1OU0A

Precorrin-8x methylmutase related protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
SLAAIDSMIDPDISGPMRHIVVKAIHAAGDFAIAPLIRYSDGFFKSMLAKLKEGCTIICDSEMVRAGIYSRPVLERNRVVCYLNDVRSKEMADVNGITRSAAGIRIAMQDHRNSVIVIGNAPTALLEAMRMIEENGWYDIPIVGIPVGFINASKAKEGLVSSHIEYISVEGHRGGSPIAASIVNGFGRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords precorrin-8X methylmutase related protein
publication title Crystal structure of a predicted precorrin-8x methylmutase from Thermoplasma acidophilum.
pubmed doi rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Isomerase
total genus 56
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature ec 5.4.1.2: Transferred entry: 5.4.99.61.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1ou0A00
4AU1A 3E7DA 1F2VA 2AFVA 2AFRA 1OU0A 1I1HA 1V9CA 4FDVA
chains in the Genus database with same CATH superfamily
2I7TA 4JLUA 1KJZA 4PGFA 4HWTA 4LK3A 5DYTA 3CIOA 4V3BA 4MCJA 2C0PA 2P4HX 3CRVA 1E4OA 3FBWA 3I39X 3BE6A 2GM9A 3P9YA 4G25A 4KUHA 4V0QA 5C8YB 2GEDA 4WOJA 1YZHA 2HRZA 3GPBA 1M67A 5C18A 2B9EA 3PHBE 4FWTA 2I4MA 5GZ3A 5E7QA 3V3KA 4ZJPA 5BV7A 5FUQA 4Z0TA 4BEJA 1UDWA 3MLAA 2WEKA 4FSHA 2MYTA 2XV1A 3RJTA 4NTZA 1T1RA 1IZ9A 3B78A 2I6XA 3S4YA 5EC8A 5AM0A 2BFPA 3A37A 3KD2A 10MHA 3EXIA 5LPNA 4IPTA 2J0EA 2JKYA 1FUIA 3RT7A 4ZFNA 1J8FA 5D3ZA 4GM1A 3FIUA 2O7NA 3W4JA 1DQPA 3MWDB 4IEEA 1NVWQ 2WAMA 2YNMD 2R6JA 1SUEA 2EBHX 1OFUX 1SHTX 2CMFA 2FR8A 1KRHA 3DE4X 4FFBB 1CK4A 1XWIA 4P4SB 4EI7A 2FOXA 4YLYA 1SCAA 2Y77A 3NWOA 4Z3KA 13PKA 4K9DA 1Q57A 1SUBA 3QSGA 1DC4A 4YALA 3A4TA 5HKOA 4TTIA 2G1AA 1Q15A 2YV1A 5CDSA 3FPGA 3QPVA 4JWTA 2FHSA 4XRRA 3TYXA 2WSLA 2C7VA 2Y1LA 1RW4A 1RYHA 4O5AA 2E0IA 5BR1A 1WG8A 3G2QA 5JS6A 3UUFA 5MGNA 4MW7A 4AF7A 4LK2A 4ZODA 1UEIA 5FOUA 2Y6VA 5HKBA 4CFSA 4EY7A 2DJIA 5FF9A 3M6LA 2A9VA 2NVOA 3KOOA 1E2NA 2VDMB 2C83A 4Q9DA 4TXMA 4FEGA 3DVAA 1AMOA 2AG1A 1OYVA 3R44A 2IOFA 2J85A 2Y1KA 5FTKA 5ICEA 1EK0A 2ZWIA 2OAEA 5ARBA 2KWIA 2R4UA 1G20A 4P9NA 2FPIB 1WCIB 4IDOA 5DTEA 5KZMB 1R74A 2QT0A 3GJQA 1U0TA 2ZIAA 1ADGA 4BO0A 3DOJA 4C0SA 2J48A 3Q0EA 1EDBA 4OREX 5ITWA 1U6KA 1I7QB 3J7TA 3VKHA 5IMSA 3A25A 5AW5A 4UAUA 8OHMA 3RIEA 2R8XA 4DMRA 1OX4A 1O94A 5DCUA 4CMHA 2RI0A 2GBGA 1IN4A 1BDJA 1GTZA 2Q4BA 5C46F 3QY0A 1YK1A 1K5DA 3BD8A 3FWPA 1LVUA 2R48A 3LVQE 3M6XA 4RKQA 3KQPA 4BNIA 1IB6A 5EPUA 3MBOA 4RETA 3L8MA 2FP3A 2OXCA 4XQ0A 3N8IA 3K5WA 1M2HA 3RKRA 4BC0A 2Q3EA 4E4TA 2V4UA 3W1VA 4DADA 4OI4A 4MYCA 4FGLA 1CQPA 2ZR0A 3CW9A 3TECE 3ROFA 4IIJF 2NO9A 4ZRDA 1URPA 3GH3A 2XB2A 1AO3A 3DE0X 4RV9A 2OD2A 1U4OA 2C2BA 3ZD7A 2PO7A 1E7SA 3PX2A 2FSSA 4IIEA 1E89A 4B34A 3F9IA 4LI3X 1KORA 1K0FA 1WCIA 5SZJA 1OPXA 2JHAA 2IKSA 3BK2A 2J3QA 2W8BB 3Q7RA 4ZKEA 3UB4A 3JVIA 5E3HA 1NP3A 5IT5A 1V8DA 1X9HA 1AE1A 4EARA 5IEBA 2HUNA 4MGYR 4RBNA 2H48A 1ZUNB 3D2AA 2YOFA 1PTJA 3NJ8A 4MA0A 2C0QA 3AWIA 3EQ2A 4HQ6A 3B5JA 3OLQA 3UAOA 2YXEA 4RL6A 4LN1A 1BOOA 1NBHA 2Z3VA 2YASA 4HH0A 4IIFA 4TTAA 1XEWX 2VZ8A 3M5PA 1CT9A 2IHTA 1NI4A 2IYOA 3JYOA 1SD5A 2UV8A 3OQ1A 4XR9A 4BAGA 3BFXA 4BRWA 4ZTUB 1GSIA 1DHRA 2MJLA 1M33A 2FSGA 3DMPA 3QEOA 5L3QB 1W0CA 4KQHA 1FJ2A 2Q3MA 1X13A 2ZFUA 2A9JA 3DW1X 3DCYA 2JLBA 3HO6A 1XTPA 1J24A 2G76A 4OHUA 3TVTA 3M6WA 4NY1A 4AI6A 1IZ0A 3DEZA 4IHKA 4FZJA 5SV2A 5HZMA 4ZT2A 2TMDA 1Z16A 3W5BA 1VHLA 4R51A 4LMBA 1PWYE 1V9SA 3D4NA 1LEHA 2BGKA 3F5DA 4HUQA 4C7JA 4DYHA 4IGEA 4R0MA 1V96A 2ZRKA 2ENWA 1IL0A 3ONFA 2JLCA 2JJ1D 3HN7A 5ICSA 3W6ZA 3P9PA 2E21A 4TUYF 1QANA 1U2DC 1E4EA 1VRVA 4YJ3F 3CLRD 4RLHA 4JBIA 2AN5A 2ZWOA 5E7IA 4WK0B 4X94A 3OFKA 3L06A 3VR5D 3DFUA 2CV1A 2BGGA 4MQMA 4JI3B 3MJTA 5KYUA 5T4HA 1IBSA 3R3JA 3F3YA 1P1BA 5JEDA 1F38A 3IMEA 2IK8A 4A2WA 1TEHA 4C5CA 2FP4A 3STTA 2G17A 3WI7A 2IUSA 1TCCA 1EINA 2GI4A 3PHGA 1EVQA 2IDZA 4H6PA 3T7DA 2WHRA 4J16A 1AS0A 4LKOA 4MUFA 5JG7A 4EVIA 5KCZA 3RADC 1KI1A 1ZAKA 4OGKA 4LFBB 3LUDA 2LGJA 4BFXA 4DIMA 4HAIA 3OU6A 2I8CA 4PYJA 2EBFX 3ZWAA 2Y92A 4DL9A 3C7CB 4GF5A 1F06A 8AT1A 2NOAA 3TE6A 3DC2A 3H11A 3G2NA 3PLNA 2GO1A 4MB6A 4M76B 4QRDA 3GQBB 4TZ0A 3H19A 2ODWA 3U7QB 2F8TA 4HN9A 3CEJA 2XNKA 4CM5A 2R66A 4EUHA 4BLOA 5AVOA 1BDMA 4QGHA 3AL2A 4TV8A 5ALQA 4XAQA 4YRAA 3OJ0A 4WA8A 5CB4B 4X8OA 5WRFA 2B1JA 4CN9A 1L7AA 3B7PA 3EB9A 3AW8A 2PG3A 3FZEA 3H6HA 4Y3UA 1NE7A 1TU0A 2ZJ2A 2A0XA 2JGFA 4JI4B 4E88A 2GRUA 4D99A 4DDTA 2DHEA 2VF7A 2EJVA 4JV5B 1ULZA 3NDIA 4EY6A 3E7FA 2QUKA 3MTDA 4N18A 1RHQA 3ZU4A 2B94A 1NFFA 4DIOA 1VL8A 6REQA 4D9CA 4UQOA 3ESCA 5FFMA 2HI0A 5JC8A 4AC9A 3EZ2A 1YCFA 1QQ7A 2JKZA 4C14A 2QL5A 3WYDA 3RFTA 4Q4JA 3V2GA 2P77A 5REQB 1DEOA 3H84A 1XZPA 1OAAA 4AG6A 4B87A 3AVWA 1E32A 3T8YA 3M4YA 2LKDA 4BRUA 1S89A 3KBBA 1JJ7A 1FNBA 1IQ0A 2EGGA 4ZPJA 2W4MA 4ECEA 3WVNA 4GXTA 5AKHA 4IF6A 1GITA 2VPXA 4MCIA 4OQMA 1AVTA 3H18A 4RENA 5TARA 3U7QA 4CLOA 1FYEA 4KUEA 4DKXA 1FTNA 4LMAA 5EQJB 4Z7OB 3FWNA 1E2KA 1SBZA 1V3QE 3JQAB 3ILSA 3I3OA 4UDYX 5CB6A 4YWJA 2Z3ZA 2X40A 4EG4A 3ORSA 2YNMC 1IPEA 4NOKA 1GGJA 2YNMA 3HY6A 4P4UA 4BVHA 4HX9A 5DN6A 2GEBA 4GSYA 4QXPA 1FNCA 3WTBA 5BQ3A 3KJQA 6ABPA 1NMZA 4L02A 1E8NA 2RBKA 3EIWA 2NNLD 3A4YA 4NZMA 1DJLA 4Y8VA 4QVIA 1J2UA 3LUBA 2GKOA 3EXG1 4MJ7A 2F1JA 4RSRA 3VHLB 2DFDA 2UVQA 1U0EA 1UBFA 4NNJA 1PWXA 4EGCB 2ZTSA 1TYAE 3FJYA 4I5FA 5HJ2A 1CR4A 3SF0A 1UADA 2DUWA 1C3JA 3GNLA 1S1CA 5FQNA 1L7PA 3QW4B 3IOMA 4MPJA 1PK8A 3DE1X 4WESB 3ISTA 3IV7A 3H2BA 3ASYA 3X3HA 4MGZR 3IPXA 5LXTA 1XO1A 1V8ZA 2ETXA 2VL7A 1TLFA 4GLFA 1OPRA 1XJ0A 1IBMB 1ISIA 1Q0QA 4K28A 1H9AA 2ZU6A 3CMCO 4RPKA 3W5CA 1I7SB 3SQLA 5HIKA 1NZDA 1Q0PA 2WJHA 3TFWA 3WNCA 1QQAA 4C4YA 3WK7A 3CCCA 1AQJA 1YIDA 3DZ8A 2O2XA 2SBTA 3DXYA 3FF1A 1H23A 4AS3A 2WNIA 3GT3A 3T9BA 1C29B 1A50B 3N2GB 4JT2A 3U5TA 1TTHA 1ZCZA 2QOEA 3LCJA 4G9BA 4L28A 3ZDCA 4M6WA 4WECA 1N9KA 5EWMA 5D7BA 821PA 4ZDJA 3AZQA 2PKQP 1MJFA 1KETA 1PE0A 5LQDA 2P91A 2YMPA 5B4VA 1MX1A 2MMCA 4V0OA 2WYUA 4Q82A 5E0OA 4P7FA 1P6UA 1QLJA 1YBMA 1YZYA 2X9NA 3A36A 3PBKA 5DXFA 2NSDA 3FCYA 4JEIA 1I0IA 2CXXA 3I28A 4G8JA 4AWBA 1K4KA 3BIXA 4LZNA 3LD9A 2XOXA 4KAAA 4WMLA 4GZ3A 4B80A 1NU8A 4FYJA 1QP4A 1QS0B 4UREA 2E5FA 1EK2A 1N9ZA 5ADHA 1LCIA 1G66A 1RC0A 4JASB 1N75A 2H59A 2Y1XA 2HZBA 2VH1A 4J0FA 2DR2A 4OLBA 1V37A 1E9BA 2BMWA 2X4GA 1O5IA 4FT4A 4NFHA 4A8JB 5IJXA 5F7XA 1T0IA 1VGVA 1HE2A 1YAHA 2NSYA 3IQZA 3QYJA 4GQBA 3SQWA 5CFZA 4KO1S 4WKBA 1CU1A 2A7XA 2QW8A 3JY6A 4FX2A 1DCTA 3PT5A 1BMTA 3KB8A 2NGRA 3NEPX 4JI6B 1H05A 1EFLA 3OF2A 2AFIB 3B51X 4GKAA 2W2KB 4YRJA 1G55A 2PCLA 3DQQA 3N2GA 1Z37A 4D45A 4LYAA 1N33B 3GNTA 4CG3A 5AQ1A 2FPGA 2YOGA 2HXSA 1NI5A 3X1YA 3SKVA 3M1IA 3UWDA 1HLGA 1O96B 3CE9A 3M1AA 1BZYA 2AUNA 4S35A 3OZDA 3BREA 3DLAA 5HFAA 3IX7A 3UJ8A 2E1RA 3V34A 2G9RA 4MUNA 4YAOA 2PUJA 2FFHA 5KNLA 3ZGZA 3WIUA 2IEDA 4TL8A 1M2VA 1R0ZA 1YQUA 2WFZA 3GRZA 3C0KA 4PZLA 1T3HA 5E9WA 1BEZA 5BY2A 5F2NA 1SFRA 5CB8A 3EZ9A 2JAPA 1ZWKA 2Q5FA 4F5ZA 5A9RA 3CZRA 4TYMA 4OHBA 1A7UA 3SKXA 1BVRA 2HLNA 3BWBA 3KQLA 1OLSA 4RVOA 4EGQA 3F4BA 1RHUA 1C80A 3CLRC 1FDWA 2AR0A 2XRYA 1UFVA 3C45A 3ZPXA 5CM9C 3SMQA 3C3AA 3VR5A 2O8DA 3COJA 2XVMA 3RFFA 1WD7A 5FL3A 3C6BA 1KIFA 4GWLA 4LE1A 4CLRB 4RVCA 3E7XA 1C50A 2QTFA 2VSNA 1X70A 2DECA 1V8OA 5CPBA 1RAGA 5TV2A 2PRJA 2ZE5A 2P40A 3PXUA 3K70B 2HDHA 2O8CB 2YQ4A 1DP4A 2DQZA 3LX5A 4BN5A 1BAPA 3I9V6 3QOXA 4YAJA 4EYKA 4M1MA 3WNZA 3LC7O 4FNMA 2ZSUA 3RD5A 1GV1A 1Z2OX 4ZTBA 3MWGA 1T4MA 2WUDA 2BKAA 3S2FA 3I0NA 5LYYA 2P11A 2PH7A 1A9XB 2ZU0C 2HXYA 4EP1A 4ESOA 1YC2A 1GUFA 2JFOA 2PD6A 2WU4A 1VKRA 2NZ2A 5BNZA 4IDGA 2OXRA 2XOEA 4UTOA 3QE9Y 3B9BA 1IJFA 4PCVA 4PLPA 1IHPA 3NNSA 1NU6A 3HKCB 1VIVA 1NTRA 3C2QA 3TRJA 4MIKA 4DCJA 1Q7CA 4B2LA 3QVKA 4LGVA 3OMWA 1S3SA 1ZPDA 1Y1PA 2C9OA 1OUMA 1Y34E 2EKQA 1DEXA 3P0EA 4HDCA 1XYGA 1P3DA 3RSGA 3V8EA 3A6JA 5JTTA 4RSGA 3K30A 4BMCA 4L8VA 1QBGA 4FLEA 1AO0A 1SH7A 5EGNA 2PFSA 3MRVA 5T4BA 4EO4A 5JJCA 1A9PA 3OIYA 4BQIA 4CEJB 4WCFB 3GGOA 1I4OA 1IXKA 3D3KA 4AJIA 1VSTA 3GP8A 4IH4A 4CLRA 2OV8A 1QX3A 4GYJA 5FTNA 4OX9B 3OM8A 4Y6OA 3U7IA 2IHJA 4X92A 1P0IA 1EFKA 1G1MA 2RCYA 3AG5A 3M3PA 4IKOA 2O9JA 2ACEA 3HCBA 3KLMX 5I7OA 1WZ2A 2O8CA 1C8LA 1SUFA 4ITUA 1CY2A 5BV1A 2GTPA 4TYNA 3UXHA 3TB4A 5EIOA 4GYWA 1NDUA 2UUCB 1XD2B 4DN6A 4F1JA 3WV4A 1Q5PA 1TL7C 2AKAB 5I5GA 4US2R 3KK0A 1D4ZA 1R9GA 2FETA 2X6RA 4IW3B 1MA3A 2EW2A 5CP8A 3I9NA 2B0CA 1ZRSA 1SQSA 2ZBFA 3LZ6A 1O0CA 1KRXA 3M2TA 1AKQA 4NFLA 2QVLA 2WUGA 3GUHA 3O8BA 3AEKA 4IJKA 5JH7B 2JLRA 3P32A 5EESA 1OLUB 2KW5A 2VAWA 4C89A 1SQFA 3H6GA 3RVLA 3SEAA 2JK0A 4BGIA 2VXBA 3VKFA 3R7BA 5JJ5A 4GICA 3ELBA 4LAFA 4UU7A 3RUAA 1FC0A 3GP3A 3A06A 3KXIA 3WGUA 1ZJYA 2QLJA 3K9FC 2PQ6A 3MGKA 4R3UC 3K2BA 4MGKR 4R2XA 3RC7A 1TVKA 4CEJA 4BQSA 3AFHA 1EGHA 2JI9A 5BORA 1CZNA 3IURA 3D64A 2UXBB 1C7IA 4K46A 1XHFA 5TJHA 1WTAA 4H3HB 3M4ZA 1VJDA 1OXMA 2YZNA 4EW3A 8ABPA 3IAUA 4OK3A 4ESHA 4MHSA 4RGBA 4IKPA 3U6BA 2RHBA 3HNRA 2AOUB 2I1WA 1KK1A 3H42B 2YWRA 2WE7A 4XE5A 5J40A 3STUA 4DMMA 3HRKA 1UKZA 1Z15A 4Y1GA 4LRQA 2VFAA 1XD2A 3L0SA 3F3SA 3HUFA 3T5GA 3T5MA 5SY9A 1GNSA 2IUEA 2VUSA 5HIAA 4L5AA 2E4XA 5C3MA 2I2XB 5JDIC 1ZHFA 3OQVA 3H7AA 3K0BA 4II3A 5DLDA 1FZTA 5HKLA 5F21A 4WI1A 4Q4AA 2FZ4A 4I6JA 4PZ0A 3QTBA 3QV2A 2P0EA 4AMBA 1LW6E 1OLUA 1XGKA 4BNDA 3CEMA 2X8WA 3BBLA 4AJ4A 4EX6A 1XELA 2HQSA 4ID3A 3C6ZA 2ZBEA 1FP1D 3D6UA 1Y8CA 1SK9A 3SK0A 4GLOA 4ZEMA 5C8XA 4HVLA 4RK0A 1K5GA 2OO3A 4KRYA 1QBKC 1Z8HA 4AWXA 1BX0A 1XL0A 2ZYVX 3RFCA 4BO7A 4V1CI 2POQX 2NZJA 5JQGA 4AY4A 1N3BA 1VYTA 5DN9A 3GPCA 2FUKA 3GUCA 1ZIYA 3WYNA 4B3JA 3RTBA 3Q8LA 4IDEA 2IZ5A 3OY2A 3PWTA 3TLAA 4P35A 4TMKA 1Z8DA 1PHRA 1L4GA 4BQOA 1J70A 3IEMA 4V2IA 1WX1A 2V7VA 5LA6A 3LZDA 4DCUA 4S05A 1XB2A 1VJGA 2BZSA 3D0KA 3DKPA 1AQIA 1HTTA 1RYZA 4CQMB 1OHHD 5ALOA 6YASA 2XGMA 1T5SA 3CN9A 3S2EA 3GA7A 1TA9A 1U0JA 2Q4RA 3HDGA 1NJSA 4L4XA 2OPHA 5TLSA 1O2DA 1RYEA 5ER9A 3NC4A 4L5IA 2IXDA 3EHDA 2FFBA 4TTQA 4QNRA 5JSQA 1MG0A 5TJ9A 1O4WA 1UQTA 4QASA 3REOA 3CUTA 2YH2A 4ON9A 1CQJB 1F6WA 4QGFA 5A04A 4BBZA 2CW5A 2D5CA 4CDRA 3PF9A 1XMOB 2I6FA 2Q0SA 4XYMA 2FPSA 4Q4DA 1D2HA 4M0MA 1Y6FA 2RGGA 1ZA1A 2GT1A 1H1DA 1UPFA 3VU0A 3G9ZA 1D1QA 1D6MA 2VI5A 2BGIA 3DT9A 1XEAA 3IP7A 3SYMA 4MTCA 4RHUA 3PFBA 4DCTA 5HRUA 1WMFA 2FQWA 4EHIA 4UUOA 3TGPA 3R6GA 4EFNA 5ALZA 1Z0FA 4L6CA 4RFLA 5K03A 1M2KA 1B2LA 4EG1A 5C7OO 1HOTA 1E9EA 2A0FA 2WSBA 3F96A 4PCUA 1I5EA 1X39A 1DAHA 4URYR 5CXSA 1SZCA 3FUUA 3KYIB 3IALA 3H3JA 1JQKA 2OEPA 1KK3A 2VK8A 2G1KA 1PF7E 3FB1A 3B9PA 2Y76A 1D1PA 3FSRA 3V5NA 5HJEA 3IIIA 5FADA 2OXIA 1ADFA 1MRZA 2JASA 3TR6A 4QARA 3BMOA 4YN3A 3B1YA 2QZ4A 3HYSA 1NR7A 3PEEA 4JBWA 4XJTA 2A1UB 5CURA 2CWWA 3TQCA 1C2YA 2E6KA 3OX3A 4HPXB 2HLDA 2CLSA 4KSCA 2P2GA 1JZSA 3G2JA 3QVJA 5TGZA 2W6OA 4QUKA 4KIUA 5LQKA 1YHYA 3V1NA 2ZSIA 1WSDA 1E77A 4HHEA 2EFDB 4JLMA 2ERYA 2CVFA 2ZJ7A 4M9CA 1JFSA 1HQCA 2QAJA 4BWVA 2BKUA 2FKNA 3G79A 5F9MA 1RHJA 1M1NA 2NO1A 3FROA 4N3GA 2NVWA 4Q3KA 4QXOA 1B41A 4PLVA 3UTDA 3V2UA 4BCCA 1NMQA 4KQEA 3ZY2A 4DCMA 2BT4A 3W5IA 3SIRA 2A4MA 4OKSA 3DLIA 4ROTA 4GHWA 4O3FA 3E1GA 1P1HA 2WKRA 1E94E 1FLAA 2FZLA 2JFQA 2YW2A 5E1BA 4WAUA 1Z7EA 1DCFA 4KNVA 4K9LA 2D1FA 1O5OA 2EV9A 2J7KA 1FQWA 2RH8A 2I7CA 2ZAIA 3CVOA 1Y4DE 2Z9CA 3QA9A 4GQIA 3SFVA 3WMGA 2D13A 2CNLA 3AY6A 1NN0A 1JYFA 4WE3A 1R66A 2Q07A 4UZEA 1IN5A 4HCJA 3G0OA 2XUFA 1FFWA 2ILTA 4LXIA 1A5ZA 1TB4A 4MVJA 2DKOA 5K0LA 4QICA 5AJUA 4UNRA 1H9BA 2QVXX 3WBBA 4RVNA 4K9KA 1JKMA 2Q3BA 1Z18A 1WLYA 2Q3LA 3FLEA 1M6WA 2ZRGA 2ZYDA 3I42A 4BU1A 5JMPA 1AQNA 2MWMA 5FXMA 1JE0A 2GF0A 3HVKA 4IIJB 4K8RB 4BLWA 5BUSA 1FFSA 2L2QA 2PZFA 2E85A 3N05A 1O6BA 1YE8A 3DOHA 2Q8PA 3NJ4A 3VPCA 2Q3FA 3PC4A 4F2WA 4XGKA 2IYEA 5IJAA 3AP3A 1Z6GA 2R9VA 3OPYI 4CTNA 3N2NA 5F64A 3OQOA 4TMXA 1Y1RA 2C3UA 2Z2IA 1T5HX 4CIBA 5T41A 1THMA 5LJIA 2LTAA 2O8NA 1UXJA 2V3WA 3GO4A 3PA8A 4MUKA 3ESRA 4PAWA 3NV9A 1T8TA 5KYVA 3AINA 3NMUF 5EA2A 3P20A 4TTJA 3CT4A 4BAUA 1M8PA 2QB5A 2WUVA 4MJLA 3ZQ4A 3FDFA 5DVZA 1DIHA 1JU4A 2J32A 4LJ7A 2CWDA 1X8KA 1XOIA 4K3UA 4AMVA 3O47A 2GPYA 1Y8QB 1N2BA 1C1YA 4I8DA 3GLKA 1I1OA 4KK4A 3I8OA 2DPMA 3T5CA 4MUMA 3GGJA 1QIMA 2H2GA 5EJ5A 1E0DA 1L3CA 3G85A 1USKA 2WA1A 1MC4A 2ST1A 3IAS1 2CN1A 3ONWA 4U5XA 4RMHA 5IASA 5J2UA 1TQHA 2YWEA 3O91A 3O4JA 4O3MA 3HEAA 3BN3A 4G9EA 3HDQA 3EZLA 3RABA 1W4LA 3PGA1 4JUAA 1JA1A 3UHOA 1WXEA 5K51A 1SEPA 3DE2X 3G7NA 1XK6A 3FKQA 5A3SA 4AVYA 5GV7A 3B6KA 3K31A 4LIPD 3M4NA 4Y1FA 3A6GA 3BWXA 2JEOA 5U4QA 5I47A 2ECKA 1SZJG 2PGAA 2PSDA 1SRRA 3VJRA 1OH5A 3EK2A 1VE3A 3GHHA 4Y6PA 3KYJB 2CZCA 4CT0A 4CV1A 2GK6A 1LK5A 3L8FA 3ABSB 1YB1A 3VGPA 4COKA 4ZGBA 2QRMA 4OQXA 3LRXA 1GGNA 1XYVA 2CNDA 2ZQYA 3L9WA 3O7WA 3OESA 4UUPA 1MIOB 3KTFA 4XFKA 3NVAA 1F51E 1CRZA 3UFBA 1F14A 4D96A 6PFKA 4INZA 2Z9DA 1L5MA 4U7DA 4AECA 3EF3A 1RPZA 3ORQA 4RULA 1NFRA 1IJKA 3GJYA 4ITRC 1P75A 4K86A 4IDFA 4FD3A 4OBBA 2PUFA 5ENVA 5H3HA 1HDEA 4JBHA 1M0WA 4CIWA 4G8DA 1U28A 3FUVA 3E9RA 1NV8A 1FXWF 2FLWA 2OGTA 3EWSA 1TK3A 3DJFA 1LS1A 4HYEA 4K40A 1L5NA 5HWSA 1VL5A 1W5FA 3KOWA 1MABA 1O8BA 2XDAA 3R77A 4TOIA 3W9SA 4QNMA 4FMBB 3DBRB 4JBGA 4BO4A 3GUYA 2E4AA 2JH3A 3O8QB 1DUVG 2HTEA 1OHHA 3QW2A 3NLLA 5AHWA 5LNK6 1XRSB 2JBHA 2NVUA 1XPJA 3KWJA 1M6HA 3CEPB 1XQ6A 3UJAA 1EM8A 4YBZA 1WZEA 4LQLA 1UOPA 3FCAA 4J4TA 4N1AA 4RS4A 4IRUB 1U8XX 4B5LA 3L0YA 4F3RA 1NLUA 4HL6A 4K6OA 3S6JA 1DQRA 3I9OA 3IEIA 4DV6B 2F4VB 5GIOE 2YUTA 1QDUA 3IB3A 3OM1A 1P17A 1V71A 4UOQA 3DWGA 1JV2B 5DGXA 3YASA 3TDNA 4R1LA 5DM60 2PZAA 3IA2A 3LP8A 2QEQA 2YYSA 1ZESA 1EGMB 1GXSB 2NXEA 4P7BA 2Q4EA 3KZOA 3LXMA 4TXJA 1DXYA 5HHTA 4BQEA 3UG7A 1TRHA 5C8ZA 3LXRA 5BWBA 3BH6A 2H63A 4M60A 1GT91 2YW9A 5G1OA 1RADA 1F8GA 2G0NA 1XYYA 5HXAA 2GD2A 1RMYA 4WCVA 2X14A 3HJHA 1J9ZA 4JLWA 4W9MC 1WD5A 1I3CA 1IXSB 2XCIA 4OHPA 4M9ZA 3ZV7A 4CKCA 1YQWA 3H2YA 2HY7A 4E2ZA 4ALIA 3ZQKA 2CJWB 4YLGA 3ZNQA 2EZ4A 4B1FA 1WPRA 4U5QA 1SU8A 1E9AA 2G8LA 2YV5A 3S27A 3ZQJA 5L51A 3LUAA 4U9UA 3N5KA 4FR2A 4U2DA 1HGXA 3RTEA 5GZ1A 4DSTA 2R8OA 1U1FA 4TROA 1EE1A 3LWBA 4Y0NA 3HXQA 2Z4SA 4QPPA 2FZEA 3D7MA 3LY7A 1DT5A 2II6A 5KHAA 4BMNA 1Y1TA 1NSFA 4PSAA 1JDTA 4NQRA 1N5KA 3F5QA 4BGDA 3NXKA 1WIWA 2M1ZA 2V9PA 4B8WA 1HTWA 4LF8B 2P7HA 3BJEA 4D5GA 1FQJA 2JGDB 3CO5A 4DW8A 3OEYA 3LQYA 2PM8A 5C2JB 5IJZA 4R1NA 1A7JA 2IXEA 3WNDA 4R8SA 4G1VA 1LQTA 4B2YA 4BDTA 1B74A 3KXLA 1PFKA 1XEFA 4OAOA 3E9NA 4HXFB 3GWGA 4F71A 4F3YA 3MJFA 2EFGA 3MCVA 2WT8A 4KGDA 5DBIA 2H0AA 5HF6A 1F2UA 1SPBS 5J1TB 5TGTA 3ADDA 3ZDYB 2KJQA 3A3YA 3GVCA 4BFTA 4AJHA 1J0XO 3Q6MA 3SXUB 2YQ5A 3UT5B 1BN6A 4JYBA 3VU3A 1W9MA 3WQBA 3K1JA 3MTIA 4Y7CA 3TK1A 3WAGA 4MR8B 2G4VA 1GRNA 2WINI 1IATA 2PGIA 1P7VA 1DJPA 4IY1A 1YQTA 1EAMA 2A3RA 4K9RA 4NBUA 1HDGO 2WNHA 1GKLA 2VDJA 3KX2A 2AJCA 3DG9A 4LRSB 4RSHA 4DDUA 2VJAA 3TZLA 2H2HA 3A6LA 4F4IA 3H1PA 1FFXB 2RC6A 4QBGB 4X44A 4U00A 2A5GA 1UBSB 3C1AA 2H1CA 1Z45A 1QP7A 1ZJZA 5ESDA 4Z49A 1FMTA 2WHQA 5JBNA 3P9ZA 3WLTA 3R5SA 4RHEA 4YV0A 3BCSA 1JDJA 1J09A 4V3CA 4B40A 2AC4A 3LK7A 4DWWA 4CDGA 1FF9A 1AJEA 1NPYA 4I66A 3K8YA 2NM0A 2E2WA 1G7CA 1XAJA 2D7CA 3EDCA 4Q0MA 5FL7D 5JNSA 1Z12A 4BN0A 4GYYA 4ARUA 2OHGA 5AVRA 5KPJA 3GJRA 5AJZA 4XUCA 3IBTA 1JS1X 3AJ8A 3QXSA 2W2XA 1NAIA 2W8ZA 4M55A 4XDHA 4RA6A 5B2EA 2J67A 3LA8A 1QU3A 3TW4A 1DRWA 4L4UA 1UAAA 3TMYA 2B82A 3O8NA 3NWBA 4JI1B 4JJGA 4OGGA 1MO5A 2FX2A 3ASZA 3EC2A 3ZX4A 2RK6A 1XNGA 3U61B 4TLAA 2ATEA 1R4AA 1A7AA 1T8UA 2VSOA 4XWWA 3E5HA 2WV9A 3KQVA 4MR8A 4L2IA 4YPFA 3JPYA 2ZRIA 1WUKS 1MXFA 2P2SA 3FDJA 3DQZA 1DC8A 1ZOPA 1U3GA 3ONDA 1B43A 4IXWA 3O4FA 4PG5A 5BW6B 3TAHA 3VJMA 4BWYA 4B46A 2WQ7A 1QCCA 5AIAA 3EIOA 3LSTA 1Q3KA 4QUBA 2J4FA 3KSZO 1QZXA 1GARA 3BB3A 2IH5A 3D59A 3OLXA 3EGCA 4BLPA 1J2YA 1EFDN 3VHXA 4D57A 1VPEA 1Z2CA 1O03A 3SNKA 3JQ6A 3A1EA 3TO5A 1HYBA 2PRKA 1NNSA 4PGHA 1JAIA 1XJWA 4XB2A 3TZHA 4WLUA 4W1RA 1RM5A 4DYVA 2ZB2A 5IM4A 3FGNA 1SWVA 1H2ZA 4KMOA 1EIZA 3RGGA 2E55A 5M04A 2EL9A 1U7OA 1N36B 1IEQA 1ZJ4A 4K88A 1LXCA 1Q11A 1S5PA 4N4AA 4RPIA 4HGOA 2VHJA 2B8TA 4L8FA 2REXB 3PT9A 4RU1A 3B8EA 1NXQA 2IY8A 3AU8A 4KJXA 4M1SA 4PYKA 4ZI3A 1EUYA 5IDYA 4LE0A 1CS0A 2YUIA 2AZ4A 1EP1B 1R3UA 3FPHA 1HKUA 3F4KA 1UC8A 1GUBA 2I4LA 2WTMA 3SDZA 2H29A 3MC1A 4PFJA 4OQPA 1S7GA 1T3LA 1W8IA 2NNWB 3D7RA 3GLTA 3WL5A 2JKVA 4ZV4A 3BBPA 2R8ZA 4D4IA 1AB5A 4P93A 3LUCA 1W25A 4YAWA 2XA1A 3IILA 1UPBA 2NU6A 3PNSA 4J07A 3VR6H 1VDMA 4IGIA 1SVMA 4RLQA 4FDAA 4X1YA 3FHOA 4LOJA 4EHBA 1P44A 2Q49A 3S5JA 4EG6A 5BW8A 2FR0A 4NH0A 5KJFA 3Q12A 1V7PC 5AKZA 4OUDA 3BTSA 3E5NA 1JZTA 1KGSA 1O6ZA 2FHPA 4G65A 5L45A 1SK8A 3Q2KA 4NE2A 3R9XA 3NFYA 3FMFA 4LYHA 1NVVR 3D3EA 1B4DA 3FHCB 3LCVB 3BF7A 4JJ4A 1TD9A 4OHRA 3AXTA 3OQNA 4J75A 2EJUA 1JG3A 3A31A 3WQHA 5JXIA 2ECQA 3MJEA 2J6HA 4EUSA 2CT8A 4BTVA 1WWKA 3V4PB 3ETJA 5ALDA 4DGSA 4UHJA 2XYGA 5ERGB 1Q91A 3LO5A 3V7UA 5CEJA 5DNUA 1H9CA 4Y0VA 4COOA 4YCNA 4PC3A 3C3EA 3H9GA 4X1KA 2IIPA 3QUSA 2OZVA 1FNDA 4OHKA 2JLQA 5IF9A 4TYYA 2H3HA 3PNOA 4YCBA 4AX8A 5DM4A 3WLEA 1WDTA 5TT0A 3X2SA 3P45A 1ZH4A 3R09A 5K0EA 4YT2A 2UZAA 4G5GA 3MPOA 3B1JA 3PIDA 4DSOA 2EYQA 3AJEA 3I5UA 3THYA 1OC4A 5MN4A 3JR3A 3L7CA 3NV7A 2RKBA 4CR8A 1ECGA 2WWHA 4HB2A 3UYKA 4MMZB 1U2GC 2RJNA 3EG9A 3KFLA 4GIBA 1FSFA 3H05A 4J90A 3LQQA 2AWNA 4L1KA 1YZVA 2LBPA 4IHQA 3V4VB 2XTAA 1SHZA 3FD8A 3QM1A 5LYJA 4E5PA 4F9GA 4IGAA 1SCUA 1WLSA 4JOBA 1CW2B 5KOJA 4ZPXA 3HL4A 1WZIA 3BICA 3EWIA 3F90A 5A9SA 3QFFA 4K9QA 4ILEA 3KG2A 1T5DX 2AXEA 2WG1A 4MS1A 3CZ4A 4IV0A 3T94A 1ZC3A 1C41A 1SB8A 2XUQA 3SXPA 1ZO8A 1R12A 5KNDA 4RY9A 4OGWA 4JYZA 3TTVA 4JLVA 1YDHA 3BXXA 3QXJA 2P1ZA 1QFMA 3D6VA 4FBLA 2Q3DA 4M2LA 3STYA 3UICA 1ZISA 1JRLA 1XROA 2PTHA 2QXTA 2SKCA 3RG8A 1E98A 1E7YA 1FRNA 1UP4A 4UPDA 4EPRA 1Z8NA 1UQRA 3MWJA 3R5TA 2XZOA 1WF6A 5FWXA 4CEHB 2YJ6A 3DBVO 3O93A 4HVAA 3T7CA 3OZCA 1KH2A 4K5QA 1WP9A 4RPHA 1ZM7A 4RHXA 4C4SA 3F6CA 2QQEA 1XLUA 4NZZA 3CZAA 1EFAA 2YV2A 1CC1S 2OAQ1 4QJ4A 3H8VA 4U7WA 3ZI0A 1MPTA 3IV6A 3MUFA 1JBEA 3LVRE 3R5FA 1LPOA 4NEGA 3NI2A 1MO4A 4F5YA 5INTA 1DJOA 4LC1A 3WMEA 1P3Y1 2H5JA 5A9TA 5CLHA 3WR5A 1BE8A 3BCUA 4CM9D 2ZRBA 5CCDA 2PUWA 3A1NA 1M73E 4JODA 4BLRA 5D5HA 1VLJA 2JJ8A 4J7UA 3UAGA 1W5SA 2GCOB 2GDJA 2HA0A 3G5UA 3O8OA 3I1FA 4B44A 1W4CA 4EFDA 1E2QA 1ZM9A 2GKSA 2QKYA 5EXTA 5F78A 3H1EA 3GFVA 3NTXA 3WB9A 2IF2A 5K8IA 4EEZA 4V1CB 2I8LA 4H7KA 3U48A 3RVKA 2NUPA 3HB4X 4JGBA 4YMVA 1J8QA 2BGTA 4JB2A 3LKDA 4C07A 1YJ5A 3QUBA 1SKUA 1SN7A 3O90A 3CW2A 4EJSC 4EJSA 4D3FA 1Q22A 2CNWD 3CNOA 1EVZA 4D8XA 4X7MA 1Y4UA 1EJBA 4OHVA 4CLEA 2Z6AA 4ZYTA 3ZK8A 1VBKA 4DPLA 3KJGA 2ZSDA 3M6UA 3PNPA 4MWZA 4RCVA 2W6PA 4X91A 4EGAA 4Z7QB 2NWQA 2RHTA 1J49A 1Y7HA 1AS2A 1U0SY 3REGA 1VHQA 4C1BA 1K89A 1U0HC 2PY6A 4GMXA 2BP7B 2YMQA 1BXZA 4LDJA 1O58A 1RLIA 2GX6A 4LHSA 1M2FA 2CNKA 1BD3A 2FW0A 1WB6A 4ND4A 4YO8A 4QU0A 2F59A 2CB0A 1WMEA 2EATA 1K3TA 1XG5A 5BW5A 1CUSA 1PNVA 3E0QA 3HP1A 3MAJA 1QC5A 2OP1A 4NV3A 2IWHA 1FJXA 5F5NA 3ZJUA 3GGSA 4P4LA 1DDOA 4AAYA 4ZCRA 4MWSA 5E1DA 2GCOA 2IU3A 4HN4B 5FAKA 4Y9DA 4O8ZA 1MEJA 4JL6A 3M1LA 1JR2A 4UCXA 2D5AA 3MXTA 5AM4A 3K9GA 2J9ZB 3RFUA 4AZVA 2H5LA 3CBQA 3PCRB 1OGJA 4UM5A 3DLBA 5TR9A 3OZRA 1VI5A 2H06A 2R6GA 3HVHA 4I1RA 4L8WB 4KNWA 4N0QA 1NIJA 4DA7A 2ZJYA 3NQ41 2UYHA 3UH0A 1T2EA 1J1ZA 3U17A 4CNBA 1JFRA 4ZMSA 4JITA 3SX0A 3Q7TA 2FEPA 1L5LA 4BP8A 2R87A 2IEIA 3G59A 4XB1A 1DBRA 4YI5A 4B9EA 1XDWA 2DVMA 1M0TA 2OORC 5B4TA 2M6LA 2OORA 2G88A 1GFIA 3E7PA 4BKUA 4X63A 2JG3A 4Y1RB 1DXQA 1ECCA 1TM1E 3S5UA 5F3RA 5DYIA 4AYXA 4ZZ1A 5ES4B 1I32A 2QRHA 4FYMA 3ZHXA 2E9SA 4I9HA 4W9NA 3RCBA 4FIZA 3RV4A 5GM2A 4CUZA 1MQ8B 1B8NA 1XQ1A 2ZB8A 4DCCA 3EJ6A 2PIAA 3GJ0A 1VBFA 1ZOOA 3JQBC 1NNUA 1KO7A 3BGIA 2XHZA 1M34E 4BEVA 3RYTC 2ZB4A 1L7RA 1DAMA 1DTWB 2CLCX 3FSGA 1EX1A 1ADJA 5ISMA 4UMFA 1ZMRA 5BXYA 4RY2A 3GIDA 2D0OB 3F6YA 1BXKA 2ZQ5A 1KJIA 4G5FA 4QJBA 2IITA 4AJLA 5K3EA 3MILA 3UMBA 1P5ZB 3E3LA 4JY7A 5ULLA 3SS8A 2HMUA 4YJFB 1AKEA 5EJAA 5NULA 3HCEA 1WZNA 1NY6A 1KI3A 1MV5A 5IJWA 3VZDA 1KI6A 3UGTA 4A1OA 3QYPA 2FCAA 1U0BB 3TLXA 1E92A 5CIWA 2NU7B 5KX5A 3FPSA 4OGLA 4ZQEA 1OGIA 3RK1A 1I3MA 1Y80A 4B6RA 4G97A 1YT5A 4J7AA 1SQ0A 1ZGZA 1MU0A 1R6AA 3CF4A 4JKIA 5E4FA 4X5OA 3QFSA 2X5XA 2ZI5A 3TLGA 3AOEC 4P4NA 4XIIA 3UXYA 1I33A 1U63A 1JA9A 1N3LA 3RS5A 2IYPA 2VJMA 4Y18A 1SKQA 3DAYA 2NU9B 2XY4A 4YMIA 1PO7A 3K1YA 1I6LA 1KNQA 4RQBA 3MM4A 1EFVA 3QVOA 5AKYA 3H0EA 5FQOA 1TO1E 3HCRA 4HB4A 4N76A 1V6SA 1EVYA 5T6MA 4KOEC 2WWXA 3L8EA 5CW1A 2RAVA 5I7AA 3VNRA 5KTSA 3NBFA 3ND9A 4JR2A 4IDAA 4AJEA 2P62A 3VH3A 3A1CA 2XD9A 3STVA 5JS2A 2G0AA 3WHLA 5DIFA 3LGXA 4YJFA 1OROA 4G5YA 4GD3Q 2GD1O 2Q1UA 1KAEA 1P7WA 2A33A 3B6MA 1T15A 1UANA 3I73A 3RHSA 1IOLA 5IMBA 1SURA 4YDSA 3KYDB 3N8DA 4GC5A 2V7QD 2HIMA 3EMBA 4W6QA 4FHDA 1MB4A 3L93A 1Z2PX 2NU7A 1YZNA 2QYHA 3CJQA 1T8WA 4MUAA 4O2AB 4WFQA 1LF5A 2G07A 2Z5LA 1LLQA 1FP2A 3RHTA 4ZGGA 5HCIA 2PT5A 1B8UA 4HS9A 3VUEA 1E7RA 1HL7A 2J41A 4WZAE 5A05A 2H08A 2C96A 2PIDA 4EW1A 4BJ6A 3VPBA 2GD6A 2XMZA 3JTMA 4G1CA 4QUEA 1DCKA 3CTMA 4J94A 3HJGA 2J3IA 3VNBA 2CLDX 4HMQA 4RS3A 1D09A 3JVUA 3OEEA 2NU9A 4K9MA 4ZOLA 3AILA 3S70A 3MTQA 2FLVA 4KN8A 3EVFA 2VLIA 4C7VA 5I7WA 1JEEA 4CWAA 3D2LA 1F5NA 4GL4A 4HSEA 3FTEA 4MAAA 5AQEA 4BV2A 4DARA 4UFPA 4JJ8A 4MKGA 2BZ0A 3W3ZB 5IKXA 5EZYB 5I9SA 1B6RA 2AQHA 2XQJA 5HGJA 1F0YA 1T5OA 2OHVA 3PFNA 4WD3A 5AXAA 1E3JA 1ZZEA 3FMGA 1PJ2A 1DLIA 3HN2A 4TZKA 4WV3A 3THWB 1FDVA 2H1HA 5IJ0B 4AKEA 4M0DA 3K5PA 4Z6KA 4OYRA 1LK7A 3KD3A 4FS3A 4H7HA 3UT6A 2CD7A 3EIXA 4EKNB 4IWYA 5EWJA 4QECA 4QEDA 3KYDA 4M8SA 5EPOA 4OVKA 2BISA 2V55B 3K6RA 1E2BA 1ZI6A 5BN4B 5T3YA 3MHTA 2ZSEA 1FDUA 3AFOA 5C5CA 4XCQA 4UU1A 1IDN1 4N82A 1MB3A 1PFWA 1BEEA 2MYPA 2RK4A 3KPVA 3SP1A 4QZVA 2VJCA 4OA5A 2X3UA 2KBFA 3K72B 2HEIA 3E8XA 1INLA 3MN1A 3WYAA 2ZYWX 5GY7A 3LAWA 3O0DA 5DP1A 3WRXA 2WVHA 2BE7A 4TRRA 4UTRA 4CIVA 3PDCA 1UBNA 5CBPB 1JIVA 4ZVSA 3T1HB 1YMUA 4OLAA 3F7TA 3NGMA 2XITA 4UEQA 1PNQA 1QB7A 3EFHA 3KXDA 4EZEA 1C9EA 3DPIA 1YBAA 2OE2A 4FILA 3OWOA 3U09A 1ZCBA 3QBJA 3D0OA 1OI7A 3DL4A 1TEXA 4RV4A 3R7SA 5F1OA 4F56A 3E5RA 4LDNA 5LIRA 2FOIA 2RFLA 2CNWA 3NNNA 4B7AA 3G8BA 5SYNA 4MWCA 3BGVA 3EN0A 3IXQA 4KUGA 3THWA 1F9EA 1QHIA 4R84A 1E5DA 4ZYUA 4M7RA 4V38A 3AV3A 5DRTA 2JJQA 5EMNA 1NN3A 2PPLA 4H27A 4INAA 5H68A 1K97A 3DTTA 2XRZA 2AXNA 2ODAA 5KQPA 2IEYA 1ETHA 3GAAA 1Z4JA 4D6YA 2ZYGA 5BN4A 5IK2D 1KDPA 1FYWA 2X0KA 3P4UA 2LR0A 2ZXFA 4MSUA 5D86A 4Y2VA 4JGIA 2MHCA 4Z3DA 3UJPA 4ENTA 4D4HA 5F23A 1SUAA 2H85A 3P2YA 4W8HA 3USCS 3VUFA 4LEIA 1XZCA 1T34A 2DSNA 3DMFA 3MCTA 4NHEA 1GL3A 1OKKD 5JYEA 3G0CA 5EY5B 4LHVA 4CPDA 3TH5A 3ZWWA 4Q4LA 4R9SA 2ZUWA 1Z22A 2UUPA 3BK7A 4XX1A 2CZGA 3FHLA 5J2UF 4UNQA 3RIGA 3GJ6A 2R3SA 2JNWA 1W49A 2Q9BA 3BE4A 3GLUA 3Q3GE 1QHYA 5COQA 4XB6B 5DHQA 5FNVA 1NVTA 4BV9A 3CNEA 4C7XA 3IS3A 1N57A 1Q12A 4D8WA 3MWEB 2C94A 4UW9A 1VPWA 1JFLA 3ROKA 1L4EA 1Z2AA 3CHYA 3O82A 4L8YA 2V03A 1YFKA 4MKZA 1ZNZA 4IMJB 3PDJA 3DT8A 2FSHA 1FRVA 4FMDF 1SKYB 4JD5A 5EFOA 3HFSA 3V1YA 2ZRLA 1FLDA 1R3DA 2NACA 5LZ4A 4AQYB 3OAAD 2RE8A 2O48X 5AJYA 3IAAA 4DMCA 1Q7BA 1K2VN 2WNSA 4TL9A 1V2GA 2HV8A 3QF7A 4KE7A 1AKMA 2PX4A 4HADA 3LPNA 4HDKA 2ZDGA 3MTJA 4PXSA 3ZIDA 5KYGA 1CJCA 3QTLA 3OZTA 3ZH2A 5FIUA 1FP4A 2WWRA 3OFVA 2GN4A 3AVQA 1IPFA 5JAOA 3DEAA 4N0EA 5G02A 5JFGA 4KDFA 1TCAA 5I8PA 3DHVA 2O4UX 4FYXA 4QJIA 2JCVA 2V1XA 1GU1A 4PAGA 2O4CA 3CLUD 4J1TA 2Z83A 2V0CA 4YS6A 3DV0B 3CG0A 5B1HA 1V43A 2MSKA 5FHQA 4YQEA 5AVXA 1HE8B 3TN7A 2BFNA 5FAXA 5LLTA 5AM5A 1NBAA 1R8QA 2VO1A 1ZRMA 4L73A 4M9XA 2ZR8A 3JQ7B 1R8XA 3ESDA 2QTVB 2ZUSA 4LDAA 3EVDA 2JZOA 1PT6A 3I6BA 3UFXB 5KVAA 4BY9E 4IVNA 1YGPA 4LZOA 1ZD2P 2NZVG 4U0KA 3L1UA 1WETA 1FFCA 4Q1AA 5H7XA 4JEMA 4J0HA 1PSDA 4FGZA 8LDHA 5EJEA 1E2JA 2BBWA 4N7MA 1L2TA 4TL7A 3U4QA 4JJAA 4Q3BA 1QFXA 2WBLC 2C98A 5J4HA 4B31A 4B4UA 2C4HA 1IJEA 4C08A 2XTZA 1D2EA 4DABA 3IQDB 3N6XA 5LZ5A 1XZIA 3IMKA 4E5YA 3ZVNA 2JATA 4MO2A 1IM8A 2FWBA 2CXTA 1IQUA 2O57A 3T5PA 3ND7A 1NW9B 3LCMA 4ZQIA 4C7MA 1KZ7B 2CSUA 4UAVA 3GIWA 4XQGA 3IDAA 2YN4A 3RAPR 4DC1A 1F8UA 2PL9A 2WZDA 3GPLA 3HRIA 2GB4A 3IAFA 1HYGA 2XMGA 1RLOA 1AKTA 2ZT7A 3L4EA 1N3YA 4JLKA 3WYFA 1EUQA 3L4BC 3N9IA 5EHGA 2D0DA 1IMOA 1AM4D 4EIWA 2DWQA 4CKZA 1ZXXA 2PRYA 1J06A 1JEQB 4YRQA 1CIJA 2Q45A 4R2LA 1JDVA 2QTVA 4D9GA 5LLSA 4IHJA 5CEFA 4F4JA 1P1RA 3GU3A 5G0UA 4EB8A 1OVGA 3UFXA 4YCDA 4BMOB 4GX5A 2Q29A 1AB6A 3JSXA 1UK6A 5JSUA 1UH5A 5DIZA 2XB9A 3NBKA 4EB6A 1Z5PA 3HG7A 3NT2A 3GYGA 4K9NA 4OD0A 5FPPA 3K1ZA 2DBQA 1VECA 2LD4A 4OQFA 3I61A 1IN1A 3LVBA 2ZRFA 1HE4A 221PA 1NVMB 1JBKA 2H8GA 3MGAA 5DLEA 4BNNA 5HPYB 1LSSA 2X5KO 1RJ9B 4CMEC 4NBVA 3BE5A 4LX8A 1WMSA 2MSCB 1O4VA 4PRLA 3FYTA 4QU8A 4UE2A 3MYRA 5GPBA 4M9RA 4FN5A 2X86A 2AI2A 4GECA 3I1JA 4U02A 2P9HA 3EQ9A 2DM6A 3ORRA 3DBHB 3U9SA 2RIRA 3DHEA 2P9FA 4LECA 5H5JA 3PV0A 4Y6SA 1TYEB 4BNFA 1NVGA 4P83A 3R7LA 1GUZA 4AMGA 5BV0A 3VH1A 1SBTA 4C6HA 3QRWA 4C0QC 3DZJA 1FUUA 1SC1A 2EWVA 1HV8A 3BWCA 2ZYSA 4GBJA 1MOSA 1S96A 2VHUA 4Q39A 1XVTA 4C0WA 1ZZGA 2DT5A 1IULA 1O9BA 1PYDA 3LQ2A 4FJ1A 4IUDS 5FYQA 5A4KA 2AGVA 4HQLA 3W4IA 2FB9A 3QOFA 3BYZA 1SIBE 1ZBQA 3S2SA 3EX7C 2N9UA 2REOA 3G7UA 4O4JA 2X0FA 4Q5IA 3RT1A 3BH7A 2NP7A 4UUQA 1TYCA 1MFZA 3GGCA 3CX6A 3SS7X 2MTBA 1LBEA 5D3MA 3B7GA 1KSGA 1Q3HA 3EVEA 4WKOA 3ZY4A 1NN1A 5A3JA 3Q8KA 3PI7A 5EZ6B 4M9UA 2JLZA 1AK9A 2Y1FA 3G2OA 4OBXA 4EF4A 4EVRA 3TZEA 2PRZA 5AH0A 3C5HA 4DLZA 4IL5A 3FBGA 1A71A 2DZDA 4M1ZA 4PSCA 4E6PA 3E35A 4QFMA 3SEFA 4D3DA 5LQCA 3PTAA 3K4HA 1TK9A 1IBLB 1PL6A 4EOGA 3EZGA 4MDEA 4H60A 1PT8A 4NK4A 1NSTA 1UBMS 3I3SR 3T1QA 1ONNA 2WB2A 2I3GA 3BRQA 2JVKA 1RMQA 1U3UA 3QPDA 4PO1A 4D6PA 3AI7A 3OBBA 1KMHB 3PXAA 1NJ1A 3W2HA 1T35A 2CUNA 1OLXA 1GGMA 1R1DA 3Q8WA 1ZK4A 2RHMA 4UD6A 3WRYC 1YR1A 3ZS8A 1DWQA 2WD9A 1TPYA 2VA8A 3IDSA 2NQ2C 3FUCA 3IVXA 3NBQA 4R6WA 3GVHA 3ER8A 1B6SA 3WWZA 1HORA 1KY5A 3T1NA 3VJKA 5B7PA 2QORA 3GLHA 4MP8A 1RBYA 2ODPA 3NW9A 5JY6A 4LYFA 2QR5A 4RFSA 3A4LA 1HWYA 1VRCA 3OVMA 4L72A 3F6EX 3L4SO 3PJGA 4IS3A 4P3PA 4KBYA 4JH0A 5IK2A 1Z4MA 2C4TA 1N5OX 3G2HA 1GZUA 3EPRA 3N2KA 1RPAA 3WGJA 3MIIA 1CE8A 3REQA 1NULA 1AX9A 2A9OA 2INGX 1FP6A 3JZMA 2QSYA 1GLGA 5EP3A 3O4VA 2ID4A 4WZBA 2XODA 2FFRA 2HFJA 4WN3A 1WE2A 1MTOA 4U3JB 4II7A 3QMPA 2LVBA 4B71A 1KQPA 2ZITA 1N6IA 2HJWA 4RPLA 3KL4A 3MOSA 1FPQA 1QF9A 3TD6A 4OXRA 4YRKA 4G9GA 3TI9A 3VAAA 5CLLA 4TTRA 1JQJC 3WO0A 4H7FA 4Q93A 4UXHA 1KMHA 3N2EA 4PLGA 2IIQA 3IP1A 2DHRA 4AJ1A 3STXA 5F12A 4DV5B 2I62A 2RGXA 2ZSFA 2ZUDA 2DBYA 4QBHA 3V8NA 4AUMA 3TFOA 1NE2A 4DIKA 5A0TA 5P21A 4BJ5A 2Z8YM 4CKXA 1VG0B 1BS2A 1JTEA 1KZYC 1JUDA 2RK3A 3HA5A 4U2FA 3ZV5A 1I3OA 3RVMA 4OXQA 4B76A 3A32A 3KPYA 3N70A 3PR3A 1Z0IA 4MUBA 4LSWA 4D1YA 2BKLA 3OAAA 3ZHTA 1NVUQ 2ZS9A 4Y2SA 1T0PA 4LGMA 2FN7A 3WB2A 4PZEA 4QKQA 5C1DA 4E46A 1JSCA 4E07A 4MO9A 5TRTA 4C0KA 3GCWA 4FNOA 5HS6A 4WJZA 1SHLA 3VR4A 3I9MA 2OHFA 4PZPA 1DKNA 3NHWA 4H7JA 1NDHA 3C3DA 1P72A 4AZSA 2BHNA 4D9MA 2ZYUX 5FLEX 1DJNA 1LC0A 2BFDB 4R81A 1X80B 4ETIA 2OZLB 1KSJA 1WULS 1PR0A 3CLUC 1VL0A 2BSAA 4WZZA 3ZWYA 1PFQA 1TT5B 1T2FA 2Q2QA 2CKDA 2G5CA 2GLXA 3LQFA 1H1LB 4H17A 3IAS6 4OJQA 5IW8A 4DC9A 3FYCA 4WLFA 2ZJ3A 3L5KA 1XNQB 2YZMA 4IJUA 1A2OA 1JLKA 2Z30A 4AZ0B 1XA4A 2A0YA 4WKCA 3B9QA 3WAJA 3BA6A 3LYLA 2AHOA 5IBRA 2ZT8A 5I9MA 4BQQA 1H4QA 1M34B 4I0WB 3IPYA 4HGNA 4IJQA 3PXBA 1EFRA 1F0PA 2OQIA 1OXTA 3W9BA 4QG3A 1HFKA 4BMXA 3AM5A 4UQLA 3FDZA 1CQWA 2VF8A 4KMMA 4HLDA 1P2FA 3RM3A 4BNLA 4W5RA 3A26A 4HNSA 1SVSA 3EMVA 5DLQC 1MW8X 2J1LA 1SRQA 1ATIA 4EM6A 2BUCA 1AMNA 1OCEA 4RABA 3L5OA 3KEFA 3H7IA 4ZYWA 3F9CA 1XCGB 1WEHA 5AKGA 4MIYA 4UAGA 2ZE6A 5CB0A 1RKQA 3OOWA 2VQDA 4ZVKA 3UAVA 1VXRA 2HHAA 1JH8A 1K8YB 3KDAA 3DW3X 5ETJA 4QFBA 4B0OA 3X44A 2DEUA 1DVRA 4TV9F 1EM6A 5JAQA 1DTSA 2HBZA 1OWNA 2XA9A 2IPLA 3QX9A 4MULA 4IDBA 4OMFG 4YRCA 1GPH1 3RAFC 3ES9A 1VCNA 2Q1XA 4EY3A 1Q83A 4WFKA 5LDHA 1D9XA 5J23A 4QEKA 2PT9A 3VNQA 2I1LA 2HNAA 1NW3A 1DZ3A 2QLMA 5AVKA 5LYJF 2DWUA 4AZ0A 1YONA 4M8NE 3RS2A 5DHFA 1EA5A 1UK9A 1VB5A 3U3RA 1LBQA 3QGMA 2LE0A 1VYUA 5IC4A 1YKFA 4JLNA 1Q1EA 3NTUA 4CMIB 5HOEA 2B4TO 2BELA 2WI8A 2CY0A 3HKEB 2JJ2A 2MINB 4OXIA 1JGTA 1QHHA 3EDMA 3TAXA 2X3FA 5G0VA 5C5EA 5KREA 2YKGA 1G16A 5HYVA 2EFCB 1Z6AA 2C99A 2YJZA 1R6DA 3GRYA 4QBTA 3NXSA 1JXAA 4XEHA 4P7GA 5AK0A 2JGEA 3RUHA 5B53A 2RHLA 5BVHB 3R20A 1R4MB 4IQ8A 1OZAA 2AW5A 4HYYA 2Q7DA 1V47A 3DZFA 1ZXBA 1S2GA 2GUWA 3L6DA 1JFFB 4UKDA 3RTAA 5ALMA 2XT0A 4B3XA 3IELA 1S8AA 1JR6A 4TKUB 5J5VA 3DFIA 5LD2C 4B3BA 5AKLA 3KXPA 3JQFC 3PA6A 5G41A 2PR7A 3UCXA 5IVPA 1EX7A 4PHHA 1DDIA 1Z25A 2NP6A 5AKKA 4AKTA 3G2IA 1EK1A 1H65A 1E2GA 1P62B 4WZAB 5E9QA 1RI4A 1PR5A 2M6KA 4IJWA 2WHEA 2O8EA 1ZDMA 1GVHA 1V16B 2WDPA 4LV6A 5J59A 1MX5A 2V8OA 5CJPA 1KVSA 5BWMA 3IODA 4KDEA 2ZR7A 2R1VB 5G3ZA 3RSFA 4RKFA 1QNFA 2JAUA 4CMIA 1EESA 3LCCA 3X1XA 5GADl 1AQUA 3EF0A 4O2BA 1DAIA 1WUYA 2H2WA 3DAHA 1QIHA 3DMYA 4G8BA 2BEVA 5AUOB 3KCNA 2C03A 1SELA 3BQ9A 3CINA 4JJEA 3PFWO 4QSHA 2QMOA 3CF6R 5C35A 3UKOA 1XALA 2B3DA 2QNRA 5TMEA 4WUTA 4DV1B 1MZVA 2XNHA 1YB2A 2YIDA 2H2AA 4M1EA 5LKAA 3IPLA 2MCFA 3RRZA 3G13A 5G3YA 5IAGA 4B6OA 3CS3A 4KW7A 4NCIA 3G8YA 2VHWA 3OOYA 5ILQA 1QVRA 2X7JA 4KXQA 1YJAA 1E4VA 2ZQZA 4GEKA 2QP4A 5BNIA 2ZDHA 1S1MA 3LHDA 3UMVA 3WYEA 1J00A 1GTJ1 2JLAA 5GP1A 5B55A 4NCNA 7GPBA 5LP1A 1YKSA 2AN1A 4N40A 4PC7A 1WHSA 4MINA 3VU9A 2Q21A 4CM4B 2O0JA 2VJYA 5LM3A 4GDFA 4G01B 1QCZA 1NBOA 3I64A 4PLWA 2R1VA 3UK0A 3M5WA 4CBVA 1BH2A 2WF6A 4O4HF 1UFOA 1SNYA 2R8RA 3V1LA 3N39C 2VBFA 3CKYA 2H65A 1CZOA 2B5VA 2WWYA 2WM9B 4X65B 3ENWA 3GDOA 5EUCA 2FXIA 4AU1A 4MGHA 4ZI7B 5J9FA 3OFJA 4FZRA 3TSCA 3KC2A 1PUIA 2GPNA 2JW5A 1GDDA 1UT8A 2H4WA 2XKBA 1K68A 5KOIA 3N8KA 3DV2A 2IH4A 3MOGA 4JI7B 4KQ6A 3L4KA 2CFRA 3H5NA 2QD2A 3FCXA 3OPVA 3SYKA 1H2YA 1VSQA 1EA7A 2ZJAA 5CX1A 2K7FA 1T2VA 5B3JC 1LDBA 3HR4A 3WFIA 2QTZA 4O1IA 3WG9A 1GP2A 2YR0A 4E14A 1DX4A 3G2MA 4OIMA 1D07A 2JZCA 4JBLA 5ICMA 1VJ1A 1Z2NX 1Z56C 3KTAA 4CETA 5U4XA 4AMUA 2J3LA 2HRDA 2I3ZA 3FTNA 1ZIOA 4RW0A 4DQDA 1Y6JA 1RZRA 2DR3A 3DWIA 5DFAA 4MZDA 2XB8A 3PFHA 3T95A 1SXJD 1AY0A 1GGEA 1TYDE 1CRLA 3AUAA 1DFHA 4XVHA 1CDOA 3IP9A 3CRRA 4DNQA 3GY0A 4LSMA 1U9IC 2PUVA 3FYUA 4C3VA 4JNCA 3GEMA 4D80A 4FE7A 2PKRA 3MZ0A 3SHTA 1W8DA 2DR0A 5ECGC 1HYEA 3AONB 3ROGA 4JVNA 2NXCA 3MMSA 3ROZA 4KPFC 5HTKA 3IJPA 1CUUA 1RWWA 2AI1A 3PRJA 2RGAA 3QKSB 5CFLA 4JXKA 3RYFB 1VPVA 4ER3A 4FDMA 3ABOB 1V9CA 4TQUS 3ZKWB 3ACCA 3ZZNA 2O0MA 1TPZA 5EJFA 3RSCA 4MOWA 2IHNA 4ZV7A 4CQNA 1JIXA 2IIBA 2NZYA 3OX1A 2CYCA 3BAZA 3N1UA 4F12A 3UWSA 1ZMXA 4MQEA 2BHLA 3W6PA 4C6TB 4YP7A 4Q3DA 4M89A 4YTEA 2BTOA 1T6BY 1P0QA 3P5BA 2YHIA 4PZYA 3RVDA 3TW6A 3BGDA 1P1FA 3OCCA 3AU9A 4B81A 4RIHA 1P3JA 3G8CA 1F4VA 3QV1A 4FIDA 4HNHA 4JU9A 2IP4A 4MR7B 5LWHA 1Z33A 2P5TB 1N5JA 1PWHA 1E63A 1W94A 2H5IA 2H0QA 1ZN2A 3VOBA 5FUWA 4F4CA 1L7VC 2ZZNA 5FNZA 2QR3A 4AY6A 4PS0A 4X7BA 1EG7A 3TR0A 3ZJVA 2ZVDA 3KR2A 2J0UB 3UGKA 4JJIA 4I55B 2IXAA 3DZBA 4X20B 1EJ6A 3ZU3A 1R7RA 2VK2A 1H8HD 2WJ3A 3A28A 4LZAA 3AMVA 3ECCA 3O2QB 2ZEJA 1ISMA 1NBMA 3SE0A 3KKMA 5FUVA 1E61A 3ONEA 4ED9A 2FDCA 1FX0A 2XBLA 4Y6LA 3BEDA 2WM2A 2ZCJA 3F9RA 3THOA 5GVSA 3NVMB 3FCUB 1TM7E 2QN3A 3B3AA 3JWGA 3K0EA 3MIZA 4XM0A 3R5XA 3N2LA 3WRVA 3SVLA 3D6HA 4DV4B 4U2BA 2OSVA 2JRCA 5BQXA 2UUBB 1JG1A 1U1DA 3O75A 4NULA 4BMVA 5ADWA 1A9YA 1KMIY 4X7RA 3X2FA 4EVQA 3U1BA 5EZSA 4EMTA 4OFBA 3O2NA 1N1EA 3HKDA 2ZI9A 4J6FA 1L5GB 1BW9A 1M2GA 1R5BA 1UK8A 3O4RA 4MI9A 3WK8A 4ZVQA 3N0RA 5G2OA 2CXNA 3LDHA 3OIWA 4PG8A 1JMYA 1HM5A 4ZOLF 3KVYA 1E9SA 1DAKA 2J3JA 4JQSA 3AUYA 3OFND 2Z8ZA 4BVBA 2HV9A 2TYSB 2VCEA 1GRRA 3PL1A 3EGWA 4IDDA 3UY4A 3IHKA 1NF9A 2H57A 3ZUPA 3AVPA 4YC7A 4DDKA 3PGKA 4KI7A 3BL6A 3BMNA 3MD9A 4UXJA 3CCFA 3V7YA 1EDDA 4RGVA 2XSZA 3U4MA 3KEGA 1MC5A 1N3IA 4N5HX 1MAUA 1RXCA 2L42A 2XJ9A 4MWOA 2Y1WA 3ZJYA 4DF3A 2WR8A 1M8FA 3Q4GA 3ZJTA 2XCRB 2B1IA 1GT6A 1NWCA 4AY3A 1NRIA 4C78A 1K66A 3N59A 1U3WA 3DWFA 5TB5A 5I7VA 3OUUA 4FFLA 1EPUA 1GNTA 3RUEA 2NV2B 4Y2HA 4JKOA 3WWCA 1FLNA 1GCIA 1NZJA 5CDHA 4AIRA 3GHYA 2PKWA 3PVSA 3Q6IA 4FMDB 4LX0A 2O50A 3I72A 3E58A 1SOVA 4REMA 4RVFA 5FLXA 2ZRNA 1CEYA 5IP5A 2VYND 2QRVA 3ERCA 2I2FA 3HB9A 5AVQA 1U7PA 2HSJA 1MJ5A 3HCDA 4A3SA 4BFWA 4D41A 1K3UB 1SD1A 3TSAA 3KRTA 4TLLB 1S6YA 4Y7DA 2C42A 2VNKA 3P9NA 5KTTA 1X1EA 1WCWA 2FMIA 2VRWA 2B1RA 2AE2A 3GMDA 1OA1A 5KHOC 1HF3A 4QTTB 4L27A 1SGWA 1AURA 3NHJA 1RP7A 2C54A 1C3OB 4QXMA 5K3BA 2LRHA 1P0FA 4DWVA 1Z4PX 4UBOA 3TRIA 1RYYA 3S1SA 3DTVD 3F67A 3KV3O 2CZQA 1T1IA 2OO7A 2J3MA 2OK7A 1ENOA 4B4VA 3RJZA 3UWMA 3B70A 3EXAA 5JISA 1UBTS 1W93A 2OBNA 2YN2A 4FLMA 5FYDA 1CNMA 1W4RA 2EZTA 3AM3A 1IC6A 3QEJA 4N5DA 2HLHA 4OYLA 4P6VF 3RGWS 3KFVA 1TZMA 2I4TA 3P2JA 4IKEA 4EFKA 3WHKA 3BMCA 2GF9A 1MC8A 2HMYB 1M0SA 3SPXA 3IA7A 3LYUA 4TYQA 4BWGA 2QJWA 5JROA 2VTBA 5LP6C 1QK5A 5CDFE 1E64A 2XQKA 5LP6A 2PFGA 3QYAA 2R84A 1ECLA 2VJPA 2ZIXA 3HZHA 3RVJA 4B4OA 1CNFA 3QYFA 5ESRA 2GXUA 1P2GA 1LJLA 2OOKA 3IBCA 3IP3A 1G19A 2D2XA 4A2QA 1CUEA 5HF9A 5KYWB 5BQOA 4AK9A 2WJAA 2WPDA 1IYZA 2QUZA 3EYWA 1USVA 2P4SA 3BTVA 2OKCA 3HFRA 3O3CA 5FO0A 1O0BA 2UZ1B 5IKOA 1E5QA 2D2IA 1XTRA 3DLTA 3FA2A 2IU0A 5EN4A 2HNBA 3EEIA 3B53X 3DS8A 1MP0A 4PLZA 3LW8A 5FNVF 1QV7A 3NBZC 5ALTA 1F4LA 2N46A 3FOWA 3L18A 4KQIA 3LIPA 4N12A 4UTNA 3DE3X 4PNZA 3MS7A 3W3AD 4YJHA 2BHSA 2X8BA 4YYEA 1WXGA 1EX9A 1XVAA 3R40A 4BTLA 3T4PA 3OQJA 2GN8A 1Y81A 4Q4CA 4UM9B 5K6RA 2H18A 3DZHA 4R3WA 1X1BA 3E4DA 4ND1A 4I4CA 1DQYA 3B1ZA 3ZHYA 4X60A 2I2DA 2YWHA 3QVWA 5D87A 1HG0A 3OZUA 4MQ4A 4JI5B 5EKXA 4FR0A 3TVDA 2IDMA 4DT1A 1C1DB 1JIQA 1SXJC 2G67A 2H52A 1I01A 1KFKB 3AUXA 4L3OA 4U39A 4BX0A 4EJMA 1KWKA 2V7PA 2IY7A 3SEZA 5CG1A 3IOCA 3CLSD 3RS0A 3T0FA 2LPMA 4FYWA 1G8PA 4RJKA 2I6SA 3ZJ5A 5JW6A 4UAJA 5L53A 1Z3CA 3ZWBA 2C3PA 4P2GA 4DSNA 3INYA 3ZXXA 3LT4A 3C41J 1F0NA 1UPAA 1Y5NA 3K73O 2NUTA 2FDRA 3OTWA 2I6UA 5AD1A 3ZNPA 1O77A 4A6DA 3PHLA 1V25A 2EQBA 2PA3A 1ONOA 2QRPA 3KP1A 2Q9UA 2J4DA 4TM8A 2FZVA 2XGSA 3MQ2A 1E3QA 4N6OA 1KEZA 1QOPB 5C31A 1Q0ZA 3AH8A 4PPFA 2BTEA 4HS4A 2VH2A 3Q9UA 1KJWA 3FOFC 2HIGA 1G3IA 1CHNA 4QAQA 2O19A 1IRIA 4TLDA 3E22A 3Q40A 3G17A 5GONB 3WAKA 3QK7A 4KE8A 4ZI2A 3A6KA 4B17A 2F9LA 4W7HA 2IXFA 1YL5A 2XCTB 2GM4A 4DQ0A 4JJZA 1JIKA 3SC4A 1P5HA 1VKJA 1FFEA 2IPAB 1WSAA 4B85A 1Y8RB 4ZAYA 1B73A 1HZZA 1I10A 3KCQA 3Q0TA 1NW8A 4EL0A 4EKEA 4N7JA 2QTGA 3QXGA 1WUJS 2I6GA 3EPPA 5D00A 5KKCA 1KQOA 2W9XA 3NHBA 3EVTA 4MIEA 1RTTA 4Q1VA 1MVNA 4KXNA 4R1UA 4FEEA 4WLVA 3PHCA 4Q03A 4JP1A 1XTUA 4F6CA 3IKVA 1H8HA 2JLYA 1AF7A 4ND5A 1J1IA 3WP0A 4XWGA 3D6NB 2TMYA 3FTFA 5GJWC 4BP3A 1E9RA 1XXLA 3HBMA 1X42A 1K06A 4MVJH 2F43B 1NOIA 1J21A 2VPQA 2WZBA 3BHJA 3FTDA 4IHJF 4XYEA 4Z51A 1AHIA 4B4DA 1WDWB 2C29D 4ALLA 1HRDA 2Z95A 2XBUA 2XZTA 3HY3A 3MMPA 3QLJA 5ADUS 3E9MA 4NK5A 1ZM4A 5DNCA 5JFOA 1FVXA 3C4QA 4WX2B 1S9HA 4YBRA 1QVWA 2E89A 2NU8A 2Z08A 4IYJA 4QATA 2V7TA 1D8TA 3AVOA 4S0XA 3UJ9A 3T3HA 3OJXA 1YZ3A 4HC4A 7REQB 5U9CA 1MV8A 1NXTA 1ELOA 3HXPA 2WZCA 2WSSD 1MJHA 2VAVA 2GN9A 1DT3A 3HLYA 3RI3A 4EHLA 4Z3OA 1C9KA 2MU1A 5DI3B 3A1TA 1U6JA 4D9HA 4R3NA 1G21E 2IVFA 3ROMA 3RVPA 1A4RA 4PYNA 4FHFA 3KWMA 2O3SA 5CK5A 4YMSA 2A58A 2B78A 5KSZA 4DMKA 2G9UA 2K87A 1MO6A 3HADA 2VF5X 2BF7A 5J3JA 3ZXUB 3U3KA 4RXMA 2RHJA 1J2JA 4L9RA 3RDPA 2AZXA 1QK4A 1YGYA 2GLTA 3I58A 4C6TA 5DMHA 1QHNA 1FCJA 1IZ7A 3AUFA 3LF2A 3Q72A 4MKXA 4Q15A 1AKYA 1NYRA 1KVQA 5EE3A 3WSVA 4F4HA 4YRBA 4HB0A 4CKWA 4UEOA 4H4CA 2BCGY 4K6HA 1OI3A 4N54A 2JBAB 5ECYA 5IHPA 1HBJA 2EFYA 1YBFA 1ZQ9A 2GAJA 2JC3A 4OHCA 1EKXA 1X19A 2OY0A 2O52A 2HOQA 3T9CA 4OP1A 3F4LA 4MPDA 3WWEA 3VDRA 2XWSA 3MFQA 1CY6A 3AI2A 4F97A 1COZA 3KT8A 3HXMA 4P4TA 1OIVA 1QVAA 4QLBA 2KS6A 1ZKMA 2ACWA 4KFRA 3UJ7A 2HWYA 3C6XA 1U81A 3DMDA 1P29A 4GAEA 2ISCA 5KEIA 4I4TA 2VDUE 1FTWA 3L77A 4U7FA 3WL4A 1OE0A 2HDNB 4GI1A 4C0AC 3BKWA 3L8DA 3LIIA 5T6BA 2C2YA 2O2EA 3KVVA 5EYPA 4X1IB 2IE0A 5IH7A 3UQYS 3F2VA 2WD7B 4OMUA 3ROEA 4X1OA 5DNEA 4ZEOA 1KSHA 1L4YA 3TX6A 2QL6A 3IE0A 3IYLW 1SVLA 2BGUA 3KT6A 1V11B 4GSKA 2WJZB 3RK4A 4HRYA 5LFAA 1SXPA 2VDNB 4G86A 4RHFA 1CUIA 1K4MA 1VE6A 2FUCA 1PK9A 3DTVA 3L9XA 4BPRA 4DEYA 2C5LA 3VNSA 4GI3A 2BFFA 4OM8A 4I8IA 3S2ZA 8GPBA 1JEOA 5JRZA 2C9MA 2VEOA 5GJBA 4I5GA 2SNIE 4LY9A 4PR3A 4CQJA 1NM5A 3WGOA 5K6AA 2WM3A 1X0XA 2G1JA 3SHQA 2AK2A 1V1RB 5BUZA 1FDIA 3ZXYA 4X0EA 1UBUS 1XZBA 2JBAA 1VPDA 4DLUA 2GHTA 3BL5A 1A82A 2HMVA 4R40A 4DR1B 5FCDA 4CV3A 3OIDA 4JB3A 4MR9B 2CLIB 4EI2A 2P78A 2HF7A 5IJ9B 4G2NA 3AWDA 3L07A 1J07A 1ZK2A 1QIKA 3C1TA 3NG1A 3PNYA 2PUBA 1NNI1 2HMAA 4L9AA 4BUJA 4N01A 4BLQA 1H3EA 4HNRA 3FVRA 2PCJA 4FE3A 4OQQA 3W5AA 2P9QA 1G9XA 2EJTA 2VSFA 1W4AA 2WTAA 4L8LA 2Y68A 2W2OA 4MHOA 1LVHA 4JELA 3D8TA 4OQYA 3DL2A 3UW3A 3RBXA 1YQXA 4TKVB 5B4UA 2WD7A 3EEQA 4IUBS 3COPA 1B93A 1KC1A 4BB5A 3T6KA 1GYPA 4TV9B 4ZVUA 3QHPA 4IEIA 5H9VA 5EMLA 2O20A 1P7ZA 3NIGB 4XX0B 3WL8A 3D7NA 3L92A 4FGUA 4RACA 4RQTA 1P33A 2NUAB 5KWVA 2I22A 5KQMA 2FPXA 3FOBA 3PR2B 1K88A 1UJMA 3BVPA 3MELA 4UULA 1YQQA 1ARZA 1HT1E 3TRHA 1D4AA 2HEGA 4M8IA 1V1RA 2SECE 1LTHR 2IGTA 2IELA 1A97A 2KSQA 3IOYA 5CNIA 5IKMA 2LW7A 3IV9A 2OXEA 1JHXA 1N2XA 1Z5ZA 3LX4A 4OU4A 4PNPA 1J5EB 3KFXA 2PQ2A 1WF3A 4GOJA 4DBVO 1RZUA 3ADCA 5EKUA 1M76A 3FVQA 4EITA 5A5FA 2C7PA 2PUEA 3S2YA 4KIGA 3CLSC 3LMKA 2J3HA 3FKSD 1MAWA 4MITA 1DO8A 5EAIA 1GNRA 3D5TA 3VTFA 1Z73A 4EO7A 3IKTA 1X7WA 3FPLA 5CJ2A 3ND6A 2ZJ1A 4RH3A 5LUBA 2J09A 2J5RA 2QN6A 4PINA 4KQ2A 1QV6A 5JXHA 4JI8B 1PT7A 4BP1A 1R88A 3G23A 5KOYA 4TKVA 2IYUA 1NW7A 2JHGA 2QRLA 3P0HA 5ALSA 3TD9A 2JFVA 2OZPA 3CUEF 3O8DA 2N42A 4RZSA 2OR3A 2F1RA 3NASA 3W90A 2C2MA 3RVBA 2GFQA 4JBXA 2OBFA 4KHZA 4Q12A 4WFIA 4FGWA 3R0QA 4RDCA 4ENWA 4AX4A 3LBAA 3CLVA 1M2OA 1L5VA 3GRCA 1RWOA 4OA8A 1YTUA 1Z0KA 2A5FA 4QXQA 1DS6A 5KAMA 1OTHA 2JLWA 3OPQA 4B6JA 2QMEA 4QJ5A 2ONJA 5E38A 4P54A 3CVUA 3G1TA 4CKBB 3NKLA 4EO9A 2ZS7A 4HB3A 5GM1A 4FMCF 5JPIA 4F3NA 3DAFA 3KR0A 3U60B 4MW1A 2ZJZA 5HQ3A 1BD4A 2GSDA 3JD1A 1EEXB 3BE8A 3NEJA 2Z2YA 3QBVA 2OHXA 3HO8A 5K45A 2G06A 1FXSA 1ZW1A 2KLHA 2QIOA 5C52B 4B3FX 4QUDA 1EHYA 3N3AC 4PO9A 3CONA 2HPZA 4L78A 5HK9A 4M46A 4URXR 5IZCC 1K6XA 4XH9B 3S8YA 3SZUA 1C7EA 4PHFA 5IZCA 2DJ5A 3K0AA 4HZUA 4XGQA 3HLKA 4OSOA 4K6FA 3EG5A 5MFZA 2C97A 4RDHA 3H17A 1Q6ZA 4V0SA 2JCYA 2ZJOA 3I04M 4AJNA 3P71T 4OL9A 3KQYA 4JMLA 3FRJA 3LLCA 5DASA 4GVXA 5GGXA 2WTBA 1M2EA 1Y0BA 4NECA 1JDSA 4YACA 3SLRA 4CTMA 2ASEA 4AYTA 4YQFA 1NG9A 2EKZA 4BFUA 3PJEA 1ECBA 4IX9A 1PAUA 2R7NA 4U9IS 1W29A 3WFJA 3EARA 3DVQX 1CY8A 3M2PA 1JG6A 2VWGA 1BWQA 4W1SA 4J7CA 1W36B 4EK9A 4R1OA 5DJ5A 5FPYA 3ECSA 3BQMB 3D6FA 1PQWA 3AW9A 5FFFA 4H6VA 3N07A 4LVOA 4MZXA 5TPWB 1KA9H 4CL3A 1ODJA 1II8A 2L82A 2BZ1A 3W9UA 1E79D 5JVDA 1BN7A 3DTNA 3PD7A 5AM1A 1IEXA 1WHTA 2NO6A 4LDRA 2WIFA 3URKA 4TT3A 4BNXA 4EKYA 5JAZA 3U16A 5LDGA 2IFTA 5JEEA 3LUKA 1NI3A 5JIBA 3CUWA 3P0JA 3CGWA 1Y9AA 3BOSA 3HVUA 1VTKA 1ZEJA 1YNOA 2NXJA 3ELWA 4GDMA 1CJBA 5A5GA 5ADVA 4X62B 4MH0R 5CCXA 1ZJJA 3IVMA 5BUQA 1PJZA 4OKNA 3DNFA 2R6DA 1DG1G 2RH9B 2Z9BA 3O94A 2JGIA 2YIMA 3B89A 1BC5A 1CUXA 3UC9A 5GTDA 1KEKA 1H5QA 2QK4A 2YY6A 4B3TB 4EDHA 4OV6B 3GJ7A 3UJNA 2Q5CA 2BONA 3TF5A 4ZMRA 1YVPA 2PL1A 1UBKS 1KQNA 4EL5A 1I4WA 2CHUA 3VDXA 1G98A 1TAHA 4ZN6A 2HJVA 4HWSA 5A0VA 5BSGA 4J0EA 3A04A 1Y33E 4BHTA 1OZHA 3NUGA 1FVFA 1AC5A 3PKZA 1HZJA 1VJ0A 5KYNA 1W581 5JSYA 1Z0AA 4D42A 1HFEL 2DQSA 3GEDA 4HDRB 3SOZA 4EA7A 5KSWB 5BT8A 3CN7A 3LA6A 1CHDA 5HQJA 4DZTA 3EIFA 4HX5A 5KUTA 1L7OA 4ZCPA 1W34A 4FJ2A 1UWCA 4DHWA 4QU9A 3K8OE 2E18A 2QMQA 4D7AA 1VQ1A 3U80A 1VMEA 2QX8A 4A0QA 3DLHA 1YU6A 5BURA 3DFFA 5BN3B 3BSYA 1T29A 2R5NA 3UHAA 2OKGA 1TJ4A 1U8FO 3COSA 1IU9A 4DXDA 2IZ0A 4JUFA 5GV8A 1CR2A 1E9DA 5DH9A 4J76A 2IS4A 2SCUB 3I2YX 4LY3A 1EWTA 1KDRA 1Q84A 2V5AA 2NG1A 5A02A 4FDUA 4EGJA 1CUDA 2L19A 2AX3A 3CX8A 1R2QA 2R2AA 3LL4A 2EP7A 4RIEA 3WC4A 5C32A 2I2AA 2Z04A 2DWCA 2GEVA 1LB1B 2GK4A 9LDBA 3ZE9A 2AFHB 2J30A 4IRMA 2F1OA 3Q1LA 1Z83A 1IY8A 3ABRB 4K3VA 1UODA 3I9FA 4PQGA 4BN4A 2ZTHA 2XMDA 3OETA 2QE7D 4HZGA 4XIGS 1OC2A 1XXHA 4S2EA 5JO9A 1EBBA 4UE3S 1IUKA 5JXJA 3PTLA 3AF2A 4J8PA 1VG8A 4BZPA 2Z2ZA 4KO3S 5C3UA 1ABBA 3G1WA 2JFFA 1L5ZA 1WR8A 4EUNA 2EG5A 2VDPB 4NICA 1EBUA 1KHHA 3HJAA 1RJWA 1ZVKA 2P0YA 3U9LA 4ZT3A 4DCGA 2X15A 2FG5A 1L5KA 3OT5A 3CV3A 2HSZA 2R6FA 4GZMA 3HXTA 2Y1EA 5JOQA 1I14A 4ZVVA 1L4UA 3DL7A 2EJCA 1NUSA 1SVUA 3B85A 2PKXA 2BGJA 2QAGC 1ZVMA 3CH7A 4UVDA 3ZY6A 3DYBA 4XD2A 2JI6A 1GSOA 2SCUA 4V0KA 1OX5A 5EIAA 1PL0A 1A27A 2GPBA 3G49A 4C5BA 1QUFA 1PV4A 3QG1A 2Q4TA 4AKGA 1QH8B 4YONB 2QN9A 3ZE2B 2AA3A 4RD0A 4Q1BA 3K94A 1S3IA 2AFHA 2Q46A 1TJYA 4QYIB 3V8MA 1JB1A 1DZIA 1RXWA 1DKMA 3S1AB 1E1YA 1DNPA 2DP4E 4Q9AA 3RNLA 1PVVA 1PJQA 1SXIA 1UBRS 2FWPA 2OXFA 4IP0A 4TKLA 2AOTB 2PZGA 3FKSA 2W6ZA 5AO9A 2WG2A 3TIVA 2IPXA 4AWAA 1CJVC 1JT9A 2Z1MA 1ZNWA 3HKBA 2NT3A 1GO2A 2ETVA 4KR0A 2CFSA 1RMTA 2H0RA 3AQIA 2JPDA 3IT2A 4KPUB 1ZM3A 4UVGA 4WIAA 3NHRA 5KNDH 4I1PA 4KP7A 4EH1A 4IF4A 4PIPA 3D9QX 3A9RA 2A0KA 1GZ5A 3EVCA 4GMHA 1EBFA 1QJCA 1WKVA 3BQNB 1FDTA 4GSLA 2EZ9A 2D5LA 2W7TA 4P31A 2PBLA 3MUOA 3ZK7A 4LTDA 4DDWA 3E70C 2JIRA 3QITA 3BIOA 4F38A 3UC5A 2GLUA 3VR6D 1ULBA 1KVRA 2GESA 4HG2A 5CFQA 2VZ9A 1UZAA 4DMHA 3UWKA 2I8AA 2H1VA 1KYWA 3CRZA 5ERXA 2WV7A 4H1HA 1SJ9A 2PV7A 1WNFA 4XRGA 1TUBA 1YR8A 3NALA 3OCZA 3PWSA 4L85A 1TLLA 4BVGA 4FW8A 1WY7A 3ILXA 4FS8A 2J3KA 5K8LA 2NZWA 3II6X 3KLOA 4LJLA 1Q16A 4Z4EA 5H16A 4IMIB 1D0IA 1U5BB 1F2TA 1L4FA 2OCKA 4YP6A 5GJCA 3ILVA 5JSZA 3CURA 3I2HA 3R4VA 2JFYA 3BWDD 5AOCA 4MS3A 1OV6A 3TLYA 1X1RA 2QY6A 5FWYB 1QAQA 3RWOA 1TUGA 1I2ZA 2J08A 3AP2A 1U2EA 2FPLA 1GSHA 4Q7KA 2AI3A 3NYIA 1Z7WA 4NEHB 4LG1A 4JSTA 3AFMA 3C8UA 5DBFA 1OWOA 2HRRA 3JPWA 5EIHA 3SR0A 3C6KA 3VQTA 4UCWA