2FDXA

Clostridium beijerinckii flavodoxin mutant n137a oxidized
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fdxA00
1CZUA 2QX4A 2FX2A 3S2YA 2Q9UA 2BF4A 3U7RA 1YCFA 4PU0A 3FVWA 1RTTA 4PTYA 2OHIA 4PTZA 4GI5A 3KAPA 1AMOA 4HS4A 5B3LA 1FUEA 1D03A 1D4AA 3QE2A 1WSBA 1AKRA 2V5VA 2KLBA 3W77A 5ULLA 3U7IA 2MWMA 3L9WA 1AKUA 4QOJA 1E5DA 4XDGA 1BVYF 2QMZA 1ZX1A 5LBUA 3NHLA 2GSWA 3NLLA 1JA1A 4Y9RA 1F4PA 4QODA 2BZSA 3NHWA 5F12A 3K20A 5NLLA 1FLVA 4YAOA 1H66A 5EMNA 2AMJA 3NHJA 2A5LA 3NFRA 3EYWA 2HPVA 2RG1A 4ESEA 5F4BA 3ESZA 3UXEA 1QBGA 4QOEA 2F1OA 4YAFA 1J8QA 1NNI1 3FW1A 2FLVA 1RCFA 3L9XA 3ESXA 3W78A 1BU5A 3O2NA 5BUCA 2FDXA 3OWHA 2Z9DA 4N9QA 5LJIA 4LTDA 1SQSA 3OJXA 4BMOB 3B6MA 4BMPB 3F90A 1TIKA 3ESYA 5EA2A 3JSXA 5LVAA 3UXHA 4XDHA 1CZRA 2FAXA 3NHYA 1T0IA 2WC1A 3OX2A 2QX8A 1QR2A 2Z98A 2X2OA 4YAWA 3K1YA 4FGLA 1KBQA 2MTBA 1B1CA 4QOIA 3KLBA 3NHKA 5LLDA 2KQUA 4H2DA 4Y9UA 3SVLA 2FZVA 2QX6A 4FGKA 3O73A 4YQEA 1ZWLA 2Q62A 3GAMA 3FJOA 1CZNA 1DX9A 3R6WA 1AKVA 3LCMA 3GFQA 3NHRA 2MT9A 3KAQA 1CZHA 4NLLA 2MOKA 2XOEA 3B6KA 4Y7CA 4YALA 1XT6A 2Z9CA 3ES9A 4U7HA 1FTGA 1AKQA 2N1MA 5JROA 3GFSA 3N39C 1AZLA 2FZ5A 1H69A 4U7GA 1CZOA 4ICIA 1JA0A 3HLYA 4OXXA 3FX2A 4GR9A 2V9CA 1FLDA 2ZKIA 4GQIA 1OBVA 4DIKA 5FA6A 4N82A 1RLIA 1XYYA 3HR4A 4ZVMA 1YCGA 1YKGA 3G5MA 1X77A 4ZVKA 1AKWA 1T5BA 1C7FA 1AKTA 3N3AC 3NHPA 3OJWA 4FX2A 4HEQA 1OBOA 3P0RA 1KBOA 4NULA 2OHJA 1TLLA 1FVXA 4LA4A 4F8YA 1J9GA 4DILA 3F2VA 2W5UA 2QR2A 1ZWKA 2ARKA 5FUQA 3QFCA 3HA2A 4FGJA 1QHEA 4QOGA 1D04A 4LTMA 4R81A 1CZKA 1CZLA 2R96A 4LAFA 2XODA 3RPEA 3OVMA 2QMYA 4C14A 1OFVA 1RLJA 1V4BA 3OX3A 1I1OA 2BMVA 3B6IA 1FLNA 1FX1A 4CETA 2HNAA 1GG5A 4ZVLA 2BPOA 5TGZA 3LT5A 2HNBA 2BN4A 1FLAA 4M0CA 2R97A 4QOHA 1AG9A 4H6PA 2QWXA 3F6SA 2FVXA 2M6SA 3NHFA 1YRHA 2FCRA 3KEGA 1YCHA 4C76A 1VMEA 2B3DA 4DY4A 4N65A 5LBTA 3NHUA 2V5UA 3EDOA 4CF6A 2X2PA 5LMCA 1YOBA 5B3KA 2OYSA 3N3BC 5FX2A 3TEMA 4QOFA 2OHHA 3TE7A 2D5IA 4ZVNA 1C7EA 3F6RA 2Z9BA 1XI2A 1XYVA 5LJLA 4J8PA 3TZBA 1DXQA 1DXOA 1QRDA 3NHSA 1WSWA 4C0WA 4YAUA 3QFRA 5EAIA 5A4KA 2FOXA 3GFRA 5NULA 1SG0A 5F51A 4D02A 1J9EA 3B6JA 3OWXA 3FNIA 1YDGA 4U7FA 3ZHOA 4LTNA 4C0XA 1J9ZA 2M6RA 2QX9A 3OX1A 3D7NA 1AHNA 3W7AA 3W79A 4S24A 6NULA
chains in the Genus database with same CATH superfamily
3RYCB 1P0MA 2BZ0A 2SECE 3GRUA 4WV3A 1N6KA 1R3DA 2CVFA 1B0AA 5I6DA 1P61B 3I3OA 5K3BA 5HIAA 4QDZA 4QWMA 1HNXB 5CJPA 5KU1A 5DRYA 4KWIA 2PKRA 5IN5A 1PEAA 1Y3CE 2QQEA 2P77A 1B6RA 1YU6A 4FN5A 5LDGA 1CX9B 1PYGA 1GP2A 2G0NA 2J3QA 2Q1XA 3IQZA 4U6QA 2QZSA 4ATNA 4EJ2A 4K9KA 5FTMA 3UJAA 3KSUA 1UDXA 4B8YA 2W9XA 2XD4A 4GR5A 4YWHA 1QIIA 4FCCA 2LW7A 5IMSA 2GOYA 1IZ7A 1K08A 1T35A 4N6OA 4PU0A 5C9ZA 2WWVD 5G4LA 2Y1WA 3VAYA 1V1MB 3R76A 3UJ9A 4C1BA 5BR8B 1NRJB 2A58A 3HP4A 5AO9A 2HA6A 4UHBA 2DECA 2G77B 3EXEA 2I2XB 4KQFA 3VI3B 4I1SA 4MW9A 3T7CA 3TPCA 1H4TA 3I61A 4J7UA 3QENA 3KZVA 1QGAA 1ISHA 3WK5A 4PBTA 3OTIA 1SIOA 2DULA 1MGPA 2BUBA 5AW0A 1V0JA 4WZAB 1FFWA 2EFHB 1P0QA 1PK8A 1MOZA 4QOJA 5DN6D 4WK2B 1I4DD 3KEMA 3GBVA 2AFIE 2DHQA 3MCAA 4LSZA 3LXRA 2SKCA 4BZQA 2PGIA 1T2EA 5CLFA 5GIPE 5E4FA 1ZITA 3UMYA 2O2IA 4R5MA 2PH3A 2WAXA 5LP6C 1K6XA 1Y6JA 3WL3A 2E48A 5TR9A 2CC2A 1AQJA 2OORC 3L05A 1A04A 1BE8A 3GJ4A 1IDOA 1SXJD 4L6IA 3ZK9A 4LPSA 2AL7A 2I5PO 3OF5A 1I33A 4KIUA 4JLAA 3PE4A 1Q83A 2D1YA 4XCQA 5EGSA 5F78A 2GK3A 2OORA 2VBCA 2BGKA 2J7PD 3KYDB 4JI6B 4HRYA 1Q50A 3KJNA 3ZQJA 1Y1LA 3DP7A 2AKAB 4FPXA 4RMJA 4IOLA 3VH1A 3FVTA 3WMGA 1JI0A 4B48A 3JSAA 3FY4A 1M1XB 1NVMB 4R3WA 4Q6WA 4I8DA 4KSYA 2XPCA 5AVTA 1EFVB 3WLNA 3ELDA 3FJYA 1FDTA 4GPZA 2W93A 3UT6A 4A2CA 5FTLA 3P9KA 2WQ7A 4RLHA 2DPLA 4X1OA 4XDYA 4JGBA 5KYYB 5LOVA 3I62A 1RADA 5AVJA 2OYCA 3TB4A 3HN6A 4F4HA 3CKYA 4IFIA 3QMMA 2FMTA 3A1NA 1JTVA 3IIEA 3GPLA 2V7XA 2VAPA 2COKA 1UMCA 2ONYA 4IR7A 4NBNA 4KPFC 1NNI1 3ZK7A 4EEXA 2JANA 4PC6A 4XQGA 8GPBA 3HYTA 1KL7A 1NXOA 1OY1A 1T4CB 2KPOA 2VYCA 4G1FA 4UNRA 2Q07A 2OXTA 2AVDA 4N03A 3CVWA 3VV2A 2DT5A 3E9NA 2H7YA 1MEJA 4RFLA 1DWOA 1G20A 2WE7A 1JE0A 2GBGA 3VU1A 1E6UA 2OYRA 1TA9A 1U2QA 2YCBA 4BO3A 4JJIA 4FFPA 5TDHA 1JHRA 4EY3A 1J0EA 1M8PA 3W5DA 2XE7A 2L17A 2XGSA 2ZI4A 4ZC1A 2BDTA 4ZI7F 3L1VA 5BWLA 1I2MA 1QE5A 2QUAA 5JSUA 1AMNA 1IY9A 1PJLA 1E5LA 2HA7A 2NM0A 2YH2A 3CSSA 3CW2A 1G41A 4TS1A 1MC4A 4BOYA 2GTHA 1XZQA 3AGQA 3H99A 4EDFA 5FD8A 1FVOA 5GZ6A 6REQA 4GR4A 2I03A 1RKUA 2FZWA 3R75A 1TVKA 3AUAA 1DUIA 3REOA 3SOPA 4W8OA 3HDHA 4B31A 4RH0A 5KPDA 3V97A 1AURA 3L7BA 1M8KA 2BEJA 2RHTA 2IUSA 4PYKA 4ZO8A 1HE4A 2ANCA 4JQOA 2DSTA 2WKPA 1T1RA 1QM5A 2ZRLA 3W2EA 5CIYA 2RGBA 4HUQA 3AZOA 3A4MA 1B0PA 2DXIA 2I67A 1RM0A 1Z4IA 2P1RA 3PC3A 1AVTA 1AY0A 1H2YA 5ALUA 1LV8A 2H2AA 3AUKA 3EOZA 1MABA 3TMAA 3TSZA 3T34A 3ZE9A 4A1OA 1UAGA 4JGIA 5DX0A 5KNBD 2UZ4A 5GONF 1ZOSA 2IBMA 4G24A 4MKRA 3BGSA 2AC2A 1GZ5A 1HRKA 3NDIA 1O4VA 4HYEA 5JSYA 3WGYA 4TYWA 3UFXB 3IILA 4XUGB 3PDHA 5IBRA 3ZCUA 1AXEA 1L7OA 4CM3A 2GI4A 3NHYA 4OL9A 5KNBA 2CB0A 1T4BA 3LPAA 3FUVA 2FY8A 1A77A 3E7PA 3JY6A 3OJFA 2WC1A 3NONA 3L93A 5H02A 3KJIA 4F8EA 1TK9A 4LZLA 4OMDA 2ZYUX 1FY2A 1KYIA 5GJWC 3D7SA 4MVJP 3FPJA 3Q0TA 2DPXA 2QTMA 4MYTA 4NYMQ 1FTYA 2JAQA 1RYYA 5T4FA 4H7JA 5YASA 3ZHSA 3QUCA 3RYCA 4IJ5A 2VI5A 1BH2A 1X19A 4MP6A 2ZE6A 4WK0B 4CBVA 1Z22A 4QYTA 1MB9A 3N28A 4Y1FA 4YAWA 3N5KA 1CUJA 1HQKA 1W0KA 3ZX4A 1VLMA 2F1RA 3AESA 3DNMA 4RD0A 2C57A 1GNQA 2ZSAA 4NDNE 5CITA 2VDWB 2ZE5A 3BMNB 3Q87B 4RJ2A 3RS9A 1A2BA 3E7DA 3W05A 1K92A 1PR2A 2Q6TA 2XT9A 1A8UA 4V0KA 5T3UA 2DWPA 4MVJG 1GL6A 1DAEA 1SQ5A 2AB0A 2RBKA 2ZOSA 5T8KA 3FLAA 3B82A 1PBTA 4D8XA 2XUHA 1P1IA 2IPMA 4M7PA 4TSFD 1V3QE 1TEZA 5HMMA 3TQRA 4CUJA 2QL6A 4XWWA 2DSNA 3FPAA 3DT8A 1V1MA 1PG2A 2O2DA 2JI7A 2OB1A 2Q41A 4KFRA 4EJSB 2EERA 2KI5A 3WYNA 1CEEA 3BQMB 3FCUB 3D1LA 3GQBA 4TSFA 4BNJA 2O3SA 4I66A 1I24A 3BE8A 4CUKA 4J6EA 2PKXA 1DC6A 3OCUA 3E7XA 1Q2XA 3VTAA 3K94A 2L42A 3KUCA 5HKKD 1SWVA 3FYUC 4FWTA 4IF4A 1WSDA 2YOHA 5MGNA 4L7VA 4MJXA 4YDQA 3MCTA 1TQ2A 5DNWA 4ZVRA 3H11B 3FYUA 2FW1A 3I9KA 1GJRA 1GRCA 1VKJA 2RI1A 3EVDA 4AIIA 1IOWA 2I4NA 5HKKA 1QDLB 4OK3A 2QTZA 4DAEA 1AMUA 3GLHB 3ASYA 1NGSA 2C9YA 5M29A 5REQB 5CCDA 2Q8QA 3ZV7A 2BJVA 3O2SB 4M55A 3RVOA 3RNLA 5IBCA 1BN6A 3AV3A 4G67A 5IYZB 3OURA 3ISVA 4DPKA 3THYB 2RE8A 4DBZA 3RVBA 4CLOB 2CYAA 1JJVA 2BELA 3PXCX 4BB5A 1DP4A 2QMHA 2JLAA 2Z8YA 4ZQCB 2V65A 3GBSA 4GYYA 4XSHA 3U26A 4ENPA 3ED5A 2GWRA 4TVBA 3KYDA 1WMSA 3V8PA 2P9FA 3O6VA 2UUCB 5KSWB 3DKRA 2ZPTX 1ENYA 3OZTA 2OKCA 2EFJA 2QT0A 3I1JA 2DVMA 3PQEA 1GPH1 3FX2A 2CJPA 3N86A 4QOSA 5JV5A 5C52B 4DMKA 3N8IA 1NRIA 3M6UA 2IK8A 3DOFA 1EFVA 3GCGA 4KWTA 2QEQA 3GBPA 4KVZA 3GYBA 5AM3A 1ZGZA 1DQNA 4HLQB 3RS7A 3TRDA 3FCSB 5KYYA 3WP1B 1E6LA 4J43A 3TLBA 1S3GA 4PR0A 1RLUA 3VO2A 2OESA 3RIGA 4B87A 3FMFA 5GIOE 1M54A 2RGGA 4JMPA 3SP1A 3GELA 4CDNA 1A2KC 1MO2A 1QCYA 3KKZA 3CLUC 4NEHB 3VGJA 5CDYA 2C7RA 3FDJA 4JB8A 5CTAA 1QF9A 1XRRA 4GKAA 1L1FA 2WWTA 1BMQA 2YWHA 5TQVA 1H3EA 1T8SA 3JYNA 1C8BA 3KWLA 4YI5A 2J0EA 3KXIA 1JNYA 2PN1A 1MO6A 5D6NA 2C3YA 4FFBB 1MN6A 2GEJA 1Y34E 2CXNA 2JJ8A 3OI7A 4KQMA 4XVRA 1BO6A 3HY3A 3ZCSA 2B8JA 2H48A 5E7QA 1M66A 4M83A 3L8FA 5JJ5A 1X1RA 1OZHA 1XDUA 2ZWPA 5C5CA 1XMSA 4E94A 1KKMA 1IM2A 2FU5C 1C8LA 4EHKA 2ZAMA 3F2VA 3SX4A 4EQ6B 2JFVA 1O96A 8OHMA 1PJ2A 4KWHA 3SJ7A 4C0JA 4F4DA 1XAHA 1TVMA 1JXOA 1RHMA 1WXHA 1YVEI 3L41A 3EPLA 4JA2A 5IT5A 2QW0X 2XZDA 3L6EA 3T1QA 1SBYA 3FNQA 2JLBA 3NKVA 4FFRA 3U4GA 2X0FA 4W5TA 1X7YB 3GGSA 4DW8A 2GBPA 1JZQA 2OLKA 2K7FA 1H23A 4YQYA 1RLOA 2YMPA 4C4TA 3CLTC 4JX8A 4Y1RA 5FBKA 4BVEA 4R81A 1LDEA 2G1UA 3DLAA 5L9AA 1T9ZA 1GPJA 3AB3A 4TUYF 4HYTA 2ZPUA 1G21E 2BFMA 2HWKA 1AZSC 4FB5A 2VP9A 2WYUA 4IJMA 3AY6A 3L4BC 4DJDC 3VPSA 5HQ3B 1W0JD 2YJ5A 2DB3A 2PWAA 3PIDA 4O4LB 2B1GA 4YQZA 4D3YA 5A0FA 3ECCA 3ROPA 3P8ZA 2VSNA 3KHTA 3L4BA 1N2JA 3PIRA 4M1EA 3CPEA 3UFXA 1Z38A 1EX9A 2DUJA 2GBFA 1XGKA 4V0SA 1LJ8A 3EODA 4HD8A 4Q4CA 5B4VA 1RLJA 4QZVA 3HCWA 5ETJA 2EG9A 1LLUA 5J58A 2H1IA 2JJ2D 2VAVA 1O54A 1R8YA 1Q7RA 2EYUA 4G0OA 1MT0A 3OKPA 4FGSA 4ND2A 3SYKA 4D96A 5IS2A 3EQZA 3GGJA 3GJ5A 5J4YA 3E3LA 3B6IA 3E22A 3PE6A 5LWHA 3C74A 4WCFC 3LGAA 1IH8A 2VEDA 2JJ2A 3LT4A 3GLFA 2VDJA 3ISJA 3HMQA 4RTMA 5TGZA 3LDGA 1BD4A 1VL8A 4C7KA 4FN4A 4WCFA 1PLLA 4FZ3A 5COQA 2MYPA 2O3RA 3I9MA 4BKPA 3VH4A 5K0GA 2DETA 1QV7A 3ZZTA 2HF9A 1IY0A 3B3JA 4XFJA 1J1UA 4KO4S 3BMNA 1Z0SA 2XJ9A 4HC4A 4C2UA 3IRVA 1RMQA 4LUCA 5F73A 3TSCA 1NW9B 4BHTA 2WWRA 4Z1MA 4ALIA 2BFOA 3DFZA 2OCKA 3DPUA 4EJSC 3KEGA 3KQHA 2VOEA 4YUXA 2AZTA 2A6PA 2QRLA 4YA6A 1KJWA 1PR9A 2DC1A 4JVNA 3G7SA 4OQFA 2CFIA 3A0UA 1XZFA 5CUQA 5HGJA 3WL8A 3WIVA 3DE7X 1J8DA 1U63A 4EJSA 5TGDA 2VJNA 5DTQA 4PYIA 1BWQA 1OJ7A 3QOFA 4PINA 2H7CA 1U99A 4U00A 3ROQA 2ZVQX 4CG3A 3MJ4A 1IXSB 2RK6A 3VGPA 1Q20A 3ZWKA 2Q3FA 1IC6A 2G4CA 1JDUA 1EE1A 4KXLA 3EDOA 3P27A 4PZYA 3DSRA 1AIPA 3OOHA 4CGYA 3SKVA 4PYJA 3V2IA 3B7WA 1KWKA 3R3ZA 2RONA 4OQ4A 1TT5A 1YOBA 1W35A 1MNQA 2D2EA 3ZIDA 1O0CA 2W2MA 1QVAA 3O74A 3USES 2P9HA 1DCMA 3F7OA 1P2FA 4QAQA 1G64A 1VLZA 4C0KA 2PYDA 5CW1A 4F2WA 4RTRA 2HCTA 1L8QA 3VYSB 4EYSA 3N7UA 1IN8A 4MZDA 3SNKA 4CT0A 5FX2A 4DIUA 3EF1A 5LB4A 3FPLA 5REQA 2D5IA 3OZ7A 2YYSA 4M89A 3DFUA 4MICA 2OGSA 3LC2O 3GLGB 3RG8A 4BFYA 5ILOA 1NR5A 1GPYA 2V4UA 5EIAA 3THYA 4KN9S 1G8HA 5TARA 1D2CA 4AG3A 4CLOA 1S8FA 3GO4A 2QV7A 3HBAA 3PJEA 4QA9A 2Q4TA 4WOJA 5JSZB 3BIOA 1P5ZB 1FRNA 1S8AA 4KO2S 5IEBA 3WDLA 4A6XA 2ZR7A 1KXJA 3KJZA 4XYBA 1VI5A 1FNNA 3T1VA 1U2DC 3R77A 3O5AA 3N2YA 4H27A 3CBQA 1KFCB 4IGKA 4L0QA 3QU9A 4B81A 2GCNA 1UFVA 3G5LA 2VUSA 2GN8A 1U2DA 3QEJA 5EE5B 5HTOA 1IZYA 1F0NA 3EZYA 2Q7DA 1GUZA 2P11A 3D1JA 1SZJG 3FKJA 3NWEA 1RYDA 1T3GA 1J56A 2HHAA 4ND1A 4JDPA 4NONA 5KI6A 4ARBA 5KYTA 4H31A 2ZQZA 5KJEA 1P3DA 1CFJA 1P4HA 3DEFA 4BN4A 1SQFA 2I7DA 4LFAB 1NQ5A 2EGGA 2IYPA 1QONA 2OCBA 3CNQS 3MS7A 2XQGA 5L95A 3WTCA 1O97C 1SG0A 2YWEA 3FUUA 5F51A 4ZTZB 2CNNA 5HIIA 3OOYA 2O8BB 2O5RA 2B21A 3DEIA 2PYIA 4PPQA 3AB8A 3GY0A 2IDMA 3F98A 3IT2A 1ZPDA 1F48A 1UPCA 1AQIA 1Z5UA 2VRNA 2XW6A 1M1YE 1LI4A 1NQWA 4WKNA 4NAHA 3KQSA 1CHNA 3UFBA 3C3AA 3NP7A 4FFBA 4HK4A 4UTNA 5K8LA 4JXZA 3ST7A 4US1R 3KWMA 4WUVA 4AAYA 3QWHA 1GNSA 4CEIB 3W79A 2GJKA 2VCEA 2FZKA 5DTIA 1JKMA 2WYIA 3EWNA 4TZ6A 1ZM4A 1HI9A 4QKQA 2KE5A 4GGPA 4QDOA 2C2ZA 4C30A 4GPIB 4I9FA 3FUWA 4AF7A 2I6UA 3INYA 4EQ6A 2JGDB 2QORA 2WTUA 2WJHA 2UU9B 1PK9A 4NBTA 3TB6A 2I4RA 2JAOA 2IHVA 3HDGA 2ZB3A 1F2UB 4DIDA 1N3BA 3CWZA 3QV2A 2VDRB 2BCEA 4QVGA 5DIFA 4CU2A 3U7GA 5EY5B 3C4JA 1X7YA 1RHJA 2W4IA 3RASA 1JLRA 1L5MA 1OV4A 3ENKA 3TX2A 1Z8DA 2CXSA 3OLWA 2JGIA 3MCZA 1Z29A 5C4IA 4Q1AA 3H5IA 2P4UA 3GRVA 4EMUA 2WINI 5EZ6B 4JP2A 1Y3DE 5HQ3A 2ROQA 2G1KA 3AP3A 1EJ6A 4ARUA 3RYTC 2QD1A 3FTFA 4O4HB 3EH2A 2EP7A 1NW5A 2BFAA 3L7OA 4IIHA 1C9JA 1UZAA 2IHZA 4HDRB 3SR3A 4P31A 1D03A 1J8VA 1G6KA 1TYBE 2LWIA 3HE3A 1JH9A 3BD8A 3QE2A 4PIVA 2JCBA 3ZX5A 2QY6A 4FT4A 2V74B 4GC5A 1EDDA 2W4MA 3M9WA 2G72A 4ZA2A 3WNQA 4DCJA 5KHLB 2VYND 3I58A 2PO7A 1DDGA 4O4JA 3ACDA 2BGIA 1Z16A 1U3GA 2FMIA 5CLHA 4IW3B 3UM9A 3FZQA 2OSVA 4LX8A 3UWOA 1M3SA 4DCSA 3KAJA 2KMLA 2PX6A 1DLJA 1EVEA 2VBFA 2QMZA 3CNBA 1VHWA 4OHOA 4F46A 3J7AC 1X3SA 2E4XA 2IYOA 1M75A 2A88A 2GM9A 4Y0VA 1Q0UA 5KREA 5CK4A 1R0RE 1AN9A 5SYAA 1I7NA 3PKZA 4NYJR 1G8SA 1J1IA 5K3CA 4Y9RA 1JDVA 1E5XA 1GFSA 1D8AA 2R11A 2RJ3A 1NMZA 3NVDA 3PSHA 3ZR4B 1G3IA 4BWGA 1AO3A 3QBJA 4MB2A 3PNYA 2WYOA 3AB7A 3HFRA 2ZJOA 3S8EA 3A0RB 2IXGA 3FYDA 4IVQA 1F6DA 2VDKB 2H4ZA 1ISJA 3N05A 3UAWA 2NSHA 4FKMA 5EMNA 2HJRA 3OEHA 1LK5A 2IKSA 1DI0A 2AZ4A 2VRCA 3E5NA 5B55A 4IVPA 4AB1A 2GLXA 5ADVA 1FDRA 3BHMA 2QBYA 1J0CA 3U7FB 3ZKWB 3G13A 3RS3A 2PUGA 3EOAI 3AFIA 4I4TB 3S2IA 1COWA 1HOTA 5K0FA 1UFQA 3HYCA 2F90A 3LL7A 1OF1A 4A6PA 4I5EA 4E5SA 1D0SA 4ZO9A 3VOBA 3ESZA 5IKXA 1GTL1 3O8OA 3U62A 2HJVA 3SR4A 4YFVA 1KKUA 2NZVG 3UMJA 4RD4A 5DWDA 4GYJA 1U5BB 2WG2A 1I0LA 3O8RA 4HSGA 1C8VB 1OFUX 2BGLA 2ZI3A 3H13A 1MFPA 4HR7A 2R79A 4BVJA 1IJKA 4GX1A 4RMNA 1HDZA 3T5PA 1WMBA 2QIPA 2E4YA 2X3UA 3IUNA 1YS4A 4G2TA 4GWLA 4UUMA 3L8GA 2YC2C 3RODA 1CQJB 3LBAA 2A5FA 3V4LA 2BDUA 2P5TB 4M0FA 1ZRHA 3KIPA 4LZPA 4M1WA 2X1VA 3AW8A 8MHTA 3ESXA 3U9TA 1G3MA 1UPFA 4KIWA 2CY0A 5K4HA 4O2AF 3GLTA 4Q9IA 3IP3A 3GLGA 1W5TA 3VA7A 2O1XA 4X85A 4L08A 3UIEA 4RZIA 3TNFA 3B48A 4MULA 4DPMA 4QFMA 2EV9A 2FWNA 4BMDA 2Z6UA 4R83A 4IHQA 4B46A 4K81B 3FSEA 4RVNA 5EYPA 4UUOA 1R37A 3S70A 4CTJA 2EHDA 3AEXA 5TPWB 3KETA 1XD9A 4RE6A 1U1EA 4X6UA 2E3JA 2ZPAA 4Q02A 3ODPA 5JAZA 3CMMA 1UINA 5C31A 1LS6A 1MVOA 1NYTA 2AA3A 3X1YA 1N8SA 2EF1A 2VTKA 1E1CB 2QD5A 2ODAA 4QREA 4PN7A 4X8LA 4IDPA 5TY0A 4BY9E 4YCSA 2IS1A 1FXUA 3BTVA 2JZNA 1F5SA 1NQXA 1GTG1 1NT2A 1ZMBA 3ZE2B 2B78A 5JNTA 5AQEA 1PFQA 3BERA 2PS0A 2Y1XA 1CPYA 1XN4A 3D8NA 2R6GA 4YT8A 3H6HA 1SU6A 2CLHB 4YRPA 1C7ZA 2P7IA 4UBLA 1P7VA 3BGIA 2O8BA 2BP7A 5FWAA 5DNYB 2FMXA 3D8SA 4B7CA 2X0IA 2E4VA 8AT1A 1Y7HA 4V3CA 1LI7A 1WEKA 4G23A 1XK6A 5EJ2A 5HSGA 1LPPA 2J6BA 5DPMA 2H6EA 4EB8A 4QM6A 1EMDA 2PR2A 3I83A 5A5EA 5FXMA 2XX3A 1KAQA 2PT6A 1AN0A 1E0SA 2BKAA 3ET4A 2LR0A 3L7NA 4W6QA 2ZYHA 4CEIA 3UGKA 2AQIA 3PV0A 2HC9A 4OM8A 4DLRA 5B64A 2Q28A 5KOJB 2GEBA 3DXFA 1YULA 5CVUA 4M0MA 1ABFA 2PUHA 1EDEA 4P84A 5E2AA 1KDPA 3DTNA 2JGDA 4E51A 5CG2A 3AK4A 3DHYA 3H5VA 3PPYA 2XQIA 5LP6F 2IZ6A 1U7OA 1TK3A 5DNDA 4MH0R 5FI3A 1GQOA 1X1CA 3JASB 4CKBA 2IT1A 2W43A 5HGXA 3L04A 2ZUTA 3BFXA 3DZKA 3I1IA 1DZ3A 2XOKD 4HH3C 4LZAA 4QYXA 4Z0TA 4JSYA 3UVEA 4MRVA 2BM0A 2QN9A 1W94A 3R9XA 1T5HX 4B9AA 1M34E 1E62A 1R00A 2RBGA 1UXJA 2APJA 1W5FA 3AHFA 3EK2A 3KTOA 4B6JA 2ZT7A 5LOVF 3ZZNA 3NKLA 3TIGA 1BS1A 1DX9A 4XTCS 4LQ4A 4ZJPA 3SLKA 3X1KA 3G2NA 2I1LA 5I7VA 1NLUA 4HDRA 2ZXUA 2JH3A 2Z3WA 1JBQA 3MILA 1POXA 2UZAA 1FRQA 2C98A 5FUMA 1ST3A 2JKVA 3FA2A 4BZXA 1E3TA 1YQTA 3B6EA 5L3QA 5HUHA 4EBBA 1G4AE 2XOEA 5IKOA 1R5JA 4OJTA 1T0UA 2IOFK 4ERNA 2V55B 4ID3A 3HA3A 4NDAA 1C0KA 3JD2A 3LW8A 1GPLA 3JAKB 4QUHA 3VRHA 4BJ3A 1T1JA 4EPXA 2FDRA 1MW8X 3R7DA 3JYPA 3RR2A 1R4NB 5KVVA 3CF4A 4WBSA 1SKYB 4ROTA 5JYBA 1Z6GA 2IZ1A 4O5AA 4QICA 5F2EA 4CTNA 1AUVA 3TRKA 1Y9EA 3I5UA 1I6LA 1GZHB 2VUIB 1KEZA 1JR3D 3TTXA 4CRWB 3O82A 2WJVA 1P4AA 4EUEA 3VO1A 5A6VA 1KAGA 3UAYA 1WOMA 1EGQA 1Q44A 3TAXA 4RKYA 1L3BA 1YRAA 3SICE 3K70B 1TMGE 3K4PA 1T15A 1H69A 4PZEA 2X41A 3QH4A 4PLCA 1J00A 2D1SA 5HXAA 4HJRA 1E64A 3N0VA 3SZUA 3RE1A 1CFZA 5HVNA 3MWEB 1OLOA 3TQIA 4L2IB 3UB4A 4YRGA 4Q12A 3ZKWA 3EPHA 1K97A 1QGDA 1ZUWA 2ZT5A 3NBYC 4H6XA 1ZQ9A 3N0WA 3G1WA 3Q7EA 4I4TA 4LRTB 3L4KA 2TMKA 1G59A 4R2HA 2ZIWB 3E48A 2GKGA 4N1AA 5JMWA 3ZBTA 1UKZA 1XHEA 2V5AA 3UYLA 2IXTA 4AO8A 5BWBA 2WHPA 3NRCA 5JSFA 4CPDA 4MP3A 1VHLA 1E94E 3EMVA 3C8HA 4IRUB 4IS3A 4NI5A 5C7IO 10MHA 2C20A 3UCXA 5B6PA 3W1VA 5IDQA 2V8BA 5LIPA 1IVNA 1NVBA 4R8SA 1ADFA 2HSEA 3ZD6A 1SBCA 2J3DA 3K0EA 5AJVB 3EVCA 1CQJA 3INGA 4D7AA 2OBNA 3QY0A 5J23A 5L3ZA 4QRHA 1EVYA 2YQZA 3BM5A 4AZWA 1W9HA 4LOHA 1DZIA 3QG1A 2MCFA 3OETA 1KH2A 1VZ2A 2HJHA 2OBFA 4Q00A 3UHFA 2O7NA 2FSVC 1YBMA 5DYTA 4UTVA 2VNIA 1MJNA 4Z0NA 3VR6A 4LYJA 1ENOA 1UWVA 5KNLA 1FSGA 1YZFA 1ZKMA 2FSVA 1K75A 3NPAA 4PCAA 5CTJA 4P6VF 1QJ4A 3UA3A 1E92A 3MLAA 1C1YA 5TPWA 1XQYA 1E7YA 3GEMA 1D3AA 1EFCA 3HJGA 2JA1A 3KB2A 2PMKA 3SBEA 2CV0A 4JZKA 2SKEA 4JD5A 1A27A 4ZV7A 3R9KA 1N2XA 4D3ZA 3EEIA 3BIXA 1CIPA 6Q21A 2FXVA 4YJ3B 1TJ4A 1OC4A 2VPXA 1QIFA 4FEGA 2P3LA 4YR9A 1ZIOA 2GVNA 2I1QA 4A92A 1YL7A 4L5YA 4CF7A 3L7MA 4O29A 3T9EA 4V0QA 3TLMA 1GT91 5G40A 1QU3A 3UEOA 1KYZA 2EJCA 2IF0A 4JIMA 4ZCIA 4N8SA 5DN9A 3TL2A 5JNWA 4OAPA 2ZSUA 2QMOA 1XEAA 3VV3A 1ABEA 1C9NA 4CIBA 5BSUA 2JCVA 1SR8A 4EKDA 5MGBA 4M1SA 3FSGA 4B35A 1RU3A 3KC2A 4BO2A 4DLPA 3FTCA 2IU0A 4RV5A 2FK7A 1C0PA 4G9BA 1EP9A 5CB6A 1BMFA 5FLEX 2WTXA 1G5PA 2CFCA 1F7UA 3FCAA 2Z0MA 2OPBA 3NALA 3PX3A 5BURA 1F2VA 1U7UA 2JGRA 2V8OA 3C6YA 1GO2A 4ZQHA 2Q5IA 2PSEA 1Z56C 1KY2A 2C04A 3NEAA 5DXJA 2NZ8A 3VVCA 4NCJA 2Q3EA 2YMMA 2WSIA 3WI7A 2QQGA 3O47A 2BE9A 2IYVA 4LVCA 1IAVA 2R44A 2ZSFA 3HDYA 3I5AA 3DD5A 4FYYA 1TQDA 4GFDA 4KQKA 2VDLB 2ZVDA 3D02A 2PUBA 4YRBA 4X44A 5EWJB 1AQNA 4EKIA 2I91A 1WMEA 5FT9A 1BRTA 2ZIAA 3F6EX 2GFQA 4Z4CA 4DMFA 1MTOA 1QGED 3HCRA 2A9JA 3R4VA 4KDCA 2CKDA 1JMVA 4UVGA 1WU7A 3MTAA 1UPUA 5J1SB 3ON5A 4LDNA 3JASA 4DCOA 3CZCA 2B8TA 3ZVMA 3QPUA 1PQPA 5CFQA 1LCIA 1TMKA 1TT7A 4C4OA 1V41E 2CXRA 2VP3A 1DAGA 1Q1EA 3ZKAA 4A2QA 4GI1A 4KITB 4RAQA 3IP5A 1NVGA 2FJPA 5JNVA 5LQMA 1NBIA 2ZAOA 3R8CA 1UT5A 3WLRA 2R60A 4BEBA 3KSMA 4RFVA 2HW8A 2IA5A 2Y1KA 5JDCA 4LHYA 2HDHA 4H3HB 3TRFA 1W19A 2QMEA 1ZBQA 4JBXA 2GAJA 3UZUA 3V55A 3G2HA 4IJUA 4PG5A 5K0TA 4PIMA 3KD3A 2L69A 5A1JA 1WMAA 4RU1A 4U8HA 5JQGA 3FWHA 1P2BA 3GAFA 1Z0FA 4B44A 1AF7A 1K3TA 4MKXA 4YMUA 1B43A 3SN6A 3N6VA 4NL4H 5B1EA 1VJGA 1P7PA 4AJ2A 4MB0A 2A0FA 2CVZA 2IS2A 1WR8A 2I4IA 4FW8A 4WY5A 1S8NA 2B30A 3JAKA 4HN9A 4JNKA 2HPZA 1CULC 3S1AB 2OHHA 1R4NA 4OB6A 3IVAA 5FH9A 3STYA 2QAGB 4B85A 1VIYA 2Q3MA 3K70D 1Z6XA 1MO4A 1R5OA 2Y71A 2Z1DA 3IP6A 3QM1A 4PO3X 2XNKA 4BMZA 3QE4A 2PRKA 2NTEA 2P62A 3RO7A 1LY1A 2FSHA 4P9NA 5C5IA 1QG0A 3REQB 3G5TA 3LUPA 2RGRA 5I47A 1A2QA 1I13A 5FNZA 1G3QA 1UZMA 4S0ZA 4B84A 4BDSA 2OV1A 2YJNA 3I9NA 2KS6A 1ZJ5A 4MMYB 3W9YA 1RAHA 3VHQA 1QP0A 3SIXA 5EXEA 3THSA 1COZA 3WNZA 3N8GA 4FLMA 4M38A 2ZTSA 3MWEA 1X7HA 3WFZA 5LLSA 1ORRA 1J70A 5CCBA 2QBYB 3K5WA 4B3TB 1SUFA 5E0KB 4PQEA 2VR1A 1NXVA 5BN1A 2QXTA 1VL6A 5LLTA 3N76A 1DKUA 4BX8A 1XAIA 1HDGO 3IO3A 4BUJA 2O8EB 3R3SA 2FFBA 4QUGA 2P75A 2EWMA 2UZIR 1ZAYA 2FFAA 2V7WA 4BWVA 3KG2A 1CY6A 1GQSA 2GMWA 2ZULA 4LYYA 4MMXB 1QMGA 5FTJA 3NAZA 1KYYA 2WWYA 1RZRA 2J07A 4KDEA 4G9EA 4TLCA 5D3MB 5K20A 3AVYA 1H5UA 3R3HA 3HWX1 4IJWA 4ZIRB 1PT8A 1C30B 4MITA 3USZA 2PX5A 1KK1A 1VKRA 4Q66C 4ZRMA 4FHZA 4A6EA 3SZOA 3GJYA 2XRMA 4ZT4A 1A9XB 2XZLA 3MTJA 1N6IA 1E6KA 2ZRKA 4MEJA 1AV6A 5LKAA 4LYAA 2QV0A 3FGPA 1GUYA 4XGQA 3RVKA 3M6VA 5A5GA 3U56A 2Q4RA 4TRNA 2VL7A 3Q88A 5DE3A 1H2EA 2Q45A 5EE3A 2R62A 2BIFA 5AK6A 2HQSA 3SFVA 1N0HA 3C24A 2Q5HA 5BXQC 5BNTA 2FKNA 1P18A 1SAYA 3PXDA 5ALQA 4DDUA 3GGDA 5C35A 5MN4A 4MARA 1O9BA 5F5NA 2ZJ0A 3R8FA 4JYAB 3IRUA 4D42A 3AVVA 3SDBA 4KEAA 1VG9B 5CLQA 1XXHE 2EIXA 3Q98A 1DKOA 3OZDA 1PNQA 5IT0A 2JEYA 5I3CA 1PD0A 2BR4A 4IQ4A 3I5YA 3DE2X 3R0IA 4MWBA 2FN8A 1WXFA 4HQOA 3CU5A 3AWDA 2I3ZA 3IVCA 4MPRA 4TN1A 4WXRA 2BGWA 4D9NA 1IUKA 2KBFA 3G9ZA 1RS0A 1YTLA 1DCKA 4BX0A 3AHEA 3R3YA 2OD9A 7GPBA 4KE9A 2X15A 5K99A 1KDTA 3FYSA 3PQ2A 2TMDA 5KYUB 1P17A 3ZVNA 1ECPA 2GYUA 3FCCA 1L4NA 3SVZA 4UQLA 2HTFA 3H9BA 3MN1A 3T06B 1HE1C 4TL8A 4J91A 2W48A 3VISA 2G1JA 1VP3A 3P45A 2FPRA 3KALA 4D0RA 3TTYA 3RB8A 1JECA 16PKA 1ADGA 1XKLA 3KFXA 1X39A 2J87A 1W2GA 2F1KA 4JROA 3RU7A 5LQSA 2H9IA 2FWMX 1ND5A 5ULLA 3FPGA 2BC9A 2ZB8A 3RHFA 2JGFA 5JNRA 5KSYA 1I7PA 1E3QA 1K6JA 1Z7YA 2FMHA 3HFJA 5EMHA 2DPYA 4KNWA 3RIHA 1E5DA 5TV2A 1NY5A 2OILA 2YZNA 3LT2A 3U7EB 4GUDA 4I5DA 4Y2QA 4B6GA 1PKXA 1Z4LA 1E96A 5F9FA 3AY7A 1EZ1A 1C81A 3DDNA 1UDWA 4BYMA 1DWQA 2W98A 1Q0TA 2UUOA 3H1FA 4RENA 4MHTA 2C4TA 4FDTA 1NDQA 3FZGA 3GDOA 1Z07A 3Q10A 4I6JA 4DEXA 1VE9A 3JYHA 4OCZA 5K0ZA 5GPBA 3T4UA 1PJAA 2Z1MA 3DR3A 2QMUA 2VH5R 4RZ2A 3VH2A 2BH2A 3CNEA 1QG6A 3M6WA 1M1UA 3E70C 1I6MA 1MC1A 1LRJA 2X7XA 1C1DB 1HDEA 4DLYA 4DSOA 3Q0EA 3FOEC 4NFSA 1EX1A 3ZIUA 1HO3A 5FEUA 4FE7A 3EXG1 4PHCA 2XBMA 3EIFA 3FYCA 1TLFA 3HJAA 3SC2B 2EJWA 3OTWA 4LMBA 3UA4A 1U2GC 1YIDA 3G89A 1SBIA 5DHPA 5H3LA 3LC1O 3U4HA 1P6QA 3TW0A 5LR6A 5IK2D 1J99A 3GUZA 1DC7A 1IBKB 3R20A 2IH2A 2VPPA 3B5EA 1W4BA 1U2GA 1YKFA 3B20A 1UM9B 2MR5A 4U2KA 1SWWA 5I9MA 3TIXB 1Z25A 2CLFB 2PZAA 1JHZA 1T3SA 2AE2A 2VHJA 4HQLA 5B53A 3MA0A 1HLGA 2BI7A 2FF5A 1SU7A 3GGGA 4YROA 2YVKA 4MNTA 4OXQA 1KZHA 3SF8B 3O8QB 4A5SA 2BJHA 4AL4A 4UE2A 4ZZIA 5CB4F 2JFWA 5KB3A 1C3LA 2HWYA 3K9FC 5L4NA 4AKGA 5AVWA 3GJSA 4HRVA 4R0NA 4ZAWA 2QAGC 2ZSIA 1NM5C 2P27A 4ZFNA 2Y6VA 2PXCA 5T4BA 3S1AA 4ER0A 4F4UA 4ZVSA 2NMVA 3TE6A 1U2PA 2QAGA 2XDQB 3HRHA 4L57A 2WT9A 1KYWA 3H05A 5JTUA 1NM5A 3O2NA 4UCXA 3RIEA 1UPAA 4JY7A 5ESXA 1NC1A 3V4PB 4EMSA 4HFMA 4AY5A 4FS3A 1MAUA 1NBME 1RQ2A 3A2MA 5FUYA 5AJHA 3REQA 5EMLA 1YONA 2OZEA 2D5CA 2Y0PA 4NS4A 3V2UA 5BQFA 1TAUA 2B5OA 1GPNA 1W25A 2Z9DA 5FBLB 3PDUA 4ZWNA 2PKWA 4N12A 2QD3A 1KE1A 3WHPA 4B2PA 4F6RA 2WHQA 1WULS 1UMKA 4K0KB 1QX4A 3DWFA 2NSJA 4FLFA 2HJGA 3B6MA 1RBQA 2QZZA 2VNSA 5BT9A 1SUIA 2H4JA 4FBGA 4GG1A 2P4QA 4K2AA 4LWOA 4OYRA 2XNDA 4WUTA 3OJ0A 4RQUA 4JI1B 3V1NA 1N9GB 5KMGB 1YKSA 2HLNA 1GZ3A 3T7JA 2FSUA 1P9LA 3GJQA 3HSYA 3UJ8A 1G5IA 2QLJA 2O8EA 1T6BY 4HB3A 3OZFA 1K8YB 2PGXA 3FE2A 4RX1A 3GG2A 3ZWDA 4KGVA 1D4OA 3EISA 3NAGA 5K9ZA 2E2WA 4RDXA 3KQLA 3SZGA 1GYPA 1OI4A 2LIVA 5C0OE 3L4SO 4K9MA 2WFLB 1E1DA 1I8TA 4WLOA 5JEDA 1JLLA 3UN1A 4O4JF 1HC7A 5AUNB 5BNWA 1MJ5A 2DKOA 3IC5A 4ZIRA 4QLAA 3WR5A 5EJIA 4DSZA 1C30A 3A1WA 5IVDA 3THXB 3BKWA 3Q7TA 1IN1A 4Z0PA 5CX1A 4CM1A 1IUNA 1ZC4A 2VUHB 4U39A 2NYRA 5KYWB 1G19A 4MYRA 3O1IC 1T5DX 5JQWA 1U2EA 5CFRA 1FF9A 5I5GA 4B83A 4MDEA 1Z37A 3RAPR 1T91A 3KDPA 4BGIA 1M9NA 1Y6RA 3Q4GA 3T38A 3RFUA 4AJPA 3QEMB 1SCJA 1HEYA 2EXXA 3D5QA 1SCDA 1UIRA 2FN4A 3H1TA 4AZVA 5T41A 3DLHA 3GPCA 1N5LA 3LUCA 1YJAA 1KBQA 5AKIA 1KTIA 1AKNA 3E2PA 1N2HA 2NUTB 3EDQA 3UH1A 1NQVA 5CVCA 1F06A 4CV0A 3GXBA 2I9KA 2V0GA 1CE8A 4H2DA 4IZ6A 3N9IA 1C2TA 4K88A 3Q1LA 5ALZA 1M6EX 1KJQA 1ZY2A 1A96A 3BB3A 3KU1A 3MTDA 2BGNA 5FL7A 4A36A 1DJMA 2OCGA 1ZD9A 4BO5A 1SZDA 3N53A 5JU6A 4OSPA 1BZYA 3QVGA 4EG6A 1WXXA 3IQIX 5A5FA 1NG1A 3N2IA 4AC9A 3JQPA 5KYUA 3CIFA 4AM8A 4KR3A 2GN9A 2R25B 1IOVA 3F67A 2IYEA 4HAZA 2J67A 5K3FB 1QHNA 1I0ZA 3O3OB 1GQYA 3DZDA 1TTPB 3DUFB 1KNQA 3HJHA 1AKVA 4W8HA 4WZZA 1KS2A 3HL4A 2WZBA 2PUTA 3JQDA 5ALLA 1KZYC 1YZHA 3JVIA 4CXMA 2EJUA 2PLFA 6LDHA 3CH7A 5JIBA 5J4LA 3CB2A 4NBUA 5AM1A 3TQFA 1HNZB 2FEXA 4NLLA 4KXNA 4KZKA 4YV7A 3TRIA 3TTSA 4LGMA 1OREA 5JWOA 2FDCA 4TT3D 5J4VA 4WJLA 4Y7CA 1QRRA 2IODA 1AO0A 1M6NA 2E4AA 2R2GA 3X2FA 3W2TA 3VC7A 1BEEA 5EE1A 1L9KA 3AILA 1EVKA 4QXMA 5EVCA 4UU8A 4Q9DA 1QZ3A 2AOWA 1JEYA 1E79D 1QO0A 1RACA 2G1PA 1RFLA 2FFRA 1EAYA 2GK7A 3DVSX 1P6XA 3QKSB 4LGYA 1FMCA 3URMA 3N39C 3QA3E 5LIRA 1AZLA 3ENQA 1C1DA 2QN8A 1DQZA 2OXCA 4U7GA 2E5WA 3EGOA 3HLYA 2PBRA 4AJ9A 4BLVA 3TUZC 3KTDA 3U13A 3T6KA 3ILXA 5JJLA 4OX9Y 3SC2A 1X86B 1EZ4A 5ILQA 1S3SA 3TQOA 1QHHB 4D4HA 721PA 3THWB 5TQ2B 3N75A 3QBVA 1L8AA 4EB0A 3ZTYA 3L84A 2DYKA 5TGTA 1IEVA 3OIGA 5FA6A 4GVPA 4BQQA 1WY5A 4UUQA 2IGTA 4BZWA 3PCRB 4BVLA 5JBQA 3GF4A 3PQ8A 1M76A 2OD7A 4M86A 1XVAA 5JDIC 2H2HA 3SBOA 2PX0A 2WABA 4EGAA 3T5CA 3SF8A 3O8QA 5T64A 1Q91A 7ABPA 2EYQA 2JFXA 5JDIA 3NCHA 1A4RA 1ORWA 3Q7IA 5KX5B 3GYGA 4HEQA 5FHRA 3EDCA 4TSKA 5JS2A 3KE8A 3MGBA 4ZCQA 3BMOA 3HH8A 3ANSA 4B3JA 1ZN8A 4B4KA 3RVQA 2A1TS 5MFZA 2GAAA 3WZ2A 5E95A 1SUCA 4WXPA 2O14A 2RARA 2AR0A 3BTSA 4HEA6 4N7JA 4P4SA 5DW0A 3ZDXB 2QVGA 5BMVB 3FRJA 1QK5A 1VIMA 1W1WA 1BROA 1Y7TA 1KETA 1J8FA 4DKJA 3LWZA 3K1ZA 3LDAA 4BNYA 4R2LA 5IJAA 5JBIA 2JFQA 3IHWA 3WDKA 2IELA 2C31A 1TZMA 2P67A 1OBHA 3AG5A 4HLUC 5ALNA 3TIIA 2UVQA 4WNAA 1K3FA 4NCNA 3WKDA 5JWRA 4JBIA 4HLUA 3R0JA 1EEXB 1N9GA 2ZZNA 1K5PA 1ORDA 3D3NA 1YH3A 1L5LA 2XEXA 3STTA 3R7BA 3KLMX 1JIQA 4B71A 1MPXA 1UC9A 1EBBA 1X0XA 1AUOA 3GA5A 5M3BA 3TFWA 1KEVA 2OR3A 3PRYA 1OR8A 1VJCA 3UHPA 1DRKA 3BUSA 5G4KA 4IQ8A 3FXAA 4PQYA 3T3OA 4IDQA 3VBEA 5I7FA 2G9QA 1UZUA 3B3FA 3IOMA 4DDHA 1OT5A 1R0SA 3AM1A 1N75A 3RPEA 4BECA 4S1WA 4EVRA 1Y63A 1EFUA 4IOKA 3EVFA 3EUEA 1QHIA 2DHCA 1M0TA 3HN2A 1M73E 4IGFA 2I6QA 3BXHA 3RROA 2CNLA 3A9UA 3THXA 5AKXA 1U6IA 1TFUA 2WIDA 3MBIA 1YV9A 2CK3D 4C4PA 3DE5X 1CR0A 1AUXA 2ZTHA 1M6VB 4CKWB 1CUZA 3DGFC 4W1QA 5KYWA 2EU8A 3PXEA 2QGFA 3DZIA 3MIZA 1IM5A 2CBZA 1WKVA 1NV8A 2EKBA 1YR8A 2O8VA 4ZYXA 5IXJA 1QUEA 5AT1A 3Q3CA 1GG5A 4EPVA 4M8NE 3O26A 5LSAA 2M1XA 3QEMA 4HDAA 2J8ZA 4NJMA 5U1PA 3AJ8A 1JHVA 1QGUA 1J7KA 5HJ5A 3NBZC 3UBMA 1OHHD 1E63A 2IYUA 4MUJA 5JNUA 2WVAA 4ENWA 4EF4A 1R8QA 2I3AA 3JW8A 4R2JA 3PLAE 1N32B 1G1AA 1TRHA 4EZIA 1AG9A 3L01A 2FW7A 5ALHA 4ZREA 2NUTA 3H8WA 5AICA 3UT0A 4KYUA 4QAJA 3B1WA 4E0BA 4EFLA 5IH7A 4GZMA 2M6SA 3FMOB 5BSGA 1YRHA 3ESRA 5SZKB 1UMDB 1U0RA 2YJZA 2WF8A 4WBNA 1HFJA 1NUAA 4RKWA 4C4XA 3L06A 2PANA 1YCHA 3ETEA 1JHMA 4F3KA 4ZDKA 5HR5A 2BUCA 2Q5JA 4I4TF 5I4BA 4HTAA 2NAPA 5EMKA 2WYVA 1V3TA 2H1VA 3JWIA 4DY4A 2C5FA 4UD2A 5CDHA 4ZQEA 4XARA 3L7YA 1TIBA 4MQMA 3DF7A 4RGVA 3VDXA 621PA 1O3YA 2F59A 4JJGA 3PHBE 2Q0HA 2GAIA 3PHLA 3EDMA 4MUEA 5DVZA 5LZ7A 4YACA 4BFZA 1W34A 2OAGA 2V5UA 3NNSA 3A1EA 1F51E 1K7YA 1VPVA 1AGPA 2RHCA 2ACWA 3FMPB 3H0EA 5DHQA 3WYFA 4X20B 5TQ2A 1UC4B 1JSLA 1XV5A 3KSZO 4BNTA 5HYVA 4HRXA 3EXHB 4JUDX 2CNWA 3AIMA 4ZCMA 5T7BA 3L77A 4LEIA 4PRKA 3T7DA 4Z3KA 1SKAA 4BJ5A 4NXMB 1PR6A 4DLAA 3UHAA 3AQIA 2H1CA 4U63A 4KPGA 1B23P 2FQ1A 3BSSA 3BWEA 2PUJA 4X61A 1XAJA 5HDBB 3IBFA 5EKXA 4QOFA 1M2NA 2DLDA 2X5JO 1VIAA 2O7QA 2AOTB 5EE0A 5E9AA 4OTZA 2WK1A 4BGEA 4EEKA 3NBUA 2CHVA 3I01A 1Y8CA 1WUKS 4AROA 2XWBF 5AVSA 1JFVA 4RS4A 1IG3A 1N6RA 3CINA 1JU4A 2FW8A 3TGLA 2VT6A 3FIJA 4MQBA 4N9WA 1QWSA 2R8ZA 2HTEA 4RXMA 4BQSA 4QD3A 1R6UA 5IVIA 5ARBA 1KERA 4CLXA 4EARA 1MC5A 3A37A 1CK4A 2ATEA 3A7EA 3AETA 1TQHA 4I1RA 5K0LA 1RI3A 1N3IA 1QHHA 1TJ5A 2H9AA 3BTOA 3NORA 4ZQBA 4ZCLA 4ZAGA 4ZO6A 5F23A 2PJUA 1WSWA 4DREA 5HEKA 1JQJC 1VPTA 1WCXA 1A8PA 1O5TA 2DR3A 3G68A 4C0WA 4OH7A 1Z74A 4REOA 4Y9SA 3H2SA 4MYHA 1ZM2A 1QLHA 4Z8XA 4L0CA 1J7JA 1TUBA 2HRQA 3HZHA 1JB9A 1DFHA 5HF8A 1L7DA 2XTAA 3FNIA 4ZU6X 1PV4A 5A2QA 2X14A 2YXNA 5HM6A 2B61A 2BEUB 1PEKE 1J9ZA 4C0HA 4F3TA 4JX9A 1QIGA 2YY5A 4TRMA 4GPEA 4G5OA 4JHXA 4E88A 1V8BA 3ZQ4A 2ZBQA 8LDHA 3BF7A 3A4LA 4N0QA 2H1WA 4MGHA 5HZGA 1QH1B 3CRQA 1N1EA 2ZRPA 3IHKA 3CLKA 1VSTA 3COYA 4FDAA 4H0NA 3LKVA 4MCJA 1HTTA 2CXTA 2PUWA 1CERA 5BMVA 2NV0A 1GR0A 3RCBA 1OWLA 4OXNA 2JIZA 5K3DA 4AK9A 5ES3A 4X90A 4U2EA 2FOIA 3DULA 3RFTA 3B53X 2BW0A 5JECA 3AM4A 1KEEB 1UCFA 3PVZA 2ERYA 3IKMB 1OX4B 3CJRA 1XB2A 3EGDB 1Z4PX 2Q9UA 3M5DA 4PCVA 4WT7A 5AIBA 1R9JA 4GPBA 5KTYA 1RHRA 5K0JA 3HNPA 3KDSE 4XGKA 3HDVA 2ZUDA 4YR7A 5KDLA 3P5BA 1VHTA 2KW5A 1R9GA 4YJ2B 1KS9A 1IWBB 3JD3A 2EOAA 3QVSA 2CL5A 1NONA 3HKBA 1X0VA 3OM9A 3KKEA 1YS9A 1ORIA 4ZYWA 2A9KA 2Y0DA 3A06A 1BYIA 1G291 3MIIA 4C0AC 2ZCJA 1GL7A 3FF4A 1YDWA 2YDXA 2HMSA 3QVKA 4AYWA 4FILA 4TVOA 4J2HA 4BPBA 3OJLA 2QHXA 4TQUS 3TO5A 4HS4A 2WMYA 2EKLA 5BWNA 5C4MA 2WTEA 2C7GA 2B8WA 1E3LA 5JQGF 1NLZA 2Q7OE 5IEJA 3WSVA 1TKRA 1I80A 2WF7A 2YBDA 1E0KA 2DQYA 4K1XA 4LF5B 2WV7A 3GV0A 4UVEA 3W77A 1SFRA 2PU5A 2PR7A 1JT9A 1MTZA 3FNRA 2B3TA 4H77A 1YJQA 2KLHA 4I4NA 4XX0B 1S8OA 1M6VA 3IL2A 4D57A 5FO0A 4CKWA 5K3OA 3LKDA 1EXVA 2XMBA 1CC1S 1AS0A 1GFZA 5DOVA 1NAIA 2OC4A 3M1AA 4BMYA 3NHLA 5FADA 2D5BA 4L73A 3HI4A 2VRWA 3K1AB 2ZROA 4FHFA 3EPPA 1LTQA 3ESDA 1SPXA 3PG5A 4HV4A 3GCZA 1YGYA 1GPMA 2IEBA 5EUMA 4QVKA 2ATXA 2AMFA 4QODA 1IRXA 1DCFA 2VSXA 1MZPA 2PBFA 2B9VA 4N0EA 4BP1A 2VYFA 1C7QA 1V8PA 2FWJA 3C14C 5FYQA 4UPEA 3M4YA 2IV7A 3ZWPA 1MLDA 3FVVA 4YAEA 5IH3A 4NCXA 1KQOA 3FNBA 3IE2A 4BMVA 1OYOA 4L15A 4C0SA 2A5LA 4QPJC 4WLUA 4A2WA 4FFVA 5A4FS 1UMDA 3KQKA 1I10A 2BTQA 3EEYA 3COJA 2OGZA 3J80A 5KAMA 1GWNA 1DRVA 3ZZMA 1ZI6A 3SZMA 1P1JA 1VGQA 2I1VB 3N6RA 4GZ6A 1F38A 3OOWA 2HNKA 2I3DA 4YMTA 1RC0A 4CTOA 5BORA 2F1HA 2J9RA 5HS4A 4BNMA 2IV2X 5LD2B 2NXWA 1RXEA 3E1GA 2Q3DA 3L8CA 3LHSA 3QK7A 3QJYA 4M99A 3B3QA 3KVYA 3MWDB 3OIYA 4R9RA 1IWOA 1DQSA 1RAFA 4JCCA 3ONWA 4XD7D 5TQ0B 3EXHC 4DQ0A 3M6AA 1I4OA 1ZH8A 5FR1A 4MCIA 2QTRA 4NZ9A 2EZ8A 2I99A 3EXHA 3PT9A 4WK6A 3LKZA 1NVFA 2O2JA 1N5RA 2YYYA 1QQ5A 4HCJA 4Q1DA 4D56A 4DWJA 5JAHA 2JLZA 2BKUA 3N0RA 4CMJA 1YR7A 2J3LA 2FK8A 4IP0A 4C6HA 5DNCA 3E8MA 4XVCA 3LW7A 1N1MA 5FPPA 1IQPA 2H2FA 1KK2A 5I8WA 1BU5A 1NV9A 2DFTA 2R86A 4JLDA 3WRWA 5JCZA 2FXIA 3GVHA 3GHHA 4RL4A 1NWCA 1R0LA 1OSNA 4QELA 4F7DA 2R6ZA 3TNDA 1LC0A 1Z6TA 2XMDA 1F2DA 4ZKDA 1QANA 5HCNA 1TMOA 2C2XA 2OFXA 3G5AA 3NR2A 3Q3VA 4PVDA 4LF7B 1C7IA 2RHDA 1YJ8A 1E6EA 3DGEC 4QATA 3RD5A 4ND3A 4W5HA 4B3XA 3TGWA 1MIOA 5CM9C 2CXPA 4IMRA 1NLFA 1VRVA 3IR5A 4MS3B 3NV7A 3B2NA 3AJAA 3TQCA 3U7JA 5I7AA 3WBBA 2PJZA 3M6MD 4ALJA 4QX6A 1H8EA 3YASA 3NXKA 2W83A 1YQDA 2HADA 2IY9A 4GKBA 5JAUA 1CNEA 2SNIE 2QRVB 2CUTA 3S7TA 4EHNA 4CJXA 1ECCA 1YC5A 5GZ3A 3UAZA 1XROA 5HKBA 4MLPA 2F9MA 1LNZA 3P4XA 4F45A 2ZRQA 4HGOA 4JFRA 3IEMA 3U6KA 4G0NA 5TT0A 2FAXA 1AU9A 1WM1A 2ORVA 4MDHA 3GCDA 3IIJA 4KRGA 2BEUA 4C43A 3VVBA 2J3HA 1E0JA 2JHCA 1WIWA 1XQ1A 1J09A 4EF6A 4RSMA 1G3RA 1MNAA 4RYDA 2ZUFA 1VOTA 1XCPA 4LYHA 1Y33E 4JLBA 2K87A 3ZOKA 1QH1A 4BLWA 3D0RA 3PGJA 4JEIA 3PYMA 3OCCA 3W6UA 1R6TA 1CR1A 4WADA 4CF3A 3TZ6A 1CJBA 1VJRA 1ZN2A 3CZMA 4WX2B 5CVVA 3KOWA 5J1TB 2NZXA 1XXLA 1R88A 4P32A 1MB0A 2QLNA 1K4YA 1NC3A 4X8HA 5J2TB 2X2OA 5DM4A 3WGOA 4BATA 4RD2A 4FGLA 4D41A 2FEMA 1KEEA 3RIYA 1OX4A 2CL7X 3L8ZA 3D2BA 1IK4A 3EZXA 2QRMA 1J2EA 2CE7A 3KLBA 3R41A 2VNAA 4QGGA 4RK5A 3ZYCA 4G86A 1E7RA 3IJ5A 2HQOA 2JS7A 1AXGA 2WDPA 4HWOA 1SHUX 1SURA 2HSDA 3DXZA 5ECGC 4UOZA 1M1YB 1WUYA 1BXGA 1MW9X 2I2DA 3RW9A 1N0VC 5C8ZA 5DM1A 1IMOA 3QKWA 4DIMA 3EVEA 1XDSA 1UKYA 1EWKA 2OZLB 3BH6A 4QECA 5D7NA 3SYTA 5L8VA 4S12A 3ANNA 4N76A 3E9RA 4I6EA 1OGIA 1Y8ZA 1GAJA 3GAMA 4Q05A 1CB7A 5TQJA 2PMCA 1C4WA 3KZ1E 3R7LA 1ZQ1A 1P1KA 1P2GA 1FFCA 2Y93A 1YQUA 1V6AA 4CTKA 2BMDA 2ZYSA 2VJOA 3E82A 2P9EA 3DL2A 3JWJA 1M1NB 4UM9B 3IOEA 3GA0A 3ZHYA 1E59A 3RVDA 5C8YA 2AQHA 1O6CA 1OVGA 1E2JA 1U02A 3VJMA 4IVRA 1TUIA 4ZICA 4XX0A 1ZXXA 4BASA 3SS8A 4K40A 4HMQA 3TUJC 2TYSB 1ZGHA 2C4VA 4QSHA 1NXSA 1XT6A 2FFQA 3RKSA 4X66B 3C41J 2YJ6A 3OJOA 2P90A 3SJZA 1JVSA 3UJPA 5A04A 1BDBA 1SXGA 1P1CA 5F7OA 2WSSD 4AI6A 2Z9CA 3HCDA 4HWTA 4CDGA 4AQ7A 3RRBA 4WXHA 4H7PA 3PXUA 4R9SA 2F55A 2JKYA 5HF5A 5KKAA 3CRZA 3GUHA 4IXMA 1F8GA 3BK2A 4V2UA 3U49A 1LX6A 3U16A 1EUZA 4E1AA 4G4SP 1GA1A 1F0PA 4BNHA 2D2IA 4U7TB 3M5WA 3NTVA 4DYHA 3CW9A 4JB3A 4RANA 3KCQA 2IXFA 1W0CA 2VKTA 4ZV9A 3HG7A 4YDHB 1NUQA 1DDIA 2JFYA 2VJPA 2WZCA 2XWPA 3CLSC 1T6ZA 3PPWA 4PS0A 4ZARA 5HUQA 4UTZA 4OMUA 5LD2C 2RHMA 3KVNA 1CKEA 2FKAA 5CH8A 3LXXA 4L4RA 1OBVA 1A7KA 1ICEA 1Q14A 1Q3HA 4GHWA 5LYJB 4ROSA 3C1UA 3PR1A 5JO9A 4N40A 4PQGA 5J4KA 2RHWA 1UBFA 3MWDA 3OE1A 5TQ0A 4IZOA 3U3RA 4BYGA 3PNLA 4H7FA 4RKFA 3G2KA 4TLBA 4E4TA 5CB8A 1S2GA 1WTAA 2HH9A 1CIJA 3DMPA 4N3GA 4YS6A 3VR2A 4IWXA 1J0DA 3EZGA 5IAKA 1AKWA 3VR4H 1O7JA 1CJKC 3PDWA 3KHUA 3KM0A 1XWWA 3R6TA 3ZXUB 4O4IB 1NP6A 4QDXA 3HMKA 2WHRA 3RC7A 3TFQA 2OHJA 2B82A 3C3JA 1ZINA 3PWTA 4J9UE 3ZGLA 1NP7A 2G06A 1PS0A 1ZN9A 2X7HA 1BXRB 1LWNA 2TECE 3O1HB 4KFTA 4LISA 4YLGA 5BOSA 3FB1A 2VNKA 4JOQA 1FNSA 2DR2A 4L4ZA 1Y89A 3GPIA 3RSFA 3LE8A 2FZEA 1JXAA 1J39A 1CRLA 2E9SA 2JZOA 2QVZX 2RH4A 3GEEA 3OCZA 3RAFC 3AR7A 4R40A 2D4AA 2W5UA 4GP6A 4J90A 2XJ4A 2G4LA 3R0QA 1QCCA 4C22A 4DABA 3GK3A 4GKJB 3OAAD 4IEEA 2F8LA 1WPQA 2JFUA 2QE7A 4FFNA 4HVLA 4K8RB 1LBIA 3NT5A 1RQNA 2KM1A 1A3CA 3QVJA 5TF0A 4YGXB 3VKGA 2ZAIA 2Z4RA 5CDTA 4L8VA 3RG2A 1V7QA 4MS3A 5JZSA 2IYSA 2ZEJA 1XEFA 4QOGA 2EBHX 4P34A 3C2QA 4LXTA 3NT2A 3UENA 5C3MA 1GVHA 1IBRA 1A9QA 2B5VA 4QPPA 2LGJA 4LWZA 3D7LA 1D2MA 3QWFA 3WMRA 3BORA 121PA 1X8KA 2HLPA 5D8DA 3ZXSA 1ISGA 3I04M 3STXA 1N2OA 3LTNC 1M2FA 2QRVA 2W58A 3WMEA 3AVUA 3OEWA 2RHRA 3QIVA 4M0KA 2IGBA 3KD2A 5D3QA 5KAPA 4GP7A 2OMKA 1BHSA 2D1FA 1KBZA 3L82B 1GVNB 3ZJTA 1S0UA 1FNCA 1KVUA 1VLHA 3P94A 1K0UA 4WESB 1BMTA 5DNAA 3DKIA 4CLRB 3KTAB 3UUGA 4JLUA 2Y1DA 4K9QA 2ONJA 3EFHA 2XCLA 3JVDA 1KH3A 3PPVA 5K1ZA 1R16A 4DANA 1GNVA 1QV9A 2Y27A 4RVGA 4DF3A 2CSUA 4R71A 1KOGA 5JI2E 1S5PA 4I9HA 2D13A 3EXFB 2GHIA 3DE4X 4ZVLA 2QLFA 1F2TB 4C0BA 4RAOA 3GT4A 1HKUA 1KVQA 3C8MA 3ANXA 2VP6A 1R0ZA 4EFMA 1AX9A 5J2TA 1OBCA 1RLTA 2H57A 4NZPA 1J2UA 2H06A 4M0CA 3FVRA 3TW4A 4ZMRA 4QEZA 1B42A 1W76A 1AQUA 1WU8A 5SZIA 2DHRA 5F1OA 1TEVA 2NTNA 3KKNA 4WNYA 3ZY4A 1NHWA 4F8JA 5KX5A 2ZI6A 4MVCA 5ITSA 3WMFA 1FVHA 3NWOA 3EZ9A 4KMMA 5FBWB 1DKMA 3M89A 1XJ5A 2W71A 3RTGA 1KAMA 1QVZA 4D8UA 1Q7BA 3A05A 1GCIA 1SBTA 1SCQA 2YNMC 4I4IA 5EIFA 1IU9A 1P0CA 1GADO 5GOZA 3VSBA 5JCPA 2KJQA 2J85A 1Q22A 3L43A 2JI8A 2YNMA 3N8HA 2G0TA 3LOPA 5AXAA 3TK1A 2WHXA 5JFTA 3C3YA 4LHEA 4DV4B 5AVUA 1ZJ6A 1RXIA 2LPMA 1NXPA 4TKVB 3VC1A 3IP7A 1PX2A 2WTAA 4DIFA 2FUEA 1T8YA 2QUZA 4GEGA 3IKVA 2AEFA 4MUFA 5FA5A 3WWZA 4F92B 1RYHA 1KEKA 1RKXA 3GFTA 5SZJA 1DWUA 1VCHA 4LJAA 3FZYA 1GQFA 1JGTA 1UBNA 1V6SA 1TQ8A 1JG7A 4JV5B 1SVMA 1I30A 2R6JA 1UOEA 3H42B 1DSSG 3AIIA 5J2UF 3IDSA 1TW3A 3BVPA 1DT3A 2FUG6 2PX2A 4TLDA 1J23A 2RHGB 3LCUA 3ZVRA 5FOSA 2ZYTX 4F04A 4JC8A 3ADBA 4MQ4A 4D0LB 1BJRE 4DV0B 1QHGA 2CMKA 3G0CA 5GM1A 1F4LA 1K9VF 2NG1A 2YY6A 3D2CA 3MVEA 4GICA 5ICMA 1ZKDA 1RYBA 2A8YA 2C5GA 4ZDIA 1W6RA 3ZHUA 3UK1A 4XM2A 1Z34A 1JLHA 1XMQB 5C1OA 1XQ6A 1KMNA 5HZKA 1SG9A 2XHZA 4HOYA 2HF8A 3K0KA 3L4JA 3RDPA 3G2IA 4INOA 1YACA 1K7CA 1CUSA 5EJEA 4PLGA 3LYHA 3FWPA 5EPUA 3T9CA 1II8B 1TAGA 4U2GA 5IULC 1DPFA 1CF4A 3QQPA 1IUPA 3EZ6A 1GZ6A 3IUYA 3GH1A 2XMQA 2Z04A 5G0VA 4DBLE 2Y77A 1JPNA 2GA9A 3QI2A 5NULA 2WLTA 2C2MA 2EWWA 1Y1KE 1VCMA 3P9IA 4PFSA 3UH0A 4JUFA 5LMUB 1W2HA 2AOUB 3JRWA 4F9FA 1KRWA 2JI6A 3O3NB 4KIFA 3QEKA 5CK5A 2HYDA 4JP8A 3OO1A 1SJ9A 4HNGA 4Y6SA 4H35A 2JIMA 4EGSA 5K0SA 3T1OA 2H1FA 1SKMA 1T3TA 5DGCA 1Z5VA 2AWNA 3C3CA 1ZK0A 1N8KA 4ENQA 3TFOA 4QPNA 3WGNA 3R3UA 4E15A 3K9LA 3A3PA 2JLUA 2J45A 1T2UA 1JDJA 4L9RA 1Q3KA 5BV7A 3RU2A 1O8CA 2P8SA 1M5UA 2FSIA 2ECFA 4F21A 3QVVA 1DMSA 3H2KA 4RHCA 4TT8A 2WPDD 4J0QA 1DIBA 2BZGA 4II2A 1UK9A 3VDQA 1HEUA 2AI2A 3RF6A 4F6CA 1CS0B 2BBSA 3VH3A 1RPAA 3ZGZA 5K03A 3B2EA 1VE1A 2D8MA 2GA8A 3H2GA 1AA9A 4JC0A 4O5OA 3A9RA 5ALWA 4B5KA 2QL5A 3DKKA 2CHFA 3UK6A 5DBEX 4O2BA 3VNVA 3MMZA 3ELYA 2IYTA 1UBGA 4M1KA 3B8HA 4QGFA 2WHEA 1I3NA 4LE0A 1EG7A 2IOFA 3PDIB 4UARA 5K3SA 4CZ2A 1YE3A 1O57A 2X6RA 3HCPA 1JDTA 4LY0A 4WH0A 3D0OA 3TAHA 3VJLA 3I05A 4L3OA 4EOGA 5KHOC 3JZAA 4RQAA 1U7XA 5JH7A 4I19A 1E61A 3AW9A 4YCJA 2XI4A 1YBHA 2XHEA 4H4CA 4R1NA 1ZM7A 3LPNA 3WGJA 4UM5A 1RVV1 2Y1EA 3E58A 4X1KB 3RS2A 1QYRA 1AKRA 2NIPA 2XV1A 2XVAA 2ZBPA 3AF1A 3EIEA 1OYYA 2FZCA 3SKYA 3WV4A 4ARSA 4V0ME 4CKEB 1R4AA 3KTAA 1OC2A 1RHQA 3CNNA 2HJWA 3MS4A 2JHPA 5FUWA 1TD1A 3HPQA 3DLTA 4RHYA 3H65A 4BRSA 6ABPA 3PQ7A 3H6GA 1QMPA 1X9IA 2GJ4A 3NU1A 1TTHA 4QTXA 5CNKA 1H94A 2ZGVA 3VC3A 3IDOA 4BO6A 4RKEA 3RJ5A 2OV6A 1ULZA 3NIGB 4XYMA 5BMOA 3LOQA 3WK6A 1Y1QA 1W1UA 1M7HA 1OZAA 4DZZA 3UJBA 1V7PC 2JASA 3QHAA 1ZLXA 2C2YA 1IRIA 2JK1A 2P69A 3GNLA 1GAXA 1T5TA 2NZUG 1AHHA 1DDOA 2B0JA 4K9SA 5C7OO 4LJ7A 3G2LA 3HB9A 1N78A 3U5TA 2DPMA 3DD1A 1A2OA 2X5NA 3GMSA 4K6HA 2E82A 5AOVA 1V5WA 1KO5A 4M6WB 4LGCA 4Y1GA 3FOFC 2VT2A 1Q11A 4LNAA 3KQNA 1JFTA 3AONB 1Y3BE 2Z5FA 4WW0A 3RWOA 4RK0A 3SLRA 3B5JA 1L7MA 1B26A 1SCKA 4PX9A 5F7ZA 4B3RB 2AJBA 4R1LA 2P4HX 1OUMA 1XVUA 3HNRA 4OGGA 1H6DA 5E1OA 3UXEA 1SXPA 2OCLA 4RVUA 3CRMA 4Q9HA 1YR6A 2FOLA 2PY6A 4TKVA 4F71A 2F1OA 4MI3A 4Q9NA 3MTBA 4JIGA 4M36A 4F2PA 2HBQA 2QZ9A 2WU3A 3OP1A 4KAJA 4LYDA 4UCFA 4ZOBA 4AZ0A 4D0GA 2PQ2A 4EYOA 5JNSA 2ODEA 2W22A 3KPVA 4QBHA 3VX3A 4CMIB 3GW8A 2XA9A 1CD5A 3GEBA 4QUIA 5IW8A 4GSKA 3LRTA 4MVJD 1XK7A 1W59A 3A28A 3S5UA 3HXKA 1QYXA 2HV8A 3G85A 2YS7A 3L02A 3O0TA 4G5YA 4BN0A 1P7WA 3PTAA 5FHQA 1WUIS 4FEEA 1ZOOA 4YP0A 5E6UB 2VRBA 4LDAA 1LK0A 3MWGA 1LK7A 4CT4B 2NO4A 3DDSA 3PP8A 4WKPA 1XP5A 1XDZA 1J06A 4R1QA 1J24A 2OBYA 5DEOA 4ARVA 4WHMA 4K03A 4YPOA 5TMBA 4WLEA 2IKQA 5HHTA 2GXUA 3CZ4A 2BDEA 3HU1A 3CO0S 4R2XA 3JX9A 2F3QA 5DSTA 3DAPA 4FEAA 1OGJA 5KHAA 2A9RA 3M33A 3OJXA 1N1GA 3CH5A 3M49A 2ZWMA 3V6MA 4D8TA 4MVYA 3TJMA 4DSAA 1W1IA 5JS6A 4KUHA 1PV1A 3LNTA 2XMRA 1UKEA 5A4DA 4OGLA 3P9PA 5KQRA 2QG6A 4NV3A 3CX4A 3NWPA 3OMWA 2DWQA 5E7JA 5H68A 1K9SA 3S6JA 5IVPA 2R8OA 4YRFA 2NSDA 1OI3A 1QYWA 3TW8B 3W5HA 3FUTA 3BT7A 3O1JC 4GAEA 5HIJA 3TINA 4GT1A 3LY8A 4FNMA 4MAAA 3WYEA 1K5DA 5DHTA 3B1VA 4FE3A 5JCJD 3VXKA 4I3GA 3EEQA 2Q1SA 4KG7A 5IP5A 4B2YA 3OMXA 1BHJA 2AQKA 2BSXA 1JEJA 3B7PA 3IMGA 4EG0A 1UXIA 4QEDA 2AOUA 4L51A 4RLFA 3A1SA 2ACKA 3M34A 1GA4A 1PLKA 3NBFA 1YD7A 4HYYA 4NATA 3OFSA 3IUBA 3LUHA 3OZEA 4L07A 3WHKA 3LK7A 3X1WA 3L40A 5JCJA 1WVIA 3SZLA 1NBAA 2PBZA 4Z2AA 4YT2A 4P35A 3GX1A 1YQEA 3I8OA 1LVUA 1E1QD 1AK1A 1K06A 1I4TD 1LV7A 2ZIZA 3T61A 5BVHB 4G0WA 1Q0PA 4LMRA 2O1EA 5KSZA 2YHUA 2BHNA 4P82A 4YXWA 1ZD3A 1UDAA 2GBIA 4IXDA 4KL8S 3JQAB 4BVBA 2WA1A 4N7BA 2CFOA 3DOHA 4HQ6A 1X70A 3X2SA 3R5FA 4W5QA 2YZ2A 3W5VA 2P6OA 5BYBA 2H9YA 3UK2A 4ES6A 2AK3A 2GAFA 2E6UX 1OZFA 2HUNA 3Q0IA 1XPUA 2CLEB 5LLDA 1CS0A 1XJQA 1Z3CA 2FVYA 1SVUA 1KDYA 2H2GA 4XUEA 2ZI7A 2QX6A 4XSGA 4B3DA 2BEVA 2O3JA 3MJEA 3R7NA 3Q12A 1ZDMA 3FRIA 3ZJYA 1NULA 3WG9A 3ZV6A 3RK1A 3OO0A 3A6DA 1P3JA 1F9AA 5AUOB 2Q62A 1NQAO 3RVRA 5LM3A 4X84A 3NFYA 4BJ1A 1GTZA 2AUMA 2FHPA 2FSSA 3E5MA 4D9GA 4Q7QA 2VSQA 3CUTA 4A23A 4XKJA 1E8NA 3UMVA 4AXBA 2WU4A 3G49A 4ZOQI 4FSXA 4X1KA 1IBCA 4IDDA 2ECPA 4CYMA 1JTEA 1YHYA 2Y3IA 4G37A 4U5QA 1XZBA 3F6CA 3KAQA 2F3PA 4CKEA 3U7QB 4E6EA 4ZQIA 3RM3A 3E18A 1D4ZA 4MV0A 2M1ZA 3ZTWA 5LUBA 1GGJA 4NX2A 1RP1A 2I6FA 2Z5GA 4WACA 1KSGA 5E8RA 2I78A 2D0PB 3DL4A 1SQGA 4KO1S 3TJZA 1B6TA 4M49A 3B6KA 4HAXA 4M9RA 1EKXA 2Z1NA 4G56A 2I62A 4EVQA 1EFRD 3KFVA 5EESA 5DLYA 2V1UA 3WGHA 1HKHA 3AF6A 3RS5A 2D1RA 2CFRA 4O8CA 3BZUA 3Q40A 1RWVA 4I50B 3PFGA 1BCRB 1E4EB 2ILVA 4MVXA 5SICE 2XCRB 5ELXA 1CUDA 1Z4OA 4CIYA 5JROA 3SSMA 3FMGA 2R84A 5ELMA 4BRUA 5KYGA 4N5NA 3M82A 1S2NA 1Y5MA 4MI1A 4NCKA 5KVQA 4B6PA 1PJRA 4CF5A 5JPIA 2FCAA 4URWR 4M6WA 1DBIA 3RSSA 4MJLA 3VVLA 4RHUA 5JOQA 4BVKA 2NXEA 3FSRA 4HX9A 4W6ZA 4X65B 3E7WA 1T3HA 3IJEB 5FTWA 1A4UA 3A27A 3AI2A 4CFYA 3EPJA 2PT7A 2QJTA 3QUAA 5C5DA 4FYJA 3TLEA 3RSCA 4EW6A 3SLGA 3W6ZA 1NR7A 1WNTA 1HDYA 2LKDA 2UZ0A 2X8BA 4IMPA 3ZWAA 4ZVMA 4KXWA 1DAMA 2OG1A 5CM2Z 3RAJA 2YV4A 3WA7A 4JFAA 2Q5QA 2FR8C 4G5RA 2MINB 3QX8A 1KI4A 4TV9B 2DFLA 4XQCA 4CMIA 3ZWXA 3Q85A 5KUTA 4O02B 3WSTA 1VBFA 3M3HA 4FX2A 2FR8A 5H3HA 3K9BA 3P0RA 5BN4B 1M0EA 1T29A 2IW3A 4ND7A 3TOZA 4DJ5X 1LGYA 3N2NA 4FDUA 2XXJA 2EX1A 3OFJA 4MIEA 1DFIA 4HGYA 3WHIA 4UBKA 4NK4A 2IWRA 3DOOA 2IHNA 3ZHRA 4X24A 1O6BA 3D6NB 4M54A 3IKJA 3R44A 2P0AA 5E6UA 3AVXA 1UH5A 4NY1A 1NZJA 4N47A 1PJBA 4J1NA 1I4WA 4CM8A 2BHSA 4GPD1 4IJ6A 4LI3X 5JS1A 1ZWKA 1OA1A 3H75A 1N5MA 4BMNA 4E31A 3DW1X 2Y9PB 1NF8A 2CCJA 2M6LA 1JLKA 3C6KA 3KWJA 1MX5A 2PZGA 2ZSBA 1Z35A 2A35A 4IJVA 1TQ6A 1ZOPA 1XYGA 3PS9A 4EUKA 3MXTA 1U9IC 1D04A 3EHDA 1PP4A 3LX8A 4FFMA 4KQHA 4P5PA 4IDGA 3ZV4A 2VXBA 1Z5WA 2VUUA 3G7NA 4BJHB 4DJJA 1A9TA 4PLHA 4X60A 4AF8A 1SBQA 3R7FA 3TXYA 1U9IA 1U0FA 1ZCFA 2ZJYA 1OLUB 2OCAA 3IQGX 2QSZA 2AG5A 2PT5A 3QPAA 3X0DA 4BIIA 1L7EA 3HWRA 4R9UC 4XQEA 5EIHA 1O94C 1LB1B 4OI2A 1RW4A 3ET5A 4GC9A 3RBVA 1UAAA 2CXHA 1U9JA 1ZOIA 1GCGA 2QTGA 4YMHA 2JGMA 2XODA 1ZA1A 4JENA 1B2RA 2VH1A 4QDUA 3V33A 3OCYA 1LQTA 1O94A 1LDNA 3L8EA 3EASA 4OK5A 5C8YF 4UUPA 3ICQB 4MHOA 3FFAA 3GEIA 5DYWA 1TXGA 2XH8A 4N6NA 3VZCA 4JDUA 3QFHA 4A8PA 3BSYA 4C6TA 1YIOA 5I9NA 1CRPA 1NTRA 4G5GA 2WUEA 5C2JB 4JVLA 1NRWA 3JQAD 2GCGA 1NJ6A 1I1OA 2PYZA 3M2TA 1XLTC 1ZIXA 4NFLA 4WLFA 4WIAA 4TYNA 2L19A 3NQ41 3RSLA 1PFVA 1QXSA 3ZGVA 5LNK6 3A6HA 3GCXA 3CW8X 1XLTA 3DV2A 1QFXA 4D3DA 3PX2A 1IHXA 3BXEA 2JGAA 2Q46A 4ANFA 3E61A 2AD5A 3AI3A 4ZT2A 3LV8A 3T54A 1FYWA 2R97A 1YASA 3GFPA 4DM4A 2HLHA 5F5XA 4H59A 1PCXA 5EWLB 1CUBA 5DHSA 3HU2A 5BR4A 3GLIB 1GEEA 2MSLA 3S5JA 3U3ZA 3ZLTA 5P8WA 4DSUA 1XG5A 1BXZA 3GOQA 1QTNA 4UHJA 3NIFB 1GZUA 2Q27A 3QWBA 4Q47A 3OEEA 4QNNA 1K8XB 3B1ZA 5CFLA 2VTBB 1LVGA 1M2VA 4JXKA 2LDXA 4GRIA 3C6ZA 2GZ1A 2F8TA 4ZOLB 1MRZA 3DL7A 4FWBA 2Z2IA 4NCIA 5G0TA 1QZUA 2J41A 5JATA 1USVA 2GJSA 4WBXC 5JASA 4BV2A 4EVIA 2ESRA 2QR3A 2RAUA 3MOIA 1KSJA 2XR1A 4JQCA 2ZIFA 1SH7A 1TTTA 3I53A 1ORHA 2BGTA 2CUZA 3BIJA 1DQYA 2FSFA 1JG1A 2R00C 3URKA 3ZJUA 2VXCA 4B7ZA 3F8TA 1YB1A 3JAMA 5LMCA 3U7QA 1ZO8A 2WSLA 2CZCA 2R00A 4TRJA 1KF0A 3F6YA 1RBYA 1IY8A 1PWZA 1UXGA 1Z45A 2YR0A 3I45A 3KKMA 4AJ4A 3N3BC 1IY2A 4V3BA 3V4OA 5HRCA 4OHYA 2EP8A 1M6WA 5JJCA 3F9IA 1UODA 2OHFA 3DWGA 4MGZR 4PC3A 3R6LA 3SQLA 4B73A 1KO8A 2UDPA 2ZRNA 3MFYA 2H4XA 4YMIA 1P19A 4I50A 1BCRA 1E4EA 5FOVA 1YE8A 3CX6A 1C7EA 1AJEA 1KI6B 3MTQA 3X1DA 4G36A 3D5EA 4F3YA 5FWYA 5LKRA 1JQ3A 2VJMB 1SB8A 2DBRA 3IV6A 1XI2A 4B45A 1UL1X 1TA4A 3LK6A 2IUYA 2F9LA 2HK8A 4R1PA 3TR5A 2B7CA 2WVJA 4YUZA 1B76A 2VAMA 2WUDA 1GRNA 1SZCA 1PSZA 2DCMA 3P26A 2HD4A 1BU8A 1NI4B 1MA3A 1R10A 1RQPA 2GUGA 4BKUA 1HBJA 4TTRA 3PFKA 3F3YA 1L4HA 1IJBA 1YNOA 1Q7GA 2J6HA 4JMLA 3V6LA 4D44A 1FS5A 5BQXA 3BGVA 4D26A 3A4NA 4OQNA 6ADHA 4LC1A 1RM4A 1XMJA 5EP3A 2JCGA 1T2DA 2J3EA 3GFRA 2XIJA 3E6AA 1AK9A 4ZHSA 4LBWA 4HEA1 3QU7A 1U94A 2MINA 1B6GA 2QD2A 4M21A 4MWCA 4TV9A 5BUQA 1R6AA 2GB4A 1NX9A 4A0QA 3PNKA 4CLEA 5BN4A 1G5RA 2QX9A 5KQLA 3UHOA 1KH1A 2PUFA 1EEHA 3BB4A 1VPDA 1PHPA 1KOLA 4ND4A 5IWCA 3R1IA 2Z30A 1MVLA 3W7AA 1XZDA 5C1BA 5KYNA 1OKKA 3ELBA 1R2QA 1S01A 4MLZA 5FF9A 3LT1A 2QGZA 2PZEA 2P5SA 4ACBA 3D4PA 1N2GA 3H5NA 3GRPA 4RGYA 4DL9A 4TLMB 1FU8A 1I6KA 2QXUA 2IOQA 3DJFA 1GGMA 3NDPA 4KACA 5J2TF 3G6WA 4YLEA 4DRYA 1WBBA 5IVKA 1A9RA 1XELA 5G3YA 5T6MA 1D09A 3NRJA 2FV8A