1OU0A

Precorrin-8x methylmutase related protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
SLAAIDSMIDPDISGPMRHIVVKAIHAAGDFAIAPLIRYSDGFFKSMLAKLKEGCTIICDSEMVRAGIYSRPVLERNRVVCYLNDVRSKEMADVNGITRSAAGIRIAMQDHRNSVIVIGNAPTALLEAMRMIEENGWYDIPIVGIPVGFINASKAKEGLVSSHIEYISVEGHRGGSPIAASIVNGFGRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted precorrin-8x methylmutase from Thermoplasma acidophilum.
pubmed doi rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Isomerase
molecule keywords precorrin-8X methylmutase related protein
total genus 56
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature ec 5.4.1.2: Transferred entry: 5.4.99.61.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1ou0A00
4AU1A 2AFRA 1F2VA 1I1HA 4FDVA 2AFVA 3E7DA 1V9CA 1OU0A
chains in the Genus database with same CATH superfamily
4TTPA 1SULA 4R3NA 3G7NA 1P7CA 1O6ZA 2WF8A 4Y2RA 1GG8A 2F67A 2HPAA 3OZIA 3S7TA 3WIVA 1EM8B 3CVWA 1P3DA 5ALJA 1T25A 3RRXA 3S2GA 1BU8A 5KJFA 2VK2A 3QMWA 3W3AD 4X1KA 1W46A 1XEWY 1E2GA 2O0JA 1GYRA 1M2WA 4ZANA 4F4FA 1ZK0A 3A1NA 3D4BA 3VOSA 2V58A 2QD1A 3KL4A 1N7IA 4JT9A 5LA6B 5AD1A 2QE7D 4NOJA 1XQVA 3ASVA 4FKMA 4P82A 1EDDA 2QX6A 3BWCA 2D5AA 3OZVA 3KU4A 1SY7A 4C20A 1DX6A 4MYDA 1KGDA 4RTSA 1UDXA 4Q39A 2LBPA 3TMKA 1RC0A 4TRNA 2M6KA 3VYVA 3T3NA 1OXUA 2G5PA 1A97A 4WK0B 5KYUA 4C14A 3CUTA 4L22A 1ZJ6A 5HRUA 10MHA 4C06A 5THKA 5A04A 1GDTA 1K5DA 4MITA 2A94A 1IJEA 4E5NA 1GZ6A 2PBFA 2VTEA 4TLMB 1VA4A 3GJ8A 1G6KA 1GCUA 1J5XA 1KXZA 4KWCA 4DE5A 3V42A 4LJ5A 2DUMA 5A2GA 3BGDA 1IQPA 4UCQA 1JSLA 1W4RA 3M4JA 4Q4JB 2WJWA 3P9ZA 4IIEA 3OIFA 4B6FA 5JALA 1DP4A 2FK8A 3DAYA 4TYMA 4A2QA 4EGCB 1L5LA 4KDFA 4ESEA 1YAHA 3ENKA 3QSYA 1O4WA 1R0SA 3NTXA 3CLUC 1IOWA 2DQKA 3LWDA 3EXEB 2QV0A 3WKEA 4A2CA 1WZUA 3GAMA 4OOEA 1Z2DA 2H92A 2WJ4A 4RIGA 1XG5A 4JGGA 4DBLC 4Y1RA 4GX5A 1QIIA 2GYVA 3DGEC 3FZEA 4HXEB 1LEHA 1ZM9A 4I5IA 2WM3A 3LSTA 2R4QA 1L4KA 2PJZA 4ZAVA 1A9PA 1KZGB 1I3OA 3V1NA 5CB6A 4FFOA 3V4OA 5KDDA 4KNYA 4C5CA 1E32A 2PEZA 3GROA 3KT0A 3SJ7A 1LI7A 5EIBD 3HR8A 1HOXA 5AKLA 1E69A 1CDOA 4IG9A 1FFXA 2H4WA 4FS3A 1EDEA 3QYFA 3W2TA 3ZWPA 2ZRMA 4XWWA 4L5YA 1KYQA 3ZVRA 5AVWA 3HVRA 4KDEA 2JK0A 1F14A 1SHJA 2XUJA 1RHKA 3HVIA 1J2TA 3IXLA 1P19A 2P9QA 5HKAA 4B6JA 3HB9A 3T41A 3QG5A 2OQVA 5BN5B 3O2QB 4XGQA 4R3WA 5BSHA 2BKLA 2ZM6B 1Z35A 1NDHA 2A58A 3DHVA 3NV9A 2Q28A 1OIVA 4QGFA 1QK3A 3SPXA 1CF2O 3HCBA 2NO0A 5DI3B 2WA1A 4JI0B 4Z0PA 1D6MA 1U7WA 3NORA 3PJGA 4J6FA 4LHXA 4MLZA 1XC7A 4RJ2A 1IQRA 3TG8A 1Y1SA 1FYXA 4HAXA 3DOUA 3U48A 2EF0A 4DCGA 3AUSA 3V80A 4XJVA 5GONF 3AIKA 1AUQA 3EYAA 1TTHA 1JPNA 3C5EA 3FUXA 1NW5A 3O1IC 5F7JA 3W9SA 5CFLA 2Z2YA 3DVAA 2BI8A 1TF2A 2E7ZA 1FTQA 3KJEA 4AG3A 2Q29A 3IBCA 4UEJA 1Y4UA 1CUFA 3E7DA 2VQ3A 5A6VA 1TZKA 2QLNA 3PUKA 1XPUA 1LFAA 2CZQA 2PS0A 1T4CB 3GUVA 1Z0JA 3HO6A 3JRXA 4H7EA 3DZCA 2E6KA 4JC8A 2O3QA 2DQYA 4IH9A 1V7QA 3IE0A 1R74A 4CU5A 1PI3A 1WCV1 3BB1A 3FHCB 4I9NA 4LV6A 1U0SY 2Q2VA 2IYSA 2R47A 2QENA 1HLGA 3V6MA 1CY2A 4XVRA 1P1BA 2GUWA 4HGNA 4QSHA 5C31A 5EQJB 3MA0A 4KR2A 5E0OA 3NIWA 4TKLA 3T7DA 1ZHHA 2I71A 3HFSA 3K1JA 2ZRJA 4XKJA 5ALOA 2DY1A 4BLWA 3IUMA 4CCYB 4E07A 3FDIA 2ZDQA 1OBVA 1ZVVA 2YJGA 4CM9A 4GUAA 2HU5A 1XXLA 1G8YA 2J9GA 3AXSA 4HMPA 8ABPA 1R3UA 5KQSA 4JC4A 4LRTB 4WRRA 4FIDA 1T9HA 4CTMA 2I4LA 3KWJA 4PYLA 3TYXA 3C3PA 4DV3B 1HFKA 3T54A 1RLJA 4MICA 4H6WA 1E9RA 3GRYA 3NIBA 4US1R 5I9LA 4X8OA 3L8HA 4Q19A 1VJGA 2WVJA 2I3GA 4TXNA 2Z08A 1SG9A 4AROA 1MG0A 4IMJB 4NU0A 2QZ4A 1Q6YA 1CZOA 4J76A 3U7QB 1SO8A 3ZK8A 2IW1A 2UDPA 2C8JA 4MUKA 4Q4CA 4XQ9A 3D8RA 2PO5A 1MAVA 4HDQB 3ANTA 4BLRA 2JAPA 2XUOA 4AY6A 2ZIVB 4QM6A 4CIDA 5KVAA 1SVIA 4F2HA 4A7PA 3K16A 4FQ7A 1SZDA 4QOGA 1KRHA 4RPCA 1G18A 3R7WB 1TC2A 2R62A 5LMUB 2XX3A 2QN9A 3EWSA 1UMDA 4HXYA 5I7UA 1GXSA 3D8TA 4C7KA 2HDHA 1FUIA 1Z2AA 3OTWA 4IKEA 1T13A 4F3CA 5JJBA 2Y3IA 4RY9A 1U2DA 4J2TA 5BQOA 3KPUA 4D79A 4Y2GA 1M2VB 3V2UA 2QY9A 1AJEA 3QTLA 1MJGM 1JPVA 2CXQA 4K9PA 1TTQB 3PQ8A 5U1PA 3V1TC 2CD7A 3FRIA 4MUMA 1GLGA 4BMVA 4OQ4A 1A9XB 3NNSA 1C8BA 3TI9A 2JLVA 2ZRCA 3TD2A 1D1QA 1WXEA 4C4AA 1KI6B 4FZRA 5C4MA 5JMPA 3B2EA 4CMBA 1VRVA 4OXRA 3GP3A 4ARZB 3EBLA 1I7SB 5IPFA 1AF4A 1W5EA 1PR9A 2Q5IA 1JTEA 2WIJA 3N87A 1TJPB 3ZCRA 1U7PA 1D4FA 2OUKA 4KYVA 4L3VA 1H2WA 4S1WA 2VH5R 2IITA 2FLVA 1SKYE 1PJQA 3QKIA 3UH0A 1G66A 4WKBA 2BPOA 5F7OA 5LP6F 1P1KA 2IU0A 3R3JA 4BP8A 3RGWS 3OD1A 1DSSG 4QYIA 1NIJA 1RBQA 1VL8A 3C8ZA 5FWXA 2CKDA 1Q7RA 2WD7B 2J45A 4B7ZA 4CYMA 2CSXA 1KJQA 3CX4A 3TPZA 5BT8A 5HP4A 1A7AA 4OFBA 5TQJA 1QR6A 1JJBA 4ZTUB 4R6WA 2RCNA 3CR7A 2G63A 3RVPA 1YGPA 2BEVB 4KAFA 2VEOA 1Y9AA 2Q8PA 2H1VA 1V4BA 2ISSD 3NH9A 1X8XA 3QBTA 2PY6A 2ZBUA 4J0FA 4ARUA 3F5QA 4YAOA 3ZTYA 221PA 4KSCA 4M54A 2IEZA 2ZUDA 3GLHA 1WUYA 2OBBA 4G1BA 1KH1A 1PIWA 3UEOA 4AZVA 4B6OA 4E22A 2HHJA 3GGJA 5I8PA 3ZHBA 4Q7MB 1UFOA 1YB5A 2EDCA 3K32A 3L4BC 4ZAGA 2L42A 2O7NA 5ICFA 3H2SA 4UU7A 1G17A 1NG1A 3DC7A 2RE8A 3E0XA 3QE4A 4G84A 4RDIA 4GPBA 5HJ7A 4TSKA 5GONA 2BMFA 1DBWA 1GIAA 3N6RA 4Y9DA 4GXQA 5CBKA 5BUQA 2G9RA 3KJFA 3AHHA 5JAZA 5AM5A 3DE2X 3QITA 2J5BA 2CLFB 2VDUE 3OE7A 1MXFA 2CCGA 2OBXA 3O26A 3P52A 5FL3A 2ADOA 5AJZA 4L5CA 5C8XA 1XN4A 1KJIA 2GZMA 4MB0A 4K8RB 3R8CA 4IS3A 3P32A 5EHNA 2ZVJA 4Y7CA 2RC5A 1FTWA 2D7JA 4EO9A 1BDBA 1VMEA 1QNLA 3R6LA 1J9EA 1LJUA 3F7TA 4E6PA 1Z6ZA 2HSEA 5TVGA 2DH6A 4Q3LA 4FK8A 3F6PA 5K0BA 3BRWA 4CM3A 4BX9A 2YMQA 1DJLA 1IN5A 1SU4A 3OJEA 1OYOA 4N7BA 3M6UA 1S01A 2OXEA 3MUOA 3VU1A 1NL3A 3B3JA 2OHFA 1A2KC 3HMKA 4FLMA 4WPGA 3TDNA 3SSMA 2YXBA 1RQGA 2A59A 2EERA 3HJRA 4B7AA 1YR9A 1V8FA 3GGGA 1Q1GA 3BF7A 4MUYA 4E15A 2N0SA 1V1MB 4S1PA 4L5IA 1PR4A 3CLTD 2PU7A 4LOJA 2PRKA 5JQGA 1T6ZA 1II8A 4RJJA 4RZUA 5JVDB 1II8B 3GCXA 1Z83A 1MFZA 1OHHA 2JBHA 3DDCA 4GOND 1QCZA 1L5FA 1R37A 2PN1A 1EVYA 5GY7A 1N4AA 1FSGA 1VBFA 1P4JA 1HG0A 5I9TA 5E8RA 2Q62A 2QG9A 3NP7A 4J0IA 1T5DX 4QGGA 4M1KA 5C4GB 4PM4A 5D01A 2AOWA 4PLFA 4XLTA 1ZW6A 4J0KA 1S2LA 2HA6A 2TECE 3EN0A 5IEBA 1NVEA 1U0EA 2BHLA 4UM9B 4OG2A 1T36B 3DZGA 3UT5B 4NQZA 2X5NA 1QO9A 2HXGA 4BGIA 2PRYA 4JJ8A 1JAYA 2QAGA 2V98A 1GZ7A 2C4TA 3ISTA 4M1MA 4ZT6A 3AVVA 1I7NA 4XQ0A 1XZEA 1QFYA 2JI7A 2XLBA 1RAGA 4IJ6A 4AYWA 2A8YA 2QP9X 2VJMA 2Z43A 2PH1A 4IGIA 1GCOA 1TUIA 2FPIA 1DT5A 3QEKA 5FUYA 2C9DA 2DJIA 2QLFA 4TYQA 4LFBB 4QXMA 2REOA 4QATA 1Q19A 1Z8NA 2H8GA 2VDRB 3AR3A 3N39C 3QNUA 1E1YA 4JGIA 5CVUA 1AO3A 3SF0A 3REQB 3W0LB 1ZUIA 2XPCA 4OI0A 3AF5A 1F8UA 2JW5A 3WJ1A 3PKZA 4AXBA 4C7VA 5BN4B 3BWBA 2J3DA 3QE9Y 4ARIA 2HRDA 3DOJA 3JQCA 4BECA 1NLUA 2Z8YA 3W2IA 4QDUA 5K20A 3TK1A 4CL8A 3U7JA 4PFSA 1GDHA 5HZKA 4OSPA 4RLQA 2H8KA 3GUUA 4FHZA 4XVQA 2O23A 2Q6KA 1OIWA 1YR2A 2VPQA 1BXGB 1L4NA 2YN2A 4TRMA 2VSOA 4PICA 4ND8B 5ILGA 1U28C 1VRCA 2FFRA 3KQOA 4X1OA 2VP2A 2IWHA 3BGVA 5K6TA 2H1OA 3RSOA 1GCIA 1DC8A 4FX2A 4ZYLA 2EP8A 2AOUA 1KKUA 1J5PA 3LVFO 1PBNA 3EULA 3N2GA 4G0NA 5CH8A 4EAAA 5LYJF 1E2BA 4EHJA 4W9MC 4ZYTA 2V96A 1EU1A 3AIMA 3BMNB 1AURA 1IULA 3QP9A 5DOZA 4M60A 4BVLA 1ODJA 3OPMA 3KJIA 3PUVA 3IPXA 4JIMA 4YP9A 3LQYA 4R0VA 4BIIA 1HE5A 3RC9A 3HCWA 3CMCO 1K8XB 5IC5A 1CRZA 2GO7A 1AY0A 5HCUA 1CVRA 3C4JA 4DIDA 3N7AA 5F64A 3ZV3A 2ZBRA 4C78A 4DG5A 1VSUA 4EJ0A 4KTVE 1KJYA 4MVJG 3DFMA 1SB8A 3PQFA 4GMFA 3QE0A 4ALIA 3P4XA 3HCEA 1OIXA 5GQSA 2XB8A 5D51S 1GPDG 3SM3A 4DZTA 4UUPA 4N6NA 2JGAA 2H08A 2P69A 1SHLA 3LF2A 3QEMB 5HKKD 3FVVA 4ZQCB 5IK2D 5DYWA 1AK2A 2YWEA 4XB2A 2XOXA 1P5FA 4A8JA 4DGSA 1SBYA 1L6RA 2JGIA 1MJHA 3Q7SA 3AWIA 5BVGB 2J67A 1SHUX 1JG2A 1GSIA 3SQOA 1GUYA 3TCKA 4BNJA 2I2FA 3A1SA 3UGKA 1WQ1R 2JLQA 4RY0A 5KNDD 4EZBA 3OEHA 4R8LA 1N2BA 2P9GA 5FPTA 4KXYA 4FQ8A 4X8HA 1W5SA 2B94A 3V1KA 4BVEA 3VKGA 1IWBB 4UCFA 1CRWG 1XALA 4E70A 4KAXA 3IPRA 1JEDA 1O94D 4Q7KA 4EEXA 3WAKA 1EESA 2O9JA 4HYTA 1YQUA 4OBXA 1NWHA 1FU7A 4I5FA 3IQXA 3KKMA 5GJWC 3WGVA 3IBTA 1V8OA 3LV8A 4RU1A 3VR5A 4YQYA 1QCDA 1O1YA 4D98A 3EFEA 5KJ6A 2XVYA 4DHWA 4EKEA 1PDOA 3AT1A 4EL0A 3CA8A 4QJIA 4I4TA 1YQGA 2IXEA 3SEFA 2G1PA 1F8GA 3FFBA 4JA0A 1PDWA 4OREX 4NNJA 1B6SA 3A11A 1XZKA 3BXZA 3OIYA 4M9CA 2FEOA 4RMNA 2OXIA 3VR6H 1PD1A 2G9NA 1U9IA 3L6OO 2R00A 1N2HA 1E1CA 1DC3A 1R18A 1W87A 4AJEA 2PYIA 2YWJA 3PXXA 4P3NA 1VP9A 5E1MA 3B78A 2PLNA 3N5CA 1D5CA 1EX1A 1W94A 4HQNA 1S3GA 3TXYA 4WASA 4B3XA 4D92A 2ORWA 2NP7A 4R1UA 3R9XA 4HRYA 1XL0A 3HB4X 1KDTA 2BFNA 1XJ5A 3L7MA 4R7ZA 3MUNA 4LW8A 4XCXA 1SUBA 4CDNA 4DWWA 1F0PA 4Z4HA 3Q1LA 1BWQA 4IL5A 2AFHE 3HM9A 3RU3A 3Q2KA 4QU0A 2ODTX 4O59O 2G28A 1EE2A 4XYGA 3HZHA 2P3LA 2BAGA 4KPUB 3D6TB 4II3A 4OXQA 2CXPA 4CV3A 5JNTA 3IPCA 4HTFB 4B3MB 5AW8A 1OREA 1UM9B 4Y2SA 3UKJA 4KDCA 2HCBA 4OHZA 4YUAA 5LWHA 4A0RA 2NV2B 3H2JA 4HS4A 2JFOA 4JKIA 4C30A 2WPNA 4CCSA 1VB5A 1J2UA 2BFMA 2H2IA 2Z4RA 1MJNA 3MBOA 5DV9A 1L4LA 4JP2A 2GAIA 3ORHA 1KOJA 1C0EA 1WDWB 2JASA 3VXKA 3QLUC 3ENZA 2GGSA 3DO6A 1JBQA 3T0IA 2FUG1 1SC4A 2F1OA 1ZJ5A 5JVDF 1PSDA 3MRXA 4IRXA 1XZQA 4N1AA 4NXNB 4RKEA 3UM9A 3JAKA 1Q0TA 2VHJA 1IY0A 4BLOA 3EPHA 1JGTA 3SMVA 4BO1A 4FD3A 4E2ZA 3WLFA 2RFLA 4H4CA 2O2XA 2VWGA 4AZ3B 3PEEA 4CKWB 1UADA 1NP3A 9ATCA 3DMRA 2ZUCA 1GD1O 1ECFA 1U8EA 2WQ6A 3PUJA 1M1NA 1PQ4A 3AFGA 3N76A 2BJVA 3FOCA 3V8VA 4JUIA 1M6HA 1CJVC 2BLNA 4YACA 5DGCA 1IL0A 2XE6A 4JLNA 1AGXA 1GUFA 1DL5A 1F2UB 4RMIA 4KG7A 5IJ0A 2WIBA 3DT8A 4LI3X 4XPZA 1W4BA 3VMFA 1GTVA 1U04A 2BKUA 4G01B 1B8NA 3U4GA 1SCNE 4KQWA 1Y8QA 4QQNA 4IFBA 5JFOA 3WWCA 4P36A 5E1BA 1RWBA 1IN6A 2OP0A 3IAAA 2P8SA 3PIIA 2IBMA 3LTEA 5E9AA 4BUZA 4EY7A 5BUZA 5B4UA 1IUKA 4RTOA 1BYUA 2FMFA 5LOVA 4WAUA 1NNUA 4O2LA 2NXWA 4CKYA 3KPYA 3KQVA 2G7ZA 4OQFA 4PU0A 3B2QA 4FI3C 1JLSA 5ENDA 5JD4A 1ISPA 1L7XA 1P2BA 3KZXA 4INZA 1I94B 4JC5A 2UZ4A 1D2RA 4F86A 1FFWA 2DFDA 3BILA 1F06A 5AMXA 5DDIP 5BW8A 5KWJA 4IICA 4PSCA 4PSVA 2CLKB 1QKJA 2PSHA 1XE3A 4TL6A 4UQPA 3UJ8A 4CM5A 4KWHA 2WJ3A 4YK7A 3HZRA 1KJ9A 1T36A 4PAWA 2DR2A 1LS6A 3EH2A 3QH4A 4HAIA 5K3FA 1OXKB 1Z2OX 1KVUA 4DQ0A 3C3WA 3NT5A 1QPZA 1A9TA 3X2EA 3L0SA 1AS2A 4JNKA 1RSZA 4EH1A 4DR3B 3NOVA 4DSTA 3SEZA 3KETA 2JVJA 2ZS7A 4J43A 2GUGA 1FTNA 1K7CA 2PA0A 2F43B 4GICA 5CLFA 1BOOA 5EJMA 3V8EA 2XVMA 3IBGA 2XBMA 1QHSA 3JSXA 3KUCA 3NAQA 3TKAA 4EG3A 3LWZA 3AG6A 3STVA 5AVRA 1IATA 2PS1A 3DTTA 3JD0A 3WBKA 4F6CA 3FDXA 3ZWWA 5I7VA 4OGLA 1V8BA 3GEPA 5HQJA 2ORED 3FYCA 3TJZA 1VYTA 4IDNA 5ES3A 3WGOA 4IV5A 4B8ZA 3NHZA 1RJ9B 1YIOA 2W48A 4HK4A 5F7ZA 3TDKA 5LN1A 2BEJA 4LY0A 3U7FB 3EF3A 1Y3AA 2Q4OA 3I5MA 4ZHQA 2PT7A 3QU9A 3VU9A 1J07A 4DNQA 5BV1A 5ILOA 2YZMA 1MGOA 1V8PA 3BAFA 4EG0A 4REQA 1U3WA 1ONNA 2Y71A 3D9QX 1N8TA 1P2DA 4OQQA 4UEKA 2BGWA 2J3EA 3NGXA 3T4XA 4DW8A 2FZKA 2VJDA 4DDHA 3AEQA 1B3RA 1YI1A 1Y3FE 4K88A 2WD7A 4KIGA 5HCIA 3S2UA 3P20A 3WMEA 4B4UA 5G4KA 3QUTA 3VSCA 4PC7A 4RZXA 5G4KB 2DYKA 2IXDA 3DBLA 3ZGZA 1HDZA 4OLAA 1U9IC 2ZT8A 5EE0A 5IM4F 4JLDA 3FFWA 3C0KA 3IQFA 4OHUA 4PYKA 3CVOA 4WDQA 2JCGA 4MVJH 3OE5A 3R40A 3DWEX 4EGSA 1S4MA 1DKRA 1K3TA 3WWYA 4BS9A 2CBZA 1R0BA 821PA 4NH0A 3CZQA 3IP6A 2HPVA 4M2LA 3ZU3A 1E1LA 2YV2A 3MWDA 3UJDA 3Q9SA 4DR2B 3FVWA 4PYJA 1RJEA 4YJ3A 1DIGA 4MKZA 1T5BA 4YJ3B 2FNAA 2HADA 2IX9A 4LOHA 3KM0A 3EA4A 4ENVA 2IRWA 4UMDA 5IHXA 4PLVA 4HN9A 4KJZA 3LK6A 3I39X 1LVUA 2I6FA 1EQ2A 1K4MA 3U4DA 1G63A 1WJGA 4DQLA 1M2NA 4IUBS 4F8JA 4O2BF 1IXSB 1JPJA 1USKA 3AYZB 2GKOA 3GUHA 1KYTA 2HSWA 5JI2E 2NYRA 3UPDA 1AUPA 4OL9A 4B7UA 3FB4A 3TFWA 4KR3A 3KKNA 3AOGA 3LUGA 4ISBA 5IWAB 5H9VA 5LU8A 1PUXA 3C6MA 2ZJ3A 3K96A 1P62B 1R0XA 3M83A 4OQXA 4U63A 2J6HA 2JGMA 4D41A 5MGNA 3D5EA 2DKNA 1KJWA 2PXXA 1AA9A 1QV7A 2WU0A 3CIOA 3L93A 1G7CA 3VO9A 5HQ3A 3D6NB 2G07A 1KXJA 1RJDA 1KWGA 4AMVA 3ZU6A 5CXSA 4ZHQF 3QFTA 3MM4A 4MJLA 5ELLA 4ZTBA 1FTSA 4PXYA 1NNI1 4FKZA 3GARA 1EWKA 1FXWF 2YHIA 3FR7A 4L4SA 4E32A 2A84A 4DMUB 4E33A 1GPMA 3OA0A 3NAMA 1II9A 2GFHA 4BVKA 3PA8A 3ZVMA 4NZ9A 4OFZA 3R3WA 4YREA 3VR4H 1U2EA 1XCJA 1N2CE 3COSA 3F9CA 4WMLA 5JD3A 4BEVA 1UDAA 5JZSA 4M86A 4UMFA 2OQRA 2ATCA 4Q66C 3VNUA 1J8YF 1Y8AA 4HNGA 5A5EA 1XAHA 1C29B 2OR3A 4YMTA 1NE2A 1ZU4A 4AJPA 3RREA 4EJSC 1G3IA 2OHHA 3CTPA 1E1DA 4OHRA 1MH9A 2WYWA 4M7WA 1OBOA 1XU9A 4B76A 3FHTA 1Y8RA 2B4QA 2FXVA 3BHIA 4M0KA 1Y8RB 4TMVA 3WBJA 2C2YA 2IZOA 1DXHA 2C4KA 4HLUC 4IOLA 4MKIA 2QTCA 3L40A 5CPFA 3SNKA 1P5ZB 1WUJS 4AG6A 4B2IA 1ORHA 4C08A 4AY3A 1UXOA 4RVCA 1RLIA 1ZD9A 3C3KA 3D3NA 2POCA 1Y3HA 1FDWA 4ZC8A 2TMGA 1NXVA 1EBUA 1XYVA 3L4BA 1KP3A 4TS4A 5FWYB 1ZW1A 2PS3A 4KWTA 4A0FA 3TNYA 4BJ6A 1NJGA 3B1JA 3L6DA 1DX4A 4KKVA 2EZTA 5E1OA 2D0OB 4OX9Y 1N2GA 1YFZA 2YXLA 1WCYA 1KEPA 1KC1A 4KXQA 3K1AB 3WJAA 1E9AA 4EA7A 3I1JA 4YMHA 3QHAA 5GPBA 5BORA 3QX8A 1F4PA 3HBLA 5T4EA 3JR7A 3A1UA 3BICA 3SR0A 2D7CA 3T9CA 1UQUA 4HY3A 3IA7A 4KXNA 4Z1MD 3OI7A 2XRFA 4XR4A 1VSBA 4FYPA 3WIUA 8MHTA 4E11A 1LC0A 1MP0A 1V5FA 4G24A 2JC3A 1A50B 5G0UA 5JAOA 4MW1A 3TVYA 3UV6A 1QTRA 4N9WA 1IEQA 1KTVA 2JBAA 2F3TA 3JYPA 4ZI7A 5A9SA 1FMFA 3BWDD 1G2PA 2R8YA 1HT0A 3STHA 3D6JA 1GQSA 2QTRA 1TJ5A 2RGDA 5HOQA 2ENUA 3QPAA 5DM4A 4LRYA 4AO7A 1E0SA 2VQDA 3ER9A 4DMHA 3HCFA 3HV2A 2Z95A 3IP7A 2F90A 2W43A 1KMMA 3AJ8A 1DWUA 1KF0A 5F35A 3OOJA 1UJBA 4HWPA 4LXXA 4YECA 4PLCA 2XTJA 4I2VA 1DGQA 1U4SA 1MJ5A 4XDHA 3ID6C 1E77A 2JBWA 3LWBA 1ZWLA 4I55B 2QQEA 3EAGA 3ISJA 1JYEA 2X2OA 3TSCA 4YJ2A 1Y9DA 1W6RA 3AV3A 1RJ9A 5AUQA 5EWLB 2AUTA 1RZUA 4OGWA 3TLZA 2RHCA 3KAJA 5I7EA 1E7RA 4EHNA 2ZITA 4YASA 2PMEA 3WLLA 4ZMSA 3URMA 3FPEA 1QO7A 4NZNA 2ZYGA 1SWVA 1BDHA 1VIVA 2JKVA 1RXEA 2XIQA 5F78A 3FYHA 4TS1A 4XDGA 1E7WA 3BTVA 4P22A 4MB6A 3RPEA 3NLLA 5GM2A 1H66A 4PNEA 2KSQA 2C1ZA 3KQKA 4Q4AA 3B9BA 3OD5A 2OB2A 5CD9A 3PRJA 4S0XA 2PL1A 2QL7A 1UCFA 2C5BA 3EGCA 4U4AA 3TVTA 3RVNA 2FMIA 4B2LA 3WL8A 3EXAA 3UGJA 2RGNC 1LCIA 1WV0A 3GZTB 1FPQA 5GJBA 2O59A 1O95A 3RK0A 2HLDA 3SDBA 3F7MA 1GLNA 5KC9A 4DIMA 3ILXA 3T3OA 2PG3A 4HDKB 1IBCA 2MYUA 4U7WA 2IDKA 3ZWOA 4C5BA 4FGJA 4DPLA 3U1BA 4I4TF 2RI6A 3PXDA 5LYJA 3DNPA 5F9HA 4X90A 4TTQA 2WF7A 3WGJA 5L4SA 4GSKA 3PFWO 5FUWA 5GAJA 3TLAA 3NXSA 1JHUA 1WXWA 3QVMA 4JITA 4MS1A 4Y9TA 4MV9A 5J43A 4RHEA 1RM0A 4X7PA 3VVMA 1EB8A 1N9GA 3SX2A 4Q15A 3WMWA 5E2BA 1QS0B 3AF4A 3FIJA 4MRMA 1CV2A 1QS0A 4MRMB 1RC8A 3B6ZA 2Y0CA 4PVCA 4RHTA 2OFOA 3W7VA 1UT5A 2PJRA 4CEIA 3EGIA 4H1UA 3EWNA 4IFIA 4BC0A 3D81A 3Q3HA 4Q5IA 1QX3A 2I3AA 1HV8A 1E1QD 1T15A 4ML3A 5AVXA 3VHRA 2NP6A 2PAFA 1VGVA 1I1QB 1X15A 3EEOA 4F71A 4WK6A 1G3RA 5IZCC 3C85A 1QJCA 4NVRA 2IYPA 1M6NA 1ENPA 3ZXUB 2ZR8A 4MQMA 3UCXA 4MUBA 3V4RA 2HBQA 4UBMA 2VDMB 2BKVA 1PJZA 2JJQA 3IS3A 3KYIB 1ZJ4A 4Q0MA 5FUXA 1XMOB 2GA9A 1JI0A 4YXWD 5JSHA 4IKOA 5AM1A 3ODPA 2Z6UA 1GTG1 3CB4A 2CWDA 4D2IA 2P3QA 4FINA 3AG5A 4IAOA 2GAFA 5SYMA 3I45A 2IP1A 2FR8A 4OXIA 3FR8A 2O8FB 1RE1A 1TKBA 2WABA 3L0BA 1B23P 1D1PA 1EUDB 3R74A 2EZ4A 3TSOA 4GP7A 3C4VA 3KYCB 4ZEOA 2WSSD 5J2UF 2DT8A 3E9MA 1UXKA 4R7GA 4YWJA 1KI2A 2VQ6A 3LRTA 2QRMA 1N7GA 2W2OA 4J1TA 1J21A 3PNYA 4P2BA 4PC3A 3OT4A 1UP6A 3C3XA 3THWB 2JD1A 1BD3A 5BWCA 5DLDA 1ZN9A 3GGDA 7ABPA 3GFRA 2W8BA 3HA2A 3KVVA 5EI5A 3WRVA 3WLKX 2W37A 3I76A 4URFA 1JDTA 3W7BA 5JH7A 3Q8LA 1WU8A 4NDAA 4BP1A 3PXGA 3P9CA 4YRCA 3WISA 3ZDEA 2K4MA 3I8SA 1YA8A 4WXPA 2WYHA 1K5GA 1CIPA 3D8UA 3TKYA 1T2UA 2XE4A 4DT1B 4FMCF 1YR6A 4I6EA 1K4KA 3WB0A 3TR0A 4ED9A 5M2QA 1G7SA 1JFTA 4GLOA 5FL7A 3CSUA 3W8RA 4EG4A 1CUGA 3P2OA 3DOOA 2ZE5A 1H9CA 5KDLA 3PEUA 1D1TA 5CGQB 1D04A 3F5SA 1ULHA 3OHSX 4GI5A 4I7EA 2B83A 5ALSA 5F73A 1I30A 1U3GA 4HH3C 1SIWA 3EIQA 5GADl 4TMZA 4JGBA 4C0LA 1LK5A 2I6XA 1YCDA 3ZE2B 1H2XA 2OAEA 1TIKA 3PZBA 1XZAA 4HB0A 4QARA 5FO1A 1EFAA 5B7PA 1DJMA 1D07A 2B8JA 4K9SA 3T5DA 5BRAA 2VA9A 3JX9A 5EIOA 4RTNA 3HO1A 1UPCA 2FAXA 3ETNA 4UU0A 2DHQA 2HFKA 4RVDA 3QJYA 1Q1NA 4KXXA 1E9SA 2BR4A 2C57A 4RLSA 4A6XA 1Z4LA 2Q1UA 5CX1A 3MERA 1AKNA 1GYPA 2CZGA 3Q8KA 2QVLA 4ME6A 1JFRA 1D5WA 4RTJA 2Q5JA 2BGKA 4G97A 4W99A 1FF9A 3H84A 3LP5A 4D02A 3AU8A 4JBXA 3JQGB 4YQZA 1Y1LA 3A1VA 4JVLA 3NWEA 1OT3A 2QE7A 3CNLA 13PKA 3UMRA 3WXMA 3TB4A 1CQPA 3DMPA 4U7DA 1Z8DA 2HUNA 3BIXA 4LOKA 4CI9A 1K6JA 2ZLBA 3PC8A 3T9BA 4AMUA 5EPUA 1HGXA 5GM1A 2A9KA 3IUQA 1D6JA 1OOEA 3N0TA 3KU1A 4OP3A 2QRGA 3A3NA 3LGAA 5JC8A 4D0NA 2P9CA 5B7GA 4CIAA 1JFLA 3GVIA 4H17A 3ZBTA 3KYDA 4U9HS 1S3IA 3IALA 3A2MA 2J9FB 4LISA 4RGVA 2W2PA 1I6KA 1RI3A 1P9OA 1JN0A 1PK8A 2ACKA 4IBOA 4BAGA 4ER0A 1MJGA 1GPBA 2BT4A 2O2SA 1XDUA 3MBIA 5GJVC 2JG3A 1LJLA 4IUDS 3PJFA 2Y66A 4BNKA 3ETCA 4F45A 4YJHB 4RZ3A 2FFAA 3JQ8A 1UK8A 1Y98A 3Q2OA 1ZNYA 2X4IA 5KS2A 4L8VA 3H5LA 4CIYA 2RG1A 2LKDA 5AI9A 3IAS6 3SY8A 1SVKA 3HKEB 2FZLA 2EGUA 3ANNA 2G6TA 1LVHA 3Q11A 2OD2A 3R3YA 1RM4A 3VH2A 1A96A 4HX2A 1XWIA 3L8ZA 1EVJA 5DBFA 3MTBA 3WDLA 3UK2A 4XUCA 1JZQA 3JS5A 2EIXA 1M2VA 4Q3EA 4WKNA 3VPHA 1WDMA 4MXDA 4D0SA 4OFXA 3LD9A 2J0UA 1YNSA 4GNRA 1LDYA 4HDAA 1M2FA 2RGEA 1QZZA 1Z28A 2SNIE 4G0VA 3PF8A 3B5IA 5KNDA 1GHTA 3RIMA 3PHGA 5HVNA 5C53B 3IIKA 5DHQA 3RV4A 2OHGA 2FQQA 2X2PA 3V6LA 3CMMA 1TXGA 4S3MA 4N5IX 1SCDA 1IEWA 4UXJA 3SYNA 2NADA 4YRZA 1IJKA 3B12A 2JI8A 5EE9A 2JD0A 3GJ3A 3KD3A 4Y9UA 1X3SA 4UAJA 1JEJA 3FDZA 1CD5A 4FX5A 2ABWA 1I7PA 2HJGA 1BCRB 4LA4A 2ZVDA 3RVMA 3MBKA 2HR1A 2AC7A 2ODQA 4TSFD 5AT1A 1HYBA 4Z4QA 4HAWA 4AS1A 2AYXA 3AHCA 3K94A 4MZXA 3U1TA 4ZJYA 1BMDA 1PN3A 1JDZA 2A5GA 3FVQA 4HL6A 1FZTA 4HAVA 2ZB3A 1M9NA 1KEUA 1PFYA 2QN6A 4PW0A 1LDMA 4WNCA 1SD5A 1Q12A 2YFQA 3FTQA 4CQLA 5KO2A 4BOYA 1CC1S 5EMMA 4ACBA 4PPYA 2HK9A 4CL3A 4DL9A 1W30A 4NENA 4UAVA 2ZWMA 4O6VA 5ELMA 1YBHA 3QJ5A 1OYWA 1SOUA 4LGVA 3HEMA 4H2DA 5EIFA 3HU5A 3QXCA 3LRPA 2ARKA 3HXMA 2WYVA 3RRJA 1Y48E 1XK6A 1OFHA 1NNSA 2W6NA 4BQOA 3BSSA 5A4MS 1CZLA 4K6FA 4YHHB 3DV0B 1QRUA 4B84A 2HMSA 4RFVA 3AIOA 5J1TB 4A27A 4RKWA 3S81A 3H65A 4K0KB 7MHTA 3DMYA 3GLHB 1XZFA 4CIVA 4XYLA 3A2KA 3G59A 3CZ4A 3Q6IA 3V7FA 3VZBA 5K1ZA 3V8MA 1I6LA 4ARAA 3UMYA 4RD0A 2J3MA 2GESA 5BYAA 3FSRA 3VR6A 2BWJA 1X39A 4ZCQA 2WT9A 3PT5A 1JKFA 3PBKA 3KHSA 1OBFO 5EJ7A 2V0GA 2PX0A 1DDOA 4JCCA 5EQFA 1MDFA 1ZD5A 4JNCA 1YT5A 1FRQA 2QP4A 3I5AA 3P4UA 3ZWMA 6CHYA 1CE8B 4NV1A 2IPAB 4NE2A 1LPOA 2GFIA 3RS7A 5F33A 4EG7A 3VR5H 4M9UA 2QLMA 2XUGA 3LE8A 1OLXA 4CGYA 3NJ8A 1PBTA 3PPWA 4OATA 2HC9A 2I54A 3OVMA 1OX4B 2J3QA 5BOSA 1PR1A 1ZPDA 3L7KA 1RACA 3ZX4A 2BN4A 4WN9B 1E98A 4EMSA 1HE4A 3V8BA 1C9KA 3TVDA 2XMQA 1SUPA 3FWPA 2IOQA 1ZS9A 2P79A 3A06A 4YWHA 5LZ5A 2YMLA 3L46A 3SYTA 4CTNA 3CRMA 5FP0A 4KXLA 1N5KA 3NAGA 5DK4A 4KMRA 3V33A 3P9PA 3OEYA 3GR6A 2CMGA 2TMKA 3A28A 4O5AA 3L8FA 5CT4A 3EMBA 3BWXA 3GUZA 4OGKA 5M29A 1R5OA 2C95A 4WINA 4JBLA 4CG3A 1H8HA 2FB9A 1DARA 2IOYA 4X41A 4DXHA 1IBLB 4OTZA 1YRYE 1TYCA 1U6KA 4X97A 3SK0A 4TTAA 1WRBA 4PANA 4MQ5A 1DBIA 3DEJA 4ZZ0A 2ODWA 5K8JB 3L8CA 4NOMA 4GE0A 3PF9A 5EVJA 5EMKA 3V1YA 4XW2A 2A30A 1E9VA 1K7YA 2KBFA 3AEKB 1AQNA 4C7OA 4Y2TA 3K1AA 1PKXA 3BZWA 4M38A 3RUPA 4NABA 1Z4NA 2OO5A 2RJOA 1R8JA 1S3SA 3O8QB 2QTGA 4J7CA 4EKNB 2R6JA 5C7YA 2D4AA 4HQ6A 2VWQA 3UC5A 2L18A 2JLBA 2OHIA 3GV0A 3MF4A 1ZMTA 4FFBA 1ZN8A 4EBFA 2PX5A 2ZRFA 1YU6A 3B60A 3G6WA 4YJGA 1NVVR 2FWJA 2BBOA 1EWVA 1FVXA 2OL4A 3KPVA 3RVKA 3ZCQA 2FMXA 4C76A 4XGNA 2ZI6A 3EXHA 2NYAA 4E5PA 5KREA 4BQNA 4MSUA 4KO8A 5IT5A 5HMMA 2H57A 1CZKA 5H4HA 3WIOA 1FC0A 3ADDA 3H5WA 3D1JA 3C6XA 1V25A 3KP1A 5JBQA 3OU7A 4PY2A 1U6JA 1L0BA 2QUJA 2IC5A 3HUFA 1Y1QA 3DE7X 5B3JC 5HNKA 3UICA 4NFSA 1PWYE 1FX1A 1A9OA 3JALB 3OIUA 2X58A 3VV2A 1XZDA 2HQBA 3E9NA 1DAHA 2P78A 4DB4A 3EBOA 2FYTA 2M1XA 5DVZA 3LBHA 2MYNA 3CH5A 3EPLA 1L9KA 2WNIA 2QBYA 5ICGA 3I1FA 2XQJA 3SS8A 2GPWA 4WKGA 2V7WA 1P6QA 3U37A 5ALEA 1J22A 4R84A 1ZEJA 3CLTC 2IDMA 4W9NC 2DWOA 4EYGA 2EP7A 5CR9A 5HFNA 4CWAA 1ZONA 1CZRA 1XAIA 2CFSA 2YJZA 2FSUA 1U94A 1DG9A 2BFCB 3BN3A 5HKLA 3WC4A 5HZHA 4BJHB 4P38A 4EPRA 1PO7A 1KE2A 3OQ6A 1X1AA 3HGTA 3A1TA 2Q1SA 4OHFA 3RYFA 4BHTA 1YF3A 4FHDA 2OZLB 1MH1A 3VDRA 3RT7A 2ZSJA 1RAIA 4V3CA 1GGHA 3LRXA 1WBBA 2P1RA 3QIAA 4RSGA 4IIHA 2ERYA 3J80A 1NU8A 4BX3A 1Q83A 1VLHA 3BHNA 1PS9A 2GM4A 1M34A 4XTCS 1Z74A 1T3GA 4R1NA 4G1EB 2HMWA 2OECA 3M4NA 3U09A 1AZTA 1TMKA 4MWSA 1ZAYA 3GBPA 3CSDA 2HZBA 4JL5A 1Y8CA 4F4HA 5CJJA 1V1RB 5DLEA 1BRMA 1CDEA 2W6ID 1K4YA 1NKSA 2VNHA 1EG7A 2BEUA 1EAMA 2RHLA 2Y93A 1MA0A 5HK8A 4DCTA 4LEIA 4UEWA 4V0ME 4EHLA 1E7QA 2JZOA 2WFZA 3TBFA 2W2NA 3HCNA 3DTVB 1YZTA 4OAOA 3UXYA 5LB4A 2ADFA 1YS1X 4O4IB 5JXIA 2QZZA 1TT5B 2ZR9A 3MCTA 1FFAA 2ZSIA 5AOAA 1OTHA 4L95C 5IW8A 4BP9A 3UMMA 2WAAA 4M9XA 1AKMA 3RR2A 3HE3A 3GLIB 3G2HA 3HBMA 3I42A 3K0AB 4G41A 3VZQA 2J3KA 2NSHA 3M4YA 5K4GA 5THQA 3HVUA 4LX0A 3MJVA 4EFKA 1OWNA 4OHKA 1FP2A 3H8VA 1XLUA 1N0VC 1WWKA 4QDKA 6REQB 4XWAA 2CW5A 2SKCA 4OI4A 3QPUA 4XB1A 5IANA 3S0JA 4J03A 3PPXA 1IJBA 3HA7A 4GGOA 5E6RA 2PFKA 4TZKA 4ZVNA 4B4OA 5C5IA 1VJTA 4QGSA 4A6PA 4YR9A 4G1VA 4TSFA 1CERA 1UBHS 3MWJA 1YK1A 4IWXA 5DTJA 1FU4A 3S2ZA 5FI5A 1X9GA 3EW9A 4CQJA 4BC1A 1NT4A 1H93A 2LW7A 2B82A 3CF6R 4IX1A 3ZWXA 1AKVA 2ZJZA 3BTSA 4LTDA 5F5LA 4O4JA 5KAMA 4E3ZA 2OCDA 2QW8A 4N3NA 1FP7A 1P2UA 1D3AA 1SG0A 3KR0A 4RNDB 3RVRA 5I9MA 1R64A 4G67A 3A10A 2D5IA 1RKBA 1U2PA 2HWUA 2VNKA 4HAYA 1FMJA 4YFYA 4TOIA 3AM1A 3OU2A 3ROFA 2GCGA 4P7BA 4JH0A 4B47A 2FZVA 3OPYA 1J0DA 1CUZA 4B8WA 3OPYB 3OETA 3OKFA 2I4NA 2V5AA 3VZPA 1TA4A 1NF3A 2IEYA 1CVIA 1N3IA 4Y30A 4OJMX 3KO8A 1WY7A 1D9XA 2ZRHA 2HA0A 3KRTA 2VDNB 2MSEB 2FTKE 3T7CA 3M3DA 1KVRA 4IP0A 5AKIA 2I7VA 3HJHA 1GPKA 4JMPA 4J07A 3GPDG 2X7JA 1EDZA 1JKJA 2C9YA 2DZDA 4O0MA 5FBVB 2NX2A 2A92A 5HF8A 1T1SA 3FMPB 1X7GA 3IRUA 3MWLA 1UDWA 2YQ4A 5EZ6B 5EYPB 1ELOA 1M1UA 2OD7A 3BWMA 3RUFA 3ZEIA 2G7MC 4CEHB 3NNDA 4C43A 2XMPA 4JXXA 1JQLB 3E1SA 1C3OB 1IEXA 4KPUA 5HM8A 3O7MA 1K9SA 3IAM6 2C82A 3S2IA 3AUYA 2GLUA 1B4DA 2CB9A 2F8MA 1GQFA 2GSWA 3HU3A 5ALLA 1II0A 4W5WA 1X3LA 4E2XA 4EB8A 1OHHD 1G9TA 2XTNA 1H22A 1RI5A 2C2OA 3K71B 4LWOA 1QV6A 4JI3B 3IHTA 4ACAA 3VOBA 3KLNA 2V7GA 3RBAA 1Y7HA 1Y82A 3GUCA 2FDCA 3C1OA 4YDQA 3DBOB 2P2CA 4OXKA 4QOFA 3LY8A 2B25A 4JLPA 1E2HA 2R6R1 3O6VA 6ADHA 1T6NA 5LD2B 1ZR2A 2DULA 1IZ7A 4MVJE 1ULSA 3U9LA 1MGPA 3K1YA 4M0PA 3SG0A 4ZU3A 2NWQA 2OAGA 3I2IA 1WA5A 2AUMA 4KLRA 1GRQA 1Z3CA 4X95A 2LWIA 4EI9A 4I1YA 4AJ1A 1XV5A 3E2IA 4I1VA 5E1DA 2VBCA 2VSXA 3ZIAD 2OBFA 4V0NA 4HCJA 4MAMA 1K7EB 4DSNA 7REQA 4CKWA 2OCGA 4M83A 4AJKA 3WDKA 5JMOA 1EXMA 5KU1A 1BFKA 1TYDE 3R5HA 3K2BA 4PZ0A 4IIJB 4QULA 3SS7X 5EWJA 4ZEMA 1Y34E 2ANCA 2PXAA 1SXJA 2J48A 1GAJA 1P74A 3L0PA 5EE5B 1U9YA 3PWSA 5KTSA 4B83A 2F1JA 2WHYA 5B4VA 2CBGA 3IOCA 1P4AA 5LSAA 1OROA 2F00A 2ON6A 2R5NA 4HQ0A 3NHSA 2WHRA 3QE3A 3COVA 4JJGA 4IIJF 4YCJA 1UEXC 1I6WA 3Q6NA 1FFBA 1TECE 3KKOA 1W85B 4QXAA 3T3DA 7GPBA 3DMTA 3PEWA 4AIRA 4DLAA 1KH2A 3SVTA 3QVGB 1PR5A 4LZJA 4Q7JB 4OUKX 3QG1A 4ZCTA 1SA0B 2FPRA 3AL3A 3O8QA 3KPJA 3OIGA 2C58A 1C30A 1BE8A 1U8ZA 3H0KA 3HZOA 1U2SA 4MP8A 1FQWA 2V3VA 4PO8A 2MYTA 4FFBB 2MU1A 4KO4S 3QF7A 4C7BA 3KBBA 4YUVA 1XLWA 2W2LA 3DL2A 1E6EA 1GPJA 2C2WA 1RC1A 3N7TA 2Z2IA 2CLEB 4D0RA 3KB2A 2BFWA 4GOKA 2REXB 2XE7A 3QVXA 2VUIB 4GBMA 4MR9A 1GRCA 2BP7B 2GJKA 1A69A 1TA0A 1V8DA 2JIMA 1A9ZA 2QNIA 3LPCA 1MV5A 2B5WA 3G5LA 3PCXA 2XB6A 3EEFA 2PMDA 2FWPA 4C6RA 4U3JB 5JRDS 4F3NA 3MMZA 4DUYB 3K35A 1WVGA 1OFUX 2VAMA 1C1DA 4X1KB 4CG0A 2C4VA 5T4BA 3ZVLA 4HSEA 2YWCA 4MP6A 4GIBA 4KE9A 4KWEA 4NDNE 5TQVA 1YZKA 4WVFA 4XJSA 2VNAA 1KGSA 6GPBA 2AYZA 3BMNA 4Y1GA 2P7IA 2X2FA 5DK6A 5HM6A 3MT9A 2WU4A 3D2BA 3P9YA 4HMOA 4PIVA 5E6UB 4W7IA 1I36A 2PVCA 5HFAA 2MHCA 1HC7A 2DCUA 5ILQA 1BYIA 3LW7A 4Q9KA 4O4IA 4ID9A 5T3UA 3E18A 4AQ7A 5BWBA 2J6IA 4INJA 3CKKA 4HD8A 5LQSA 2G76A 2CFTA 1A88A 3K1TA 5B58T 3CVVA 5JNRA 2OO7A 3WIEA 4TVSA 3ZUGA 1WB5A 4RTQA 2GJSA 3IEVA 5FWXB 5AVJA 1NPDA 1NF2A 4ZJPA 3HC7A 4HYQA 1EXWA 2KMLA 3M1LA 1W52X 1OV6A 4ZQHA 3FTEA 4PYIA 3WR5A 4ND2A 3N8IA 3TTWA 1WP4A 3QFFA 1E3MA 4HQRA 3OTIA 3AR7A 1LTQA 3ANMA 3ZI7A 4CQLB 1MQAA 2YYSA 5HCNA 1YB6A 2XNJA 3ZS8A 2PUCA 3QVJA 3BUSA 4DKXA 1U8CB 1XWFA 2WW8A 3M82A 5ETJA 4BNLA 1DBSA 2X1MA 3HP1A 2I6SA 3COWA 3GPLA 4FEGA 4IGFA 1MNAA 5JCOC 2XOEA 5LR6A 4BFCA 1HKHA 2A9PA 1WIWA 3IV9A 3LU1A 4UU1A 5AW5A 4WLFA 2PK3A 3RKSA 1WQ4A 4BP3A 3LCCA 2WYUA 1FX0B 3LGSA 3AI1A 4K3VA 1UZLA 3OQMA 5CT9A 1GL3A 5L3SA 2H9IA 2JLXA 5L3SB 3KAQA 3FX2A 3VU0A 3WO0A 1RWNA 2F9LA 4ITRC 3QGMA 2EJBA 4HF7A 4PQEA 5DMXA 5F1OA 3AUAA 3GIDA 4FEAA 3TQFA 3PIRA 2A3RA 2PFGA 1OCEA 3GUYA 4QTTB 4Z51A 2OPHA 5I7RA 3MCAA 4D42A 4WBNF 3CXRA 1AO0A 1UH5A 3SX4A 1C80A 3B1KA 4PLZA 3WVNA 1A4XA 5KJEA 3A7DA 1IXRC 3A05A 3VHLB 5AI0A 1QRAA 3BE5A 3RS9A 4OJQA 2H5JA 3CZAA 4R41A 4Z4EA 4OBWA 2AC4A 4PHTA 2BF4A 4I50B 4MDEA 5EA2A 3D4NA 3SZGA 5CYGA 2G0TA 4I14A 2FOIA 2NZJA 1PZMA 2XGJA 4FZ3A 5CNMA 1VG9B 4XM2A 4XWYA 3E8SA 4P54A 2YV4A 1OLXB 5DB4A 4BU1A 1O6FA 4TPKA 2UYCA 2O8EB 4KX3A 1NLMA 2NYVA 4LQ4A 1YV9A 1I7LA 2YUTA 4D1YA 3EXEA 4I1SA 4UFPA 4QYSA 5HGJA 2F62A 1CY1A 1UPUA 2IYAA 1UINA 2GYWA 2XEXA 4RQTA 4E1AA 4BVHA 2NUAB 5HS6A 1XYYA 3GH1A 4FFLA 2GRJA 2Q7XA 2WKWA 2LZ0A 5HIMA 3D0KA 4FSXA 1M5TA 1ZVJA 1QFJA 4NX2A 1S6YA 1FLNA 4WUTA 2IHYA 1NXWA 2YINC 3FPKA 5D87A 1V1MA 3VTAA 3IUEA 1PSZA 4L51A 4IIFA 3PE4A 1NGSA 1QIGA 1GDDA 3SAJA 3KQLA 1CS4C 3E8XA 2HWWA 4KLCA 4MWOA 1MB4A 3ZIAA 2E3JA 2J30A 2PL3A 3P5BA 4DEYA 3UPUA 3KEMA 4MVJF 4CLOB 2DHEA 4TL7A 4K0RA 3RFUA 1LLDA 1OU0A 5FAKA 5JWRA 1XP5A 4YR7A 1Z6GA 2HJSA 2C03A 1SC9A 5F98A 1L1RA 3A4NA 5B2FA 1LDGA 3EXHC 1GCAA 2P67A 3G79A 2RHTA 5GZ6A 3VDMA 4B3JA 1J0AA 4P7JA 1KA9H 3I5XA 4QU9A 3EMDA 5BQPA 2YJ4A 2G0AA 2Y4NA 5IUNC 2O0HA 2EL7A 2VNIA 3HDTA 3CH6A 3CM0A 4ALJA 3AGQA 4YXWA 2OC9A 5CCBA 2VRBA 3RNLA 3KXDA 4TTTS 1VC2A 1PCXA 4LRSB 3PWKA 5BYKA 4XDYA 1ZICA 5FDFA 1XZGA 2NZUG 1V16B 1YQQA 3L0IB 3U81A 5BV2P 1WS6A 4WOCA 5IS2A 1CIJA 1QXSA 1I0ZA 2CHVA 2VBFA 2ZT6A 4PZDA 2UYHA 3B1YA 3HSKA 2OG1A 2ONCA 4WX2B 3TZQA 4C29A 2BM1A 2VDPB 1M2OA 3CNHA 4LE1A 4JQYA 5LOVB 3T4EA 4WXEA 2WRZA 3AK4A 4L74A 2NM0A 3MRSA 3MXTA 3NTUA 2QS9A 5DWVA 3ZDBA 3HYRA 4MV4A 1CS0B 5EXTA 3HBAA 2D00A 2VKQA 3U62A 2AOTA 5LP6C 1BS2A 3WO1A 1OI7A 5JXHA 5E3IA 3WZLA 2XGSA 4BKUA 1VIAA 2G77B 4MS4A 1O97D 1GM5A 2D6FA 1U8UA 3A9VA 5JT1A 1R8QA 2E89A 4M9RA 3PK0A 1BWPA 2C31A 1F4LA 3FPLA 1DWOA 3MOIA 3WWEA 4JIGA 4ON9A 4LRXA 4P5PA 4KXVA 1QVRA 1EX9A 2ZTHA 4MKRA 3ZWCA 1QX4A 2C0QA 4DAEA 2PUDA 3SXUA 3A1WA 5I5GA 3IBYA 2WTXA 3QBDA 1C9NA 1JALA 1ODKA 3GAAA 2G8LA 3Q3GE 1KDYA 5G40A 3WNQA 1XJWA 2F43A 3OY2A 1XDDA 3IAEA 2HBZA 2PRJA 3CWZA 4JEIA 2W83A 4HHEA 6YASA 3UUEA 1HURA 3F5FA 2P9YA 5K4AA 3UAGA 3BXPA 2X4LA 1QP4A 2X8WA 1MEOA 3UIEA 3D31A 4KGDA 5BSTA 2DU8A 1RFGE 3EHEA 1RKXA 4I55F 4C0XA 1XN1A 3OX1A 4TT3D 4ZVQA 2C9MA 3I34X 4L9AA 4Z99A 4CV1A 4KRYA 1R8YA 4YRPA 2PBLA 2WUEA 5FAXA 3D2AA 3S29A 4WY5A 1GV1A 4RD3A 4REQB 5YASA 2VZ9A 4QRDA 1RKUA 2C59A 3R3XA 3JAWB 3K05A 2DWCA 1K7SN 1QO0A 4IIXA 5EN4A 3AL0C 2I99A 5DN6A 4YRNA 1TYBE 4MAFA 2R65A 4MUGA 4B71A 3WJ7A 4DS3A 2NU9A 4RJTA 3SKVA 4AZ0B 3JYOA 3CLRC 4UD6A 2UU9B 1K1EA 3QRWA 1KQ3A 2OOKA 4LOLA 9GPBA 4ABTA 4TLLB 2FR0A 1N6IA 1TFUA 3PIDA 5EMLA 4ZKEA 2YV5A 2ZUEA 3E9YA 4TGLA 2FQ1A 3WICA 4AM8A 3LPNA 4PTLA 1OWOA 2C20A 2GX6A 3H16A 4FCWA 4HWOA 4JR2A 1L5GB 1H85A 1THMA 1KJNA 5IJAA 4XRGA 3C7AA 2KW5A 3SXJA 4FCTA 4MWGA 4J90A 3KVYA 4XAQA 3UV3A 4J9UE 2A0UA 1MOSA 3LXXA 5HF6A 4K6CA 4ZXPA 4OQZA 3DVQX 1L9XA 2Z04A 1KY4A 1NLZA 2FSHA 3PD7A 4QVKA 2CLCX 3AERB 4Q7LA 4HWRA 5JRJA 1TFRA 4F9FA 3EGVA 1PJRA 1M75A 4TTSA 4KIJA 2C7RA 1IRXA 2J4DA 2XGMA 2VJPA 3N7UA 1ZO8A 4LYJA 4OM7A 2VHEA 4UBKA 1NYQA 1FFEA 4QJ4A 5AKZA 3Q0EA 4YRKA 2QM3A 2CV1A 1ZIDA 2HPHA 1RAEA 3CG4A 3FCSB 4JEUA 4URZR 5FULA 4EVSA 4P2GA 3FNBA 2XBUA 4A0SA 1LPBB 1WO8A 1ZGAA 2CMHA 3E7PA 1ZUWA 3RFCA 4G4SO 1I51A 3AJRA 3SJBA 4CF6A 1DINA 3L92A 1JQAA 1VYVA 1VLLA 4DLPA 2VOEA 4PAMA 2EKBA 3D64A 3L02A 1G7TA 1VG8A 1U7TA 2YHAA 1Q11A 4GR4A 3ZZNA 3ZCUA 4C6HA 2HHCA 1KSHA 2AQ8A 2C7QA 1FLVA 1RP7A 2VK1A 2VT6A 2DLDA 2DJ5A 2VF2A 1L4BA 1UT8A 1SB9A 4LXHA 2W8BB 4NE7A 3T1NA 1PHRA 3KYCA 3I2YX 1K3UB 1W25A 2KLBA 2Q4DA 2ZJAA 4RKQA 3GT4A 1F12A 3GF4A 4FBMA 4UW9A 3OZAA 2Z9DA 4W6QA 4PCUA 1BHJA 2OXFA 3VVBA 1KFEB 2IIBA 2JLCA 3G5AA 3F78A 1Q1AA 3OZEA 4BV2A 4OA5A 3J81A 2W6MA 2AG8A 1BH6A 1AE1A 5AR1A 3WL4A 1PP4A 2L82A 3C3YA 3JAKB 5IMSA 2IXGA 2OV3A 2Q5EA 2JI4A 2ZI9A 3S5JA 2ZPTX 4NMXB 2GLTA 2PR2A 4JSYA 2F4VB 1QVZA 2FZWA 2LVBA 3KX2A 3K4PA 3OZUA 1OF1A 3TZLA 4B6SA 1N5DA 4KQ6A 2A4KA 1N1GA 1Z82A 4AW9A 2QGFA 4AIIA 1ZD2P 3ZZTA 1XVAA 3G17A 4C4TA 4GD3Q 5NLLA 1F7VA 1CY4A 3BMOB 1NAHA 3PFHA 4R9RA 5DM0A 2NO4A 1U0HC 3QI2A 5IJXA 3IGFA 1N6OA 3DLHA 5ALFA 4OB6A 2WVGA 3HU1A 3WQHA 2P7HA 3MTDA 3W8NA 5I7WA 3OQOA 4GXRA 1XFDA 1BVUA 4ZGGA 2QUBA 3QLEA 3TR5A 1QGED 2WSBA 3HADA 4LJLA 5BSRA 4K2AA 1SIBE 1YQTA 2BFPA 3ZHUA 4WEOA 2A1TS 2EXXA 2QTZA 3ONWA 4YB8A 1E2EA 4WN3A 3U3JA 3ETHA 3W9YA 5ISMA 4YJ3F 5IDXA 2NN3C 3O8CA 1X9IA 3VAAA 2DTDA 4DTIA 3H5VA 3DOEA 3DNFA 4QUIA 1Z36A 4AULA 4F04A 1JLLB 2AJCA 4H0FA 1PK7A 2A1UB 4PYRA 5DIFA 3W8EA 2CCJA 2W70A 4YPOA 4MA4A 4BLVA 4HN2A 3RIXA 3X44A 3JRNA 3TZBA 1J42A 2PUHA 4MHTA 3IX7A 3L8EA 5CA0A 1BQEA 2AOUB 5D7NA 1EUQA 1F1BA 1FA9A 2VH2A 3WWDA 4RTPA 4MYCA 2XXAA 4C4XA 3FHLA 5K09A 5A4IS 2BM8A 1VFNA 5KVSA 1ATIA 1P73A 2B4AA 1DQRA 4TN5A 4IF4A 1DQNA 3F9RA 1NFRA 2ZJ1A 3Q6MA 2B30A 4HDOB 2R8OA 4KKXB 3ZHOA 4HC4A 4C3OB 4HNVA 5HTKA 1P0CA 1RAAA 3UHAA 5JNWA 1BKDR 2D8AA 2H2GA 4RIHA 2FR8C 2AR0A 1XXHE 4DV7B 1THTA 3MINA 4UXHA 2W0MA 4I55A 3NEYA 2PUTA 1D0SA 2IF0A 2RDMA 3LHIA 5CXXA 1M2OB 3ROPA 3DLAA 4HLCA 1G21E 1GGJA 1PLKA 4WTOA 4F3TA 4MA5A 3A4MA 4ZHQB 4E94A 3QXHA 2W11A 2Q9BA 5KOHA 1KDPA 3GAFA 4XWTA 1CUVA 4DR1B 2KX7A 1H2BA 2Q5HA 3DUFB 3K8QA 1Z5ZA 3L7AA 4FWTA 5AM2A 4KR7A 4C4OA 1SNYA 3VSEA 1DB3A 4PPFA 2ZDHA 3ZOKA 1AGNA 2NV0A 3N0WA 4U2KA 3CU5A 3H4TA 8ADHA 2WHQA 4Q1EA 4CKXA 1NMQA 1VPLA 4RYLA 4IDOA 3KOYA 1YZUA 4NBWA 4KI7A 2CYCA 4Y6SA 1XTQA 1ZNQO 1NVUQ 4YN3A 2OYCA 3UTDA 2FPMA 3L1JA 2JLZA 3N8HA 1T9GR 3BKWA 1EVEA 4O2BB 1ST2A 4KQIA 1BX1A 1NYTA 1SVNA 2V8OA 1OLUA 4MEAA 4QTZA 3RUCA 3TQIA 2ZUFA 3MS7A 5DSTA 1Q16A 1U8XX 2V1XA 4NYIR 4IHAA 4TKUA 1QF9A 3X1XA 3COPA 3PDJA 3JYNA 1RJGA 1ULZA 2OY0A 1Z9BA 1SAYA 2R66A 4JX8A 1A9QA 3VGPA 3EVBA 2C2MA 4LDQA 5FO0A 5T41A 1C1HA 4O02B 3ADBA 3G2IA 1J9GA 4ZAZA 2FPOA 1RYYA 2FP3A 4ZI2A 3FNEA 3L6UA 3FROA 1GNQA 5CVDA 3EA0A 3FRHA 4EG1A 4IMPA 2EC5A 3WWPA 4C7JA 2CT8A 5KX5F 7AT1A 3ACDA 4KI0A 4NZZA 5LZ4A 1SK9A 4XQCA 4CMIA 1IBRA 3AYXB 1FJGB 1R88A 4D8WA 3O9MA 4DR5B 5FJIA 1W7AA 2FPLA 1Y33E 2I6GA 1N33B 1DUIA 3TMAA 3HFRA 1EUCA 1SGWA 4N4AA 3U4CA 2QNBA 5ANRB 2OKGA 4OL0A 1OXTA 3FPFA 2BEVA 3N2ZB 2QWXA 4H9GA 5FFNA 4OP2A 1JLHA 2JFWA 1VOTA 3M1IA 3UGQA 4NCIA 2DPLA 1MIHA 2XLCA 4XTRA 1SCIA 4Y2XA 3D0RA 1UC5B 3SDSA 3THRA 2IUEA 2FF7A 3F6BX 4PC6A 1UDRA 3BJIC 3PE3A 4C1BA 4JSRA 1HDOA 1TCVA 3EVEA 1KIAA 3KEOA 5ECGC 5CEFA 3BZBA 3PNKA 4V3BA 3K0EA 4DLLA 2XNSA 4BXOB 3EXIB 4AKIA 4IDAA 2G5GX 1USGA 2PGIA 1UBRS 2QRZA 1WP9A 2G70A 3RE1A 2B1GA 3N86A 1L8LA 3M4ZA 5F3DA 3D2CA 2W00A 2FWAA 3EZ2A 2DB3A 4OI1A 5ICCA 5IAOA 2PH5A 2IH5A 3KDSE 1T9KA 4BWVA 2B7BA 2DKFA 4BWGA 4ESHA 5A1TA 1ISMA 2XUIA 1LZKA 2JANA 2BE9A 2UYQA 5K99A 2EW8A 1IY8A 1B6GA 2P2SA 3FTPA 1EWQA 4YAKA 3ESRA 3HXOA 1ZZGA 4FFWA 1V9CA 2C5FA 2VJOA 1VI5A 1E6UA 4Q24A 4UAGA 5BRJA 1O2DA 4O0LA 3TW8A 1AQ6A 1AMOA 2IBSA 4OH1A 3AI2A 1A1SA 3H3XA 2OORC 1ODSA 2EFEB 3PUYA 3NTLA 2DE0X 3OPQA 2I4RA 3V8RA 4TZ6A 4M98A 3QPDA 4MV3A 3IAM1 2FA9A 5JSYA 1N5LA 3K30A 1JSXA 3DZIA 2JGNA 2PANA 3UKOA 2OO3A 2JK1A 3RC3A 1Z12A 4QFCA 1DHRA 5D86A 1K0UA 3ME5A 1FP6A 4BCBA 1MCZA 3I12A 5DNCA 1GUAA 1UZUA 5JS6A 4ZO9A 2I6UA 4ZDIA 3BE4A 3RW9A 5GGYA 2D5BA 2BFBB 1GTZA 1P31A 2HQRA 3HWSA 3OWOA 3PHBE 3ZKWB 3FPSA 3GLRA 3NI2A 3WBFA 2AZ4A 3FTCA 1L5ZA 2VCHA 4GSYA 3V2HA 4MOWA 4TWIA 1H2FA 2YICA 1IM8A 1ADBA 2OCIA 1JLLA 1ZGZA 2OZPA 4IDFA 1FSFA 1LX7A 2GAJA 4ZOLA 3V8PA 4PZ9A 1T35A 2XQGA 1EDBA 3S8MA 2VP9A 2QRVB 2AJDA 5EOVA 3PZRA 3UB3A 3QM1A 1NX9A 3ZLUA 4RIFA 1JR6A 3K0FA 4GYJA 4YJGB 3QSGA 2E55A 4QLOA 4EM6A 5ITSA 1X7DA 2X3YA 3S4YA 1MX1A 5D3MA 3L9WA 4H7PA 4RSRA 4CRWB 4EB0A 3RANA 3O1LA 5CDGA 2P90A 3W4IA 1PW7A 1Y4SA 2A0FA 1LQUA 3U4AA 3KUDA 3YASA 3BBLA 5KBYA 2JIZA 5HE8A 2FEXA 3VC1A 3EISA 2F59A 5ARBA 3LC0A 4GT1A 5DI9A 1GQYA 3BRWD 3CUWA 3UUWA 2YOHA 3T5CA 3UWOA 5C8YB 4OLHA 4NF2A 5I7HA 5CFQA 3O8OB 3HY3A 5ITZB 1ZD8A 1NJ6A 2IQIA 3K5IA 1R0ZA 2C2HA 4Q3OA 4DUGA 4JODA 5KTKA 4RWZA 4B17A 3IDOA 4Y3UA 2ECFA 3UAOA 1LJ8A 2Q6TA 1E3IA 1KU0A 2YJNA 4ZA2A 3WL5A 1B1CA 3QX9A 4RHYA 4Z54A 4NECA 1F8YA 1UR5A 4QICA 3GL9A 3MGKA 1Z4JA 4B5KA 2QJTA 3FZNA 3NHLA 2JGRA 3WYCA 3LBAA 2DPYA 4KN8A 3AVUA 4PWYA 1JR3A 1ZMBA 3OHMA 1ZXXA 1GKIA 3W2GA 1HNZB 2Y1XA 4P3KA 5K3FB 2B69A 3LDAA 3QMVA 1RHQA 2PQ2A 5FLEX 2GZDA 3I01M 1UK9A 4NCJA 4XWOA 2CY0A 1KZYC 1Q7BA 2XKAA 3DDHA 3GLUA 4K6HA 1AV7A 1DV1A 3ZD8A 1JT9A 1SUIA 1GG2A 4QBKA 4B3HA 3V1LA 3VI3B 3DZKA 4BNXA 3QWHA 5H3CA 1X70A 1FVFA 4DYVA 2X6QA 1WMBA 3AJDA 4KGXA 4B3FX 4EJSB 3HVHA 2C07A 3OEWA 1E3EA 3EQ8A 4Z7QB 5AW6A 1QOPB 4P9NA 5BMOA 3MS4A 1H0HA 4PCVA 2IYNA 3ABZA 5EWLA 2Z3ZA 3TIIA 2F7SA 3GFQA 3HCRA 3L7JA 4I81A 3C48A 1SXJC 1TJ4A 4V0OA 3V4PB 3VYWA 1AOXA 3E7FA 4KYUA 5K6AC 1CWUA 4TROA 3WBBA 2EGHA 2G0NA 4R5HA 1G8AA 4CQMB 1DS6A 3D7LA 2GOYA 1TO6A 4L7VA 2GB4A 2P4EA 3LQFA 2CF6A 4RK1A 3GFPA 1S8AA 2J3JA 4F3KA 1HM5A 3B7GA 2GCPA 3GRFA 3HDYA 1KZ1A 4P83A 2IT1A 521PA 3RJZA 4FTWA 4BGVA 1WUHS 2K2QB 3VM6A 4Q4JA 3BSFA 1JHRA 3SJZA 5A06A 2Y1EA 4FNOA 3NHAA 1MT0A 3CPSA 4YI3A 2NV6A 4ZZIA 1WETA 3R6TA 5ALHA 1O08A 3UVEA 1IUNA 3CWCA 3OFSA 4FYXA 3EWIA 4FE3A 3VYTB 3AR9A 3H13A 3OCUA 1T9AA 1O6CA 2Q1YA 3E22B 5HPYB 4PFJA 2GDJA 4M0FA 1VGRA 2ZSBA 3STWA 4F1KA 3MLEA 3F90A 5ITWA 1XZPA 1OKKD 1P2VA 1VHQA 2QMOA 4LN1A 2BGNA 5BSMA 1CJCA 1Q2XA 2YOGA 1ZK4A 1FU8A 3D6UA 3P27A 4ODIA 1LZLA 2FWMX 3GDFA 4IOKA 4RM3A 3PC7A 4WXYB 5JH7B 2GM9A 2VKTA 4ECAA 1Z5VA 5FUQA 1E5VA 1JKJB 1Z29A 1Q15A 5MN6A 3LS2A 5FBLB 2UZ1B 3I9KA 3MJSA 5LXTB 1W49A 4ZO6A 5EYPA 3B53X 3DAFA 1BTOA 1H9BA 2BCEA 2P9BA 4TVOA 4X1YA 3A1EA 3LQ4A 4TWZA 3JTEA 4AD8A 2V5UA 1N8SA 4D9EA 1XA3A 1OXSC 5E4JA 1WVIA 3OZCA 2JFFA 1G3MA 4J49A 1TIPA 3FGZA 3DWGA 4FDUA 5AXBA 1H1DA 1DMSA 2J08A 2NVOA 3G0IA 4JSTA 4NK5A 2GRUA 3E5HA 4XYMA 2WG1A 5D3QA 1W96A 5C80A 2O8NA 1YR7A 1B74A 4TKVB 3TGLA 1QC5A 1XZMA 1WSWA 3IQGX 3PJDA 1QYIA 2LCIA 1JR2A 3C39A 1X1DA 2VPTA 4MRRA 4KTTE 3V2GA 2J0SA 1K6EA 2VAVA 1C2YA 3U61B 3ONNA 4FLEA 1PVOA 3RC2A 2I22A 1YJAA 4N76A 2VPIA 2ZS8A 3NG1A 1G20E 3WDSA 1R9JA 2CD9A 5DN9A 3RM3A 1IBKB 4RPIA 4NAUA 4BX2A 5KX5B 4C0AC 1UM9A 2HNKA 3OCZA 1CKEA 3IEMA 3M2TA 5K0FA 1WMSA 2HJHA 2IPXA 2XYGA 3FUTA 3LQ1A 4EGQA 1NQUA 4PSDA 1CNMA 3WQSB 3JASA 3Q8WA 1PLJA 4BUCA 3O84A 2AV6A 3GDGA 1NXXA 1U99A 2CVPA 4MVCA 4IVNA 2ZROA 4A0QA 1SUSA 3K0HA 2OAQ1 1TM3E 3LUBA 5F4BA 1A3CA 4PSAA 3P9QA 4ANFA 4GLLA 5B37A 4UBNA 2YHUA 4B79A 2RAVA 5FOWA 6Q21A 1DRKA 2E2WA 4ND1A 3RHSA 1RLUA 1X6VA 2YHBA 4H6VA 3VNSA 3TNFA 2GZHA 4J0GA 4BTVA 2WR8A 5FF9A 3OZ7A 2HA4A 1JBKA 2EVWX 4TUYB 7MDHA 5TLSA 1IYZA 2WM8A 2HXSA 4OUDB 5EXSA 1FNDA 1KYYA 3I73A 5K3EA 3UB2A 1RW4A 2OO5C 4PGGA 4PIPA 4HV4A 5IT0A 1M6VA 4RJLA 1IHXA 4MX8A 3QLUA 2FFJA 5J2UB 2W6OA 3EQ7A 5FH9A 2Q5CA 5KSZA 4YRAA 4UCWA 4D80A 1N2EA 1Y9ZA 3WA7A 3ED5A 2Q7DA 1PQUA 2WWYA 3VISA 4EZIA 4TWJA 3P2IA 3O4GA 2W5UA 3G9QA 3G9TA 4DVGA 2Y99A 5I8WA 1RCTE 1ESCA 1UMBA 2GCOA 2A5FA 1ETHA 4FGWA 4MYHA 3C3BA 3WOVA 1YR1A 4FS8A 3GZNA 3FYUC 3W5SA 1XRLA 2AWOA 2FE1A 1AQUA 1ISIA 3JQAD 2AF3C 3PQ4A 3TZHA 2X41A 3V4FA 4E5UA 4BO6A 4J75A 3W78A 4L9SA 4ND8A 3TECE 3FJ1A 4YJFA 2PSEA 3V8QA 3F8TA 5LZ9A 5TT0A 2WWIA 4QUAA 1L5WA 2JA2A 4YRFA 3M33A 3VDNB 4G07A 3EVZA 4MYUA 1YJBA 1KRXA 4GMGA 5HXAA 1EE9A 1L7RA 1Q7TA 5DWQA 1UAAA 4P0QB 1QLWA 1VKHA 3A9CA 5CB0A 3A14A 1UIMA 1YL7A 1FFGA 4RL6A 3CLSC 4MI6A 4DR4B 2PPVA 4H3HB 1KYZA 2HZ7A 2JIBA 2XNCA 2NZWA 3PGMA 4KZPA 4M9QA 1CIVA 2VHYA 4UUQA 1IDN1 1H05A 2HAEA 3CRW1 4N7JA 3UT0A 2NZYA 1HFWA 3E7XA 4X8LA 4D56A 5CBPA 2D2VA 4V24A 2I6QA 2VQFB 1G8SA 3EUWA 3RVDA 1K8QA 1I8TA 2Y9PB 9ABPA 3MIIA 2WPDD 3ELWA 5CB8A 2ZRQA 1VCMA 2R1VB 1UBUS 4FSDA 1BMFD 4B6EA 5JZMA 2GBLA 4PBSA 2HLDD 4JXZA 5T6MA 3RHTA 1MQ8B 1PG5A 2ONKA 3ABOB 3P2YA 1NM5C 3W5VA 2H4YA 1M3SA 3IMGA 3DLIA 4ZMBA 1XSEA 4O1IA 2BTEA 3QLTA 4J94A 5DEOA 5H3LA 5K01A 4W82A 2ACWA 4HFNA 5HF9A 4BGDA 2AB0A 2D7DA 1NQAO 4ZEXA 4WOJA 3CNNA 3KS9A 3LUCA 1WD5A 4F85A 3PFIA 1U02A 2A3NA 4PS0A 4Q93A 3R3UA 3H75A 2IY9A 3NBMA 3FOBA 1B3BA 4B3BA 3PC6A 3FKSD 2SKEA 3I4LA 2X9VA 1T0BA 2CB0A 3EIOA 3IAUA 1WZNA 3PQCA 1S3FA 4V38A 3N3BC 3NVKI 4F9TA 2VJKA 1SKQA 1UJ5A 4QDZA 3KSRA 4INPA 2AOVA 1NR7A 1AV6A 1Q1QA 5IKMA 3VBCA 4JQOA 3HHEA 3VR4A 1UDBA 2WDPA 3NIDB 3IYLW 2VSQA 4F2WA 2OV8A 4UD2A 3WYNA 1XMJA 3E1GA 3LCJA 4R9NA 1SEPA 2PL5A 4PGFA 3TQRA 2DLCX 2R2AA 3LYUA 1H1LA 1QB8A 3N2KB 4FB4A 3ZVKA 5DISB 1QFXA 1R27A 4XCVA 1IHPA 1YRAA 1PAUA 3GHHA 3S1AA 1GL9B 2AFHB 3USZA 3ZGXA 1U2GA 5JYCA 4V1CB 4R2XA 3R7FA 1YXMA 1ACJA 3WGUA 4BGEA 4WUVA 4F6LA 2VXBA 5CH5A 2ZJYA 1DVRA 2XNDA 2BMDA 2QR3A 3L8MA 1BGWA 2QTVB 1KDRA 2AIRA 2ZIFA 1GG5A 3Q40A 1XR3A 3BD6A 1GSOA 3MJRA 4JOQA 2PKCA 2RHDA 2J9XB 3A25A 1EFPA 1H8ED 5EQDA 2ESRA 4EPTA 3NXKA 3WLIA 1YZGA 3HCCA 1Z25A 2AG0A 3U17A 4V0QA 3QXXA 3TF5A 3H4MA 3U4QA 5KX5A 1XELA 4IF6A 4AQDA 3S8EA 4UTVA 3HRIA 3TOCA 5AIBA 2BKEA 2UUCB 1VPTA 1SKUA 4JR0A 4W9RA 1QGUA 3GBSA 4K81B 4L9RA 5E95A 1T6BY 2HEIA 2PJUA 3EZ6A 4Q01A 4R1PA 4L5AA 1JECA 1E2DA 2YXEA 3K15A 4S0ZA 2Z5LA 3RT1A 3ZY3A 2WB4A 5ARDA 1E9CA 2NTJA 3ER8A 4MRAA 3DXXA 1F60A 4GKJB 1QYWA 4ZDJA 2HRRA 3T9EA 4DCJA 4DCUA 4EYOA 4F56A 4QECA 1W93A 2MOKA 3HXPA 2YX1A 4TLBA 1TI7A 1Y6QA 4R2LA 3KSZO 2C92A 4CF5A 2KS6A 2C04A 3J81k 4A1FA 4B6PA 1WD7A 4YUYA 3LVRE 4W5RA 2H4ZA 2PGDA 2XDQA 3FDFA 5IJ0B 3H8WA 2PSSA 3QUAA 5D5QA 3PFFA 3SC2B 2I2AA 2AN1A 5KWEA 3BJZA 3D1LA 2PX4A 3CQ9A 4GKVA 1ZH4A 1QG6A 2AK3A 3OLYA 2R8ZA 1O77A 2C2BA 3IEKA 4GECA 2WK1A 4L73A 2GD6A 4TLAA 1COWD 3FOAA 2J85A 4IGKA 5IKPA 3AUUA 2VUSA 4WD3A 1CDZA 5HKBA 2V59A 4EL5A 3I5UA 1NVXQ 1Y6GA 3TLGA 5FIUA 3IH5A 2OK7A 1S5PA 2UYGA 2BMWA 2WIAA 4XX0A 2Q45A 4W5OA 1ABFA 4J9VA 2QEQA 4PPGA 4UHFA 3RYTC 4BQFA 4EMUA 1XTBA 2EU8A 1NJSA 5DJ5A 3WDMA 3A36A 3DT9A 3H1AA 4I8IA 1A8SA 1DG1G 5CIQA 1XCOA 5A7GA 5I4BA 4MB2A 3LT5A 5F51A 4TMWA 4GGPA 2AXEA 1TDJA 4GC9A 3BJRA 4MW0A 2GARA 2ZR0A 4LS3A 2XH8A 4GW3A 4GYKA 1N3BA 1JFVA 4RY8A 2WTBA 2YMMA 4ZJUA 2PT5A 2W2MA 3OZBA 5I4IA 1PDVA 2PZMA 1YBMA 4MGHA 3NT2A 4C0WA 3FKSA 2Q0HA 3I3OA 3GIWA 4FHGA 5BNIA 2XUQA 4PX9A 2LUOA 3IB6A 2VA8A 5KTTA 2QN1A 3WSWA 1L5HA 1XEAA 4MW2A 5EHXA 7ADHA 3JVEA 4WNIA 2N46A 4YYZA 4MWCA 5DHTA 1ICIA 2QU8A 1I5OA 3A6DA 4AJHA 1AZWA 2YR0A 3FLEA 2CVQA 3HH8A 1O0BA 2GERA 3HJGA 4N6OA 4CMEA 4IDPA 1P7VA 3VU8A 4G9GA 5HQTA 1O03A 2C1XA 3BDAA 3OZWA 3QU7A 1HDYA 2CNWA 3C8DA 3KTFA 4KQ9A 4DJDC 4NV0A 3MJFA 1NSYA 1NW3A 1CUDA 1G5HA 4JLWA 3OOSA 2GJ8A 2H2AA 2J59A 3PC3A 4CEIB 3EIFA 1N2ZA 2OV4A 2P1ZA 2WD8A 3HV0A 2ONZA 4MKXA 1UKVY 1ZKMA 2FZ4A 3C16C 4OHOA 3ZZMA 2R7KA 2RHMA 3AF2A 3WL7A 1LXCA 1Y80A 1I4DD 3WLTA 3UAYA 1HORA 5KNBD 5FA5A 3TKLA 2JNWA 2H4XA 2MMCA 1HX7A 2CN1A 2OZKA 3ECAA 2WKSA 1JHZA 3NFYA 4TV9B 1RXCA 1YULA 3OH8A 2Z3WA 3F73A 5E4TA 2OHVA 1EVKA 2FOXA 4JK3A 4MUAA 1MF7A 1YZ3A 3ITNA 5E9JA 3GJ0A 3ZDCA 2NXEA 3EMKA 2DPGA 3AILA 4XFKA 1AG9A 2BKXA 1RXYA 1S1MA 1VZ2A 1QZTA 3CYFA 3PGKA 3Q3CA 4FDMA 4RTKA 1RHJA 3VJRA 4RSMA 1Q14A 5ENZA 1KTIA 4TQUS 2VDLB 2HRQA 3A37A 2GXSA 4RGYA 4KQHA 5DGIA 4KR6A 5U4QA 3THXA 3MJHA 4MGYR 3H3JA 5K45A 3RAGA 3RSGA 4BFYA 5P8WA 2Q0SA 2NSJA 3IRVA 5FPPA 1QTQA 4CIWA 4CKZA 4A26A 1KPGA 5EZSA 2D5CA 5FNVA 2BH9A 2CLOB 2UVPA 3GLTA 3HB0A 2FG7C 3O7WA 3T3PB 1SFRA 1P1IA 1UJ2A 2DTXA 3D7RA 4BBAA 3OFND 1EB9A 3HYCA 3PJEA 3ZJUA 4AN4A 2NXCA 2P1DA 1DC6A 2IYUA 3PQ3A 4X63A 5CW2A 4P7GA 5IAJA 2K5UA 1TUBA 3H19A 5EC8A 5BOVA 3GLFA 3D7NA 2G1JA 4FN4A 4OQLA 5AXDA 1VL2A 3ZI4A 2DF8A 4FZVA 4O4IF 4HJXA 1CU1A 3B3GA 3CRNA 1JX6A 5IKXA 2VJCA 1SVSA 1THGA 1YKFA 1JJIA 4QJBA 2UXDB 4GVLA 4R01A 1YJ8A 4M7OA 4J4HA 1ZCAA 4QNMA 5FTNA 5TRTA 3SN6A 3MMSA 4C7MA 4Y2VA 5CHEA 5HJ2A 1W34A 4B82A 1HE3A 1V95A 4EY5A 3H1GA 2J9RA 2WOOA 2C61A 4DCSA 5I6DA 1GKUB 1Z5PA 4DT1A 5AIAA 1YE8A 2O0MA 2FG6C 2R79A 2N9UA 2V0CA 2R25B 1YWGO 2NO5A 2XGGA 2HU7A 4LJ4A 2FEKA 5I9SA 4DLYA 2OD9A 4AZTA 4TMKA 5E2AA 1TQ4A 2I65A 3WKDA 5ECWA 2PX6A 1FNCA 4DSOA 1ILWA 1DLJA 1VJ5A 2LP4Y 3G2MA 3KKQA 3N9IA 4GI7A 3ZKWA 2WE7A 4S24A 5CB4B 5CX1B 2IYRA 2WHEA 2BZ1A 2NO6A 3EPRA 3G0BA 1BCSA 4IYRA 1KQOA 1U3FA 3GWZA 2EKDA 1H1LB 1IIRA 1KJZA 1ZGGA 2BHSA 3PSAA 2X6TA 1F0KA 4RPKA 2B2XA 1KSGA 3DXZA 3GK3A 4LQLA 3VSBA 3EGWA 1X0XA 2IH2A 4TVBA 4PHFA 4PZCA 2OA0A 1WPQA 4MK4A 2AFRA 3EGEA 5C7IO 3AR8A 4OQDA 5DU2A 4YV7A 1QF6A 1Z7YA 3ML1A 4Q9LA 5JCZA 1LV7A 1T3SA 1XCLA 3DW1X 1T26A 3OQ1A 1DFIA 3NT4A 3UZUA 1HEYA 3QKSB 1CR4A 2AKYA 3ABSB 1FUUA 1UJ4A 3DFKA 3PR3A 2HJ9A 2H0QA 2D1SA 3GWGA 4CG1A 4B4VA 1NU6A 4MLDA 1JB1A 4PHHA 3P4YA 2VJMB 4JC0A 3C7DB 3PFBA 1XZJA 3AEUA 4FBLA 4PHCA 4H1HA 1IDOA 3IESA 1C4XA 1W29A 1Z39A 2J0QA 4M1SA 1ZRNA 4U02A 3KQMA 3N1UA 5FPYA 4DOMA 1N36B 1GGFA 4B7XA 1BX0A 1LX6A 1NP7A 1U7ZA 2OAP1 3MWYW 3PHHA 2F17A 2IVFA 4HSGA 4I0WB 1Z7EA 3CWQA 1MFPA 2VI5A 3OEED 5SV2A 2PRSA 2X7XA 3SDZA 4RXTA 5HRAA 1ORRA 2O2YA 1MU0A 1M6EX 2LIPA 2QRHA 3BCSA 4Q37A 4MW6A 4QVIA 3U9TA 1CUJA 2JBAB 2G80A 1O3YA 1O96A 4D99A 2H1CA 2BRUA 4AN1A 2B34A 4OEHA 2NXNA 4PINA 5K8LA 5IH3A 4WDRA 1KQFA 1VLVA 3G2KA 3AVOA 4DXAA 1GXSB 1UBNA 1PFKA 1EVZA 3D3KA 1QQAA 4NQRA 3VTZA 5E3HA 1NFFA 2GWRA 4KIFA 1YI0A 2PUFA 2AHRA 1I2DA 5KYKA 3ZU4A 2IDJA 1C4WA 2WOJA 3ZJ5A 1P7WA 3RABA 4D3ZA 1XAJA 1NJ1A 1JR3E 2K87A 2NO9A 2EFDB 3Q1KA 3JQ9A 4QYMA 4HDNB 2AG6A 5K3DA 4ENQA 1A27A 4UREA 3T4UA 4ZHSA 3SIPA 4XGKA 2MCFA 3LFUA 2ZYTX 1RRGA 3QVLA 5DXJA 1SA0A 5CTAA 4EG5A 1U2DC 2QZPA 4URXR 3AOEA 1PX0A 3ZLBA 3OEHD 1UEJA 2CV2A 3K09C 4EENA 1C3JA 1RYNA 2ZAYA 3K9WA 1RZRD 4G5FA 1CFZA 4WCFA 2VPXA 2RKOA 5E6RB