4YUXA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2h-1,4-benzothiazin-3-amine
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
b'PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
molecule tags Transferase
source organism Trypanosoma cruzi (strain cl brener)
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
total genus 100
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuxA02
1NBHA 2YXEA 3EPPA 3UBTA 2B78A 1WS6A 3GWZA 5EMKA 2O05A 2R3SA 2BM8A 3UZUA 2JHAA 2NXEA 1ZHFA 4M37A 5CVJA 5DM1A 1TPYA 3H2BA 3G5TA 2OZVA 3K6RA 5CIYA 3AJDA 2YVLA 4P7FA 3NJRA 4Z2YA 1YB2A 3B89A 4RVDA 4PYIA 2PSSA 1NW5A 3GCZA 3ERCA 3NWBA 3FTCA 5GM2A 2IP2A 3G2PA 2ZIEA 1O9HA 4YV2A 1KXZA 1X1AA 3P9KA 2JH9A 1XCJA 3GRYA 2HTEA 2P35A 2NNWB 3DMHA 3LGAA 3TKYA 2Z6UA 3TM4A 4C08A 3A7EA 2I9KA 5EKXA 1NW8A 5EOVA 2QE6A 1EJ0A 4QDJA 1X1DA 2IDJA 1D2GA 1QAOA 3A26A 3LDUA 3UA3A 1O54A 3VC2A 5GP1A 1RJGA 2AVNA 5F2NA 5EGSA 2G71A 5CVDA 5FTWA 1DUSA 3A25A 3KPUA 4ER0A 5ICGA 2K4MA 4CXMA 1HNNA 1KYWA 4PYQA 4B17A 1SG9A 4P7JA 3SM3A 3UA4A 5HIKA 4OA5A 2Z6QA 1QYRA 5DX8A 3P2IA 1JSZA 3HEMA 2PXXA 3DUWA 5HOQA 3MHTA 5E8JA 3KPJA 1P39A 2PX2A 4YUVA 4OQDA 2CKDA 2B25A 2YR0A 1L9KA 4RSRA 5E1DA 5EHIA 4HSGA 1L3BA 1RJDA 5K8VA 5DTQA 2IIPA 3CKKA 5FULA 5FUBA 3M33A 3HVHA 4E31A 2HMYB 2I62A 2ZSUA 3GU3A 1OR8A 1UIRA 3KQPA 3UJAA 2AOVA 2E5WA 5E2AA 1V39A 4P7KA 1G8AA 2OYRA 5GIPE 1DL5A 3RODA 2B2CA 3DULA 2QY6A 5E1OA 4ER3A 2P7HA 2FK8A 4DCMA 2IBSA 2BM9A 3KR9A 1KIAA 5C0OE 5ERGB 3KPWA 2IH5A 3LDFA 1EIZA 1U2ZA 4F86A 5HEKA 2HV9A 3BGIA 1F3LA 4LWOA 2N47A 3G2MA 5E1BA 1WZNA 8MHTA 3UJ8A 5F2OA 1JTFA 4QVKA 1RI5A 4OA8A 5DXJA 3K0BA 3EGEA 4MWZA 4E30A 4YUYA 3VSEA 2FPOA 1NT2A 5DM0A 5CCBA 1UFKA 1ZG3A 2ESRA 2ZBRA 4PGGA 4HTFA 5KQRA 3DLIA 3V97A 4ISCA 2JHCA 5FA5A 1RJFA 1P1CA 3HCCA 2CWWA 3DXXA 4XUCA 3OE5A 3ELWA 3FPEA 3CC8A 5HILA 3KR0A 3G88A 4BLVA 5H02A 1RI3A 5M5BA 3X0DA 4GOOD 1JR4A 4AZTA 1VL5A 2PJDA 4POOA 1SQFA 4AZSA 1I1NA 3IYLW 2O57A 3LDGA 3C0KA 3D2LA 3O31A 4AZWA 3LSTA 2EFJA 1N7JA 1KR5A 4QVGA 5K03A 1AF7A 3AWIA 5KS2A 5CCXA 2ZTHA 3KQWA 3GRZA 3E8SA 4GC9A 3FUUA 2G1PA 2NXCA 1QZZA 1L3CA 5KQSA 3UWPA 4DKJA 3LHDA 4RTMA 1JG2A 5LR6A 3UFBA 3DMFA 2Z6AA 5E1MA 1BC5A 5K0GA 3UJBA 1QANA 1FPQA 3ORHA 5K05A 1P1BA 3OZRA 5CVUA 4AX8A 3A27A 4RTKA 4QPPA 2BR4A 2IPXA 1R8XA 3GDHA 1SVUA 5F2KA 5IH3A 4FSDA 4HTFB 4XUDA 1T43A 2BH2A 2C7QA 3HTXA 4RVGA 2UYCA 1WG8A 1XDUA 3DTNA 2O0LA 5EC8A 2VDWA 2ZW9A 4E2YA 3PX2A 1RI4A 3AXSA 3ELDA 1JSXA 3MTEA 5FA8A 4IV0A 3C3YA 3PT9A 4FT2A 4PYOA 1XTPA 3HCEA 3WSTA 3MCZA 4U7TB 4DM3A 4FZVA 2XBMA 3I9FA 4Y30A 2NYUA 1QAQA 1SUSA 1ZGAA 1EG2A 3ER8A 3M6WA 3GNLA 4KDRA 4ER5A 9MHTA 3IV6A 5CM2Z 4DQ0A 3HVIA 3M4XA 2FRXA 1BHJA 2P3OA 2P8JA 2PVCA 3FPFA 3MAGA 4PYKA 2AOWA 3DXYA 2CMGA 1I9GA 3TKAA 5BXYA 3FRHA 3C6KA 2IFTA 4A6EA 4DA4A 2QM3A 5K0CA 3P8ZA 3HNRA 4OBWA 4UOEA 1ORIA 2JH8A 3FUXA 1G8SA 3KQTA 5DRTA 4C04A 2H00A 1NV8A 4EQZA 3NWEA 3JWGA 4OQEA 4M38A 4CTJA 2CMHA 3NVMB 3HM2A 4FT4A 1KPHA 4GUAA 5EQJB 4E2WA 1SUIA 2ONZA 2ONYA 4FGZA 4KDCA 1M6EX 3B7PA 2ZZNA 3KQYA 4R6WA 2AN3A 1VIDA 4C03A 4BP3A 2ZIFA 4H0NA 3G7UA 2PT6A 4PGHA 2YUIA 3SXJA 3R24A 4X61A 3MGGA 1X1BA 1NE2A 4PIMA 3SR4A 1SKMA 4RTJA 4QQNA 4QQKA 5ICFA 3SSNA 5ICCA 1N7IA 3P71T 3E23A 3M6UA 5K0FA 1VP3A 1YUBA 3KPYA 3UJ6A 2EJUA 1IM8A 2BR3A 2A14A 2CL5A 3I5UA 4GBED 5G02A 1NW6A 3CJTA 5EPEA 4KWCA 4PIPA 4PCLA 3AXTA 3HCAA 4EK9A 3BXOA 3TQSA 2OKCA 5K0JA 3EMBA 3FUVA 3KQVA 2OO3A 2DPMA 3DP7A 2ZWVA 3GO4A 2C7OA 1KPIA 1O9GA 4C05A 4HRAA 5D1NA 1IY9A 1KP9A 1VPTA 3CJQA 3FPGA 3IHTA 4E32A 2G72A 1R8YA 2OXTA 3R9XB 1L1EA 4CKCA 3AY0A 2P7IA 4RYLA 2AOTA 3DXZA 4YUWA 4QPNA 3B5IA 5K01A 3SMQA 4ZTBA 4KIGA 5EMMA 4RTSA 1SQGA 2QRVB 2VS1A 2OB2A 2I7CA 2QRVA 3REOA 4YV1A 2ZIGA 3FYCA 4MQ4A 4E2ZA 5C9ZA 2V7EA 5CVVA 3FPHA 2PXAA 2QYOA 3UJCA 1JQ3A 1NW7A 2I6GA 4RVHA 5U4XA 2IH2A 1XDZA 2O06A 2UYOA 3P9CA 4P58A 3TR6A 3R0QA 4V0RA 2GS9A 1M6YA 3EGIA 3P9IA 1YF3A 4JXJA 1VBFA 5K0NA 5JUWA 5FWDA 3E7PA 4G56A 3GRVA 5E2BA 2G70A 4HGZA 5EVJA 1I4WA 3BGDA 2AOXA 1H1DA 3OPNA 5E9JA 4LG1A 4RTNA 2YX1A 3NDIA 3B3JA 3JWJA 5K09A 1VQ1A 2FCAA 2WA2A 3FUTA 2ADMA 3LECA 3EVZA 3LPMA 4DMGA 4DCGA 3HVKA 2LD4A 5KVAA 2XYRA 5EG5A 1YZHA 1EJ6A 2KW5A 2DULA 3FUWA 4L7VA 4K6MA 1FBNA 1TW2A 2VP3A 3MERA 1ZGJA 3CVOA 5HFJA 2ZBQA 5T6BA 2YTZA 2C7RA 5B1SA 5DX1A 4CWAA 5DTRA 4BLUA 1FJXA 2IBTA 2FYTA 2EG5A 5DRYA 4LECA 4GF5A 2PX4A 2IGTA 4CKEA 3EEYA 5ICEA 4GOLD 1INLA 1B42A 1JG3A 2ZZKA 3G2OA 2P41A 3CGGA 3G5LA 2ORED 1RJEA 4PCAA 4BLWA 3NMUF 2HWKA 2OB1A 2AVDA 5LQRA 3OU2A 1NBIA 2AOUB 5GOZA 5CD1A 5CUQA 3HA7A 3TOSA 4R8SA 1P91A 3BWYA 3DH0A 3OFJA 5FQNA 4RWZA 3GJYA 3I58A 5BP7A 3G89A 2IH4A 1BKYA 3FTEA 3HA5A 1R00A 3KPVA 5HIJA 2ZLBA 3VYWA 3NVKI 5IKMA 5HIMA 2ZCJA 3LBFA 4GOND 4AUKA 3JWIA 2XYVA 2GA9A 4FS8A 3B3FA 5EKUA 3G8BA 3RW9A 4XCXA 3EGVA 2ZZMA 3CCFA 3I53A 4KVZA 4KRGA 4MIKA 5DPMA 5LQAA 3BT7A 1NV9A 2AS0A 3NDJA 3PVCA 3Q7EA 4HGYA 2WA1A 1D2HA 3Q87B 3FPJA 5DLYA 5LQCA 1Q0TA 1WXXA 4GC5A 4O29A 5FCDA 3EVAA 4M7RA 3EVGA 3O4FA 3PX3A 1Z3CA 4FR0A 4KIFA 1YFLA 3SSMA 3THRA 2Y1XA 4DF3A 4BY9E 4QTTB 5DM2A 2AR0A 4C07A 4WVLA 5DT2A 3BWBA 3DOUA 5LQNA 3TFWA 5EZQA 3MQ2A 4X1OA 5EEHA 3HCDA 3P2EA 3TMAA 3LCCA 4EKGA 2V74B 4RX1A 2NP6A 3BGVA 1EAMA 3PS9A 4RV9A 1QAMA 2PX8A 3EVCA 1HMYA 1KPGA 3L8DA 3LL7A 2PGXA 3P9NA 5E9WA 1FP2A 4C4AA 3TLJA 1VE3A 3GRRA 2C7PA 4RTLA 2ZFUA 2NXNA 2P3LA 4RTPA 1DCTA 3R6TA 5GWXA 3UJ7A 4YUZA 4IV8A 3LKZA 3QOXA 5EZSA 3KU1A 3NW9A 2H1RA 4IKPA 4YMGA 1L3IA 3ER9A 1N2XA 1RI1A 1EQAA 3F4KA 3E05A 1AQIA 5HIIA 2PX5A 3DLCA 2ZULA 4PINA 4V0QA 3FTDA 3DR5A 3I64A 3UJDA 1WXWA 3HCFA 2F8LA 1JTEA 3BWCA 1PJZA 3KR1A 3EVEA 2PY6A 3P97A 4RVFA 2VDVE 4ATNA 3BWMA 3PTAA 2AZTA 2JJQA 3BZBA 4E2XA 2Y1WA 5JR3A 2OBFA 2WK1A 2VZ9A 4IWNA 4ER6A 5DM4A 5K0LA 4RTQA 3FZGA 4QTUB 3GXOA 5K0EA 4MHTA 2FK7A 4RTOA 3BUSA 1MJFA 3BKXA 4CTKA 4PYMA 3PFHA 5MHTA 4EMSA 2P40A 3HA3A 5DXAA 3TM5A 1XVAA 1WY7A 3T7RA 3ANXA 3KQOA 5DSXA 4AZVA 1JQDA 2PLWA 3DMGA 1AQJA 4HH4A 3KQMA 3R3HA 2AOTB 5FQOA 1FP1D 1XDSA 2AN5A 4LWPA 2GLUA 2PXCA 2B9EA 3LKDA 3NTVA 4WXHA 3EVDA 2VDUE 2ZVJA 3MB5A 1X1CA 3T7SA 5HZMA 3C6MA 1VP9A 2HNKA 3M70A 3PFGA 2YXDA 5DTMA 4OX9Y 2UYQA 4PYJA 1G55A 4EVIA 5EIFA 4CKBA 3SGLA 2B3TA 3LBYA 2XVMA 4X41A 4F85A 3SSOA 4EKIA 5EIWA 5LSAA 1JG1A 3EEOA 2AOUA 3OFKA 4C06A 3LCUA 1XCLA 1TW3A 2BZGA 4GQBA 1KHHA 5BW5A 2IDKA 4BP1A 1ORHA 1ZQ9A 3ID6C 1UWVA 4OBXA 3OU6A 2Q41A 2XYQA 2PKWA 3EMDA 5EMLA 7MHTA 3GIWA 3G2QA 3QV2A 3A4TA 4U7PB 5E8RA 5FHQA 4E70A 5EHGA 2PWPA 2YQZA 4PYLA 3OZTA 4X60A 4ER7A 5LQUA 2PBFA 1M0EA 3EVBA 1D2CA 2P1DA 3ELUA 3OU7A 5KYGA 3JWHA 5K0BA 2PT9A 1YZ3A 2PV0A 2NP7A 2EJTA 2P3QA 3T7TA 1BOOA 4M36A 4YUXA 4MTLA 5T64A 1F38A 4X63A 3MCTA 3OCJA 3SX0A 3BKWA 3TRKA 4F84A 4R8RA 2JHPA 5DSTA 3T0IA 3THSA 4HC4A 3SVZA 1G6Q1 1AV6A 10MHA 2OY0A 4YV0A 1NKVA 2ZWAA 1XJ5A 2H11A 5DX0A 5FADA 5LQKA 3HVJA 1NW3A 3C3PA 2JG3A 3CJRA 1YFJA 2ERCA 2EX4A 3OE4A 3HP7A 5EEGA 2HR1A 5FHRA 3HCBA 4YMHA 1JQEA 3FTFA 1JG4A 3TPZA 4R6XA 2GB4A 4PYNA 1RI2A 3KR2A 1IXKA 4RTRA 1MHTA 3IEIA 3LCVB 5FWAA 2O07A 2GH1A 3M6XA 3O7WA 5P8WA 3QOWA 4XUEA 2BR5A 3FRIA 3KHKA 3B3GA 2GAFA 5BW4A 3PLAE 4QDKA 5EMJA 5C1IA 4PONA 3LX6A 2GPYA 1G38A 3RIEA 3KQSA 4P7GA 4FP9A 2AN4A 1XXLA 1G60A 4R05A 2UZ4A 1R6AA 3CBGA 3ME5A 2R6ZA 1ZKDA 4FSXA 2XVAA 2NXJA 3A7DA 3ELYA 4GEKA 3V8VA 5GIOE 3MTIA 3PB3A 4E33A 3U81A 2PWYA 3GRUA 4A6DA 1KYZA 3FYDA 5GM1A 3GGDA 5D1HA 2G8NA 1Y8CA 2ZBPA 3M6VA 5CVEA 5LQJA 5GINE 3KKZA 5T67A 1VLMA 3P2KA 4Y2HA 2OPBA 5DWQA 1PRYA 1R74A 4NECA 4PWYA 3G8AA 4KW7A 1X19A 4PNEA 4DZRA 3S68A 1Q0SA 3EVFA 2FHPA 2UYHA 4GOMD 2YXLA 5E9QA 3UJ9A 3VC1A 1R18A 3KQQA 4HG2A 3OZSA
chains in the Genus database with same CATH superfamily
4B45A 1JHPA 1JQAA 2HSZA 1HGXA 3I30X 1ULBA 2WD7B 2XDQB 5F9MA 3V1UA 2Y1EA 3A10A 3ANYB 2JGAA 4LGCA 2HCBA 2WPDA 1V7PC 4G41A 4M37A 5CIQA 5ALMA 2PUEA 2OZVA 4G0MA 1I01A 1N2CA 3W3AA 4IMRA 1TU4A 4XD2A 5D6NA 2JLVA 1UK9A 2MU1A 4KB5A 4AP5A 1WIWA 2IP2A 4N7JA 4OQPA 4JS0A 4NP6A 3WX0A 4ENSA 1T1IA 4AYXA 3SPXA 5JZVA 4UZEA 2I4LA 3NANA 2NUAB 4LK3A 5DYNA 1UBRS 1IEXA 4R3UC 3I5XA 2I9KA 2O2EA 3BICA 2G25A 3RRNA 1X1DA 3A26A 4MQEA 4LZPA 3VC2A 4DNFA 2V3VA 2R2AA 3EBPA 2ZSDA 2ZDGA 4QOEA 1M73E 2O0JA 1B7GO 3RAPR 4CU5A 1VZ3A 4ENPA 3KPUA 1AHPA 3AR3A 3K53A 3LFUA 4DNOA 1TXGA 3FSEA 1KYWA 5JDCA 2H3EA 3W3ZB 3UYLA 3AHJA 1PJTA 2PUAA 2H52A 3PEYA 3LWZA 1Z68A 2G9NA 3JAWA 1CQIA 3OCCA 1H8ED 1EUDB 3HB7A 1ZJWA 3CNNA 1TC1A 3CTMA 2OM2A 4RACA 3CBQA 1J33A 3STXA 1DT3A 3K1YA 4J3NA 1V8PA 1C1XA 3TS1A 3V5NA 2IIQA 3HYLA 4RXUA 5H3LA 1R6BX 3ADKA 2FZGA 3EIWA 4FMPA 4FW9A 1UBMS 2I3ZA 1AUVA 1X7WB 3GD5A 2ZBGA 3KQPA 3SXUA 3KJQA 2OHOA 2AOVA 3V32A 4BFTA 1UXJA 4P7KA 4R7TA 2QMZA 3EZGA 4DC9A 1JIKA 2ZETA 4G0YA 3J81k 1ZD2P 4KMMA 2PYDA 3UWKA 4A0RA 5BN3A 1M1YE 1X3SA 4DNXA 1G8GA 3I3OA 3IKJA 1XXHA 2JGFA 2EJWA 1UZUA 4ETNA 1FS6A 4MPPA 2CHFA 4J91A 4KTTE 5THQA 1SXPA 1AT1A 1GU1A 1KEVA 4PRYA 3TTXA 4NAHA 4IFBA 1QYWA 4QVKA 5IDQA 1XRQA 3FX2A 4EI9A 4WNYA 1PK8A 4YMVA 1XTJA 2ZWIA 3CZCA 4YMIA 5UKDA 1CRPA 1NT2A 1Q95A 1Z12A 1O1YA 3KSRA 3W9UA 3T5TA 2ZS8A 5LXTA 1YL5A 5IFKA 3S8EA 5D6OA 3RVLA 1UT6A 3SEFA 3O4JA 1JDPA 3OM9A 4XUCA 2I2XB 4KFRA 4TTPA 1QB8A 2M6RA 2VG8A 2HAEA 4JUCA 4POOA 5BY2A 2BGLA 3NRJA 4KACA 3DLHA 1B6RA 4K9OA 4EGAA 3BB1A 3PNOA 3U4CA 3T5AA 1N6PA 1YNOA 2QMQA 1LC0A 1DOZA 3WLPA 2YY7A 2F3UA 4CM6A 4NBRA 2H1CA 1JILA 1IQ0A 3ACCA 3T5GA 2OGZA 2XUFA 1I94B 4Y2YA 1IAQA 3AWIA 1TNDA 5K1ZA 2G09A 2J6IA 4HWTA 3ZS8A 2EX0A 1FX0A 1UPUA 4IQFA 1HDXA 5EKDA 2RI1A 4HDKA 3LHDA 4GWKA 4RVOA 4RTMA 1JG2A 3FSGD 1U7HA 2JAHA 3HDGA 2H7CA 3QOYA 2I7VA 1P60A 4HNHA 2ZGVA 3KT0A 2H2WA 1UM9A 1T5LA 1WRBA 4AROA 3HB5X 3HI4A 4Q9LA 5I51A 3K6SB 1OFGA 1UDRA 4TSFD 5K05A 1IWBB 3MB8A 1F8XA 4U2CA 5DISB 1U94A 1QO0A 4DSUA 1EZZA 3JYLA 2ZAIA 5HUJA 4RTKA 1DBIA 1M1NA 3GEIA 3I2KA 5KTNA 4QYSA 4JVLA 4D4HA 2V5AA 4Y2XA 4EY4A 2VDWA 3EDRA 3GAFA 2Q1YA 1E2JA 1WUJS 2IW1A 2QAJA 3DC7A 5TMPA 3K9NA 3PT9A 2PMKA 5F35A 2XUQA 4C0HA 4UBIA 4DNQA 4N6NA 4B35A 5A7FA 2B4RO 3D81A 1EG2A 2JVJA 3CNOA 5THKA 1M76A 1O5OA 3IV7A 1VLHA 5IN5A 3NP7A 3NWJA 4RJ2A 4HH3C 1UBHS 4JC0A 1CZOA 1GFWA 3G23A 5A7HA 3DGEC 4JFAA 1NMYA 3C3KA 3O21A 3EA0A 4NU6A 4F5ZA 3RYHA 1B93A 1ZR2A 4Z4IA 1Z13A 2GA8A 3BIOA 2PSEA 3OEEA 2NACA 4BNIA 5BRJA 4O4HF 4KC0A 1ZW1A 1WVIA 3BK2A 3CUYA 1HE4A 3LYAA 1MEEA 4HRYA 5DZSA 3FDXA 3ZQ4A 1HXHA 3KYDB 1Y1QA 1C2YA 2B4YA 3JWGA 3AETB 3QFCA 5CVTA 3T1QA 3BB3A 3H8JA 4K6FA 3F7MA 3NHSA 5DTEA 4LY3A 1SUCA 3RYIB 5HTOA 2NVBA 2G5GX 2ONZA 4JI8B 4HDKB 4ARVA 4ZYWA 3WK7A 4YRRA 3EFBA 5K7SA 4LJ7A 2PRIA 1ZPDA 2MIIA 4FHFA 1O57A 4X24A 4MHOA 4R6WA 4AKSA 1X7XB 1D9ZA 2CXRA 4IZIA 1MC1A 6LDHA 3DQPA 5HF5A 2PV7A 2E0IA 4AQYB 1ICEA 1S02A 1YULA 2BBSA 1GKUB 3G1UA 3VR3A 1RXVA 1RD4A 3WAGA 2H5JA 4TKZA 2Z4SA 4OU4A 2V54A 2FGJA 4HQ6A 1FMJA 3X1YA 1RAAA 1SG0A 3E27A 3UPUA 2XNDA 3H2IA 4O4JF 3B13B 5JNVA 2G1KA 5ECGC 1CR6A 5HFAA 2CXXA 1NF8A 3QELA 4FDMA 3AP1A 3I6MA 1KI4A 5IJ0A 1PWEA 3AVUA 5M7EA 3N0XA 2X7XA 3RARA 3PI7A 1C5KA 1DV2A 2AD1A 2HCJB 2DPMA 2YY5A 3KLPX 4IVRA 2PUTA 5AUPB 2JGEA 1KJZA 4PZCA 3WFZA 2QRHA 4CLRB 4OAQA 4ZZ1A 1RRVA 2VT7A 3PC2A 3GUUA 4UJ3A 1N9GA 2HRBA 2R25B 4W63A 4K9LA 4MV8A 1CJBA 1VLZA 4YRCA 4RDHA 3DOJA 4ZTBA 4KIGA 3VDRA 1BS2A 1NG9A 1BDHA 4I2VA 2EKBA 3LUHA 4L15A 4Z7QB 3MF4A 4P4UA 5B57C 1PJLA 3H17A 1XDWA 4NNOA 3H5LA 4YAIA 1PG0A 1RPAA 3Q9SA 4QQFA 2RH5A 2XCQA 3DZBA 1EDDA 3P0IA 4CQMB 1K06A 2QAGC 5F51A 4D6YA 3IC5A 2JRCA 4BECA 2B61A 2XA1A 1NXOA 4DLTA 1Z7YA 3E7PA 1U3DA 3GNTA 1BH6A 2ACWA 1ND5A 3OA2A 3DV2A 4L0MA 3RSGA 2H2HA 4HO1X 4WXYB 3OPNA 4P93A 5I7WA 1FC0A 3CA8A 4G5XA 4UDYX 1U5BB 2I2FA 3VPXA 1EWQA 5JS1A 1F5SA 3NM6B 3EVZA 3LPMA 3QV1A 5HIAA 4FX2A 3AFHA 4R8VA 2OQIA 3DNFA 2EF0A 3AL3A 3TLXA 4CMIA 5JROA 3E9ZA 4CMJA 5CH5A 4FHEA 4EG0A 1RC8A 1W5SA 4ZMRA 4YXFA 3KTAB 1N6OA 4IIFA 2OV6A 3ZBTA 3I1YA 4REQB 1G3IA 4X1KB 4EEKA 4LISA 4PPNA 4N48A 4JBXA 4HNSA 1PTJC 5C8YB 4PPQA 1LPBB 5B1HA 5BUZA 2P41A 4RABA 4OQFA 2J0VA 1MEJA 3IQXA 4IZHA 3L8YA 2AVDA 1E9RA 3OUUA 1Y89A 1N6IA 5BUCA 4ZAXA 1Z2OX 1TLLA 4N0MA 3DDSA 4EH1A 2W6ZA 2I2CA 1Z34A 4IDCA 3BWXA 1DGQA 4YR9A 2W5UA 3KZCA 2EV9A 4M87A 4X66B 4KYUA 4ZQEA 2XUDA 1SBHA 3ET5A 3LFHA 4NH4A 3LBIA 4IKOA 4Q39A 5HF8A 1GYPA 3EC7A 3PUIA 3QTLA 4UAJA 5HF9A 3ZV6A 4B9AA 1N2CB 2CHQA 3EQZA 4RUKA 2HHJA 3KOUA 4H35A 3WRYA 3WOHA 3FKSA 2X40A 4J90A 2F1KA 5JASA 4BO5A 3GPBA 4BOYA 1DAEA 2IHYA 3JVEA 3DEYX 4DMRA 1U2PA 1T5BA 3NDPA 1E79A 4DVJA 1XALA 1XMSA 2CFSA 4KHZA 4RMIA 3FOEC 1L4EA 2DBZA 3EVAA 1EFVB 3S99A 5CLGA 1EQUA 3AF6A 3KETA 4QFBA 4BJ5A 4G0XA 3T41A 2B36A 2IF2A 1L5MA 1QYIA 2ZIWB 3CUWA 4IXNA 4Z8YA 1I51A 4FC6A 2IHUA 1P2TA 3ROPA 3U31A 3T0GA 2HA7A 1CNFA 2P9JA 4L8WB 2Y1KA 3NHPA 5KJEA 5HX7A 5A62A 2PU7A 4QYMA 1P1JA 1XD2B 5FNVB 5HCUA 2V5UA 4RGQA 1YMVA 2WB2A 3CZRA 2OBYA 3MS2A 5IC4A 4YREA 1HDZA 3HZHA 1I5EA 2O3UA 2VXOA 4O2BF 5CITA 5KX5F 3OJLA 4GGMX 1EYZA 1KMHB 2OYCA 5BSRA 4Y7DA 3JQQA 3B7WA 4FYMA 4RTPA 2OORA 3R6TA 4X1YB 4GUDA 1E2GA 4B4VA 3IODA 4ZVUA 3WHIA 2H1RA 2DSTA 1BFDA 2QVBA 4H9GA 1TTPB 2R5FA 1YZTA 1VPWA 1IULA 1EQAA 3IMGA 3SZRA 2EHJA 2AQIA 2HJ9A 4PINA 5K3DA 2C5LA 1D3AA 3O8OB 3HCFA 4LN1A 4EHLA 1PD1A 1MB3A 3NM4A 3OOHA 3P97A 4FWBA 4BNGA 1K8YB 2AZTA 4G01B 4JLVA 4AXXA 3NOQA 5CLFA 2VZ9A 2WINI 2QD5A 4ER6A 4FYWA 4QUAA 2DJ5A 3EXHA 4QTUB 5F12A 5TNXA 1L5GB 5KMGA 3LC1O 1KIFA 3A8TA 3EAGA 1NDHA 4N7MA 4F21A 4Q93A 5AMXA 3AF0A 4Q7JB 3QY9A 3IP1A 2W6CX 4RF5A 3A37A 3ILYA 4ME6A 3OM0A 2B0JA 3I8XA 2YJTD 3LH5A 3EWIA 4PLWA 4L8GA 2HLDD 1P0FA 2IYXA 3LT4A 1B0AA 2PZFA 4XPIB 2GETA 1NJFA 3EDMA 3P7MA 3E9DA 1KDOA 4PAQA 4IUYA 3VNSA 3K4QA 2ZVJA 3DPSA 4J2HA 4BVAA 3FZYA 5FKJA 3BCSA 3RANA 3AC0A 4OX9Y 1U80A 3E18A 4FQ5A 4QDTA 2WQ7A 3T3DA 3DVLA 3JATA 1KC3A 1YFKA 4FS3A 3Q6IA 3RWMB 1R37A 5K3SA 2FEWB 2AXEA 1EVJA 1XX6A 4FN4A 1JG1A 1L4GA 1C4WA 1ZUHA 2XPCA 3JS5A 1VHJA 1C41A 3PDUA 2YJ3A 1YUMA 1IATA 3DWIA 2GF9A 4XM1A 2KHZA 1S8NA 2J46A 3FF1A 3SJCA 5JVDA 3FJ1A 2R62A 1PV1A 3ID6C 3PFIA 5AKKA 4NU0A 4V0NA 3CFYA 3EF0A 1ZONA 2Z2ZA 5E8RA 3UK1A 4M0CA 1GGFA 1II9A 2WD8A 1KP2A 1IZ7A 4N3NA 4MLCA 5LA6F 3EGOA 5LQUA 3QH4A 2C2HA 3QQ5A 3GDOA 4J1SA 4TTRA 2EIXA 5FUWA 1OYOA 4U02A 4QTZA 3OZVA 3JWEA 4AD8A 4BNYA 1YVEI 4ZOAA 1BVUA 1Q50A 1TE2A 1Q1AA 1UOEA 2GZ3A 2OP0A 1ISJA 1BGWA 4GX0A 2B30A 2DU8A 2HHCA 2XR1A 1LJLA 5C5DA 1B26A 4EMBA 4HYTA 2CXOA 4NKRA 1P2FA 1V37A 4EZEA 3WJAA 2OY0A 1UFVA 4AZ3B 2QV7A 1SZCA 5JBIA 2VT2A 3HVJA 3R5TA 5AI4A 4BFVA 1X74A 4D0RA 5JAMA 3WJ2A 3FCSB 3C41J 5LUBA 1V96A 1CE8A 3T15A 2HIGA 1DAPA 3FCEA 3HG7A 4JKIA 1FRNA 1YCHA 3HCBA 1KGSA 1Y9DA 3N2IA 1DBRA 4H3HB 4OVKA 3TE6A 4CV0A 2PUHA 4Z86A 1G8JA 2NO7A 3RC2A 3ZWVA 4PYNA 2PZ8A 1E2HA 3HKBA 3LWNA 5AI8A 3ZW9A 2V98A 1JHAA 1Y80A 2BZ1A 2C4HA 2FR8C 5CDFE 1T2DA 5A2QA 2BEUB 2E1RA 2P78A 2I1LA 3BMCB 4CLOA 3IXMA 2BMDA 2Q6TA 3NIFB 4C6TA 3DKKA 4J7XA 3WMEA 1Q19A 1TK2A 1UBKS 2YWXA 4P7GA 1F2VA 3AFOA 2ACEA 3ZV5A 1R5OA 2G17A 3F96A 4RHCA 2R6ZA 2PQ2A 4ENUA 1X7DA 4MV6A 4DMFA 1Y8AA 5KSZA 1SM4A 4MRNA 3WRWA 1DG3A 5A05A 3DL7A 4LI3X 3VKVA 5L3RA 2ZUVA 1QTNA 5JNUA 1TUBB 1Q1GA 3CONA 4I1YA 3OP1A 4N8EA 2G8NA 3BYZA 3K2IA 4ZEVA 3EZYA 3KWLA 1FMCA 2G6TA 1Q1NA 5WRFA 1WUYA 3PIIA 3IQWA 3QX8A 3P0JA 1KYXA 2APJA 5DSZA 1L5ZA 3GL9A 2OHJA 4NIMA 4R1OA 5CNIA 5IWAB 1KQGA 2CVHA 3QZUA 3M6LA 4JXXA 2B7BA 1QH1A 3I61A 1PFUA 2B78A 2X58A 5EMKA 3T52A 4ZI2A 1VYUA 3RFUA 1M0TA 2VF8A 3A4VA 2G83A 3H2BA 6YASA 3G5TA 3QVJA 1L5SA 2H16A 2YMQA 4Q4AA 3HVRA 4Y2SA 4BS9A 1KIMA 4LGYA 5FO1A 1TGYA 2OBBA 4ZCSA 2N46A 3HVUA 1G3QA 1VZ2A 1Z4LA 1GP2A 2VSOA 2Z58A 5CTAA 1C9MA 3CZAA 4X64B 1JWLA 4UPVA 4NBLA 4JDPA 1XCJA 4QEDA 5IPFA 3E5NA 2ACKA 2OGUA 4YRAA 3RSSA 2H3HA 1ENOA 1AQLA 3MTQA 1FL9A 1EJ0A 4XSGA 5EXXA 3GRKA 2W8ZA 2WJVA 3C7TA 2XD9A 1BX0A 2PKCA 3EOZA 5GV8A 5A3VA 4F5YA 4GYJA 1DV1A 2CNBA 1FFHA 1L4LA 1EXNA 1Z4NA 4Z9FA 4N0EA 3I4LA 4OMUA 2ZTLA 2ATCA 1AH2A 4WINA 5AJWA 1EGMB 2AKYA 1TF5A 4JT4A 1TKAA 4ARBA 3BTOA 1S5PA 2G7MC 2I4IA 2OESA 2XWPA 2Z6QA 5DX8A 4V03A 1WPXA 3NFYA 4UUOA 4HBZA 4KN6A 5LZ8A 5JLAA 4LC0A 5H70A 2B4KA 2ORWA 3OT1B 3SNKA 4XLZA 1Z63A 3O3MB 1MJNA 3WA7A 2ZROA 1VYTA 3W0LB 1GPMA 3Q0TA 4PC7A 4QSHA 2GCGA 2RBGA 2ETXA 2W83A 1L2TA 4K2HA 1XZFA 3VYVA 3A1WA 4H1WA 5CG1A 1I3KA 4N4AA 4CMEA 4GI5A 1MZPA 2J3HA 1K5GA 2B0CA 3ETJA 5G3ZA 4BDSA 1T0JB 4KLRA 3RODA 4PXYA 2P6RA 1UZLA 3VKUA 5DIFA 1Z8DA 1HKUA 1N5RA 3O4VA 1QO0D 1LQTA 5ERGB 2NZVG 1W8DA 4EJ6A 1L4BA 2EWWA 2FY8A 4LHWA 2BJHA 5K0TA 1ISGA 2IYTA 2QDKA 4H15A 2Y93A 2IZ5A 2X5XA 3D7LA 1N0HA 3KVRA 1Z6TA 3TLMA 1Z2EA 2P9CA 3RFFA 2UXBB 2P6PA 1GLGA 2ZB4A 4PBTA 5DCLA 4LOKA 1HQDA 1JDUA 2CB9A 1KJIA 2DPHA 2O8NA 3QYJA 5IAAA 1XNHA 4X71A 5B5SA 4GPAA 2E4XA 4HTFA 4PGGA 2JD0A 4DWWA 2JHCA 2R5NA 5CLHA 5ALWA 3HCCA 3IX7A 3RV3A 4BRUA 5JIBA 5DBGA 2XDYA 2CY0A 2QMUA 3OZUA 2W2XA 3I9JA 3UOGA 4EJSC 3A6DA 1DJMA 4TKMA 1KXJA 4P32A 1RHKA 6REQB 2XE6A 3L0YA 1J07A 3C7DB 3DHWC 4FYIA 1CDDA 1GLVA 2PH5A 2WUVA 4YN3A 4AJHA 4JA0A 4M1OA 4D9FA 1KJNA 1UM8A 2OV1A 2CUTA 3O92A 4M9RA 2QSZA 4ZCTA 3UT5B 4KR6A 4HAIA 4ARIA 4A8JC 2XMDA 4XGIA 3L7KA 1Y42X 3K0FA 1PEKE 3O03A 1I7SB 5J2UF 4EGQA 3TFQA 1C0IA 1SUEA 4MUEA 1UJ2A 3MVEA 1I0LA 4BWYA 1L7MA 2NAFA 4BEWA 3QG5A 2XNSA 1T6NA 4KFUA 4V0MA 1TCUA 1IOLA 3DUFA 4BV8A 4Q4LA 1GUAA 4ZHQF 2LKDA 2VHZA 4HJXA 3UK6A 1U7XA 1HV8A 1SHTX 4XSHA 1JUDA 1P1BA 1IN8A 1MEOA 2YWRA 3KIPA 4QG7A 3CLHA 4EUSA 1QH8B 3RAFC 1R7RA 1EFRA 5CXXA 2GNAA 4AQDA 1Y82A 2G07A 3VDXA 1E96A 2E18A 4RKWA 5ED4A 4ZK6A 3P9XA 1GRQA 3FMIA 1USIA 4B3DA 2G04A 1XMIA 2DYKA 1E3JA 3AOGA 3NT4A 4I14A 3HBFA 1D7AA 4M54A 3MTEA 4ND8B 1FTQA 5ALFA 4XDYA 2J6BA 1ZVQA 3RTDA 1H23A 4DM3A 4W5HA 4UTOA 5FXMA 3BBPA 5TF0A 3ZOKA 4UTPA 3SQXA 1ZGAA 2WWIA 5C8ZA 4R69A 2RHWA 1QORA 4OHZA 4H2DA 3S5UA 3KTDA 3H4MA 3WJ7A 3ANNA 2HRQA 2AQKA 3ZNNA 3ETDA 1NR1A 5IAKA 3II6X 3UAZA 2W6JD 1U0FA 4LQCA 4BFWA 4BPRA 5FJJA 1WB6A 3ZFPA 2L42A 4AJOA 1XMOB 1V1MB 3NEPX 3RBAA 5DRTA 2JH8A 4EQZA 1GZVA 5JANA 3NWEA 3K6SA 1E3MA 3ES9A 1XVIA 5JD4A 1Z5UA 2J59A 3U4QA 2P68A 3K0HA 4ZCMA 5FWYB 2JFFA 1PS0A 4FEGA 4KQIA 4I4LA 5JDCC 1XD9A 2QNRA 3AM5A 5AVUA 4EFLA 4R9NA 1I80A 4TT3A 3WR5A 1ZCZA 2AN3A 3C97A 2AR9A 2LPMA 4RKFA 1X7XA 1ABEA 4I8IA 2DHQA 4CMBA 1BN7A 4X85A 2GCIA 4V0ME 1PDOA 1IN6A 2JD1A 2Y0DA 3MGGA 1X1BA 2REBA 3SFZA 4URVR 2G82A 4RTJA 4C4SA 1RLTA 1N2BA 4CKWA 1FFYA 3BK7A 3OY2A 1T4DA 2M6SA 2O7QA 3GJRA 2DP4E 5J2TF 2VP9A 4PG6A 5LL6P 2G5CA 3KFXA 3Q7PA 3BQ9A 3OQIA 1OQAA 2AT1A 5D3KA 4B4UA 2H08A 1JZTA 5FUXA 1XZIA 3Q3GE 1DKNA 2PR7A 1SD1A 3TQSA 3WQQA 1KMMA 4GI7A 1V1MA 2NAPA 5DGXA 2D6FA 4LE1A 4IUBS 4WWHA 1OA1A 1JAZA 3L4JA 1KP9A 2GHRA 3WADA 1JEYA 1A76A 4H7DA 1MX5A 3WGYA 2DH6A 2OXTA 2FZVA 3IPCA 5ALLA 1SKYB 1XCOA 4YRPA 2YL2A 5LP6F 3GUVA 5I7EA 2NWQA 2JK0A 1D4FA 1NJ2A 1KDZA 5BPFA 3BDVA 2WQZA 1TO1E 3RS4A 5KDDA 3T7CA 3S2FA 3M1YA 1NL3A 4E2ZA 4DYVA 3OX4A 2SCUA 1K88A 1WCIB 2VTDA 3L8CA 4N49A 2Q5QA 2IH2A 2WV9A 4AU1A 3QE2A 4CCAA 1W76A 5CD9A 6GPBA 1SCNE 1XLTA 1JKJB 2GS9A 3BSSA 5MFPA 3H8VA 4RKEA 3IBTA 2Z57A 4G56A 3NM5A 5K3OA 3RU9A 1J0EA 2UUPA 2YHIB 3NHYA 4MA0A 4RZUA 1ZH6A 3NBUA 4IWXA 1LK0A 3AY3A 3CVJA 3GLFE 3G82C 4XOIA 3UKOA 3ZWKA 2JS7A 3H75A 3TIXB 5I47A 1OJLA 2QQ0A 1WOMA 1UBFA 2WMNB 3DG9A 3JQAB 3RUPA 1LQ2A 3W2TA 3WBFA 3RPEA 5KYYA 4WLUA 2FWRA 2KX7A 2WIKA 3QVSA 2PZMA 2YJGA 2FPGB 4LNUA 5E3IA 5JJLA 1KWKA 5EN4A 1Z4JA 2J3JA 3NTLA 4KGVA 1KMIY 1XJQA 1N1GA 4DUGD 2YTZA 1RR6A 5B1SA 3MTGA 3PDCA 1E3WB 2FYTA 2OCDA 2FMKA 3QWFA 4NYIR 4J0FA 2OBXA 2VQ6A 4Z9AA 1GQSA 1INLA 3DKRA 3LY5A 1CJTC 2JFHA 3GVHA 4YRGA 3RG2A 2R751 1V7QA 2FN4A 2ORED 3AP2A 2W2NA 3ECCA 2OV8A 1HE5A 4GPZA 1L5YA 1JXMA 2O1WA 5JE8A 3LQFA 3FOBA 3RS0A 3X1WA 3F5FA 5ALZA 2P4HX 4ZCRA 4OHYA 3CLTC 3DH0A 4EPTA 5G3YA 3VAYA 3Q7QA 4ND6A 1S3IA 2B6HA 3ZHZA 4HVCA 1JR3E 2IUEA 3AM4A 3TNYA 4EFDA 3F0TA 2QU7A 4FGJA 4PW0A 4C21A 2ZCJA 2CJPA 2DFLA 1JHMA 4FS8A 2ISCA 3NYRA 1LCIA 3D31A 4OPMA 1GNRA 5FPYA 4JP3A 4DCJA 3FHJA 1ODIA 5C8DA 3CCFA 1NVDA 4MR8A 4A1FA 5BQXA 1G6OA 1OPXA 1T26A 3FLBA 4TQAA 3RTEA 1L4HA 4RJTA 1D2HA 3AEYA 3GOHA 4UAGA 4G09A 2CLMB 5G1PA 1Y6RA 3TBHA 3FWNA 3UMFA 5LQCA 1BWQA 2GSWA 4RK1A 4CETA 1NRXA 3HNPA 2XNHA 2Q5OA 2XKBA 2IEBA 3ZCQA 2UUBB 3TVTA 4Z49A 1PN3A 2YFYA 3OZCA 4ZPXA 2I2DA 2ZJZA 3UG6A 3A9VA 4FIZA 4FTWA 3U5TA 1RXCA 3ABIA 4O4LF 1O87A 4PAOA 3HCDA 3P2EA 4WAUA 2G7ZA 5TXGA 3LXUX 3WZMA 3PQ8A 3CISA 4N5IX 2PZBA 3O82A 3SS9X 3ZI0A 5JI3E 5LDDC 1L7XA 2O23A 2O54A 3LF1A 1RCTE 1B8NA 1EFPA 3WNZA 3ZY6A 2FPPB 2MYPA 3B1VA 4FLFA 1AK2A 5CLIA 1KFEB 2C0PA 2F9MA 4RDCA 2ZG6A 2R11A 1DELA 3IHKA 4MUGA 5LYYA 3VJKA 4E12A 4JXKA 3ZK9A 3UT5A 2VH2A 5CJ2A 1L7EA 2HSEA 2V7XA 3JSAA 4U2FA 3L82B 1HDEA 1ZUNB 3E53A 4EIWA 2OTCA 5E6RB 4DZTA 4PX5A 2A4KA 1Z6XA 2JIRA 3L0PA 3O3CA 1RQRA 4QFCA 1X9HA 2XGGA 3WWCA 1A97A 5LWHA 6REQA 2R7AA 4HWGA 4Q00A 4D3FA 3B82A 3JD1A 1YDFA 4BWFB 5BMVB 1PFKA 1YNSA 3TPFA 4DL9A 1PT7A 4IRXA 1AGPA 3EBLA 4UFNA 4BQNA 1NYRA 5JRJA 4A7PA 2QWXA 1JQKA 1TM7E 3BUSA 4ZFNA 2D1TA 1GVHA 4PYMA 5LQDA 4QOFA 4NENA 3V4VB 4F3KA 3K9BA 5IKPA 4C4TA 5I4KA 1EEXB 1QK3A 4NEQA 4EEXA 4GMFA 3BAZA 1JQDA 3LUDA 2GBPA 4MVJG 2XTNA 3HLKA 2V58A 4HH1A 3NORA 2Z1DA 3EMKA 2QBYB 1CZNA 3CWCA 4K88A 2GEUA 3D1JA 4WFKA 5ALRA 3V9PA 5AM2A 3PFGA 4BBAA 5CFNA 2EDCA 3D3WA 3AVPA 4EJMA 4HLNA 4K26A 2RGAA 4G5SA 1IBCA 3RU7A 1W46A 1E98A 2HWXA 3D59A 4A82A 2EKZA 3ORSA 2MSEB 3SSOA 5ICMA 1YZVA 1PNVA 1ZL0A 2XD4A 4TZ6A 4XVQA 4C5CA 1XTQA 1YVPA 4UXIA 1KHHA 4HWOA 4RPHA 4PCVA 1JIUA 4CZ2A 2JDIA 4OB6A 1ZQ9A 4YIHA 1UWVA 2H2DA 1ECLA 1EI9A 4EJSB 4C7XA 3N87A 1YC5A 3QWHA 4MV1A 3A4TA 4QUDA 2BFWA 3BPSA 4X60A 3RVSA 4OQNA 4CM5A 1A8IA 3U4MA 3I4FA 2E85A 1MOQA 1YHZA 4U0JA 3OFNA 2PV0A 2QTTA 1A7KA 1CUFA 1Q84A 4YYEA 5J43A 4R1NA 4E13A 1VJTA 1RHQA 1NQAO 2ZS9A 3G7SA 1HYQA 3EIQA 4RHFA 5JY1A 3G9QA 3WL7A 3H5AA 4NOJA 3QFSA 3KDSE 5JXHA 1O2DA 3GVPA 3A6ZA 1VJDA 3R0VA 1MMFB 1PD0A 1XZCA 4NICA 2YHSA 2TMYA 3ESCA 1TEXA 3GQBB 3C3XA 3SHWA 3VYUB 3CZ9A 5BNIA 3RNOA 2AWNA 2J0QA 2F1HA 2MJLA 4N7BA 4IEIA 4PFKA 2ZT7A 4PZAA 1A69A 2JG3A 1QCZA 1T6XA 1WW8A 1CE8B 1MRNA 4MRMB 4B7ZA 4EELA 4MUMA 1V3QE 2YIVX 1NN1A 3E9YA 3NP9A 1EE1A 3EGCA 3I62A 2O7NA 3FTFA 1T9BA 2HF9A 2WJWA 3ZI4A 4AZ3A 2OAQ1 2X8JB 1UPTA 6PFKA 1GZ5A 3S40A 2BKAA 3T7AA 5B7QA 3H3XA 1FNMA 3TI7A 2ZB7A 3KUCA 2Z3ZA 1JXQA 5C80A 2ZRCA 5L4SA 3DTTA 1BQ4A 2ZRDA 1Z36A 4ZGBA 2CFCA 4JJKA 1NQ5A 4AWXA 4BNFA 1ZJ4A 1FJ2A 3A6LA 4AC9A 4CL8A 2KBFA 2OECA 2Q62A 3ETGA 3CG0A 3OWOA 2Z43A 1T5HX 1IB0A 3BB4A 3QHAA 1HEIA 2O4UX 1YK0A 1V2GA 2WZCA 3H13A 1NF2A 2F3QA 5CX1A 2ZJYA 5LPNA 1O95D 2BEVA 3GGDA 1J1ZA 2ZSIA 2PSJA 4GKVA 4HMPA 4JYCA 4K86A 4ND3A 5LQJA 3HNOA 1FXSA 1RXUA 4EAAA 4P38A 1QU3A 3LUPA 5EIXA 3DYIA 1AKNA 3EZ6A 2EAUA 4LJKA 2J9XB 1HNWB 3N8NA 1AOXA 1ZJ5A 4QUHA 4HG2A 2IT1A 1Z35A 1CB7A 2C3OA 3AVOA 4D4LA 2WE7A 2JFBA 1VA5A 1W25A 1U2EA 3DD1A 1EFKA 3WO1A 2JI6A 1ZAYA 3QXJA 3IHWA 1P4GA 1XQ1A 2BEUA 2NSHA 4FOPA 4HEA1 1UBNA 3UKJA 4DADA 4BHTA 1Y6ZA 5KB3A 4LE2A 1Z39A 2G8LA 2PSSA 5DNCA 1DB3A 3NYQA 4GX5A 4B3RB 3SJZA 4D0SA 1E1RD 1S7CA 3Q98A 5CT9A 1NG1A 3OQHA 3P9KA 5SZJA 2J9FA 2FFQA 2BHSA 1ZVKA 5BSVA 1IN1A 4NZZA 1JEQA 3DE5X 2O5EA 4CG1A 3RKSA 1CF9A 3AUXA 2QJFA 4YJ3F 4B3SB 3NR2A 4BZQA 1V3VA 2OYSA 1I10A 2YNMD 5KYWB 3U7EB 4I5FA 1XAHA 1MX9A 3LQRA 3LBHA 3RT7A 4F3CA 3GQBA 5K99A 4KNWA 3F3KA 1ADGA 3HLTA 2GTHA 4KGZA 4CCYB 3QEKA 2YUTA 2EFHB 3DEJA 3OY7A 2NU7A 4NV0A 2G77B 5EA2A 1W5EA 3EG9B 1XDBA 3F73A 3ZHUA 2HH9A 3UXEA 1KAHA 2JIZA 3QYPA 4AJ4A 1NVFA 3KZNA 3BGSA 4GMKA 4B2IA 4EZBA 5HOQA 5PGMA 1JFFB 3W5CA 1Y5RA 4YY3B 5G4LA 4TXJA 1JYEA 3M8KA 5H3HA 2BGJA 3WGQA 2DBYA 3F8TA 1BVYF 1L3BA 3W5AA 4ZYVA 3KBOA 3P9QA 3M5DA 1LA2A 4AVYA 1SZJG 4EAQA 3H5OA 1SKBA 1R8JA 2ZBVA 1JGTA 4Z0NA 1EVQA 2A92A 5JD6A 2VK1A 1O8CA 4I5DA 2EG9A 3HCRA 3QX7A 4TWBA 3H83A 3CQ9A 3X2FA 2R1UA 5ITWA 1I32A 1LVHA 2WP0A 4IHJB 3NHRA 1KERA 3GT3A 4L5IA 5C32A 5JCOC 2BM9A 4EB8A 4V0LA 5EIOA 4TOIA 4B7AA 3HN2A 4FHZA 2NSJA 3TE7A 3TZQA 4I1SA 2YWGA 2CBZA 1AGRA 3OPYI 4R1MA 1H4TA 3W2EA 2EGHA 2XVXA 3SX4A 2JGLA 3NO4A 4XPIA 1RZUA 1P81A 5CYGA 5CFMA 4BKPA 1RBQA 1XZEA 1RI5A 2J07A 3DKIA 4UOZA 5LIPA 1XQYA 1QVZA 4LF8B 5F78A 5F7OA 1M8FA 3CM0A 4Y2VA 4N5MA 1P17A 2ZSAA 2XUGA 3H9UA 1OILA 4Q4CA 5JXJA 3RVBA 2E4VA 2QUKA 4P6VF 2D7CA 5DNDA 2O59A 3H8WA 2UVQA 1A82A 2WWYA 2J09A 5H02A 4E03A 4DYDA 4I4CA 2AMVA 2YV3A 5EWLA 1RQXA 2DTDA 3C3EA 3LPLA 1OI2A 4OJKA 3W06A 3GN1A 3N1UA 1HKHA 5IABA 2PSHA 1FCJA 4WKCA 4A92A 3K0SA 3MFYA 4NMMA 1WF6A 4Z4QA 5ICSA 1R6DA 1Z56C 3KJGA 5HFNA 1B2LA 4WY2A 3WGIA 2RHLA 2HFKA 1PNQA 2PMEA 4B4DA 2NXCA 1C29B 1GGKA 3ABZA 4J43A 2QUJA 2YIJA 1GPDG 1H2HA 2P2SA 1VTKA 3AMVA 3BA6A 4CMIB 2XZLA 2WYHA 4P92A 1MABA 4KQWA 3GOQA 4OFBA 4EGSA 2H0AA 5IG2A 4PYRA 1GCUA 4AG3A 2GGSA 1GQQA 1WMBA 4Q16A 2CLKB 4XB1A 5ENZA 4RZXA 3U80A 4RK6A 4ARUA 2FTKE 4RK4A 1XVUA 1G19A 3QXSA 1QQ7A 2BR4A 4XJTA 3SC4A 2XMPA 5LP1A 3T61A 4RVGA 1J8DA 1QCDA 4HFMA 1TI7A 2ZYVX 1A5AB 2YHAA 3P52A 2ZI3A 4B4OA 1T3HA 1DJOA 1JSXA 2WKSA 2Q45A 1M5UA 4B3JA 4XWAA 3Q2KA 4YP1A 3CSUA 1ZRSA 3SDZA 4LF4B 1KYQA 5EJ9A 1SUSA 3ENNA 4FCWA 1JNXX 2QRPA 2RHRA 3CRW1 1AZTA 2ZIXA 5DW0A 4PLYA 4CBVA 2FPKA 3OOEA 2RHOA 1VFPA 3Q5DA 3WXBA 3RK0A 3ZNPA 1VI5A 2D00A 1JECA 2DUNA 2ZJFA 3R0JA 1E89A 1XNJA 1XN1A 5CM2Z 4BIMA 3VOBA 3MAGA 4Z0PA 1Y4AE 3JPWA 3M9LA 1JAYA 3SYRA 1K7CA 3VDMA 4RJIA 1W8IA 4RF2A 4K03A 2QM3A 2DEUA 3P8ZA 4HLUA 1D2MA 4QBKA 4ZAYA 3SKYA 1X1SA 5CEEA 1WW2A 2R1TB 4I19A 3MS4A 1DBQA 1TZ2A 4Q6BA 2QTMA 2PWBA 4CIYA 4LRQA 1X39A 3DZJA 3MT0A 3L06A 5C8YA 4HZUA 2PL3A 4KDCA 3F2IA 5FTKA 3VGPA 2B83A 2DQKA 4YCNA 4C0JA 2QENA 4YRLA 4HBGA 3VOSA 4GOXA 3ZE8A 3KQYA 4W7IA 1LNQA 4DMCA 2XE8A 3I5YA 4JU8A 3VM6A 5TE9A 2O8BB 3KKLA 2R87A 4QJ3A 3G7UA 4KWTA 4IICA 1K68A 3H5TA 4EOGA 4A36A 3IQFA 2JC3A 3DF7A 4OLFA 5LP6A 1RXSA 4JYBA 4O4IF 3MT8A 3F5SA 3NYIA 5IXJA 1CY4A 3OJ0A 2IWRA 5ALIA 2JFWA 2XT6A 2JHGA 3CJTA 4IW3B 2H1OA 2H1SA 2C7GA 1B6GA 3HUEA 1NVBA 3H6KA 4WT7A 2C2MA 1GZSA 1MGOA 1SBTA 2AL7A 4D5EA 5AW5A 1S2OA 3NUZA 4GPBA 2HBRA 4HRAA 2GARA 2FZKA 3F3MA 4GKAA 4K05A 4LMBA 3ANSA 4UEKA 5TT0A 2ENWA 4AUNA 5H9WA 1R0SA 2D7DA 2QLJA 2RGNC 4E5UA 5JVDF 3GAAA 3W7BA 5DB4A 1I4LD 4R8KA 3ZXIA 4D9IA 2YCBA 4FGSA 3QF7A 4L02A 2WTUA 4RIEA 3QLEA 4WH0A 4D6PA 1V4NA 1NP3A 2EIHA 3FYCA 4Z9BA 1JB1A 4ZWNA 2QUHA 1A9XA 3ORQA 1U0NA 5KVSA 2UXDB 1JI3A 4YX9A 2ZSHA 4IJWA 4YIKA 4EUKA 4XWOA 4CLRA 3BFXA 4ITRC 3VPHA 4C0AC 5JHHB 3R9XA 2O06A 2KLBA 4B46A 4U7DA 3WIVA 4B3MB 3BFPA 2GHIA 4IDAA 3KVOA 1A7AA 3O26A 1OXMA 2QPOA 5G0SA 4YTEA 1T8UA 1LDEA 1C4OA 3HB1A 2CL0X 1JWAB 4JC4A 2YJ5A 2CLLB 1G291 3N74A 8GPBA 2J3MA 2GBLC 3K0AA 3TDKA 3MCUA 1XQ9A 4PHTA 4C0XA 1PV2A 2ZB8A 1HT2E 3OQIB 1YVDA 4A16A 3O83A 1ZJYA 4L6IA 1FNBA 4CUJA 3RDPA 3ZWBA 1F4LA 3OLCX 4NV1A 3STHA 5IXYA 4XM0A 3ZWXA 3PHJA 1BG6A 2ZI6A 1K7XB 1C80A 4D56A 3K0EA 5T6BA 4C22A 4F38A 1FJXA 5DX1A 3U7QB 2GEKA 5AVWA 3U61B 1ADFA 1FXWF 4YA6A 3TRFA 4RPJA 1KH2A 4CIBA 4PLPA 3OOSA 3FCOA 4OLHA 3UOWA 2C82A 3M83A 1ZSVA 4K9MA 5GOZA 1G8FA 1E9CA 3O47A 4ZICA 2Q6OA 2HQRA 2VDQB 1WCYA 3LT2A 5JH7B 1ESZA 4JVOA 1GTVA 4LRTB 2Q3BA 2W22A 2ZR7A 4QA9A 2JARA 4CTOA 2Z3VA 3GLIA 4M98A 1JKFA 4G1EB 1SB9A 5LXTB 4A0QA 2PA3A 4OL9A 1FTSA 1YB6A 2J7KA 2ZUUA 1J9ZA 4HATA 2LRHA 3CZMA 3LLMA 4FWTA 1KJ8A 1W4LA 3VJMA 3DEKA 1UKYA 3DW1X 3EIUA 2Q50A 5LQAA 4XFJA 2BSAA 2JLYA 2LUOA 2DECA 1CR4A 1VHWA 4P1ZA 1W9MA 1XDGA 3TTTA 3ZU3A 1GAWA 2BDTA 1Q21A 3Q87B 5AH0A 1WXGA 5BURA 1TJ3A 3CR8A 3H16A 3CX7A 2DUMA 3PX3A 4FYXA 3FPSA 5ALGA 4QARA 4D79A 2C54A 2J32A 4M4SA 3THRA 1QHEA 1M8GA 1ATIA 4Y2QA 1O6GA 2XZTA 4C87A 2BLNA 4WKNA 4NFYA 4KPEC 1E9BA 3HUTA 3TFWA 1VGRA 1W85B 3PHCA 1WXQA 1BO6A 2BI4A 2QLMA 1XPOA 2FQQA 3JQRA 4TWRA 2ZRHA 3R5KA 3SBXA 5E9WA 3B38A 1U8ZA 3PT5A 4IHKA 4NR0A 4E5MA 3L3BA 4Q3OA 5AKHA 1HTTA 5I9BA 3CH6A 3WGUA 3MYYA 3ZJ5A 4PC2A 3DDCA 4A8PA 3ZY2A 3ILSA 3HB0A 3D7KA 5AQEA 1VMKA 3LKZA 1E5XA 5AVYA 2EW2A 2Q1SA 3K5HA 1KI1A 2PAFA 4JEHA 4X7RA 4DA8A 2FOXA 5KOJB 3KOYA 3UJDA 2MSNA 3C3JA 5DI9A 1TB4A 4BYMA 3FR8A 1USKA 1WDLA 2YV5A 3WGKA 3DTVA 3WBJA 4ATNA 4TT8A 1K4KA 2VATA 5ESXA 3CSSA 4E2XA 2QUAA 2ZBEA 4BX8A 2XXAA 3HUFA 2OBFA 3D8BA 1B8UA 4LY6A 5FOUA 2QIOA 3KKPA 3G0GA 1Z16A 4YRJA 1VM6A 3HB9A 1G2OA 3NGLA 3R8XA 4YMSA 3PF9A 4M0UA 3WGNA 2P9FA 4G1MB 4TMWA 1WEHA 3T8YA 3JQPA 4WFIA 2IPMA 4Q15A 2OQVA 3RIXA 1PJRA 1DWOA 1I5RA 3PPXA 3EFHA 3NIGB 4RJKA 3KQMA 3GNQA 5ED0A 4B6RA 2HKIA 5SY9A 4PN7A 2OG2A 3J80A 2LV8A 4JMLA 4MB0A 4F7DA 4RZ2A 2VDUE 2WUWE 2RH4A 5DYYA 3T7SA 4DR1B 1RZVA 4Z51A 3JQBC 5I45A 1IUPA 3SJUA 5CBPB 2BP7A 3ZE6A 3DQQA 2CMKA 4ALLA 3RE1A 1Y98A 1T29A 3OLVA 3P2MA 1T2UA 2WJJA 2JJYA 3HRHA 3HKEA 4KN8A 2Y0BA 4HDRA 3O2JA 3GPCA 4Q21A 1E6WA 5ANRB 4MMZB 3ZQUA 3ZTTA 3S8YA 3DTYA 3BRWA 4QT0A 3RREA 5F5XA 3RRYA 2HHHB 1SXHA 5LJLA 4Q4JB 4F98A 3K09A 1N36B 2E49A 1CF2O 3CLRC 4R68A 2A0UA 4RL4A 7MHTA 4C88A 3G0HA 4GP7A 3RROA 2CFIA 3ZE0B 2A0KA 1FFGA 3GJ3A 5ALYA 2CMDA 3EA5A 1KC1A 2DJIA 2PBFA 3Q3CA 1VKHA 2HEIA 2VXBA 4PGAA 3CX6A 4PX3A 4QQ8A 4RKYA 2A5DA 4C3ZA 2X4LA 3B85A 1E4EA 1KA9H 1ZMBA 3E81A 2HGSA 3GZ4A 1O6FA 1ONNA 1QGZA 2VWPA 1Y7LA 3D1LA 5BSUA 2M1ZA 3UGQA 4DLSA 1NXPA 4FE7A 4ZARA 1NN3A 1F38A 1SIUA 3NC0C 2LKCA 2NGRA 2R6AA 4F84A 1I7PA 2GAJA 2XYHA 3FTPA 2VRWA 4MI9A 4LVNA 4HC4A 2Q21A 1NFRA 4ITVA 3QM1A 2ZK7A 3CRZA 1K3TA 1UK6A 1XJ5A 3OLQA 4GP9A 4RLFA 4R1PA 2V9CA 2NSLA 1TIBA 1E1CB 5K2MA 5H59A 4AJNA 2D1SA 2MOKA 1E1CA 1Z73A 3E1GA 3F7TA 4PZUA 2PGAA 1G8KA 4D02A 3RIGA 3G5AA 5AW0A 5EEGA 3ONDA 5FHRA 3IT1A 1AKQA 2IXFA 4BO2A 4EPYA 1T6ZA 3OEWA 1JG4A 3E3LA 821PA 4JI0B 4KFSA 1NUAA 2UYYA 4WNAB 2C1ZA 2I3BA 1LPSA 2PRSA 3M49A 4Q3CA 4F93B 1LDMA 1RLMA 2PHZA 1XN4A 1BCRB 1GPKA 2ZI9A 3LCVB 3PICA 4HP8A 1NMXA 4M0DA 2R1VB 2JGIA 3CLKA 2GJ8A 3DBLA 3HP4A 4II3A 5A1JA 2HRZA 2RONA 3H2SA 4RO0A 2ZSJA 4WMLA 4X00A 3A06A 5EJIA 5FI3A 1FTWA 1THGA 2EFGA 3K2QA 4IEEA 3LQ1A 2FPXA 3OJCA 4UTVA 2UZ4A 3SG0A 4DIBA 1M34E 3AF3A 1USUA 2RSLA 2INGX 4CTNA 3ZH2A 3S28A 3V8VA 4LW8A 1OWMA 3NHJA 4J9UE 1DC4A 4UNSA 1FDTA 3M6VA 2OO5C 3KKZA 1ML3A 3OAAA 5C1DA 1N8NA 5KYXA 5JOQA 2CD7A 1ZIYA 2BDUA 4KW7A 5CW1A 2ZXUA 4R16A 3DLTA 4LBWA 4MQ5A 4ZVKA 5ALUA 2FHPA 3F67A 3L92A 2VL7A 4Q9AA 5F64A 5IASA 1MP0A 2M2IA 4K6GA 3PR2B 3BE5A 1GQ2A 4DC1A 4CJXA 1RHUA 4DE5A 3BXHA 1R50A 1GPBA 1YACA 2R3SA 2UVPA 3EYWA 2NXEA 2QLBA 4XYLA 3A14A 1G9TA 3ZI7A 1CP3A 1UP4A 4KI7A 2YINC 1GPH1 4IFTA 3RC3A 3HKCB 4IOJA 4KR9A 2WWTA 1DDGA 3KDPA 4M0KA 2D7JA 5AW2A 2WHYA 1YB2A 4OOEA 3ZVNA 4IXWA 1OHHA 9ABPA 4IF4A 3SIRA 4ZT6A 3PNQA 4KQEA 1OT5A 3P9ZA 4X91A 4YJ2A 5JCJA 1AZWA 1K6EA 4ZOEA 3GRYA 2K87A 3K9LA 1Z2CA 3QU7A 4PG5A 4YMTA 2QRMA 3I8SA 3OMXA 3EZ9A 1DLIA 2WIAA 2H4JA 3WDKA 1TUEA 1PS8A 1I33A 4HDSA 3WIOA 1F48A 5AFSA 2Y77A 4D26A 4DDVA 4R9SA 4GR5A 4H0FA 1TIPA 3QJYA 2D13A 4LI0A 1TJ4A 3NBZC 4ZIRA 2CJFA 5FTWA 4NSNA 3CYFA 4RD6A 1BMFD 3GP8A 1H2BA 2PXHA 4QOHA 4QPZA 3Q9LA 5ILGA 1T4CA 1IZYA 1XLUA 2FWIA 1RC1A 2AG8A 3UXHA 3H3FA 1JSZA 3CNQS 2YR0A 3AGQA 4UPDA 4B3HA 4ERNA 1ES9A 1RQPA 2XZDA 2FMUA 5D3MB 3A70A 1LDYA 3KAPA 2NV6A 2HF2A 2P9EA 2VCEA 1ETUA 3PDJA 1X1EA 3WO0A 1GDTA 1YZKA 1VKOA 3AIIA 1TAGA 1J2JA 3JQAD 3L7JA 4OB7A 3OX3A 1C0PA 4INPA 4TQGA 1UDWA 4DV4B 1XYYA 4YRFA 5IM5A 5B3LA 3O6VA 3A2NA 3COJA 2EKPA 5KUTA 1JLLA 2XIJA 3TG8A 1GG5A 1CY2A 4GZMA 5G0VA 1YGPA 2FSHA 3C8HA 3QVMA 3UJ3X 4ZV7A 3VTFA 4YP7A 3PC8C 1J20A 1Q7GA 4E2FA 3G2IA 3KPWA 4L22A 1U2ZA 1Z82A 2DPXA 3TJZA 4XARA 3W8RA 4LZZA 4F86A 4G86A 5B7PA 4O33A 3KKEA 4GR4A 1X0XA 1H2ZA 4CCYA 1GA1A 4B85A 3I34X 8MHTA 1UMDA 1XPUA 4BMVA 4F06A 1PR3A 3ZZ1A 2PNFA 3COZA 4CM8A 4EKDA 3N8GA 4G1CA 1QCCA 2AX3A 5C1PA 4K6HA 4WCFA 1C9NA 4LOHA 2GYUA 4YRQA 3DLIA 3V97A 3VX4A 3JQFA 4ZVLA 1RMYA 2LDBA 2G63A 1L5FA 2GVZC 3I09A 3QA3E 3EXHB 3VZDA 2R6HA 5EERA 4W5TA 3ICPA 5B2FA 4DA7A 2PZJA 4EO9A 2PJDA 2XYPA 4QUEA 2PT7A 4CM8B 3LXRA 4EJ2A 5K6AA 1ZOOA 2ISSD 3BEDA 5AW1A 4J03A 2NU8B 3C0KA 2IYZA 3HCNA 1C2TA 1X1RA 3N7AA 1JRLA 1Z83A 4S35A 5JS2A 4IHAA 1MPXA 2CLSA 4R2LA 4U7GA 3SBOA 2Z2YA 1CEEA 2G08A 5J2TA 1E6KA 5JJIA 1KO8A 3QFHA 3E7XA 1QIDA 3DPUA 3PL5A 3STVA 4NE7A 4OJMX 3VR0A 1YIDA 1D09A 1CERA 1XYVA 1EU1A 3R5XA 4IO1A 4LKOA 5FORA 1UJMA 3U1VA 3PEEA 1NOJA 2HMVA 1OAAA 1XZKA 5A4FS 3TF5A 2QX9A 1WW3A 4O1IA 4W4TA 1XD2A 5LXTF 2WAMA 1SBQA 2I8CA 1GTL1 2R6R1 2ZWOA 4J0QA 4UHCA 1AGXA 1CR2A 2BCJQ 3LF2A 1CUUA 2IV7A 3SOZA 3TW4A 2Z4TA 1YK1A 1R0XA 4GX1A 3F4BA 5T8KA 3HADA 4C7MA 4E5VA 2F55A 3WLLA 5SV2A 1Y8QB 4HXEB 3F1LA 4US1R 1X87A 2O6HA 3D6TB 3EAQA 3HZZA 3TEFA 4JELA 3M7IA 4OMFG 3UGJA 1LWOA 4HX9A 3URKA 3W4KA 4F2GA 4K3VA 5A1TA 1DC3A 1S2LA 3C3YA 3ICQB 1US8B 3IAHA 5HZKA 4B3TB 1J49A 2VQFB 1T4GA 2CVQA 1TVMA 1V6AA 2IYQA 1C8KA 1QPBA 3B6KA 4RQUA 4U3JB 3U48A 5KTRA 1LSUA 2VA9A 3UHPA 1L8XA 3FRJA 3F6SA 3I28A 1RBZA 1UPCA 1VRCA 2GKOA 2IHTA 2O2CA 3AFMA 3E9NA 3ZTWA 3ZLTA 1U0JA 3ZZUA 4YT8A 2PVPA 4X62B 1WNFA 4NX2A 4OXKA 4UVEA 3SYTA 4RH3A 5HBRA 4GRAA 1UR5A 2GPJA 3P26A 3I9V1 3OHPA 2YZKA 5EL0A 2C4VA 3ONVA 1KMQA 1L5WA 4YI5A 3T7KA 4A10A 4DA4A 1NQOA 2BCEA 1G8SA 2DG2A 2Q3CA 2VWGA 3QFFA 3KZVA 5BQOA 2OFXA 1ZI8A 2AZMA 3W77A 5HHTA 2VT3A 1RAHA 3UM9A 1PLLA 2H65A 2X76A 2HIAA 4HL6A 3MLEA 3TO5A 2ATEA 4KDFA 4M22A 1BRMA 2QS9A 5DH9A 1QH0A 1WJGA 1E99A 1VIDA 1ZUNA 9LDBA 4O2AB 4RAOA 1T1JA 3BGOS 3HS3A 3ZQKA 2HDNB 3U56A 1JPJA 3NATA 2PL5A 2OZKA 4L4UA 4P3PA 4GMXA 1WSBA 3AR7A 1EH5A 3SR4A 3QEMB 2ZITA 2H9AA 1H93A 4XPZA 5L53A 1ZJ6A 3GD7A 1F2DA 1UJNA 1YUBA 3DZFA 4O0MA 1I7DA 4DKXA 2QQFA 4N03A 2H31A 1U5BA 1L4MA 2DHRA 2J5RA 4J29A 4RD3A 3AXTA 4GLBA 3VNRA 2BKLA 4C3UA 2CWDA 5TT1A 3BC1A 1FJHA 2ZE5A 3T5CA 1WHSB 3IKVA 2E48A 1M66A 2AZDA 3K1ZA 3FAZA 2FN9A 4QM7A 3C45A 4LXHA 1Q7TA 1JR2A 1LDGA 1AO0A 1QDUA 4Z6KA 3N2GB 4FW8A 4IR7A 1R8YA 3RSQA 1DADA 4Q03A 2P7IA 1PZEA 2AOTA 2OORC 2P1RA 4RK7A 3GLFB 1Z5ZA 2XBUA 1GZHB 2OAGA 3F3SA 3I0ZA 1XZDA 5DLDA 2Q2QA 4RVSA 4ZXFA 1I2BA 4CM4B 3G9ZA 1JXOA 2A8YA 3M4NA 3JQFC 5CDSA 3ND9A 4J1TA 4J6FA 3DAPA 3VVBA 5FOQA 2NU9B 1S9DA 4C78A 1D4ZA 5G0UA 3WL6A 1D8AA 1KE1A 1H0HA 1TGVA 3E2PA 5U4XA 4FNAA 1DKPA 2UYOA 1LS1A 3P9CA 2HJRA 3VH2A 4B3XA 1CP2A 1ZIPA 4RPKA 3CLSC 3ZDXB 1U3VA 5JV5A 2AMLA 5FA6A 2FKNA 1Y1PA 4EI8A 3CN9A 1EA5A 1WDMA 1HTWA 2H7YA 2ZYTX 3N0VA 1J7KA 3OM8A 3MFQA 4QECA 4DTCA 4NFLA 1PJBA 3I04M 1Y4DE 4G1FA 4ALNA 5JQWA 1G21E 2C9CA 2CC2A 4K0KB 4BGVA 1TFRA 2P2GA 3SF8B 4KSYA 4MS4A 1WY5A 4KE8A 1RWBA 4MARA 5HMMA 1WCWA 1CS4C 1D04A 1VOTA 2HJWA 1SQ5A 3G49A 2XYRA 1N57A 1RKVA 1R1DA 1U8CB 4QDOA 4BVJA 3E5HA 2B2XA 3VVLA 3MERA 3RHTA 3BG5A 2C7BA 4HAUA 3V42A 1QDEA 2XQFA 4ZP1A 1WXHA 4F9EA 3K1JA 5TS2A 5MN4A 1YONA 3D6NB 4DNPA 3HWX1 1CF4A 3ZOZA 5E0OA 2XV1A 1H2WA 1X80B 1NPTO 3COSA 4C7VA 1UMKA 1LLUA 1PFWA 2OB1A 3PFKA 5HSGA 3A2KA 2FSUA 3EY9A 1HURA 2AOUB 1MV8A 2C5BA 2WT4A 1ZIOA 3F98A 5ES3A 1M0SA 4RWZA 1J24A 2GCOA 2JJ8A 3B1KA 5DHTA 4LMPA 3VUEA 4RA9B 2XJ4A 3H8SA 1EVZA 1JSLA 1M33A 1JDVA 5I8PA 1OLXB 1TMGE 1XG5A 3KPVA 4P4SB 4ARZB 3SIXA 1L4FA 5IKMA 1RBMA 2BP7B 1KDRA 1W4AA 521PA 5IJAA 3A3PA 3GRAA 1CFJA 2R9VA 4M46A 2JCSA 4R2KA 3I53A 4MX8A 2HA5A 2C29D 1R88A 1RHJA 3C5HA 4TSRA 5DM60 5AKGA 2VWQA 1U3TA 1Q0ZA 1WEKA 2PMWB 4M49A 1DXOA 3FB1A 1Q2UA 4CN8A 1JAHA 2CVOA 2FE4A 4LVCA 1OXXK 3QTTA 5NULA 2IY7A 1Z3CA 3I0MA 4R98A 4IIJF 4RVNA 4XSVA 4TSFA 2YC4C 3JALA 4KIFA 4TZTA 3WYBA 1FXUA 5IJ0B 5JQGB 1I2AA 2NTJA 4MB2A 3HSSA 1A9SA 1YXMA 1NM5A 3RVKA 3I72A 4QSMA 3AUUA 4POAA 1ONBA 2YXBA 2ZYWX 1R8SA 3O8CA 2ZM6B 5BSGA 4LYEA 5JECA 2NP6A 1THMA 4AF6A 4YPVA 1OSNA 1T3GA 2BFAA 1S2GA 1KPGA 4X95A 4H0CA 3DLBA 5B53A 4KIWA 3IALA 1N5DA 3MGAA 4ES6A 1YS9A 2I4NA 3BWEA 3QSYA 4KGDA 4RTLA 3R8FA 1XFDA 2O2GA 3CUSA 4LVOA 4Q9NA 4I50F 2NZ8A 5FPQA 4CG3A 1JDBC 4CCSA 2Q07A 1JT9A 4TTQA 3EXFB 4F4UA 3QTBA 2OAP1 1IN7A 4UBKA 4V0QA 4FB4A 3ROMA 1KI6A 1NVKA 3FCUB 4RFLA 1D6SA 2NPOA 3KYIB 3PF8A 4REOA 2YKGA 4S1VA 1PGNA 1M6VA 4I8DA 4KVFA 4YJHA 2IIVA 3UCXA 2NO6A 5HM6A 1OLSB 1RS0A 2EVWX 2Z5VA 4Q3AA 3WAKA 4EQ6B 4XH9B 4IX9A 5EUMA 1U2GA 3ENZA 1C7EA 1WPQA 4MW2A 5A4JA 3PE4A 5A9TA 4A3SA 5KNCD 3LG2A 5K4HA 1DTSA 4LPSA 3T7RA 4QO7A 1JMVA 5GONA 5DSXA 1OFTA 3DMGA 1GPWB 2PG3A 2WJ4A 2E55A 1F51E 4NHOA 3TLEA 1XBTA 2WNIA 1OTYA 2ZIVB 2QD1A 2X9LA 3LKDA 1I3OA 1T3LA 1XA0A 2Q0SA 3N58A 5KWIA 4XYBA 3G68A 4QUKA 4WKPA 2HO5A 4JSTA 3FFWA 1JQ5A 4FUQA 4OATA 1V45E 5BWOA 3NHKA 4ZHSA 3WLRA 2EFEB 3NAMA 2FQWA 2WHRA 2ZWMA 2C95A 3EOAI 1E5TA 2VPYA 3IP6A 1YQXA 4FU0A 3EEOA 3IKTA 2XODA 3PFWO 3C5CA 3JQGA 3OFKA 1SXJB 3WL5A 4HR7A 3EDCA 4NBUA 3O3NB 4XDHA 3KWMA 3F8SA 5BW5A 2V65A 2F8SA 4ZDWA 3SFTA 2YZ7A 2NT4A 4R5HA 1JEDA 4J2TA 2QRJA 1XRPA 5CNJA 4YJHB 4C1NA 5F23A 2ZWPA 1NW4A 3DLPX 2AYXA 4LJ6A 4BATA 2I55A 2Y99A 3WMFA 2WLTA 3CH4B 1E7YA 1T9AA 1ZJJA 4XGQA 3ILVA 3UV7A 4B3BA 3IXLA 3T1TA 2AI2A 3DO6A 3OZTA 1RLIA 1ZM3A 1NUUA 4ZCIA 1DIBA 2GBGA 2DLCX 2XGMA 2P1DA 1ACMA 2NMVA 1U8AA 3M2TA 3EWAA 2DUWA 3AR6A 1BOOA 1RFLA 2COUA 3OQ6A 4R41A 4WGFA 4IM7A 4KWHA 1WLYA 2IE8A 2BPOA 2AG0A 1V16B 2C2YA 1BX1A 2JFPA 2JIZD 5BWLA 3H9EO 4RGYA 2D0PB 2P0EA 3IERA 4HDSB 3VISA 4GW3A 5LBTA 2ET6A 1HQKA 1B15A 2CDAA 1YS4A 1FNNA 2PZKA 2TMDA 4K2AA 4UU0A 1U0TA 3A11A 4UMFA 5A3RA 5FX2A 2WM3A 2ERCA 2EX4A 2ZB2A 1BE0A 1W96A 4YRMA 5L8VA 3RJZA 4LYJA 4NE2A 4ZYLA 3VKHA 3PCTA 5ADHA 5JC8A 3EZFA 5IZ4A 2I8LA 4HI0E 1JQBA 1P45A 4BNLA 2QNBA 4BZPA 1NDQA 4UOQA 2JJ2A 3G8CA 3QY0A 4B43A 3ZDRA 5KAPA 3WLAA 3M6XA 4OHOA 4GMHA 3QOWA 4M1SA 1LDBA 4MRSA 3HCPA 3S7ZA 1KFCB 1ZBDA 1ZOIA 1XMQB 3O1HB 4Y0AA 4J49A 1IVYA 4ZEXA 1N1MA 3NQ41 1TLFA 3V46A 3K70B 2QL7A 1XTSA 4PZDA 1IBLB 2SBTA 3QIVA 1P0MA 1UPBA 1N0VC 1RYEA 1Z6QA 1ZKDA 2MWMA 3FCXA 2BRUC 3G3EA 2A3RA 3KLBA 1UBSB 1XRLA 4XZ3A 5H5JA 5A5VA 1BE6A 4IUDS 4S2EA 3ZH9B 4AJLA 3U09A 2QP4A 1QC5B 4X97A 5AK5A 3AVXA 2Y0CA 3LGXA 1F6DA 1FFCA 1FQJA 1N6NA 2JHFA 4YJ3A 1UKBA 1PLJA 2YFHA 4TMKA 1VJ5A 2HO4A 2DSNA 2BOVA 2DWUA 1CB0A 1C1XB 1X80A 1N7HA 3G8AA 3A9SA 1Q0SA 4M9CA 1DEKA 3EXG1 1DQNA 4WZBB 4XAQA 3GPLA 1B3BA 3PYLA 2QRNA 5IKOA 3CX3A 1KK1A 3DFZA 1XDDA 1MDBA 4PSUA 1NBHA 2O1SA 1U2TA 3BJRA 1MUUA 4LZOA 3UBTA 3GV0A 3OQOA 1KI3A 2XRMA 3ONFA 3JQCA 4QATA 1OGYA 1ZK1A 3D0RA 2OSVA 3A6GA 4KZPA 4ROTA 1Q11A 1IM5A 5A03A 1T36B 4JL6A 4KMSA 4P7FA 4A8HA 3P20A 4XB2A 3WGTA 3RV4A 3ZV3A 1HT3A 3HYRA 2Q6KA 4LHYA 4X6LA 1BXZA 1LDNA 1W30A 1Z5WA 3VUFA 3WNBA 1LSJA 1O9HA 4XXHA 2O1XA 2VTBA 2WHXA 2X13A 2HTEA 4QD3A 3GVIA 5BOSA 3D0QA 3UWOA 2FOIA 1E3LA 1KR2A 5CNKA 1VYHA 2VDRB 2BVNA 2XHZA 4MIOA 2Q0XA 1H65A 1ATZA 4ASUD 3AHCA 2IDJA 3N86A 2WF7A 1RQLA 4L5YA 4F9TA 5IXSA 1O54A 3JQEA 5EGSA 4BNMA 1Q7CA 4FFRA 4E7PA 1DUSA 3U60B 2NU9A 4ZQGA 5F7ZA 2B3DA 3HXMA 3DDOA 4OGFA 3IVGA 3L0DA 2JFUA 3U3OA 1VPDA 2JAXA 2JLUA 1UJBA 1GZ6A 3CZ4A 1I6KA 5C1BA 2VJQA 2ID9A 4FKMA 4LHXA 2NUTA 1QYRA 4JLNA 4ERXA 4CKCB 4EITA 2B2NA 4KK4A 4JN6B 4RLHA 3Q8MA 1CYEA 3A3YA 4JI1B 3VSAA 1RJDA 5BV2P 1WF3A 4MVJI 2D0OB 4XVCA 4KJXA 1LV8A 1H85A 4ZTZB 1QP4A 2VPWA 1YC2A 3U3MA 2H8KA 2ZUCA 4K6CA 3AHEA 1ZICA 4Y1GA 3VKFA 1U8XX 4PZEA 1V25A 4FZJA 3HUNA 1BROA 1Z4OA 4AMVA 4LOJA 2ANBA 2V59A 5EJGA 5HKBA 4ARAA 4UVDA 2VF7A 2CVFA 3Q7RA 1EFUA 4WK6A 1EEHA 1B6TA 4BVKA 2VJDA 4HWPA 1OTHA 1UC9A 3VZPA 2QN9A 2V45A 3IO3A 1ZZEA 5C7IO 4FI3F 3UUEA 1RLJA 2YZGA 2QPAA 1O6ZA 3NIDB 4YPFA 5IH7A 2VF5X 4DOMA 5ESWA 1PBTA 3B3AA 4P2GA 1NXXA 1YDMA 1UC4B 1NURA 3OC0A 2XNKA 3VSEA 2FPOA 2H1LA 4X3OA 3WLTA 1PAUA 4NCIA 1MG5A 1UFKA 2B82A 4XRRA 3DZCA 4QUIA 4EYKA 3QENA 3ADCA 3OKAA 4HFJA 1QTRA 2PH3A 3R9IA 5LD2C 4LJ4A 5M5BA 4ZVOA 4M1QA 4EHDA 1E4YA 1E9VA 1MOSA 5J3JA 1KP3A 4YCAA 2I5PO 1W0KA 1T0UA 2X2FA 3FA2A 3GLHA 3IDAA 2TECE 4JT8A 4UVHA 2O57A 3LA6A 4AZSA 4U5XA 4B6JA 3LDGA 5KKNB 1UMBA 5JSYA 1JB9A 1WSDA 4II7A 4Q02A 4PNPA 1C9JA 4D92A 3E0QA 3ZZNA 1SVSA 2V7QA 5C7YA 2EOAA 4ID3A 3STYA 4NF2A 1LS6A 3E8SA 1JVBA 3BE6A 3JQAA 4BNHA 1R6TA 5FFMA 1V8FA 3PQ2A 1QZXA 3VR6D 4JBIA 4EY6A 1G98A 2OLKA 3AR2A 2GK7A 1J6UA 1F8YA 1Y3CE 5FR2A 5K0GA 2QZ4A 3IIMA 3MS7A 4MW1A 1Z2NX 1QFYA 2FX2A 2BZSA 1JKJA 2O3RA 4H6PA 1BHSA 4BJ1A 5JRDS 3RFCA 2P90A 1TUBA 4WNIA 5JVDB 2PD6A 3D6HA 1H2RS 3TSAA 2BH2A 3PE3A 2ZJBA 1F4VA 3VZBA 3WHLA 3WKBA 1FRZA 1WG8A 1NXWA 4V2IA 1ACJA 4HGNA 4A26A 5HQ3B 4PLZA 3V33A 5GJVC 2IZOA 1SU7A 1EUCA 1NJGA 2EYUA 2VPIA 2W8BA 2H07A 4I99A 1C7IA 2LP4Y 4MP6A 5G4KA 5AIBA 4GZ6A 4LJYA 1FSGA 2DHEA 2YMLA 4D4IA 1QAQA 1VGQA 4IGAA 2F59A 4ZCLA 2FN3A 3WGZA 1M5TA 5JQGF 3O8LA 3PNVA 5EE0A 5EZ6B 3B53X 1NONA 1WU8A 1RWKA 4HPXB 4E5YA 2KPOA 8ADHA 1BHJA 1IPHA 3IVCA 4RCZA 3ZGNA 5BORA 5JCZA 4WACA 5EP2A 1AO3A 3W2HA 3LZ6A 4WZBE 4NTZA 5G2OA 1JHZA 3GFSA 3GJXC 2VA8A 2HOQA 1CS0A 1T8YA 2CMHA 4JQZA 2AN1A 3RUAA 1DAFA 2OCXA 3HYTA 1W4BA 2HSGA 5DLPA 4CDRA 4TMXA 1L7DA 4ZT3A 1OTXA 3OESA 5BPHA 3BRSA 1QJ4A 1A9ZA 4OU5A 2I76A 2YWFA 1K5DA 3D4BA 2ZZNA 3QJGA 3SXPA 2KBEA 4MRAA 3MRSA 5KWVA 2CNOA 2XIQA 1ARZA 3KBBA 3GWGA 2EKDA 4H0NA 3SXJA 4BLSA 1NULA 2CSXA 2NV2B 1CX9B 3EIFA 3HXTA 4EW1A 1NE2A 5JH7F 3RIMA 4P5EA 3JRXA 3PRYA 4EW2A 3HZRA 1K2VN 2Q2OA 1UBOS 4W8HA 5FPSA 2CK3A 3L8GA 1QUFA 1GXSA 4OIMA 5F77A 2BSQA 1A1SA 2Z4RA 3VSBA 4DIDA 2DQYA 5CPBA 4Q9HA 3V4OA 3H86A 1YZUA 1RWQA 3GYGA 2FJPA 4MCJA 5FV7A 1YBMA 2IUFA 5A6SA 4KUGA 3D9QX 1PSDA 3OEED 3GUZA 4TS9A 1IQRA 3RGGA 2Z2JA 3E84A 1NOIA 2R00C 3ZY4A 4AJIA 3AR8A 1KRXA 4MI6A 3T9AA 1SGWA 4DIEA 1E0DA 3QWAA 1U28C 3DOHA 3EMVA 2YRFA 3KWJA 3M5CA 3GEDA 4I9FA 3TZ6A 4AF7A 3NI2A 2ILTA 3X1XA 2QRVB 2VS1A 3ZW8A 4CG2A 4YCBA 4CT5A 3JASA 2I7DA