4YUXA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2h-1,4-benzothiazin-3-amine
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 100
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuxA02
2P41A 5HZMA 3G2OA 5EKXA 2V74B 3HNRA 4QDJA 2P8JA 4GUAA 4LECA 5LQRA 1BOOA 3VSEA 4E30A 2O06A 2UYHA 1KPHA 4RTSA 3DLIA 4KDCA 4ER7A 4PYKA 5IH3A 2PT9A 3C6MA 1R6AA 3D2LA 4GF5A 4P7GA 4DQ0A 2B25A 3SXJA 1Q0TA 1VBFA 1OR8A 3SM3A 3UZUA 2PBFA 3QOXA 3QOWA 5EMJA 3KR2A 4AZTA 3M33A 1WXXA 5DX8A 1M6EX 1O9GA 3PLAE 3ORHA 5FQNA 3FUXA 5EZQA 5EMLA 4KDRA 2AN5A 3KPJA 2AOWA 2B3TA 2AS0A 3UJ7A 3C3YA 2N47A 2VDVE 2IBSA 4K6MA 1JQEA 4O29A 3LBYA 5ICCA 3GDHA 5DLYA 2Z6AA 1NW6A 2AN4A 4OBWA 4R8RA 5HOQA 3M6WA 3MCZA 4C04A 4CKBA 3NWBA 3OU2A 3TOSA 5GINE 2C7PA 5EG5A 1WY7A 5LSAA 2EX4A 4RSRA 2OO3A 4KW7A 4DMGA 2AVDA 2R6ZA 1SUSA 4A6EA 2PWYA 3OCJA 4FP9A 4IV0A 2GS9A 5DXAA 3FUVA 3WSTA 4BLVA 3DXXA 2IGTA 5EMMA 3LX6A 2OBFA 5D1HA 3NW9A 2KW5A 2V7EA 3M4XA 4FS8A 1R8XA 9MHTA 2H11A 4MIKA 1P1BA 1R18A 2PGXA 3NTVA 3GWZA 1FJXA 4R6XA 3AWIA 5CD1A 3SMQA 5BXYA 4R05A 2C7OA 2PY6A 5CM2Z 1ZGAA 3DOUA 1JG2A 4MHTA 5E1MA 2ZWAA 1Y8CA 2PX2A 1X1BA 2YXDA 3LGAA 2PX5A 3EVZA 3IYLW 2YXLA 5DM0A 3KR0A 3SVZA 3BWCA 4QQNA 3I5UA 3KKZA 1T43A 1NKVA 4E70A 4M36A 3EVFA 3EVBA 2UZ4A 3HCFA 3PB3A 5EHGA 1RJEA 2YUIA 3S68A 1HNNA 3UJBA 5K01A 1IM8A 5E8RA 2OXTA 3NVMB 2FYTA 1JTEA 1UIRA 1PJZA 3HVKA 5F2OA 5LQNA 5ICEA 4E2YA 3GJYA 4HRAA 5GM1A 1N2XA 5EOVA 2IH2A 1SQFA 4BLUA 4Y30A 5FADA 3X0DA 4IV8A 2AZTA 4CTKA 4GC5A 2PXCA 3AXTA 3LHDA 4GBED 4RTNA 3OZSA 5EGSA 4EKGA 2JHAA 5HILA 2B2CA 2R3SA 1EQAA 3IV6A 5M5BA 2PKWA 3DTNA 3IHTA 1UWVA 4OQEA 4LWPA 2P1DA 2NXNA 3HVJA 3HTXA 3EVEA 2BZGA 3LSTA 3ERCA 1JQ3A 5LQCA 3LPMA 1KIAA 3KPYA 5D1NA 2OZVA 3LKDA 3SX0A 4RVFA 5ICGA 2OB1A 3NDJA 1VL5A 4BP3A 3KQMA 3G7UA 3HM2A 4FT2A 2FRXA 5C9ZA 5FUBA 5LR6A 2AOXA 2C7QA 2GPYA 2I6GA 2I7CA 1X19A 3K0BA 4GQBA 4HSGA 4PWYA 5DX0A 3TM4A 4RTOA 3KQWA 1SQGA 3HCDA 4XUEA 4RTQA 2P40A 4YUWA 1QAOA 1D2HA 3QV2A 5DTRA 3CJQA 5KYGA 1SG9A 3GRYA 1R00A 2GB4A 4NECA 4PYMA 4EMSA 3FTFA 2B78A 4RTKA 1JTFA 4DA4A 3FTEA 4FZVA 1PRYA 2HMYB 4IKPA 4R8SA 4YUYA 5K03A 2EJTA 4V0QA 4GOLD 5CVVA 4BY9E 5E1DA 1VIDA 2ERCA 5IKMA 3FTCA 3GCZA 5EZSA 3OU7A 1I4WA 5DRYA 1RJGA 5K0CA 4M7RA 2P7IA 3G8BA 4RX1A 4ER6A 2O57A 2FCAA 1R8YA 1RI1A 2JH8A 3LDUA 3A25A 3UWPA 3ME5A 5H02A 3C0KA 1VP9A 5E2BA 3B89A 4P7KA 2BM9A 5DT2A 1JG1A 3FZGA 3SSNA 3UBTA 5FQOA 2ZZNA 4C05A 3HVHA 3G5LA 5DM1A 1F3LA 1NBIA 5EIFA 1XDZA 4PNEA 3F4KA 3HA3A 4X60A 2I9KA 4DCMA 3DR5A 5F2NA 3DULA 2P35A 5T67A 1BKYA 2ZW9A 4GEKA 1MJFA 3B3JA 1NV8A 3FTDA 3P9KA 4GOMD 2ZIEA 4QVKA 5C1IA 3MTEA 1H1DA 3AY0A 3C3PA 3HEMA 3JWIA 3FUUA 5ERGB 3EMDA 3CKKA 1G55A 1SKMA 2AR0A 3EVAA 5K05A 3MB5A 1DL5A 1X1AA 3OFJA 3OZTA 5FTWA 5HIMA 4BLWA 5HIKA 4AZWA 3OPNA 3HCBA 4YMHA 1FP1D 4L7VA 5E9WA 1JG3A 5HIJA 4RYLA 1G8AA 1NW7A 4QQKA 4DZRA 3PX2A 3R9XB 2OKCA 1VQ1A 4RVDA 2ZBRA 5DXJA 5DPMA 1XDSA 4P58A 1XCLA 3KPVA 1QZZA 2NYUA 2VP3A 3KHKA 3AJDA 3KQTA 5CUQA 4AZSA 4C03A 5CIYA 3BGVA 4PYIA 4V0RA 5F2KA 2P3QA 3CC8A 2JHCA 3JWGA 4GOOD 5LQUA 4AZVA 5E1BA 1P39A 3AXSA 3LDFA 4E2ZA 5BW5A 1EJ6A 1U2ZA 3GGDA 4B17A 3LDGA 3GXOA 1ORIA 1X1DA 2YVLA 3M6UA 4OBXA 1RI3A 2B9EA 3CJRA 3BUSA 2BR5A 5FCDA 5DTMA 1NW8A 2Q41A 2VZ9A 2GLUA 5B1SA 3EGVA 4ZTBA 5EC8A 1KP9A 3UJ9A 4YV1A 2XYVA 4OX9Y 5DX1A 1XTPA 3BWYA 3L8DA 5FA8A 2NP7A 1EAMA 2QM3A 4KWCA 5K8VA 2HR1A 3DMHA 3SSMA 8MHTA 1IXKA 2AN3A 3TR6A 1DCTA 3I53A 5EHIA 4U7PB 4CXMA 4QPPA 1RJDA 2I62A 3NWEA 3PX3A 3Q87B 3B7PA 4H0NA 4EKIA 3FYCA 5FULA 3O31A 3GNLA 4ISCA 2IP2A 2LD4A 4PYJA 2ZBQA 4POOA 3FUWA 3H2BA 2E5WA 3THSA 2XBMA 2CWWA 3GRZA 2XVMA 4C06A 5BW4A 4PYOA 4YUZA 2PJDA 3FPHA 4EQZA 3BZBA 3OE4A 3UA3A 3P2IA 3CGGA 4PYQA 4ER0A 2Y1WA 3I58A 5P8WA 5BP7A 3E7PA 5EEGA 4RTMA 3DH0A 2QYOA 1QANA 2BR3A 3DP7A 4FR0A 3TM5A 1F38A 3THRA 3G8AA 1BHJA 2JG3A 3A7DA 3MHTA 2IFTA 3A27A 5DTQA 1AQJA 3P9IA 4UOEA 1G60A 3GO4A 3PFHA 3HA5A 4QDKA 2NNWB 5CVDA 3BKXA 3KQSA 4CKCA 3P2EA 3GRUA 1YFJA 1G38A 5KQSA 1FPQA 2Z6UA 1NBHA 4XUDA 2FHPA 5K0EA 3MTIA 3P9CA 4MWZA 2FK7A 5DSXA 4DKJA 1WS6A 2AVNA 2UYOA 2AOTB 2XVAA 2FK8A 3KPUA 4CTJA 2WA1A 5E2AA 3BKWA 3UFBA 3I64A 4WXHA 1QAMA 3EMBA 3LCUA 4BP1A 3A4TA 4PGGA 2NXJA 4R6WA 3SR4A 4E31A 1R74A 4LWOA 3RIEA 2QE6A 1NT2A 2VDUE 3P97A 3P9NA 1JG4A 3C6KA 2ZWVA 3KQVA 5E9JA 1ZGJA 3OU6A 3HP7A 2PX8A 3EVDA 2PX4A 5GIPE 5EQJB 2ZULA 4DM3A 4RTLA 1NW3A 4PIMA 2OY0A 2AOTA 1I1NA 4PONA 3OE5A 4M37A 5KS2A 1D2CA 5LQJA 5HEKA 4C4AA 2YQZA 1QYRA 3FPEA 2G71A 4ATNA 3PT9A 5CVJA 4XCXA 4YV0A 1B42A 5K0JA 3PTAA 3T7SA 3ELUA 2ZSUA 3LKZA 3LECA 3E23A 3KR9A 4GC9A 2BM8A 2PVCA 4MQ4A 5GOZA 2CMGA 1L3BA 3GRRA 4X41A 3PS9A 3VC1A 3KQYA 2IDKA 4P7FA 2Y1XA 4WVLA 2BR4A 3ER9A 1INLA 3ANXA 2P3OA 4P7JA 2IPXA 2HNKA 3U81A 2C7RA 5K0FA 2EG5A 2YTZA 2ZZMA 3NVKI 5JR3A 3M6VA 1FP2A 1WXWA 4C08A 1ORHA 4X61A 4HC4A 3O7WA 3GRVA 2UYCA 1XXLA 1ZG3A 3OZRA 3G89A 4IWNA 5CVEA 2F8LA 4DCGA 3HA7A 3ID6C 1JQDA 1KXZA 4KIFA 4FT4A 1SUIA 5GP1A 5K0BA 2HTEA 5CVUA 3ER8A 2EJUA 5KQRA 4OQDA 2YR0A 3UJDA 2ZIFA 5E9QA 4KIGA 4AUKA 1VP3A 5DM4A 5FWAA 2O07A 3RW9A 4YUXA 1KPIA 3MQ2A 4PGHA 3PVCA 5K0LA 3T7RA 4EK9A 2FPOA 5JUWA 3FPGA 3KU1A 4PINA 5FA5A 5MHTA 2ZTHA 2CMHA 2NP6A 10MHA 3LBFA 2IH4A 2Z6QA 3UJ6A 4ER5A 2JH9A 3G2QA 5DSTA 2EFJA 2G1PA 3T7TA 3NMUF 3TPZA 3ELYA 3KQQA 1EIZA 4RWZA 4AX8A 2IDJA 3CCFA 4C07A 3BXOA 3FRHA 3REOA 3P8ZA 2ZFUA 4GOND 1RI2A 1AQIA 2AOVA 3PFGA 3TRKA 1AV6A 4YMGA 1L1EA 1N7IA 2QRVB 5T64A 4PCAA 4E32A 3UJ8A 4F84A 3EVCA 3TKAA 1DUSA 1Z3CA 4RVGA 5DM2A 3DMGA 5FHRA 1EJ0A 5U4XA 5FHQA 4YV2A 3FUTA 1M0EA 3GIWA 4XUCA 2XYQA 3A26A 1KYZA 3DLCA 2NXCA 3TKYA 5DWQA 1YFLA 3MCTA 3RODA 1IY9A 1NE2A 1KPGA 2VDWA 3SSOA 2G70A 3KQPA 2O05A 1XVAA 1WZNA 2H00A 2ZZKA 3BGIA 2ZIGA 2VS1A 3EEYA 2PT6A 4RVHA 4DF3A 1O54A 3EEOA 5C0OE 2QRVA 4JXJA 2GAFA 4EVIA 4FSDA 2ONZA 4CKEA 3E05A 1JR4A 3DUWA 3VC2A 5LQKA 3HVIA 4ER3A 4CWAA 2CKDA 1KR5A 1V39A 1L3CA 4A6DA 1HMYA 5EEHA 2YX1A 3R6TA 1YB2A 1KHHA 4OA5A 3MGGA 2IIPA 5HIIA 1X1CA 1YZHA 4HH4A 3EGIA 4QVGA 4X1OA 2PXXA 3LCVB 2ADMA 4FSXA 3TLJA 3UJAA 1VPTA 3KQOA 1SVUA 3MAGA 3HCEA 4RTPA 1G6Q1 1AF7A 2OYRA 3FPJA 3LL7A 2P7HA 3TFWA 1RI4A 3SGLA 2O0LA 3R0QA 5K0NA 4F85A 1FBNA 3DXZA 3R3HA 4MTLA 1XCJA 5DRTA 3A7EA 5GM2A 3Q7EA 3TMAA 3V8VA 1TPYA 3CVOA 4RTJA 1VE3A 2YXEA 1EG2A 2ESRA 3LCCA 1JSZA 4HTFB 1N7JA 1P1CA 2CL5A 1KYWA 2AOUB 1WG8A 2GH1A 1M6YA 4QPNA 1ZQ9A 2HWKA 2OB2A 2QY6A 2ORED 3ELWA 3I9FA 5EPEA 4E2XA 3GU3A 2BH2A 1TW3A 4RV9A 3OFKA 2PSSA 1Q0SA 3K6RA 4HG2A 5E1OA 2DPMA 3EGEA 1JSXA 2WA2A 4Z2YA 3KR1A 4M38A 4E33A 2IBTA 3O4FA 1BC5A 5KVAA 1XDUA 5T6BA 4RTRA 5EMKA 5GWXA 3FRIA 1XJ5A 4QTTB 5FWDA 7MHTA 2P3LA 3CBGA 5ICFA 3G2MA 2G72A 1MHTA 4PYLA 5EIWA 2H1RA 4HTFA 2G8NA 4HGYA 4U7TB 5K09A 2AOUA 5GIOE 1YZ3A 3DMFA 4HGZA 1I9GA 3DXYA 3FYDA 2ZCJA 5LQAA 2PLWA 2WK1A 1P91A 2OPBA 3V97A 1YUBA 3VYWA 3FPFA 3MERA 4PIPA 1TW2A 1NV9A 1ZKDA 2UYQA 3CJTA 3ELDA 3EVGA 3JWJA 4G56A 4Y2HA 5E8JA 3KPWA 5EKUA 4OA8A 1L3IA 3P2KA 2XYRA 4PCLA 1NW5A 2GA9A 1O9HA 2NXEA 3JWHA 4X63A 3G2PA 2JHPA 5CCXA 2DULA 2ONYA 2PV0A 5EVJA 5G02A 3TQSA 5K0GA 1ZHFA 3M6XA 3R24A 1RJFA 4KRGA 4PYNA 3HCCA 2IH5A 2PXAA 1L9KA 3B3GA 3G5TA 2ZLBA 3E8SA 3BT7A 3G88A 3IEIA 1QAQA 2ZBPA 3M70A 1YF3A 2PWPA 2K4MA 3NJRA 3T0IA 3UA4A 2ZVJA 3UJCA 4E2WA 4LG1A 4F86A 1RI5A 4FGZA 1D2GA 3NDIA 2JJQA 3BWMA 4QTUB 1G8SA 3EPPA 4KVZA 2HV9A 3B3FA 4YUVA 5HFJA 3B5IA 5CCBA 3BWBA 3BGDA 3P71T 3HCAA 2A14A 1VLMA 1UFKA
chains in the Genus database with same CATH superfamily
1XZIA 1E18A 1BH6A 1C3VA 4PSUA 3FNIA 4UMFA 1ZAKA 1QHGA 1Z47A 3HNPA 2ST1A 3RK0A 3A2LA 3LO8A 3CLSC 2C4UA 3OE1A 1MB0A 2B2NA 5EIBD 2G5TA 5IU6A 1S4QA 4ZV4A 4OHPA 5LOVA 1YJBA 1WW8A 2GZMA 4CDMA 4GL4A 5JBQA 1M10A 3OJFA 5A4MS 3OFNA 3SF8B 3L1UA 3MOGA 1MG0A 4K88A 4MROA 4UC0A 2N0SA 4ZKEA 2D1TA 3D6AA 1XZHA 3LK7A 2V1UA 4TVBA 1O6GA 2WFZA 3JD1A 5KIAA 1WLSA 3QKSA 2ATIA 4KACA 4B5LA 4O4LB 3TSWA 3I52A 4TLLB 4TWJA 3ZFUA 3QKUA 2HX1A 3IUNA 4CLDA 1IU9A 1FX1A 1UMDA 4M55A 3Q3VA 5FAXA 2IKSA 4MS4A 4CKBA 2Q3BA 4IHAA 1M33A 2VHUA 2OLKA 1TO2E 4HB4A 1FFBA 1PHPA 2RHOA 4Q16A 1C3OA 2ODQA 4JEIA 4XOUA 3LXUX 4KW7A 4BMZA 1YZQA 1DOAA 1SA0B 1GQSA 2WYUA 4WCFB 1JZTA 1H2AS 1U3TA 1GTSA 4N76A 5CMLA 2GUWA 2JGFA 4J75A 4HLCA 4OK5A 4CUZA 5AVSA 3G79A 5CLHA 4H4DA 1KJZA 5CP8A 2OBFA 1GUFA 4FMCB 2ZUWA 2HWUA 4UJ3A 4K0KB 1RXSA 4F9TA 3T06B 4R1TA 1WEKA 2VBIA 3AERB 1W8DA 1FB5A 4EHBA 2PWBA 1BDMA 3PCTA 1QPBA 1R4MB 1VPDA 1P4AA 4UHBA 5JAPA 4NE7A 2CVHA 2BV3A 3BRWD 4ZCQA 2A94A 1PFQA 2GETA 3OVMA 1IXZA 2IU4A 4XZ3A 3DMTC 4MW9A 4CM3A 4H1VA 4PSAA 1SJ9A 2OZLB 4B6FA 4H16A 3IYLW 5KNDD 4EY3A 5NLLA 1X7HA 4HEQA 1NYLA 4UCXA 3BWCA 3D3QA 4QQNA 3C5CA 3N6RA 1EDDA 4IGEA 3R3VA 4Q9AA 2QT9A 1TAQA 3GA7A 3IO3A 4M36A 2VXBA 5G41A 3EVBA 4MVJE 2CNOA 2WJIA 3RBZA 1CPYA 3LC1O 2GO7A 2XWJI 4D80A 1C41A 3DP9A 3G2LA 1ZH2A 2I3BA 4JP2A 3RI3A 2WZDA 2W6NA 1AQ6A 4OXRA 2ANCA 3B1KA 4OYHA 3WL7A 1JQBA 3DE6X 3KOZA 4Q1AA 3P0FA 4RD4A 1DHTA 1JKMA 2G88A 3GN2A 4F3KA 1UPCA 3U44B 1U99A 4NEHB 5J23A 1HQCA 1V5IA 4LHXA 1PU2A 4J6EA 3OPYA 2RGNA 1KE1A 1JMVA 3C3JA 5JI2E 1G16A 4FDMA 2ZK7A 3EH2A 1BCRA 3RS3A 3LQ4A 1NXOA 1O5OA 5ALYA 2P1DA 2OMKA 3A3PA 5BN4A 1JQ3A 1L5WA 3I2YX 1WIWA 1MC1A 3QG1A 1KAMA 4IIBA 3SX0A 1U1CA 2PMCA 1I7PA 1U0BB 1E2PA 3QJGA 4KQ1A 4Z3DA 1GUAA 5LZ5A 4B3HA 1OLXB 1UQUA 3LPCA 5EJGA 2BBTA 1W5FA 4FT2A 1V5GA 2WKPA 2ZRKA 4FYHA 4RVNA 2XLBA 2EFCB 5EZ6B 5AVTA 2V6GA 3K0BA 3KVYA 3TM4A 3VR6D 2VF4X 4AXXA 3ZCUA 2Z1MA 4CGZA 1D8TA 3FKQA 5SY9A 3STUA 3GBVA 1T6YA 1ZISA 1KY3A 1Z5PA 4KDEA 4KQHA 3Q12A 1IXRC 2JIQA 1J8DA 4G0ZA 1I4EB 4PYMA 1JIJA 2H4YA 3PLRA 2JGDB 4JYBA 3UUEA 1RCTE 2ZYUX 1JTFA 3ANTA 3KETA 3FTEA 1GPJA 3SMVA 3OECA 4F1KA 1JXOA 1QXSA 3OEYA 3GJRA 4KQGA 5KX5B 4Z53A 1W1WA 1A71A 2ZRDA 3AKDA 5L7TA 3FNBA 1ZUIA 4GUDA 2C99A 2Z8YA 5CVVA 2SICE 3M83A 3VHQA 1DEHA 3FTCA 4INPA 4E0BA 2J3EA 4DMRA 3B1XA 1PEDA 2HHJA 3KOYA 4H60A 5D5QA 4F1WA 4EVQA 4AJ9A 5B58T 2ZRMA 2I2BA 1OI3A 2CEAA 3KKNA 4MMXB 4BO7A 2QGZA 3A25A 1T1SA 5JS8A 3U5ZB 1MHPA 4GXTA 5E2BA 2W2LD 1NP7A 3G0IA 4B76A 5KU1A 5JHGB 5EZYA 4E5MA 3HVHA 4DPKA 4P86A 3NTOA 2XQFA 3U62A 1CNMA 4X60A 4DR3B 1A9OA 1ES9A 1L4BA 3GIDA 5IK2A 4C14A 4D3SA 1SVOA 2W0SA 3IDSA 1E2IA 2QL7A 3CN9A 3EPRA 3M4YA 4JZYA 4LISA 5H9WA 2B92A 4UARA 2HA4A 4O2AB 5IVIA 5HTKA 3TOVA 5FWYA 3RS9A 3ZDDA 1QV6A 3P9KA 1D2NA 2J3MA 2FEMA 2XUIA 2H4FA 4ARSA 4IX9A 3HV0A 3AY0A 3LYAA 2OBMA 5CLIA 3FPSA 5CK5A 2WD7B 1Y7HA 4UZEA 2WM8A 3X2EA 3CEMA 3W5DA 4YDRA 1R2QA 1DL5A 4NJMB 4ND8B 2FDRA 5JWHA 1DTEA 1OJLA 2BTQB 1JI0A 4H15A 4GNRA 1RAEA 3HZHA 4RYLA 3ABOB 1WZEA 2ILVA 5E9WA 2Y27A 4KSYA 4M9RA 5GJCA 1C0LA 4DZRA 1L5MA 3RYCB 3DUFB 1NLUA 1IQPA 1B0PA 3I5YA 1SBIA 3H2SA 3PZRA 5EZYF 3B1FA 1OV6A 2C4MA 4CIVA 1CU1A 1UADA 1XCLA 3VKVA 2WYWA 3C7DB 4J8PA 2NIPA 3SZGA 1NHWA 1J21A 2RHHA 3TDKA 3AY7A 2YMMA 3R4CA 3QPUA 2FRVA 5JLAA 4KE7A 1ONOA 2R2GA 3H3JA 3OF3A 4E22A 1T1JA 1DWOA 3IDAA 2XITA 2GCOA 2I6TA 1SKBA 2JFHA 2W93A 3NBAA 3DVLA 3FGZA 3OEED 3C48A 4GNKA 4PLHA 3SXPA 4UVIA 3PXCX 3BWYA 3USCS 2X4IA 4FBGA 3WGUA 1EHYA 1PV2A 1WD7A 2O6HA 4JB0A 4EITA 2QZPA 1WUTA 2MSDB 5B1EA 1RADA 1U9IC 3OBBA 1ZMBA 3RO7A 1G41A 2QLTA 1HM5A 1YZYA 2AN9A 2QXTA 1W2HA 3E5RA 2VUHB 3H99A 3WL3A 1KQGA 5AJVB 3SEFA 1HETA 2JIZD 5J2TA 3N87A 2ID9A 4ZI3A 2R6DA 3Q7RA 1ZJJA 1RE0A 2QRJA 1PLKA 5E3HA 5AJWA 4PXSA 3LXXA 2HBZA 1HSOA 3UJ3X 1JIXA 1KZ6A 4QAJA 1SHJA 3GRKA 2C61A 4BB9A 2FN7A 3MC1A 5KPDA 5F7XA 1R6TA 1Z6GA 1Y5RA 1TMOA 2Y66A 3K20A 2DAPA 2FVXA 1HQDA 1DARA 4I4CA 2F4VB 4R68A 1ZA2A 1GQYA 4E15A 5F98A 1TA4A 3EARA 5BP7A 3M4ZA 4XOIA 4M1WA 5HW0A 2IITA 2OXCA 3RSLA 4A7PA 3I1IA 5J1TB 1IWPB 5AVVA 3BAZA 4G07A 4RU1A 4LGMA 3X1KA 1E62A 1F3OA 2P75A 1GQ2A 1ZD2P 2QVXX 1X70A 2VHYA 2R7MA 3JD2A 3P9IA 4HLNA 4ND3A 4QBFA 3F71A 3P2EA 4ZWNA 3Q72A 5A7HA 1QNLA 5J2TF 1RLOA 2I1LA 1N8SA 3D3WB 3LOUA 3AEUA 4KTVE 3FPKA 4OU4A 4MUJA 2JAXA 2PEYA 3K7EA 5F73A 1O5TA 2DLDA 3WGMA 3QFCA 1JA9A 2HDNB 1KZHA 2AOTB 3KPUA 3T5TA 3SLRA 3SS9X 1E9VA 3ZWAA 2RGEA 1LK5A 2J0UA 4ITRC 5BNZA 4YN3A 1QYWA 4EO7A 3VAYA 3HU3A 3JATA 4XWAA 4MWSA 4TLMB 3ZFNA 1FEZA 4NH0A 1EQ2A 1E4VA 1OSNA 4QDTA 3TTUA 1C1DA 2Q1XA 1RQ7A 2K87A 1ZGJA 2RHRA 1SIWA 2Q62A 4L27A 3WRXA 4AN4A 3KEGA 4DNQA 1VC2A 2COEA 4NZYA 2XMSA 5IS2A 4RTLA 2QAIA 4DM3A 1JAIA 2XRYA 4M9SA 3ZKAA 4W5OA 1QGED 3OA2A 3EOZA 3ZTTA 2X41A 1A8IA 3JZAA 3HJNA 2XHZA 3TSAA 2FNAA 2REQA 3AESB 4UNNA 5TPZA 3PZBA 5LQJA 2FCRA 5JNWA 1BFKA 3ANNA 4IJ6A 3PXXA 3PT9A 4OH7A 3F8TA 4D9BA 4G5OA 2VHQA 4XCXA 5M29A 1C29B 4W1PA 4YBRA 2KYRA 2C31A 1K7SN 5A4IS 3ELUA 3QOYA 3D2CA 2CXTA 5JDCC 4WERA 1P4JA 1MR3F 2CLHB 3A4MA 1FNMA 3DONA 3LECA 3KX2A 1RR6A 1BFUA 2EZ4A 3NX4A 2WEKA 3GRCA 4MW7A 3N28A 2IU0A 4TXHA 2FJUA 4IIEA 4M98A 4LOJA 4PSCA 1CUVA 4HYTA 3ZWMA 2FFQA 1KI9A 1UBCA 4WVLA 3NPAA 4DGSA 1TPZA 1E61A 3BIJA 1H2ZA 3IVXA 3L7CA 2IYEA 2PGLA 3LDHA 3VZDA 2HNKA 1XLTC 1XK7A 4QXMA 3WGZA 5K0FA 2C7RA 1NNI1 2NO7A 1E1CB 1YZFA 4AS3A 2XV1A 1QFMA 3WB2A 1WNTA 2MSKA 4D2IA 1KI8A 3LUJA 3ETJA 3U5TA 1PLLA 1SKYE 2XBUA 2X77A 4Y2GA 2BBWA 1L7BA 1E94E 3A9RA 1RHQA 3RJTA 3TQIA 1LBTA 3R44A 3ZWWA 1JI3A 3CVXA 1YOVB 2XT6A 1GNRA 1OE0A 5KQRA 4XLTA 1TJ4A 4MR8A 4D3ZA 1MO2A 4GI2A 4TX1A 3HKBB 4H3VA 3RRFA 1SO8A 3MF4A 1QQ5A 1Y48E 3KVNA 3K9HA 2BN4A 5I48A 4HH1A 1ZIPA 3Q3HA 4G5HA 3KU1A 2AMYA 2AJBA 2ZTHA 3IJRA 1LLDA 1QQ7A 2H1SA 2QAGA 3C8MA 5LKAA 2BBOA 5HUHA 1QVZA 4QYTA 2GRAA 4TL9A 4TS3A 1EUYA 2FW9A 3ELYA 1KEVA 1LBEA 3DDWA 3P20A 4OD0A 4H77A 5IKPA 4LXGA 2HFKA 4C07A 2Q1WA 4LSWA 2IYAA 2WTMA 4L8WB 4QOHA 5I7HA 3LIPA 4NYJR 2NZ8A 5F78A 2ZU6A 1P1IA 4JOQA 1N7IA 5J40A 1LTKA 3QU5A 3VC7A 5I9NA 3V8PA 4FNOA 3UMMA 1ZD4A 2OXIA 3FI9A 2BFCB 2ZSHA 1D4OA 4UTXA 2AMVA 2ZCUA 3SFTA 1C2YA 4BNFA 1OXKB 1O8CA 2B69A 2J6HA 3PEUA 4NVRA 3SHVA 5EIBC 5GIPE 4HVCA 1M0EA 3NRCA 3DLCA 1M66A 1K63A 3FDXA 2G3YA 5CB0A 1YAHA 3AFGA 1NI4A 4GDMA 3H2HA 1IBLB 5C5IA 1X86B 3AYZB 2VLBA 1ZOIA 3KQPA 4HDSA 4CM7A 3GEIA 5MF6A 1B8VA 2CJFA 3CH6A 1RRFA 1H2RS 2PT6A 3B1WA 4HGOA 3T3PB 4KQFA 3GZ4A 2I29A 2ZSEA 5EAIA 4IHQA 5AW2A 4LI0A 1AHHA 4IH9A 2GAFA 5IUKC 3HNOA 5HGJA 3EPJA 2BGMA 5HK8A 2MSEB 2R6JA 5H9VA 3WAKA 2CKDA 3P9YA 3PCRB 3RUEA 3NS7A 3I4CA 4KXMA 1H4QA 3CUVA 2ZYGA 3TLJA 5KI6A 3W4KA 4JCOA 4E46A 2JIRA 2CYCA 2FW0A 3DE1X 1B6TA 3IFSA 2WNSA 1UDRA 1Q6ZA 5H4GA 2OYRA 3G5UA 3MUOA 1CUGA 4U8HA 5TDHA 4MI1A 3LY7A 2WWHA 5K0SA 4RANA 4RMGA 1BVRA 2NU6A 1UM9A 2OD7A 3BG5A 3FNGA 1TM7E 3LM8A 3M6IA 4WNYA 4Z6KA 1F60A 4KGDA 2XUOA 4KXFB 3VTKA 4D6YA 1WBDA 3H1GA 1E3WB 4QPNA 1RM0A 1Z4LA 4O4HF 3F6YA 5CDSA 2YASA 2ZI9A 3L3BA 1BXKA 3DD1A 3U61B 2O2ZA 3EGEA 3A1WA 3PGKA 4L85A 1TLTA 2VEDA 5KVAA 2FZ5A 5FWDA 3M34A 4JI3B 2PKEA 5FOXA 3CBGA 1KKMA 4P82A 3R5HA 2EX0A 1UEIA 3DTVD 5LWHA 3TI7A 2F1HA 3R5XA 3MT9A 2PMEA 4AQ7A 5EIWA 3AINA 3MWEB 3TJRA 2O54A 3MCVA 3HXQA 4M1EA 2O2SA 5DMXA 3DXYA 3J7AC 3AHEA 3DOEA 4PZPA 1YFZA 1G63A 2WMOB 3FHCB 3MQFA 5I9LA 2VSOA 1JFLA 2OFOA 5REQB 4DY6A 3S1SA 2EWWA 4M7OA 1PSZA 3SQDA 4Y2HA 4CVNA 5CB6A 1N9KA 2BFBB 4ZQHA 4KR7A 3KSUA 5FYQA 3WMWA 5BN5A 3DLTA 1BQEA 4X65B 6REQA 3EZ2A 2RIPA 3ROGA 4B6SA 4RD0A 5CCXA 4BKUA 1E1QD 3FMPB 2VQSA 3TQSA 4JQCA 4UXJA 5K0GA 2A5FA 3ZLUA 4XRGA 3FDFA 3EXEB 4RKQA 5H59A 1Z62A 1Z4NA 4MP8A 4PYNA 4W5WA 4BV8A 4P0PB 2A9PA 2XUGA 4N3AA 1OB5A 1IHXA 1L9KA 1RIIA 3E8SA 1KJNA 3BHNA 1IJEA 2ZM6B 3PLNA 3QH4A 4I5GA 1HT0A 4FYWA 1E4YA 1BVYF 3E9NA 1IM2A 4JXXA 1GGMA 1HUQA 4FYKA 5EJMA 1A8UA 4MGKR 4RD2A 5JLJA 4IXWA 3ZZMA 3P26A 1QX3A 1MNQA 4RZUA 2X9LA 2GYVA 2Y0PA 3RVOA 2ZBDA 1ZGGA 2F3SA 4WK2B 4HDQB 3GEGA 1XCBA 3WGNA 3HSYA 2ZB2A 4C89A 1NXVA 1Z29A 2FFAA 3F78A 1DAFA 1ISFA 1F2TA 4R83A 1KEUA 5LQSA 1HA3A 4BDTA 3PNYA 1TMKA 1R3UA 3QEBZ 1LPOA 1EX6A 2BSAA 2WNHA 3B3QA 3OZFA 1CFJA 3EQZA 3GDFA 2NU8A 4ALLA 1C8KA 2YIVX 1WQ1R 1ZY2A 4FUTA 2VRCD 4YREA 1DX9A 3MRXA 4ZDJA 2TECE 5IYZB 1PW5A 2YHIA 1FJHA 4YCSA 3KLNA 1V1MA 1OV4A 4KAFA 4ESOA 1QVVA 2C2WA 2XKKA 3QUAA 3DNPA 4WK4B 1JA0A 3SZRA 2EP8A 4DCOA 4NR0A 3V1LA 2CT8A 1XL1A 2IDZA 4OFWA 2MSLA 2D8AA 3IMKA 1F1BA 5HZHA 4G0UA 3C6XA 1SG6A 2N47A 2P9HA 3HWX1 3JQPA 5CDUA 1A1SA 2HPVA 2Q1UA 3MJRA 5GV8A 4MW6A 1RXVA 1XZDA 4ND1A 5HOQA 1EK6A 4C04A 4G63A 2HMSA 1QSGA 3PGMA 1EUQA 1OTHA 3L8YA 4NYIR 3VBEA 3UT6A 1RLIA 1Q11A 2OCIA 2G6BA 3DYBA 2J87A 3FPCA 4KMMA 4NJEB 4PCVA 4Z7OB 4IV0A 1ZH8A 1MTZA 2BGRA 2GS9A 4M1TA 2PCJA 4TS9A 4W5TA 5HUQA 1SRQA 2ZS8A 3FDIA 4KWHA 3IGFA 1ZM2A 2IGTA 4WESB 2H63A 5EIEA 1E0KA 1GEGA 1X9HA 4MUIA 5DGTA 5AM5A 4D6XA 2AZXA 2PQ2A 3CX3A 3DS8A 4OFXA 1Q1EA 1MP0A 4MIKA 4Q4HA 1XKXA 2PGXA 2UZ1A 4RK4A 1T24A 4I7EA 2PL3A 4URHA 4C4YA 4Z9BA 4R6XA 1FVOA 2C8KA 4FQ8A 5JAZA 4GT1A 4A0FA 1S8OA 4AROA 2XVXA 1N6LA 2PX2A 3ITEA 2YZ2A 4JLVA 4RXTA 4MGYR 4YP1A 3NXKA 3QVWA 4HQ6A 4B6EA 4C6HA 2C00A 2B1GA 3Q8WA 4V1CI 4RJKA 1QK4A 1S2IA 1NJ8A 4M83A 5KTTA 4H1TA 1BN6A 1DJLA 1E4OA 1LSSA 2D1YA 1L2TA 3PB3A 4H2DA 4QA9A 1H23A 4KN5A 4YLYA 3P0IA 4BLSA 3TQHA 3S5UA 1NVUQ 1BXZA 2HB6A 3D7SA 4YJGB 5J2UA 4FWTA 2Z1DA 1SK9A 5AT1A 3U9LA 2QL6A 3M6AA 5IBRA 5A5VA 3EAFA 4PZCA 2X9QA 4MR9B 3NT5A 2BKVA 2X5XA 2QSJA 4OQYA 1N2XA 3WL6A 1GAQA 1LLUA 3ZDFA 3DBRA 4DCPA 1I3MA 2X5OA 4RORA 3DO5A 4KHZA 2Y1KA 3DGEC 3FIUA 3SC2A 4DABA 1Z08A 1PUIA 5KREA 1FMJA 2AKEA 1HO3A 2I8AA 1WRBA 3T1VA 2GA8A 3OPXA 4CEHA 1P17A 4Y2YA 3SK0A 3EVEA 3T3OA 2QEQA 2JJYA 2Q3FA 4CEIA 1UOQA 1ZXBA 1ICEA 3ESRA 3R3ZA 1C9KA 2OZVA 1XD8A 2KJQA 2W83A 4OKIA 1QRRA 3KJZA 4URVR 2V0GA 4RO0A 1TCCA 5A5FA 3HUMA 2XUDA 5J2UF 2O2JA 5D51S 4YR9A 1FBTA 2Y93A 3D64A 4XPIB 3HDJA 1X7DA 5DP2A 4RD1A 3RS8A 1ID8A 4URWR 4NXMB 3F96A 1E98A 3DFUA 1HF3A 1EMDA 3O03A 3WK9A 1X7YB 1CUEA 1GL3A 3OIUA 3HH8A 4N5DA 4NHEA 5DTRA 4MVXA 3H9BA 4ARZA 4WCDA 2W90A 3LT5A 3SYTA 4CF3A 3U7JA 1QO7A 4JYCA 4OHUA 3T4PA 4Z0HO 3NHSA 1PQPA 2GAAA 1FQOA 2X2EA 2Q5JA 5JSKA 3RYIA 1XEFA 4ENPA 4YUYA 3FKSA 1X42A 1X80A 4IEIA 1P73A 3FMIA 3HCRA 2K5UA 2XZLA 2ZYWX 1ZNQO 3OIFA 4MP6A 2CXXA 5C1OA 5C7YA 1RXIA 3VU0A 4DV7B 5JYBA 1FIUA 3ER6A 2J4FA 2FTKE 2B4AA 1XZKA 2XTNA 4EELA 4MKRA 3OOHA 3SVLA 3NTRA 4FX5A 4EX7A 2BRUA 2DFNA 3UF0A 4CKYA 4TTVA 2GFQA 3D4LA 3WJ2A 3SP1A 2I1VB 5ELLA 3I01A 2IELA 3MMPA 3ILVA 3V6LA 2I9KA 1I4DD 4I9GA 1KJWA 5DNEA 2GD6A 3RC8A 2HCTA 3DULA 1FSSA 2UZ3A 1L4LA 1JDBC 3C8UA 3T7EA 2GD2A 2NUPB 2VYND 1NONA 2RARA 2ZIEA 4QVKA 2JPDA 3I5XA 4Q9LA 3CW8X 1EEXB 2NQ8A 4KEAA 5ERGB 4QGSA 4LI3X 9LDTA 3EVAA 4JBWA 3QKIA 5HIMA 1X1AA 2NN3C 1B93A 4CR7A 5EGNA 4EY6A 1RRVA 1FP1D 5CRIA 5DHTA 5ITWA 2P2YA 4F60A 3C15C 2FQWA 1HMPA 2GZRA 3BILA 3D81A 4HQOA 5DHRA 1YQUA 2Z8YM 3PA8A 3RE1A 3QUTA 4LGVA 4ICIA 1UINA 2VRBA 4U1RA 4X3CA 5BT8A 4IYRA 4BDSA 3HGMA 1SNYA 2WUWE 2XEXA 4HFRA 3QFHA 2CL7X 2JHGA 5EHXA 3GLFB 4Z9AA 3K94A 4UHKA 1AHIA 2HF7A 1BE6A 2F43A 3H2JA 1J06A 2ONCA 4X24A 4L2IB 3S6JA 1KYIA 4JNCA 3AZOA 4B17A 3EODA 1V8FA 1NUTA 2G6TA 3OJCA 4E12A 1FYXA 1GA1A 2E4XA 4CNQA 1A04A 3BK7A 2P90A 3OJLA 2ECQA 3ZXXA 1Z2DA 2GZ3A 3RU7A 4ZEMA 3NUQA 1U2TA 2H1HA 3SYRA 1FLNA 4K3UA 1M67A 5KSWB 3K73O 2JLZA 1FFXA 4WLUA 2J6IA 3WKEA 3MB8A 5K6AC 2BBSA 3AV3A 1KJ9A 4RVUA 3I09A 3ON5A 3N2IA 1EFHA 3T0GA 5KVQA 3QLVC 4BRWA 3CZ5A 3ZU2A 2QX6A 4G8DA 4K9QA 5FULA 1Y1PA 5AVWA 2JARA 1A4RA 3FBGA 4NKRA 4NMMA 2ZBQA 2OV2A 4OGGA 3I2KA 2CXOA 4PYJA 1I3LA 4MA4A 1TX4B 1PJRA 1ZUD1 3UKDA 2QY9A 4ARIA 2WF8A 1EX9A 2DLNA 3GGPA 5IDVA 3R7LA 1PQWA 4ER0A 4XVUA 3H1FA 2JRLA 2R11A 3DKKA 4Q1DA 2P65A 3TCKA 2OVFA 3WV4A 3I5AA 3RIMA 4IIUA 2XAAA 3NO4A 3V3KA 1H05A 2QE7D 1EKXA 1M5UA 2W6CX 2BSQA 4UZSA 5H81A 4DEYA 5ITSA 3CLVA 3UG7A 4LZOA 1KP2A 3DYVA 1WXHA 2DOKA 4CG0A 1W34A 3NHUA 4RD6A 3PFNA 5DYTA 1XTVA 1Y3BE 3ET5A 3UAOA 5DWVA 2VQFB 1ZDMA 2G5GX 5ECDA 3UT5B 4JQZA 3E22B 2A9RA 2IP1A 4Z3KA 4U39A 3EWIA 2NPFA 3LYHA 4L02A 2FK7A 3QPAA 2ZBFA 3LLSA 1GARA 2R79A 5KNCA 1F7UA 2H2HA 2Q2OA 4NBRA 1N5DA 2HSWA 1VZ2A 4RIFA 1XP5A 2AMFA 4FKBA 1P0MA 3K1AA 4JC0A 5E2AA 3UMSA 1QNFA 4WXHA 3LCUA 1K97A 4E3ZA 3O83A 4BP1A 3OLVA 1XQ1A 2VYVA 3SC4A 4ZQFA 4DIFA 1VI2A 3ZK9A 2RHGB 3UH0A 4WQMA 3KOUA 4R54A 2Y1OA 5A0TA 5C8VA 1E2GA 1F6BA 3F6EX 3OU6A 3VAZA 4MCAA 2IY7A 1L7DA 1ITZA 3F1LA 2PX4A 3REQA 5KNCH 4BGVA 6NULA 4Q01A 4TT3A 3HRHA 4RADA 2OHGA 2RJOA 3OE5A 3S99A 1YBAA 1W49A 2HLNA 3NHPA 3DE3X 4QFCA 5B3JC 1P61B 4TRNA 1W47A 1RYFA 2PV7A 2GTPA 3TLGA 1AY0A 2KBEA 1VI6A 4FZJA 4QXQA 4RMHA 2QR3A 3OCCA 5BWLA 1ZZGA 3TR0A 3T7SA 5JYEA 3I04M 1S9HA 4ZD6A 3DM5A 2QJRA 1HFJA 3FCUB 4N82A 1Z0DA 2Q9CA 2PQ0A 4Y0NA 3WIVA 2ATXA 3GGGA 3UK0A 5EJAA 4F56A 1N75A 1W87A 2JI9A 4YP6A 5K4AA 4OQPA 4B0OA 3VC1A 5IASA 1YJ8A 4D02A 3GJ6A 1RTKA 3A4NA 4X1IA 3TIXB 3UV3A 2JI4A 3GXBA 3PSHA 4GECA 1K6MA 2B98A 3HWSA 3U7EB 5EUMA 3IBTA 3W4JA 1WDTA 5JDIA 2DXIA 2PNFA 5J4HA 3L1JA 4B46A 5CM9C 2XQGA 2UXBB 2HWWA 5EJ9A 1XEAA 4QTZA 3GFRA 3A6ZA 1OX6A 1KNQA 4M22A 1GGNA 4Q02A 2O59A 4KC0A 1CRWG 4NFSA 4F5YA 5L7WA 1AT1A 3QJYA 5AXBA 1UC8A 1VDMA 1K68A 3AUSA 2VTEA 2R7KA 1N9GB 4L6AA 2GI4A 5KCZA 1W2GA 2PL1A 2DHCA 3K4HA 3PWSA 3WRVA 3CNBA 5CPFA 1E0AA 1DB3A 1THTA 2HU2A 9ABPA 1DXYA 1N5IA 3L7IA 1OPRA 3QXSA 4YQEA 1G8MA 1CHDA 3AVUA 3W2IA 3JZDA 1XRQA 1FY2A 2CHQA 4CKZA 3KSDO 1KE2A 3ZHUA 1XB2A 4C2BA 4LHZA 2IY8A 1ZM7A 2JFNA 1IG3A 2P6MA 1ZS9A 4EEXA 4IDDA 1IZ8A 3SDSA 4XVQA 3CZCA 4Y2QA 1NVBA 5E6UA 1IUNA 1CY6A 3MGBA 1JHYA 3BJMA 3UJ6A 5AJTA 2IY9A 4D8YA 2H2IA 4YMTA 1ATIA 3NHBA 5IJWA 4QEKA 4Y2VA 1EIZA 1F2UA 4J3NA 3QF4B 3BMXA 4OXXA 4WJZA 4M0CA 3CYFA 4YXFA 4RE6A 1A8PA 4RV4A 2UXCB 4LF5B 2DVMA 3IB6A 1MIHA 3IMGA 3IT2A 1Z4IA 4IHJB 4O0MA 3EDRA 3RVDA 2FWNA 3RAGA 1G2QA 2AFIA 1WKCA 4S2UA 5DN9A 4F84A 2AG6A 3EAGA 2NXWA 3O91A 1DT3A 2YINC 4RFSA 5D3QA 2V4UA 3FUTA 5FHQA 4XUCA 1QF9A 3AHCA 1LQTA 3TLMA 3O3OB 3T54A 4DXDA 5G0TA 3BDIA 1CY7A 4ONEA 4PNEA 4OX9B 4MMYB 1MW9X 4GR9A 4A0HA 1NWHA 1K7FB 2O05A 5D5PA 3RNLA 2R4QA 3NCHA 5GV7A 5BV7A 2VS1A 1RQRA 1JVSA 3LA8A 5HJ7A 1OZAA 3SI7A 2QR2A 4WAUA 5C0OE 4I3HA 1MA0A 1Z68A 1KI4A 1ESEA 1VPEA 3ESCA 4MLCA 4US1R 4LJ4A 5KO2A 4MP3A 3CIOA 1WZ2A 5FUXA 4YFVA 3ZCTA 2ZAGA 4K2AA 5K8JB 2YX1A 3B8EA 4QXPA 3MGGA 2IXGA 2QTVB 3C3EA 3UHOA 3CRZA 4QQFA 3TSOA 5AHXA 1NW9B 5K7SA 4C3UA 2A9QA 4F72A 1XYYA 1PT7A 1U4NA 3E3NA 4KX3A 4U0KA 1M2VA 3DMDA 4V0ME 3VNSA 4BY9E 1JL3A 1XCJA 1KOLA 4Y2PA 2C2XA 2PR7A 1C0KA 1RYMA 3KVVA 4Q3NA 3RVLA 3IHKA 3CG0A 3VPHA 1JSZA 3ADKA 1FP7A 3CLKA 3ONDA 3BRQA 1H5UA 2CL5A 4FOPA 4H1UA 2WWVD 2XNJA 2INGX 3D3EA 2B4RO 3LRXA 4POAA 1TMYA 3WTCA 5KZMB 3DBIA 2XD9A 3K6RA 5KYYB 3R1IA 1N2JA 1KI1A 3WAJA 4YJHA 2PTHA 4L22A 3RSSA 1CKEA 3AF3A 4HDNB 5IKEA 2GEUA 5HSGA 1XJ5A 1UXOA 4J4HA 4KLRA 2P3LA 3G8YA 3HL4A 3SWWA 4ZP1A 1RAAA 2BHNA 5D3ZA 3WAGA 1GN8A 1U0OC 1K6XA 1GGHA 1W96A 3AR7A 4YAFA 4ZVKA 1GSAA 4MVJD 1XLTA 2AOUA 1YZ3A 4N4AA 4EKEA 3LGSA 3WP1B 3PUIA 5JFGA 5LQAA 1VYUA 2HBYA 3K71B 3EXG1 2HZ7A 1UBKS 2EBHX 3BM5A 3RUHA 4UBKA 2HD4A 3PI6A 5I4BA 4K6OA 4KV9A 1I7QB 2NVBA 4X1YB 4EARA 2XOEA 3JWHA 2O3QA 1HQYE 3RD5A 4XIJA 3ICQB 1YMUA 4INOA 3UPUA 2B1JA 4FMPA 4X1KA 5I7SA 3H5OA 1T2CA 3WWDA 4KLCA 3HUFA 4GD3Q 3T7KA 2IW3A 4MWDA 1Q1AA 5DDIP 1V9LA 4TSFD 4BMYA 3FTNA 3BFJA 3G88A 1V7QA 2G5CA 1P4SA 2ZAYA 4INZA 4B35A 3ZHSA 1N1GA 3L8MA 3SIPA 4BKRA 5DBIA 3W3ZB 3K2QA 3BXPA 5F64A 3MOSA 4CHTA 2W6JD 2WNIA 4QTUB 4KX5A 3D6UA 1DBIA 2FWPA 2VK8A 1H8HA 2ZTLA 4KVZA 4YAOA 3HCWA 3JALB 1OX4A 3M9WA 3TXYA 2UYYA 2G25A 2IZ5A 2P2GA 5IVDA 1PL7A 2V97A 4WZAE 1UFKA 3B48A 3QWHA 5KWJA 2A3RA 4IZIA 3NBYC 5AKEA 4X8MA 2V74B 2V98A 5EKXA 4ZVRA 3ZOZA 2VTVA 3AETB 4RHCA 1QV7A 1FTNA 2O06A 3QNUA 1P2TA 2EKQA 1FFDA 3ENKA 1KPHA 1VB5A 1DJQA 4QOSA 3LZDA 4EZIA 5LLSA 4RTSA 2D2EA 2C5GA 1QGUB 2H9IA 2SNIE 1YC5A 3LWDA 4TLDA 1ZN8A 1BU8A 2IWHA 4Z4FA 1QO0A 4WCVA 2ZYAA 1Q2UA 2KX7A 3A6JA 1FFSA 2RGAA 3JRNA 2O8BA 2B25A 3A0UA 1UJMA 3E84A 3UC5A 4NBSA 4WJLA 2PBFA 2GILA 1TZKA 2IUEA 3KJQA 4JSTA 4C7MA 4CZ2A 3T38A 3GMTA 1XPUA 2O8FB 2E4ZA 1TAHA 3DAOA 1GWNA 3K4PA 4FILA 3FUXA 4Q5IA 5EMLA 3QVTA 3LOQA 4O3MA 5HCUA 6LDHA 4XWOA 4GLBA 3TW0A 3RSZA 2P6NA 3WFZA 2VR1A 3I9KA 1NMEA 3DPIA 4C3OB 4F12A 2Z6AA 4AF8A 3JVUA 4BO6A 5HZGA 4PC6A 4FU0A 4RGBA 4ZXFA 4E5VA 2C0PA 3SNHA 5FAKA 3K9BA 3ICCA 2HBQA 1OYVA 3GJ0A 3VH3A 4J1SA 3SICE 4TN1A 3P19A 1MT3A 3E58A 4IZOA 3H2GA 1J1ZA 2IOFA 5DHFA 4CV1A 4DPLA 1HTTA 5JCZA 4OHXA 4UHJA 2RJ3A 2HN9A 2HQBA 5H70A 4P92A 3GFFA 3PRKE 1N6RA 3UC9A 5L45A 2AQKA 2CN1A 3NOOA 2BSXA 3KKLA 5EMMA 4CM9D 2ZEJA 4XR9A 5FUWA 2YWGA 1SBTA 4YRSA 2D7JA 2UUPA 3VR4H 1N2IA 5LMUB 1R8XA 3COWA 1OBFO 4HS9A 1E8DA 3ROZA 2BHRA 1C4OA 4AO6A 3NYQA 3QBDA 1OC2A 1FJXA 3HXLA 2FAXA 4DOMA 3LZCA 5GVRA 2GPWA 3QQPA 5JH7A 2I03A 3BRWA 4J29A 3TMYA 4DS3A 3TG8A 1HL3A 1Q5PA 3TGWA 3WVNA 1KSJA 1ZIDA 5B6JA 2RD2A 2GVZC 2YRXA 1R16A 3SU8A 2WYHA 4XLLA 1DUIA 3T35A 1T91A 2DKFA 1EFRD 2EATA 3W5VA 5KNDA 2FPIA 2YUIA 1FC0A 1BWSA 2I80A 4BVBA 1D4ZA 4D5GA 1E2JA 1TVCA 3FAZA 2KS6A 3HEAA 3JR7A 3QLJA 4QUAA 3VSCA 1JTEA 1M8PA 4WNAB 2VJPA 3H6GA 1M1NA 1DNPA 4RY0A 3ZR4B 1SHKA 1MDBA 3GUYA 3KT6A 2PYDA 1OREA 3FKJA 3LNTA 1JVBA 4ZK6A 2X5JO 4WKBA 3NETA 4HNAA 4F21A 4ZDIA 3P4YA 3KOXA 5KNDH 4RDHA 3FVVA 3RGGA 3UUFA 5JH7F 2O8EA 3W6ZA 4GM4A 1UBOS 1FRQA 4LJKA 3ZDXB 2WF9A 2GN0A 4QIHA 3C41J 4WPGA 5F9FA 1UDBA 1Z6YA 1GPUA 3FLMA 3IUBA 3NHLA 1NDHA 4MIEA 4NARA 3IHTA 5HF5A 1QGOA 3KOMA 1YGPA 3RTBA 3S1AA 3JQEA 3FMOB 4FMDF 3ZXYA 1C8VB 3O0TA 4UHFA 1P77A 1SEVA 4JEHA 1RWMA 2EERA 2PIDA 3ETDA 3Q85A 4L1KA 4OYYA 4QASA 4C7KA 2A5JA 4DN6A 2V3VA 3EY4A 3K8YA 3UW1A 4EP1A 3VPFA 3NDJA 2W2QA 5FI5A 4YWHA 4MRVA 3B9RA 2YOHA 2VUUA 2QXUA 1KYTA 4LV5B 2C1ZA 5LR6A 1JYFA 3D02A 5LBUA 1G21B 1NN5A 1L8OA 1RXEA 3GLIA 3MIZA 4CCWA 2Q6IA 1YS1X 4C0SA 1KI3A 2IA5A 3H3FA 3GB9A 1B7GO 3VR6A 3QWBA 5K20A 5C2JB 2B5OA 2XHEA 3RGWS 6AT1A 4NZNA 3F73A 3DWGA 3T3IA 1YZKA 3NI2A 5FPPA 4IKEA 1QIHA 2HF9A 1D6SA 4B3IA 5LBTA 3GMDA 4BO0A 4YJDA 4E5NA 2HIMA 5FWXA 1AUOA 2WKWA 3F9IA 1TECE 3LP8A 2IP4A 4KN6A 4D9EA 4G0WA 2NUAB 1GD1O 1NG1A 2QQ0A 1RIFA 3D6MA 3OU7A 3MGKA 3PQFA 3Q3CA 3VR6H 4Z4CA 3PXUA 4BUCA 2EGHA 3UWPA 4ZCLA 1I2ZA 4Y1RB 3U31A 1OZ0A 4AYWA 2ZYSA 4JI4B 4BYMA 4GPIB 1K3FA 3ULKA 2W2LA 1VSQA 3D4IA 3IP7A 3L0BA 4URUR 3WLJA 1ML4A 3K32A 5C3UA 2PBRA 5GVSA 1G20B 1VTKA 2FI1A 3KJHA 5J3JA 1P3Y1 1YZUA 4M3NA 4R1OA 1UC4B 2ZGVA 4GOMD 4CI9A 3TQCA 2KMLA 2ALJA 3H16A 4ILKA 4NV3A 3C3PA 4RCVA 1J25A 1DT5A 4FFWA 1GKKA 3JQFC 1QCCA 4X20B 2BI4A 5DM70 1C30A 5TXGA 1T8YA 2EOAA 3DBLB 1QR6A 2RC5A 1JAXA 1FXUA 2QN1A 4AZWA 3IC5A 4L7VA 5I7RA 4JH0A 3PYLA 1C8LA 5IDYA 1M1YB 2DUWA 1E7RA 4PC7A 2WUVA 3H9JA 3ZQ4A 3BCUA 1YF3A 4C9BA 1BNCA 2VA8A 5IJ0A 4DJTA 1A9RA 4BJHB 1E2UA 4R1MA 2ZI3A 5CUQA 1EFPB 2VJBA 1E6EA 1JEAA 3QVUA 4WDRA 4TTPA 5E1BA 1Q22A 3ZWBA 4I5FA 5AP9A 2Z08A 5C5EA 3AR4A 1JLLB 3LC7O 3IMEA 5M3BA 3I01M 4MV1A 1IYZA 1VLZA 4UASA 2VZ9A 1KMNA 1V1RB 4QC2A 1VKZA 1G3UA 1GZ4A 3HYTA 2H1LA 4OI1A 2CE7A 3JX9A 2XE4A 2YV2A 5KYUA 3RVMA 3OEEA 5AM1A 3EVTA 4LZAA 3V34A 4ZGBA 1YQDA 3U60B 3FLAA 4HNUA 3I53A 1OYWA 4C21A 4YAUA 1WUYA 1RJDA 3BMQB 3PX3A 2Q5QA 4PZLA 3B7PA 1UKAA 2CHEA 4PE5B 4WUVA 5AKJA 1LPBB 1U81A 5FBZA 3EVNA 2IP2A 2Q3EA 3KKMA 3DL4A 4LECA 4EG7A 4ZIRA 1QH8A 4BRUA 2E55A 4BU1A 3G2NA 3GLHE 3UOWA 3GRZA 2C8LA 4L4SA 4DIKA 1PX2A 2D2XA 5I7OA 2ZJ1A 2I6FA 1S7GA 3ZHXA 5KOHB 3Q3GE 4TTJA 2TS1A 2Y1WA 1JFSA 4Q9KA 1J2TA 1DADA 1K8RA 3DE4X 4L9RA 1Y81A 5FOQA 3DH0A 4LVCA 4LV8B 1EBUA 2I87A 2WHPA 4FR0A 1EESA 5IFKA 1E5TA 4Q19A 5CJPA 2JLVA 3C74A 1NGSA 4GQAA 3WIDA 1TEXA 2GDJA 4K05A 1WXEA 4G5GA 4GKBA 4BLPA 2CFTA 4BNDB 4KH0A 1JB9A 1Y8RA 5KMGB 1GT91 4REQA 2QRLA 4BNZA 4NMWA 1FPQA 2NU9B 1THZA 1QKJA 5C7IO 1OFHA 1K89A 1W52X 2R8XA 3D7NA 4RZ2A 4NBUA 3GUUA 4CV2A 3C5WP 4RACA 2GTIA 3AY6A 4ZAWA 2FKAA 2XQVA 4MB0A 5ESDA 2JVKA 5I7AA 2C29D 4E5SA 2N9UA 5AIAA 2CJPA 2CWDA 5H4HA 2NVWA 2R48A 1R74A 1Y9DA 1NNSA 1YVRA 2EG9A 2GN6A 3Q5GA 3T3DA 1KH1A 2QLFA 3R77A 4DR1B 2DBRA 4BIIA 1PR5A 1EZ1A 2D0DA 1HDCA 5KBYA 1GFWA 1M74A 2C58A 3HP7A 1LH0A 4LZLA 2ZS7A 3BH7A 1OYYA 1ZM9A 3FWNA 5FOTA 3H4TA 5DBHX 4NENB 5JPDA 2JLWA 2GCNA 2VKTA 1MZVA 3JQ6A 2AD1A 1RKVA 1XCGB 2G7ZA 3F3MA 3CZPA 5JMOA 1I6WA 4MR7B 3QXXA 1FYVA 4Q18A 5E9AA 3LX4A 3WNZA 3UYLA 4PFKA 1Z0JA 1Z22A 2HRDA 2B34A 1FVFA 1T15A 4KPEC 4O1IA 4E5UA 3I76A 3LKZA 1BQ3A 2DQSA 2NVUB 3C70A 5JJ5A 1HFWA 2PLRA 2PVCA 4CF4A 4D9MA 2PVPA 3GRRA 4B8ZA 1ZR2A 1FDTA 2FFBA 3EF1A 2QLBA 5EUQB 3IHLA 2PTGA 1KBOA 4H6WA 1AF4A 1M34A 3UM9A 3FPAA 3A6KA 4Q03A 3NRJA 4OF4A 3HPQA 3ROTA 4IWYA 1EVZA 3U40A 1WTAA 4D92A 1SXJE 4JL8A 1Q95A 4DLXA 5DHPA 3LVBA 4EF6A 3FR7A 3A9VA 1YRBA 3RVJA 3SIRA 3WB9A 1NBWB 1FP2A 3AUXA 5FBKA 2AQ8A 4PHHA 3U7GA 4MQEB 2I3DA 1XXLA 4L5JA 4R2HA 3TF5A 2PRYA 2J3KA 5ALEA 4DCGA 3PQDA 3QWAA 4DLAA 5DWDA 3NLLA 5KINB 1HWYA 3MEQA 4C4ZA 3RRXA 3K6SA 4ZVSA 3NHWA 2FOLA 4FT4A 3JRXA 3A6LA 2O5VA 4W8HA 3O4HA 3NDBB 3PT5A 3PU6A 5DHSA 2XUJA 4JT8A 2Z1NA 2ZIFA 1YHYA 4O4IA 3G3EA 3ZKWB 1QRTA 4R3WA 4EY4A 3R6GA 5AMXA 3N5CA 4IIFA 1MLDA 2GR9A 5K6AA 3E5MA 1F0NA 1GZHB 4EJMA 4BNUA 3PHIA 4QULA 1KAGA 1DKLA 4Y2JA 3ZFTA 3R0ZA 4UHEA 4QU8A 4IV5A 5FUQA 1YWGO 2AYZA 4MOWA 5B6PA 2IH4A 2C5AA 4OGKA 1M2EA 1P1KA 1UFOA 2B1RA 3C6QA 3TPZA 3UANA 4D8UA 4A15A 1A4XA 4XEHA 1QHNA 5C35A 3LT1A 1Z2PX 3WV5A 1JEQA 2WWGA 3ANSA 3K5IA 4UAJA 4F3CA 3RADC 4JYAB 1SBYA 4CQMD 2Z3WA 4WX2B 2OM2A 3A70A 3KB1A 3PFKA 1JTVA 1L8QA 3COVA 1O0BA 1IBMB 4O4IF 5AVQA 1WQ4A 2ADFA 4J0EA 4PLWA 7REQB 2A30A 3K3PA 5GZ1A 1UUFA 4Q1VA 2VNKA 3WQQA 3BTSA 5DWQA 4H9JA 3AVPA 4JIMA 3SHWA 2PA3A 2A1UB 2ZPTX 3H8VA 2VH5R 1P5ZB 2H4JA 3L4BA 2NMVA 1ZCBA 4HF7A 5C52B 5EESA 3TIVA 4FINA 2F8MA 3HLTA 1PFYA 3Q8MA 1G6OA 2QVGA 4CM4B 4ER3A 1BEEA 4M2LA 4HQFA 4BVLA 1X9GA 5JXJA 5BUCA 1KHHA 4HGRA 4IJ5A 5FH9A 1CB0A 1JB1A 3MWGA 2JFVA 3M1AA 4X1OA 2H1WA 1QIGA 4MS1B 2F1RA 2NAPA 4JR0A 3UJAA 1IFXA 5KSYA 1SVUA 3ZLJA 4QFBA 2C4WA 3NBFA 5JAOA 2ZWIA 3AVYA 4YJFA 4GL2A 1EINA 4LCEA 2XVYA 2CCKA 3G13A 4HWRA 1ADJA 1OU0A 1TI7A 5GM2A 4YMWA 4QDOA 3A7EA 4HGQA 5LB2A 5BPFA 1GILA 1N4DA 2XXAA 3VOTA 2ZJZA 3ENQA 5TT0A 2ESRA 3G7SA 5HG0A 3LCCA 5B3JA 3KKOA 1PEAA 3EYWA 3WLAA 4F2GA 2ZIXA 3SZ3A 5HBGA 3TOCA 3COYA 3WNCA 4DFDA 1SC1A 1WG8A 1M6YA 3ZI0A 1R27A 1FSGA 1YZLA 2BT4A 3ZW9A 4H0FA 1Q0SA 2OQIA 1QQ6A 2GWHA 4JQOA 1AGPA 1RJWA 3CIFA 1NA5A 1H1LB 3E3AA 4E33A 2ZJ4A 3VPSA 5D01A 1U3WA 2A1IA 5EMKA 1VYVA 1IHPA 2BM1A 4ZOAA 4G9EA 3TZEA 5IWAB 1AURA 3FB1A 1F8FA 4ZU6X 4O2LA 1M76A 2ZJYA 3EFEA 1Y34E 3MFYA 3BF7A 1C5KA 2OOKA 3GRAA 1FU7A 2QZSA 3EFBA 4J4BA 4RGQA 3H19A 4Z4EA 4ESEA 1EGVB 2XCIA 3IXMA 3JYQA 3QVXA 2BFEB 4MVCA 4UCFA 2V7PA 3MGCA 5A0VA 2PLWA 3CQ9A 4N0MA 4CJXA 4LXTA 1OF1A 2R68A 3FPBA 3UUWA 3TG2A 4I81A 4YJ3A 4A5SA 4G56A 2UYQA 5LYJA 2PJRA 2WU4A 2QTMA 2H2FA 1OIXA 1OH7A 4TQ9A 1KOFA 1BJTA 2XYHA 3R3XA 4MW1A 1DIAA 5ALTA 2J0SA 5EXSA 4P84A 2X40A 2QUIA 2VSFA 3D6TB 3LPDA 3N0RA 3WZMA 1E1QA 5DI3A 1DRUA 3CRRA 3OZXA 4U7JA 4UEWA 4F9EA 4G1UC 4YMUA 1O57A 4L3WA 2AZMA 3A31A 3OPYI 4P2BA 2ARKA 2V6FA 4H9GA 4WSOA 3VHLB 3OPQA 5IZCA 2WSSA 3NT4A 9LDBA 3U4GA 3NDIA 2A0FA 3TJMA 1KJJA 4KQWA 3VISA 3GOQA 2WJYA 4IJKA 3O4GA 3W9UA 4LRUA 5CGQB 4YUVA 4EJSB 4YJ3F 3LYLA 3HCAA 3P71T 5BVGB 4HVTA 1RD4A 4UU0A 4HZUA 5LYJF 4FLFA 4DCUA 5A4DA 2R8RA 4OJTA 2YRWA 5FV4A 3WGVA 1CIPA 2ZT8A 3F0TA 1ZESA 4L74A 5SZIA 3NNDA 2JBAA 3KUXA 3C3WA 3F2IA 4RY8A 5IH7A 3HKCA 5B55A 3GUZA 3MTGA 4RK0A 1I7SB 1NRJB 5DBGA 3HBLA 5HS6A 1ANKA 1SB9A 4CM8A 4KDCA 2WTBA 4JXZA 3IEMA 3JYOA 2VQEB 4QDUA 3IKTA 1R6AA 3D2LA 1TLFA 4F4CA 1ZMXA 2BFFA 2VRCA 1RWBA 1NHGA 1IY2A 3OPMA 3UZUA 3PL1A 4YALA 3NUGA 3QOWA 4IMJB 3KR2A 5EJEA 5FLKA 4HWKA 4TXJA 3ORHA 1OI7A 3ETHA 4OHMA 4Q00A 3U1TA 4A0RA 1TJPB 2ZXEA 3RM3A 2YVAA 3JQRA 3U19A 3A1DA 2YY6A 3SOPA 3UPTA 1SCNE 1UKCA 3OQIB 1Z83A 2OHJA 4X6LA 5FOWA 3TD6A 3V42A 4BNJA 2OCAA 1XWIA 4I1VA 2AN4A 1TDJA 2JD1A 3RHZA 3ESAA 3UN1A 5JARA 5GINE 4X94A 1PL0A 4LDZA 4CNBA 2CNLA 4PAMA 3OOWA 5ENVA 4KAAA 1D0IA 3B3AA 2X6RA 1SOAA 2XMCA 3T8YA 2R6ZA 2XKJE 2K2WA 3EUAA 3QPCA 4LY9A 2YWFA 1V9SA 2X0JA 4Q1CA 4F3RA 3L4JA 1PNRA 1QORA 3I61A 2I65A 1FTWA 4O4LA 1H66A 4Q3KA 1ZN2A 4RK1A 2NSYA 3RS2A 4HH3C 2WDZA 3NW9A 2KW5A 1JJBA 2HZBA 3M4XA 4BBJA 3DVAB 4FS8A 2CLEB 4JODA 1R5OA 2QZ4A 2OZPA 3IEXA 2OORC 3NTVA 1UBFA 5G53C 5ELXA 3MELA 4G8JA 1ETUA 1KYVA 4C6RA 5F9HA 1XQVA 2ZJ0A 2MINA 4ZI5A 4BHTA 2AYXA 1T3HA 5G2OA 1QK3A 1C50A 1LWOA 1SA0A 2XXJA 4ZRNA 4WCFA 1H85A 1WF3A 2I6XA 1DDIA 2ZWAA 3LT4A 2GPBA 2II6A 1E6KA 3RKUA 4D0NA 1MOSA 5A4FS 1X7ZB 4RJ2A 3TW6A 1N6PA 2FUG1 2HGSA 3B13B 3OZDA 3TBKA 3LTEA 3LT0A 1E3LA 1K0FA 3E8XA 3QZUA 4NX2A 3ZY6A 4RXMA 3ZY4A 1JNXX 1U7WA 1RJEA 3AERA 2ZSIA 1TYZA 3QUSA 4BKQA 1R4MA 2PH3A 3NVMB 4J2HA 2X0EA 4O4LF 4R1PA 4KRXA 8GPBA 4XWGA 4ZZ0A 3DPUA 5SYAA 4JR1A 1Z82A 2OZLA 4FYVA 4WIAA 5CDFA 3MAAC 2PSHA 4Q7QA 3O8RA 5DT9A 2ZAOA 3GX1A 3KZ1E 4YXWD 5FADA 5ARBA 5AW4A 4HEA6 2AX3A 2EJBA 3LCRA 1WVGA 3EW9A 1DJNA 4LC0A 5HTOA 1M72A 1YQQA 2FSPA 1F51E 2JHAA 2B2CA 3JYLA 3FDZB 1LEHA 1ZRNA 1T0HB 4FNAA 3LUHA 4FMCF 1ONPA 2G9UA 2PMFA 3JQCA 4EOGA 1ADFA 5L53A 2N42A 3KPYA 4UBNA 4Z51A 1U0FA 1YCFA 1TKCA 4DRYA 4YPVA 1OOEA 3H4VA 5CPBA 5KVVA 1BH2A 3I4FA 3U44A 5GTDA 4HXYA 1WX1A 3L8FA 4KFRA 2QA5A 2Z04A 3UMJA 3VDNB 4P31A 4BCDA 1N1EA 2I7CA 3MFDA 4NZOA 2GEDA 3KQWA 4Q3LA 1RWNA 1SR8A 2JFFA 1R12A 3BFPA 5CX4A 5LP6C 4AMGA 3LQKA 5KYGA 1SG9A 1R00A 1G6KA 2GB4A 3SJAA 2D0IA 4EMSA 4TSKA 2JIMA 1UAYA 1VDZA 2BHLA 2P9CA 1RXCA 3V00A 4CEJB 1TMGE 1NJFA 2GPSA 3T5MA 3KJIA 2JI7A 2REXB 4GWKA 4C0KA 1L5VA 2GPTA 2YZMA 3LDAA 3PXAA 2P4EA 3DHYA 4IKPA 3AOEC 4R01A 1KOGA 1OLXA 1CVIA 3NKFA 4BQSA 4TL8A 3OC0A 2C5EA 4YB8A 5KYWB 3A2KA 2WIDA 4FIDA 4ZYWA 1PZXA 1BRMA 4PG8A 2LE0A 4H3SA 1T2EA 1E9FA 3G8BA 3R3UA 1URPA 4DTIA 4ZCPA 4ND4A 4F38A 3EGCA 3LMKA 2CLLB 2BPOA 3LKVA 4I3GA 1VRCA 4XM1A 2KE5A 2JGDA 2YY5A 3GGJA 5HWSA 1YJAA 2VCEA 4E14A 4YRAA 3B53X 2CUNA 2Q2VA 2UV8A 2C7GA 3R3SA 2HA0A 1YVEI 1KH2A 3MJVA 2NSHA 3B9QA 3DF9A 4KYTA 4TL7A 4CTOA 2CHGA 2YHBA 1IZYA 1DAKA 3EOAI 2ZSKA 3GLKA 4M21A 4X9XA 1SMKA 1R8SA 1CIVA 1JP7A 1T0IA 2PDAA 1Y1TA 2G83A 3CEHA 3LLCA 5MFZA 1UOOA 3S27A 1G9XA 2FZWA 2J46A 2IHJA 1REQB 3M6LA 4PX9A 2XE6A 2RKOA 5FPYA 3BE6A 1UBJS 1G55A 4BOYA 1CZHA 4C2AA 1EJBA 1OXMA 1Z26A 1A27A 3HXKA 3I32A 3UW3A 3V7NA 3ZLTA 4B82A 5K8UA 1WCYA 1IBKB 1DWPA 3M3HA 3EF3A 3GZJA 3EZFA 3PX2A 2BJHA 3DE2X 4AVYA 4N41A 1VQ1A 1O87A 1ZRHA 2ZT6A 4HQKA 2WB4A 4O2AA 5DPMA 4NBNA 2VUTA 3A32A 2QW0X 2PUVA 3EE6A 3JAKB 3LZ6A 4BV2A 5KX5F 1IXSB 4FJ2A 4NYMQ 2VN8A 1C3JA 4OXNA 5DASA 4JI1B 2WD7A 3C6BA 3L84A 4B3GA 3UGKA 4EZBA 4OTZA 4ZC1A 1XNGA 3PJDA 3G2JA 4I50B 1EA5A 4TS1A 4NJMA 1OVGA 1VI5A 4KH1A 4ND8A 2ZQYA 4R3UC 3PK0A 5B3AA 3RTEA 3SBXA 3SZMA 1EHCA 2BTQA 1KK3A 1W2WB 1X8LA 3QYAA 4V0OA 1SC4A 3PRHA 4BKPA 3WE7A 4BO8A 5EC8A 4OX9Y 3EY9A 3RYCA 3DUFA 3GPCA 4QECA 1BA2A 2D2VA 4OK6A 1L5FA 4CMIA 2QM3A 3NV7A 5H68A 5ES4B 2HR1A 1EE2A 1QFXA 3GUCA 1BQ4A 1VJ1A 3BEDA 2RHWA 2I62A 2RJNA 4O2AF 4YGYA 4RK7A 4AZ3B 4LKOA 4XUGB 3RTDA 4QWMA 4H9KA 3F49S 5EIOA 5FBQB 4I1PA 5M34A 1PFKA 2WG0A 1G7TA 2XUHA 3IERA 2F7SA 3FOZA 4ML3A 4DSOA 4GKAA 4ZOLB 3C2QA 4LXIA 3BMNB 1QHEA 4V03A 3MD0A 1LJLA 4C06A 4FW9A 3PXDA 4DQXA 5I3ZA 3KWLA 3I58A 5P8WA 1M7GA 1SU8A 1WWKA 2WP8J 3N6VA 2R47A 3UYKA 3ZPXA 1WHSB 4UHDA 1T5BA 4HLUA 3OCZA 5EL0A 1QANA 4LF6B 4Z0PA 3EISA 1DEOA 3TRFA 4F1JA 1UEJA 1PE0A 4CL2A 2QE7A 2ABWA 2JFXA 2Y4NA 4A10A 3BL6A 4HBZA 1W88B 1R9GA 2FWAA 4Y2XA 5DIZA 2AFHB 4KWTA 2I76A 2IHKA 1J99A 1J0AA 4EI8A 1ZJ4A 1T1IA 2V7TA 4OBBA 2V65A 2FHPA 2XGOA 1JDSA 3OCUA 2JAOA 4PTYA 5K0EA 5H3LA 2N1MA 3KEQA 3TO5A 3LHIA 4CTJA 2JATA 2FX5A 4R8VA 2JFYA 2E4WA 4YDQA 4DY4A 2C84A 2GZ2A 2VP0A 3LPNA 4I46A 4ZYYA 1NSFA 1NUHA 2BGNA 1J97A 1EK2A 4HMQA 3AP3A 2ZT5A 4XH9B 4UUAA 2XKBA 2W58A 3P9NA 4JVSB 4RELA 4M1YA 4G23A 3TAUA 2HRRA 2JGIA 3LU1A 3D3WA 5AK6A 3A9TA 2WJ4A 1TLLA 3O84A 4B3CA 3CF0A 4C7OB 2BF7A 4GLJA 1G7RA 1NNLA 2AOTA 2HUPA 2OY0A 4NZPA 4OJNA 5H82A 3ZZUA 1SXQA 1JEEA 4KMOA 4D9NA 4G1BA 1SQSA 3H13A 2V6IA 5I7FA 1I3NA 2QR5A 2QRNA 4J9VA 3IRUA 1KJQA 2NO9A 1NF3A 1WSWA 3S29A 4J3FA 4ZYVA 1XXHB 3L7NA 1BKDR 5LFAA 2OLEA 3G85A 3JQBC 3TIFA 3FOEC 1KMHB 3JQFA 3ZUGA 1BD4A 1XTJA 1VYHA 1NKSA 2AQIA 5DGHA 3K70B 2DKNA 4E4RA 3PNKA 4ZEOA 3L6UA 3MCWA 4AJHA 4PQRA 4Q7JB 4OOEA 3AESA 2ZOSA 1Y5IA 3CWCA 1Y5NA 2M6KA 1ZLXA 4U2KA 5B4UA 5C8DA 5AQ1A 1AKRA 5F7OA 2O1EA 5AJUA 4ZYUA 1DDGA 4S1NA 5CNIA 4MV5A 5F33A 5TX7A 1EXVA 1QYVA 3OTIA 1B0UA 1MVOA 2QRMA 1H0KA 3IAUA 3UK7A 1TVKA 1AB6A 5IP5A 3H1BA 1QHIA 3FSGA 3P0HA 2GXSA 5DNUA 3C6ZA 2AE2A 3BL5A 3O7WA 4X61A 5AKXA 4Z99A 2DC1A 2FETA 1DAIA 5FBWB 3RRYA 1LPNA 2JIPA 4RH3A 1DG9A 4JJFA 4ZI7B 4PZZA 2E5FA 3NHYA 5ICSA 3UGJA 1V43A 4LZJA 5GP1A 3EDYA 1BS1A 3F5DA 5SZKB 1O97D 2GLXA 4R9VA 3LA6A 3R6DA 4DWVA 2PAFA 3U0BA 2V6BA 1XRMA 4NK5A 4V0KA 3HQ4O 4M49A 4K40A 1C3XA 4LXQA 2ZSFA 2WJPA 3RSGA 4AP9A 2R6AA 4OI0A 1TFUA 4MRNA 5LMCA 2DHRA 4LSGA 4DLUA 1A50B 1N2HA 2VDMB 1KEEB 1GSHA 4YAWA 3I2HA 4BX2A 4ZAYA 5L95A 5ALJA 4Y98A 4BMOB 2QPTA 5IPFA 4RGYA 3BD6A 1GIAA 1I0LA 3OIWA 3FHTA 2WYVA 1MX9A 2IOYA 2VDWB 2E37A 3CZ4A 1XF1A 1VYTA 3ZV3A 3P8ZA 3N2NA 4B6JA 3S2YA 1S2NA 2HREA 2HQSA 1ZGZA 3HEBA 3TRKA 4C3VA 5CLQA 2HWXA 3NEPX 3HKBA 1P4HA 4B74A 4YMGA 4J0CA 1VLLA 4IDNA 1RACA 1SUFA 1I0ZA 3UJ8A 3RBXA 2DCUA 1YDEA 2G76A 4R0MA 4BEBA 4ZTZB 1JU9A 2Q4DA 2IF0A 2FH5B 3BMOB 1KVUA 1KYZA 3F6SA 3P0RA 4J94A 4PICA 1SC3A 4DQUA 2CY0A 3MAJA 4P6VF 3MCTA 3RODA 1T3LA 1IY9A 2DBZA 3QI2A 3WIUA 2Z43A 4O2BF 2H0RA 2HLPA 1KZYC 3P32A 4MWEA 2IF2A 2ZIGA 3EEYA 2VBFA 5SYMA 3CUEF 5TS3A 1XALA 7MDHA 4MRAA 5DOZA 3WWYA 5K4HA 1RLTA 2C20A 3T0FA 3WTBA 2BFCA 2PIAA 1KQPA 2YJGA 4YGXB 4C4XA 4FB4A 3ETLA 2WILA 1K7CA 2EKBA 4ETWA 2RI0A 4D99A 2VNJA 1TK3A 3L8EA 3GP5A 3T94A 4DGQA 3T3NA 1VPVA 1IATA 2IHZA 3QTLA 1YU9A 2FLKA 1VMDA 2JI6A 1EXDA 4RM3A 1D8AA 4QXOA 3TZKA 1Z4MA 4IDHA 3O38A 3HCEA 1MRZA 1GRNA 1X7WB 1TTPB 1MQSA 5CD9A 5CLFA 3LL7A 4H18A 5EY5B 1NJ1A 4XDZA 1D5CA 3ZLBA 3U37A 3B36A 3WGJA 1SKAA 4RTJA 2WZCA 3T1NA 1QCZA 3KE8A 4P8RA 4M86A 2Q0HA 5JRJA 3PFWO 1EJ2A 2BKEA 4TLBA 4D6PA 1OH5A 3SEZA 1HXHA 4XD7A 3OOJA 9ATCA 1VHTA 4LHSA 4PGMA 3TLKA 1TW3A 1CQJB 3IL2A 4CL0A 3CCCA 1ZVVA 4ZT6A 1MFPA 2E21A 4LNAA 4QG7A 4DDWA 4N5IX 1G4UR 1PJCA 1R0SA 1UXHA 1TEZA 3CT4A 1RZVA 3AZQA 3PUHA 5KJ6A 1ZHHA 4QTTB 4D4LA 2W6ZA 1PKXA 1MABB 2WSIA 3HUEA 4GVLA 5ICFA 1T2FA 1U3CA 3BEOA 5DCLA 1HDYA 4MMZB 1Q44A 4WKGA 1PTKA 2W6MA 2HJVA 2J45A 3N0VA 4CQNA 5H16A 4UPEA 1O6FA 1KO4A 4EMUA 1E3WA 4ZCSA 1A69A 1A9XB 2CW5A 5JD4A 3E3MA 3VAAA 3MERA 4MVJA 1NV9A 3CONA 1ZMRA 1U9ZA 3EB9A 4RAOA 3FNHA 1G8FA 2UVQA 4UPVA 1SIUA 3ZCPA 3S70A 3B8HA 1X74A 1V5FA 4KXWA 2JFBA 2ZRFA 2ZTSA 4UDNA 3KL4A 5CFOA 3OTGA 2IHBA 1DE0A 1DKUA 2I2CA 2B30A 2IQIA 3F67A 4TQUS 4URZR 4FBMA 5G4LA 3DD5A 1QHYA 2CNKA 2RB4A 5A5DA 3MWEA 1QLHA 2VPTA 4BNLA 3AHJA 1CEQA 1F4PA 1DINA 4UFOA 2ZE6A 4WXRA 1WBJB 3BMCA 4MVJH 1SC6A 5REQA 4KXLA 3AM3A 3CN7A 2IYSA 3HDYA 3QEJA 3RU2A 4BWYA 5KWEA 3WHLA 1XLWA 2BFBA 5BUSA 2ES4A 1TGYA 4L50A 4TSFA 4GKKB 4TLCA 1GRCA 3B3FA 4FFBB 3H84A 1XAHA 5FWYB 3BWBA 2W6JA 1NLMA 2BDTA 4MVJF 3X2FA 2A14A 4DMLA 3QX3A 2QL5A 1BEUB 3EXEA 1ECJA 4H7FA 5A2GA 3ZDCA 1ECLA 3ROMA 1H1TA 4QDJA 4Q7KA 5KSZA 4R0NA 2XMBA 4JLOA 1YA8A 3EQ7A 3A6FA 3D7RA 4I6JA 2CF5A 2R7LA 4FYIA 4HOYA 4JMPA 2WTAA 4M9CA 3X1MA 4ER7A 5HHTA 1G1MA 3U3KA 5JZBA 1HLDA 4YO7A 4IO1A 1YE3A 1E60A 2HGZA 2NU7B 4D45A 2O52A 1Y1RA 4L28A 3OT1B 4B0PA 2BGGA 4A23A 4A2QA 2A2ZA 3M33A 4MDHA 4WW0A 3RIXA 5JXHA 2GBGA 1PZMA 5KB3A 4K9NA 2H08A 3KLBA 1B00A 1UZNA 4UVEA 2OG1A 1XPJA 2P4HX 1V11B 1LDBA 3GUVA 3IJEB 3NORA 4NV0A 1LC0A 3LBYA 1RRKA 3SX4A 3WLSA 4DJ5X 1C7JA 3T9DA 1DZIA 1DI0A 5DIFA 5BN3B 5AM2A 5IYZA 5CH3A 2GHIA 1NDQA 3EIUA 5C4GB 2IXDA 2D5IA 1LB1B 2C2BA 4QJ5A 5GONF 3OZIA 1XSEA 3OM8A 2RGBA 3L6OO 4HB3A 2FSVC 3VYUB 3PPIA 3TTTA 1XAIA 1MAAA 3TK1A 5TNXA 2Q7XA 4JJ4A 4MKGA 4RHTA 2XY4A 2C2YA 4MRRA 1TM3E 4PO8A 1JKFA 3O1JC 2V7EA 1V7ZA 2BF4A 3WR5A 4XQ0A 1P7YA 4OAOA 3PWKA 2OC9A 4CM9A 1OCEA 5GZ3A 5G40A 3IO5A 3GWZA 4KG7A 2ENUA 1H0SA 1S8FA 2OESA 2GM9A 1OD6A 4CUKA 2G4VA 3OTOB 1JDJA 1GKYA 3C1TA 3L7YA 3H5NA 4NJEA 3FAKA 1Y8CA 3U1BA 1G5TA 1H2HA 4DR6B 2PRSA 2FZEA 5IYZF 5LP1A 4GH5A 3HSKA 1D0SA 5TJ9A 5A1TA 1KU0A 2P1ZA 4TUYB 4WESA 2MYPA 5EWLB 2GAJA 1H8EA 1NKVA 3OUUA 4ZU3A 3PGXA 3PXBA 4DM4A 5DU2A 4B40A 3KTOA 2IZ7A 4M0FA 3EGWA 4YDHB 4TKZA 1U8FO 3J7TA 1PYGA 1D1QA 4GR5A 4X7RA 1EFRA 3F74A 2OXTA 1UP6A 4PNHA 3JVDA 4UNIA 2CL0X 3KT3A 4YT5A 3M3DA 4U9UA 5IEBA 3OCXA 4CFYA 3F5MA 2ZJBA 1HE2A 4IEFB 1QTQA 1GVNB 5K6RA 3RIYA 2AZTA 2OFWA 3NJ8A 4YCMA 3LY8A 1APBA 2O3SA 4LUCA 2Q50A 2ZIAA 2WM3A 4WN9A 3CLRD 1T8TA 4LYDA 1USGA 4HB0A 5AVZA 2VWHA 2R3SA 2PKWA 5KEIA 2PKQO 3M8KA 4K9OA 1V8ZA 4YJGA 5CFRA 2BZGA 1GAWA 3AUAA 1RXWA 4M1SA 4MR9A 5ICGA 1QZUA 1VE6A 3L0OA 5F5XA 4HAUA 4ZANA 3LQ1A 1G8YA 2AGVA 2Z09A 4AYXA 5A2QA 5L3QB 2BTOA 1J39A 2FRXA 4G5SA 5FOUA 4YRNA 4AJPA 5KYTA 2Z5LA 3BE8A 2C98A 1SQGA 4TMWA 3K1TA 2I55A 4JAVC 4E4TA 3D7LA 4XUEA 4HRVA 3W2TA 2VHJA 1XT6A 2G8LA 3K8OE 4KYIB 5FRDA 5JNTA 3A28A 5JI3E 4H27A 3QKTA 1A2QA 1LVHA 4NECA 3MLBA 3OJ0A 4WOBA 4PHCA 3KL2A 2AR7A 4QVIA 3BA6A 3CNLA 4IHKA 3JZIA 1LCIA 3U80A 3ZHYA 2D1RA 1UBLS 4C2UA 1GU7A 2X0NA 1DXQA 2DBYA 3G9ZA 1NXSA 4XPIA 3K09C 4PPGA 5E1DA 2J5KA 2VOJA 1TZ2A 4CM6A 3NH6A 4MKZA 5CM8B 3ZHBA 5HK9A 1C9YA 1E92A 2P7IA 2XCLA 3KZOA 5I45A 1PT9A 1X7YA 1XYVA 2C59A