B 2EWWA 3G8DA 4B32A 3V4ZA 4DXDA 4IVNA 5AKZA 3KKLA 2O8BB 3KYDA 4DGSA 4DR5B 4KXFB 1FS5A 4CN8A 4BB6A 4XCVA 3HZZA 4MUBA 3W7VA 3BXOA 4ZCIA 1BX3A 4LYHA 2CF5A 2R9VA 1UFKA 3AJDA 1SXJA 3HACA 4W63A 5DX1A 2FZEA 4UBOA 1AQUA 4BZZA 1PR0A 2X3FA 4BV3A 5IRCD 3BSWA 3HJGA 3AUKA 2BMVA 1M1YE 2P2SA 3HLYA 1L1FA 2C3YA 3UK2A 3WK8A 3EIFA 1FFYA 1U3VA 2AYYA 3OO1A 4RL6A 1P2FA 2V8OA 4EW3A 1OXVA 2OP1A 4DEXA 4M55A 2IBMA 2OG2A 4MIEA 2DETA 4G5QA 5AT1A 4TMFA 1YVPA 1KAOA 4CTNA 2AI2A 2PL3A 2DCUA 3HYTA 5BVGA 4CUZA 2BFFA 4MITA 4R9VA 4CMEA 2E3JA 3BCSA 4L75A 4TT3A 4E5DA 1PS8A 2DPYA 2R1TB 2RGEA 1C1DB 1Z5VA 3FWZA 5HJEA 3VO1A 2H7CA 1F8YA 3CKYA 2SKDA 2E55A 3HDTA 4D0LB 5CB6A 5KYVA 5JECA 3PPWA 2VT3A 2IYFA 4QWMA 2CFCA 3CPSA 3WV5A 4ZI3A 4HEJA 3RSFA 3TL2A 3PR2B 1XVTA 3BTUA 1ST3A 3VKGA 3EEYA 1MJHA 3IEUA 3DBOB 4KE9A 1RHQA 2ET6A 3QW2A 4TKVB 2ZW9A 1NVDA 3BRQA 1OLUA 4H7PA 2JFVA 1CQIB 3DM9B 1Q1ZA 2VF5X 2D54A 2DFTA 3EC7A 4IFEA 3B13B 3NGLA 4OMFG 3ROFA 5A5VA 4YXWA 1CW2B 2ZYTX 4UHDA 1SCIA 2XQJA 4HX9A 4WOPA 4REQB 4NG5A 1DIBA 2RAFA 4JHLA 3K9FC 4Z6KA 2ZI7A 2VT6A 4BECA 1Q7CA 2WQZA 2H1IA 1D6MA 4D46A 3R2JA 1E32A 1SEPA 2Y6VA 1X6VA 2B7BA 2ISQA 2YTZA 1VRVA 3G1TA 2AFIA 5BSUA 5LSAA 3EJ6A 5CJ2A 1ORVA 5KTMA 5ICCA 3GUZA 2P7IA 2ZI4A 1PT8A 4GVLA 5K3BA 1E4OA 1XZMA 2FB9A 2J0UB 4ZN6A 1JFFB 3I83A 4I1UA 5DGXA 2ZAGA 3FI0A 2HWYA 4XQ9A 3GBPA 4F5EA 1WXWA 3E9ZA 3CKKA 1RWPA 2YV1A 4KYTA 3HYCA 3I6QA 4G01B 2RHLA 4NCKA 4I50F 3VHLB 4GF5A 3W79A 3KLBA 5SZIA 3HXOA 4A8JC 2UV8A 2HK8A 2HQRA 3BWEA 3NOVA 4RHTA 4Z7JA 4D80A 4GGOA 1EDEA 2QW1A 5DCUA 2R4QA 4WA8A 2AOVA 4DMKA 5FPPA 4ZCQA 1T8TA 3TZEA 4RVOA 5JY1A 2W2KA 1PR6A 1ZUWA 1MPXA 3K9CA 3QJYA 1CNMA 1H1LB 1QVVA 5ULLA 3EPHA 4OMCA 1YKFA 3ZKAA 1FMJA 1EE9A 5H0IA 3SXJA 2NXEA 3ZGOA 2WSBA 5J1TB 2BHLA 2GERA 4BDSA 3WL5A 1UKEA 2B30A 4PNEA 3MM4A 3LUGA 1KO8A 4UPEA 2CK3A 5A5EA 2JLVA 1SUDA 2QTAA 1V5FA 2W7TA 2WUFA 5EJAA 5DMHA 4ZVPA 5JWHA 1RXUA 4YAWA 4DV3B 4Z49A 1H65A 1MB3A 2XTAA 4UHBA 1T6ZA 4PW0A 2AMYA 4KIUA 4BLTA 4YRFA 2R00C 3UN1A 1MOZA 2IP4A 2Z8XA 3GP5A 3QVWA 4NICA 4CM8B 1XHFA 1J2JA 2C4HA 2ETVA 3KS9A 1M0TA 4HH1A 4Q1DA 3IPYA 3ZC3A 1X2BA 4RSHA 3IMKA 1XZHA 1QIGA 4ZT5A 5JXIA 1Y6FA 2JFXA 4HPWA 3II6X 4QGGA 1DBQA 1UK7A 2BI4A 4P4SA 4MRAA 2FOXA 3RWBA 1WUHS 3P27A 2DYKA 3QVGB 1M5RA 1JH9A 4OMDA 1Z5NA 4GPEA 3BXZA 3KB1A 5LQUA 4D9EA 4RTSA 3V55A 4K6KA 3ZHUA 3H0KA 3D0OA 1WXEA 5KS2A 5BSHA 5JLAA 1PUIA 2PSJA 4HEHA 4OFWA 4Z7NB 1OY1A 1KMHA 1XV5A 2CUNA 5KNDD 2YASA 4MA0A 1P19A 3MYRA 2R8OA 3LBNA 4N6NA 3K71B 4FE3A 1OV4A 3GRVA 2WY2D 1Z34A 2FQYA 1X39A 1CVIA 2FETA 2IPNA 2P9YA 1NBAA 4HN4B 3KO8A 4TTQA 3R7AA 3VYWA 4QAQA 3H83A 4XYBA 2WOJA 3COSA 3IQDB 2V03A 1ZI6A 3PTZA 2G17A 3L46A 3CC8A 1K2VN 2QZZA 2CNLA 4GE0A 4MR7A 1NQOA 5JRJA 2IE8A 4U7TB 3R8CA 1KNQA 2V0CA 1M8FA 4ZQCB 4DHWA 5JCJD 1QK3A 3MAJA 5T7BA 2CV0A 5KZMB 5HIJA 1J23A 3ZV7A 2OAQ1 3IAS6 4OBEA 3GRFA 1VMDA 2XDYA 4DXHA 1L8AA 3BTOA 4JI1B 1MMFB 4KDCA 4Y2GA 4H7DA 2J87A 3AO0B 4BYGA 4EHNA 5CEFA 1Q83A 1HNZB 5CDFA 3F46A 3MAGA 1NFQA 1POWA 1SC1A 2G04A 3UT5B 1E96A 3KQOA 4BIMA 4KFSA 2R6CA 3MTAA 3W3ZB 5F5LA 2JI4A 1DV1A 2FEMA 4II3A 1II8A 3N7AA 1TVEA 3ADCA 1YC5A 2MSKA 3VR1A 1Z06A 2Z57A 3KPVA 2FWMX 2V6MA 2PEZA 2P9CA 2IYSA 3INRA 2HPZA 4H6VA 3BD6A 3CY6A 4AJPA 1HLDA 3SQOA 4H4DA 4DTCA 5A06A 1PT7A 4JEHA 3PX2A 1GCOA 4QREA 2QG4A 4ABTA 3G59A 4C2UA 4O2LA 4QOEA 1I4DD 3ZD8A 1YQTA 3GOQA 4WXHA 4YCLA 3FGPA 4B34A 4E3WA 1KWGA 1Y98A 3LHKA 1I3CA 5H59A 1FX1A 4WBNB 1YI8A 2QLNA 3GT7A 2YVAA 3ENNA 4O4JA 2HO4A 4GZ6A 4XA8A 2JLRA 3WGQA 5A7FA 5K8VA 1X86B 1N2OA 2HA6A 4QEDA 3PIIA 2QTCA 4A26A 1KH3A 2RGNC 3A6KA 4MVJD 3RRXA 3BA6A 1J1IA 3T99A 4CHTA 2FGJA 3JRXA 3CW2A 3OLCX 4LY6A 4F11A 1XQYA 1ZY2A 3DEKA 3OESA 1EVKA 5IABA 5JAUA 1EDOA 3AM3A 3MJCA 4MLZA 1XLTC 4KN6A 4RCVA 2WKSA 2Q4BA 3D6FA 3V6LA 1AGXA 1GPDG 1QWOA 2E37A 2JAHA 3DEHA 4R1MA 3AXTA 5AVZA 3JQEA 4Z99A 2WJPA 1KI4A 3ZV3A 3EQ6A 4EYOA 5TQ2A 1YV9A 5E4JA 4K6GA 3SICE 5CHYA 1JG4A 3KKKA 1T9GR 1F7UA 2FN7A 3UF0A 1YDFA 2REBA 4K1XA 3N2YA 5AVUA 4UAUA 1R5NA 2Z5LA 1JSCA 2Q8QA 4MX8A 4MP8A 5K2OA 2TSYB 1Q0QA 4IGEA 3EZGA 3JALB 4KWCA 4EI2A 3IELA 1X77A 1XXHE 4XH9B 1CUFA 1RRGA 2G06A 1WW8A 3IAEA 2GETA 4UHFA 521PA 2FZVA 1XEXB 1L1RA 4NFHA 5JYEA 3R4VA 2WU1A 1LGYA 1RADA 3AESB 3PUHA 3G5LA 4LE0A 4Y67A 3EXFA 5BYAA 1K6IA 1J7JA 4CV1A 1TT7A 9MHTA 2E4AA 4JSTA 3FPGA 5IT9A 2I8LA 2OBLA 2X9GA 3AUFA 3MWDB 4DMMA 5FPKA 4MVJA 3IEMA 5KJEA 3ICQB 3JD3A 2RI6A 3AV3A 2DHCA 2RGWA 1ZD2P 1KAGA 2IYWA 3KZVA 3OJFA 4HXFB 1FNCA 4JZKA 3QUTA 1M2WA 4QPJC 4JJGA 4EPRA 1OC4A 1Y1SA 3PKJA 3QVTA 4NLLA 4YMVA 5GMOA 1ZRMA 1WHTB 3QLEA 4M1QA 1HSZA 4LFCB 3RAGA 1W5TA 4D82A 5TPWA 2YWJA 4B44A 3A1CA 3QW4B 3DZHA 3SJUA 3UW3A 4E5YA 2XX3A 5L3SA 2WEKA 1O95C 4NEGA 2RK4A 3T94A 5IFLA 1O9GA 3VPHA 1QH8A 1U02A 1V8FA 3FRJA 3MWYW 2JHAA 2I2FA 3EMVA 4FYVA 1P3JA 2OENG 1ENPA 1F8UA 3IAM1 4PLZA 3WWDA 1E3EA 3VR3D 2Z4SA 4GXNA 1XPOA 3QX3A 4L8VA 3AF4A 3ZWVA 1JDSA 4PS1A 1FMFA 3MXTA 1LBEA 1GSOA 4MGYR 3V4OA 2ZZKA 5JEDA 1W1UA 4OV6B 5BWNA 2VP3A 4FJ2A 1PT9A 1MV8A 1JT2A 3FWYA 3QJ5A 4KUHA 3PJEA 1CUWA 4B4WA 5IYZA 4GKJB 3D7RA 1GNLA 3K5HA 4O0LA 5ENZA 3C3KA 3OEEA 3UA3A 1T2EA 4YJ2B 1GGNA 2XRMA 1VIMA 5BW5A 2F1HA 4YALA 4E6PA 4H27A 4YCSA 5A9SB 2EDAA 5DNWA 1OKKD 1FNBA 3R3ZA 4KMSA 3T5DA 2MR5A 1SXIA 1P5RA 1C1DA 1SG6A 5FTNA 1SCUB 5BWBA 2Z83A 3R74A 1Q57A 3PYLA 3RASA 1KDZA 4YMSA 2Q3JA 5KOHA 3KV3O 3S27A 5KOIA 1D1TA 1X8LA 2R7MA 4WBNA 3KPUA 2YR0A 4TTRA 2PR2A 3P9CA 3DDWA 1O8BA 2CE7A 2P6MA 1G2PA 1P1JA 3MJDA 1GPWB 3N2LA 5DSTA 4ZAYA 5FFMA 1KK2A 3I53A 3IURA 4QX6A 1KK3A 3B1XA 4BNHA 4PBSA 4RJ2A 2P9JA 3NH6A 4QIHA 2CDBA 1JHVA 1B8VA 4HWKA 4IDDA 5K0GA 2NVUB 5CHEA 3CV3A 1K6EA 3L0ZA 3A4TA 3Q1LA 4OQDA 4ZVTA 1TE2A 1HDXA 4GPAA 2FAXA 5FPYA 2WZBA 2GZRA 3O4JA 5HCIA 2X5XA 3NHSA 4UJ3A 3SDBA 5IK2D 4ZO7A 1LVUA 2I78A 2CW5A 1OBFO 3AV0B 3GRKA 3K32A 5I7VA 1WETA 1ENZA 2HW8A 4OTZA 1GY8A 1KI2A 5EYPA 4HVCA 2P67A 4AQYB 3F5FA 3HYRA 1Q3HA 1EG2A 2VPXA 2VK8A 2VP2A 2QU8A 3D8UA 3DBHB 4BCDA 3WQQA 2YHAA 2QI9F 4CKXA 1QHSA 4DF3A 2CXNA 2E1PA 2IYTA 4U3JA 5K09A 5EMJA 1FTNA 1XHEA 1OU4A 5D00A 2CNNA 1XTVA 3C8UA 4ARIA 3TCNA 2GX6A 1E6CA 1K7XB 1PK7A 1E59A 3OHPA 4CM4A 5H3CA 4DQLA 5GZ1A 2O07A 1K3UB 5CLFA 3M0EA 2FWRA 3LECA 4H6WA 1BS9A 4GYWA 4LGMA 4O4LA 2IL1A 3DE3X 1MVNA 3BWYA 1QCCA 3MILA 1H9AA 2QJRA 5IBPA 5G40A 1N4AA 1DINA 1QPGA 4W1PA 3PFKA 5AYVA 3ICEA 3PD1A 2AN3A 1CY8A 1X92A 5TMBA 3PTAA 3ZY2A 2IPLA 4R2JA 3AETB 4CI0B 1DDGA 3EA4A 4RH0A 5H16A 1OFHA 4Q3KA 4Y2UA 4U1RA 2H2GA 1GT91 2IZ7A 4BX9A 4DCUA 2NU9B 1ZIDA 5LBIA 3CYFA 2O4UX 3A05A 2LUOA 2I2CA 1S01A 3RTDA 3A1UA 2ZQYA 3Q7TA 2I1LA 1U0NA 5LR6A 4CQJA 3ITNA 3DT6A 4NAHA 3RVLA 4PO9A 2GH1A 3ANLA 2EYQA 4GPTA 1IVNA 2B0CA 3ENKA 5IBRA 5JCZA 1N0WA 1BOFA 3NRJA 4DWOA 4DIOA 4CTJA 4QKQA 4ZOQI 3T3DA 3C8HA 3VZQA 1BCSA 2X3UA 5FKJA 4BJ6A 5JS1A 4KQGA 3SM3A 1JEOA 4ZMRA 3WIVA 1Z8HA 4IEEA 4C1NA 4TSKA 4CQMB 4EPVA 1Y4AE 2CJWB 3RUPA 3B9RA 1C2TA 2D0IA 5KNBH 4PQRA 4ZCPA 2H17A 3SQLA 3PTLA 5I7OA 1E7RA 3AJEA 4MS1B 1QO7A 3QYJA 4W5RA 2A0XA 1PZEA 4XYEA 3KIPA 1LBSA 1QRAA 4WY2A 3AMVA 4ISBA 1P1FA 1X7YA 3VOAA 4RM3A 1Z2DA 3EFBA 1EGQA 4Y2PA 3SFZA 2LV8A 1XD9A 3VYUB 4E5UA 4GH5A 4MVJH 4B4VA 3IKVA 1RS0A 3WFJA 1Z7GA 3BWBA 5FORA 4D8VA 2ZTLA 3F2IA 2OAGA 1U99A 2JFQA 1BEEA 4TL9A 2UUBB 2E6UX 3D0KA 1OC2A 2Q3EA 2B5OA 4RV4A 4LN1A 4A0RA 2RC6A 2G08A 2YWXA 3QU9A 2PKQP 4J29A 2GPBA 1GLVA 2O2HA 1VKHA 2YOGA 3LPCA 3NTVA 3AZOA 3ZHXA 3U1TA 1W19A 1NVMB 3ASVA 4H7KA 4L8YA 2ILVA 1OWNA 2FDXA 1OFGA 3AJAA 3GC6A 2RI1A 3L6OO 4OHCA 4XI9A 4UFPA 1C2YA 3HSKA 4EB6B 2BZ0A 4IDFA 1U7WA 4QFBA 3ND7A 3KELA 2DT5A 2JJ2D 3VR5D 4KREA 3AR3A 1L1QA 5JMPA 3TJZA 4X62B 5THXA 5JVDF 2AF4C 2A0WA 2GCPA 2OLEA 3K30A 2Z4TA 4JP1A 5D87A 1EUDA 5T4FA 1OASA 2YXLA 3O4GA 1MIOA 2WK1A 2X6TA 1Q12A 1XAIA 3SBOA 3NEYA 4AI6A 3KQWA 3QG1A 4N39A 1X94A 5BR4A 3AL0C 1JR3A 4IV0A 3LTEA 2NP6A 4MEJA 5KYWA 1V8BA 5CLGA 1EZ4A 4EW2A 1V96A 2F62A 4QHTA 1NN0A 5JMTA 3KAPA 3ESBA 1IOZA 3ZHZA 4D4HA 5EIEA 3VHXB 3GIDA 3PNLA 2YZMA 1FX0A 2P1RA 3AFIA 1ZYUA 4F6CA 4PCAA 4B2LA 3WLHA 1TAGA 2OT3B 1M73E 2ZEJA 3BORA 3EUEA 4LYGA 2PCJA 4M1OA 4HZUB 1JSZA 3AUUA 4CDNA 1VG9B 3PSHA 5ELLA 2BGJA 3QF4A 3W7AA 3H5IA 1GN9A 3MJ4A 1C4WA 4IRMA 4H31A 3ELWA 5EGSA 2M1ZA 1HYQA 4M83A 3RVOA 3V2UA 4R2IA 3M7IA 2IEDA 3ERCA 3DAOA 5A9RA 2ZWIA 3DHWC 3FLBA 3GFOA 4RZUA 3W77A 6ABPA 3HRKA 4BTLA 1L7AA 1LS6A 2VDVE 2Y1FA 2WWYA 4BXOA 1RRPA 2PBZA 3ICCA 4MUKA 1P4AA 3V1KA 2QLBA 3RHTA 4F60A 5CFOA 3P0HA 1NU6A 2D2XA 4GP7A 4AVYA 4Z2AA 1ZU4A 2GJSA 3O1IC 1OYWA 1P77A 1FRZA