4YUXA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2h-1,4-benzothiazin-3-amine
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 100
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuxA02
3FUTA 5FHRA 4K6MA 2OBFA 2PT6A 1D2GA 1JSZA 3ME5A 2CL5A 4FZVA 4AX8A 1AV6A 1DUSA 3OCJA 3K0BA 2GB4A 4E30A 3KQSA 3HCAA 2PVCA 2ZLBA 3H2BA 5EC8A 5FWAA 2ZTHA 3DMHA 1RJDA 2IBTA 3A7DA 3PFHA 4O29A 3OE4A 2C7PA 5FA8A 1VL5A 2AVDA 4IV8A 3BGIA 1PJZA 1RI3A 3DH0A 5CUQA 5F2OA 3BKWA 4C06A 1JTEA 1XTPA 2CKDA 4RTOA 4EK9A 5K09A 5KQSA 4ZTBA 3UBTA 4MHTA 3GXOA 3M6XA 4GOOD 5E1DA 3U81A 2GAFA 2AN5A 4RYLA 1BKYA 3FTCA 1R74A 4YUWA 3HEMA 2PGXA 2P7IA 4AZVA 3HTXA 2PX4A 2I62A 3GCZA 3JWIA 5EG5A 5K0CA 5KS2A 1VIDA 3DP7A 4FT4A 2HTEA 1KPHA 1P1CA 2PJDA 5DWQA 5E2AA 2ZSUA 3RODA 1IY9A 3FRIA 3LKDA 4KIGA 1XDZA 2ZCJA 3EEYA 5E1BA 5G02A 1JQDA 3BKXA 3UJAA 4P7FA 1L3CA 5E1MA 3SR4A 3HCDA 4U7PB 5EQJB 4X1OA 5FQOA 2IPXA 3G88A 2PXAA 3EVAA 4RTJA 4AUKA 5EMJA 1WS6A 3EVZA 4FT2A 5GOZA 3DLCA 4E31A 4RTLA 1O9HA 1JTFA 5ICEA 2B2CA 2AVNA 2AOTB 3DUWA 5DX8A 1MJFA 1NKVA 3I9FA 5CVVA 2UZ4A 1HNNA 2BR3A 2PKWA 3FPGA 5HZMA 3PFGA 4RTKA 3MGGA 2OB1A 3KQOA 3JWJA 2VS1A 2IDJA 3UA4A 4MWZA 2PSSA 3CKKA 3EVDA 3TPZA 3A25A 4AZWA 1JR4A 2AOVA 4ER3A 1ORHA 2NP6A 4C05A 5DXAA 3OU2A 2GH1A 3FPHA 3R0QA 3KPUA 4DKJA 3FTFA 5EHGA 1YFLA 1O54A 2YTZA 2JHCA 5CM2Z 5HILA 3HA5A 2YQZA 2PBFA 4DA4A 1MHTA 1ZKDA 2VZ9A 3DXXA 4QDJA 5E8RA 2I7CA 2YX1A 2KW5A 5EIFA 3B3GA 5EGSA 3T7RA 5GIOE 1ZGAA 4RSRA 2UYQA 2QY6A 4RX1A 5FHQA 3UJ6A 1VLMA 2H00A 4OX9Y 4PYIA 3LCVB 3TM5A 4QQKA 4YMGA 2QM3A 3KQVA 2NXJA 5K0NA 3WSTA 3B7PA 4P58A 4PYOA 5CVEA 1NV9A 5K0BA 1IXKA 2YUIA 3D2LA 4WXHA 5FWDA 5DT2A 1YF3A 4M36A 4QPPA 1EAMA 3BGDA 5M5BA 2UYOA 2FK7A 5T64A 3OU6A 3G8AA 4X60A 4LWPA 3GRRA 2K4MA 3KPYA 4GOLD 3KU1A 5DX1A 5DPMA 4CTJA 5E9JA 2NYUA 5EVJA 1NT2A 5EMMA 5EOVA 1YB2A 5C0OE 2OXTA 3THSA 3FYDA 5E1OA 3TFWA 4C4AA 2FK8A 1KIAA 3Q7EA 3TLJA 3BWBA 4NECA 4KVZA 4Y2HA 1ORIA 5LQAA 3MCTA 4PGHA 4IV0A 4ER6A 2Q41A 3QV2A 4X63A 2IBSA 1Q0SA 5IH3A 1AQIA 3HVKA 5BW4A 3BWMA 4KW7A 2ORED 3PX3A 4P7JA 2XVMA 4GOND 5KYGA 2NP7A 3P97A 2ZBRA 4M37A 4PIMA 3HA7A 5HIJA 5DTMA 3THRA 4ATNA 3FTEA 2O07A 4CXMA 4B17A 3HCBA 1QAQA 3LBYA 3EVGA 4EVIA 2CMGA 4GC9A 2UYHA 2AN4A 1NBHA 1QAOA 2GPYA 2UYCA 4FR0A 3MTIA 3AXSA 4E2XA 1KXZA 4QTTB 5EHIA 1FBNA 1G60A 3G5TA 1R8YA 3MCZA 3R6TA 2AR0A 5EEGA 5GIPE 2PV0A 5CCBA 3EVBA 2G70A 5LQKA 1HMYA 1RJFA 4RVGA 4F85A 5E2BA 4FP9A 3GO4A 2XVAA 4DCGA 2WA2A 3EGVA 3KQMA 5U4XA 3UJDA 5KQRA 1D2CA 4YMHA 1KPGA 1NW5A 2FYTA 3P2KA 3I58A 4PNEA 4KRGA 2QE6A 2V74B 4YUZA 2PT9A 3HNRA 1R18A 4QTUB 2NXNA 4PWYA 4C04A 3X0DA 2IH4A 3HP7A 4KWCA 1UFKA 2B9EA 4YUYA 5P8WA 10MHA 2FHPA 3A27A 4DF3A 2WK1A 1T43A 4E33A 3MHTA 4FSXA 4OQDA 2ESRA 3KKZA 1KYZA 3M33A 5ERGB 1XVAA 2B78A 3ELWA 2YXEA 5K03A 1N7IA 1O9GA 1KPIA 3CGGA 2AN3A 4A6DA 4E2YA 3CJQA 2XYVA 2P3LA 4FSDA 1D2HA 5DX0A 1F38A 1DL5A 3KPJA 3G2QA 4POOA 4BY9E 2O06A 1SQFA 1XXLA 2VDUE 5GM2A 1RI4A 1X1CA 2EFJA 1R8XA 1ZQ9A 3NDJA 4GOMD 4MIKA 4YUVA 3K6RA 3E23A 3UFBA 5LQJA 2ADMA 3LCUA 3OPNA 3VYWA 3EVFA 4PYMA 2BZGA 4EKIA 1RJEA 2EG5A 2Z6QA 1F3LA 2JJQA 3ID6C 1Z3CA 4G56A 5FUBA 4A6EA 3HVIA 4QVKA 4UOEA 4QVGA 3VC1A 4EKGA 5DSXA 4YV1A 4E70A 2HR1A 3P9KA 5B1SA 2FRXA 3B3FA 4HRAA 5K0LA 1PRYA 3UJ9A 5FADA 3UJ8A 1Y8CA 3VSEA 2I9KA 3EGIA 3HM2A 4OA8A 5K05A 3V97A 3SSMA 2E5WA 4EMSA 2QYOA 1L3BA 4DQ0A 5EKUA 1IM8A 2B25A 5GP1A 2AS0A 3P71T 3ERCA 3DXYA 1WY7A 1NW7A 3SGLA 4RVHA 2A14A 3ELDA 1I9GA 1UWVA 3KR9A 3UA3A 5HFJA 4DM3A 1RJGA 1YUBA 4PGGA 2PWYA 3KHKA 3CJTA 3PT9A 4HGZA 5EMKA 3SXJA 4AZTA 5EZSA 4L7VA 3R9XB 1BOOA 1VBFA 2FCAA 3AY0A 4OBWA 2BR5A 5CVDA 5T67A 5LQUA 2V7EA 5FQNA 5CCXA 3I5UA 4MQ4A 5BXYA 1BHJA 1V39A 1P1BA 3MB5A 3QOXA 3LDUA 4DZRA 1RI5A 3NDIA 2EX4A 1X19A 3LL7A 2PY6A 4OA5A 2LD4A 2QRVA 3RW9A 3E7PA 5KVAA 5LQNA 4LWOA 5DM2A 5EZQA 4M38A 3KR0A 1G8AA 1VPTA 1KYWA 2AOUB 4PCLA 2IDKA 2P1DA 3DOUA 2DULA 3OZRA 3EEOA 3BZBA 3FTDA 2NXCA 1SG9A 1QZZA 5K0JA 1JSXA 4RTMA 3C3YA 4RVFA 3ER9A 5FULA 2ZZMA 1WXXA 3DULA 3LHDA 1L9KA 4QDKA 5EKXA 5K0GA 1VP3A 2ZIGA 1JG1A 5ICGA 5D1HA 5D1NA 3CJRA 3C6MA 1BC5A 2CWWA 3ORHA 4GBED 5IKMA 1SUSA 1N7JA 1KP9A 4HTFA 1G55A 1P91A 4XCXA 5DLYA 4KDCA 4XUDA 4CKBA 4E2WA 5JR3A 3EMBA 2ZBQA 2ZULA 4PINA 3HCEA 5F2KA 3EVCA 3T7TA 3LCCA 4KIFA 3HCFA 2Y1WA 3I64A 2AOUA 1G38A 4LG1A 3P8ZA 2H11A 1JQEA 2NXEA 5GINE 2PX2A 3FYCA 3G5LA 3CBGA 2I6GA 4BP3A 4YV0A 1NW3A 2QRVB 1JG3A 3HVJA 3KQWA 3LECA 3UJ7A 5FCDA 3PLAE 3UJBA 3TOSA 4YUXA 3E05A 3SM3A 1OR8A 1WG8A 5K01A 2P3OA 4CTKA 1TW2A 2JH8A 1ZHFA 3ANXA 2Z6UA 3FUVA 3JWGA 5EIWA 5F2NA 4GQBA 3OZSA 4RVDA 4BLUA 2AZTA 1JG4A 3GRVA 4OQEA 4PONA 4V0QA 2XYRA 4C08A 2IIPA 3GNLA 5LQRA 1X1DA 1X1BA 4PYJA 5HOQA 1M0EA 5E9WA 3NWBA 2OO3A 3NVMB 3GIWA 2JH9A 2Y1XA 2ZZKA 2OPBA 4FGZA 2DPMA 1NE2A 3P2EA 1H1DA 3M6VA 2CMHA 2JHPA 3MQ2A 2ZWAA 2OYRA 4DCMA 3M6WA 3PX2A 1NW8A 3NTVA 4R8SA 3TM4A 2C7RA 4U7TB 5K0FA 1R6AA 2BH2A 2G8NA 4AZSA 2IGTA 1L1EA 4BP1A 3G2PA 3M6UA 5HIIA 2C7QA 5HIKA 1X1AA 3CC8A 3FUXA 3B89A 4HC4A 4P7KA 3TR6A 4BLVA 2B3TA 3G8BA 1SUIA 1DCTA 2YVLA 4R8RA 1WXWA 3TRKA 1NW6A 4P7GA 3A26A 2HNKA 5DM1A 3DR5A 3PB3A 4QQNA 3REOA 1WZNA 3VC2A 1XJ5A 5H02A 5BP7A 2P35A 1I1NA 3GRUA 4GC5A 3T7SA 1SKMA 5DXJA 2P8JA 3TKYA 3BWYA 3I53A 2AOTA 1VQ1A 2GA9A 2HMYB 4JXJA 3S68A 1ZGJA 3Q87B 3LGAA 1EQAA 2FPOA 3LDGA 4PCAA 3BT7A 1M6EX 2ZFUA 5DRYA 4PYKA 3V8VA 1FJXA 5K8VA 5K0EA 3A7EA 3CVOA 4C07A 3SX0A 1SVUA 1FPQA 1QANA 3BWCA 4RTSA 1G8SA 4BLWA 2R3SA 3PS9A 4WVLA 3SVZA 4YV2A 1YFJA 1U2ZA 5ICFA 3C0KA 1RI2A 4EQZA 2PX8A 3BGVA 1YZHA 4X41A 3IHTA 1NBIA 2VP3A 5CIYA 3DLIA 2OZVA 4KDRA 2ERCA 2YXLA 3GU3A 3IV6A 2BM9A 5ICCA 3L8DA 2VDWA 3OZTA 3B5IA 5C1IA 2ZIFA 1Q0TA 4X61A 2JG3A 1JQ3A 3GGDA 1B42A 1SQGA 2ONZA 3C6KA 2OY0A 2BR4A 4HSGA 4IKPA 1VP9A 4QPNA 4XUEA 5GWXA 2OKCA 3CCFA 5FTWA 3FPEA 5GM1A 1L3IA 2JHAA 2PXCA 2ZIEA 3NMUF 2YXDA 3EPPA 3IYLW 1I4WA 2YR0A 1EJ6A 5HIMA 2BM8A 4M7RA 3RIEA 2ZW9A 1EIZA 3G2MA 2O05A 4R6WA 3TQSA 1FP1D 2HWKA 3DMGA 5EMLA 1P39A 3F4KA 1XDUA 1TPYA 3FZGA 1KHHA 3UZUA 3SSOA 3R3HA 2HV9A 2O57A 3ELYA 4HG2A 3KQPA 1QYRA 4RTPA 3NVKI 3FPJA 4GEKA 2XBMA 4PYLA 3P9IA 2VDVE 2N47A 1XCJA 2IH5A 3KPWA 3LKZA 1QAMA 3AXTA 1AF7A 4E32A 2ZZNA 3DTNA 5T6BA 5DM4A 2PLWA 3LBFA 3GJYA 4LECA 4MTLA 5DTRA 5FA5A 2R6ZA 2ZWVA 3M70A 4E2ZA 5E8JA 5BW5A 2IFTA 3PVCA 4GUAA 4RV9A 1NV8A 4IWNA 2PX5A 2ZVJA 4FS8A 3UWPA 3DXZA 5CVJA 3OE5A 3FRHA 4F86A 9MHTA 2ONYA 4XUCA 3NW9A 5C9ZA 2EJTA 3LX6A 2IP2A 3NWEA 1TW3A 3FUUA 3OU7A 3P2IA 3GDHA 3JWHA 3A4TA 2P40A 3SMQA 3KR2A 2H1RA 2PXXA 3TKAA 3O31A 3EVEA 5CVUA 5EEHA 1EJ0A 3SSNA 2AOWA 3P9CA 3OFKA 4ER5A 3KQQA 4RWZA 2NNWB 2EJUA 3B3JA 4GF5A 3E8SA 1EG2A 3G2OA 3O7WA 2IH2A 1KR5A 4CWAA 3LPMA 3BXOA 4RTQA 3DMFA 3GWZA 2GLUA 3LDFA 5EPEA 4CKCA 2Z6AA 4HTFB 4Y30A 3IEIA 3EMDA 5DRTA 3EGEA 4R05A 5DTQA 1AQJA 2G1PA 3HCCA 3O4FA 3ELUA 3G7UA 4R6XA 3TMAA 3BUSA 3KQYA 1N2XA 3OFJA 5DSTA 4OBXA 4C03A 5LSAA 1JG2A 1FP2A 1RI1A 3KQTA 2G72A 4PYQA 1XCLA 3G89A 5DM0A 4ER0A 4H0NA 2PWPA 4HGYA 2XYQA 3MERA 4V0RA 3LSTA 3UJCA 2G71A 1M6YA 4DMGA 1R00A 4RTRA 2F8LA 3AWIA 3C3PA 5LR6A 1VE3A 3QOWA 4Z2YA 4F84A 3KPVA 2O0LA 4ER7A 3M4XA 2ZBPA 3GRYA 3AJDA 4ISCA 2OB2A 3GRZA 3HA3A 4PYNA 5JUWA 5LQCA 3FPFA 3R24A 5CD1A 8MHTA 2P7HA 3P9NA 4PIPA 3PTAA 1UIRA 7MHTA 1G6Q1 1ZG3A 2WA1A 3MAGA 2P41A 2P3QA 3MTEA 4RTNA 5HEKA 2AOXA 3FUWA 3HVHA 4HH4A 5E9QA 4CKEA 5MHTA 3NJRA 1YZ3A 3KR1A 3T0IA 2C7OA 1INLA 3ER8A 2GS9A 1XDSA
chains in the Genus database with same CATH superfamily
3GARA 4IPTA 1UZNA 1GTJ1 2RHMA 3B2EA 3JQ9C 4MQMA 1J1UA 1E4EB 1SHTX 1B43A 2FWAA 1R4NA 3ADPA 4ENSA 1J9EA 1E96A 3U7GA 1UKBA 5CA1F 3GEDA 1XKXA 4GW3A 1J00A 3IT1A 1U9YA 2CY0A 1GA1A 1U2TA 2OOSA 4KX3A 4MZDA 1WMEA 3VX3A 2B36A 4JQSA 5AVWA 3X2EA 3KVVA 2APJA 3MFDA 2ECPA 1EE2A 4PAOA 1AH2A 2CL7X 1T2EA 2NVBA 3BGSA 2WMOB 1VLZA 2XSZD 5AK6A 2D13A 3CM0A 2XT0A 4WNIA 2O1EA 3DEZA 1EBBA 1NQUA 1SEVA 4M4SA 4YRKA 3H2GA 3ZU4A 1RHJA 1TQ2A 2HAEA 2GJ8A 4YUWA 1WV1A 2WG0A 1N78A 3IIJA 1CEEA 3EEQA 3GCZA 2FETA 2XKKA 4R1OA 4DC9A 3D2CA 3H9BA 1O08A 2BBSA 1G4AE 1J07A 2P91A 3LKDA 2ZROA 4RCVA 2YXBA 4MDYA 2DKNA 2RGEA 5KNLA 4UUNA 1W36B 3TRHA 5CDTA 2SBTA 3FFAA 2ODPA 2H0AA 3GFOA 4G0NA 1R0RE 1YMUA 1G9SA 5KVQA 3KB1A 4IXNA 4AUKA 2PPVA 4LJSA 2G08A 16PKA 4LRYA 4EMUA 1ECPA 3R3ZA 3NWJA 2WG1A 1YA4A 1UDCA 2GCIA 4X20A 1SCKA 5ALNA 2BR3A 2FEAA 2YMLA 3W6OA 3WGNA 3U7FB 4EHHA 1I10A 3LVRE 5KSYA 4IILA 3CEPB 2PZEA 5TQ0A 2AA3A 2WAXA 4P80A 1LDGA 4YB8A 3GG2A 5H80A 3A25A 4O1HA 2X42A 1EFLA 4BL5A 3NBZC 5DXAA 5DHQA 2NSYA 4JYBA 3QVTA 3RU3A 3GGOA 3PHCA 2Z2KA 2VDNB 4XVQA 1DX6A 4G4JA 3UANA 3Q2OA 2RHBA 3AVPA 3HA5A 4MV7A 2HU2A 3DKVA 4S24A 4YASA 5EXPA 2VZ9A 5EINA 4DA4A 1BW9B 2BKLA 3A58B 1S3IA 4DLRA 1RLIA 2X3UA 4JDUA 4DLAA 4F56A 2WT8A 2PYDA 3O21A 4C89A 3QF4B 1SCJA 2P9QA 4URZR 1T2CA 2HRBA 2OM2A 1GWNA 3VTAA 2AGVA 2E3JA 4FVTA 4YAWA 4ND4A 1CJBA 1CDEA 3VU9A 5LC1A 5BVHB 1C30A 3OX3A 5D2CA 1SCUB 4DMRA 2C78A 4INOA 1BE6A 3N8DA 2D5AA 2OBLA 3L8MA 1G2IA 2B4TO 3LT1A 4LWPA 2X0EA 3ROFA 3WGZA 4EJSA 4F72A 1WTAA 3CW8X 4DNQA 1NVDA 3DDNA 2D2EA 2EP7A 3NM4A 2DT5A 3S70A 1CZOA 5JZ9A 1XZ8A 2DY0A 1G7TA 1CUHA 1G21B 2BZSA 3DVSX 3P0FA 1UBCA 2RGUA 4U9IS 1TRKA 2QSJA 2ID8A 5IHXA 1B76A 2JIZA 2BSAA 2VFAA 3PUIA 4OSEA 4R9UC 2YIDA 3T5BA 3ZXUB 3NALA 4LZLA 4Q4DA 2VPQA 4MUXA 2IEIA 2VT7A 3BQNB 4Q82A 5TRTA 1ISFA 3HJTA 3OEHA 4O3FA 4WLOA 3KOWA 4E13A 2C54A 4ZICA 2IK8A 1IHUA 1JU4A 2KHZA 5E3JA 1NBOA 3H6KA 4OHWA 1NQVA 4PLYA 1IZYA 3ENZA 4JFAA 3VPHA 4V1CA 2BGLA 1K8RA 3A3PA 4EEXA 4G8JA 4B82A 1CVIA 1NURA 5EHIA 4K6CA 2O20A 2YXPX 1XPOA 1T1EA 4Q7MB 4NEHB 4U2BA 4AJEA 3ZBQA 3LIIA 4BUZA 1EINA 1KKMA 1N2JA 1Y1PA 1NP6A 1HMYA 1YB6A 2GBCA 2JLRA 3AETA 4FFLA 1Q74A 5G40A 4CL0A 4EELA 3O3CA 2GN6A 3CVVA 2GZAA 2OBYA 1BEUB 3D31A 1A8SA 4UZSA 5L6LB 2G6TA 1WCIB 1RAFA 2I65A 2LCIA 2UZ0A 1Q7RA 3R0IA 4L9SA 4H6WA 4PQFA 1G6KA 2OCIA 3SC2B 1Q0LA 5IM4F 1OIVA 3OIUA 1PLLA 3A8TA 3E22A 2RCYA 1FRZA 2N1BA 3OZDA 2CNNA 4DM7A 1UFKA 4N3CA 4N76A 4I8DA 1JLMA 2BKXA 2JRLA 4RVOA 3OMLA 2RMKA 4YGXB 2WW8A 3VISA 4CKCB 3U7QA 4PHGA 5EE5B 3WJ1A 3HU1A 2J7PA 1O89A 2BMWA 3STVA 4LNUB 3O8OB 1LQUA 1UJCA 3KL2A 4LSZA 1FPMA 5KYKA 2VHTA 5LIRA 4US2R 5DM70 2YN2A 4KE6A 1HZZA 4YIKA 4ESOA 4KIWA 4FGJA 1L5QA 1GA4A 1SIWA 2EKPA 2VDUE 2WU0A 2EL9A 3B78A 3F5DA 5EESA 5B12A 1FNDA 1U5BA 2O8DB 4X91A 1RQLA 3UFBA 2AMVA 4PX5A 3KTAA 1CQJB 4FDUA 2ADMA 4CM3A 1ABEA 1Y8RB 4HFJA 3KZVA 4NCIA 3KOXA 4Z1MD 2YW2A 1F3LA 4X85A 5TDHA 5FUBA 3WIDA 2BHRA 3IDOA 4M0DA 3WIEA 5AVSA 1D9ZA 1GG8A 1RDFA 1HQCA 2DBYA 2QMOA 5IMSA 4NQRA 5IDQA 2DPXA 1JBQA 1V9LA 2VN8A 3M89A 3PQ5A 3HS3A 5JE8A 3RJ5A 3TLBA 3B3FA 5KTYA 3AJ8A 1A9XA 3FPBA 2WIGA 3ZY6A 2W6CX 5JHHB 4ZZ0A 1YI0A 2G0TA 4XFJA 5FOSA 5ALVA 3MJRA 2FFJA 1JFVA 1H2BA 3QRWA 2JLSA 2VHZA 4UFNA 4BHTA 2IHNA 1ZU4A 3G79A 4I46A 5IDYA 1L3BA 2E1RA 3C3JA 1W0CA 4CM4A 3PYXA 4TKUB 4ZCSA 1Q1BA 2AJCA 2K5UA 5A7GA 3FDZA 2R6JA 1NW7A 3C1AA 1R5JA 2REQB 4Q1CA 2QRNA 2YV1A 4DC0A 4MIYA 1I9GA 3GLQA 1V5GA 4HPJB 3I5YA 5HCUA 4CV1A 5F7XA 2JD1A 5IBQA 4AZTA 5DGTA 3U7HB 4OBWA 4HQFA 2HQOA 1TJ3A 1GAJA 2P6UA 2JAUA 4H31A 3ZNNA 1TZMA 1XUOA 1DAKA 5JSUA 5JVDF 4KRXA 1D6JA 2DHRA 2QTFA 3HUDA 2WYWA 1NJSA 1Y8RA 4OXYA 1PBTA 1PR9A 2QSZA 1ZI6A 2Q5CA 4ZCTA 1GPKA 2C2BA 2ZXUA 2FMIA 1N25A 2GEUA 1ORVA 2Z1NA 4RM3A 3PQ3A 1ENZA 3U3MA 4JS0A 5LYJB 4RVUA 3BRSA 1GGKA 4WEQA 3EEOA 1SXGA 3DT9A 3HK2A 1GRNA 3NC4A 3A11A 2XTAA 4GYKA 3QI2A 5CYOA 1R9NA 4FIDA 1E9SA 3RFTA 3UO8B 4ND8A 3KJXA 5FD8A 1TNDA 3R1IA 2V3CC 5HQJA 2NV6A 1BXRA 2VNKA 2G88A 3WADA 4EOGA 4OMDA 4WECA 4C87A 3WDMA 9LDTA 1G21E 3TLAA 3T3PB 5IYZB 5IKMA 1N7JA 1WW3A 5IUNC 4FPXA 1R2QA 4YECA 3AM3A 1I2BA 1GGFA 2I2AA 2F3QA 2AFHB 2OQVA 1M10A 1M2KA 4DLLA 1ZUD1 1ESNA 3C4QA 1JFFB 4IHKA 1EUDA 1GRCA 1Z7YA 3P0HA 1X80A 5KTNA 2E21A 4N8SA 2D5CA 1QGED 1KSGA 1F2VA 2DXIA 2K2QB 3SU8A 3JYHA 5DYGA 1YR2A 1JI0A 3NC0C 3NNDA 2EERA 2FWPA 2W98A 3DLPX 2NXEA 1B14A 3E3MA 3KUXA 4WN9B 5CIWA 4A03A 5FJIA 1FOEB 4IGKA 4PG5A 3JS5A 1HDIA 3O74A 4C0JA 4RAOA 3MWJA 3KQWA 5EIBD 5FCDA 1O8CA 5JS8A 5AI8A 1VHJA 1L7DA 2AHRA 2QPTA 3ZD7A 1NJ8A 1Z8DA 1XEAA 2XCIA 1MFPA 4RKFA 1OYOA 5FIUA 4F8EA 1PVOA 5CG1A 4EMTA 1E6LA 4GQBA 2X7JA 3MAJA 3GYGA 3BA6A 2H4JA 1EXMA 4LN1A 3ENVA 1XCMA 2GYWA 4N49A 1KI7A 4WXMA 4C0QC 2YZNA 2IODA 1A4IA 1SVNA 1XCOA 3E3LA 4HDRA 3W77A 2ZZKA 1YCHA 2DPMA 1EFAA 4ML3A 1GUDA 4CT5A 2GM3A 4R1QA 2EL7A 2OYRA 2YH2A 1ZMXA 3W8DA 1NW8A 3W6UA 4EGCB 2XEDA 1MEOA 2Y0PA 3AYZB 5EUQB 1KEEA 2EV9A 4BXOA 5IC6A 4DQUA 3PBKA 3FMIA 4FWIB 5LP6C 3UWSA 2I7DA 4F38A 3OQMA 1X1AA 4HC4A 1MVOA 3TR6A 1P61B 9GPBA 4L4ZA 3DT6A 1TJNA 4L3VA 1ZIYA 1PEDA 1DG9A 1N4DA 5B4UA 3KB8A 5DM1A 1JKIA 3D7KA 1VZ3A 3IKLA 1JDBC 4HAOA 3HN2A 3VAYA 3IX7A 1OWPA 3NDBB 5H02A 1Z5OA 1E1LA 1U0RA 1GL7A 3OZVA 4BNGA 1DVRA 3QVJA 1LH0A 5IDVA 3ABOB 4V3BA 1JHOA 2O6LA 4EJSC 1MMFB 3QZUA 2H9IA 3HGTA 621PA 3JRWA 4WKPA 1S8OA 4RZ3A 1LBIA 3L9WA 5HFNA 1A4RA 2GHRA 4YRIA 2OV6A 3WLRA 1MF7A 2RCNA 4C1NA 1U94A 4QU0A 4EYSA 3V8VA 4YQZA 3RJZA 2PUCA 5FNZA 5KTPA 3NHKA 5BR8B 1MO5A 1XTTA 1LK0A 2HGZA 4H7DA 2H2AA 1JFSA 4RTSA 4G1FA 3SAJA 1KI6A 3DE0X 5DHUA 4I7EA 1BU5A 2XQIA 2QN2A 4MITA 4KTVE 1VBKA 5EP4A 3WK7A 2OD7A 1OLSA 2WJJA 2V6FA 1S02A 4BNJA 4BDTA 2W90A 3QEBZ 2BFMA 4D6YA 3L4JA 1CVLA 1J09A 3DF9A 4IXTA 2BM9A 4M7PA 4R1NA 5LDGA 1H6AA 3A32A 3U4GA 1XV5A 4QLOA 5HJ5A 1JXAA 1YJBA 4R8VA 1SQGA 3OKPA 3C7CB 1OIWA 2QVGA 3CKLA 3OZFA 1ZRNA 4LHYA 2D3TA 4KDEA 1EHIA 5ITVA 3MINB 3CCFA 1GPH1 3WKAA 1RZVA 4L9RA 4YP9A 5I4IA 2HF2A 3O8DA 3EWNA 2XE7A 3FMGA 4EYOA 3AHGA 4U2KA 3W2EA 3NMUF 4PZLA 1MQ8B 1I4WA 1YL7A 1NXPA 3NOQA 3AUUA 1N5KA 2WUWE 3OOJA 3NHJA 1KJZA 4MQEA 3CZMA 1F17A 5B1YA 4PG7A 1DC5A 1A9QA 1UXGA 4YT2A 5JQGF 4BZQA 1ECLA 4J43A 5MN4A 4NXNB 4MQLA 1TPYA 3LCJA 2NPFA 2WU4A 2CBXA 3AG6A 3WHIA 1QYRA 1WDKA 4B44A 3K9NA 2ZEJA 3DWEX 4IS3A 4F2PA 2EJCA 3B48A 1N8SA 3C7KA 2H0QA 4NZYA 2C7BA 2PMFA 1HH4A 5ALDA 5EE1A 1XRMA 1VLHA 3QYFA 1IWBB 1GP2A 4MV3A 3V48A 3UK2A 1U63A 3HCOA 3UCEA 3NJ4A 4Z99A 3GJYA 4NBKA 1HZZC 1HE2A 1UZMA 2H1FA 5ISMA 3S0JA 1U7XA 3I3SR 4BO6A 1DQSA 4GP6A 1DCKA 2YC4C 1Q0HA 2H1WA 3HBJA 2XRMA 3MD0A 2IA5A 2Z2JA 3PNVA 2D2VA 4GUAA 4IXWA 1K5HA 3TLCA 3HFSA 2C5LA 4V3CA 5AW2A 4XX1A 2I3GA 4KWHA 3ZHOA 2RHWA 3CUSA 4UBKA 3ZLVA 1E6EA 2EFEB 1ND5A 3KSRA 5CGQB 1CKEA 2CFSA 2GBPA 3OEWA 5CW1A 2NACA 3A4TA 3AH8A 4QLBA 2H1RA 4ZQBA 1QRUA 3IMGA 1II8B 1A5ZA 3DMTC 4OX9B 4Q7EA 2PJRA 3DDOA 1E92A 3VC7A 1SFRA 4DL9A 1I7NA 4M9ZA 2GBIA 1LF0A 4JMLA 3GFRA 1KO7A 3PI7A 5F5LA 3T1TA 1DZIA 3DF7A 1BWRA 4R40A 1M0TA 4UNSA 2XT6A 3AGPA 3RIYA 1TCAA 4BNNA 4RTQA 1AV7A 3JQDA 2E4XA 1FZTA 2NO6A 3W04A 1FQOA 1JT9A 1W9HA 1Y3AA 4FNAA 1WCYA 3AQIA 4AP6A 1XZBA 5LLTA 3V9PA 2R11A 3HZZA 1I94B 1PKEA 1DXYA 1RR6A 2WUGA 3PPXA 3LOQA 4KVFA 4MGKR 3V7UA 4BUJA 3ZH2A 3S2IA 4BVAA 4P7BA 1VMDA 3UH1A 4G6ZA 1K7FB 1PZXA 3JQQA 3NDPA 2GXQA 3GHHA 1S0UA 4M9QA 1A5AB 2QL5A 3K8OE 3NPAA 1F5SA 3ESRA 3QTBA 4LNAA 4ZEWA 1YDWA 4F4UA 1WULS 4KPGA 4DRXB 4O3MA 2HMSA 1U28C 1U2DA 2GZRA 1RYYA 1UM8A 2VHCA 3C8HA 4JBGA 2Y9MB 4MRNA 4O4HB 5EI5A 1O95A 7AT1A 1FRVA 1WA5A 5JD4A 3OTWA 2VRCD 2JBAA 4Q34A 1L4GA 2XMQA 2YWXA 1ZD9A 2P75A 4GMKA 4EHBA 3DBVO 4JHLA 2UKDA 1DKMA 3H1PA 4Q3CA 1W94A 2AV6A 3SN6A 7MHTA 1F6WA 3AY6A 3LYAA 3U7JA 4DY6A 4IRUB 3OWXA 3GJTA 4QL3A 2RGNA 3WNZA 2CNOA 4CFYA 5MHTA 4BO1A 3RI3A 4WJKB 2I7TA 1YGPA 3E9YA 3H9JA 2OVBA 4RIFA 4KPUB 4WXPA 1I24A 3GJXC 3TH5A 4C0BA 3ZWDA 3O2SB 5EXDA 3FNBA 2ZCVA 3KZOA 4OQXA 2CL5A 3EIEA 4DT1B 4PNHA 5CLFA 4J8PA 1RHUA 3ZJ4A 2DE0X 4G5QA 3HHEA 5TGDA 4Q03A 1OFTA 3H2BA 3ANYB 3VKGA 1P0CA 5HKKA 1DKLA 3PGVA 1B6TA 4G37A 4IV8A 4O08A 4QTXA 3FR7A 2XJ4A 4C30A 3PX7A 3AVUA 2EOAA 1XTPA 2R87A 2XODA 3Q9LA 4BFXA 1T5LA 2I6FA 3GN2A 2VP0A 3RS3A 2FTKE 4LXHA 4IJWA 1UCFA 2GAFA 2FG7C 4JXKA 4M9XA 3GGPA 1E1RA 3EXIB 5H68A 2QM0A 1CZUA 5CX1B 4RLHA 2RHGB 2I80A 4WK0B 1YJAA 2AMFA 3IQHX 3QKWA 2LTAA 2FLKA 2G9UA 2PX4A 2ZIXA 3ZZ1A 2XB2A 4MUJA 1D4ZA 5I9IA 4IKOA 3A14A 3GRCA 1FTWA 2IXAA 3U80A 6GPBA 4N40A 5EJ4A 3MFYA 5EFOA 1GDTA 3FRIA 1VLVA 3LY5A 2OCAA 1UEXC 3HLTA 4GPEA 2Z8YM 3AVXA 2QR5A 2AQHA 3KAPA 3PFCA 2IV2X 4OAQA 1OPRA 1HYBA 2O2IA 3AONB 1ZK0A 3RSFA 2QL7A 4U7PB 4ZWNA 4BX2A 1G38A 4HI0E 1OBVA 4QU5A 5ITSA 2QVCA 2AVNA 2C5HA 4JP2A 5FBKA 5CDFA 3HR4A 5J47A 5EWJA 4WADA 5EJ9A 1H8ED 4X66B 1SQ6A 1YI1A 3MGGA 3S40A 3LUKA 3DBHA 2PS1A 1VKRA 2CYAA 4LXTA 2G9RA 3CR7A 2PSSA 4RHTA 4DB2A 5ELXA 3E53A 1P19A 4Q3EA 4CKWB 5AHOA 3WISA 4DKJA 1JKXA 3O8QB 2FZVA 1ZGHA 1YHNA 3UAYA 3ZIDA 3M49A 4RQTA 3EIXA 5HHTA 2GARA 2CLKB 2AFRA 4BAUA 2RDMA 1HKHA 4A6PA 5SY9A 3TNFA 4CT0A 2RHDA 1P2UA 2C5GA 2BYTA 3AU8A 1SZCA 4IQGA 1GR0A 3B52X 4OJMX 2X0DA 1Z5VA 4JJ6A 5BSFA 3RFCA 2MMCA 4YMGA 3K94A 4TZ6A 3PPVA 4QGGA 4KR3A 3MJDA 4HBGA 2CD9A 2DTXA 4P58A 5LM3A 2XOKD 1W5TA 4O4JA 2ZSKA 3RK4A 2BGTA 3FJYA 4HN4B 4W7IA 3RVQA 3SEAA 3D2LA 1IXYA 3MTDA 4TVKA 3W1WA 2AKEA 4NP6A 4S35A 3KSMA 3BGDA 1H6DA 2D59A 5F73A 2X4DA 3DHEA 5DN6D 1RPZA 3LCRA 3D2AA 3HYNA 3LMKA 1T1JA 3OKAA 1CRQA 4MW4A 1E3TA 4LKOA 2DJIA 4WFQA 1IE3A 3BL8A 4XPIA 4CFZA 1UMCA 4ASUA 3COWA 4IP0A 3KXPA 1CLEA 1GU0A 1QMPA 1AU9A 1WB6A 2Z1DA 3FZQA 3DAPA 4PZYA 3R6GA 4G26A 5DE3A 1KIAA 1V2HE 2CHQA 2XUZA 4MB0A 4ETNA 4Y2HA 4WZZA 1HSOA 1K9SA 2HF7A 3O9MA 2IS1A 3OZBA 4XH9B 4B80A 5KI6A 3A6PC 4Q1AA 3CCBA 5FLEX 3UNXA 2RI1A 1TFUA 5K6TA 2JFZA 3O8QA 2HDWA 4DXDA 5BQFA 3RG8A 3AEQB 4H1WA 4UW9A 1DARA 2VF4X 4II3A 3DNFA 4ESVA 2XE6A 3IP5A 1G41A 1ZNYA 3GZJA 3V1KA 5EP1A 4BB6A 4XM1A 3VPBA 3LC2O 1KWKA 1N33B 1M5UA 4RXUA 1Z2DA 4ZRNA 2M98A 4QBTA 1PUJA 2OXRA 1QRSA 2IYPA 2G9QA 1G60A 1L6RA 3LZCA 5FNVF 3LUAA 2AR0A 3QV1A 4JLPA 2PV0A 1UP7A 5K3CA 5BV7A 4ZZ1A 5JJCA 3M8KA 2EZ4A 3K70D 1QH8A 1TUEA 2F3RA 4H7IA 1WMSA 4UKDA 4X65B 3U26A 1ZN2A 1IPHA 3KB2A 4KQHA 5GPBA 4AJIA 1W6RA 4OK3A 1VYHA 2GNAA 2Z2XA 4JI2B 1AHNA 2ZT6A 3IR6A 2IOHA 1K8YB 3IESA 3R75A 5KNBH 1QBKC 3X1KA 4ALKA 1DEXA 4ZAYA 3EGDA 3CH4B 3PXAA 4NG5A 2J0VA 2I2CA 3LX5A 1AE1A 4UPDA 2FKAA 2ZIVB 2IOQA 3KQUA 2P2YA 1DKQA 1KEPA 2PWBA 3FFXA 2FWBA 3RS5A 5A5GA 1XVAA 1B6GA 2GXSA 4BNDA 2JFBA 4HNHA 1PD0A 3DZ8A 2M9MA 3PEWA 2B94A 2MIIA 1K8XB 1NSTA 4YH1A 4RJTA 3PFFA 4FSDA 2HT1A 1X77A 5IWCA 3LVFO 1Y9EA 4ZREA 1DL5A 2OAGA 2IU0A 1OFUA 2H1OA 1ADGA 1MTOA 1E66A 4IXDA 2JA2A 5IK2D 3SDZA 1DIOB 2DAPA 4OHBA 1Y82A 1NOKA 1E6CA 3E23A 3HU5A 2BHNA 1B15A 4K5QA 1RP7A 4FYJA 3RUEA 3X44A 1E2BA 4OQNA 4YMSA 4KAXA 1XYYA 4G56A 1LJUA 2FPIB 2H2IA 3HVIA 1G5PA 2L82A 4Y2XA 4AP5A 4KSCA 4CKYA 1KFBB 2HQ1A 4Z9AA 1DJMA 3P9KA 1YB4A 1RXYA 2B9VA 2HJHA 2IUEA 1RSZA 2X2PA 3AEUA 4MV6A 3RWMB 4NXMB 2ORWA 1GG5A 3C1OA 3V32A 1EBFA 3RSLA 2QV0A 3OIFA 5F52A 3TINA 5E3IA 4ARAA 3CF6R 5AJTA 5EE9A 4LQLA 3H87A 4BMZA 5BUZA 4UTZA 3UF0A 2NQTA 4QELA 3BTOA 1IBRA 2HZ7A 2VSFA 4TWAA 4YMTA 1OZ0A 3KLBA 2O0KA 3M2TA 3WYBA 4DXHA 5B58T 4LFAB 1CQJA 4D4HA 3PGXA 5AVTA 3UA3A 4OHRA 4DM3A 5HW0A 3ZS8A 2IXFA 3U5TA 1H6BA 1U90A 1XB2A 3T3NA 3OQPA 1UANA 3RT9A 3TZLA 1XQYA 3VH4A 1DBRA 2IEBA 1LPNA 4OLFA 3KAQA 4YQEA 3VU1A 5C1BA 4ARCA 3BD6A 1K88A 3GT4A 4G9EA 2Z83A 1JHQA 3KKNA 4FEAA 1VL2A 4KQXA 2J0UA 5JCJA 3EXG1 1EPUA 3EGXB 4JQZA 5EZQA 4BQRA 4F2GA 3CVWA 5BN1A 4IJUA 5IJXA 2HIAA 3O7MA 1OILA 1U9JA 1E6KA 2A9PA 3H2SA 4LI3X 1K3UB 2GJSA 3SHVA 2JFXA 1SM4A 3BZBA 1IJKA 2F17A 4UOQA 4C7KA 4EW1A 5CD9A 3BYZA 1LS1A 1Q17A 2SCUA 3P4UA 4HDAA 1SRQA 3OOEA 5HCNA 5DWDA 2GM5A 4OI0A 1QTNA 2LDXA 3UHOA 2ZJ1A 2WYUA 2WV7A 4HDSB 1NRXA 3CN9A 1U7WA 1GLVA 1WZIA 2YOFA 1E1QA 2HTFA 2JVKA 4QYTA 5HF9A 2QSYA 3LL4A 3GPCA 3I0ZA 3R9KA 1VRWA 2Q1UA 1GUAA 4HAXA 4D3FA 4XD7A 2QYSA 2J3EA 4MLDA 4WGGA 3ISVA 1X74A 1L5YA 3ABZA 2O8FB 3QPCA 4BNFA 3P8ZA 5KWEA 4R2JA 4U63A 1GPAA 3MT7A 3GIDA 1USGA 5H8WA 3FYCA 3IDQA 1ORTA 2QZ4A 1R6XA 4MR9B 4DJTA 5C35A 3HVJA 3O94A 2PMEA 3VDRA 4EMBA 2H9AA 4BGVA 3U1BA 2ZDHA 1XDGA 5CU7A 4ED9A 4DDVA 1X0VA 3NHFA 2TRSB 3ZV4A 5L9AA 1NVEA 3WJAA 2Q3LA 2FRDC 2P77A 2ZE7A 3MTBA 3T94A 5F2NA 5BVGB 3OAAA 2Q8NA 1H8HA 1BOFA 2CXSA 4DCSA 1SBNE 2JFGA 4OMFG 1FFXA 3ZDCA 3IOYA 2O50A 1HOXA 4YQFA 3OI7A 3NVMB 1G3QA 4KFSA 3L0IB 4C2AA 4YFVA 3UMFA 1U5BB 3I6YA 3OETA 4I8IA 3VR1A 1JHPA 3DTVA 1ZCAA 2ZRFA 3MTQA 1UQUA 4HPWA 3SLRA 4A91A 5K0FA 5J2UB 3PXXA 1WZ2A 2BLLA 3MGAA 1I4LD 3V6LA 2M6LA 1P0MA 4BP1A 2YS6A 1SB8A 4JJFA 2C7QA 1H23A 1YV9A 4KK3A 1MJNA 3BCHA 2PH5A 3QMPA 1L9XA 2GYYA 1JHYA 1P9NA 2OZEA 4K7JA 3QH4A 4H3SA 3S7TA 5ER6A 5JYEA 4PG4A 2NX2A 4BNMA 4NONA 1NXVA 4JOBA 4EF5A 1AZLA 1OVMA 5ARDA 2IYWA 3DKPA 2FZEA 1E2QA 2C4NA 5AKEA 2BCEA 3AUSA 3MIZA 5AHXA 3SCZA 3Q7IA 3EN0A 4CI9A 1XKTA 1DV2A 1AGRA 3D43A 3I53A 3M4YA 4RD3A 3HMKA 3WBFA 4JXJA 3PDWA 4QUKA 1ZGJA 2J9XB 3Q87B 5AKLA 3S68A 4Z4GA 4YRMA 5HA5A 3T7AA 1I7QB 1RACA 4TV8B 2B4YA 5JPCA 2G9ZA 1TLLA 3A7EA 3CVOA 2VSNA 1NXWA 4IIUA 4YAIA 3DGEC 4MLCA 1FSFA 4BLWA 2MYTA 3TTTA 4B6GA 4F93B 3KVOA 3M7IA 4C5BA 1Z5PA 2BFDB 2EDAA 3TIXB 3TRIA 1BCRB 2XZPA 4Z2AA 1G0OA 4CCSA 5CIYA 4YJHA 2PU5A 4XM2A 1TRHA 3BIJA 3RSZA 1RWXA 1FP7A 3S28A 1RXUA 4XVHA 1D1QA 1OXTA 1C80A 4I1RA 3CE6A 3I8SA 5FT9A 3JU3A 2I6UA 2ZWPA 3GGDA 3GLFE 3W2TA 1O6CA 3TL3A 1M0SA 2G04A 4C1BA 3ZHZA 3EA4A 3ZLJA 2UZ3A 2QN6A 1BG6A 1S2GA 4XUEA 4EL5A 4OQPA 2GAJA 3U4IA 4DTIA 3EPPA 3R5HA 3HSKA 1P2SA 2A8YA 1UWCA 3L3BA 1BROA 2LKCA 3OFNA 5ESDA 1ZKMA 4H7JA 4WCFB 2AFHA 4MJ7A 1F5NA 3AEKA 3WFJA 2QLBA 5ALGA 4YRCA 1NLFA 1CF4A 4O8ZA 2YCLA 4MQ5A 2Y1FA 3N1UA 3WB2A 2O57A 3GLVA 4YY3B 2FVYA 4YCSA 3CRMA 5LIPA 4RTPA 3NVKI 2ZRDA 3HXTA 2Q3DA 2N47A 2A67A 1D8AA 1OVGA 5TPWB 1AF7A 4QC2A 1NR7A 2NU9B 1ZK3A 1MAAA 2P90A 3IMFA 3O38A 4MGEA 4M89A 2C83A 4BGUA 3H5RA 1BTOA 3A05A 4LECA 2DERA 1PZNA 2PLNA 4FE3A 3M70A 1KR2A 3D54D 3MW8A 2D4HA 3OCWA 4RA6B 2J0EA 4CPDA 4M1SA 1FDSA 1LU9A 5J4HA 5C2JB 5BW5A 3PC7A 4LGCA 4RGQA 1EMDA 3PVCA 1R0SA 1W88A 2ZYRA 4IWNA 5JAHA 1KS2A 5L7TA 2WHXA 1OJ7A 1SXHA 1TUIA 2JI9A 2BFCA 3D9QX 1C9KA 3PE6A 3MRVA 5E9AA 4GGPA 4QRHA 2A5FA 3I76A 2MYUA 3V4PB 3SQNA 1WQ4A 3RC7A 1THZA 1ZOLA 2C2HA 2O6HA 4PC7A 2RHCA 2ATVA 4FD3A 4B6PA 1ZITA 2V1XA 3ABSB 1AQUA 1XNGA 4IVPA 4D98A 3BGOS 4LPSA 4G5FA 1PZEA 3H4IA 1C7QA 1KVSA 1PG5A 3FF4A 4QD3A 1E0SA 3OCUA 3OFKA 3STYA 4OFWA 1KKUA 3IEPA 2D5IA 2X2EA 2LW7A 3EY4A 3O7WA 3BXOA 4G97A 4IMJB 1NKTA 3DMFA 4RPIA 5JFTA 2BMAA 5FB3A 1CUAA 2WJ3A 5DO9A 1JP7A 3IEIA 1MB3A 3EMDA 2FWJA 3EGEA 3JD4A 3IMCA 5DBIA 4NG4A 2BSXA 3IO5A 3R9IA 3OPXA 3W05A 4LTMA 1Q6YA 2Q1WA 2GERA 5HS4A 5DK6A 1C0EA 1E7WA 1G18A 2XB8A 3UAXA 4D9MA 5JCXA 3WAGA 2CSXA 1BJTA 3D2BA 3KSZO 5JNUA 4XGRA 5J40A 1QG2A 4DYHA 4BWYA 3FW1A 1CJTC 4QXAA 2GGSA 1V8PA 2OORA 4DA9A 5CDUA 2VNJA 1YRLA 1RXWA 3IBTA 3LQFA 2ZKLA 1DBIA 3RVPA 2AXNA 3LQ1A 3R7WA 2QVLA 4HLUC 1PNRA 4B9EA 2GTHA 4RQAA 2QAGB 1QYDA 1AM4D 5AJYA 4BN5A 1SCIA 3GRZA 4B73A 4PYNA 3K6JA 1FDIA 3LOPA 4DLKA 4HJRA 4P2BA 3GUVA 1PFYA 1XRLA 2GD1O 2XCUA 3H9CA 1NI5A 3DCNA 1A98A 4Z0PA 2ZJ0A 4LJLA 2R4UA 2E5LB 3CS3A 3HVHA 3INYA 1YZ3A 4NYMQ 4PGMA 3PI6A 4JR2A 5I7AA 4D3YA 4E07A 1NSFA 4WLFA 1LBQA 4UTNA 3N2ZB 1BS9A 2PVPA 4RZ2A 3MWFA 2B37A 3WLTA 4HDNB 4Q15A 1LWNA 4CF6A 3HB5X 2DJ5A 5FFMA 3D6HA 3ETDA 1DUSA 4N82A 3TZQA 3I45A 3UJPA 2XWPA 2IBTA 5EC8A 4TWIA 1RJDA 2BH9A 4KGZA 4C6TB 2YOGA 1CEYA 2F3PA 2C5AA 2WHEA 3EUWA 4PAQA 3BGIA 3DH0A 4DV0B 1NBAA 1PU2A 3DG9A 5ENVA 5AKHA 5JCPA 4UBMA 4KAAA 4UHBA 3P9QA 4UUMA 3QSYA 2VDWB 1DELA 5GQSA 1UPFA 5IBPA 5BWOA 2CNKA 1KAEA 3DL4A 3FLMA 4BQFA 4Q9DA 4EHDA 1Z4NA 1L4EA 3JD2A 4J4BA 4N7MA 5F33A 2YICA 2DT8A 5K2MA 3IOMA 3Q88A 4YDRA 4AW9A 5IJ0B 1LWOA 2L2QA 1OLXA 4ZHQB 13PKA 1N7HA 1DTSA 1N3IA 1TAHA 1QRDA 2HRQA 3PQCA 1M2VB 4URYR 3ADDA 5BQ5A 2QX4A 1QUFA 2IXBA 4DR7B 1IK6A 1JKJA 2O8BA 2GRUA 1U98A 2KMLA 3ZK8A 4IDHA 2GN0A 2XTNA 2Q1YA 4LXUA 4P3NA 1FVXA 3JQ8B 3RVOA 2XB4A 4RE6A 2AR7A 3PKJA 4DGQA 4CL2A 3G88A 4IW3B 2HDHA 1O9HA 1U8XX 1DEKA 4A82A 1NFRA 4GQIA 1DRJA 1OAOC 2GFIA 5JPDA 3OCYA 3I5XA 3K20A 3KIPA 1N1EA 4PO9A 1Q7CA 3FBTA 2ZIXB 5FL3A 5B7NA 4JI3B 3ZQ4A 3KQOA 4ARIA 1BXGB 3OHPA 5F5NA 1NTOA 3UA4A 4QSMA 3DL0A 4KBFA 3ZZNA 3RASA 1LSSA 3TBKA 1JIKA 5CA0A 1R9JA 2KSQA 5AO9A 4M7WA 2EJWA 3L0CA 3T95A 4KMRA 1Y6FA 4E51A 4J1TA 5EMHA 3O8BA 5AKXA 4BNYA 2XGOA 4WNAB 4FE4A 3KQNA 3NO4A 3AUFA 4DM4A 1DDIA 2EQAA 1K97A 2QAGC 3LXXA 2DUMA 4GZ5A 1BJKA 1MB9A 4RX1A 1VA4A 2UVPA 1E3EA 1DJQA 3IVMA 5DEOA 4ZVQA 5DBGA 2V8BA 2GKOA 1GPBA 2NXJA 2XNCA 2A9FA 2BJHA 4FFNA 4G41A 3I34X 4JZKA 4P34A 2LV8A 4GKAA 3WSTA 3ZIAA 3CB4A 1U7HA 2OWEA 2A4KA 1QOZA 3E58A 2JZCA 3ZBPA 3NTXA 1WX1A 4G0QA 1EAMA 2Q27A 4M1YA 4J0GA 4B4OA 1AZWA 5FOQA 1Q16A 2UYOA 2GA8A 3OP4A 2QJTA 2QU7A 1KSHA 5E38A 3JALA 3UG6A 4CTJA 2DVMA 3IBSA 4DLYA 5DIZA 2BT4A 3RTAA 4CMEA 4QPZA 5TJHA 1ID1A 2OXTA 3THSA 2BFWA 1ZO8A 1GXSA 3FVTA 4O25A 4RS3A 1EUQA 2A5DA 2G8LA 3DBIA 3NTRA 1R3DA 3KLMX 2J0SA 3QYPA 4OCZA 3I6IA 2A78A 3QWBA 1KFJB 3G0CA 2JJ2D 3QWHA 4N8DA 3BWMA 4KLCA 4QOSA 1LBTA 1NA5A 2I2BA 2V7TA 2B82A 1ODKA 3ISTA 3ITKA 2O3TA 2PUWA 4DQDA 1QIEA 4IDNA 2BM0A 4Q7KA 1FC0A 3QITA 2JHGA 1AN9A 1U8CB 4G1BA 4NBNA 4OB7A 4EBFA 4EHFA 5LMNB 1BS2A 2UV8A 3THWA 4DZTA 1XQWA 2OO5A 2VAMA 4HQNA 2IRWA 1V1MA 1YZFA 1Q92A 1WEHA 3TD6A 1FQJA 4YV7A 1U80A 4JLSA 1E89A 4EO4A 1NMYA 1QHIA 1HFWA 3CXRA 1IH8A 1DAIA 5H9WA 5LZ9A 4DUYB 1L7XA 1X2EA 1SVSA 1PGJA 1SVMA 5FBVB 4XZ3A 1KPGA 3P2KA 1EXWA 4YJ3F 1ZRMA 2JFVA 4D0GA 1M1XB 3HSYA 1PG0A 1EB8A 3V5NA 2NXNA 2X1MA 4PWYA 1F2UB 2IXTA 4AI6A 3MF4A 1EVLA 3AZPA 1GVNB 2A0WA 5HS6A 2O19A 3OM9A 3A27A 4E1AA 3ZJVA 4E33A 3M33A 4RLQA 1KQFA 3QKRB 3QXHA 4O63O 2QP9X 5F5XA 4K9QA 1SU4A 1ADFA 2QTAA 4DRZA 3QU4A 2DFVA 1M72A 3JASA 4W9NC 4XUGB 2EKDA 2C2ZA 2I87A 1Z15A 3QQ5A 4G63A 4RMHA 5A4DA 2PUHA 5J9FA 4J0IA 3R0JA 1QFSA 4MIKA 1KO8A 1ZMOA 2WSSA 3LCUA 3C48A 1E5XA 1SD2A 1UK9A 3TSOA 2GPSA 2AD1A 3QPUA 1AO3A 4DIKA 3AR5A 5JXHA 3F67A 1PGOA 1UXJA 2OXIA 1FFHA 4TLCA 5JJKA 2HHAA 1CWUA 1DZ3A 1U0EA 2ZQ5A 1CRZA 1E8DA 2CNWA 2VCEA 5SZHB 2QAGA 1TTQB 3F98A 2I33A 4C4RA 2BEKA 5F7JA 1GARA 5K0LA 3DBLA 3VU9B 4O2AF 1YBMA 3J7TA 2WAOA 4LWQA 4TUYB 1ZI9A 4XB2A 1OX5A 3BULA 4D82A 821PA 2O1WA 3L77A 3D4PA 1X38A 1IM8A 1RP1A 3DJFA 4CQMB 4I1PA 5D51S 5ED4A 2QJFA 3AL2A 3EFOB 1DOZA 4HAUA 3RJ9A 3WB1A 4B4DA 1IMOA 4PTYA 1W87A 1UWVA 4N5NA 5BN5A 1D0IA 3OIWA 1Z25A 2F8TA 3R5KA 1W4LA 3O4HA 3JQ7B 4OJNA 5FFFA 3CJTA 2XJ9A 3PT9A 3MRTA 2Z98A 4NKRA 3TQHA 4MI6A 5T67A 2J9ZB 3V1UA 3VKFA 4E3ZA 4QT4A 3U44B 2OYCA 4DSZA 3VO2A 3CF2A 2M2IA 5HKBA 1OGJA 1V39A 3RVNA 2FRVA 4QNRA 1VPWA 3SC2A 5LQNA 1OQAA 3PJRA 1UMKA 3GK3A 5ADUS 3O84A 3WSVA 1EWYA 3X1YA 2AC4A 1O97C 5HUHA 1XNQB 1RBQA 4HH0A 5IXJA 1BD3A 4RYDA 3B3AA 3ILHA 3GCDA 1DKOA 4UU7A 1BMFD 4RJ2A 3IXQA 4N8EA 1GG9A 4YP0A 5JDCC 3NYRA 5A4JA 8ATCA 4QBHA 3NJ8A 1JG1A 2W00A 5AOCA 1FUYB 3ORHA 1ZGGA 3KBBA 4L27A 2O2HA 5TPWA 4E0BA 1PZGA 2WZQA 4AXXA 4ZOEA 4DR4B 4PFQA 2OL4A 5J5VA 1H5QA 3GAAA 2CB0A 1AN0A 4HQ0A 1MXFA 1BVYF 4QFMA 3UGJA 3DKKA 1PK9A 3NH6A 3Q11A 4EM6A 2OGUA 4LYFA 1VJCA 2NPOA 2B1IA 4P4UA 4DA6A 4I19A 4KIFA 4A0QA 4EENA 3L7MA 1SIOA 1CNMA 4S1VA 4BO0A 4V1CI 2J45A 2ZBEA 5DIFA 3W5BA 4QULA 1EWQA 1S96A 1ZD5A 1GUYA 3HMQA 2OESA 5A1JA 3IP3A 1OXMA 1ONOA 3LECA 2C98A 3ZR4B 2H52A 1Z6AA 2JC3A 2WWFA 3F90A 2X8BA 4P53A 5KMGA 2CLEB 4C78A 3H83A 3ZJUA 2JH8A 1NRJB 4I4IA 3B8HA 2TMDA 1QJ4A 2X4IA 3LS2A 3FUVA 4DCVA 2P9BA 5KCMA 1BRMA 4B0PA 1Q11A 2Z9CA 2BMVA 4HJXA 4ITVA 1QQ6A 3B9RA 3NT2A 3B51X 1D04A 2V03A 1SUWA 1Y3FE 4P08A 3ZKAA 1H8EA 4Q7JB 3ZHQA 4CG3A 5LQDA 1E1CB 2RGBA 1RMTA 2NN3C 2IZZA 2Z4SA 4DA7A 1YJ5A 1J25A 3UT5B 5J1SB 1JH9A 2R68A 4FOLA 2JZNA 1E5DA 3R3JA 4FUQA 4MXDA 2VYVD 4LV6A 1SVWA 5BUQA 4RZXA 1VL8A 1F9EA 1XRQA 4JBXA 4K6HA 4ENQA 1MJ5A 5IUJC 2EU8A 2FHSA 2JK0A 2GCEA 2AG1A 2PAAA 4A8PA 3H5OA 1Q3TA 4JQYA 4F5WA 4GX5A 4RJJA 2X0RA 3FUXA 5AW1A 3WHLA 4B3SB 1LRLA 3K0CA 1QK3A 1O94A 3G8BA 3GJ0A 1S9HA 2YVLA 2V7UA 1V11A 1BYIA 3R3UA 3I01M 3Q0IA 4LZAA 1ZD1A 4MWOA 4D44A 1T6ZA 4DZZA 5AW0A 1B2RA 3PFIA 1CS4C 5HRAA 2O3JA 4YEDA 4F9TA 1HURA 3E9NA 5BOSA 4H7HA 1WP9A 4RF5A 3NBMA 4B2YA 2NTJA 3GLFA 2VDKB 5DXJA 3TKYA 3BWYA 1AHHA 4ZQHA 4LBYA 4COOA 3PWSA 2BEWA 2XDQA 3S3TA 2C04A 3G59A 5IYZA 4L6AA 2PR7A 2WTUA 3LGAA 2FPOA 3LDGA 3WIBA 1JG6A 1RLJA 4HDCA 1PDVA 1GAQA 4M46A 1D1TA 2QKYA 1RLMA 2P1RA 4K86A 4YJ2A 2ZBUA 4U2CA 1QM5A 2PZJA 4GI5A 4X92A 3P4XA 5ULLA 4P4SA 1OWOA 3ZFUA 1U1DA 3TW6A 4FFPA 3RG2A 2C97A 3HJGA 3ZOKA 4B84A 3T7IA 3UMGA 2AG5A 4XLZA 4RHUA 2WHPA 3DS8A 2PEYA 2BEUB 5D3KA 4UHDA 1W88B 2E4WA 3BGVA 2OBNA 3DO6A 1RAGA 1UBLS 4XE5A 3WMEA 3WLOA 1A50B 3X3HA 1Y8ZA 4BKQA 2OZVA 5DMXA 3VV2A 5B7QA 2OWDA 5JEDA 5K6AA 3LLUA 3B13B 2DH5A 2ZM5A 1WUJS 1X92A 4IO0A 3QFRA 4GZ6A 2WLSA 5AKJA 5JLAA 3A4LA 4NF2A 3WDKA 5K9ZA 1AA6A 5ECDA 3NU1A 3LO5A 1UDAA 4CMAA 2C3YA 4IDGA 2XKJE 4ZMRA 1EVKA 2QUZA 1Z75A 3HHPA 4GRAA 5JDIA 4FYIA 1KK0A 1Z22A 5CP8A 3GLFB 3NUZA 2FFRA 1WZCA 1FXUA 3UQYS 4BYMA 5BRJA 2QMHA 2PQ2A 2ZIEA 3CONA 4IVNA 4LIPD 3DWFA 2WKRA 4QHYA 2G4VA 3T3GA 5DISB 2R62A 5EPOA 1DC3A 5CAEA 3HU2A 2QRUA 3A6ZA 2W6PA 3L4SO 4EAAA 3ZFTA 1YZVA 3OKCA 4WACA 4B6SA 4MQFA 4RVCA 4CUJA 2YYAA 3HWWA 3KKQA 2ZATA 1IBLB 2C77A 5HJ2A 5B1EA 5EQTA 4G65A 2ACEA 2NT4A 4KV9A 1SCQA 5L51A 2YZKA 2REXB 2GCPA 3BXZA 1CEXA 4HWOA 2VG8A 2WFLB 4R81A 5B6IA 1B1CA 2ZSEA 1CRLA 3T7JA 3EXG2 2O2GA 3H19A 1GDDA 2R1VB 1JHUA 3WO1A 1ECGA 2AG8A 2IE0A 1BIFA 1SU7A 1XTUA 4UNNA 1EDOA 1UP4A 1HLFA 4UMVA 5D6NA 3IILA 2BMEA 2ZWVA 3JSAA 4EF6A 3VJRA 5AKKA 4NZMA 4UDNA 4B43A 3A1NA 4X9XA 4B3XA 4J2OA 5LWQA 1U3FA 5H0IA 3SZOA 3VGJA 4NX2A 4JJ7A 1RWQA 1XLTA 4PLCA 1HG1A 1CY1A 4TQGA 4ENRA 4KQMA 3CUYA 1SMKA 1U7ZA 4WZAE 5C9ZA 2JANA 1YONA 4RD1A 4X84A 3RC8A 1Y4DE 2CVPA 4FDLA 1V6CA 2H4FA 1KYXA 1SD1A 3ZW7A 1QPGA 4UBOA 3WL5A 2H2GA 2W6IA 3VH3A 2VWQA 4MLZA 2VOEA 3BE5A 3N2KA 1L7PA 2GSWA 2G25A 4UHJA 1PJCA 1PW7A 3P0JA 3SMQA 4B46A 5I5EA 1QV6A 4YJ2F 1M0WA 4Z3KA 2XGJA 4YAFA 4V0NA 1NHGA 2PSEA 3UKOA 4HEQA 1GG2A 3B3JA 1X7XB 1EG2A 1FP6A 3C43A 2NQ2C 3FWKA 1WQ1R 3QPAA 4G25A 1N8NA 5DYTA 4ARVA 4DSTA 3EULA 4PZ9A 2PNJA 4Q66C 2MJLA 2YJ3A 4OUKX 1K63A 1K7YA 2VA8A 3F7TA 4JNKA 3PNSA 2OLJA 4R2XA 1RFGE 2XOXA 3HCCA 4OF4A 2BFCB 3O4FA 4QUGA 1EFKA 1KFEB 3ZGVA 1W2GA 1M6VB 1RAHA 2IHKA 3VR4A 5L3VA 3MBOA 4RMGA 3N8GA 4JFRA 4MRAA 5DM0A 4KITB 5KOHB 4HGYA 1OH6A 3IXMA 1GU1A 2PXHA 4PSKA 5F4ZA 4A15A 1GPWB 2ECOA 4DR2B 3AINA 4FB4A 1QP0A 2O54A 4DQXA 1KKLA 5AM3A 1DKUA 1I33A 3PF9A 5CA1A 1SXJE 2GPNA 4LK2A 4IIDA 4RAQA 3OTIA 1GRVA 5D87A 3IUPA 1Q15A 1RQRA 1G20B 1CQPA 3E27A 4QDTA 5BN3B 2W2NA 4AS1A 4COKA 1Y6ZA 1QE5A 1VMIA 2DSNA 4B6QA 1XMOB 5AJWA 4AJ4A 2ZBGA 3L6RA 1F48A 3QU5A 1E3SA 1QPZA 2W6QA 2FN7A 1WXIA 3FCCA 1YRYE 3P0IA 3B1WA 1CNEA 1VMKA 2PJUA 2WA1A 4EB6B 1Y5RA 4JD5A 1R0LA 4RK7A 4XTCS 4WVFA 1VSVA 4ID9A 4NFSA 1P5RA 4FNMA 4RVNA 3R44A 1JSRA 3K0KA 4YAJA 4G1CA 3CNNA 5KJ6A 3PQEA 2QW1A 1OCEA 4IUCS 3TLXA 3Q8LA 4S1OA 5EIOA 3KJNA 4ES6A 1VE1A 2I34A 2QE7A 3ME5A 4Y2QA 4YALA 4LXIA 3IE2A 3ITEA 5F7ZA 3FHLA 4A5OA 1YK1A 4N4AA 5IP5A 3SICE 1A82A 2OQIA 4DA0A 1PCXA 1ML4A 3FSJX 5CA0B 4ENPA 4XFDA 4EFLA 2FUG1 5J5CA 5ALUA 3N2LA 4LJYA 4PLFA 4CBVA 4Q00A 1TKBA 3DOIA 1A5BB 5AESA 2OD2A 4NICA 1WKVA 3JAWB 4NVRA 1PYOA 1UMBA 3EDQA 1J2EA 5C8ZA 1CY7A 2OG1A 5KINB 1F3OA 4OOFA 2XF8A 5BRNA 2XQJA 1NOJA 1MP0A 2J67A 3L1VA 3V7WA 2X2FA 1KETA 4RFVA 4QUAA 2HHCA 2YQ4A 3A1VA 4RYLA 4P3YA 2J07A 2BCGY 3UUGA 2PGXA 1S3SA 2JIDA 2PMWB 1NL3A 5BXQC 4DIDA 3F5FA 2I62A 3RKSA 3DQPA 2ZTVA 1EEXB 3DAFA 4KO2S 3WE7A 5CBKA 4W1QA 3MTJA 2ZR0A 1LDBA 4QATA 1BHQ1 4FYXA 2OP1A 4ZI7F 1KQ3A 1Z4OA 5AICA 4G0ZA 4G86A 1UZUA 4JX8A 3VNUA 2I6XA 2WDZA 1JJIA 3KUUA 3PNQA 5BV1A 4UTXA 3BKXA 2OAEA 1CY4A 2GPTA 2XCQA 1PEYA 4FNOA 2Z2YA 3D0RA 3NUQA 5KOJB 2BDTA 3U4HA 2YV2A 2AMYA 3QKUA 5IAJA 4D8YA 3V1TC 5EJ6A 4KE9A 5EMJA 2ODEA 2GEBA 4TV9F 2WU1A 1CSEE 5DX8A 3BICA 5CVVA 3U16A 1CFJA 2Q9CA 3QX9A 1G5QA 3KTAB 1I7DA 2WWHA 4AU1A 3MNFA 4FX2A 1ZQ1A 1Z6GA 2HQRA 2FGKA 2JGRA 3Q5EA 5IKEA 3KM0A 4IGEA 1QFXA 5AKGA 3F6YA 5C3UA 3X2FA 1NUAA 4MWZA 3Q4GA 4D3DA 5IJ9A 1TEVA 4B9AA 5K0ZA 4LF8B 1NYRA 3WK4A 2OHFA 1UWLA 3VHXB 3Q12A 3ZZTA 1S8NA 4AS3A 2YTZA 1E2GA 3A4IA 2IHJA 1R64A 3HCPA 2C9BA 5HQTA 3WY9A 1AB5A 3DLAA 1QKKA 5D7NA 1WD5A 2RKWA 4OX9Y 1IK4A 4BPBA 1NZDA 1SOVA 2QSUA 2DBVO 4L51A 5K0NA 1I1QB 1UBOS 4R41A 2OT3B 5AVOA 5FUWA 5IT9A 4OHCA 1KAGA 2PX3A 3OLXA 2FZKA 1YU6A 4ACAA 2Y6UA 3C3XA 2YVUA 2ZQZA 3CWZA 4GX1A 5HFAA 3QNWA 2TMYA 5M34A 5T7BA 4G0OA 1MH9A 4WA7A 3SKYA 4HS4A 4CKEB 2HCRA 3OU6A 3VU3A 4KJXA 4EY6A 1WSBA 3KSUA 3BX1A 2R7MA 3SVTA 3AC0A 2HWYA 5EMMA 3T4UA 3FVWA 5TVKA 4CQJA 1LLDA 4M8SA 4DDKA 1H0KA 2FK8A 4QIHA 4BX3A 2D8MA 3EBPA 5G0TA 4NH0A 1ORIA 2M1XA 4MKGA 3SC6A 1RRKA 5FJJA 5LQAA 4DV4B 4ER6A 2W6JD 3J81k 1Q0SA 1U99A 2VT2A 2VLBA 4UDYX 2FPSA 1DUIA 1ZJWA 2VBCA 1SB9A 1XD2A 5UKDA 4CDGA 1WUTA 1KO5A 4REMA 1YQ9A 4J03A 3TIFA 3HCBA 2XB6A 1V45E 1OLUA 2VNHA 2XPCA 1ODJA 4MMZB 1A7KA 4PC1A 1GM5A 2PO7A 2I5PO 4NYIR 4LSGA 1NNSA 3JW8A 3PCTA 4TMFA 4TMZA 3RYTC 4G0VA 2AN4A 1MC5A 2QVXX 3C3DA 2X1LA 2PBZA 1G3MA 4YRLA 1H1LA 4ZD6A 2QMQA 3LKVA 1UPUA 2CZCA 3CKMA 1HEYA 1TLFA 1E79D 1GAWA 1GCGA 2DWCA 3BMCB 2P0AA 3E9RA 3EH1A 3R6TA 4GM4A 4MJ3A 4XR9A 4AICA 2C4WA 5JC1A 3HKBB 3HB0A 3LI2A 2ZGVA 1UFOA 3DE2X 3QKTA 5H4HA 5HGXA 1RJFA 2L0XA 4ILKA 3I61A 3COYA 1S2OA 4IICA 3RPEA 4DCGA 4LC9A 1HORA 5IKPA 1K9VF 1JHAA 4O2AB 3ZNPA 4XPZA 3GEBA 4MEJA 3B3QA 2ANBA 3WO0A 4TSRA 4WZ6A 3ZOZA 2DUNA 4QTUB 3UMYA 1V4BA 3HP7A 2BI4A 1ZR2A 2OCDA 2B9EA 2PA0A 2QPOA 1XZIA 4YUYA 1TOAA 1TYDE 2WU8A 3HB7A 4MB6A 4WNYA 1QQAA 1DB3A 1W4BA 1RYBA 4UM8B 4EYGA 1AKEA 1GGMA 5D3MB 1DC7A 4HLQB 1ZGBA 1KYZA 2GLTA 4KXMA 4QXPA 5TEWA 3RC3A 4OXNA 4EZIA 1N7IA 5K03A 2H3HA 4AG6A 5LD2B 2ZRNA 5E4JA 2XNKA 2XUAA 2IKQA 5L3SB 5J43A 2ODQA 1TM2A 3G2QA 3GJ6A 4POOA 4MRPA 4PVDA 3KJQA 1U04A 1V7CA 4XWYA 3U3OA 2F1RA 3EZXA 4JOQA 1TJ4A 2HRZA 3WQRA 4G81A 3TZ6A 3K6RA 1L0BA 3F6EX 4ABYA 4CDMA 4F8YA 3LUFA 5FUYA 3WRYC 4F0JA 3TX2A 2RH5A 2Q7DA 3HKCB 5D85A 3A3OA 3E3NA 4MUKA 2OCYC 4YXWA 4F3CA 5IKXA 4LQDA 3HYCA 5JEEA 1U8AA 1A2QA 2Z09A 3UJ9A 1PFKA 3ROKA 1E9FA 4X3CA 3HKDA 1PJSA 5K05A 4M60A 1ISPA 1KQPA 2IYLD 3A0UA 4HNQA 1Z62A 2KLBA 3JAKA 4MVJI 1US8B 4EITA 2PKQP 1WPRA 3A1WA 2W70A 3H1AA 3TIIA 1X1QA 4P8RA 4XB6B 2AS0A 3B8EA 3CE9A 4NABA 5KQGA 3V2HA 3KQHA 3HLYA 1YUNA 3LJKA 4TM8A 2NUPB 5CDSA 1RM5A 3ELDA 4KLZA 2NTEA 4O4IB 4WOBA 1C2YA 4LF5B 2BSQA 4X44A 3F9CA 2YN0A 4PGGA 3W5IA 1UFRA 3MS2A 1UK7A 4B74A 1XHEA 5H4GA 3HM9A 1G1AA 3MJ4A 1U2RA 1A8IA 5DTJA 5P21A 2H7VA 3O4RA 3X1XA 4MQ4A 4BMOB 1KC1A 1HTWA 5K1ZA 1QC5B 2FAXA 5EXTA 1JA0A 2ZB4A 2NZXA 2ZTUA 2QRVA 4O6VA 3BFJA 3SZ3A 2IYTA 3E70C 2B8NA 2BZ1A 1ZOPA 4B85A 4YLYA 1XF9A 2WUFA 4Y3UA 4REOA 3ZGNA 2PRKA 3OA2A 4HGPA 1I2DA 1G8AA 1SEPA 1KYWA 1U8FO 3C4JA 4P32A 3V7NA 1DFGA 1UR5A 5CT6A 1KIFA 1SK9A 4BO4A 4YMIA 5K0JA 1V35A 1E9BA 2VH5R 2FPRA 3C45A 1JI3A 2FWRA 3HA2A 1JIIA 2OV3A 5ALZA 4WKGA 3H9QA 4N65A 2ZWIA 2UZ1A 4HHEA 4YJDA 2UUPA 3ZE9A 4M76B 4XUDA 3TMKA 3HG7A 3R7AA 4CKBA 4PWZA 4BFWA 4DDUA 1N5JA 2GEKA 2Y9PB 3N70A 4REQA 3HPRA 1CQXA 1QFYA 1W1UA 1U9IA 3GXBA 5JT1A 1W25A 3ZXIA 4AF7A 2YV3A 3L1UA 1SOAA 4GDFA 1W29A 1RVV1 4QUHA 1XSEA 1T5TA 1U02A 2A5JA 3EQ9A 5IANA 4LGYA 1EB9A 1NW3A 1Y1TA 2QRVB 4N47A 1F6BA 3W2GA 1PP4A 1MO2A 4M0CA 4TSKA 2AK2A 4OATA 5EGNA 2VAPA 2BMFA 4H60A 4RL4A 3DDZX 4AJJA 1U1EA 5G41A 2O9JA 3LW8A 3ZPXA 3F3SA 3Q8WA 3IIIA 1AO0A 5CURA 2XDYA 5AW8A 3GCGA 1RKXA 4L8LA 3SJCA 1X1BA 3H8JA 3HY3A 1II0A 3UV7A 4BS9A 1M0EA 3S2EA 1CD5A 3CRNA 3BXHA 1QTIA 2XXAA 1PFVA 2TYSB 1JTVA 1C3JA 3M6WA 4U9HS 1N5RA 1U8ZA 4XJSA 2B6HA 1V3VA 4U7TB 4CLDA 4EUEA 5I9SA 3V2IA 1NRWA 1RQ2A 5ALLA 5LU8A 4KHPB 2GQ0A 2E49A 2CJFA 2EFDB 3A1UA 3PDIB 1S7CA 5KNBD 3FPLA 2VHUA 5CLQA 4OREX 4QU9A 5BSEA 4DNXA 3GNSA 5KNDA 1R16A 4Q4HA 2BI8A 3NT5A 3BSFA 1WXWA 2HMAA 1SBZA 4QPDA 3KUKA 1NFQA 4XDHA 2M32A 1QGUA 2C1XA 3CY6A 5TX7A 3H6GA 4QM6A 2O8VA 5FOXA 2G5GX 1K6EA 4D0NA 1ZL0A 4EABA 3P26A 2D4AA 1OA1A 4YJGA 3KOMA 4NOKA 5BSGA 1CIPA 3FNFA 3DAGA 2PUBA 2PQMA 1MA3A 2IYFA 4PCAA 1UKCA 2DHDA 3L1KA 4CR8A 1ICEA 3FGNA 1O58A 4YJFB 3DLBA 3OX2A 1UODA 1UPCA 2PMCA 3T5MA 4D46A 2GBGA 1HC7A 3RHFA 1WHSB 3TECE 1U7UA 2F7SA 4L15A 1NSYA 1RC0A 3KJEA 1Z2NX 3WMWA 5BPFA 5JNSA 3NHZA 4XIJA 3VZQA 4PLVA 4C7JA 3C0KA 1RZUA 4OQYA 4DILA 2VUTA 1J2UA 3UHPA 1A95A 1Z8HA 2WEKA 2DUWA 3FG9A 4C6SA 1UC5B 2ERCA 2QIOA 3GU3A 4U7FA 5LYJF 2G06A 2MU1A 4NSNA 3DYBA 4Q4JB 1WMBA 1KDRA 1LUAA 1UT8A 1VCHA 3CIFA 3QBTA 4V03A 1JQ3A 3DB2A 4GQAA 3FDZB 1Z82A 4OU4A 4DS3A 3KZMA 1VRCA 1L5GB 4DVJA 3I39X 2C4TA 4G2NA 4KNVA 3K71B 2QYHA 1W85A 2P5SA 5GM1A 2JHAA 3KETA 3WLQA 4JVSB 4JKIA 1MUUA 2P68A 1KSFX 1PJAA 1XEXA 3C1TA 4RPHA 4YT4A 3D4BA 1Q7BA 1SG0A 5KVCA 4L0CA 4CU5A 1EIZA 2BEUA 5K5EA 1I0LA 3KB6A 3ZY4A 1FYFA 1T4MA 2GJ9A 2MSDB 1I14A 1H4QA 2JI6A 2CW5A 1T9BA 3WB9A 4LW8A 4HDRB 3GJ8A 4URWR 4J1TC 3ZVKA 1T34A 3P9IA 1QJCA 3GZNB 2GBFA 3KPWA 1QAMA 3TDMA 4E32A 1OU4A 1AG9A 4FWTA 3KP1A 2IP1A 5JO0A 2RBKA 4N54A 4PXYA 2JEZA 2OC4A 3DVAA 4M6WB 2DPYA 2IWHA 1BXRB 3T34A 4XVCA 1BDIA 4ZO8A 2FUKA 3AZQA 2FB9A 2RAPA 4RY2A 4PSDA 3EX7C 3O8NA 1LCIA 4KQGA 1NQOA 4Q24A 4ON9A 2Y77A 1ZZEA 3K5PA 2ORVA 3Q9UA 2EGHA 5IASA 4DXAA 2IP2A 1H2EA 1TW3A 1OJLA 3WIVA 1NG9A 1X7ZB 3P2IA 1YA8A 2B8JA 1IN8A 1T36B 3JWHA 3ODGA 2R00C 2ZUBA 4R8LA 1W30A 2QF7A 3EVEA 4WT7A 1B74A 4DMHA 1J5XA 1XAGA 2YJZA 3IP7A 1JE1A 4NE2A 2VA9A 3VZPA 3O9VA 4MIOA 4WOCA 3IL2A 4O1IA 3ACDA 2OGZA 4M8NE 2BUBA 4QHTA 4C14A 1MCZA 1D6MA 4D8TA 1QYXA 2OO5C 5IC5A 3ZY2A 3KTOA 4IHAA 4TVBA 1B3RA 2HA7A 1F51E 4KQJA 3C8UA 5I8ZA 1R15A 3A2NA 5DF1A 1MO6A 2R6CA 2YV5A 3UY4A 5DTQA 2HSDA 1LV8A 3L41A 4GWGA 2WIBA 2NSDA 3ELUA 1WXDA 1EX7A 3MGKA 4AYWA 1BYUA 2BE9A 3OPYB 4TOIA 3CSDA 4XVRA 3HB1A 2Q3FA 1JG2A 5JECA 3QNMA 4UPEA 2B83A 1PL7A 1XCLA 2VDQB 3G89A 3S6JA 4F4HA 2XNDA 2Z9BA 3CVYA 2QRKA 1YA6A 5FV4A 3OE7A 4M8IA 2V0NA 4B47A 3EZLA 1OFUX 5JJIA 1Y42X 1Q77A 3DZFA 4A2WA 1IIBA 2GZSA 3EXEA 3LD9A 4NH4A 2MSKA 3CLUC 2F4VB 4BYGA 1CYEA 2O1SA 4W5OA 3LUGA 5KKNB 2E6KA 3OT4A 5I9TA 3ZJTA 4YXWD 1Q44A 4EB8A 3FCYA 3AJDA 4ZYTA 1BVRA 2YIMA 4MCAA 2NO4A 5JUWA 4TWBA 2BEVA 4UASA 1QYCA 2QA5A 4DWWA 1UOOA 3MWGA 2XI4A 3FM9A 4NESA 3QVGA 1VKZA 3JYNA 4XR4A 2PSDA 3P9NA 2CLLB 4GKBA 4KXVA 4PTZA 5L7YA 3RNOA 3HDJA 4I8XA 4NY1A 2P3QA 3MTEA 2PX6A 1E94E 2J08A 4TWJA 2WINI 3V8MA 5I7WA 1U2GC 2PJZA 1Y5IA 3R41A 3ZV5A 2OC9A 3KR1A 2DBQA 3VHRA 3UM9A 5SYAA 1T5OA 4XCQA 2FLVA 4CEHA 1CRPA 4TM7A 3VPAA 5LNK1 1XZPA 3K72B 4CM8A 2HHHB 1KTIA 3O8OA 1EGAA 1GT6A 3R5FA 3SKVA 2I4TA 2NYVA 1K7SN 1MH1A 1IAVA 1JDNA 1QB8A 1PL6A 1T0BA 4S1PA 5LDHA 4HWRA 4JOSA 4CIDA 3ABIA 1QYWA 1JPVA 1P7YA 3OPYI 1L7VC 4J3JA 4RY8A 1R0WA 4GPAA 5ENZA 1PX2A 4ZU1X 3TLMA 1BWPA 1JKFA 2WJIA 4OIFA 5CDYA 2QS9A 1ZN7A 2OV8A 4XX0A 4BFYA 1H5UA 5C5CA 3CCCA 8OHMA 1BN7A 3WIUA 4YT8A 3LWDA 4MHTA 1EDBA 2WFLA 3QENA 4CDNA 2PCLA 3GVCA 3AMVA 3F8SA 4YRDA 2Q28A 3HV0A 4V0MA 4DPMA 1TA0A 1HE3A 1T9GS 1OXXK 3BC1A 1KAHA 2ZETA 1TYAE 3LGXA 1U3UA 3V4FA 4AZVA 3HTXA 3ZWPA 1MXHA 1R8SA 3I8XA 4TV8A 3OJOA 5KS2A 2ZCUA 4P22A 4MI1A 2OA0A 5GY7A 3E1GA 4EH1A 4G36A 2KB0A 4RF3A 3DEIA 4UQLA 1T3SA 1Y1KE 4UMFA 1G17A 3VDNB 5KPDA 5AMXA 2JA1A 3RLIA 5EIXA 2GFQA 2ROQA 4FHCA 5I7EA 5FWXA 1DKRA 5COBA 1P3DA 4HNAA 4G8CA 3OC0A 2ZRAA 3HCDA 3IT2A 3MJEA 2JGAA 2F6RA 3E9ZA 1TVFA 1KJYA 2GK3A 4HZIA 3FR8A 1ECJA 4RA9A 2V7GA 4E31A 3UICA 1GU7A 4PAGA 4EG4A 2R2GA 3DUWA 3AKDA 3B1VA 4CF4A 1BZYA 2I4MA 2QRQA 3F6RA 3I1JA 3OA0A 4JWTA 1Y7PA 1VM6A 1TF5A 2QIPA 3G0IA 5JS7A 4K9DA 1XD2B 5HZMA 2CN1A 3LWNA 2VF8A 5CFZA 3L82B 1NWHA 5LFAA 3BMQB 2ZUFA 2CLFB 2W2VA 3IS3A 4MCHA 1GPDG 3C8MA 6CHYA 1F6DA 2HCTA 1AKNA 5KX5A 3SVLA 3N0TA 1J5PA 4JI7B 2P4UA 2GH1A 1FU7A 3CB2A 1C9EA 5TGTA 3SS7X 3O91A 3W8EA 3AVWA 1O54A 2H5EA 4WKCA 1JUDA 4UU1A 4PZUA 1LDMA 3IPLA 5BY2A 4G84A 2AG6A 2VDJA 4LXGA 3JYPA 4EX7A 1E1YA 5IC4A 3G5UA 4ZXPA 3NGMA 1DIAA 1Y3IA 3KKKA 3DO8A 5I9NA 4WY8A 4Z4IA 1AKWA 3DKIA 3CUWA 2I6SA 2QD5A 4LJ5A 2KWIA 3ZK9A 4HUQB 3ZI7A 4ZVTA 2F43B 1F60A 1NNI1 3O92A 1AQLA 3PPYA 1A04A 2PGOA 3UMVA 1ZINA 2FW8A 2WLTA 3A3NA 4HX9A 1NYLA 2R86A 1GDHA 3M6FA 3L40A 4R2LA 4JL6A 1R37A 2CUTA 3I1FA 3I8OA 4U1RA 2PYZA 1VMAA 1R6DA 4GR4A 4J7AA 3M6AA 3ZU2A 5FUXA 1GQRA 2DGDA 3C5WP 2H16A 2J9GA 3V42A 1AKMA 4NECA 4F12A 3D1LA 2C4KA 2UXBB 5AJUA 2DBRA 3F1KA 2EZTA 1RKVA 3UTDA 5C5IA 1XMQB 2WOOA 3HVKA 1J8MF 3N8KA 1CUFA 4AQYB 2XVMA 2NP7A 3F46A 3PGJA 1Y7TA 4KQ2A 4UBLA 5CPFA 4F1KA 1H3NA 3NDRA 5HP4A 1KZ1A 4B17A 1PNQA 1UMDB 4XWGA 5FFNA 5CH5A 1W0JD 4AROA 2FSPA 2GJ4A 4LGVA 4Q4AA 1AXEA 4K3VA 4MARA 3JYOA 3BWDD 3QE3A 3CPEA 5A9TA 2UYCA 4FR0A 1P29A 1RKBA 3U6BA 5BNZA 2AL7A 4EYQA 1RWWA 4GBJA 4CF3A 5KNCA 3NAZA 4UVGA 2O8BB 4MS4A 3LRXA 4X7PA 3TEJA 2XMSA 3K16A 5EFZA 2HCJB 3CPSA 1HMPA 4I1SA 3UJDA 2PO5A 1I4OA 3L05A 4BV8A 3K2QA 1L4KA 3TNDA 4INJA 2BOVA 4FQ7A 1DLJA 1F4VA 4Z0TA 3SZUA 2V74B 3PPIA 2VKQA 5HQ3A 2AKYA 2PKEA 2PT9A 1D2RA 3F7OA 3IOCA 3HNRA 4O2BB 1G66A 5EJFA 4B7CA 4IIXA 5LL6P 1JSLA 1T6BY 2HL6A 3QKSB 1YZLA 2DUJA 4B2LA 1TYBE 2E48A 2NZUG 1EBUA 1ZIOA 4FSXA 5LPNA 5ERGB 2A2ZA 1QCCA 2CFOA 3NNNA 4A8HA 2VTEA 3SQXA 1ODCA 3C3KA 3WLLA 1ZPDA 4A6DA 4Z49A 5B55A 2YKGA 2NZ2A 3DTYA 4MW2A 4V0ME 1WSWA 2K7FA 4AG3A 1VSTA 1GJRA 1GL6A 2V9ZA 4Q16A 4ARBA 4DWVA 4Z51A 1Z0DA 4FFVA 4DV7B 4HDQB 5BSRA 1XZAA 1TM4E 2GJKA 2WJPA