1PUXA

Nmr solution structure of bef3-activated spo0f, 20 conformers
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sporulation initiation phosphotransferase F
publication title The NMR solution structure of BeF(3)(-)-activated Spo0F reveals the conformational switch in a phosphorelay system.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 24
structure length 124
sequence length 124
ec nomenclature ec 2.7.-.-:
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1puxA00
2JVKA 3KHTA 4EYKA 1Z13A 3KLOA 3BRSA 4S04A 5HQJA 3FGZA 1PEAA 4O1HA 2PMCA 4N0PA 1BDJA 1DCKA 3DZDA 4WUTA 3KSMA 2HQBA 3RVLA 7ABPA 3A3KA 4HYEA 5IEBA 4MQEA 3UK0A 4KQ9A 2VUHB 1QMPA 1YK1A 4IGAA 4N76A 1XHFA 4MPTA 3H6HA 3CLKA 4TLMB 3F73A 2ID7A 2R25B 3FFTA 3F7NA 3Q7TA 3FFXA 1U0SY 3LOPA 3RVNA 1VPWA 3CG4A 3MIZA 2YHBA 3N8IA 4MLCA 2VK2A 5IBQA 4D6XA 3OLYA 1AB5A 2A9PA 2RDMA 5HSGA 3GBVA 1BDHA 3RVJA 2IPLA 1YS7A 2PL1A 3IDOA 4G0ZA 2NT3A 4Q7EA 5C5EA 1LBHA 3I42A 1PUXA 2CWDA 3OMWA 4RK0A 3I5AA 3LUJA 4UHJA 3T38A 1Z18A 4IMJB 4DADA 5EWLA 4JP1A 4Z4EA 1P8AA 4L85A 3NHZA 4IMIB 2XDYA 1NXWA 3HUUA 3O2QB 1QP0A 1ZAYA 4PE5B 4KMRA 3HZHA 4MAAA 2PKXA 1DCFA 1QO0A 1C0EA 3RVRA 5T7BA 1CYEA 3HEBA 1YMVA 1URPA 3OLZA 3N6VA 2JVIA 2Q5CA 3IP5A 3C6QA 4G0YA 3LUKA 1WETA 4Z4IA 4KREA 4MGEA 4NICA 1JLKA 3OLWA 3QEMA 4F11A 1CHNA 2I6FA 5C5CA 5TQ0A 1JDPA 5KQPA 1JYEA 1SD5A 4YR7A 1TLFA 2PUCA 1J56A 3N0XA 2QVGA 4Z0NA 2PLNA 3OQOA 3SY8A 3NHMA 2E4ZA 2FN9A 4IILA 4HNQA 3LFTA 4LE0A 1P6QA 1M2EA 2L18A 2PL9A 1GUDA 2MSLA 4KFCA 4LDZA 5DKFA 4RS3A 1BAPA 3QELB 4PICA 5EWMA 1H9CA 1PHRA 3E61A 2N9UA 3FDFA 3MQ4A 4PYRA 3JPYA 1DZ3A 2JK1A 4G0XA 5DCLA 3H5VA 3IP9A 2FKAA 5JNTA 2FLKA 9ABPA 1Z2EA 4G0OA 3JY6A 3DLHA 5IEJA 4MS1A 4YCSA 1ZVVA 3CU5A 4RK5A 1QNLA 2R48A 4ETIA 4MLDA 4G86A 5IX8A 3RVMA 1USGA 4FE4A 2H0AA 4PZ0A 3NNDA 4FE7A 5BQ3A 5ED4A 5TPZD 4RK4A 4WXMA 1USKA 3BBLA 3O2SB 4MR8A 2PUFA 4XXHA 1GCGA 3GA5A 3OM1A 4LRQA 1ZHHA 1QPZA 2L17A 1FQWA 3Q7SA 1M5UA 3EDCA 3HDVA 5D2CA 5DLEA 4W5TA 1A04A 1Z17A 1Z26A 4EVRA 5FWXA 5IUKC 3QK7A 2PUDA 1ZDMA 3R0JA 1BDIA 2RJOA 3CZCA 5EWJB 3A10A 3D02A 3E3MA 3EODA 4KNYA 1KRXA 1EWTA 2A9RA 5TPWB 1Z15A 2WB4A 2RGYA 1TJYA 3O74A 5HKOA 3JS5A 4RWEA 2JVJA 4Z9AA 3EAFA 1YS6A 2FW0A 2PJUA 2IYNA 2PUGA 3BILA 5DTEA 2HJ9A 3IP7A 3RQIA 4EVQA 5I4CA 1XWWA 1F51E 2AYXA 4MS4A 2LPMA 1ISRA 3RVQA 3ROTA 4QYWA 1YVUA 1ZY2A 1DRKA 1EHCA 3QLUC 2FSPA 1U2PA 2V0NA 5DGCA 4DQDA 3BREA 3DGFC 5HM6A 3I45A 4P1ZA 2IOYA 5KQLA 2VYCA 1PNTA 3ILYA 4N41A 3LMKA 2QV0A 4JOQA 1U2QA 2HPHA 4Z4CA 3LKVA 2TMYA 3GL9A 3LUCA 4RK7A 1NXVA 2F8SA 3C97A 1FSPA 3C3MA 2LP4Y 1PNRA 3TD9A 4RY8A 3QLTA 5F64A 1T34A 2LBPA 1OXBB 2GX6A 3H5TA 4ML3A 4Z4GA 1A0OA 5JS2A 5FWYB 2FTKE 2J48A 4Q6BA 4P98A 4YO7A 2M98A 4MRMA 4WXEA 4Y9TA 3RH0A 1AB6A 2CD7A 2W42A 1QQBA 2MYUA 1FFSA 4MR7A 2OQRA 4YRZA 1I3CA 3TB6A 1QO0D 4H60A 4HNSA 2FEWB 4KVFA 4KQCA 1D1PA 4DN6A 1JFSA 4N47A 5BR1A 1JWLA 1LJLA 3H1FA 2BGGA 1U04A 2GI4A 3KYJB 3Q7RA 3MA0A 2E4XA 3N53A 4ZMRA 3T95A 4PEVA 3DGEC 4Z4HA 3TX6A 4NQRA 3HSYA 4RDCA 3T6KA 1JFTA 2VUIB 5FBKA 2PUAA 3LKBA 2R47A 3FFWA 4CBVA 3P9YA 1SXHA 4W5OA 2WY2D 4MR9A 2RJNA 3NNNA 5TQ2B 4KV7A 4EYOA 3MM4A 2PUEA 4KPYA 4EYQA 1B00A 1E6KA 6ABPA 4F3TA 2FMHA 3K4HA 1JL3A 4TN5A 3F6CA 4OG2A 4RY0A 1QP7A 6CHYA 4Q6WA 1BVHA 2IPMA 4EY3A 4HNRA 3HM9A 2NZVG 4RU1A 1NXXA 2NZUG 1DBWA 2R4QA 2FVYA 3O1JC 1NTRA 3N0WA 4G0QA 2A9OA 3JTEA 2FEPA 1QP4A 1RPJA 1D2AA 3VNBA 1Z12A 3CS3A 4XARA 4E7PA 2MSWA 1JHZA 1D5WA 2HQOA 3CFYA 1NXOA 4FB4A 2NT4A 3BRQA 3ILHA 1JBEA 3LUFA 1NY5A 5JNRA 3L49A 5KC8A 4IRXA 1DBPA 2FQWA 2E4UA 3OQNA 3H5WA 1D1QA 2OENG 3G85A 5KI6A 3H5LA 3TO5A 4F12A 3OQMA 2YHAA 2FLWA 5IUNC 2ID9A 3IPCA 2E4YA 4YP9A 4JAVC 5JS1A 2WJAA 3M9WA 3O75A 4TMYA 4GNRA 2JBAB 4YGXB 2X7XA 3EGCA 2P4UA 3C3WA 5GQSA 1EAYA 3Q9SA 1LK0A 3SAJA 4NV3A 3OLXA 4ZJPA 5JNVA 4OLBA 8ABPA 2LIVA 2KYRA 1BA2A 3HJFA 5CNJA 1A2OA 1SRRA 3QLVA 4YS6A 1ZGZA 4TLLB 5IC5A 1ZITA 3FMVA 3O21A 5KWSA 4MQEB 3VNAA 3CKMA 1QKKA 3M6MD 1ABFA 4WZZA 3N0RA 3OM0A 1DP4A 2MSKA 4W5QA 4YWHA 3EJWA 5CHYA 2E4VA 2ZAYA 3QLUA 3QEKA 3QLVC 4D6YA 1APBA 2F8TA 2M1ZA 1DC7A 2DRIA 3B2NA 4H3KB 4QYMA 4MQFB 2GWRA 3O2JA 5KQMA 1F4VA 2QU7A 3RVSA 1DJMA 2MYPA 5JNUA 3HCWA 1DBQA 4ZYLA 3KG2A 3LUDA 3F6PA 3QELA 3KCNA 2NUBA 1MB3A 1RXIA 1JX6A 4QICA 3GRCA 5GOTA 3DBIA 2MYNA 3G1WA 2HSGA 2FXIA 2PUBA 1E2BA 5JNSA 1KRWA 3MYYA 3GBPA 2HQRA 2FEKA 3QX9A 5EWLB 4B09A 3JVDA 2IPAB 5TQJA 1SXIA 5BRAA 2JB9A 1ISSA 3H1GA 3RVOA 1GUBA 3SNKA 1TVMA 3IP6A 5IULC 1RZRA 2QXYA 4RXMA 1JFVA 3I09A 3OO0A 4ZMSA 3MMNA 5CNKA 3L6UA 3K9CA 1L5YA 1ZGGA 3A0RB 4S05A 2ZWMA 4RKRA 4YLEA 1FFWA 1GLGA 3H5OA 3KJXA 5TE9A 3H1EA 3D8UA 3QEMB 4RY9A 5TQ0B 3Q41A 1ABEA 3QX8A 4UHKA 4XLTA 5EWJA 4RXUA 4MS3B 4XASA 5B3JA 1EFAA 4KK4A 4EUKA 3HVRA 1VRVA 4KZKA 1JDNA 2WWVD 3W9SA 4OTZA 5TPWA 2MYTA 3KTOA 4ZPJA 2FMFA 1LJUA 3GV0A 1NXPA 1M2FA 5ABPA 5KQGA 1PEYA 1RNLA 5EWMB 1JH9A 2E4WA 1KMIY 1YK0A 2IKSA 3MF4A 4LDAA 1DC8A 1YIOA 5IUJC 2QSJA 4MQFA 5B3JC 1OXKB 3NBMA 3GYBA 2GKGA 5E3JA 4QPJC 4MS1B 1P2FA 2PAFA 4JASB 4YV7A 3LUGA 3CZ5A 3Q15C 4H3HB 2QZJA 3UUGA 4O5AA 4Z4FA 1YTUA 4KRFA 4W5RA 3LUHA 3GWGA 3RVPA 1L5ZA 4JB2A 4RXTA 1DG9A 4EGSA 1ZESA 4Z9BA 4IF4A 4F06A 4MR8B 1YMUA 2QW1A 3CTPA 3NNSA 3ROFA 4W5NA 1QQAA 2P9HA 4RSMA 3RVKA 3HUTA 3N75A 2WRZA 4E7OA 1VKRA 3OLVA 5FBHA 3T8YA 4JB0A 2IDMA 5FWXB 4OATA 3S99A 4N0QA 3HO1A 3H6GA 1M5TA 1JF8A 5FWYA 3KKEA 4G97A 1S8NA 4OBBA 3C3KA 3TMYA 3CG0A 5CNIA 1P6UA 1Z2DA 4LE1A 3O1IC 1Y1LA 1SXGA 1C4WA 2WJWA 1R8JA 3H5IA 4MS3A 4RK1A 3EQZA 3KS9A 4RV5A 1GCAA 3JVIA 5KC9A 2QR3A 4JA2A 4ETMA 1E6LA 4LE2A 3SG0A 3HDGA 4MYRA 4MS4B 2FN8A 3DLBA 4L4UA 3HS3A 5T3YA 5BRJA 1MB0A 2GBPA 1IIBA 4LX8A 2L19A 4O1IA 4OLAA 2JRLA 1LBIA 3KYIB 4WT7A 1Z16A 1MVOA 1TM2A 1DCMA 5TQ2A 4XFKA 1DRJA 1XHEA 4KK3A 4WWHA 1U8TA 1MIHA 4D74A 1UDRA 1W9HA 1NATA 4XAQA 1ZH2A 2JCGA 4NCAA 4Z99A 3GT7A 1CEYA 2CHEA 2FMIA 1K66A 2QVCA 1E6MA 2L2QA 3M9XA 3EULA 4EVSA 4EYGA 3URMA 1EWKA 3CNBA 1EWVA 4ETNA 1RXEA 4RZSA 1HEYA 1TMYA 1FFGA 1K68A 4MRMB 3O1HB 1W25A 2CHFA 4M88A 1ZN2A 1D4ZA 4NCBA 1RZRD 4LZLA 3HK2A 4MR7B 1ZH4A 2FQXA 1KGSA 2LUOA 3JPWA 4RK6A 5JNWA 2B1JA 1NXTA 1VLZA 2H3HA 2WMYA 3A0UA 5TPZA 1MAVA 2B4AA 2FMKA 3LTEA 5PNTA 3H75A 3CHYA 2A9QA 1USIA 3OO1A 4G0PA 2O20A 4G0MA 1JYFA 3IPAA 4GPAA 3SM9A 3SQNA 3UKJA 2IPNA 4MR9B 2PE5A 2AYZA 1Z25A 3LUAA 4N03A 2JBAA 1NXSA 2FQYA 3KLNA 5CNMA 4RKQA 3EQ2A 3CRNA 3HXMA 3HV2A 3OMXA 4F8JA
chains in the Genus database with same CATH superfamily
1DT3A 4KQ6A 1NR5A 4RY2A 5HMMA 2C98A 2WOJA 5BMVF 4TGLA 1US8B 1Z45A 5K1ZA 2OBFA 2VDPB 3WOHA 4I4IA 2OAQ1 5HGJA 1PVVA 1T1SA 3TXAA 4BRSA 3DV0B 3K9BA 2AFRA 2PS9A 3K1AB 5IM5A 3P94A 2ADFA 5KVCA 4QDUA 5F76A 4CUJA 4R8KA 3TECE 1DAKA 1VLJA 4ZV4A 2H16A 3HBMA 4UTVA 2GHTA 5HF9A 4RLHA 2XHZA 3RSLA 5JYCA 4CV2A 2B8JA 3JATA 5THKA 3T41A 3IERA 1KJIA 4CDMA 3OE7D 4CRWB 1DC3A 1QUEA 3TDMA 1IXRC 2ZBEA 5LXTB 3R23A 2WKWA 3AB3A 2VTBB 2VJMA 4FMDB 4EMBA 3OLYA 1CF9A 4FLMA 4AICA 1ISGA 3Q0IA 4JYCA 3I9JA 4D3XA 3T3HA 3OY2A 1UJBA 4ZN6A 1W4RA 3JU3A 3X0DA 1OYOA 3OMWA 3QHAA 5FOSA 2GK7A 4B84A 2NYAA 5HJ2A 5K0GA 4AI6A 1YULA 4F2HA 1ND5A 5EWLA 3UM9A 1NL3A 1B3RA 1H65A 1U8CB 3OWOA 4CKXA 5CD9A 2C7OA 4BNNA 4ONEA 1V8PA 2HPZA 4PG6A 5JE8A 5B1IA 1ZGBA 4N7RA 1IE3A 4BZQA 3AP1A 2CFTA 4QO7A 1UBCA 3I1JA 1KO8A 2ECQA 4OHZA 8AT1A 1RWOA 3CRVA 1L3CA 1I94B 1U3TA 3M2TA 4NEGA 3NIWA 3EIFA 1E8NA 1NJ1A 3AERA 3C3XA 1JLLA 1P9OA 3KPUA 2XA1A 1K9SA 3T9FA 2DPYA 4F04A 3PB3A 2WTXA 1KU6A 4RHEA 4AQ7A 1I13A 2CUNA 4JBGA 4A0GA 1PJAA 3GJRA 3Q8LA 1WX1A 1FZQA 5KTRA 1IN1A 1E0AA 5MN6A 4J0DA 4F38A 3MUEA 3RT1A 3WLFA 1NWCA 1P0IA 1MW9X 3U49A 4B0OA 1PLKA 3SBDA 4IG9A 2FFRA 3RD5A 4LJLA 1UPAA 4IM7A 4M1OA 1T8WA 1U7UA 4J9VA 4PQYA 5ESDA 1CR0A 4IIEA 2X86A 1VCHA 2BEUA 5FBLB 3QF4B 1KVTA 1H9BA 4X1IA 4HDMB 3I32A 4OQNA 3W4IA 4CCSA 1I5OA 4MITA 1VSUA 1DQZA 2WJHA 2W6ID 2ZYIA 3NI2A 5D3MA 4BNGA 3GFFA 3GPDG 4JIMA 5KOJA 4B4WA 1I4DD 4ZP1A 2FDXA 4D79A 1H2FA 1RJFA 2FKAA 2QUIA 3OC0A 3FGPA 2EKBA 2R6DA 3KT0A 4PIMA 2I4TA 4BRZA 3ZS9A 4Z7QB 1PW7A 4NFLA 3USZA 4TKVA 1F7UA 3THOA 1UJ2A 2GJAA 2OLJA 4A6DA 2W2TA 1M1NB 4CKCB 5K8JB 4G84A 3UH0A 1UOOA 1DAEA 2JATA 5B1DA 3DOIA 1BXZA 3L1KA 3TI9A 5ED4A 4TS9A 2CVPA 3IEVA 1LD3A 1QYRA 3NPAA 4TTAA 1RQ2A 1USKA 3HDHA 3ZHSA 4ER3A 1IDN1 2AJCA 3ZNQA 2O0HA 3PNSA 1B6SA 3OM1A 5EGNA 4GG1A 4ZU1X 1KI3A 1XD2B 1C9EA 1XCPA 3Q7SA 5AVRA 2GZ1A 5DLEA 1T0PA 2XCOA 4IEFB 2R0QC 1PN3A 1PR4A 2GF9A 3IAXA 2BFBB 1Q14A 3CZAA 3GAAA 4YDHB 5TY0A 2QK4A 3OQIB 2R68A 3MBKA 1ZK4A 5SYMA 2QXTA 5DB4A 1U81A 1GVNB 2R11A 3DP9A 1N1EA 3E7FA 1PDOA 2M6SA 4KPUA 3N3AC 1TJYA 3S2EA 1PJLA 2QQ5A 4O6VA 3FUWA 3QFRA 1IM8A 3F67A 3CW2A 3FNIA 3S81A 5C1DA 3VNUA 1T5OA 3GP3A 1IYZA 2YKGA 1A71A 1RBMA 4EQZA 1I0ZA 4DZTA 2JGEA 4LK3A 2DKOA 3PQDA 4QTZA 3I83A 3VZSA 2J87A 2CMDA 3EXIA 1YVUA 4JI7B 4IR7A 5SZJA 3GZNA 1DKLA 1Q7TA 2F3PA 4C7XA 3W78A 4MVJD 3MCUA 3BREA 3LGSA 3LX5A 1LI7A 3JARA 5JH7B 5KQLA 2VTKA 2D0IA 5TNXA 1ZAKA 4ETWA 1G6HA 3SEAA 4DDWA 2VDLB 4NL4H 3I6IA 4D46A 3HJBA 3DTYA 4BHTA 1J9EA 1JNXX 4QXPA 5A4JA 2RK4A 3EVAA 2WT9A 4JGBA 2ZVDA 4M36A 4MYHA 1L5HB 3QUTA 2IH5A 3GFOA 3ZG6A 3DQZA 1B7GO 1GU1A 1R12A 2AFHA 4DKXA 5LOVB 2Z1NA 1L7BA 1R0KA 4TS1A 4BLTA 4UQLA 1X39A 3FXAA 4UNPA 5FL3A 2H1VA 3INGA 1K4MA 2FPIA 4UFNA 3LVRE 1PR9A 3PT9A 4CDGA 1RJWA 4QDXA 5JMTA 5EI5A 1W44A 4QXQA 1RZVA 2JLQA 4EOGA 1O0BA 4PG8A 1YGPA 2QP4A 3FCAA 3PRHA 4AP9A 3BL5A 4HQNA 2IDKA 3DBRA 4I3GA 3S2GA 4BKQA 4FOSA 4NS1A 2B7BA 3UFXB 5T4FA 1XZQA 2Y99A 4GGOA 3H19A 1RM3A 1YDWA 2WWIA 5J2TF 1SUEA 2G8LA 2HJWA 3EEYA 4YUYA 4DBLE 1GR0A 1KAGA 3JQ7A 3SHQA 5LBTA 1K6XA 2J32A 5DLQC 4BEWA 4INAA 3ZWVA 1TUIA 3OM8A 3FFWA 1OZFA 4W5OA 4KGVA 3EWAA 2VTEA 2HA5A 3NNNA 3D8TA 4J3JA 2GR9A 4BRWA 1ONPA 3T7CA 3UQZA 1X70A 2X8BA 1E6KA 5AR1A 1RDFA 1E4EB 4AYWA 3SIWA 1MFPA 2PRYA 2FWPA 3BH7A 1JLHA 3ODPA 1Q2XA 5KYTA 4S24A 3QXJA 4M54A 5L4NA 4JT8A 3NXKA 1ODSA 2AJ8A 4O1MA 3RB8A 2NZVG 2D1TA 1Z3CA 2OV4A 5MDHA 2Z8XA 3IOBA 1DBWA 3VVBA 4BBJA 3UTCA 5JC1A 4HL6A 4UDYX 2VJOA 2Y9PB 3EK2A 2BGJA 2IODA 1NZFA 3I5UA 2WV9A 1XWIA 3R74A 4I1RA 1QOQB 2M9MA 3ND9A 1EK0A 2XRYA 1PJSA 1SEPA 3AHIA 4RLSA 3WDMA 5C9ZA 1TADA 3A11A 1TM7E 2JLRA 1JHZA 3FIJA 4BMOB 4YJ2A 2AG0A 2XCTB 4XGQA 5CDFE 4KH1A 2GJSA 2JGNA 3FVQA 3W5AA 2PCLA 3QPDA 5F4BA 1WWKA 5JT1A 2JEOA 1DX4A 3E4DA 1IBLB 3MCVA 3AY6A 1YFKA 1TB4A 4CYMA 2FN4A 3BHMA 4J03A 1UDWA 3EIEA 3SYRA 4GVPA 3K72B 3H5LA 3JQEA 4OI1A 2Z83A 1HE3A 4Q7JB 4E4RA 4EG6A 1YKSA 4FDLA 3OQMA 5J40A 1WCXA 3FETA 3IPCA 3PWKA 3QRWA 2JHAA 5DOVA 5FRDA 4YP9A 3ZJ5A 3RYCA 1NR1A 5JEDA 3CYFA 2WMDA 4CCYB 2EJCA 4EFKA 2PS0A 4O4LF 1HYHA 3OT5A 1E77A 1FJXA 1E2LA 4EI8A 2ZB2A 2BFWA 3B9BA 1NQWA 1K89A 3C3WA 4UPEA 1OREA 5L9AA 2FPPB 2VWQA 5WRFA 3ZVNA 1E1QD 3LNCA 4YTEA 1W1UA 1Q74A 1T9GS 1R6BX 2W6JA 3PFCA 1E3WB 2IHKA 4HWPA 4LV8B 2XTAA 3QLVA 2RAUA 2GXAA 2IBMA 3OMLA 2R7AA 2MSDB 2WP0A 1ODFA 3A58B 4U7WA 4WGFA 4YXWA 5BV7A 5C7LO 3FNEA 1STOA 3RC9A 4UMFA 1F2TA 3ZHTA 2C7PA 2ZB7A 1EBUA 2OBYA 2ZM6B 3H86A 1JLSA 5ICCA 4K6CA 2HSZA 1AD2A 1IY0A 2I2FA 3UW3A 1L5QA 3KSZO 5KCMA 1ETUA 2HJGA 4BVKA 3QLVC 3U0VA 1UOQA 3GDFA 4B75A 5C1BA 1AUOA 4YJ2F 2HK8A 1JFFA 3B2NA 2YYYA 2Q5QA 1GT6A 1G5IA 1R0XA 1ZJYA 2PSEA 3MWGA 3Q3JB 4GSYA 4JZKA 4LA4A 1JFLA 4MVJG 2VYVA 1OHHD 2MYPA 2WDPA 4LTNA 2UUPA 3KCNA 4D02A 3PX2A 2WKRA 1PT5A 1MB3A 4CKBB 5HTOA 2NXEA 3CURA 4RJTA 3FSGD 2XJ4A 2GETA 3GGJA 4JDUA 4FWIB 2C4WA 4TXNA 3MLBA 4JUDX 1TUEA 5GY7A 1C4OA 1JG2A 1LY1A 2Q0XA 4XJXA 3DBHB 3O92A 1IJKA 4J07A 2J33A 4GDFA 3PDJA 3HLTA 5BWOA 1RPAA 2C7RA 2GPAA 4YUAA 5KDOA 4XQGA 2E7ZA 3AW9A 4E2YA 1E9EA 5I9BA 1HFJA 3M5CA 3GJ5A 1S3GA 4K6HA 4HWGA 1D9XA 4B6SA 1ZGGA 2W2PA 3M5PA 4ZQBA 3ZS8A 4M1EA 3BWVA 4INJA 1U9ZA 3DWEX 3JYPA 4B32A 4MROA 1XTPA 1U6KA 3FW1A 5HUHA 3HKDB 5AW1A 4RY9A 2CFCA 1FNDA 1QWOA 1XVUA 2KM1A 3NC0C 3UENA 1HNXB 2QAIA 3HVRA 1R5NA 4EHIA 5KWIA 4NDZA 2XXAB 4OTZA 5GVSA 4YR9A 1TAHA 1KVUA 1QC5A 1PYDA 2ABWA 1POXA 3CUUA 5DP2A 1BVUA 1RTKA 4H7DA 5A3SA 3L8YA 3W2EA 1WNFA 3H3JA 4IV8A 5BQOA 4II2A 5EVCA 1G0OA 3OJWA 1A8PA 1H6AA 3GQVA 4L3VA 4XRRA 3C6BA 3BMOB 2P77A 3PR3A 3V5NA 1KI4A 3L0CA 4A1FA 3DT9A 1XRPA 1Y82A 4AS1A 3L7JA 1UWKA 2RFLA 1GL3A 1MG0A 2PMBA 2GD6A 1HK7A 2YVKA 3AWIA 3DVLA 3EVBA 1SVIA 4YT2A 3EPHA 1XGKA 1EVQA 3EFBA 1ORRA 4EGFA 4BO9A 1CQJB 1S1MA 4P08A 5K8CA 1Z83A 3GFTA 4HWRA 4ZOEA 2H5EA 3TEFA 1MCZA 3TM4A 1KVSA 2XUAA 3M6XA 4MTCA 4YMVA 3DZIA 3K8ZA 4PCUA 4KR3A 3NDBB 2EV9A 4W5NA 2ZROA 1D0IA 3IIIA 3HUTA 2G0TA 3AFIA 5BSTA 5A0VA 3FDZA 3RSZA 5FBHA 1FFDA 4G4IA 4TQ9A 1EUZA 5J5AA 1X13A 2GBCA 1G0NA 2BE7A 4MXDA 4DLLA 3T1HB 4XI9A 4O2BF 2XECA 5C80A 4MWEA 4YX9A 5BNWA 2A88A 3MS4A 1ECBA 5ESXA 1W59A 2APJA 3C3KA 4JQZA 3L7DA 5AKYA 4H7HA 1M6EX 1L1EA 1CQIB 2F4NA 4LE1A 5FA6A 3VX3A 2P0AA 1E0JA 3LE8A 3VR2A 3R3ZA 1SXGA 1L0BA 2I33A 2IOQA 4HLNA 3OF5A 1BXGA 2WU3A 3KS9A 3X1MA 1VYVA 1TF5A 4QWWA 2BFPA 3MRTA 3N2ZB 4GE3A 4EARA 5ICSA 1EK1A 2YZMA 1QE0A 1SIWA 1Y0BA 2V9ZA 1CUGA 2AXEA 5HDBB 1T8RA 3F78A 4L5BA 4O1IA 5FTWA 3AM3A 1K5DA 5BOSA 2PV0A 3HN7A 2REOA 3QYPA 2WKQA 4UUBA 2G06A 4WDQA 4Z54A 2QBYB 4MJLA 1AA9A 1UKYA 4K2HA 3S2IA 2QGNA 3BCSA 1LBSA 3ACCA 2B8EA 3AL3A 4DDTA 2VK8A 1A95A 1DJQA 3OIDA 1B0AA 2RG1A 4JN6B 4CZ2A 2IXAA 1V71A 1K63A 1JDTA 4YLYA 4F3YA 3OD5A 2ZZNA 4FOLA 1EGHA 3EXHB 3IP1A 3FNBA 1YJ5A 1ZH6A 4GMHA 4ZVSA 3VVCA 1IG3A 5IBRA 3EULA 4ZXFA 2DHDA 3KE8A 4LOKA 1CY4A 2F3RA 1R50A 2G6BA 2R5FA 1JKIA 2IYEA 2ZE8A 4KEAA 5F98A 5F3WB 3D8RA 1YFZA 4RZSA 3CPEA 1OJLA 3FCCA 2Q6TA 5MGNA 2I8CA 4RTMA 1JDBC 1QHNA 4OX9B 7REQB 2CHFA 3B3AA 4ENRA 3EGIA 1D4ZA 3M89A 1BE0A 4D1YA 4ZYTA 2XWJI 3DLTA 4NDNE 3RS2A 4R83A 5A9SB 5DGHA 1TAGA 2I99A 5FOVA 2GEUA 3PDWA 4Q12A 1WAMA 3LRPA 5ECWA 1K4YA 5G40A 2QF7A 1OXSC 3B5IA 3MLEA 1DUSA 1X6VA 2ZBDA 4HQLA 5TMBA 4YY3B 3PQ5A 1G9XA 1VI5A 5ENVA 4FOOA 1RCFA 5B3AA 4DQKA 4BNHA 4OKNA 4G0PA 5CB4A 1KAQA 2WJVA 3GDOA 3PD0A 3R3HA 4YJGA 2ZS9A 2VHEA 2YWJA 1P72A 3RASA 3RJ9A 3LUAA 4B7CA 4RVSA 5B1HA 1H3EA 2QUKA 1OYVA 2BI7A 1L5FA 1ZOPA 2R87A 1I33A 5CFOA 2XWSA 2ZG6A 1OASA 2JKYA 2P2NA 1H3FA 1XQ1A 2Q1UA 2D8MA 3PCRB 4C6TA 2A1UA 5D8DA 4L8FA 3JZAA 2FE4A 1CB0A 1E2KA 1KEVA 4JLWA 3DMNA 4EYKA 1QZXA 4YCNA 4JSTA 2PMCA 4LIPD 2XNDA 3G2JA 3ZEAA 4WUTA 2QTTA 2BM9A 4OH7A 2PZBA 3BWEA 4J0JA 1YQQA 4J90A 3DDWA 4OIMA 4HYEA 3BGWA 4Q7KA 5AJXA 2VA9A 1TU4A 4IHAA 3QOFA 4L6AA 1K6JA 1KMHA 2I80A 3HJRA 4MDHA 5BP7A 4TMWA 4LX0A 1PFVA 5DU2A 4DLRA 2X8WA 1GEGA 2ID7A 2I2CA 3FTDA 1YL6A 3HO8A 3MOGA 4RZ2A 1K7YA 4AN0A 4UD2A 4BLPA 1IM5A 3N2EA 5HYVA 2O3JA 1VPWA 1BMFD 1DAGA 2IYAA 1DWUA 1D7OA 1G8MA 2NOAA 3DOOA 3MCZA 3NLLA 4ITRC 4NCJA 4XIJA 5BRNA 5JZMA 3UMCA 2TMDA 4AMUA 3N2KB 1T4GA 4F4JA 1YRQA 2PGAA 2A9PA 1ZX1A 3Q85A 3QVOA 4JOSA 3TZCA 3GEDA 2JK0A 3LQRA 4B1FA 4PN3A 3H84A 3ONEA 1R5BA 3D4NA 3NHPA 3TIIA 3AMVA 4YJKA 1QG0A 2QAGA 2HFKA 5IKPA 1T35A 4UVEA 1IK6A 1FDVA 4P4GA 4XFDA 4RK0A 3KPYA 4LF8B 4DEXA 2Y1GA 2IHZA 3Q5EA 4JI4B 3IIJA 3HN2A 5IJ9B 4RTQA 3NWOA 1MT3A 1DMRA 3I6ZA 2X9VA 1MQ9A 3G3EA 4BV8A 5A05A 4H7FA 4EW1A 2IH2A 3O2QB 4YLGA 2PKYX 5A3VA 4RE5A 5ITSA 1KFBB 2WINI 3G2MA 5J1TB 3ZDRA 5LDDC 4PZZA 4LXIA 2ZJFA 1Y6RA 1TTHA 3GH1A 4DLYA 3L8EA 1D2MA 4LOAA 4UAJA 1YQ9A 3SSNA 2ZTUA 4DIBA 1EINA 1JKJA 4YK7A 1F7VA 3WMRA 1I0IA 1Y37A 3ESBA 2ZI3A 3N2NA 2YMPA 2ZUDA 2J46A 5FA5A 3KXKA 1JDPA 1O6BA 4CDNA 5C5CA 3I9V6 2FY8A 4QGSA 5L7TA 4BEVA 2W5UA 3IIKA 3K8YA 5K99A 2I6TA 2PXHA 2NX2A 2C9CA 2OG1A 3HU5A 1V5GA 4BFXA 1G4AE 3IXMA 3A2NA 4FCCA 4RPIA 1GTL1 2VNAA 6LDHA 3AFHA 4MNTA 1NV9A 2HTEA 4QYIB 4FCTA 4C01A 4K3UA 1H5NA 1PZNA 1QJCA 1JEEA 1J49A 1LS6A 2N9UA 4WERA 3R5XA 3ZU5A 3JPYA 2D1QA 3E2IA 4B7AA 1Y1RA 2XR1A 1U1CA 1FJHA 5AHKA 3FHLA 1E2HA 1WTCA 3F3MA 4FHEA 2DY1A 2F43A 4GU5A 4A7PA 4OQLA 2IY7A 5L8VA 3HNOA 1BTOA 4R2LA 1NW5A 1R64A 2SCUA 1MABB 1G66A 2BYTA 4DV2B 4Z3KA 1NDHA 3KWJA 5TPZD 1FBNA 4IKEA 1Q20A 1U8YA 5BO5A 4R2HA 1USWA 5K0JA 3THXA 2VZLA 4NP6A 5AD1A 4YXFA 3MEQA 2ZYGA 2YN0A 1Z4JA 5AJHA 1NT4A 2Q3EA 1M5UA 2R2AA 3PXEA 2SKEA 2JJ1A 4I0WB 1EFUA 2LNDA 3CVYA 2QTAA 1Z26A 2HEGA 3UJAA 4EVRA 4UD6A 3DDUA 3VH3A 1K8XB 2VC2B 2A59A 2XE8A 3E3OA 1LLUA 3IJRA 2W90A 3X1JA 1VCOA 4R69A 3IO3A 1G20E 1EJ2A 1A72A 1QQ5A 1LF5A 1OYWA 3GR6A 2BHTA 2LV8A 4JLVA 1MEJA 4EZIA 1YC5A 2ZUBA 2IHJA 3BFKA 2ATIA 2I1VB 1OXXK 3KFXA 3TRHA 4Z9AA 4F60A 5GZ3A 4BO3A 1PJ8A 2GA9A 3JR3A 4J2HA 3Q88A 4NFHA 1IPHA 4TM8A 4YO8A 2J0VA 3NS7A 2PWYA 2G9NA 5JIBA 1V3UA 4DV7B 3T1TA 1ZHFA 3KKOA 4X71A 1GYRA 2NZXA 4EATA 2R86A 4AJ9A 4HNVA 3DF7A 5KNDD 5FNVB 2MOKA 3K2BA 1DIOB 1P77A 3GY0A 1TA9A 5JSHA 4LJ7A 2IXDA 4CKEA 3GLIE 1EHCA 2Y0BA 4XYEA 5LXTF 3E23A 3KJFA 5HOQA 3LWDA 1F3OA 3UY4A 2PQ0A 2FW9A 1NPTO 2WF9A 2XIQA 1S5PA 1E18A 1ZVMA 3ENWA 3LH5A 3HUEA 4NMXB 2FJPA 3G0DA 4UUNA 3QUCA 4GSKA 4RACA 4FZRA 2W6MA 2ZWPA 1GNTA 5CX4A 3LUCA 3A70A 4CTOA 1BKYA 1YDHA 2NIPA 1T1IA 4ZQCB 3C97A 2LE0A 4X3OA 5HEKA 2P4SA 3EGWA 3VHXA 4DXDA 3T9AA 8ADHA 2P2GA 3VH1A 2BTEA 1VIVA 4D3DA 2V1XA 3PCXA 4M8SA 2FZWA 1IRIA 4ZXPA 3AEQA 1E79A 2G0NA 1J2RA 1I4WA 2O0LA 3T4EA 3GRKA 1QZ3A 3RF7A 1H93A 1WEHA 2M98A 5DHPA 1OI7A 1KARA 4DCMA 1AB6A 4EABA 1CE8A 4XOUA 1D1TA 4Y8VA 2RC5A 3C6XA 1F48A 2I7VA 1LJ8A 4TXLA 4ZT7A 1YDFA 3KWMA 2VYQA 1M2WA 4UTNA 3OQIA 2GCIA 2UKDA 1JMYA 1C41A 3DBLB 3E27A 1UC4B 4LYYA 4R0NA 1RI5A 5HK8A 3H1PA 4GZLA 1L7DA 1LJLA 1QRRA 3JQAB 2DE0X 2V4MA 1XRNA 4HNAB 1IBSA 4AY5A 5IHPA 4ZYYA 4HAWA 4NBVA 3KKQA 4RDCA 5EVJA 3KQLA 3JQ6A 1RZ3A 2BJVA 3BHJA 4A8JB 1M73E 4ZKDA 4P5EA 1JRLA 1M6YA 1QGDA 4ZQGA 3ASYA 4ER0A 4CM7A 3DEFA 4BVGA 1BSVA 1CHDA 1I01A 4F4CA 4KPYA 3X1XA 2WD7B 1V2GA 1WY7A 1QDUA 1U98A 2VUTA 5H70A 1QP7A 2D00A 4M86A 4J4HA 4FNGA 4X3PA 2A0KA 2IS1A 4F91B 3HA2A 2WHYA 3T12A 3RYHA 1NG9A 5BSHA 5EJ8A 3FCOA 2OWEA 1JVNA 1LRKA 3ZZMA 2AWOA 3A27A 4WUVA 5A5GA 5E6SB 1Z29A 1D2AA 5CTJA 3OPYB 3PITA 2EL7A 1YRYE 1O9BA 2JAQA 3SS8A 3DMTA 3EEBA 4L07A 4MW2A 1WJGA 3DKRA 2HQOA 4UEJA 4URZR 1BC5A 1T3ZA 1AN9A 3JALA 1NYLA 4KACA 1M1YB 2B25A 3DHYA 3LX8A 3PGXA 1AOXA 1E2FA 5EE0A 4ASUD 2ZRPA 4LC0A 3ECAA 5C4IA 1FP4B 3LUFA 2JLCA 4X45A 1LQUA 3E18A 1MXFA 4KL8S 2GN1A 3PNPA 4GX5A 3IP8A 1NP6A 1Z6TA 5DWDA 5JXJA 2HA7A 1D1QA 3G85A 1Y4AE 1KI8A 1DAFA 1PV2A 2NSHA 2NU7A 3GBSA 4L3WA 4DCPA 1FW8A 3KEFA 4EA6A 1Y34E 1YRBA 4KXYA 2XCSB 1WPQA 2ID9A 2PFGA 4J94A 4BE9A 3T9CA 4Q4AB 2VJLA 4PTZA 2WJAA 3MILA 3NBAA 1PLJA 1E20A 4KQMA 3H7IA 4GW3A 1ZR2A 4WL0A 3ORSA 4P54A 3LDAA 3WGZA 1KBZA 3E22B 1Y89A 1KJYA 3L7IA 3MJRA 1XPOA 2I6QA 1JR4A 1C9DB 2V74B 3SYMA 5DV9A 4CMGA 1BWRA 1KP3A 4Z6KA 1XAJA 5KPJA 3GPLA 7AT1A 1TECE 1KY3A 1GIAA 3HCBA 3EBLA 4MVJH 5CNJA 3RFTA 4G6ZA 4NEQA 1TYDE 4REOA 3UOGA 4RQAA 5IC5A 4B71A 3B1VA 3GJ6A 1FJ2A 5AK3A 2C04A 4LDQA 5DRTA 3P0JA 1W5EA 3CKMA 1Q3TA 5BYAA 5JH7F 3VJLA 2FSIA 5AVQA 2Y0DA 2XMZA 1N8NA 5TRTA 4YWHA 1NUTA 1KH1A 5GVRA 2OQ2A 3OZUA 4EGJA 4RKYA 1LNZA 3C7KA 3OZ7A 4EPWA 2R00C 3WDSA 1X1QA 4RIFA 1HR0B 3PDIB 4P7JA 4QFCA 1ZHOA 2DJIA 3IOMA 5KQMA 4J0GA 1L3IA 5LOVF 3QKRB 4TZKA 8ATCA 1CYDA 5KKAA 4PLYA 3CEAA 5CFMA 3QELA 3HBLA 2HM7A 3WJ1A 2PRKA 3DEHA 3W77A 4DPMA 3OA2A 2OBNA 5JNSA 1AHNA 2B2XA 2BMVA 3QW2A 4LVOA 3G5UA 3ROEA 5J5VA 3U6KA 4J0EA 1FSFA 2QE7A 4LBZA 4K87A 4EAAA 1I14A 2IIPA 2UZ0A 2WT4A 3CVJA 3PBKA 3TLGA 1TZKA 3SNKA 1IJFA 5D3QA 5IULC 5EJ9A 1ENPA 2SHKA 2OILA 3KIPA 3OD1A 3VC3A 4EB3A 4X65B 4W1SA 4X92A 4FLFA 4GI2A 5E2IA 4BAGA 2IYOA 3HFRA 1M34E 1E4VA 3L1HA 2WVGA 3A0RB 2WIKA 1NW9B 4IICA 5E9AA 1D2HA 1FMTA 2C1EA 5LP6B 2DTDA 2RAVA 2PKCA 4G89A 3VI4B 3MT0A 1GZ3A 3TCXB 3R7FA 3PYLA 3IOYA 3KQYA 4NCHA 2IZ0A 3DB2A 2F59A 5ALNA 3WJ2A 3ZCUA 1X1SA 5I7VA 3I2FA 2HHLA 3EYAA 5EP1A 1X2BA 1C29B 2YVLA 1CUXA 2WILA 2NW6A 1G291 1VRVA 3CRZA 2EIXA 3EZFA 3K05A 3K09A 3NKVA 1TF2A 5AOAA 3DW1X 3U62A 4BCCA 1C1XA 1OFUA 3JQGA 3GJQA 4OQQA 3W9SA 2BFCB 1CP2A 3O6VA 3P9RA 1M2FA 4QFMA 2EF0A 2Q1TA 2VNKA 4XVHA 1MDBA 1KMIY 2QJOA 4XWAA 1D2GA 1X2EA 3BOSA 1ZBQA 3F7OA 3MN1A 3EXFA 3CB4A 4JT9A 4ZCSA 5AQEA 5IANA 4UKDA 4LTMA 1T3TA 3FMPB 5ALIA 3EIWA 4C06A 2V7XA 1PJCA 2YRWA 3AEUB 3KOOA 3RSGA 1L7MA 4D6PA 3SQWA 3VPHA 3G5TA 2CSUA 3BAFA 3BJZA 3F2VA 4CKBA 1SY7A 3NBQA 3F4LA 3VU8A 1T6YA 2C4MA 5FYQA 4EY8A 2LTAA 4KYVA 2WV7A 1DDGA 5JSYA 5JQWA 3F97A 5JCJD 2W2LD 3IULA 1JEQA 1BEZA 3VR6A 4FS8A 3HVUA 4RYLA 1J20A 5DBEX 3KUUA 2F9MA 2FJUA 2JH3A 3N75A 5KSYA 1KPIA 2BGUA 4QHSA 4BLUA 4LXQA 1XWFA 3F90A 4UXJA 2IY9A 3L7KA 1G64A 3DL4A 3H6GA 4XCQA 5DLYA 4LOJA 3WK7A 1QU2A 4A0SA 5E0KB 3HY3A 3ZWBA 3WK6A 2VZ9A 2ZXUA 3AKCA 3DONA 2EGUA 2XNSA 4J0QA 3FRHA 1N7HA 1T5HX 1FC0A 3NG1A 1AIPA 3CG0A 3QMMA 1ZOSA 5BSKA 3LP8A 1V4NA 4U7TB 3VZBA 1ZMXA 1W46A 2OUKA 1IZ0A 2YV2A 3UK7A 4ARSA 4DSNA 2OL4A 2RGEA 2Y92A 1O87A 2XX3A 1FYWA 4GL4A 2FSFA 3I52A 1SBYA 2AA3A 2O9JA 2UYHA 1PU2A 2NZYA 1PSWA 4RV5A 5C1PA 5KC9A 2QR3A 3IKMB 3OSZA 3WGUA 4LXGA 2WVJA 1HE8B 4UEQA 4Q48A 4LECA 4L4UA 2H1RA 4N01A 4QM7A 5LMNB 1C7IA 4H2DA 3ESZA 4GP9A 4GYKA 1Z16A 1YZYA 2F3SA 3NYRA 1JHYA 4BMSA 2ZAOA 4KK3A 5T64A 1NAHA 1DJOA 5I9LA 2R65A 4P35A 4UE6A 5D1NA 2Q3LA 2XVAA 4D74A 1NATA 4B80A 2Y9MB 4IZIA 3AZQA 2CEKA 1FNSA 2C58A 5D6OA 3SJUA 2ATVA 2Z2XA 3QHPA 3SLRA 3TTWA 3BN3A 1N7IA 5ER9A 4F71A 1RFGE 1XALA 3ZWAA 4ZMBA 4EYGA 1S2OA 3FDIA 1A4IA 2AF4C 3K0HA 4U2GA 4BLQA 1XTJA 2Q3MA 2HT1A 1W75A 2GZDA 3RS7A 2JFPA 1QK3A 2VJYA 3I1IA 1JIVA 2ONCA 3MT9A 4ESEA 2A6PA 3FRIA 2WQZA 2R6FA 2RHGB 4R2JA 2G07A 3A4NA 4PYLA 1NVWQ 1RABA 2AG8A 3M33A 4F3NA 4D3ZA 4D3FA 4HLQB 4PNEA 3DE5X 3KUDA 3RS8A 5FUMA 3CZPA 5CLIA 1YV9A 4ZU3A 4BGVA 2WJIA 4DB4A 1DRUA 2WM9B 1B8PA 3L4SO 2WE8A 1L7OA 2NTVA 1N2BA 2AL7A 3JRNA 4POAA 2QD2A 3AR4A 2VKQA 4E13A 1DBSA 1MAVA 2EYQA 3MC1A 4GMXA 5PNTA 3VO9A 2XOXA 1QB8A 3RJMA 2IIBA 2QRJA 2P2LA 3HJCA 3PPXA 2R96A 2VYND 4ZVOA 3V4FA 4OBWA 4IEIA 3SQNA 3FIUA 1ZFNA 1QVWA 3IUQA 4C6RA 4NULA 1K5GA 1JR2A 2WAAA 1W52X 2AYZA 3OJCA 4M3NA 3S1AA 3VV2A 4PHFA 3Q7IA 4A91A 4OVKA 1CS4C 2CNNA 4AUNA 3A6JA 4BMXA 5E0OA 4EI2A 1PT8A 3WMXA 2HXYA 3QU9A 1IN7A 4BECA 1JG6A 3RSSA 3N76A 1SC9A 1TO6A 2HDWA 3IVCA 4B31A 1LDBA 2OV1A 3CISA 1PVDA 2O50A 3K0AB 1PS9A 4NHOA 2A0UA 4CM1A 1N2EA 1G8GA 2LXNA 4LEIA 5M2QA 3VSCA 5IAOA 1J8YF 3E0XA 5D5QA 2H11A 3FOCA 4YJFB 3Q6NA 3ECCA 3ELDA 3QG5A 3MMSA 5EZYB 3D8HA 2RHDA 3F7MA 1MFZA 4N76A 6ADHA 1TKRA 2PVSA 3PICA 1KFJB 1FUKA 1DQYA 1ZSVA 4H9GA 4RTKA 1QX3A 3ZE7A 1YL7A 1CUCA 2P79A 3FPCA 3HHEA 3ISVA 3P9NA 4TPKA 4XUCA 4L78A 2HJRA 3OJXA 4EQ6A 4GRAA 4CKWB 5TJ9A 1GGFA 1H2EA 5K7SA 1G7RA 3I04A 1T10A 5LB2A 2RDMA 1JPNA 4K9SA 4AW9A 2JFFA 2VF5X 1EB8A 2CUKA 1U0EA 3MS7A 2YWHA 1DFGA 3I01M 3DMGA 3MJFA 4PX2A 1ZO8A 3MQ2A 4XWOA 2ZRCA 4RTRA 1RACA 1ZRMA 3A04A 3RNOA 2A9KA 4CI0B 3G5AA 3G9QA 3KKLA 1EU1A 3NHZA 4L85A 3EBPA 3W5SA 2RE8A 3BULA 1ZAYA 2ZE5A 3H1TA 1R37A 4JODA 2HU5A 1SHKA 3TSCA 4FT2A 4DREA 1G17A 9GPBA 3FJ1A 4KO1S 621PA 1ZN7A 1CWUA 2CE7A 3D59A 4O4HA 3BZUA 5IKMA 5BW6B 1OAKA 3ZYCA 3FG9A 4FGJA 1TTTA 2QVYX 4M9XA 3JV7A 4MGEA 2C2XA 3L0BA 4TWRA 4KN5A 2GK4A 4CFSA 4WECA 2ZYHA 3D3WB 1X1RA 1FDUA 4Q7LA 3ICEA 5DHFA 2I4NA 2NV6A 3NB0A 2RGUA 4V3CA 4HDKA 1WQ1R 2NU8B 4AURA 4KITB 1NQUA 1P2VA 1CS0A 4OK6A 3WNZA 2GERA 4BFLA 1NLYA 3M7IA 4V0ME 5HMLA 5EHQA 4D0NA 3VKFA 1C9YA 4J0HA 2FX2A 5DI3B 4B2PA 4L15A 2O52A 1ADBA 4NH4A 1Y81A 2WUVA 1SQ0A 4DJAA 4P4UA 1GUDA 1BAPA 1MLDA 1NDUA 1O58A 3CY6A 1B42A 5EWMA 5JVDB 3GI1A 1KI6B 4UBOA 4YJ3A 4BYMA 3B3JA 3WXMA 3NFYA 4J7AA 2XXBA 2JGJA 5AK5A 4UQPA 5JLAA 3ZHYA 1C2TA 3IUSA 5JNTA 1N2SA 3I5XA 4HH0A 3F8WA 3NEPX 5B7NA 4LZPA 1TCBA 1ZI9A 5IZCA 2V96A 5F2OA 2WZQA 4PLGA 4L6CA 3RKRA 4EG5A 1YZTA 3FWZA 4LJYA 4B3JA 1DEOA 3C48A 5BUCA 1NBMA 2MIIA 3IKLA 3KQVA 5KSZA 4DV5B 4ERXA 4JLJA 1Y1PA 1U7PA 2QUZA 3NEAA 3HEAA 1PR2A 4RPKA 2C4KA 2CVQA 3E9NA 2XRMA 1C7JA 4OYHA 5A4DA 1DU4A 2QTVB 4YASA 3H9GA 3LGXA 4JR1A 4Y2XA 4QXRA 9ATCA 3MXTA 5D51S 3HGTA 3R9XB 4BUCA 1C7RA 1JPJA 2JIOA 2QQFA 3DDZX 2KSQA 3IHLA 4Y6OA 3FMFA 1X7DA 3KHUA 4QTYA 2VT6A 5AXAA 5JAHA 1MVNA 1N0WA 4BPBA 3D02A 4ARAA 5KQRA 1KORA 3IIMA 4OJQA 2FUEA 3CLTC 1J5EB 3RARA 2O6LA 1PDWA 3DUFA 5TPWB 2VO1A 3JAWB 2RGYA 3KEGA 5CT9A 3UN1A 1CJCA 3TJRA 1TRHA 3K4QA 1DZIA 2JFHA 3CQ9A 1QP8A 5DCYA 5K9ZA 1HT1E 3F9RA 4Q1VA 3M6LA 4F2PA 1HYGA 1Z0IA 2AC4A 1OTXA 2X58A 3ETGA 3GCGA 1M1ZA 3GEPA 1SB9A 3WIDA 3ZE6A 1OWMA 4BBAA 5LWHA 4M1SA 4EZEA 2HB6A 1OIXA 3F8SA 3MMPA 4EY7A 4L4XA 2VPYA 3ROTA 3RUEA 3SEZA 5JYBA 2H5JA 4Q34A 4E03A 3ZCRA 1SCIA 3PZBA 3DFIA 1EXWA 1U2PA 3QLUC 4C0AC 4QOHA 4V0QA 3VV3A 1Y7TA 3DGFC 1QFZA 1S3IA 3AUUA 5HPYB 1KR5A 4QDJA 2ZR9A 2PJZA 3PRJA 3PYXA 1UWLA 1EQUA 1I1NA 4UVGA 1AXGA 2PEYA 1K5PA 3GHHA 3IT0A 2XUZA 1H0HA 1RJ9B 1XVVA 1N6OA 3NXSA 5K0BA 4RYDA 3C3MA 3B1KA 3K9GA 4ZVUA 1GQYA 4EGAA 1NBOA 4NR0A 3PGLA 4JQSA 2X8JB 4ML3A 1KOFA 3NANA 5AHOA 4ERNA 2BTOA 3X2FA 1A0OA 3QIVA 4BFZA 1WMFA 3U80A 5B6PA 5HOEA 2WTEA 1PK7A 4Z53A 4P98A 1NV8A 3DAOA 4MI1A 4DYDA 2G71A 2ZRLA 1P3JA 3B1JA 3H8JA 2OCAA 4QSMA 5L6MB 3VYRB 4KVAA 3WG9A 3TL2A 4NOKA 4KVFA 5JXHA 3QOWA 3VR1A 4EG3A 3WL7A 2AOUB 5BR1A 4MKZA 1Q3KA 1Z8NA 2B92A 3KYJB 3Q7RA 4CV0A 1GU7A 3CEMA 1GFSA 3T7SA 5EIEA 4YRCA 5JUWA 3DGEC 5D3ZA 4AMZA 2V98A 4DR2B 1VL5A 1SCUA 2G1KA 4LI0A 1MF7A 3E8MA 2WY2D 1DKMA 1J7JA 3BK1A 2FEAA 2PUEA 2W6CX 4C6SA 4X7RA 4EYQA 3O8CA 2UZ1A 3ICWA 4F3TA 1P60A 3AESA 4Y6RA 4BGIA 3PUXA 1E7QA 4X6XA 3USES 2BMWA 1O5IA 2ZUUA 1QGAA 3DZFA 2RCYA 3KOMA 4GI3A 3A8TA 2NSDA 2OXRA 4MRRA 1P62B 2V7WA 3A2LA 3T35A 5U4QA 3VDRA 2DQSA 4G5QA 3SQLA 1LZLA 2NZUG 3QXHA 3WL4A 1S2MA 4O63O 4N8DA 1ZIDA 5A62A 4ZO6A 5GV8A 4M8NE 4RSRA 1QGED 1CLEA 4JVOA 3KM0A 1PGJA 4HB4A 1ZOIA 2XGGA 2G5TA 1N5IA 2XZDA 3U9LA 4AJOA 4KBGA 4KXWA 4ER7A 2XRFA 4ENQA 3DE0X 3FA2A 2P91A 2O2CA 1MVLA 3VZPA 1NXOA 2QRLA 5AI5A 1K7EB 3FUVA 1KJJA 1N6PA 4PO8A 1WW3A 2G40A 3WQSB 3ZK9A 4DCOA 3RUIA 1ORTA 2LCQA 3R9WA 3NHBA 3FUXA 4MQ5A 3TQFA 3C85A 5KC8A 4IRXA 5LDHA 1T9ZA 1Q1GA 3GLGA 3D6AA 3TO5A 3V1LA 3O4GA 3V8MA 1FS4A 1IC6A 2IIQA 2Z56A 2PQ2A 3K20A 4QASA 1KSGA 3VAZA 1YQGA 3KQSA 4OP2A 3A3YA 3T5TA 2E4YA 4M9QA 2PTHA 5JS1A 3U4GA 2I03A 3URKA 3WKAA 4MA5A 2CL5A 2JBAB 1FDWA 1RE1A 3DLIA 3LT5A 4NJMA 5EMMA 3TCKA 1A4XA 2AJLI 2CUTA 5KNDH 3HCFA 2Z09A 3AFOA 1X7ZB 3KDSE 2VJAA 3GAFA 3KT8A 4HO1X 5E2AA 3A6DA 4KAJA 3V4RA 1Q2UA 5GQSA 3RIMA 1YHZA 3Q9SA 1LK0A 3SAJA 3OPVA 3OLXA 2MR5A 5FNVF 3PTLA 5JNVA 4OLBA 2UVDA 3L01A 1PZGA 4GQBA 4DMLA 1EJBA 2HT6A 2HRBA 3LLSA 3SDBA 4YAUA 3ZLBA 3LC1O 1T0HB 1I2BA 2XT0A 3QJYA 4RA9B 3CNNA 3C5WP 1RJGA 3PQCA 5AJUA 1CP3A 3KKMA 4A8JC 1RLOA 3F6BX 4N39A 1WXQA 2XH8A 4WZZA 3WFZA 4BY9E 2JFUA 5EERA 1NJ2A 4UCQA 5A9TA 4E2WA 2IU6A 3NTQA 4WCVA 1CX9B 2XHEA 2HXSA 2QRMA 3HYCA 4QFDA 3ZGOA 5JS6A 5EUQB 1LRJA 2RKBA 3SIRA 2NLOA 1QAOA 3HVIA 4GXRA 1LVGA 2HDOA 1XDDA 2RAFA 3HADA 4H3KB 4MQFB 4AWBA 3PJRA 3O8BA 1P2BA 3A7DA 5HE8A 4LXHA 3HCWA 1B73A 4DA6A 4US2R 3U7FB 1J24A 2WJ3A 2UYYA 1C7ZA 1U3VA 2VJQA 3WE7A 1L8LA 3ZWXA 3F47A 2Q3BA 3K70B 4WK2B 2ZJ1A 5ALYA 2HRDA 4N5IX 2O4CA 4ZEXA 3U39A 1ZP6A 3GJ7A 3WGVA 1RXCA 1JSRA 3KR0A 1CY0A 5DNEA 2HRZA 3Q8WA 1JG1A 4F3KA 1NT2A 1U90A 2QNBA 2F6RA 3Q3CA 1FUUA 1A8IA 4EYSA 3F8TA 4FX5A 3QI2A 4IMRA 2WWXA 1SOWA 3E8XA 1YUMA 3MMNA 2FX3A 4KRXA 1VECA 1MORA 1OGJA 5EP3A 2WZBA 4RKRA 4LNUB 2O19A 3DNFA 1WB4A 4M1ZA 3UJ6A 2ORIA 3VZQA 2GT1A 3L02A 2DG2A 4MW1A 2NO9A 3ZHRA 4CQMA 4ABYA 4A1OA 2PMWB 1OOEA 2WOOA 2B37A 3I3SR 2ZRMA 2PSDA 4ARIA 2O5EA 2NNLD 1ABEA 3WLNA 2I66A 3JWGA 4B3SB 3TN7A 4AD8A 1HLDA 1XTRA 2AC7A 4RUKA 2VF4X 3TL6A 3ZWWA 1D8TA 3I4CA 1VI6A 2Q4TA 1JXQA 4QBKA 2WWVD 1C3VA 4IJ5A 2JHPA 1ODLA 3U3DA 3G2HA 5EL0A 4Y9SA 3KL4A 1U9IA 1LJUA 2P9CA 3JX9A 1EP2B 4G4JA 4RJLA 3AUXA 5I9MA 5SZHB 3RF6A 1W94A 2F55A 2VDRB 2YOHA 1K7XB 1YK0A 2OHFA 2O1SA 5C18A 5AHXA 1R9NA 1GQ2A 5B53A 1DC8A 2VHCA 3WNCA 4ZAGA 3HYTA 4HADA 2GVNA 4ZT3A 3BRWA 4TX1A 3T0FA 1HDOA 3T1OA 3QKRA 1QUFA 1KNXA 4QEDA 3SC3A 4HY3A 3R6GA 1IHYA 1AZWA 1UK6A 4MRVA 1J8FA 4FYVA 1VGRA 4K1XA 4BQNA 2CV2A 1U9IC 1HETA 3I9V1 2O2DA 4MYSA 3D2AA 1MP0A 1NG1A 3LY8A 2W8ZA 1O3YA 4J2TA 4PBSA 1YTUA 4RHCA 1E9FA 3UKOA 2BH2A 2DR0A 4RXTA 2JFVA 3HVKA 3KWLA 1H4QA 4QPPA 3FGOA 5EUMA 2E55A 3FWYA 1P4JA 5G0UA 3AKZA 1YJQA 3COZA 5BMOA 1QIEA 2AZMA 1B8VA 2X41A 3J7TA 2QW1A 3ICVA 1PJBA 2RI6A 3G0BA 4ACAA 2DFLA 3COSA 2NP6A 3AVWA 1MQ8B 3KQNA 4AJ2A 2DUUA 1R0CA 4OQMA 1ZGAA 2ATCA 2OR3A 5DMHA 3MD0A 3HO1A 5MN5A 1M5TA 3H18A 1IL0A 1OFHA 5TIIA 2Z4TA 5LP6A 1Y98A 2SNIE 4YAWA 3DOCA 1VG8A 5HF8A 3TTTA 1M2VB 3HJGA 1JIIA 4MUNA 1AXRA 1UKBA 2E9SA 3EGXA 5CVUA 2A7XA 2W6JD 1UMKA 2WJWA 4W9RA 1XOIA 2GASA 2WSMA 4YXWD 3QNWA 4OHPA 3W6OA 5BR7A 4MUEA 3SPXA 1NNI1 2SICE 3E0QA 5LP6C 4BJ6A 5IM4A 4LYAA 2EKPA 3R41A 3UJ7A 5DSTA 1G4UR 2RK3A 4MKIA 4TWAA 1EXMA 2ACWA 2C4TA 2Y8EA 3SN6A 2H2IA 2J6HA 4H6PA 3RGWS 1TDJA 2Z04A 2B82A 1DCMA 1QOPB 2A5GA 3QJ5A 1IHDA 2DKFA 2YCBA 4WWHA 5K51A 3NDRA 4I5GA 1LBEA 2YX1A 5DCWA 3AEUA 4AJ4A 2P9GA 2VHYA 4C0SA 2VYVD 1J5PA 3FSRA 1V43A 1ML4A 4KO2S 3IT2A 3DEJA 1T8UA 2P6MA 3H9QA 4MUKA 3RK0A 1F1JA 2LDXA 4M1YA 4PANA 4YDRA 1QIKA 3NYQA 4OV6B 1K7CA 4ZD6A 1P9LA 3G1TA 3HVJA 3LPAA 3RBAA 3TEJA 2H5LA 5GM1A 5KAPA 4EVSA 3ADKA 3CE6A 4C04A 3V7FA 4Q9KA 4LXXA 1V41E 3GA7A 1K7FB 3GIWA 4OQEA 1VMKA 4HPWA 5KEIA 2D5LA 4NCBA 3HDTA 1QWSA 3S1SA 2WTAA 4U5QA 5COBA 1E9VA 2XV1A 5B1SA 2YY5A 3OJOA 4XD2A 3PNYA 1WOYA 1F9EA 1FRFS 4ISCA 1GO2A 2FQXA 3PNVA 2B98A 1F1BA 5LP6F 4PLFA 1H2HA 4Z51A 1D03A 3IPLA 3T3DA 1NXTA 4BP8A 1IY2A 3QUSA 4ZOQI 1J9ZA 3D4LA 3JWHA 4UBJA 3EFEA 3RLFA 1R16A 2HC9A 3CHYA 3KOXA 3CF2A 4I81A 4J3FA 4H0NA 3GELA 3T5MA 2FZ4A 2O1EA 2V6GA 2WNIA 2WAXA 3DEZA 4TQAA 1DGQA 3EVDA 1U0LA 3NOQA 3ER8A 3NHKA 5DBFA 3ZE2B 3D8SA 4JXKA 3OCJA 4LRWA 1RWKA 1HWYA 2N46A 1PZHA 1TKCA 3WVNA 2G4CA 3WB0A 1SKYE 4DG5A 3IHKA 2GPBA 3LQ1A 3OZBA 4RKQA 3U37A 4YQEA 3WWYA 4ZTZB 1ZZEA 4XGRA 5FUWA 5H80A 4Z3DA 1NNEA 3COJA 3PFHA 2CLSA 2ZYVX 4X84A 3MT7A 3KHTA 4MW7A 3TM5A 4BFVA 3UB4A 5CXQA 2IBSA 2W2MA 3DE1X 2F3QA 2Q6KA 4OK3A 4KRGA 3D3NA 3OX4A 3PHHA 4GH5A 1BDJA 4OJKA 1U99A 4HVLA 1VG9B 4EG4A 5HS4A 3UAYA 4B3TB 3VTFA 2DQ4A 3ESYA 4P93A 5GONA 3ASVA 4KR9A 4MPTA 4ZTBA 3V80A 2G5CA 1FPMA 1KJ9A 4MKRA 4GI7A 4M83A 4Y2VA 3VOSA 3F7NA 2H2HA 2IC5A 3FFXA 4HRAA 3RVNA 3ESXA 2IA5A 3P5SA 1EZ4A 1XRRA 2QZ9A 4RVGA 5HK9A 2E87A 2WK1A 2QN1A 3BIXA 5FPHA 3QA3E 2DUNA 4KXXA 4UTPA 3LPDA 4CQLB 4D6XA 3IVAA 3WDLA 4BQPA 2HHAA 4YV1A 4U7HA 5DWVA 4YHBA 5LQKA 1T0BA 3L8GA 3CGWA 1R8SA 3UHAA 2H1CA 3ZDAA 5CBPA 2IDJA 4LF9B 4G1UC 3LQQA 3DEIA 4JBWA 1XBTA 3I6MA 4A8HA 4DADA 2QMEA 3EOZA 4G1MB 4HS9A 3GRVA 3O3MB 2V3WA 4HB3A 5AKJA 2JFWA 2BHNA 4ND7A 3PWSA 3CH4B 1QPBA 3EQ6A 3VR2D 1QP0A 3V7WA 2P1DA 1T4CA 4M0UA 3THRA 4D4HA 5JJLA 2HV8A 1H0KA 4PAMA 1GXSA 2V54A 4HGPA 8LDHA 4IQ4A 1E58A 1C0EA 2QX7A 3TFOA 2DM6A 2JGAA 1IN6A 4JI2B 3BWMA 2UYOA 1GAXA 1TOAA 1XCOA 1YONA 3OX3A 4X94A 3ND5A 2RGNA 1VP3A 2WI8A 3C6QA 5AM3A 1TZMA 1DLIA 5JBQA 1GL9B 1N6HA 2BF4A 3K0AA 4J4BA 4O0LA 4LY6A 4US1R 4ENTA 3WQBA 3QOXA 1C50A 2Q8QA 1NIJA 1XC7A 2PT7A 2XWPA 3NZEA 5HDQA 4QRHA 5IJAA 4DNPA 4UW9A 1UUFA 1NJGA 2X0EA 4I50B 3A6FA 1D1SA 3WTCA 3EG9A 3DMFA 5B64A 1BOOA 2YIVX 4Y1FA 1PFKA 2RGNC 2RHOA 2OZLA 4AZ0B 3MZ0A 4K5QA 3Q5DA 4FE3A 1E6UA 5L6LB 3K94A 3MHTA 1SM4A 4KFCA 3IDQA 3GW8A 2ZJZA 1XMQB 1DIBA 1NLZA 4RDIA 2H2DA 3OEHA 3QKSA 1LGYA 1XN4A 2VPZA 3K8OE 3H8VA 2XZPA 3LC0A 4H77A 1XVAA 4HTFA 2M2IA 4RFSA 2P3OA 1OBFO 3IP9A 3OOYA 5ESRA 1EG2A 1RQRA 1JI3A 2OV6A 2RHCA 5GM2A 5JDCA 4G0OA 2GH1A 4AFNA 5CLGA 3KJGA 1PLLA 3ORYA 4CMIA 4ZCTA 3WXBA 4ZJZA 5KNCA 5FFFA 2W2QA 4R16A 1D2NA 4P7GA 5JJBA 1A2BA 1IEXA 2XAAA 2ZUWA 4DCVA 2AX3A 1II0A 1KDVA 3L0SA 3MUFA 3T99A 5A3JA 3JWJA 3ZTWA 1UDCA 3BEOA 2GO1A 1HY3A 5JDCC 1TC2A 1Y1KE 4PONA 1P17A 3CSUA 2G1PA 1RM4A 1NUHA 4J0FA 1DEHA 1GTMA 5D2CA 5TGDA 2VQEB 3AF5A 3TSYA 3KSAC 3BJRA 3PUZA 1FLDA 5ARDA 3U56A 1WV1A 4M21A 2IEBA 3E3MA 3IQXA 5FQNA 5AVVA 1QRDA 2VAXA 5FO0A 3EODA 3K96A 5FP0A 1ZKMA 2P6PA 1J33A 3HB9A 4JP2A 1NW8A 2NU9A 3MWDA 3QE2A 1V5FA 2XTZA 1E1MA 3GJ4A 3GLHA 2E0IA 5AO9A 5H59A 2Q3FA 1SC4A 3CJTA 3DOHA 4HEA1 4V38A 4DIUA 1PR5A 2X4IA 2XNDD 1PZFA 2CDRA 1TTQB 3FOAA 3GCDA 5EZYF 2PJUA 2EKZA 4I6JA 4LV5B 1C1HA 4GOJA 5I51A 1XQWA 4HWKA 3DYIA 3PE4A 2XB2A 1CUZA 4HDQB 2AYXA 1JA1A 3FHJA 4MS4A 3QGMA 3C3EA 3KSUA 1N8TA 3VR4A 4YIKA 5E95A 4RLFA 4F45A 4EW2A 2KQUA 2Z6UA 1CT9A 2OZEA 3HKCA 2A5JA 1MW8X 2EG5A 2UYQA 2FG7C 4TUYA 2IOYA 1MIOB 4CPDA 1ZCFA 3BD9A 2VYCA 3T7EA 1GPAA 4LFCB 3IA2A 5DNUA 4H27A 5CFQA 3EVZA 1PJZA 2Z4RA 2JLYA 4RAOA 2ILTA 2JI9A 5AI8A 1IATA 1UK8A 2NVWA 4E08A 1EGQA 2GAJA 1ZA2A 3Q0TA 3QLTA 4INOA 4KHZA 4RF3A 2BDTA 4Q3OA 4WFQA 2O1WA 4E0BA 1RVDA 3H5TA 3RAFC 4Z4GA 3PFBA 1VJTA 2AUNA 1WMBA 2YFKA 3RAGA 2BKLA 2I22A 4TMVA 5IBPA 1BOFA 2FTKE 2J48A 3WBBA 4OKIA 4TYPA 2B4RO 1CTQA 2P5YA 2D7JA 2LWIA 2Q27A 4WDRA 2PLFA 3QENA 4R8SA 5K6RA 4DCUA 3ASUA 2CD7A 3KNZA 3KKNA 1PF7E 5A5FA 3H42B 5IG2A 5TQVA 4TYMA 4HNSA 4EI9A 1XZHA 1VIDA 2ST1A 1D1PA 2Q3HA 3BICA 1GTG1 1GU0A 4URWR 1U04A 4NOMA 3I72A 2VBCA 2H57A 4CEJA 5JPCA 2CZCA 3KLPX 3PQ3A 1BWPA 3BH6A 3VPCA 1OILA 3U13A 4FGUA 4DDHA 2R85A 3ZWPA 4PAQA 5EYPB 4RDXA 3A4TA 4GEGA 5TQ2B 4EYOA 1KNQA 2PUHA 4BRUA 4M0KA 1X7WA 4P92A 4U8GA 3WLMA 5SICE 2R6JA 4DRXB 5FX2A 5I4KA 3H4VA 2PR2A 4QBFA 4QU8A 1PFQA 5JVDF 1QONA 2KWIA 4I1OA 5AKKA 4ROSA 1GGNA 2KLHA 1ZJWA 1OC2A 3GJTA 3KQPA 4QQ8A 4OQDA 4IP0A 4C2AA 1LQTA 3AFNA 2IF2A 4JL8A 1BO6A 2L69A 2PDAA 4PZYA 3JTEA 3QFSA 4L2IA 4DY4A 1DTWA 2G7MC 3FCSB 3FPFA 3HXPA 5FPSA 4YMUA 3DFZA 3CS3A 4YQFA 4AMGA 1TQ4A 4F2DA 4LN1A 3SXJA 4EEXA 1FSZA 2B99A 2H8KA 3CFYA 3CKYA 5EKDA 4DRZA 5BT9A 3K6KA 1QM5A 3EF3A 2Y93A 1UC8A 3IJ5A 4FB4A 3DO6A 3DTNA 1EUCA 2ERYA 3RC1A 1DSSG 2F17A 5DTMA 1SCBA 4NVRA 1VE9A 1QV7A 2QORA 3L49A 5D7BA 5AVJA 3ZY3A 3B70A 3WS7A 1LLCA 1RBYA 2JJ1D 2PT5A 4DLXA 1QAQA 4DSUA 2BMDA 1LV7A 4IIGA 2ENWA 2RI0A 3AX6A 1SHUX 1CJSA 2J7KA 1UT5A 1YZVA 2ZAMA 3O7WA 4RBNA 4ZEOA 3SDSA 4G1CA 3HRHA 3ENVA 2R1VB 2BJWA 1K27A 3M9WA 1EG7A 2PS3A 4KKXB 3PV0A 3V6LA 3ZIAD 3N7AA 2IVFA 1FVHA 1OLUA 1VKOA 2AR7A 2GVDC 2G08A 3RIGA 4YP7A 2B61A 1WXDA 4NBNA 3RU7A 3AVPA 1GV1A 3C74A 1V8DA 1E94E 1N7GA 4AJHA 1NM5A 1V6SA 4Q5IA 4F46A 4AU1A 3BUSA 4J1TA 1MRSA 1W5FA 4JNCA 1VLMA 4LGMA 4LUCA 4FFRA 3HPQA 2HWUA 2I3ZA 3RCBA 5JBNA 2PYIA 1BA2A 2VDQB 1JIJA 3BJMA 1FEZA 4XR9A 3V1NA 2Y27A 3PNKA 1DEKA 1H0SA 1U5CA 1W4LA 1WXWA 1ZGZA 4B48A 2CV1A 4B6GA 3I2HA 1F12A 2GLUA 4HMPA 3V4VB 3ESAA 3VNAA 2UVPA 3JQDA 2J0UB 1NM5C 3M6MD 1OKKA 1ABFA 2I6GA 4K9DA 1NFFA 4PFSA 4KSCA 3H2KA 4OOEA 1EA5A 4ZVQA 1MJFA 3ONDA 3BB1A 2HMTA 4JCOA 4N5LA 9MHTA 2SECE 2GLTA 2EBHX 3F9IA 2CMHA 2EJVA 5EE9A 4IJKA 4AXXA 1FX0A 3UT5A 4ZVTA 1AK2A 4PCVA 3QVXA 3ORQA 4OQ4A 4O08A 3SC2B 5J47A 2XBUA 3M1IA 2NUPA 2VQSA 4EHKA 4DZRA 3HU2A 4RA6B 1I3NA 1UP6A 1AV7A 1YH3A 2XYRA 3LW8A 1NA5A 4QNRA 1NNUA 3AETB 2J3IA 2ANCA 4P84A 4PW0A 4QODA 1YIAA 4DC1A 4MGIR 1JECA 3IQZA 1R27A 4QICA 1J1ZA 2B1GA 1E79D 3C5EA 3Q1LA 3V8NA 1HM5A 3JVEA 1E9CA 4ZOAA 1V2HE 1NMZA 2XSZA 4Q82A 4BN0A 3L7BA 1NBIA 4EO7A 1ARZA 5BR8B 1AZTA 1FP6A 3DXZA 4M0PA 2EHDA 5IJZA 3KL2A 3W5DA 4JA0A 4ZYZA 1BFDA 1NHGA 1XDGA 1YUBA 3SVTA 1B3BA 4YECA 2XEXA 3FMIA 2IJGX 3H2IA 1RZRA 2PGJA 4OA5A 3KR9A 4I4TA 2WIAA 4HDCA 1KRHA 1Y5IA 1XTZA 1YU9A 3FDXA 3K9CA 1E5DA 1KSJA 4ED9A 4P31A 4REQA 2I6UA 2BP7B 2AUMA 3K9WA 4ND2A 1SWVA 3TTXA 4XWYA 4MQUA 5BN4A 3OTWA 1DBVO 3PD7A 4B9AA 4CEHA 3TQTA 3FYUB 3X1ZA 721PA 3QEMB 1R8YA 3SZRA 1J8VA 2XB6A 2OO5A 3WKBA 4B45A 3SZUA 1ECGA 1M2OB 5C8ZA 1CRQA 4JEHA 5IVPA 3TR0A 4JXJA 4OGLA 1FFBA 4XDYA 2DH6A 1EFAA 5K3FB 4C9BA 4WOBA 2AN4A 1X15A 1I6MA 3P0FA 5IXYA 2W2KA 3N2GA 3ES9A 2B1RA 4QQFA 5DN6D 1RNLA 1FP2A 2CXXA 2X8AA 3HKEA 3LPLA 1L4UA 2CEAA 1FQKA 4N6GA 4ER6A 3ICQB 2JFXA 2WYUA 2GTPA 2Z8ZA 4PQEA 5AKLA 1YIOA 4N0DA 4ATNA 1PRYA 4MQFA 3BTOA 1DOHA 5BXQC 3INYA 3GPCA 2WJZB 4TMXA 1RIIA 2PZ8A 3THWB 4K28A 4FYPA 1PT7A 2RIRA 2I76A 1N5RA 2Z95A 5AKZA 3WL5A 2ETXA 5EE1A 3WQHA 1XD8A 5U9CA 3FPBA 4EDHA 2VK4A 3QLEA 2FRVA 1FRQA 4LMBA 1VSTA 1YOBA 3UAGA 3LPMA 4HBGA 2ZJ6A 4RTLA 3RJTA 2GZHA 1Z4MA 2P9FA 1T6NA 3FUUA 5G4LA 1IVYA 4YRJA 2J9YB 2IUYA 4Z4QA 5AXCA 1BMDA 5JATA 3STXA 1VB3A 2AE2A 4B8YA 4F9EA 5C35A 4QOGA 4R98A 1TAQA 1EFLA 2BBOA 2FCAA 3UXHA 5HQTA 3OUTA 4O8ZA 5IT5A 2JLWA 2FH5B 2QY9A 1X74A 1TVKB 4FD3A 4MSUA 5EIAA 3TAHA 3ZU2A 4EB6B 4GKVA 5IK2A 4N0QA 2WU1A 3SSMA 2GPTA 1EWYA 4D25A 1ZJJA 3GEBA 3PX3A 4RVOA 4KJZA 1U0GA 3HZRA 3W2GA 4Z7NB 2A5DA 5LQJA 2G17A 4EKGA 1KZ7B 2ECKA 3GUVA 2CNBA 4BTVA 1E5TA 1Q0RA 3VPDA 4BCDA 5BN3A 5JCXA 1H1TA 2C77A 3NHRA 4D4KA 2G76A 3O4FA 4Y1GA 3RIXA 3FUTA 4KMMA 1C4WA 1OE0A 4PG4A 1W34A 1J0XO 3R4VA 1M7HA 3CMMA 3O3NB 1CIJA 3BQ9A 2GBGA 1RQPA 2WZCA 4OCZA 3JVIA 4PSAA 2PWZA 4B81A 5JRDS 4YRRA 2AQIA 4JA2A 4E46A 5I9IA 3SG0A 2RD2A 4MYRA 1KO7A 3B36A 4MRPA 3LK7A 4NMLA 3PC8C 2FUKA 3LBIA 5ARBA 2NO0A 4LF4B 3P2KA 4PFKA 3AOEC 4U6QA 2H2GA 4IQGA 2BKEA 3ETDA 3D0RA 4CL3A 3SS9X 3ZJTA 1T9HA 2J3JA 3DCIA 5F7OA 2LDBA 4KH0A 4ALLA 5BNIA 4IUDS 1M1YE 2MMGA 2Q3JA 2HLPA 1CW2B 4R1QA 4PCLA 1U8FO 4DJ5X 2XUGA 5KWEA 1ANKA 1ZN9A 3UGJA 1G5TA 2WG2A 2EZ8A 5T41A 1IZ8A 3AC0A 5DF1A 3V4ZA 1VCIA 3EVGA 4XWGA 4BJHB 4UU1A 4ENPA 3EOAI 1FDIA 3G9XA 3OCWA 3BBPA 3SYLA 3KOWA 4G0NA 3Q4GA 4WEQA 1DHRA 2V4ZA 2ZJ8A 2RGWA 1EWVA 3GFGA 3TRDA 1RXEA 4AS3A 5E3IA 4GZMA 1TMYA 2QE7D 3L6OO 1KA9H 2DT8A 2PUVA 4XB6B 1X8LA 5ALUA 3TSWA 4D9EA 4XIYA 5HZHA 2UUBB 2YWFA 2YW9A 1SU4A 2C8JA 4I1IA 4BASA 1QO9A 4LZLA 1H4VB 3VUFA 5KOHA 4Z1OA 4WASA 1TNDA 4MR7B 2E49A 1JG7A 3R6DA 4A92A 2XYVA 1WZUA 4W1RA 1EGVB 5BVHB 3CF4A 2YJTD 4RK6A 3E7PA 3JR7A 4CETA 2VUUA 3FOFC 3BKXA 4IX9A 3LTEA 3ZGVA 3E7DA 1E92A 4WNCA 5TARA 3UPUA 3DLPX 4CMHA 1RP7A 2P9BA 4GKBA 1DOZA 1JYFA 4NARA 5DEIA 1G21A 2JW5A 5U4XA 3TF5A 1SULA 4R1UA 5KWJA 2YYSA 1BGVA 5JTTA 1HZZA 3FB4A 2NTEA 5BSWA 2O7QA 4DXAA 4PXSA 4B3HA 1QRSA 4GICA 2P68A 2C7BA 4TROA 3T5BA 4LWPA 3FPSA 1KJ8A 2E4AA 2GPYA 3AQ4A 1TUBA 1H1DA 4F8JA 2JVKA 4YN3A 2H31A 1B6RA 4BNUA 2NO6A 4NCKA 3TK1A 1P33A 5BQXA 4FJ2A 3PENA 4EB8A 4L6IA 3FZNA 1HZZC 2QT1A 1R4MA 3KSMA 3FI0A 3ED1A 5DNYB 4Q02A 4RD2A 2CLDX 3A1EA 5DZSA 2XYHA 3U2QA 1UC9A 3H6HA 3I2IA 1NF9A 3KJNA 3T9EA 4N18A 2P8SA 1RP1A 1S6YA 3H6KA 1CUIA 3GUZA 3AO0B 1X1CA 4LJ9A 1RYZA 4R9SA 2HU7A 1CY7A 2GJ4A 3DBOB 1JU9A 2DHRA 4QYTA 3VR6D 4ND1A 4JWKA 4BLRA 3SVZA 2D2IA 5F2EA 2VK2A 4DIOA 2ODBA 2QTWB 2ZR7A 1AZLA 4BP9A 3QPUA 1XAGA 3RUCA 3ISTA 2IPLA 4XYMA 1O94A 2PL1A 2JLBA 1PD1A 2NT3A 2FMUA 1GNQA 3I42A 3V33A 1N3BA 2C2HA 3D7RA 2O1XA 3GQBA 3ABIA 3I5AA 4BNYA 2NSYA 4C3ZA 2DFKB 2VRNA 4JP1A 1LPAB 2H4XA 2H7YA 3OTIA 2P5UA 3TUZC 3MPUA 2GKOA 3A1FA 4EY4A 1Y9DA 5EC8A 1O94C 4HRYA 4EJ0A 4PE5B 1HZJA 2HHHB 1Q95A 1AV6A 1Z82A 2XODA 3UJPA 2VDWB 1SC1A 4FHZA 4ZVRA 1YA6A 1YZNA 5JC8A 4GX2A 1XKLA 4ENWA 4TS3A 3GLFB 3WLPA 2XQIA 1EX6A 5GJWC 4U00A 4YPVA 1IJBA 2Q5CA 1C4KA 2X2FA 3EUWA 5CG1A 2QYOA 4V1CI 2VEOA 2PZFA 4KREA 2DAPA 1BU5A 2YUTA 3VTKA 2DPHA 5E9JA 4KVGA 2CD9A 3V46A 1J56A 3SEFA 2EKLA 3QWIA 4KUGA 1C5KA 2EHJA 2XE4A 3H9JA 3CBQA 4L16A 2ISSD 1HKHA 5ITZB 2QG4A 1UKZA 4JDPA 2A0YA 2G67A 4GOXA 4PF1A 1L7VC 2K2WA 4R9RA 4Z9XA 2I71A 3U31A 5CW2A 3R7AA 4CLOA 4NJEB 1N2GA 1NKVA 1JSZA 4U7FA 2WWFA 2ZSJA 4QKQA 3DFKA 2K7ZA 2QZSA 2H7VA 2HA6A 1XF1A 5IYZB 1IAQA 4WV3A 1NU8A 3TLMA 4D98A 2OCPA 1BDMA 2RH4A 4AC9A 1PL6A 5HRAA 1DVRA 4ZAVA 4DCJA 3W2FA 1QDEA 3FHCB 1JHVA 1BCRA 1FNBA 3HXKA 1L4YA 5DNAA 4DM7A 4YCSA 5DASA 5C7IO 3M1AA 3IB3A 2R48A 4II3A 2QRNA 4MV4A 2ZIAA 2ZRIA 4JEIA 3B6JA 5DLPA 4O3MA 4G5GA 3UWOA 4MHSA 2DP4E 2XAUA 3LW7A 3DS8A 2P9TA 2CNDA 2C00A 1PV4A 5I01A 1E2DA 1JLRA 4LGCA 3BT7A 4OUDB 1WZCA 5DULA 3H11B 5C4GB 1NLFA 2PUFA 2NG1A 4K6FA 5JCOA 1HQYE 1FQWA 1PEDA 3OY7A 5KX5B 3P4XA 1AKTA 1K8RA 3MJDA 1ZDMA 2WTMA 2FOIA 3H17A 3C45A 4NE9A 3GNQA 5E7MA 1RHKA 5AI9A 1W48A 3NUZA 3AJ8A 1K5HA 4G5RA 4XJVA 4KNYA 3ZI4A 1KI1A 4HN4B 4NYJQ 1WMDA 5JCOC 1Z15A 2O3RA 1Y7IA 5DDIP 2HWKA 5EJEA 5ITVA 3G2KA 3IEKA 4BZXA 2ZS8A 4CR8A 3LZCA 2JIMA 5DGDA 4DXHA 4I50A 2WHQA 4MDFA 1G18A 1WP9A 4OSOA 3K8QA 1CY1A 2IYNA 2XE7A 4URUR 1NKTA 3S44A 1WVGA 4L8LA 4TYWA 1PGNA 4R81A 3RQIA 1G8AA 4BGEA 1V45E 3ETHA 3QPWA 2AS0A 1HO3A 3KZ1E 5C3UA 1Y3BE 2FW8A 3BL8A 4L75A 1E3LA 2QZPA 4XPIB 1IQUA 5DFAA 1VDMA 4L0CA 4ZCPA 1U2EA 4O4IB 3CM0A 3RIHA 2FSPA 1DWOA 3GROA 1L2TA 4XWTA 4PYMA 4FILA 1P2TA 2Z6VA 4NC9A 4X00A 1M66A 3TLXA 3WISA 2PT6A 4W82A 1EVLA 2IYUA 2J59A 3D54D 4HRVA 3JZIA 3I9KA 2DFNA 1X42A 1P1IA 5KVVA 1GA1A 5HM8A 4FDAA 5AXBA 3B7GA 2VHTA 4Z4CA 5C8VA 5KO2A 4D5EA 2JGIA 1DWPA 2ZSUA 3KB2A 4W63A 1O4VA 4M9SA 1IOVA 3N05A 1NF2A 3LK6A 4P33A 4KIJA 3IEPA 1T34A 3NTLA 2IUUA 1BVRA 4F4HA 1ZU4A 2GX6A 4NZYA 4HX2A 3BERA 1MAUA 2J6BA 1FDRA 5JS2A 2ZU0C 3WGIA 5FWYB 4GZ3A 5F52A 1A5AB 3LIIA 3ABZA 4NESA 1NUAA 1Q19A 1N2HA 2AOWA 4MRMA 4M89A 4WLFA 3SEQA 4D80A 2HPAA 4ALMA 4BNDA 4B76A 5D3KA 4F93B 4Q3AA 3DB1A 3VAYA 3N59A 4B2YA 5INTA 2GAAA 2F67A 2P5TB 1TEHA 2ZRGA 4KLNA 3UUWA 3D2LA 2AHRA 3W8RA 2FZEA 4Q37A 2OMKA 3BE8A 4JT2A 5HIMA 1A1VA 2VPQA 1JEAA 1J1UA 2G7ZA 3MA0A 2W8BB 2HA3A 5FBVB 4UULA 2IHVA 4YAFA 3WP0A 4PO3X 4QARA 4I50F 1JR3A 4KWHA 4M8LA 3LHIA 4NDAA 2BTQB 4WFKA 5F7JA 5AW6A 3R2JA 2OP1A 4MB0A 3S2YA 3WL8A 1QHXA 3DZJA 4AY4A 5CCDA 4Z2YA 1AKYA 1I9CA 4TRMA 5DXFA 1YRAA 1U11A 4CG2A 3KJHA 3TI7A 1AQLA 3C6KA 1B23P 1JUDA 3KVVA 4RY0A 3ZCSA 4BKOA 5CFZA 1FUYB 5JJIA 1I6KA 3ONNA 3EY4A 2D7DA 3AKEA 3G7UA 1MIOA 4RQBA 3PZRA 2QRVB 3NRCA 1ZUD1 3SR3A 3LZDA 1GPLA 1N25A 3N0WA 2A9OA 5LZ7A 3D31A 4FLEA 4MV1A 1O7JA 1LS1A 4CV1A 3F98A 4NNJA 4ZICA 1JHRA 2JGDB 3IUMA 4IKPA 2AQKA 3PPVA 2EERA 5AM1A 1RVV1 5ALSA 1QGUB 1C3OB 1CVLA 7GPBA 1NBMD 4E6PA 4BX2A 4UUPA 5DH9A 1N2CB 3HY6A 2FFJA 2KW5A 2JAPA 3ZXSA