2FDXA

Clostridium beijerinckii flavodoxin mutant n137a oxidized
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fdxA00
1YCGA 3LT5A 2BF4A 3UXHA 4FGKA 2OHHA 2FDXA 1B1CA 1J9ZA 1QHEA 4XDHA 5F4BA 2ZKIA 5LLDA 2BPOA 3ESZA 3HR4A 2QWXA 2OHJA 3KAPA 3F6RA 3K1YA 2GSWA 3FW1A 1T0IA 5NLLA 1AKUA 1YCHA 4QOGA 4QODA 2AMJA 2MOKA 2Z9DA 3NHYA 3F6SA 1TIKA 4H2DA 1C7EA 1QR2A 1YKGA 3GFQA 3N3BC 4PU0A 1AHNA 3U7IA 3SVLA 1J9GA 2KQUA 1OBOA 1RLIA 5JROA 2Z9BA 3OX3A 1I1OA 4C76A 3HA2A 4ZVMA 2QR2A 1SQSA 3LCMA 1CZRA 4N65A 4YQEA 2MWMA 4YAWA 1BU5A 5EMNA 1CZLA 2OHIA 4YALA 5FA6A 3ESXA 2QX9A 5LBUA 2HNAA 4Y9UA 1AG9A 1JA0A 2A5LA 3KEGA 1XYYA 3O2NA 4ZVNA 2QX6A 1J8QA 1C7FA 4BMOB 1T5BA 1ZX1A 1XI2A 4FGLA 4DIKA 2FZVA 5LJLA 1AKQA 2N1MA 1NNI1 4N82A 1YOBA 1XYVA 4ZVKA 4S24A 1JA1A 5LVAA 1CZHA 2W5UA 1H66A 2Q9UA 4ICIA 4LAFA 1CZUA 4M0CA 5ULLA 1FTGA 1XT6A 1AKTA 1FX1A 3NHWA 3B6IA 1AMOA 2FX2A 1DXOA 4QOEA 3KLBA 3W77A 2FCRA 2Z98A 2V5UA 3JSXA 1YDGA 5FX2A 4GQIA 4GR9A 4PTYA 1OFVA 2OYSA 3HLYA 1YRHA 2MT9A 3RPEA 2Q62A 3TE7A 3GFSA 2FAXA 2M6RA 2F1OA 3KAQA 4J8PA 4XDGA 5FUQA 2V5VA 1AKVA 5LBTA 5NULA 3NLLA 3U7RA 3EYWA 3W79A 5B3LA 2QX4A 3NFRA 1AKWA 1CZNA 1DXQA 4Y9RA 3FX2A 2D5IA 3OWHA 5TGZA 2MTBA 4C0XA 5B3KA 1WSBA 5LMCA 1RTTA 4QOJA 3D7NA 4QOHA 4OXXA 2FVXA 3QFCA 4NLLA 4R81A 1BVYF 2QMYA 1QRDA 3B6JA 1DX9A 2BZSA 5BUCA 2FZ5A 1CZKA 3NHLA 1D04A 1D4AA 3N3AC 3O73A 1F4PA 4U7FA 1KBQA 1J9EA 1RLJA 3UXEA 5A4KA 1FUEA 1AZLA 3OWXA 1RCFA 3GAMA 3OJWA 3W7AA 3FNIA 1ZWKA 4YAUA 3L9XA 1VMEA 2RG1A 3G5MA 5EA2A 4CETA 3F90A 4NULA 5F51A 1FLDA 3NHKA 4FX2A 4HS4A 3QE2A 3P0RA 3W78A 4GI5A 3OX1A 3NHRA 3F2VA 4PTZA 4ZVLA 4LTMA 4DY4A 3NHSA 4Y7CA 3K20A 3NHUA 3OVMA 4BMPB 4D02A 1FVXA 1GG5A 2XOEA 4QOIA 1FLVA 4DILA 1FLAA 2Z9CA 1SG0A 2FOXA 2B3DA 2FLVA 3QFRA 1OBVA 5EAIA 1ZWLA 2HNBA 1WSWA 3EDOA 4ESEA 1CZOA 1AKRA 4LA4A 2X2OA 3B6KA 4C0WA 3OX2A 4H6PA 3S2YA 3ESYA 2QMZA 4C14A 2R96A 2BMVA 2QX8A 2HPVA 4QOFA 2KLBA 3TEMA 5LJIA 3B6MA 1V4BA 2BN4A 4HEQA 2X2PA 2M6SA 2V9CA 4FGJA 5F12A 1X77A 1E5DA 3ES9A 3N39C 4CF6A 3GFRA 4LTDA 6NULA 4U7GA 4YAOA 2ARKA 1H69A 3OJXA 1QBGA 1FLNA 1KBOA 3R6WA 4LTNA 1TLLA 3L9WA 3NHJA 1YCFA 3FJOA 4YAFA 4N9QA 4U7HA 3TZBA 2XODA 1D03A 3ZHOA 2R97A 2WC1A 4F8YA 3FVWA 3NHFA 3NHPA
chains in the Genus database with same CATH superfamily
3IH5A 3TIFA 1CPYA 1FRZA 4FGKA 3DQQA 3UHPA 4LYJA 1JXAA 3FDJA 4BGEA 5B12A 4BLVA 2WZBA 2C84A 3AUYA 3C5CA 2AKEA 3E9CA 4GZ5A 4Z6KA 1TKCA 1EE9A 5FH9A 1MLDA 3FPEA 3HUEA 5LBTA 2AFIE 4YRLA 4WKOA 1EFRD 1DCFA 2GVZC 5CX1A 2IXBA 1YQXA 3H99A 3PWZA 2WF9A 2IZ6A 4R3NA 4Q1BA 1B6GA 2BDUA 4YJFB 5BPHA 3DVAB 5DTQA 4UBKA 1Y6ZA 3DDUA 3N86A 1H1TA 3EA0A 4HDCA 2E7ZA 3H0KA 1F2TB 1FF9A 1NIPA 2Y76A 3ZDZB 5C0OE 1A3CA 1E9CA 4JXJA 1Z88A 4L76A 4TTJA 4URFA 4HV4A 4P84A 4RTQA 1JG4A 4A91A 2WOOA 3C3XA 3LM8A 4PWZA 3AR5A 2GNPA 2L19A 5EIFA 3OT1B 4RJLA 3TSWA 3USCS 2PQ0A 3QA3E 4IIGA 4RF4A 2HJSA 3VDNB 1XZQA 1XHLA 5E9JA 4E88A 3VJLA 2NZJA 1RZ3A 3QF4A 3M4XA 4RTJA 2FX2A 1PR4A 1E77A 3I0MA 1ZH2A 2PQ6A 1X87A 4MS4B 5KC8A 1RHJA 1YRHA 1MJHA 3ORFA 4I9GA 1GQSA 3OQOA 4PZLA 3VPFA 1MB4A 1DRVA 3RIHA 3W1VA 1KEWA 4ND5A 1X7XB 5EJEA 2G17A 1AKYA 1PLLA 1IWOA 2A88A 1M6VB 3UJPA 2P9JA 3HUUA 2MYUA 5CITA 1E60A 4YFYA 3UJ7A 1QRDA 4ZMSA 5DN6D 5AI0A 4NU8X 4Q9NA 4JS0A 2DBQA 2HHCA 2G09A 3HEAA 3P9RA 4NK5A 3SFVA 4DLUA 4C43A 8ADHA 5DNYB 2C5LA 3AKYA 4NI5A 4KMSA 2I29A 2NXNA 1FUEA 2EFCB 4L6CA 1R64A 4DSTA 1T25A 4DSAA 1KKMA 2Q3DA 3OFKA 1RAEA 4KXXA 3TRFA 3HKCB 1Y8ZA 1OXTA 5AVXA 4OQDA 1LU9A 4MITA 3EZ9A 5ICFA 2DTEA 4PZEA 4ZVLA 3TD9A 3IGFA 3O91A 2ZYIA 3L8MA 3CZ5A 4E32A 2C3OA 2HZ7A 4I1SA 5THKA 2XCSB 3IEMA 5EAIA 2ZWOA 4TXHA 1KRWA 1GEEA 2IOFK 4LJ9A 3H2JA 3D54D 1EU1A 2MR6A 4RZIA 3SJCA 4ZI7A 3ZE1B 1VIMA 3U9TA 2V8OA 1L1RA 1W93A 2CLHB 4NY1A 2O1EA 1U8AA 2VXYA 3IMCA 3FHOA 1QQ5A 3H3JA 4RFSA 4RKFA 2Q5JA 4FCCA 1NF8A 3MWGA 4MGHA 4CMEA 2WUWE 3HCAA 3L6BA 5JZVA 1C4WA 5LSAA 1A50B 1ZJJA 2UVDA 4JNCA 1CB7A 3E23A 3GJ5A 1OWNA 2XUAA 3CNNA 2QJOA 4YGXB 4BEJA 2H16A 1RKUA 4JLAA 5KTPA 2XB4A 5EHQA 3RABA 3ZS8A 4OHCA 3OE5A 4ZGWA 1CSEE 3FH0A 3WYGA 1N3IA 3LOQA 1E2UA 4FLMA 4GLJA 4BP3A 4EZIA 5J2TB 4J16C 3RUHA 2GLUA 4BFYA 4XDZA 5TNXA 2ZDQA 1DTSA 2DQSA 5J4HA 4NE9A 3OZGA 1NF2A 5KUTA 1PJQA 1RPAA 4FFLA 4Y0NA 5AFSA 1YQQA 5L3SB 1VDMA 5AJVB 1VCNA 2JFNA 2PRJA 4DEVA 3F8TA 1P5JA 2XVZA 3EE6A 1CRLA 3X1XA 1P80A 5HIAA 4W9MC 4LF4B 2Y05A 3L7NA 3LQYA 2KQUA 1HQCA 1OBOA 1O5IA 2BT4A 1RZVA 2HKIA 2X8JB 2XYPA 4F5YA 4PINA 1DU4A 3FLBA 4KBYA 2SKEA 3IXLA 3ZWCA 4B8WA 2IUEA 3LX4A 3REOA 1UK6A 5G40A 3P0IA 4INZA 1IZ8A 3QUBA 2H54A 4KWTA 2PUAA 4EKIA 3FYUA 3B1ZA 3V80A 2QXUA 1S1MA 2B4QA 5DDIP 3GCWA 3UUFA 2BMDA 1UDXA 1PR6A 2DCUA 2JCGA 1QX3A 2V4ZA 1TGVA 1U0RA 3FN4A 4FN5A 5I48A 2UZ4A 4H0CA 3B2NA 2XXJA 4IICA 1DHTA 1EGHA 1FDIA 2DVMA 4B33A 4IIJA 2JRLA 5CEEA 4K2AA 4FYIA 5AI9A 2QNIA 2JH9A 2VT2A 2Z8ZA 5DK4A 5AW7A 2HU5A 1XCOA 1I9CA 3BD6A 2W6MA 1Q17A 2EZ9A 3MJ4A 4FHFA 3LKZA 4ZP1A 2GD6A 3U62A 2EBWA 3TE7A 4CDNA 2XYVA 6ABPA 3C3KA 2FSFA 3Q8MA 3ZXUB 1OE0A 4FZRA 3T9EA 3A6DA 4C6RA 3VR2D 2WUVA 2HT1A 4RFLA 4AMZA 1Q84A 3WFIA 4WLNA 1G5QA 2FVXA 4MWZA 4MVXA 1HDZA 1S7CA 2PD6A 2PPVA 1YS6A 2Q4RA 3EQZA 4Q00A 5LCXA 2WM2A 3NHLA 3ETDA 2AKYA 3Q12A 4NAUA 3CNLA 2JFUA 2NPFA 3CX8A 1GUYA 1HEUA 2DHQA 1GU0A 1Z26A 3EFOA 2Z1DA 3Q3EA 2C7RA 1KC3A 1SOMA 4UTOA 5JSFA 2RHRA 3EDYA 2YNMA 4JJGA 3UHFA 1J8MF 4LMBA 1DI0A 1UKBA 3F73A 4NULA 2FRVA 5I9BA 3QE2A 3E1KA 5KINB 1N3LA 1B2RA 2YN4A 4JBXA 1RQ2A 1N1GA 1NF3A 1VL1A 2EKDA 3KPUA 4RM3A 4DCTA 1YBAA 2GPTA 4BWVA 2GVDC 3OTGA 4YRKA 3A28A 1I3MA 3KT8A 1N25A 4RTKA 2DEUA 5TS2A 1CS4C 4PQEA 5JJBA 2J45A 1DEHA 5KWVA 1PNQA 3CCFA 1Y89A 2XADA 3BMQA 4S1TA 4B73A 2R96A 5C80A 5B5SA 3VVMA 1NVKA 1PNRA 1WV0A 3FIUA 4IFTA 4AQ7A 3OTHA 1IN4A 1DC5A 2QXYA 1S3IA 2B4TO 5C31A 1X77A 2C82A 3BGDA 4BX9A 3I9NA 5C8YB 1MJ5A 2CDBA 3FOAA 1GGFA 3K0EA 4OYRA 2ECFA 2NUPA 4RVUA 4NYIR 4J0FA 4RD3A 2IU0A 4AUKA 1J22A 2AG6A 3BVPA 2JGLA 3L8YA 3K4PA 1WD5A 3L9WA 3L5KA 4LOKA 1RWBA 4YAFA 4Q7QA 1NT2A 4JBHA 4YRSA 5JNVA 1OHHD 3H2GA 3PYLA 3IPRA 1FU8A 3UV6A 1KARA 2IX9A 1X0XA 3G8YA 4O2BA 4XCQA 5CVJA 4XZ3A 2WQZA 4CLDA 3TPZA 4U00A 4CQMA 1D2HA 1NQVA 2PTGA 2OK7A 1MW8X 1O7JA 2VDPB 3N0TA 1SU7A 4MWOA 3C3BA 1DINA 3L4SO 1TC2A 1W2GA 2ZI7A 4YLYA 1AS3A 4JNKA 1JR3D 4MQFB 1T3SA 3ZJVA 3N2GB 1QMPA 1QR2A 5CFRA 3N3BC 5HOQA 1COWD 2R6AA 5EMMA 3D8UA 1CR0A 3NUZA 1EEXB 2VJMA 4LIPD 4RDXA 1Z0FA 5DNCA 1EM6A 2A9QA 2WD9A 3LLCA 4PLCA 1H8HD 3K1JA 2EQ5A 3GUUA 3EGOA 5GIOE 1QAOA 4ZDIA 3IJRA 3OIGA 4W7HA 1K7YA 4MIEA 5BYBA 2GD2A 1M2EA 2C54A 5AXCA 1WCWA 2QRHA 5EE3A 4QWMA 3QLJA 1SH7A 4HRYA 3ZDRA 3GLVA 4M87A 4ZO7A 1YBMA 4A8JC 4WXYB 4AZWA 5CB0A 2B30A 3KVRA 1WETA 2WWXA 4B3XA 1WMDA 1Y0BA 2CDNA 4PG6A 5CG1A 3ZHTA 4GX2A 3JWHA 3K6JA 3ZI0A 4D9GA 2VJLA 2HMTA 1AO3A 3JATA 5C4GB 1GJRA 4EFMA 3VH1A 3L7YA 4QUHA 1KU0A 5DCLA 2OXIA 2NPIA 4YV2A 1T3GA 1L5YA 1U7PA 3OJOA 4BBJA 1GTL1 1P72A 3KQVA 5FUWA 3R8XA 3SD7A 3TIVA 3JS5A 3WWOA 4ALNA 1T4CA 1O94D 1LC3A 3L02A 3GWZA 4HQKA 3S7ZA 2WB2A 5EJAA 2A9JA 1QF9A 2J8ZA 1IJFA 3GNLA 1DUVG 4F3KA 2CV2A 3FCCA 1NNEA 4DBZA 1VKJA 4ZQEA 5I4BA 1C81A 3KB1A 4Y18A 1XDGA 1SBCA 1A8UA 4MP6A 5G4KA 4JP2A 1EVZA 3HVHA 4OQMA 5LP6A 3I1IA 4PPNA 4B7AA 4DDTA 5JO0A 5LQJA 3LY8A 3UF0A 3EQ7A 3AJDA 1TU4A 2O1SA 3PGKA 2CDAA 3S99A 2P6NA 4YT8A 4Q66C 1PV2A 1PJSA 2P11A 4P32A 3MW8A 1A82A 5BV0A 4XQCA 1RMQA 2GEVA 5KVAA 2QQ5A 3L8FA 1E1LA 2R3SA 1PL8A 1V7QA 5K3SA 3WLHA 2ODNA 4NQRA 4JEUA 2FWNA 3IERA 4EF6A 1H3EA 3AQ4A 1T2VA 4JASB 3I01M 3H1FA 1U7DA 4GUDA 2HI0A 4LE1A 5IHPA 2DUUA 3P0HA 4LDAA 3T38A 1KP9A 3LMKA 3W2HA 2B4RO 4B9AA 1UC9A 5LJIA 3O2QB 3G02A 2LWIA 4Q48A 3VDXA 2UUPA 4GM4A 1LS6A 4AKSA 3HNOA 3STTA 3ZVKA 4JUIA 2I0FA 4WJKB 4YB8A 3D43A 4TV9A 5CH8A 3OJXA 3FUTA 5CH3A 1IY2A 2EZTA 4KN5A 4EGSA 1E6LA 1T43A 1YXMA 2IZ0A 4NG5A 3VGPA 1N6HA 1C8BA 1IULA 4WK6A 4BASA 3V3TA 5AUNB 3FVWA 5K2OA 4KLZA 1IVYA 2DKFA 3OEEA 3I73A 1OH5A 1EP1B 2WFLB 1Q2UA 3HV2A 1WCIA 2JJQA 1U28C 1G60A 2IVFA 1MAWA 1NTOA 2SICE 3ESZA 3TNDA 5LLDA 4LF9B 1Y9DA 1USKA 3O74A 3SJAA 2IEDA 3N2ZB 3WKEA 1V71A 2OGUA 1NBMD 4LJYA 3AJRA 5EVCA 1SBQA 4IUDS 1H4QA 4GC5A 1EIZA 3CX6A 1RXCA 4IDDA 4K9KA 1BKDR 1I2MA 2ATVA 3OX3A 5GTDA 1OH7A 2GAOA 1C30A 1NQWA 2OZLB 1NYLA 1Y4UA 2CC2A 1ZHOA 4ZT7A 5BXQC 3MUFA 2WWFA 2P2GA 4ND2A 4WUVA 5JARA 1XMJA 2Q9AA 4GT1A 4IX1A 3EXHA 3L0OA 1G4UR 1Z4KA 1HE4A 3IMFA 3KP1A 3LHFA 2R8PA 1VECA 3MYYA 4I1YA 4IGAA 4JZKA 1XMOB 2EFDB 1UANA 1PG5A 1TB4A 2PWZA 1VB5A 2X5KO 4DZRA 3Q3VA 2Z6UA 1WOMA 2OD7A 1XZFA 3ANXA 4IIXA 4O4JB 4UULA 1FCJA 3D4NA 3ZEIA 3E03A 4A4DA 1OR8A 3T1QA 1ISHA 2OO7A 4B4VA 2WSSA 3G5AA 1KAGA 1LPOA 4KAAA 4MAAA 1MIOA 5FL3A 4ZYWA 5CFPA 3BMOA 3LC7O 3IUJA 4AYWA 2L18A 5EGSA 2UVQA 4K6MA 2RDMA 1E6CA 4Y0AA 2XMSA 1M34B 4UHBA 3MXTA 3K0BA 1QQ6A 1JQEA 1PFGA 1XBTA 3RODA 4DWVA 2VJYA 2X9QA 2YJ3A 2C83A 4RJ2A 1OLXA 3EIEA 2C3YA 1KH2A 1ULTA 3I3OA 2GJAA 4Y0VA 2P90A 3QXJA 4AULA 1DIRA 4GPAA 2IEYA 1ZPDA 3UWPA 3LPMA 5IFKA 2DU8A 4IIHA 4TSFD 2F3SA 3HY3A 5EIHA 2DETA 3FSJX 4X6YA 4EMBA 2B5VA 1AK2A 4MW1A 3TLYA 2C2WA 2IU4A 1CZKA 1KO7A 3AQIA 3HEMA 3KRTA 5HF6A 3PC2A 2WHQA 1USVA 1CXZA 1NN3A 2BP7A 4ZQBA 5JXGA 4HNQA 1AHIA 2NSJA 1FDTA 2XSZD 3RLFA 4MWTA 3R7WA 3E82A 3WOVA 2Q0HA 4B3HA 5DJ5A 3KXDA 3DVQX 4BKRA 4Q9DA 2K2QB 4H1UA 3IEPA 3Q2IA 4KIUA 2KW5A 2II6A 3L06A 5IVKA 3NEPX 3NHKA 4TSRA 5HF5A 5DTRA 4OHWA 2JEYA 1LPSA 4X85A 2R1ZA 2PUWA 3OEWA 1EWRA 4IW3B 3R7DA 3BZUA 5JYCA 3D9QX 1FFGA 2C94A 3UYKA 2D74A 3K0CC 1DAKA 4JBNA 3D59A 3EZXA 5E2IA 5F2KA 3T54A 3P9ZA 4E1VA 1YDWA 5JAUA 1OLUB 2IODA 3JATB 2VHEA 1YZLA 2BRUC 3ZE7A 2F3QA 3RROA 1XFAA 2QRJA 1FMCA 1GZ5A 1PT5A 2IOQA 3AJ8A 1PFVA 4N9WA 1DEXA 2WTXA 4TMTA 4WMLA 4M1QA 4AZ0A 3WYAA 3EVBA 2X2EA 1Q50A 4P1ZA 4DB4A 4J0JA 1OYWA 1VLMA 4LC9A 3HJGA 3K2EA 2H9YA 3LJKA 1W4BA 2JVJA 2Q5OA 3GEPA 4QHSA 2HLDA 4US1R 3V8NA 1QTNA 3V9PA 5E2AA 4B6JA 2DKNA 3NBMA 3M1IA 3CSSA 5AI6A 1T1EA 1YDFA 1PLJA 4O4HF 3UENA 1VC2A 3CCBA 1OD6A 4YPOA 3OLCX 1ZEJA 1HA3A 1NA5A 4ZO4A 4UUNA 3TE6A 2SNIE 3LBAA 1GUZA 1KS9A 2WJHA 3IC5A 2A1UA 3VSCA 2FPWA 3VQTA 3TUIC 5JPDA 1SIBE 4G1CA 2QZ4A 1PNVA 4QYIB 5HMMA 2J59A 3O9MA 4H7IA 2F1RA 2FSIA 2A7QA 1FDWA 4DJJA 1KDTA 4KNYA 2YVKA 3ILVA 1JF8A 1XVVA 2A5JA 2OFXA 3M4JA 1KVUA 4K9RA 2RJ3A 3DZDA 3LYAA 5DBGA 3JWPA 5EUBA 4EAAA 2RAPA 2DFTA 4LYYA 1PIWA 1YB5A 2XWBF 2W2MA 3GLIB 1Q1GA 3RSZA 2BKLA 4DQKA 2ZYVX 4B3FX 4ADSG 1ESMA 1N2BA 3K32A 5FA6A 3IOCA 5A3QA 2ZGVA 2ZIFA 5J23A 1M66A 1E0AA 5FTKA 4WDQA 5IJ0A 1NKVA 3G2MA 4TWRA 2VJCA 3NAQA 3FF1A 4B3JA 1GU7A 4JLUA 4UC0A 1L7MA 1M8KA 2Q3HA 4E07A 5D1HA 1MB2A 3U7GA 4KIJA 3PXBA 4RAOA 3QV2A 3KSBC 4KGVA 3AYXB 3TQTA 4HHEA 4HO1X 1JU9A 1NFRA 2H4HA 2JFOA 1GEGA 1U3UA 4RADA 3STHA 2HMVA 3C43A 4RK1A 4HNHA 1YB2A 2BHNA 4NMWA 3PD0A 3FPGA 2CXNA 2NO0A 2YMLA 4JFAA 1H1LB 4OHUA 5CNKA 3VTAA 1DWOA 3PD7A 3JQQA 3QH4A 1OV4A 2D13A 4TLCA 1K4YA 2EXXA 1CHDA 2OXRA 2XNDD 4S1PA 2P9YA 3O8OA 3MJDA 1IQRA 1I51A 1MR3F 3HG7A 5DV9A 1VG0B 5B53A 3PPWA 4UM8B 5AJXA 4WL0A 4BB5A 4CDMA 5ALFA 1CQIA 2PLWA 1Z5WA 3G9TA 3WC4A 4C6SA 5KQGA 1ZM4A 1EFRA 1KDOA 3A1SA 2VTVA 1R1DA 2I2DA 4DNXA 5KU1A 2YWDA 3ROGA 2GPSA 2ZE8A 3E81A 4H3KB 4AKHA 4P2BA 5DLYA 3ZNOA 2WR8A 4QM7A 1L4MA 1E6WA 4DCUA 1XTJA 4MGYR 5KYUA 3PHJA 1V3TA 3EZLA 5CA0F 2IZ5A 4Y98A 5JVDA 1D8TA 1YJ8A 2Y77A 4EWLA 2MYPA 4QREA 1Z56C 1AN9A 5JYEA 1CW2B 1K3TA 1RWWA 1CQZA 4CTJA 2Y3IA 3PYXA 1E3WA 1I1HA 5TS3A 2PUTA 3AJAA 4ZQHA 5EZ6B 2P1DA 4ZZ2A 5IAOA 3KIPA 3UMBA 1KSHA 4ARAA 4UXIA 4YRFA 1ZD5A 2C92A 3O4JA 2VDUE 2H0RA 4G0VA 4DANA 4KR3A 4OHVA 3ZVRA 2Y27A 4PC6A 4E7OA 5FUVA 3ZCPA 2ZWMA 1TQ2A 1QK3A 2I5PO 4L27A 5I9SA 4LZJA 3SLGA 4R1MA 1TT5A 3MCWA 4MSUA 3UJ6A 1TK3A 2R60A 2VTKA 1VE5A 3GUHA 4IZOA 4LYGA 2BI7A 4O2RA 4DCOA 4F72A 2N9UA 1NIJA 2PJUA 1KERA 1PZXA 5HW0A 2DGDA 1WBJB 1WUJS 3T3HA 5JAIA 5DGDA 3IAM6 4KQEA 1SAYA 3AV3A 2H3EA 1TM7E 2LR0A 4BEVA 3NH6A 1ENOA 4E3WA 1IHDA 4IBOA 4J9VA 4CM9A 4Y6GB 5TRTA 4YDRA 2XUHA 2FG6C 3AOEA 1EBFA 1JU3A 2AMFA 2DUNA 2GWHA 2QVBA 2Y1DA 1Z5UA 3KKLA 2HPHA 4N54A 1EEHA 1RDFA 3V00A 3HGTA 3AF4A 3IIEA 4MHOA 3ZE8A 2YL2A 1P6QA 1PTKA 2VPPA 3TFOA 2BBWA 2LBPA 3LP5A 3ZUPA 1C7ZA 2I6XA 3ED1A 5G53C 3ZTTA 2O05A 3NHYA 1H9CA 1K0FA 5DW0A 3DO5A 3GVXA 5DTIA 1UAAA 1GILA 2IYXA 4Y1GA 5LQCA 3OLXA 1NXTA 1BS9A 2EBUA 3DBOB 1DAGA 2GEUA 3CMMA 1II0A 3L1JA 3GGSA 1I10A 1ZJWA 1ZO8A 1SD1A 2CVZA 4GBGA 1CDOA 2CMHA 4IG9A 4AJ1A 1PKEA 4FJ2A 2F3UA 3ESAA 4QD3A 1V41E 4CEHA 4M7WA 2BM9A 1H2WA 2ATXA 4HMPA 1LJUA 1BMFA 1ZX1A 3FWKA 3PDIB 4OATA 4HGRA 5TGDA 2COKA 3B7PA 3P71T 3NUQA 2AG0A 3KQSA 5IZCC 1EFAA 2JLWA 1VLZA 1XALA 3WLQA 1SVOA 1R3DA 2JJ2A 1HOTA 2HQOA 1WRBA 2OAGA 3QUAA 5FOUA 3WLNA 4ML3A 2LZ0A 2D06A 2NXCA 1H65A 3C5HA 2JGFA 1CYDA 1MX9A 2H2DA 2LDBA 1B8OA 4O4IB 4A8TA 4CMKA 1Z4IA 2R8XA 5B58T 1U8YA 2GEKA 4L3WA 4XARA 2FCRA 4MK4A 4BVAA 4EKDA 3M6WA 1QYIA 4OAPA 4GR9A 1U7UA 3GCGA 4PTYA 4YA6A 4ARCA 2QPOA 2C98A 2Y4NA 1YNSA 2GGSA 2XUQA 5CX4A 3CONA 1P2TA 1XUOA 5JH7F 2GTPA 3W3AA 4MCJA 4Q6WA 3RGWS 1Y5RA 1IQUA 1ZRSA 2IFTA 3RU3A 1PFYA 1WKVA 1VSVA 3MAJA 4RETA 1DAMA 3LBHA 1R0LA 3K6RA 2ZAOA 1HSOA 4HLUA 4PXYA 2ODQA 3UJBA 3WFJA 2P78A 2EJTA 1S2OA 1SBTA 3B1KA 3KOMA 2P9BA 3V97A 4JYPA 3BWXA 5A4FS 4YC7A 2MSWA 3WGNA 1GYRA 3QZUA 3AEKA 5B4TA 4OREX 1V6AA 1MUUA 1I2CA 1MOPA 1MT0A 2Q5FA 4NYJQ 5I9NA 3RK0A 1R8QA 4F4IA 1GNTA 3DGEC 2ZWPA 4BNGA 3ELYA 3V6LA 1PFWA 4MUYA 2O8FA 3A3NA 1YMUA 5IKXA 3RRFA 1P2FA 3VFDA 3SNKA 3BB1A 3AF1A 2XGGA 4DPLA 5IDWA 4D8UA 1V16B 1K4MA 1SBHA 5KVSA 5BO5A 1YUMA 2OHVA 3IAHA 5HG0A 4LA4A 1ZD8A 4OG2A 1NQTA 2VJOA 2P6PA 3ZV5A 4B81A 4B76A 2AHOA 4RDIA 1U0GA 2OCLA 4U6QA 1OC4A 3I2YX 4B87A 3K9HA 1G6HA 2ORED 3IMEA 4LJSA 2Q6VA 4G97A 5IWCA 5F2NA 5FNZA 3SZ3A 3OU6A 2G08A 4F5DA 2IBTA 4GSKA 3AEYA 3VR2A 4JUFA 4HNSA 4OJNA 5KNDH 1PUIA 2W7TA 2DPLA 4JVLA 4HUQA 2C4WA 2HU8A 1XD2B 2VJKA 5B7QA 4KXVA 3EGWA 4RA6B 2A0XA 2Q5CA 3K94A 3KZ1E 5I51A 3UUWA 1RJ9A 1WHSA 3ZE9A 2Z6AA 1BE6A 3E4CA 1VKZA 1E5TA 2AFHB 2DAPA 3PVCA 1P61B 5KYKA 3GN2A 3ADCA 4Z53A 3PPYA 4FS8A 2HWXA 4JXKA 2HQ1A 3Q5GA 4I08A 1WEHA 1BG6A 2GKGA 4BO9A 1KJWA 4GI1A 4K0RA 4DWJA 5MGBA 3TGPA 5K51A 1P4HA 1SD2A 2VRNA 1TYCA 3C6XA 2RGAA 3CUWA 2GJ8A 2ZIVB 4UASA 1C3JA 5EIOA 2OK8A 521PA 2H07A 1FYFA 1WA5A 3CLUC 3FLEA 4HLNA 3KU4A 4A0RA 3O2NA 3BICA 4PQYA 2BH9A 3ICOA 4ZA2A 1C3EA 5JSHA 1FPMA 2B9EA 1UH5A 1BDIA 3WAKA 5K8VA 4GNKA 3A10A 4TROA 3ZOKA 3RGGA 1GTSA 3GMDA 4KPFC 4WBNF 4GWLA 1Z0IA 3JD1A 4AC9A 5CB4A 4KQ2A 4GP6A 3DBVO 2NSDA 2PNFA 2Q3EA 3DF7A 3P1JA 5EKTA 2BRUA 3SM9A 4Y30A 2R65A 3VUFA 5EY5B 1B16A 3ZGXA 5JEEA 4ZXPA 4P5EA 1U7OA 2EGHA 4PSAA 2EKLA 4DY6A 2NU6B 5DH9A 5IEBA 4M1TA 3T3DA 2AR9A 5TB5A 1E5VA 2XEDA 3STVA 5LDDC 3AM3A 4RL4A 4E33A 2D3WA 2ZS8A 1UJ5A 2KWIA 1I4OA 4GZ6A 2QZ9A 4I5DA 2X9GA 4P7FA 4TL7A 3NYRA 4V0ME 4FCVA 1UBUS 2QYSA 3MRSA 1JIKA 3GA7A 4H35A 4QFMA 4J0QA 2QPAA 4L0QA 4L73A 4AX8A 4XWAA 5BNIA 1IN7A 4EO7A 1PZEA 1YZYA 1RIIA 1MJGA 4F04A 5C18A 1XO1A 2CUKA 5JXJA 4D82A 4F2HA 5L7WA 1M6EX 1JL3A 2BKXA 3GJ8A 5TEVA 3CNHA 1AZLA 3AKDA 1J56A 1K3FA 1NRJB 3QJ5A 4U0JA 4JVMA 3DDHA 3EG9B 4YCDA 5B1IA 2Y1FA 3DNPA 3X44A 1A27A 1TA0A 2VDKB 4ZAZA 5KWJA 3HJTA 4KE7A 1B93A 4LCEA 3T4PA 4XVCA 4E4RA 4RTRA 3D02A 2VT6A 3COPA 3QLUC 4PQGA 1FXWF 1H2HA 1PYOA 2D1TA 2JLSA 3DKRA 4NOJA 4EY4A 2WQ6A 2ZT8A 3SZOA 2KJQA 5KYWB 2R8OA 1FW6A 2ZBRA 2RGUA 2Q8NA 1TPYA 1KTVA 2VUSA 1A9TA 1MAUA 2HZBA 1JVSA 1F51E 3GJ3A 3UANA 1M2GA 2JLRA 3TCNA 4BLTA 1Z4NA 5ITSA 1NMEA 5KYNA 3E7PA 1WAMA 1F3OA 1NLMA 1Y8RB 2BMVA 1EVYA 2XQKA 3IQWA 3D6VA 4G09A 1QG0A 2P2SA 2Q3CA 3VAAA 3HVIA 4QNMA 4EG0A 3T94A 1R4AA 3OQ1A 2C5HA 1FUKA 1LA2A 1TKRA 3RADC 1U4OA 2MSCB 1IE3A 1JWAB 4D9EA 5DHUA 2PLRA 4HAOA 1U5AA 1VPVA 3PXEA 1RI3A 1T2FA 5E95A 2BGKA 4GR4A 4YAIA 4JGBA 3R5XA 2ZSFA 3ZGVA 4QU0A 3HXPA 1I3NA 4DA0A 1SQ0A 1VBFA 2HMAA 2JH3A 1ND5A 2BSXA 1MBZA 2XZLA 1SXGA 3E7DA 4IOJA 3EVAA 5DB4A 4KWIA 4PVDA 5C8ZA 5I8ZA 1HKHA 1BSVA 3DLPX 4E5YA 3A1CA 5GONF 3B70A 1DC3A 4IMRA 1E1CA 4MJLA 5BMVB 3WNDA 1ODLA 4URVR 3PQ2A 2HV9A 1G1AA 4R8VA 3BGSA 4JT8A 1Y5IA 4MRPA 2ADMA 2C0CA 3DDSA 1SZDA 1WB4A 4HVCA 2D7DA 2PS1A 1DWQA 1Z83A 1LW7A 1K3UB 2HT6A 1H42A 2RIPA 2X5JO 3HBAA 5FYQA 4DRXA 4ZQCB 2BW0A 4YALA 1WPXA 1P3Y1 2J0QA 4HB2A 3INGA 1QZ3A 3E27A 3NH9A 1O77A 2I6QA 5AUPB 4KCGA 4Q19A 1DKLA 2X8AA 5K6AC 2PFGA 2J85A 4CKCB 3WZMA 1YJ5A 4PAGA 1NX6A 3OESA 4GW3A 4LE0A 5MF6A 5CLJA 1HE3A 4B34A 3BM5A 1YTUA 1Y4SA 1I1QB 4XRGA 3DE3X 3LS2A 4BIIA 2E0IA 4NZZA 3UB3A 5LVAA 3EC7A 4UEKA 3CUYA 1VZ2A 3A04A 4QUGA 3TFWA 3OUTA 3EPHA 1FRNA 1GRRA 1YDMA 4R3UC 4NOMA 3NKFA 1P9WA 1RP1A 3CN7A 5JBIA 3H6GA 3KFVA 4OA5A 1BIFA 2H9AA 1Z2NX 3SYRA 2B35A 3SHVA 1D0IA 1MRNA 4I5FA 3VSAA 1IPEA 3MA0A 5GONB 5GQSA 3NLLA 4L8YA 3HJUA 5K6TA 1V26A 3HJAA 5D7NA 1RTTA 3CX7A 4RHYA 4GEGA 5SICE 4YMIA 5EXPA 4OXXA 2QTVA 4EG6A 3UNXA 5IDXA 1IBLB 2QMYA 3PFNA 2OYCA 2EZ8A 4KQHA 1N57A 3R5SA 4NXNB 1FU4A 1P7CA 3TZLA 5BVHA 4CLEA 5HJ2A 3T6KA 4F45A 4F3NA 1POXA 3OFNA 4PNHA 4S12A 4TRMA 1E4EA 4QRHA 3WADA 2E4ZA 2WWRA 4MKZA 4DLPA 4Q7LA 3CUUA 3OPYI 3PG5A 4V0OA 3J80A 1D2EA 5MN6A 4Z0PA 2VK8A 1Z29A 3BTUA 3FSGA 4URUR 3ST7A 4BX8A 1IC6A 2LD4A 5C7OO 3EF1A 2GARA 3LSTA 4KZKA 3BZBA 3FDIA 4W7IA 4XKJA 3JRXA 5EUCA 4MWSA 4PYIA 3EMDA 5T4HA 1SGWA 4MAMA 4CIAA 4RHCA 3EFEA 1P5HA 2FZGA 3AKCA 3I0NA 2P9ZA 2R6JA 3IRVA 3P4XA 4FVTA 1GPKA 4BO6A 2ZT6A 3B7WA 5E7JA 3ESCA 5FWYA 5AUQA 3GVPA 1ZBDA 4RD0A 4F4DA 2ZJZA 2PL5A 2QJFA 1R2QA 1BQ4A 2BCEA 3MJCA 1KVQA 2C7QA 1PSDA 1NR7A 3K2BA 5IVHA 3HABA 3TH5A 3PIDA 3Q2OA 5KMGA 5JXIA 3SS9X 1L3CA 1E2GA 1T24A 3FTCA 4IEFB 1Q0UA 4PV7A 2ZJ7A 4ZJPA 3CF2A 1VL5A 4HAVA 4MQ6A 1W96A 3TR6A 3FKJA 1JPUA 3C6QA 1R9JA 4O2AB 1WR8A 3QVLA 4A15A 2F9LA 2BC9A 4Z0TA 1E1QD 1IQPA 4JP5A 1HZZA 4X9XA 3FHCB 3WNVA 4EO9A 4KPGA 1S2NA 3AHGA 4JBWA 2QUAA 4LDQA 4DN6A 1I30A 4LNHA 3N8DA 3LCCA 1MX5A 1Z74A 1VGVA 1Q0SA 3DD1A 4KVAA 3EA4A 4XR9A 4EPWA 2HDNB 4TTAA 5HBGA 4Q1DA 1T0IA 3UAGA 5M7EA 1ODTC 5TPZD 3VMMA 3CKYA 5BV8A 3Q9NA 1IHUA 3IT3A 4A3SA 4YCMA 4C29A 3GRFA 3ABZA 2PGXA 4C5CA 2J7KA 4HWTA 4JROA 1VKNA 5ITZB 1K7CA 4GPIB 1GSAA 1Q20A 4GVXA 4RK7A 3TUZC 2I4TA 2P0EA 4IJVA 4LWZA 1HDYA 2CF6A 3GD7A 3PUWA 5KU7A 3PXXA 4KR9A 1UWCA 1EVJA 5AVOA 1L5QA 1WNTA 2WLSA 4DLTA 4D8VA 1UWKA 2GLXA 2D62A 2Z8YA 3EB9A 3DDZX 3NRCA 2XNHA 2JATA 3DCJA 2FZVA 4MQFA 3B89A 3EC2A 2COEA 1XU7A 2IDKA 3ISVA 4FNGA 4HH1A 4IQ8A 1E1CB 3V2HA 3GFOA 1LKZA 5HRCA 2GYYA 5D5QA 3OF5A 4NJEA 3C3YA 2DG2A 4PEVA 4W8GA 1KMIY 5KNCH 4O2BB 4YMLA 4KSYA 2WZQA 5EZQA 1B8PA 5BQ5A 4N8SA 3I5XA 3PGXA 1UQTA 2JBAA 4N01A 2PMWB 5EPOA 1KOJA 2OV3A 4ZHQB 3BEOA 3IAAA 1WSDA 3I8XA 2NUPB 3A1VA 4BNZA 4KDRA 1D6MA 1YRAA 3RT7A 4F21A 5EJ9A 3DCIA 1J0CA 1V7CA 1UDAA 2FLKA 2IHJA 3RJZA 4BDSA 1E2BA 4V0SA 3MERA 1KK1A 2JHPA 4FEAA 4KX3A 5E4JA 2A59A 2OBBA 4OFWA 1UEJA 4CM1A 5JS7A 1E4OA 1O4WA 1XTPA 3MWFA 4F11A 4YK7A 5GADl 4IDEA 5ALEA 1XX6A 1L5VA 1Q0QA 3N76A 1UAYA 4R0VA 4YV7A 1TCVA 5ELLA 4DIDA 4O0MA 2A1TS 5DOZA 3VKUA 5CNMA 2BHSA 3H19A 2QTLA 3KYBA 2QEQA 4B43A 2V6GA 2O8CA 2EQAA 5EA2A 4O3FA 3WQBA 5SY4A 1YACA 1Y8AA 3W4KA 3P0RA 2ZS7A 5K0CA 4Z99A 1ZP6A 2BP7B 3ICWA 1GPYA 4JB2A 1AZSC 3OIWA 2JCSA 2GF9A 1GNVA 2C95A 3S5JA 4CHTA 2ESRA 4BC1A 4PZDA 4DY4A 2FPLA 3VH3A 4QGHA 3MZ0A 2DQKA 3BK2A 3V4ZA 4LGMA 5ILOA 1RYBA 4LK2A 2EWVA 3VZSA 5JY1A 1IG3A 3G2LA 5H82A 4YUYA 1G8HA 2Q4BA 1PDOA 4TLAA 4MQEA 4IMPA 1FS6A 3JX9A 3F74A 2OUKA 3VSBA 4AKIA 4RY2A 1V7PC 2WHPB 2K5UA 1E3IA 1NFFA 3GOHA 4ANFA 5AW8A 4UUMA 5JMPA 3UW1A 5MGNA 3E48A 3OLZA 2VWGA 4BUZA 2HV8A 1GYQA 4QXAA 1RZRD 2QLTA 4LHVA 2NU8B 4AY5A 2AOUB 5LZ5A 1IYZA 3G49A 1S01A 1JYFA 1Y1QA 4TLMB 3DV9A 3TL2A 5GMOA 1QFXA 3RRZA 2V8BA 3RWOA 4C08A 1XRJA 5BSFA 2ZBQA 5HRUA 3L6CA 4YACA 4LF7B 4O4JA 4EF5A 4WBXC 5BYJA 3VYTB 1K6EA 1D7OA 1Z5VA 2FZWA 3EH2A 3SDBA 1JPVA 1W48A 1F7VA 4AP9A 3NHPA 1NKSA 2ODWA 4HDAA 5F7JA 2BJVA 1WIWA 5CLFA 2ZJ0A 5JAPA 1OZGA 1DQPA 1RR6A 4LRXA 4Y6OA 1GKUB 3MG9A 4G01B 5EUMA 4D96A 1NBME 2YUTA 2DZDA 3FR7A 4QBIA 1N0UA 4RMGA 4AQYB 3LY9A 3WV4A 2APJA 4JYAB 1T6NA 1Q0PA 2XX3A 1YK1A 1EFKA 4ILEA 5I7SA 4FMPA 3C48A 4LF6B 3T5AA 3UT6A 3ZE2B 3WLPA 2E49A 3LY5A 4UOQA 5G3ZA 2E4UA 1RHMA 2W98A 3PTZA 3U17A 4QU5A 3N70A 1O89A 1QCYA 1TMGE 4PQFA 1VJGA 1CZLA 5FOTA 4X1IA 4MW4A 3V1LA 1T3LA 4KXYA 1EFPB 2HK9A 3ITNA 4M0LA 3DM5A 2C99A 1AIPA 2QLLA 4PGMA 2V96A 2FKAA 4TQGA 4E70A 5FUXA 5BRAA 2AXQA 1ICIA 1YGPA 1C1HA 4MDFA 2ZDGA 2I8AA 4JSTA 2IBMA 3MJFA 4IINA 3I92A 3WB0A 2BGWA 4GKKB 3NV9A 1GTRA 3VNBA 2GCOB 5EZ5A 2MCFA 3AF0A 1Z8HA 4JUAA 4NZPA 4Q47A 2FX3A 2W48A 1ZA1A 4PG8A 1YULA 4MUGA 2PN1A 2VAPA 3KFXA 2HOQA 1JHZA 3WRXA 5C32A 1N4DA 2WJVA 5KYUB 3JYLA 1X1QA 1QUEA 1XMSA 3HLYA 4RQAA 4RZQA 1JE1A 1Z8NA 2P2CA 4GGPA 4G9EA 1Y3AA 4PR3A 2VNIA 1DX4A 1ID1A 2BFBB 3EULA 2H2GA 4JJEA 3A2NA 3N87A 1PW7A 3ZLTA 2GD1O 3OUUA 4GPBA 4LFAB 2WDZA 4NNPA 2N46A 5IXSA 1QM5A 1W6UA 4MEBA 4J90A 4IM7A 5A2QA 1G3UA 1TIPA 5D7BA 5KTOA 3EVEA 4W6QA 5EZYA 2PUEA 3DEAA 2RK3A 5IULC 3WI7A 1P2VA 3T1TA 1GPNA 2LV8A 5A4KA 1T34A 3VH4A 1F9AA 1XRRA 3E53A 3L8HA 3MLEA 4LEIA 4M54A 1ZBQA 2QORA 3G2IA 3SZGA 4CCYB 2D8AA 4S1OA 1B42A 2QQFA 1P1HA 3AIKA 2R87A 3OO1A 1XYGA 5AO9A 1RKBA 1VJ1A 1M5RA 1W73A 4J4TA 4Y7CA 3ZDQA 2QT1A 4FR2A 1U3FA 4J0DA 5JYDA 3AEZA 3OIUA 5CP8A 5KYTA 3U13A 1F0YA 2N47A 3IYLW 2CXHA 4QPNA 3U4MA 1ZOOA 3ADPA 4DIUA 2XVXA 4WT7A 4OP3A 3WLSA 2HNBA 1RQNA 1FP4B 3KOYA 4KXNA 3TFQA 1YS2X 2PUFA 1PVVA 3HJBA 3D7KA 5FBWB 5K03A 5C1PA 2PD4A 1U5BB 1M1UA 2PMKA 3EMKA 2XMPA 3HB9A 3P52A 1WF6A 4RD6A 4U2FA 4C14A 4DLNA 3DHEA 3DCYA 3UGKA 5IC4A 2V03A 1A9RA 1QGOA 4HEQA 4PSDA 4XUCA 4D4GA 3MJHA 4EVQA 4JT9A 4LJAA 4RW0A 3DBHB 4Y3UA 2AEMA 4Z9YA 3TAXA 4A8HA 3TMYA 4AIRA 5ESWA 3ZHCA 1CIVA 2HD4A 1SZPA 3QEAZ 2ORVA 3BDAA 4D8TA 4BBZA 2GCIA 3CPJB 1ZU4A 3O84A 4RABA 4UUBA 4BTVA 2DP4E 5B55A 4TYNA 3LC2O 1K08A 5JFGA 2W4IA 3DMFA 4HDQB 1I1NA 1W30A 1ISMA 2IEAA 3IAFA 4UEJA 1DO8A 2J0VA 3FWHA 3ME5A 2P35A 4CQLB 1Q14A 1KEZA 2F3TA 3B6ZA 3ONNA 4LHSA 4MI3A 3LWBA 4C4OA 2REXB 1QHEA 4D92A 2PBZA 2WTMA 2QNRA 1GT91 3FJ1A 2Q99A 4GFDA 4IF4A 2WWVD 1Z18A 2VWPA 2E21A 4RS3A 3HO1A 3KAKA 1RPZA 3L6DA 2PKXA 3ZV7A 5GGXA 4ZICA 5D51S 3DMRA 3AEXA 3PWSA 4G65A 1AY0A 5ELMA 3OCVA 1CR1A 3HQ4O 3BE8A 1L5SA 4YJ2B 1T8PA 5HQ3B 1QYRA 3KD2A 3RFVA 3ZWQA 3LCMA 5TT0A 4DMFA 1BW9B 3GXBA 1RXUA 1C7IA 1XKQA 2RH5A 2Z5GA 3L7AA 3FFBA 4MA5A 2B7CA 5F7OA 1GGEA 3MCAA 4IZIA 2NLOA 2FWRA 1PQ4A 3D1VA 4WKPA 1BXGA 5JS2A 3U6KA 4W5RA 1XQ1A 5KZMB 2CJWB 1AHPA 1THGA 3EISA 5FQOA 2QY9A 2XCRB 1CY4A 5CG2A 3R9XA 3GP3A 5HUQA 1IATA 3SBDA 4F9GA 3BK1A 1ONPA 1J0DA 2BKVA 4BEBA 3BRWD 5TV2A 1B2LA 1G5HA 1KNQA 3E2IA 3M1LA 3KSRA 3WL4A 2A78A 1QH8B 4QTYA 4N49A 4FYVA 1QCCA 5EXTA 5DIFA 4I5IA 2G9VA 4G4SP 2IGTA 4ZV9A 3HKBB 1C1XB 1V1RA 2OBMA 1Q7RA 2Q2WA 2QYTA 1B14A 3N7AA 2ATCA 3ZZNA 1WM1A 2F1OA 2Z8YM 1MAHA 3EYWA 2FK8A 5TX7A 1NVWQ 1SIWA 4E03A 3OWHA 2DPYA 2XQGA 4MNTA 3WIBA 3Q6NA 1TE2A 4D3FA 4M88A 4K9MA 4BX0A 2YX1A 5DOVA 2WFMA 2ZAIA 5J1TB 3CM0A 4WIAA 1G3MA 4G2NA 3CFYA 3OPMA 1G4HA 1L8AA 4Y2QA 4A7PA 4DB2A 3FVRA 2GNAA 5CT8A 3ZQJA 4HPWA 2JAHA 3R9XB 4L5YA 3CZRA 4ZT4A 5DASA 1YS4A 1JWLA 1P0QA 3OE1A 4C2BA 5AK0A 4E6PA 3QOXA 3DAGA 1QVVA 5DT9A 5E6RA 2WHRA 1YR6A 2HF2A 3A2LA 3I52A 5IN5A 4KRGA 3T9FA 1EM8A 1ILWA 4H7PA 5DBOA 3M3HA 5K2MA 1S8OA 1BW9A 4MH0R 5EFOA 3VPGA 2ODTX 2Y0PA 3U3OA 1ADFA 2GXSA 3PZBA 1XROA 1TU0A 3HKEA 4HP8A 4G0QA 4PLTA 4TSKA 4ZC1A 2NVOA 1J6UA 3HZZA 3BWVA 1U9IA 1JT9A 3B12A 3WKCA 3QSYA 5JAHA 2WNIA 1TM5E 3TQOA 1KZ6A 2PYZA 5F9HA 3GROA 3OKCA 1G20A 2QD2A 4OJQA 4BQIA 1AQJA 4H1VA 4KOAA 3TLXA 4EELA 1UJ4A 2XRMA 3NM4A 9ATCA 1GFWA 1VSUA 2FW1A 2HJHA 4EMSA 5CT5A 7GPBA 3K6SA 1K5PA 2NO5A 3GARA 3V7NA 4RORA 3M5WA 1Q7CA 2BGNA 2YFKA 2WM8A 1GPBA 4HGOA 5ECYA 2DBZA 2Q6IA 3W5CA 5A0TA 3O7WA 5FO1A 2VIIA 3TZBA 1A5AB 3AFMA 3S4YA 4QXQA 4AJKA 3ECAA 4HF7A 1F0NA 1U6KA 5EWJB 3RUAA 1KJQA 3WE7A 2PFSA 1LBEA 3AJEA 4I6JA 3TNFA 5E4FA 1MX1A 3LAWA 1B8UA 2A92A 4PCVA 4R71A 4DBVO 5EIBD 3GPIA 4M98A 2IJGX 1T13A 5DLEA 1NT4A 1AQUA 1A4IA 1H2YA 5JNWA 2ZIWB 3GLGB 3WA7A 4CEIA 1RJDA 5DEOA 3AETB 3UMCA 3QXXA 5LKAA 4PYLA 2H11A 1ZL0A 5HXAA 4G81A 4B3MB 1FXSA 1SXJE 5HMLA 1CDZA 1GPUA 1R8SA 4L4RA 2GHQA 5F1KA 4D81A 1Q6ZA 1SUPA 2PCJA 3QNUA 1U1EA 3O8DA 5I7WA 4WHMA 2JCYA 2VZ0A 1GADO 1R6BX 1XDZA 3VX3A 4K0KB 3IESA 2GJSA 1VIDA 5GOTA 2Q3BA 2I4LA 3LXRA 1C9MA 2W00A 1HZJA 1O95D 4IVNA 4FFVA 4D0LB 2EWMA 4ZVNA 4UD6A 1CUFA 1FBNA 2RGWA 4E14A 2VRCA 4ZKDA 2NT3A 2CT8A 4D9JA 4MR7B 4R05A 4G0UA 3FAZA 5HSGA 2B7BA 3BQ9A 4E2YA 4ZI3A 3ULKA 3IQIX 1Z08A 2QN1A 5LZ8A 2OCPA 3OP1A 3QQPA 4O8ZA 4JX8A 3SYMA 3JYNA 3Q72A 2W58A 4YRRA 4B09A 2BCGY 5JJLA 2NSYA 4UCXA 4BO1A 1AKTA 3ZTWA 1C3OB 4NKRA 5ARDA 3ZU2A 2JI9A 4LY9A 1ZR4A 3UA4A 1E3SA 4RH1A 3JY6A 1TJ4A 4MUEA 4Q4HA 1T8RA 3BJEA 2DX7A 5EL0A 1X39A 3B85A 5GM1A 2X23A 2TSYB 1EGAA 1I6MA 1PTJC 2CMDA 2CB0A 1V8BA 3ONFA 1Q3HA 1Z2OX 1UOQA 2DTDA 2VSYA 1I3OA 4GKVA 4EKYA 3JQPA 3VAYA 5CT4A 4NBVA 2FA9A 2MU1A 1OXUA 1PJTA 2WTEA 4N7RA 4JYMA 4P6VF 1XNRB 4D5GA 2P2ZA 3P5SA 2UAGA 4ZAVA 3SSOA 3C6BA 2JHGA 4YXFA 1NI5A 5ECWA 2REBA 3DT9A 4OGGA 4O2AA 4LBWA 3TQQA 1UZLA 5B1DA 1B7GO 1BMQA 1P4RA 4J7AA 5F52A 3DT6A 1MENA 1N1EA 2MSLA 5KQRA 5F9FA 4JLVA 3ENQA 3DE4X 4JJ6A 1IPHA 4QNNA 2IOHA 4QJ3A 4K1LA 4TMZA 3AWDA 2QZJA 2OV4A 1KQGA 2FOXA 4CXMA 2IU6A 4P80A 2XF8A 1X7ZB 1TM1E 1AV7A 5TF4A 3ZY4A 4ILKA 4MUKA 4KH1A 1J1UA 3BL8A 3UT5B 1FQJA 1I3LA 2P69A 2VDQB 4GF5A 1YI1A 4L2IB 5EHZA 2VQFB 3AZQA 4PFJA 4INPA 2M1XA 2R44A 1TEZA 3VR4A 4YQZA 3ZJ5A 5DGCA 3ROFA 3ITDA 1FDUA 2DT5A 4LN1A 2BFMA 3RYIB 3FYUC 4WFKA 3ASZA 2CF5A 1BKYA 2BTQA 4N40A 3OJLA 4C7MA 1EXNA 1CUAA 2RI6A 1DTWA 1M7GA 4ZQGA 3GQBB 3KPVA 1KNXA 1P7PA 1PP4A 1KJ8A 2AXEA 2HPZA 5ES4B 1I0LA 1PZNA 1KY4A 1JLKA 2VQDA 3FTDA 2HK8A 2QRMA 4JUBA 3X1ZA 4YRZA 1CJSA 2JRCA 2OILA 4FYXA 2Q0SA 3LT5A 3EXFB 3M2PA 4WCFA 5KJCA 2RKBA 5HGJA 3LNTA 2EWWA 1J9ZA 1LX6A 4PZUA 1T0BA 1F2TA 3ROEA 3WLTA 4A0QA 4UAGA 5FYDA 1NMQA 3PNSA 5JJKA 5CM8B 1KQNA 2YY6A 4AO7A 2PH1A 2PLAA 1Q7TA 3LT1A 3O82A 4F7WA 3FBWA 2A0KA 5D3ZA 1L7QA 1ML3A 3DL7A 2FEAA 3VNQA 3ZU5A 4LV6A 2YKGA 1FFYA 1XP5A 4HWGA 3E84A 1SK9A 3GDHA 1RFLA 3WMEA 4BU0A 3QU9A 5HPYB 5GOZA 2R7LA 1Q21A 1E7WA 1YQEA 4Q4CA 4O25A 4DS3A 2PUGA 4D79A 4AYTA 4AX4A 4CYMA 3KCQA 4MCIA 3BH7A 4RTOA 1QGDA 4MUFA 5KPDA 3ZUGA 4DIKA 3WZ2A 3DEHA 1U80A 3CPSA 5IF3A 4PLFA 1UPBA 2YBDA 1NG9A 2AG8A 2VPYA 1K4KA 3VU8A 4M3NA 4KLAA 5ER6A 5A3SA 5T5QA 4EAQA 5KOJB 1T5TA 4X65B 2I2WA 4W5HA 3T5TA 4E5DA 3JYQA 2ZSHA 1UFKA 1G5FA 1OJ7A 1B8NA 1EJ2A 1A98A 1QYXA 2VEOA 1PGOA 2C5EA 3DVSX 4HNAB 3NHWA 4OPMA 3PFGA 4MULA 2JNWA 1VSBA 1IY0A 1RLOA 3LRXA 5ALMA 4BPRA 3KLBA 3FWYA 1KTIA 3TAUA 1E1QA 5AOCA 1JEAA 3O8RA 3IDAA 1T4MA 4IVRA 1L4KA 3EZ7A 4IF6A 3W6PA 5TJHA 1WZIA 5A7FA 5H3HA 4RTLA 3M5DA 2ZCJA 2DF8A 4MQ5A 2IIVA 4R01A 4WDRA 1XFDA 1KJIA 5TE9A 2B6NA 2YWXA 1PG2A 3UB2A 2JPDA 2WP0A 3ENWA 5H59A 2W42A 4I3GA 4PLHA 4GQBA 4CKWA 3ECSA 3L77A 2AEJA 4EYKA 5BUZA 3HKDB 1K8XB 4J0GA 1UZMA 1ZEMA 1VKOA 1LW6E 4HXYA 1XZEA 1J00A 4RAQA 1R9MA 1SZJG 2CZCA 4HXFB 4DT1A 4IJQA 5ADVA 5SYAA 4L8LA 5JALA 4M9CA 2GEFA 4ZIRB 1YASA 3JAKA 4XWGA 4D43A 4GI5A 2JLZA 3C3JA 1X7YA 5B3JC 2ZS9A 1FVXA 2FR8A 3KPJA 1U28A 2QUIA 4MQUA 1CJKC 1ZCFA 2O5RA 4C0JA 1GUAA 2HO5A 721PA 2FUG1 5LP6B 2ZJYA 3PP8A 3O4VA 3WIEA 4G36A 3FLMA 2XTZA 3DFKA 3WK7A 2YZGA 3RVLA 5TMEA 4B40A 1X7ZA 1FSPA 1T36A 2J08A 3BB4A 1QHHB 1ZGGA 1FQWA 2GJKA 3PUHA 4GRAA 2YYZA 1I6KA 1K7FB 1KL7A 3MC1A 4WTOA 1I2BA 2R1TB 3IUSA 1T4CB 3BF8A 1IHXA 4G0NA 4IQ4A 3ZJ4A 1TZBA 3ZHXA 4GS5A 4LXHA 3JD4A 3AHJA 1NRWA 4MUAA 2BYTA 2G9RA 3BE5A 3U4IA 4R2IA 1L5LA 1JVNA 4HRXA 2GBCA 3P96A 2DFNA 4IDHA 5AOBA 4GHWA 4ED9A 1BVHA 2VP0A 1RJWA 1NC1A 1CUSA 1FSSA 2X6TA 5KMGB 3NX4A 3C16C 3LRPA 1RQXA 4JUDX 2SKCA 1JBEA 1TQ8A 1XVAA 3D1LA 4EK9A 4S3MA 4C78A 4EHNA 3ZD6A 4ZREA 1CUWA 2XCTB 3A4VA 4MO9A 1RABA 3HCNA 1T2CA 1NXXA 4WZAB 4K9OA 4PLZA 4YY3B 1A8PA 5JCZA 3K9LA 4R98A 3P27A 2FWPA 2DM6A 1S4MA 2HO4A 1JQLB 4QJ4A 2FMIA 5K3FA 4DYDA 4QEDA 4N47A 4Q1CA 4ZVMA 3UW3A 2NMVA 1N2CA 2JJ8A 3L4JA 3R3VA 5DNEA 1E3TA 1PL7A 5JANA 4IIDA 4R68A 4WNIA 4LHYA 3H8VA 1EQ2A 1M2WA 2NZ2A 4OU5A 2LCQA 3UN1A 4BMOB 2LKCA 4FONA 4ROSA 1G3RA 3WLEA 1E4EB 2GAIA 3JQ7A 1PK9A 2XWJI 4F86A 1CUYA 1RE1A 1PS9A 4EG7A 3DDCA 4M0MA 2ZZMA 1YR1A 1UP6A 1ESEA 4YNBA 4PYQA 3UVEA 3PEWA 1VJ0A 3FHJA 1MO6A 1NW9B 4RA9A 4XDYA 5EQDA 2OXFA 3B6IA 3BKWA 4A23A 1W0CA 1L4FA 2UVPB 4OMUA 3VZCA 3W3ZB 4Q02A 3H87A 1F6DA 1W5FA 3X1JA 6GPBA 4R8SA 4HYTA 4PX5A 4P7GA 5AXBA 3T06B 5IFLA 2IYVA 3JQBC 2HW8A 4DXAA 3Q7IA 1P1IA 4YONB 4G1FA 3RANA 1QV9A 3W8NA 4WGGA 3SXUB 8MHTA 3KLNA 2J4CA 1SN7A 3SWWA 3DUFA 3NBKA 4IHKA 3ERCA 3GFTA 5K01A 3E9EA 1HDOA 1A8IA 5JAMA 1MHTA 1X7XA 2RHTA 4M99A 2I6TA 1TFRA 4CFZA 3NT5A 5MDHA 1JVBA 1AXRA 2QF7A 3G2OA 4BNFA 5J43A 2A0UA 3CXUA 5F1PA 1FEZA 2QPLA 4XQ0A 4UU0A 5A9SA 1A88A 3KE9A 5DP2A 4AS1A 4QBFA 3NHSA 4MRAA 1CVRA 3QNWA 5HKAA 1C4OA 2EJWA 3B3FA 4UTVA 3HADA 5DHSA 4CKEA 1G20B 4LOHA 1Y3CE 5JQGB 2CXTA 4KGDA 2AJTA 1IJEA 4LCBA 4MS3B 4NOLA 3QBEA 3Q4GA 4KPEC 4OUDB 2XQVA 3G2JA 3MHTA 2CUTA 1DAIA 3TGWA 1C9JA 1GWNA 5ALQA 1PR3A 3LOPA 3VR6D 1DT3A 4CMJA 3EBPA 3F0TA 4UBOA 1NOIA 3VU9A 4YJFA 2IPAB 1ADBA 2WKQA 3AL2A 5CA0A 4XGQA 4BV3A 1KA9H 3VPCA 3ETCA 1UC5B 3O1HB 5LPNA 4RVGA 4K40A 1R4MB 4WEQA 1C2YA 1DRKA 1UIMA 3DB1A 4NEGA 1KZ1A 1R0WA 1DC7A 3HP7A 3KSDO 4HWOA 4YRNA 3FHLA 3FRIA 3LWDA 3U9LA 3AFHA 1NE2A 1UJNA 3DZ8A 3DKIA 1PVDA 3DR5A 3GDGA 3ZGLA 4BQPA 2BR4A 4HUJA 4K81B 4UM7A 3NBUA 5GINE 3KAPA 2P9FA 1FYXA 4DIEA 9LDBA 1SHJA 3AHHA 5J2TF 1I80A 2JFGA 5AKXA 1EXDA 2DECA 4KGXA 2FPSA 1Q12A 2HWWA 3WS7A 3EZ2A 1IL0A 2PO7A 3LA8A 5KNBD 2H5LA 5FI1B 1TLTA 3MLAA 3JD0A 3OH8A 1IHOA 1JA0A 4JI1B 2BFCB 1EB9A 2PA3A 4M38A 1Z62A 1Z36A 5PNTA 1I7PA 1J90A 4KRYA 1X9GA 1ODSA 2ZCVA 4NFHA 4CZ2A 5A4IS 2VNSA 5K0LA 2JLAA 4KV9A 3E8SA 3TS1A 3QX9A 4NRDA 3JARB 4F93B 2GPYA 1SRQA 2R4QA 4JELA 4QE3A 4DRXB 2J0UA 5JNTA 2JFVA 3MXOA 4M21A 5M3BA 4CMAA 2G0AA 2GCGA 1SUCA 2H52A 1TTPB 1E7YA 3BREA 1KEVA 3EGDA 3K1ZA 4BKOA 4C4AA 3O3CA 4I81A 1JDJA 1KQOA 2NZUG 3FZYA 3W1EA 1G7SA 2C07A 2BGUA 1KZ7B 1BU8A 3B60A 1T3ZA 3A32A 1MABB 2ZBUA 2PXAA 5BMVA 4URZR 3DYIA 2HFJA 4TV9F 1BDMA 5JQWA 2GK7A 5GJBA 4ZI7F 4Q9IA 2EIHA 1HFEL 2KBEA 5CIYA 5D85A 2JGMA 2X41A 3QXCA 4KNWA 1T8UA 3NVKI 4OFXA 5L51A 1T1SA 3MMZA 1P9RA 1WMSA 2ZRFA 3IP5A 1Q1BA 4QATA 2UUOA 4RK0A 3RO7A 4RTNA 3BFXA 4WE3A 4HAZA 2G5PA 3L1UA 1UODA 5EJMA 3H5VA 1TKAA 3IKTA 2XUZA 2OG1A 2QG6A 3G9ZA 2FPKA 1DJQA 4I66A 5T57A 3RT1A 4U8HA 1VPDA 2C2ZA 5DN9A 1U0OC 2I3BA 3I04A 2D7CA 4L6AA 4LGCA 5AVKA 1KI2A 3KHUA 2ONCA 3W5SA 3U44B 3WHPA 4G3XA 4RQTA 1IBRA 2D4AA 1SC4A 2ID9A 3KEQA 4ALIA 1EUZA 1YQWA 2JVIA 3CS3A 5A7HA 1OVGA 1JIIA 5D2CA 4KJZA 4HXEB 4W63A 1ADCA 1KO8A 2IYTA 2VP5A 2Z3WA 3Q9SA 5E9AA 3VKGA 1CJCA 1A9QA 4J16A 2AYXA 2N42A 3TL6A 3HPRA 4X6LA 1QRTA 3FUUA 4HDMA 1DAHA 1Z0KA 4TYWA 2OV2A 4DAEA 4QXOA 1JAHA 1JDZA 2GS9A 4JODA 1L4YA 2ZZKA 4BMZA 2CXSA 2PWAA 2M9MA 2QRPA 1O94C 3GF4A 2W9XA 1G64A 2Y71A 1ABBA 3RHZA 1R00A 3O8BA 4M0KA 4OXIA 3RFTA 4NBRA 1W34A 4XYLA 4D3DA 1G21E 3C3CA 1P0PA 2X1MA 3ASVA 4TTRA 3VU9B 4QELA 1P17A 1YT5A 3SBXA 1L4NA 1N2CE 1Z68A 3WK5A 5IAEA 1CRQA 4DLLA 5IYZB 5L53A 1ACJA 3L7BA 3UG6A 4FK8A 5JU6A 1JFSA 3ZZ1A 5AESA 3ED5A 3EZFA 2JCVA 4B85A 3K5WA 4G24A 4RULA 1NYTA 3K0FA 1DPGA 3BTSA 4H4EA 3UATA 2ZBDA 1NZFA 7ABPA 3BORA 4G9BA 2P7IA 3RUPA 3D2AA 1WB6A 1BX0A 3C3PA 4UVEA 1ISPA 5AW5A 3VKHA 3BA1A 1UM9A 1YKGA 4O5OA 2DWPA 3A25A 1HNZB 4L08A 1SKUA 4CIBA 4U63A 3R0ZA 4PIVA 1GDDA 5AW0A 1W0JA 4RHXA 3A1DA 2YDYA 3HDYA 2NAFA 1PQWA 2BZ0A 3O1JC 4QFDA 4MIYA 4DRZA 5AM5A 2QE7A 1NDUA 2O6HA 4XSHA 1W2HA 2ECOA 3GHYA 1LNZA 3ZGNA 4E0BA 1TZCA 1UBEA 3ZY6A 1IM5A 1T5BA 4LJLA 4F9EA 3RHSA 2BAGA 1B00A 3BMCB 5I9TA 3DBLB 4FIDA 4H15A 4IFBA 5IMSA 2R1VA 2VHTA 3UMMA 4Z3OA 4BUJA 1YCDA 2VJDA 3RV4A 2QXTA 5CRIA 1P1JA 1XYVA 4MZXA 3WK8A 2O5VA 3PR1A 2OBFA 4N5LA 3BYZA 16PKA 4ICIA 5TGTA 1UFOA 4CUKA 2YZ2A 2CHQA 4L4XA 1G18A 2XAAA 3HDQA 4CF5A 1YZNA 1KKUA 1QGUB 2A9PA 2W8ZA 4GI3A 4TS3A 3W5JA 4EA6A 3RNLA 5LIRA 2H7VA 3RRMA 3OZVA 3KYJB 3D2BA 3NWJA 4QTUB 1K92A 1VLJA 3QELB 4ZAYA 4NDZA 4Z54A 3B53X 4JC5A 4V1CI 3UTCA 1AKVA 4FHZA 5IBQA 1XQ9A 2H1WA 5PGMA 4BYGA 2NU9A 1N33B 3BD8A 4BEWA 2OGWA 1ZU5A 1CY8A 1SVMA 3JV7A 3D8HA 4MMZB 5LYJA 2DERA 1UIRA 2WJYA 5EEHA 5HS4A 1LX7A 1Z4LA 3GK3A 1UDWA 4DM3A 4HUQB 3PGJA 3B2QA 5C5DA 1F4PA 3F1KA 3QVMA 5E1BA 4Y6SA 2COUA 3V42A 4Q1AA 4KAXA 4NJMA 1GPWB 1Y6GA 4IEEA 4OKSA 3O8CA 1RWKA 3VTZA 4ZYLA 4W9RA 3SJZA 3MAGA 1FLDA 4E5PA 2WTUA 2KS6A 2HF8A 2ZFUA 4FT4A 1FFSA 3IKLA 5J2UA 2BMEA 3ZR4B 5BT8A 3FUXA 4EUHA 1JHQA 1NBEA 2BGRA 4OVKA 5A02A 1C41A 2GF0A 1QHIA 4TL9A 4LGYA 2J30A 4WPGA 3WLOA 4Y1RB 1N8SA 1XZLA 3FYTA 4XRRA 1WSWA 4PAMA 4YP6A 5ENDA 5BSVA 4DMKA 2O6LA 5CFNA 1MH9A 1SIUA 3UUEA 2R84A 3K8QA 1ZINA 4DADA 1U2EA 4LECA 5EXDA 5AQEA 4WLUA 3TG8A 3DFIA 5JTUA 4MR8B 1LWNA 1NMZA 1OFUX 1W1UA 1SVNA 2OXCA 2X13A 4DV1B 5GGYA 1LRLA 4KHZA 4K9QA 5TQ2A 3WB1A 4KPYA 1DKMA 5IKPA 3RNOA 2ONJA 4ZN6A 2WD7B 3UCFA 3H2KA 5A05A 5CDFE 4ZTUB 3F3YA 4WZ6A 3KU1A 2WD7A 4QNRA 2WJ4A 1JKJA 4LRTB 4DIOA 1I4EB 2IELA 3SHTA 4DYHA 2O52A 1T4DA 3FPCA 4JJIA 1FVOA 1XA3A 3IAS6 2PBLA 3FVQA 5JH7B 3ITEA 2HSDA 1ZUWA 4I1IA 4ETIA 3MMNA 3M82A 2GSWA 4X90A 4YMTA 5ALHA 5HEKA 3OY2A 3FR8A 3IV7A 1N9GB 2R7AA 3ESRA 3GIDA 4Y7DA 3B1YA 2TMDA 1V5IA 4LY3A 4KACA 3ANNA 1U99A 2I1LA 4H3SA 4WCVA 4YPFA 5B1YA 5LD2C 1G38A 4KZPA 5CGZA 4PAQA 1DZ3A 1YA6A 4YI3A 3FE2A 2XDAA 4B6SA 5J2UB 1IBKB 1AG9A 3A2MA 3COWA 3PDIA 3RHFA 1A7UA 2AI1A 2I66A 5DI9A 5BOVA 1CF4A 1OZFA 2P41A 4QEKA 1E18A 4WKBA 2AG1A 3WP1B 2E48A 1WXDA 1Y5MA 2P6RA 1SCAA 4DW8A 5JIBA 4UTXA 3ZWOA 4L5CA 1ZNWA 1I94B 2VFAA 3H6HA 3P9CA 3R75A 3H84A 1ZUNA 4LF5B 5F33A 4W1PA 3MMXA 5IJ9B 4Z8XA 1Z47A 3E2PA 3ZI4A 3GA5A 4TTTS 3T9DA 3IP8A 1V1JA 3IA7A 4RVOA 2F64A 3QUSA 4J49A 5EJGA 4CIXA 1FL9A 3FI0A 2M6RA 2PMBA 1FZQA 2IQ5A 2QW0X 4RPCA 4AURA 4D98A 5LQUA 2P91A 2ACKA 2QX4A 3NFRA 3B3GA 1J2TA 1DFHA 1RBMA 2H1LA 5DWVA 3U31A 7REQB 5ICEA 2MTBA 1L8QA 1XL0A 4NH4A 5ALVA 2F8SA 3ZDYB 5KYWA 4J3JA 2WUEA 3R0JA 4V0KA 5DYTA 2DUJA 4XGKA 3PGVA 3QW4B 4MICA 4WLFA 3TBKA 1MB3A 1WQ3A 4GZ3A 1PRYA 4MV3A 5M2QA 4JLKA 3NZEA 5DLPA 5JRJA 1GVHA 2ZUTA 4QGFA 1T5LA 1U8UA 3PI6A 3FYDA 2OD2A 3F90A 5GJVC 4D8YA 4Z4HA 5B6IA 1N2ZA 1YF3A 3WJ2A 2WAXA 3PNYA 4G0MA 4LVNA 1J42A 3BCUA 3Q3JB 4QSHA 2QLMA 3H9CA 3R44A 4X8OA 5E8JA 2PKQP 1HEYA 1CLUA 3G8AA 3UPDA 1XZHA 2ZU6A 1HOXA 5AOAA 3AOEC 1FQKA 1AB6A 1Z2EA 1RSZA 3ETHA 2V58A 4M0FA 3DS8A 3UC5A 2BGGA 4OYYA 3M3PA 2O07A 4R0NA 2WSLA 5I7AA 3LVRE 4CE6A 4EQZA 3TQRA 1GQQA 3WWCA 4FFRA 2C4TA 1DIAA 1GFIA 1TVCA 2WWYA 2LUOA 1NE7A 2WBLC 3GFRA 4KIGA 4OQEA 4IDOA 4OX9B 3PA8A 3PFHA 1HG0A 5ALSA 3RI3A 2WA1A 1UBHS 4RDCA 3AB3A 4H1HA 1G8FA 1PGPA 1NW4A 2VDMB 2YJTD 4YP1A 4AO6A 4F46A 4NZYA 3O8LA 4HGQA 4UDNA 5DN6A 5F3RA 3U5TA 3X43A 5FTWA 1Z7GA 5HE9A 3GFFA 3FOZA 1C3XA 4XLZA 3PDWA 1XMPA 3JAMA 1NVGA 3FA2A 3PQ4A 4MWCA 4PCUA 1FNCA 4U7DA 3T52A 4XDHA 1H6CA 2D2VA 1DLJA 2F1IA 4RCZA 2ZIUB 5LFAA 3HR4A 4MYSA 2CYAA 4K6FA 2FRDA 4P2GA 4RSRA 1DS6A 4EPVA 1P33A 3DSRA 1XRLA 1X8LA 2PZEA 3FW1A 3PE3A 3H97A 1KMHA 2IKQA 3V1YA 3BWDD 3CXRA 1AM4D 1BJKA 2BBOA 1ZC3A 4L51A 1IK6A 1U2SA 2YRWA 1T3TA 4PZ0A 2OKGA 1XMVA 2P8JA 4MYDA 4TYPA 4V38A 5JROA 1QPBA 2EW2A 4AF8A 1O6GA 1OQAA 4U2EA 4DMMA 3LU1A 1JG7A 2PGAA 2IHBA 3BFKA 1CIJA 1K2VN 4XAQA 3KDAA 1LDNA 1KI6B 3U26A 3AVXA 3BHNA 2QLBA 3SKYA 1PR9A 2P62A 2YIVX 3AJ9A 4RENA 5BV1A 5KQMA 3EXG2 2W8BB 2IQIA 4RZSA 1LZKA 4LSGA 4GR5A 4RA6A 3QOFA 3CH5A 4REQA 1DB3A 1CUHA 4U1RA 2CFRA 2V7WA 3FTPA 1LFDB 1OFHA 3OAAA 1JMVA 2C3MA 4M0CA 3S1AB 4K28A 3FNGA 4FPXA 3RCBA 3RH0A 1V2GA 4FHGA 5DW3A 4YRPA 1JEYA 1NBOA 1QK5A 2A94A 2K87A 2WP8J 5DT2A 1UKEA 4FB4A 3KQKA 3DCNA 1ELOA 3C3EA 4TTPA 3T1YB 1EJ6A 3GCZA 3KCNA 4LZAA 5L3VA 4H08A 4R2WA 4ITRC 3V7WA 1ZITA 1CY6A 2QAGA 1EDBA 2WAOA 4IYJA 5E38A 4EZEA 1CZNA 3LUDA 4FOTA 1QCZA 1PFKA 4GI7A 5F78A 3TGLA 2REQB 1TI7A 9GPBA 4OQNA 4V39A 3RWBA 1HRKA 2P5TB 4UNSA 3PPIA 3CLTD 3WY9A 2VJAA 2ZSEA 1GR0A 2BD0A 1YHZA 4O1HA 3AONB 3I6ZA 2GBGA 4TKVB 1RW4A 1JFFB 1HO3A 1F1BA 3U56A 1SC1A 2XDWA 2NADA 2VA8A 2AOTA 4WFQA 1NFQA 2QU8A 3EVTA 4X3CA 2GCEA 2IPOA 5L4NA 2CVQA 3KJGA 3X3HA 3ZK7A 4KQWA 3VOSA 1Z0AA 2R8ZA 4DUPA 2RBKA 1CS0B 2WSIA 1ONBA 5TSDA 3RRBA 4BV8A 5C53B 4H7HA 4XSGA 3J81k 3ZGZA 3GA0A 3PKJA 4K03A 1NV8A 1GG2A 4DYVA 2ONKA 1CEQA 2V9PA 3EDMA 2Z2KA 4XPZA 1ZWLA 4CEIB 1KKLA 3CZ4A 5IKOA 1P1RA 3I5AA 4MVJM 5D84A 4CG2A 3NVDA 2C8KA 4TKZA 3OMWA 3RM3A 2BSAA 4QOFA 1HMPA 2PX6A 2FFQA 3ZGOA 5B1SA 1IXSB 3PC4A 3KWLA 4DA7A 1HNXB 2JA1A 1KVSA 2OPBA 1ACMA 2VXOA 1M2VA 3A1FA 4O4IA 4PANA 2FX5A 1DZIA 4P98A 1R9GA 4M7RA 3KTDA 1EG2A 1PG0A 5IAKA 2IH5A 4G0ZA 1KBOA 4EY3A 3D6MA 1Q6YA 1T5SA 3DHYA 4M0PA 1R6VA 4WXMA 1ZCZA 4GE3A 4LNUA 3EVNA 3I62A 4M9UA 2R97A 2V7QD 5JPIA 4C4SA 4EHLA 2NO1A 3QRWA 1XMIA 1UBTS 3H3FA 1M1YE 3NTUA 1E9SA 4CLRB 1X8KA 1SY7A 2FDXA 2I8CA 2JI4A 5K3OA 4LZLA 2G83A 4NMHA 1MH1A 3ZY2A 3ND7A 5JDCC 4I1UA 3MM4A 2AUMA 2W2PA 3M6AA 4MMXB 3N74A 4BVBA 1QYVA 1VG1A 2GK4A 3HWWA 4DMHA 1YBHA 5G1OA 1TT7A 2BIFA 3UO8B 3BQMB 4NONA 1AK1A 3KSMA 3EGDB 4FEGA 4PZAA 4W9NC 5AK5A 1ZG3A 3L8ZA 2IS2A 1L7OA 3B48A 4PBRA 1V2HE 3HA2A 3NDJA 1ZGJA 4CG1A 5JAQA 1U2PA 1L5KA 3VO2A 2VLBA 1N6LA 2EEZA 1KH1A 2P1RA 4O4JF 4BLUA 3R0QA 1VXOA 1NQXA 2V55B 3PTLA 4JB0A 4UMDA 3UT0A 2OPHA 4BVGA 1JUDA 2WG2A 3C6ZA 4F1KA 4UAVA 5TARA 4Q0MA 2AC2A 1CUBA 3WWDA 4OOFA 2G88A 4QUBA 5LZ2A 4I99A 5GZ3A 3AHFA 3UQYS 2GN8A 1EXMA 3R7BA 4G0PA 3MFYA 3AEQA 2QY6A 1NJ1A 4FOLA 3UKJA 5F7XA 1B73A 3WQRA 3R5TA 2HA6A 4KO8A 1TCUA 2G4LA 3KEFA 5A5FA 4FBLA 2H3HA 4B4OA 3D4PA 3G89A 4BOYA 1M75A 1VHJA 4Q01A 2YS6A 4EB0A 3NBXX 1KE1A 4CQMD 2MT9A 3QYPA 5J5AA 1OAKA 4QEZA 2DFPA 2DR2A 4DV0B 2PUDA 3A36A 3F46A 5JCJA 1LLDA 4H4DA 4FHCA 5CNIA 1K8YB 1BO6A 2BKUA 1IK4A 3NRJA 4MCHA 1JR3A 1DARA 3OHPA 1UBLS 1SC3A 3SVTA 1NW5A 3RFUA 2PRSA 3QXHA 3WMFA 4AS2A 3EX7C 4O2AF 2JGNA 1EGMB 1NUTA 2ZB7A 2IP1A 3D6JA 2FG5A 3WGOA 3Q41A 4UUAA 1J25A 1RWQA 2JJ1A 4FEEA 5J2TA 3HXQA 4UFNA 4I36A 4TVSA 5CURA 2IV7A 3HCCA 3NV7A 2J6IA 2P30A 3CTPA 3VA7A 1C7RA 1X8XA 1JHRA 4BXOA 2BTEA 2DHEA 2HSZA 4UKDA 4R9UC 3KELA 4WKNA 5I5GA 5TLSA 4X62B 4DE5A 5REQB 5HZKA 4RPKA 4PTZA 1EXVA 3JALA 3RTDA 1W4CA 5IAJA 2UYHA 1NJ8A 3ET4A 4YAEA 3UK7A 4P0QB 5BR7A 3GEBA 1UBSB 1Z25A 1CHNA 4ZDKA 1G21B 1H4TA 3K0FB 3UC9A 5ECDA 3RFCA 2J7PD 4QUJA 2O8DB 5HCIA 2C00A 3HXKA 2G63A 2IUSA 1XV5A 1E0SA 3IB6A 4HRAA 1N2GA 1XG5A 1XAIA 4JOBA 1EWTA 4O4LB 1DSSG 4C2AA 5A5DA 4ALJA 1S96A 2NYAA 1I32A 2VXCA 2ZYAA 2PBRA 4N4AA 4WVFA 5F12A 1QH0A 3ISJA 3VVLA 1D09A 4WNAB 1YIDA 2F3PA 4I4CA 1T9BA 4LRYA 2YICA 4A2QA 4GPZA 1AXEA 3QU4A 2MMCA 5EKUA 3GLFB 3JAWB 3KZVA 4ZJZA 3D6TB 1Z7YA 4MS1A 2VPTA 1GCUA 2JVKA 4UE3S 1W29A 4UDOA 4L75A 3U3XA 2H92A 3BJMA 1U81A 4I3FA 3RUDA 1VSTA 1J49A 2ILVA 2XUDA 3C5WP 1XEAA 4MX8A 5JCOC 3U7HB 2AMVA 1JECA 3FCAA 4ITVA 4KR7A 2CK3D 2KSQA 1MO2A 1Y3IA 2NWQA 2XUFA 3C3WA 4JVNA 3COSA 5K4AA 5JXWA 5MHTA 4F3TA 1TK9A 3VJKA 3LW8A 1UJBA 4G5SA 1N6KA 3FOWA 5A0FA 1KYTA 1ZDMA 1R0SA 4FR5A 3GAAA 2OA0A 1RLIA 3W5DA 3PDJA 2GM4A 2C1EA 2Z9BA 4FWTA 3BZWA 2W93A 3QHQA 3BA6A 2WWIA 1VIYA 2C61A 4JENA 1CRWG 1R15A 1W1IA 2HY7A 5F64A 3EPJA 2YYYA 3HBLA 4TL8A 4HLCA 3EEFA 4HTFA 4OHPA 5CHYA 3IAEA 3U3JA 2I99A 1L5FA 4YIKA 1Y1SA 3AO0B 3H1EA 3I8OA 3NT4A 2WTBA 2QDXA 2E82A 1KFEB 2OM6A 4HFNA 4I55B 1TC1A 5EUQB 3JVUA 4ZO9A 3KM0A 4OL9A 421PA 5EIWA 2R9VA 2B94A 3M9XA 1CZHA 3O47A 3KKEA 3QWAA 3HBMA 2WVJA 1E8NA 1CE8A 4DLZA 2O50A 4UTZA 3RU7A 1TTHA 4MGEA 2PD3A 3N0RA 5ARBA 1L5MA 2HWUA 3QFSA 2IY8A 4XGNA 3GJ0A 2H1VA 4E31A 2OV8A 2LPMA 3L8EA 1JDNA 1MMFB 1UT8A 3JZMA 5NULA 3C45A 4KI7A 1HR0B 2GCOA 3EAFA 1DQYA 2R7MA 5KSZA 1UKZA 1QV7A 1SXQA 2BUCA 1BDHA 2PHZA 4S1NA 1ZMXA 3T4XA 3ZWVA 4IV5A 1DO2A 1HL3A 3GEGA 4IO1A 4J3NA 1GUDA 1YI8A 1XZAA 1YI0A 2GBIA 2V7BA 1WUYA 2JIZA 3HJRA 3HEBA 1W4RA 5FTMA 2J6BA 1V8OA 3PKIA 5HRAA 5ALIA 1TVKA 3NP7A 5BUSA 3SEZA 5A1JA 2PAFA 3NEYA 1K5GA 3OP4A 1V96A 5IW8A 4FX2A 3DZIA 4E2FA 5CDGA 5EE9A 4ETNA 2G04A 3F47A 1AO0A 4BVJA 3BG5A 3D5QA 4E7PA 4RK4A 3HXLA 4B7CA 5KX5F 2F55A 3RC8A 5JCPA 4UVIA 1KR2A 2F43A 3FROA 3HP1A 3K09A 3UJ8A 4BMNA 4YPVA 4KODA 3LX8A 3GUYA 3R7NA 3DUWA 3DAHA 2C8VA 3V8BA 3MBIA 3RAGA 3LCRA 3WRYA 4CTNA 4DDUA 5BN5A 1Q15A 2FYTA 4TS4A 4U6SA 3FUCA 3VNRA 1P4SA 1OWLA 5D01A 4E1BA 3M1YA 5CJJA 1VBNA 2DKOA 2PQ2A 2HDOA 3TRHA 1CJVC 3A3KA 5JWOA 2I54A 2YH2A 2P9TA 2B1GA 2JGRA 1ZN8A 2IC5A 2JEZA 2WU1A 5JJ5A 2F9MA 5KX5A 4QVGA 2AN3A 4NH0A 1FA9A 3TTTA 2VDJA 2Y1LA 4D42A 4ZVQA 1DGQA 1DHRA 2PRIA 3BRQA 1KQ3A 1V8FA 3OLVA 3TR5A 3LFHA 2ARKA 2NU8A 3TM5A 4UCWA 2B0CA 2DR0A 2OY0A 2ZSIA 1R8YA 3PJGA 5G1PA 5BQXA 2ZBPA 4KFSA 3ZK8A 3HP4A 4D8WA 4DJ5X 1SUEA 2XIJA 3NCHA 5HQ3A 4Q37A 5LWQA 2Z8XA 4BJ5A 2OENG 2XSZA 1E99A 5LDHA 4DR7B 1YJXA 3OF3A 3OKPA 2QUKA 2GM9A 1DBPA 2UXDB 3AX6A 1QHFA 3IT2A 5JQGA 3KQNA 1F5SA 1DVRA 2OZLA 4RVHA 2B1JA 3ABRB 4EW6A 4RGQA 1JAZA 3GBVA 3K70C 2J3QA 4XM0A 3A3OA 5HJEA 1U7WA 1Z4OA 1W88A 4PPYA 3O9VA 1QANA 4L1KA 2YIJA 2ZYGA 4GL2A 4OHKA 3RLIA 3UMVA 3CVVA 3IUQA 4CM6A 1CTQA 4Y6LA 2IPMA 1RRKA 2WYUA 4QUKA 3K70B