2FDXA

Clostridium beijerinckii flavodoxin mutant n137a oxidized
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fdxA00
3HR4A 1YKGA 1RCFA 3ZHOA 4D02A 2XOEA 1WSBA 1KBOA 5LBUA 4ZVMA 5NLLA 1XI2A 2QX9A 2OYSA 3NHRA 1AG9A 2A5LA 3K1YA 1AKQA 2FLVA 4GQIA 4LTNA 1QRDA 5LMCA 2QMZA 1YCGA 2FCRA 3KLBA 5LJLA 3GFSA 1T5BA 1AKWA 3ESXA 2HPVA 1J9ZA 5EMNA 1V4BA 2X2OA 3HA2A 4F8YA 3P0RA 1T0IA 3ESZA 2OHHA 2W5UA 4H6PA 3KAPA 4M0CA 4YAWA 1I1OA 2Q9UA 2Z9CA 1CZRA 2BMVA 2V5VA 1AKRA 4ZVNA 1ZX1A 4YQEA 2Z98A 4PTZA 1E5DA 3QFRA 2FDXA 5FA6A 3KEGA 2FX2A 4U7GA 5B3LA 2ARKA 4ZVKA 4DY4A 3KAQA 3NHKA 5NULA 4QOEA 3U7IA 3N39C 1JA0A 3UXHA 3O2NA 1OBOA 2X2PA 1KBQA 5LLDA 4QOGA 2QR2A 1AKVA 4GR9A 4XDGA 3QE2A 1J8QA 4N9QA 3GFQA 4ZVLA 1J9GA 1WSWA 1VMEA 2QMYA 3W78A 2MTBA 3OX1A 5JROA 1J9EA 2WC1A 4YAUA 1QBGA 2XODA 3B6IA 3F6RA 2FAXA 2Z9DA 2GSWA 3ES9A 4HS4A 3NHSA 1CZKA 1FTGA 1CZLA 1ZWLA 2MWMA 4PU0A 3NHWA 4FGLA 3B6KA 3QFCA 4QOHA 4C14A 1FLNA 3W77A 1OBVA 4HEQA 5TGZA 4C0WA 2M6SA 2BPOA 1DX9A 2KQUA 1FVXA 3W79A 4LTDA 1D03A 2MOKA 2QX8A 4H2DA 4YAOA 4C76A 3U7RA 3NHJA 5ULLA 4QOIA 4YALA 3OJWA 3SVLA 4LAFA 1XYVA 1NNI1 4N82A 3K20A 5F51A 1YRHA 5LJIA 4Y9RA 3FW1A 3NHFA 2D5IA 2OHJA 2N1MA 5FUQA 3OWHA 4ESEA 3TZBA 2ZKIA 3GAMA 4BMPB 4OXXA 1H69A 4BMOB 4QOFA 4PTYA 3B6MA 2RG1A 5EA2A 1AZLA 2QX6A 4LTMA 4FGJA 1FLDA 3GFRA 2FOXA 1FLVA 3LCMA 3D7NA 4CF6A 2HNBA 3OVMA 3EDOA 2AMJA 1CZHA 3OWXA 5F4BA 3F6SA 1RLJA 3FX2A 3R6WA 5BUCA 3NHUA 2B3DA 3B6JA 4NULA 1RTTA 2Z9BA 1H66A 1D4AA 1YCFA 3OJXA 4QOJA 4C0XA 1XT6A 2R96A 2FZVA 1FLAA 4U7FA 4CETA 3L9XA 2V5UA 1AKTA 3F90A 4U7HA 1YDGA 2F1OA 1B1CA 1YOBA 2OHIA 4FGKA 5A4KA 4LA4A 1QHEA 4QODA 1FX1A 3N3AC 2BZSA 4DIKA 4J8PA 3N3BC 2BF4A 3TEMA 3HLYA 1QR2A 2HNAA 1AMOA 1DXQA 1C7FA 1SQSA 1AHNA 3W7AA 2QWXA 3OX3A 1CZUA 1OFVA 3NLLA 2R97A 3G5MA 2FVXA 3RPEA 3NHPA 4N65A 2QX4A 3NFRA 1TIKA 3FNIA 1X77A 3FVWA 1DXOA 1YCHA 5F12A 1TLLA 1C7EA 5EAIA 3ESYA 4DILA 5LVAA 3JSXA 3FJOA 1RLIA 2MT9A 2M6RA 2BN4A 3F2VA 6NULA 4GI5A 2V9CA 1D04A 1JA1A 4R81A 3NHYA 1ZWKA 1GG5A 1BU5A 1CZOA 5FX2A 4FX2A 1BVYF 1FUEA 3OX2A 3NHLA 3L9WA 4XDHA 4S24A 3TE7A 3UXEA 1F4PA 3S2YA 4NLLA 2FZ5A 5B3KA 1SG0A 4ICIA 2KLBA 4YAFA 1XYYA 1CZNA 3O73A 3EYWA 4Y9UA 4Y7CA 1AKUA 2Q62A 3LT5A 5LBTA
chains in the Genus database with same CATH superfamily
1HFWA 3ETJA 4L4ZA 1UBKS 1YKGA 4WPGA 1CIJA 4YT5A 1WXXA 3WA7A 1A3CA 5TC4A 3M2TA 4B6RA 1E0KA 2Z04A 3QX9A 1ZM7A 1QFYA 1K88A 3MCUA 4LY0A 1VI2A 3H97A 5IKPA 3G3EA 1GL9B 3L6RA 1N7HA 2VSOA 2XYQA 4KN9S 4AZSA 1P62B 3G1UA 1X1AA 3BICA 4N3AA 4OQQA 4LWPA 1P29A 1GAXA 1Z6GA 3B1KA 4ZRMA 1GPH1 5EWJA 1EFVB 5CHEA 5L40A 1JG2A 3VYWA 1JLKA 2A3NA 4FD2A 4NBTA 1EFDN 2CLHB 4GOOD 3DOOA 1GQFA 3WK7A 2JAQA 1QGED 2DYKA 3A05A 1NQXA 4W5JA 4ZTUB 4POAA 3U3JA 1Y4DE 4EPYA 2FFRA 4GQIA 1M2GA 1N5IA 2V58A 3Q9LA 3QVSA 2FWAA 3JY6A 4NBNA 3X1ZA 2JZNA 3Q3EA 3AKZA 3C8HA 3SJBA 3EMKA 4OKSA 3VU3A 4O4IB 1YCGA 3S2ZA 2E89A 1HNXB 1GCUA 4IIJB 2CXHA 2HLDD 2FOLA 3LCVB 3LKBA 1R10A 5JWHA 3RRYA 3LI2A 1NQWA 3HZZA 5FTNA 2R87A 4YDHB 5EHZA 2PJRA 1ZK0A 4PRYA 3HJAA 1IIBA 4NEGA 4YRMA 2QN3A 2UYOA 1CY8A 1N5KA 3LS2A 1R0BA 1BJKA 2Q3LA 4MW1A 4RJKA 5IAKA 4A3SA 3DAGA 3GJ8A 1KC3A 2V6GA 2B2CA 3ZE2B 2GHTA 1UFRA 1Z34A 2ACWA 3NJ4A 4LK3A 3DMTC 1ARZA 2WIBA 3PEEA 2J7KA 3QBDA 2OCBA 3HMKA 4PGMA 3F49S 1T5SA 3BMNA 1BXGB 2G63A 3W6NA 5HK9A 5M34A 3DNMA 1UR5A 3ESZA 4G1FA 4O4IF 3TUZC 3LUGA 1AZSC 2PH5A 1BWRA 1VL0A 4IIJF 4AN4A 4DABA 4AG5A 3VDMA 1T3GA 5KYGA 2JI9A 3WGIA 2AHRA 4MV7A 2GAIA 1IH8A 5IZCA 4O59O 2IHTA 4C20A 2W4IA 4DIMA 1JPVA 4BNGA 1LJLA 3G6WA 4W63A 4GVLA 2OV3A 3LMKA 4TGLA 3ZHXA 4KAXA 1QH8A 3R6LA 5AKHA 1W4BA 3KKKA 4LHWA 3V4LA 3LT2A 4JQCA 1W52X 5KSYA 1UEIA 3ZD6A 1DSSG 2VUIB 3K0SA 821PA 2UYCA 1TPZA 1OFGA 4M0DA 3LTEA 3ITKA 1Y89A 2V7EA 1ZD9A 3L79A 3ZE1B 3OA0A 4EHIA 5ERXA 4I36A 4J4TA 3ZD8A 3AUKA 2HCRA 2CE2X 4JWTA 4PZYA 4WDRA 1DIAA 1I3CA 1KEWA 1WMBA 2JJ8A 5ELMA 3J81k 1A7JA 1Z45A 3LW8A 1A4UA 1BXZA 3EOZA 3QFRA 2BEVA 3HV2A 2WSYB 1JG3A 4JITA 4M7OA 4XYEA 5KYVA 1L1FA 4OHZA 5KWJA 2DJ5A 2Y67A 5FBHA 3ZHCA 2X0JA 2GDJA 2EJCA 3OIYA 4F4UA 4GR5A 2ZP1A 2H4ZA 4HZGA 2CK3A 3ROEA 3O4JA 3SG0A 5EOVA 4MR7A 1IB0A 4XYGA 2VTEA 3DR3A 3A4VA 1GPAA 3QENA 1YQDA 2OXEA 5DM1A 5ALRA 2PA0A 3U7IA 5AOAA 1M0TA 3FOWA 3N39C 5IJ9A 4TZ0A 1QIKA 2FY8A 2WICA 2OXTA 3K4QA 2ZRAA 5KQGA 2ZPTX 3KTAB 5A0FA 4B73A 3OKAA 1YIOA 4I4CA 2PX8A 3MJ4A 5E6UA 3HJFA 3OY7A 2ZKLA 1PI3A 2J0UB 5EJGA 3EVGA 4TTRA 2VF8A 4KIUA 2GEKA 1ZSNA 1EGQA 1KEVA 5K01A 3OMXA 3A3OA 3UAOA 3INNA 4F2DA 3OX4A 1E66A 2BGTA 4GMHA 4UVGA 3L7YA 4N9QA 4P98A 2OAGA 3F1KA 5K6AC 3I62A 3GOQA 4S2UA 3WG9A 4QXRA 4I1YA 3AF5A 2ZIXA 1GR1A 3DWEX 1O5IA 3I5XA 4AX8A 3OPYB 2Q3DA 4GI2A 2XDQA 1FFHA 4L5YA 1D2MA 2R6GA 1B6RA 1TYEB 4OXKA 1GU0A 5HF5A 1I7QB 1KYXA 2VJPA 5JEDA 4ZI7A 2CXQA 1QDEA 4UASA 2HXYA 4H4DA 3OZGA 5ENDA 4PBRA 3L05A 1TGYA 3VR6D 3DAPA 4CF4A 1WXIA 1UPAA 3AHEA 3G2JA 2R8OA 1B0UA 2OGZA 4OJTA 3LX5A 3PVCA 1DHTA 4QDOA 2IYOA 4JEMA 4FOSA 3BWYA 3TFOA 1W4LA 3ZHRA 4X3PA 4YCCA 3WKEA 3LTNC 1KDZA 5J4LA 3BHNA 4RD0A 5IVPA 5B6IA 4L9SA 4KC0A 4YWHA 3STHA 1YNSA 3PQ4A 2GZ1A 3DCYA 5JXIA 1SCQA 2RHLA 5EKTA 1GP2A 3OTHA 2Q4DA 1YQUA 5LUAA 1SOAA 2XZPA 3WLSA 3H05A 1SGWA 2CNKA 3W77A 3SD7A 4IFIA 1ORTA 1OBVA 4J6EA 2QN9A 4TRNA 2PWPA 1AS2A 3GDGA 2RH4A 4R68A 2FLKA 3K32A 2HTFA 1F5NA 5TGZA 5LFAA 2NV6A 3NYIA 2P65A 4HAWA 5C80A 1G59A 4CGYA 2CL5A 3EW9A 4KJXA 3JRWA 1PJ8A 5A3JA 1SPBS 2H52A 4HDKA 1E77A 3JTMA 4K6OA 5KNCA 4HUTA 5JATA 4Q82A 2HYDA 3CNOA 3MFQA 1JG4A 1B26A 4FFSA 4H1HA 4LJ4A 4UNNA 2J3IA 4PYLA 2QN2A 1XLTC 1FDUA 1A9RA 1JDBB 4FSXA 4WINA 3RYIA 1M5TA 4I9GA 2QRHA 3N2KA 4MS3B 4P7JA 5ALPA 4YR7A 1GTZA 4X6LA 2PL1A 5CTJA 1DJPA 1BKYA 1I3MA 4PBTA 5K3BA 2NUPA 4YUAA 2G5GX 4PHCA 5CA0A 4LDAA 2R1ZA 3AYXB 3CLRD 4Z9FA 4M7RA 4XDYA 1T3TA 1E6UA 3PSAA 1DUSA 1U80A 2DBZA 4KAAA 3IAUA 3KNZA 4ZOEA 3OHMA 3QBJA 1TKRA 5BXQC 2CEKA 2PX5A 5E2BA 2IH5A 1ODIA 2APJA 3K20A 2Q41A 2CJYA 3OZBA 4UKDA 2J9XB 2I80A 2FW9A 3A9VA 1DKMA 3SQOA 3VR0A 3AI7A 3V42A 2C9BA 2QK4A 5C53B 1K2WA 2JLZA 1S8OA 1VB3A 2WNIA 3ZHTA 1Q11A 4E09A 2NPFA 3AIMA 4ALKA 1A9PA 3KEOA 4J0QA 3AUFA 2A9JA 4X5OA 2BR5A 2IY7A 1W87A 1TVKA 2FEPA 4CI9A 1RW4A 1TNDA 2H31A 3KL2A 1Y7TA 4LOAA 3TZBA 3BWXA 3W34A 4F9GA 2WA2A 4Z4QA 1NFRA 2Q5EA 2YW2A 5EHIA 4ZAWA 3GAMA 5BV0A 2JCYA 4B74A 4KKVA 3LP5A 4OQDA 5COQA 2FJPA 2ZYIA 1E92A 4R3UC 1LB1B 1TCCA 4KQ2A 4IZIA 4BFUA 5E3HA 3JQ8A 1TK9A 3SYMA 1WUTA 4HLUA 1JWBB 4RLSA 1HURA 4YVFA 1CC1S 3MRTA 4PTYA 3ZIUA 4NZZA 2Q8NA 4LF4B 1Q7RA 3QLEA 5CIWA 1CG6A 5J4VA 1O0CA 3CO0S 1M8FA 4CQMB 3DLAA 3DV9A 5HMLA 2D0DA 1LDMA 3P97A 4MYDA 5I7AA 1V3TA 2J31A 2WZDA 5K0JA 1NVWQ 2OP1A 3NORA 3KWFA 2YYSA 4CCYA 1TTQB 1X1EA 4I8IA 4E32A 4G0PA 5FWXB 2WUWE 3JQFC 4QD3A 3LM8A 1L5RA 1PD0A 2XT6A 4RA9B 4YBRA 5HIKA 3P1JA 5AH0A 3ZWCA 4DBVO 5CK4A 2TMDA 2P11A 1TU0A 2YC2C 3HL4A 5FLEX 2FSPA 4MH0R 3ZBQA 1JNYA 1F14A 4B2IA 5CVDA 2CV1A 2H16A 4KXQA 4LKOA 4OFXA 3KXKA 3I9V6 5GADl 2R2GA 3O8RA 3KOZA 4G9EA 3SS9X 2QSZA 3T1QA 3T4EA 2YS7A 4L0MA 5F4BA 1JEAA 1R8YA 1JB9A 3FFBA 5I48A 1RLJA 4DN6A 1VZ3A 1CD5A 3G17A 4A0QA 4EY5A 3BPSA 5IDWA 3KQPA 1HLGA 1T8YA 1K86A 3EVNA 4JSTA 5B12A 2IQIA 1JU4A 5AW8A 1M7BA 2ADMA 2D0IA 4DR6B 2VQDA 2DTXA 1UZUA 4KWEA 3QJYA 4H4CA 1JJAA 3Q2IA 4X61A 2ORED 1N3BA 1NAIA 5JXJA 1RQ7A 2Q5IA 2YIMA 5T5QA 2CBZA 2QL6A 2XUQA 1UKYA 1P5FA 2R96A 1NMEA 4O1MA 3VZDA 3WWCA 2Z6UA 2FZVA 2FUNB 2WTXA 3IDOA 3MMPA 2CNDA 4KMMA 2P2DA 1WNFA 4PX2A 5BSUA 3RRXA 4KPUB 2IOYA 2HRCA 3E5HA 4EFKA 4YXWD 5JAMA 4JVLA 2YL2A 1HY3A 3BMCA 3RSQA 1MJFA 4RACA 3HFSA 4MA4A 4YONB 3SZUA 1GGVA 1VI5A 3ZHSA 4Q9NA 4ER3A 4NCBA 2ZT6A 5E6RB 1GQSA 3E05A 4GZLA 4RHCA 3Q7RA 3MXTA 3DBLB 1FDOA 1XMJA 1T15A 2OHIA 2BFMA 3D3WA 2ZUBA 4L8FA 4MCJA 4XPIA 4C7VA 1EUCA 2FZEA 2FSGA 3ZK8A 5KMGB 1UF9A 3G2LA 2I99A 3MF4A 1D7OA 4RZHA 1L5HA 1ZFNA 3T3DA 1RHRA 4G07A 2O1WA 1UMCB 4XX0A 1I51A 1JJVA 1KMIY 4R0VA 3A28A 1HNWB 2BEKA 1PGPA 4TT3A 2ZU6A 3KYDA 4D9JA 4UTVA 3RCBA 3TNDA 1EVEA 3IOCA 3N3BC 4BB6A 4OK6A 5BSKA 2IYYA 3UW3A 1US8B 1VJ5A 1D9ZA 1G8SA 2IHUA 4HBGA 1J00A 1L8LA 4X84A 5CDGA 1TLTA 2Q2NA 3ZCVA 1NW6A 2RHDA 1N6PA 3NTOA 3S7TA 1HEYA 4DV7B 4BFCA 1R4NA 5K99A 1IUPA 2VBIA 1ZXXA 1RM0A 2B9EA 2PGJA 5JPCA 1PZFA 4R84A 5EFOA 3C41J 5KTNA 1OR8A 5E4TA 2HF2A 4LVNA 1W36C 2AKEA 3OFNA 1IWPB 2XKBA 4IBOA 4Z8XA 5GGXA 1ATZA 2QAGA 2BFPA 4HH3C 3OX3A 4WECA 1Y8RA 1DIBA 2W2NA 1AQYA 2ZUCA 4EHFA 3I4LA 1OFVA 3LC2O 1GL3A 3LVQE 4ILEA 2ZBQA 4JLBA 3C7TA 3U16A 2I6GA 2Z95A 1RVDA 3NM6B 1H05A 2HJVA 4OQMA 2A9QA 4YV7A 2OBXA 4LHYA 3DAFA 2Y3IA 4PLTA 3M8KA 2D4AA 2WNSA 2A33A 3BSSA 5ELLA 1Y7HA 3RHFA 4C4OA 2G1AA 1L5FA 5A5VA 1KK3A 2RMKA 1S8NA 3ODGA 5BSEA 2ZSKA 4P4SA 2YXNA 1A88A 3BHIA 4NYJQ 1VCNA 3KYIB 2PTGA 3M6XA 3R7FA 1XNQB 1G3IA 1MHPA 3LKDA 3AO0B 4UEOA 3AFIA 5FUBA 2IPMA 2O7NA 5FPYA 1WQ4A 3U3ZA 4QLOA 2LIPA 3W06A 3FOEC 2GQ0A 4HYYA 3ZCTA 1OFHA 3WLAA 1FP4B 2G08A 1L7EA 2YW9A 5F2KA 4DOMA 2VDWB 2JA1A 4KR6A 3WGVA 1USKA 3EIUA 5EMLA 1K4KA 2A3RA 3GBPA 3L0SA 5FQNA 2PG3A 2Q4OA 2QM7A 5U1PA 3SMVA 3TVYA 5DNYB 2XUOA 2O5CA 1WVGA 1TIPA 3OCYA 4CKBA 1GG9A 4KQCA 4RNCA 3SFZA 3WGOA 3DLPX 4KWCA 3U1TA 3UG6A 1XDSA 1CR1A 3AKEA 2RGGA 3G0OA 3D0KA 3HJRA 2I7TA 2B0JA 4KP7A 4BNZA 4CKEB 5E9QA 2DKNA 1Q50A 5F64A 3EUWA 3LPLA 1J7JA 2DLDA 4AQDA 2YVUA 1M74A 5CYFA 1YKSA 4FQ8A 4NBKA 5F1YA 3VPSA 4A5SA 4CM3A 3QELB 4XOUA 4ZALA 3JQGA 5TIIA 2AFRA 3ZCPA 1Z62A 5MN5A 3PX2A 4TYNA 1PJTA 1XZMA 3E3NA 1QNFA 4KQFA 3OEED 2OLEA 5K4GA 3DDNA 5CEFA 2X4IA 5AW0A 4NBSA 1A8PA 3M9WA 4IVQA 3LNCA 3EGDA 3A2NA 4LCEA 3I34X 1QPBA 4FE3A 2CBGA 4F7DA 3RAFC 3PLAE 1E3MA 3U09A 3E8SA 2WFZA 1Q1GA 3KCNA 5EMHA 2ZDQA 1XB2A 1PLLA 3SM9A 2VJAA 1BDBA 4JU9A 2HIMA 2RHRA 4Q7EA 1N5JA 2Q49A 4DDMA 2YHIA 4NXMB 3UAZA 5B3KA 5L3SA 3RADC 4B3MB 3TLKA 4DCVA 1II8A 4C89A 1FTQA 3LQYA 1IOWA 1GFSA 4ZRNA 3PEFA 2PFKA 1X92A 4LBVA 3QOXA 2FPXA 4GXRA 1YZFA 4R2JA 3G13A 4KXVA 1XYYA 5FJJA 5JO0A 3D7KA 1UJ5A 3RS5A 2Q3BA 2WJGA 2C8LA 3WDMA 5AM3A 4R8LA 4DRXA 4QHSA 4ALMA 4NMXB 2OILA 3E2PA 3S0JA 3ZU2A 1JVSA 4F9EA 3LWZA 3ICVA 4WLUA 1L8XA 1A4IA 4I46A 1S3FA 1DBVO 1PHPA 3AJEA 4EI7A 2O54A 2B7LA 3BL8A 5AW9A 1HDGO 1GNLA 4F72A 2QMQA 1JHVA 4HB0A 2QT1A 4A6EA 2WHPA 3LW7A 2IZ6A 1JJIA 2ZI7A 4GEKA 5AVXA 1J06A 4MQFA 1YFJA 2NZWA 5CX1B 4CNQA 5CCBA 3JWGA 2WWWA 4LW8A 4DLSA 2G0NA 3WICA 4NK5A 2X1HA 3RS4A 1YZYA 3R24A 4YGYA 4MLPA 2JIZD 3V3TA 1IZ0A 4PZAA 3WGTA 2AT1A 2IA5A 3WBFA 4MDEA 3M1IA 3D54D 3AEZA 4QSMA 3I39X 5T4BA 5IDQA 1LVUA 5IVIA 4N6NA 2BEUA 4RH1A 4CL0A 3PD0A 1G6OA 4G5GA 4IUCS 3R75A 1T1IA 2J9FB 3C6YA 4OM7A 2IS6A 2NU7B 2FW6A 3A4MA 3CH6A 1EK1A 1NZJA 2Y6UA 5JFGA 2WF8A 1BCRA 4EIWA 3A4NA 3WE7A 1PL7A 3EY9A 4BQSA 3L8HA 1FSSA 3ZE0B 3EVDA 4JSYA 3TMYA 2FK7A 3W6ZA 4CFSA 2FRDA 3ETGA 3O91A 1PZGA 2C5FA 4EL5A 2HN9A 2PV0A 1P81A 2JFVA 4EMBA 2VBCA 1U2PA 3FMGA 2VI5A 3NBUA 2VJYA 2IODA 4AB1A 4CI0B 3UUWA 1TVMA 2WJIA 5AUQA 2ZGVA 2IYQA 3PDIB 2OA0A 1QE3A 1FFWA 1CEQA 1EB9A 1Y9DA 3O1IC 4HTFB 1LPOA 1ESEA 1ZJYA 3VO8A 3WLKX 5JNLA 2CCKA 2VJLA 1A96A 3AEKB 4TTAA 4AYXA 3WP0A 2P7IA 1KQOA 1G3MA 2QVLA 1ZNYA 2PO5A 1Y4ZA 4O08A 3IP1A 3HHEA 1JEOA 1TJ4A 4HQNA 4F6RA 3ELDA 3GLFE 2A14A 2XAUA 4O2AB 3DZCA 3EA4A 1EGVB 1KOFA 4YMWA 4JLVA 1QAQA 2JVIA 4QU0A 1FIUA 5K3DA 3WLQA 3EIXA 2WHRA 3A27A 3S40A 3GN1A 2FKNA 2ZITA 2OZLB 4D4MA 3AW8A 2OECA 1OXMA 3WIBA 2WIFA 1DEKA 4F38A 1I7SB 1M2WA 3C97A 4RY8A 3UPDA 2Y1WA 3UK6A 2IWHA 4UM9B 1V8OA 4Z2YA 3ZV5A 4E7PA 1B0ZA 1VHTA 5IJ0B 2NV0A 2P0YA 4ZARA 3BXFA 3A1WA 5KSWB 2XMRA 1VJGA 3CIFA 5AJXA 4O2AF 1ZD5A 4EYQA 5C4IA 5AMXA 1A5BB 4HMOA 3U7GA 3W5UA 3GGCA 4LDPA 1D7AA 1UIMA 4WZAE 4J90A 3RQSA 3BS4A 4YCJA 4M1SA 4BWYA 2YJZA 5JBNA 1FJGB 4BN5A 2RGUA 3GJTA 1FDRA 2YQ4A 2Z98A 2ZBGA 1ADCA 3KRTA 1ZEJA 1XMPA 3B7GA 1OY1A 1AZTA 3R4VA 2O2JA 4PTZA 4U2BA 3SKYA 3U56A 5DYTA 3O4IA 1V37A 1R6DA 2EKZA 5L3QA 4BYGA 1XMXA 4TL6A 3KKNA 2HREA 3F74A 3QIVA 5TR9A 4D46A 5AXBA 3UNXA 1DAGA 1ZISA 1KO5A 4D79A 1QP0A 5I8WA 1W1WA 3REQA 2VJMA 4V0KA 3HR8A 1ESMA 4JK3A 1MZVA 4PXSA 1EBUA 1EB8A 3A70A 1TUBA 2OHOA 1RJDA 4TS1A 3CJRA 4KGDA 4QHTA 4JEUA 2NU9B 3FYTA 1EWVA 3NDJA 1JA0A 4Q4AA 4MUFA 3PQCA 3N70A 1ZYUA 3JQBC 1QSGA 1LJ8A 1KORA 1PGJA 1AUQA 2H7YA 1H3NA 1V8ZA 4IYJA 4XQCA 3RLFA 2GDZA 4OB8A 1EDBA 4M0UA 4HLNA 5L9AA 1T2AA 4D4KA 2AX4A 2V54A 5CRIA 2HO4A 3UK2A 1UDXA 5JI3E 4JUDX 6YASA 1SG9A 1V5GA 2QUAA 3ITEA 1VG0B 3H1FA 3PS9A 1VJTA 2V6JA 1RHUA 2BI8A 3DLTA 3FFAA 4C5AA 5GIOE 1FFCA 4D6YA 2QRPA 3KUXA 5D85A 4F60A 2WWFA 3E70C 4Q1AA 1BXRA 1M8GA 2NVUB 2LPMA 1EWQA 3RVSA 5JCXA 5JROA 3DUFA 2DR0A 2CMGA 1I5OA 1JFVA 2Q07A 2GKGA 3Q15C 4GVPA 2NU8B 3CVUA 1DCTA 2UUBB 3H2IA 3PNPA 2PUGA 4AJEA 4N1AA 1CU1A 1V11B 4FUTA 4H15A 3OTWA 4RK5A 2VHCA 3GEEA 2WE8A 5L4LA 4IM7A 4PO8A 3A6LA 2YZNA 3ZKWB 2OPBA 5ILGA 4L3WA 1XXHE 3W4KA 2OCAA 1OE0A 1W5EA 4EUSA 3A6KA 2I34A 1ZWLA 2IYVA 4GKAA 3QUQA 1NULA 5DXAA 1XHLA 3TMKA 4PU0A 1V6AA 1SUIA 1E1QA 1T6XA 4CZ2A 4DT1A 3PZRA 1IJKA 1S96A 4X3CA 3UB2A 3U4QA 1TU3A 2CUNA 1O5OA 2ZJ3A 3AVYA 3EJWA 2ZTHA 2PQMA 4MQEB 3L7BA 2ZYWX 4V0MA 2AZ4A 1IHOA 3KR1A 3MJFA 3SYKA 3QKWA 3B1FA 4BVGA 2QT0A 4FINA 1CIVA 4C0WA 1PVOA 1DU4A 1NN3A 1WXHA 2C59A 3MMZA 3TGPA 4IP0A 4G0WA 3FDFA 4OJQA 2YJNA 2AS0A 4IOJA 4Z51A 1ZAKA 3QSYA 5DIFA 2R25B 3PUWA 3OFSA 4HDNB 4MR8A 1WVMA 1XRQA 1RJ9A 2FRVA 3CUSA 3OOHA 5FRDA 5HE9A 2V96A 5A4DA 4N5DA 1R0LA 2ZIZA 1JR3A 3DNPA 4FYXA 1E2FA 1H2AS 4UC0A 4DQ0A 2CY0A 4WIAA 1XMOB 1JQDA 2G7MC 4J4BA 4YRZA 3CXUA 3AJ9A 3TKAA 2ZVDA 1ULUA 5KNDA 1NI4B 2QENA 3MJHA 4WLFA 1NC1A 2N9UA 1T9HA 2ZI9A 4F2HA 1GVNB 5JCZA 1U81A 4YAGA 3IC5A 1R6AA 3J7TA 3BILA 4PV7A 5B7GA 2A8YA 4EF5A 2H4XA 4NTZA 3KPUA 1S9DA 3VZRA 4E4TA 1NNI1 3HKDA 3HSYA 4HGZA 4CKCB 4HDMA 3H2SA 2QLMA 1XZPA 1YJQA 3UWMA 1A04A 1A5SB 3C3YA 4NNPA 2P5TB 3AEXA 3M2PA 5SZKB 1WNTA 5U4QA 3FHJA 3I53A 4LWQA 1PG0A 1YZQA 3AG6A 3Q3GE 4GNKA 3H2ZA 1VLMA 5BO5A 2WWRA 2P3LA 2CDAA 2VQ3A 2VUTA 2Y0BA 4MW7A 1HDCA 4AP5A 2R47A 3H9CA 4RADA 5T6BA 3IERA 2ERCA 1JPNA 1O94D 1W88A 3OCZA 1C2TA 3HVJA 3K72B 4ZVRA 2ZBPA 1R66A 4Z1MA 1PW7A 2N42A 4IOMA 4CLRB 5CBPA 4REMA 2CDBA 2YH2A 3X1WA 1BKDR 3A4YA 4R71A 4TSKA 4Y6SA 4I2NA 4Q3BA 1XALA 3PGMA 3EPHA 3RBXA 3PFHA 3HU2A 3FDIA 4FZJA 2YXLA 2G06A 3ZLJA 1U7UA 2CLFB 2O8BA 3IP3A 2ORYA 5HQ3A 1P8JA 1RMYA 1Y9JA 1ZMBA 5FL7A 4UHFA 5DBHX 1ZNQO 4JR0A 3WWDA 1WV1A 1KRXA 1M1YA 2R8EA 3LO5A 1YJ5A 2JKZA 3MB8A 5EPOA 3WKAA 1G66A 4Q1CA 5F33A 1QO0A 3B20A 3TSAA 3D6FA 3MB5A 4ZQIA 3GLIB 1EAYA 3H84A 3N6RA 4RF4A 1E2MA 3KM0A 1ZRMA 3L7IA 3D2CA 1QTQA 4WCFB 1JFLA 3T4UA 4A9AA 3OQJA 4E5UA 1RWPA 3SK0A 3VNRA 1ODKA 2GPSA 4JU8A 4JD5A 1BFDA 3LH5A 2LGJA 2E6UX 4E30A 2EBHX 2V97A 2YFYA 4AXXA 3I2YX 5CB6A 3WGNA 1RAFA 3NGXA 4LZZA 1EM8A 2WUVA 4B7ZA 4IO0A 4XJTA 1T91A 4HEA1 1VYUA 1IXZA 1NY6A 1SXIA 2P3QA 1WEKA 3FJ1A 1ONBA 4MVJI 4CM9D 1BYUA 1UPUA 3CLSD 5JQGB 2XZDA 3H1TA 1I6LA 2DSNA 1LVHA 2E0IA 3RS9A 5I9IA 4ZZIA 1QLWA 1FFAA 4QQFA 5H4HA 1R0KA 3C1AA 3HMQA 2W6NA 3NDRA 1FA9A 1S1CA 4RW0A 3TW0A 2CNOA 1U0JA 3EXIB 4LMBA 5AVVA 4KR7A 1LBQA 4KUHA 4S1WA 5HZHA 3WI7A 3L0ZA 5K09A 3D3QA 3RT1A 3V8QA 3W04A 4NYIQ 2ZR0A 4IRMA 1WBJB 5CYPA 4Q3LA 3E9YA 2AN3A 2IF0A 2WYOA 5HZKA 3JWJA 1H1LA 1WX1A 1GN8A 3OQPA 4JB8A 1PJBA 5BNWA 3QVWA 2P1ZA 2XWSA 3KT0A 1OB2A 3VFDA 3A10A 3U4HA 3GQBB 5JQGF 1X7YB 1UFKA 2G70A 3GIDA 2NQ2C 2BUCA 3KVOA 2FPMA 3AR7A 3EWNA 4UM5A 2IIPA 1LW6E 1FSZA 2ZE5A 2O07A 1W47A 4RGVA 5L3VA 1UK6A 3C5EA 4LWOA 2BMEA 2WT8A 5EXPA 3FD8A 2NTJA 3AGPA 2IFTA 3MWEA 5LKRA 4TL7A 3GARA 4FLMA 4TWZA 4OOEA 2XD9A 3EDQA 3PSHA 1X7XB 3IE0A 5TY0A 4B3CA 3I4FA 4NYMQ 5EJIA 2BZSA 1TO2E 3CC8A 4BX9A 3RGWS 4HZUA 1Q0RA 3FZYA 3RRFA 3U4DA 4MKIA 1F8FA 2QTTA 4TZKA 3QKSA 2RCYA 3A9RA 2EF0A 4EB3A 4RQTA 3Q0EA 1E2JA 3Q72A 3AFNA 1N92A 3FYUB 1OROA 1UFOA 2Y2UA 1TMYA 2X40A 3PBKA 1ZMTA 4Q93A 5FTLA 2A0KA 4YAKA 3D6MA 4Y2HA 4LE1A 4WE3A 5HOEA 2AG0A 2V9PA 2IDZA 1OX4A 1J5XA 1DBPA 4PCVA 3PTLA 4MPJA 5JE8A 1U1FA 1H8ED 3EWIA 3QI7A 4Q4LA 5BMOA 3UKDA 1NLMA 4RTQA 1TL7C 3PIRA 4BWGA 2JLUA 1TYAE 3HC7A 1ZHFA 1ECBA 2GTHA 5JEEA 4FDMA 1MLDA 4LC9A 2ZRPA 3NLLA 5JDIC 1PV1A 3FH0A 4XIYA 4GMKA 5T64A 1P4AA 3TLZA 2O8FB 4W9NA 1DEXA 3I45A 3G7SA 2J3LA 1AUOA 2XVZA 1NMXA 3ND5A 1E5QA 1ST3A 3BE8A 4IZHA 1RFGE 2HBZA 3ZI7A 4PZCA 4LSZA 1U7WA 3QHPA 4OP1A 4B1FA 2JIQA 2IXAA 3HB0A 1Y1RA 2JJ2D 1PFUA 3TTYA 2P0EA 3CNHA 5AUNB 2V7UA 3FNHA 3PJEA 2HJGA 2H29A 4RTPA 3HV0A 1J97A 4RAOA 3VDXA 3ICEA 1B1AA 1C7EA 3JQDA 1VHQA 2WJ4A 1BKSB 1YB4A 3CB4A 3IKTA 1ZA2A 1SUFA 1I5EA 2WTEA 3EPPA 2BKAA 3TIIA 1ENZA 4AICA 5LIRA 4YMVA 2QTHA 5FKJA 2VTBB 2J0EA 1GT6A 3B8HA 1P5HA 4Y0AA 1KP2A 3OESA 4XX1A 1G1AA 5EKSA 1VYTA 4YRBA 1YFKA 1EFKA 2HK6A 4IEEA 3WHLA 1HT2E 1VSTA 4KQEA 4N3BA 3IELA 5FWDA 3HI4A 2Q5JA 4PAQA 1XPJA 4CIWA 3A9CA 1WKBA 3MCVA 5EYPA 3B51X 3BZBA 1OH6A 1L7QA 1ZJ5A 1ZSYA 1RI2A 4JT8A 4RIIA 2BY4A 2ZIWB 3N8IA 3IPXA 2CKMA 5EHNA 3IT3A 1LLDA 5E7MA 3GL9A 1GUYA 1YJ8A 2GYVA 3PF9A 3BRSA 2ZYGA 1GLNA 4RVSA 2VP9A 1JVNA 4OY3A 1E9VA 2C4HA 3GVHA 4FU0A 4J0HA 4MRPA 4BVKA 1D3AA 4D2IA 3N8KA 2JGDA 4V3BA 2C94A 2AE1A 2J5QA 2DFTA 2Q5LA 2QMHA 3H2YA 4RTSA 4AJKA 4BYMA 1R0SA 3K92A 1ACMA 4P8RA 5ICMA 2H1WA 3MGGA 1AHHA 4M9CA 4BU0A 3MAGA 5H3CA 1LNSA 5K0BA 1DJLA 1GG2A 1M54A 3RSGA 4E11A 5HW0A 3DZFA 3GHYA 1X7WB 2PD6A 2VJNA 2WG1A 4K2HA 2SCUA 3LJKA 1FE8A 4IHJB 4PNPA 1X7ZA 3GT4A 4BNLA 3DBRB 1QK3A 2IYLD 1JV2B 3ADPA 3BBPA 4U8HA 1POXA 4C6HA 4ZMBA 2QD5A 1RYNA 2XVXA 5AVTA 3ZN2A 1NPYA 2V8OA 1DTWA 4B87A 4F5ZA 4M1OA 3JX9A 2DH6A 2QP9X 4G4IA 1KDRA 2UYHA 1C0LA 1P7ZA 3W8EA 4YCNA 3MEQA 4IEIA 4MW4A 3ZIAA 3VJLA 4UTRA 5DHSA 2EBFX 2FW7A 3VU0A 4G2NA 5H83A 5EERA 4FC6A 4IHJF 2RK4A 2QYSA 3GA7A 1QK4A 2IYTA 5HDBB 1IBKB 3PC8C 4K8OA 2FE4A 4DJDC 6PFKA 4QTZA 3FWKA 1DKNA 3ER8A 3IVXA 4CF3A 2VR1A 9MHTA 4Q3OA 2C98A 3NT4A 3SQLA 3FDJA 4CLDA 4G0VA 4OH1A 4YLEA 3V8EA 4B4WA 4JI2B 1Z18A 3H5WA 4UBKA 4WERA 1Q0LA 1VFNA 1VCOA 4QTYA 3TEJA 4DS3A 3ZC3A 4C0AC 5U9CA 2W6PA 2BKUA 4QYSA 2HH9A 1N0WA 2AN4A 3G89A 1QQ6A 5IVHA 1OCEA 1E3JA 1HE1C 4HC4A 3P9IA 4NZMA 5BRJA 2QORA 2IYUA 3OLCX 4EDHA 1GUBA 1U94A 1YQTA 2J32A 2PKRA 2WUEA 1JHPA 5GONB 2I54A 4K03A 3JQ9A 4PZ9A 1KOLA 4ZV4A 3RDPA 6REQA 4MVJA 1TEVA 3WBKA 4B3GA 2XMSA 5HM8A 1EXVA 3ESCA 3QVGB 1G9SA 4H9GA 2O2EA 3S44A 5JD4A 1J09A 2IVFA 1X80A 2Q2QA 4MIOA 3UB4A 3B9QA 1GKLA 3RF7A 2C61A 1P19A 2RHGB 2YR0A 3A1EA 3M0EA 1NVXQ 3TL3A 1Z4MA 3PNMA 2FFBA 1ZU4A 1D8TA 4XASA 5F9FA 4RV5A 4ZGBA 3W5CA 1RHKA 2JLRA 5GONF 4GP9A 1KMCA 4U3JB 4EG4A 3ZKAA 1LH0A 3CF4A 5ICEA 1S8FA 2VSXA 1PUXA 1SR8A 3KWMA 4TWRA 1JTEA 3MSXA 2LBPA 2YDYA 3D8RA 3G9XA 4IS2A 1BYIA 3BL6A 4K9RA 5AJWA 4EJFA 3UJAA 3UMCA 1C3JA 3HWSA 4XQGA 3DZGA 4MUIA 4B76A 5F23A 5I7SA 2YXBA 3HHPA 1W59A 2G8NA 1W2HA 2LIVA 3C7DB 1MD9A 4BFTA 1NSFA 3D2LA 1HF3A 5I7OA 3MPUA 4FHFA 3ZXYA 5K2OA 5CW2A 4J2OA 4XIFA 4QGBA 1HFKA 2HMTA 4PC2A 1D0VA 4OGWA 5EI5A 2BSQA 1QXSA 3V8BA 3VO1A 1L4NA 1A50B 4MVWA 2EFGA 5HBRA 1Y82A 1ZSVA 2ZUFA 1C1XB 2I22A 1AD2A 3KZVA 2D7JA 1P0IA 4CE6A 1OXVA 2HOQA 3P19A 3UV3A 4A10A 3G8YA 2QV7A 3HFJA 3UZUA 3K0FA 1WSDA 4PCLA 2BR4A 3KYJB 5COBA 2WJJA 3KTDA 2LNDA 4ZCSA 4BE9A 2VK1A 2VEOA 4MW2A 2Q1WA 3BAZA 4QPNA 2J9RA 2XWJI 4HNAA 2QJTA 2UYQA 2IWRA 2O7SA 2H54A 3H4TA 4WWHA 1XVUA 1EXNA 1ULZA 2ZYHA 3DQZA 3C98A 3NR2A 1AK2A 5JJBA 1Q21A 3C87A 5CJ2A 5HQTA 1KIFA 4WVFA 2GZ3A 5F9MA 1W44A 1Y6QA 2OESA 3JWEA 3KV1A 3L1KA 2XUGA 2JB9A 3TLYA 4CM8A 4EG1A 3RC8A 2XUIA 1E32A 1Z15A 3OIGA 3RUEA 1BHSA 1DO2A 3HCPA 5ADHA 1RABA 1H8HD 1UKZA 3WYDA 2AXPA 4AKSA 1YRWA 1TJ3A 2A59A 5CDHA 1G7CA 5CFMA 2PSHA 1TUIA 3ESAA 4P4NA 3WQHA 1T9CA 3BTVA 1IZYA 1RQGA 3R9KA 4Q24A 2KYRA 1P3DA 2W6OA 1G9XA 1Q95A 2ACEA 2VXCA 3JAWA 4FZVA 3UXHA 2CV2A 3HU5A 1P5JA 3GJ7A 1UBGA 3V8RA 2QXTA 1OBOA 3P9NA 4X8OA 4EQ6B 2EZ4A 2OUIA 4Q1BA 1GDDA 4FXPA 1G2IA 1X1RA 4RXMA 3M34A 2YIVX 1DDIA 1W5BA 4NOMA 3NBXX 4XDGA 3UKJA 4FFDA 3MRVA 4E6PA 1W8IA 3GRCA 1N1MA 3EXG2 1A9YA 1ZQ9A 4MEJA 2X4LA 1JPJA 1M8JA 3CPJB 3MJDA 1Y42X 4WEQA 5IBQA 4ZJPA 4ZO7A 4LRSB 5JBQA 2J3KA 2GYYA 1R5JA 1EBBA 1Q16A 3DE7X 2ZJ5A 5L8VA 2GAAA 4U7WA 3VMFA 3TIGA 4EEKA 2Z3VA 2E87A 5AUPB 3VO9A 3ELYA 2PUWA 4DCSA 2CYBA 4NZNA 1M73E 3JXEA 4I19A 2W6QA 3DAOA 2OQ2A 4X0EA 3MTGA 4UTNA 2IRWA 1E79D 1DFGA 2ZU0C 2MWMA 3ZLTA 2ZAGA 3RS0A 2A7QA 1ZD4A 2XGJA 3AEQB 2I2XB 4NDAA 1JQBA 2DPLA 1F2UA 2NIPA 4REQA 3RAPR 3PR2B 4JUCA 1CRQA 4N01A 4J0DA 2G04A 4KQXA 3K2BA 1IG3A 2AXNA 3K31A 1U3UA 2MYPA 3ORQA 3PE4A 4AMBA 5C4MA 2X2FA 1OASA 2WT4A 4TMKA 1LBHA 3DDWA 3TLGB 4PS1A 2M6SA 4IJ5A 1AQIA 1LQ2A 2NV2B 4S0XA 4DIEA 2A86A 2VDVE 2Z5GA 5KVCA 3FR7A 4K9PA 4DSAA 1DAPA 1K8ZB 1C1YA 1CS0B 1U7HA 2FEAA 4HYEA 3VVMA 1JTVA 2VPWA 4U5QA 2C9CA 3AVVA 1JDJA 3I37X 4NE9A 1NWHA 1U8EA 1ULAA 4LJKA 1QCZA 4K2AA 2X19A 4DVJA 5FOXA 4R8RA 2B8TA 3ET5A 5DSXA 721PA 5A4IS 5JCPA 2DJIA 2SNIE 4RLHA 4TQAA 4TSFD 4B7AA 4OLBA 2MYUA 1B16A 2RGNA 3COYA 2F8SA 1MJ5A 1Z8DA 4K6CA 1FFXB 2P8SA 4NE2A 5DV9A 3C3EA 3TKLA 2I0FA 4KGXA 2DHQA 3DG9A 2PCLA 4GDMA 1IPFA 3R8XA 3G49A 2AEEA 4K1XA 3B52X 3OCWA 1UKVY 4IKOA 1HDOA 4EELA 2GZHA 2RKBA 2RKWA 1JSCA 2H1RA 1KZ6A 3GVCA 3ISJA 3F8TA 3LFTA 2VVTA 5KVAA 3ADCA 2BM9A 4MTLA 2BTEA 4DIOA 2Q1XA 1PT6A 1ZNZA 1AK9A 4ZT3A 2QUBA 2YIJA 3BQNB 3B3GA 4R1SA 2DQSA 5DX1A 5EE3A 3VH2A 2OQIA 2C3YA 1NA5A 4PBSA 5LYJF 4FZ5A 4R8KA 3V2GA 1ZN2A 5KNCH 1A1VA 1J0AA 2DLNA 2OFWA 4ZOLB 1JIIA 4LXHA 5EJ4A 1JAZA 1AY0A 1UDBA 2F1KA 4UJ5A 4YO8A 5FF9A 5J4YA 2RHWA 3W1VA 2O3UA 4IH1A 4ZQCB 2G88A 3ZY4A 5CVEA 3L0BA 5KNLA 1HDIA 4WBSA 5BNZA 2QYTA 1Q1QA 2EGGA 1SPXA 5DHTA 1VL6A 3ANSA 3BH6A 4RHUA 2GH1A 1QIJA 3FCYA 4AIIA 1ZI9A 4ENPA 2WTBA 1L5KA 2ZXUA 4F1JA 1LC0A 1KTVA 4MI3A 1K6MA 3SQNA 3A11A 4HLUC 5IWCA 5TLSA 2XH8A 3TNLA 1OIXA 4ZIRA 3UJ6A 1NYQA 3U31A 4N49A 3WFIA 4CTNA 1QX3A 1M6VB 2IUFA 3TLAA 4DB2A 3BF8A 5CEJA 4YJFA 4Z54A 2B8WA 1BXGA 1UPXA 4UZEA 4ZOLF 5SYNA 3WK8A 4X93A 3ZOKA 1CUHA 1H1DA 5C7YA 1UEXC 2HDNB 3WXMA 1XP8A 3EODA 3EZGA 4RDCA 4ZPJA 3W2HA 1GSAA 4HVLA 2WW8A 1K75A 3F1LA 3AHDA 3EZFA 2VSFA 1C30B 5AM1A 4DV5B 1AC5A 5JCJA 1P5RA 3PCTA 4QG7A 3VYSB 3O8BA 5LP6A 1YHZA 4NYJR 2GPBA 5EKUA 1CUVA 4IIEA 4OB6A 3RE1A 3GRRA 3E15A 1OVGA 3N6XA 3UGKA 3TRDA 5ALGA 4KIGA 3KR9A 3NTXA 5CHYA 5H1YA 3UCFA 4ME6A 4OHOA 4IMIB 1U8ZA 1PEKE 1OLXA 1JTFA 4QVIA 2ZZNA 4BUZA 3T9CA 4B47A 1U8TA 2WIGA 2CLEB 4TXMA 1SAYA 1UK7A 2ODBA 2J08A 3JZMA 4KE9A 1HKUA 3LKZA 1OILA 2VJQA 4B32A 4DREA 5L53A 1XEWY 5FR1A 5MN6A 2Y1EA 1E2UA 4MPRA 1WRBA 4NKRA 3NI2A 5ENZA 4HX5A 4JN6B 3E61A 1FQKA 3E8XA 5FO0A 3KK0A 3O8QA 3GZNA 4XVCA 3BCUA 2DB3A 4HDCA 3EDCA 3L4KA 1C0IA 3BE6A 4X7RA 2DPMA 5IFLA 3LUJA 3ABZA 4UMVA 2XTNA 1P6UA 2W58A 3W5HA 4GLFA 1N1DA 2ES4A 1V2HE 2CF5A 4XR4A 4MUJA 4XFJA 2CLCX 3IAS1 2JASA 1WOYA 3N87A 5G0SA 4N76A 2ZUWA 3KX2A 4HDOB 3U1VA 3C5HA 4YQFA 1MO2A 3TD2A 2TMYA 4OBBA 2D0OB 2VCEA 1WHTA 3LRXA 1NQVA 1GILA 1HOTA 3TI9A 3WNZA 5I47A 5JLAA 2WHXA 3VR5A 1KJYA 3OE4A 1CJCA 2Y93A 4EOGA 5LZ2A 3U49A 1CQJA 2K6GA 4YS6A 4PFJA 3RASA 3RTGA 1GAEO 4ZGWA 3JRNA 4D41A 3TAHA 3NRCA 4JKOA 2Q21A 3U0VA 2XYHA 3ANMA 3V55A 1X19A 2BFEB 2DBVO 2QSUA 2D8AA 4RXTA 2BFDA 2OD2A 4C4PA 5HIMA 4H59A 4PSVA 4WBNB 5E8JA 3Q6IA 5DOZA 3FPBA 3UJ8A 4F1WA 2OLJA 2G5PA 1CUJA 2P67A 3K0AB 3U3KA 1Q12A 3QA9A 3R3XA 1R5NA 3KB2A 2JHPA 1RD4A 3CWCA 3N76A 3A3YA 4XUCA 1UJBA 2Y2VA 4LZNA 4ZCLA 1HETA 5E1MA 2IHNA 4FW8A 1NVUQ 4D98A 2YZMA 1W25A 1NUSA 2PRKA 2P2GA 2Z4RA 4EFDA 1R15A 2I4MA 3C1TA 4CG0A 2C8JA 3IJEB 3ZDDA 1XTVA 2D5CA 3Q2KA 2AFIB 4KWIA 2XMDA 3U7FB 5EJEA 1AMOA 4QYIA 4YJGA 3ZLUA 4PAWA 4ZI2A 4LYAA 1P60A 4PLPA 3O1HB 4TUYB 5JD3A 1GTJ1 4GPIB 2XGSA 6GPBA 3OZCA 5HMMA 3OUZA 2QAGC 3AU8A 3H1PA 3LQQA 2VKTA 1RKBA 2QWXA 1OHHA 2B20A 3P26A 1BMDA 2B6NA 3IUBA 1WPGA 3TE6A 2XDWA 1EDEA 2AZXA 4LNUA 5FCDA 5EUQB 2A94A 1V1MB 3EXHA 3M3HA 3NKLA 3LKVA 3OP4A 5CEEA 4MUBA 4OK3A 2R97A 4MV5A 1KJ9A 3HPQA 4IWYA 4KCGA 2B4YA 3GEBA 4MS4B 4O63O 4TLBA 5ESRA 3RVOA 4WT7A 1IHDA 1I4DD 1ISMA 1IFXA 2XD4A 1IN1A 3OHSX 1MAWA 3T9DA 4YPOA 1M3SA 5EWLB 3TDMA 3X2SA 1IZ9A 1OF1A 4BGVA 3AQIA 1MAHA 1T6BY 1YD7A 2P5SA 2Z3WA 4RESA 4X1KB 4ZVVA 3ZGOA 4HX2A 1KOJA 3LRTA 4ALNA 5BQOA 4IUBS 1HBJA 1M72A 3IDQA 1ZCJA 2WM3A 1GUDA 3DVLA 3TLXA 5HPYB 5JIBA 2GD1O 1NM5A 2HADA 2X8JA 1E2KA 3L2OB 4IDGA 1MTZA 1UBJS 2AJLI 1YS9A 2FPKA 5F76A 4LZPA 2HXSA 1RRFA 2OWDA 4TTQA 5AI4A 3A2MA 5C52B 2IX9A 2IYNA 1VHJA 1SQ5A 4EFMA 5JWRA 5T4EA 3T41A 1HSZA 2POQX 3OU6A 2M6RA 3ROGA 4ARBA 3FHTA 1L5LA 1BQ4A 4JLJA 2BBWA 5DLYA 1C4WA 2IHVA 4L0QA 3AR2A 5BUSA 1XMQB 1NMQA 2ODNA 4UAVA 1ZI6A 2O3JA 5HXAA 1L5NA 1SXJD 1MENA 3MWDA 4NENB 5A2GA 1ZW6A 4KFSA 3JR3A 1YL5A 2J9YB 3QNWA 5AW4A 3ZK7A 1CVLA 4CEHB 1V8FA 2VA8A 4W1QA 1BVYF 3V4RA 3F6CA 3L7KA 1FW6A 2QTRA 1OBCA 4AW9A 3H8VA 2XDYA 5JS6A 2JFZA 1XIVA 2B6HA 1NQ5A 3DTVD 4J75A 3UV6A 1QAOA 1VLZA 3UXEA 4EGFA 2B35A 5JANA 3RUDA 1XCPA 2RGYA 3OEYA 1QPGA 3WVNA 4MTCA 3MWLA 5ALSA 2YQ5A 4NLLA 5CX4A 2ZWIA 3QVVA 1PFQA 2H18A 3K1JA 1GQOA 2DLCX 3IQWA 3H0CA 1ID1A 3UK0A 4LEIA 1JAYA 1P1HA 2VYVD 4PYJA 1TB4A 4JENA 5HRAA 1CW2B 2UAGA 3UT5B 3FPAA 4DSTA 1G4AE 5M29A 1Z0SA 2QTMA 4G4SO 4BE4A 1T8SA 1QHSA 5A4MS 1CHDA 3B3AA 4PO1A 1PR1A 2BMDA 3FB1A 3T0GA 1EK6A 2C5BA 3MNFA 3QWAA 1E7QA 1KXJA 1EK0A 4BAUA 3V80A 1T5OA 1JRLA 3PNSA 2Y9MB 1I2ZA 2PQ2A 3QPDA 4TKUA 4YP7A 4DJAA 3GF4A 1UWCA 4BV9A 3OA2A 4UHJA 5H9WA 2F3RA 1P4GA 2QTVB 5DCYA 3TQOA 2ZG6A 3ZV3A 2Z2KA 3TFWA 2IUSA 4C78A 2XV1A 1ZU5A 2BFAA 3NTUA 4FHDA 4HMPA 5C5IA 2C1EA 2Z5LA 3ILSA 4KH0A 1L4FA 5BWNA 1WJGA 3DE2X 5EZSA 4ND8B 2WYIA 4N54A 1T2UA 1XDBA 5ELXA 1J2UA 3ABOB 1N6IA 2AGVA 2E55A 4KWHA 4RWEA 1GDTA 1EFLA 1LA2A 3ZXSA 3T1TA 2PHZA 4OSEA 4HFMA 4XVHA 3LPNA 4DR3B 2A0FA 1UDAA 4WZZA 4NCXA 2ZI5A 3QOFA 3QVJA 1H4QA 4D0RA 3QF4B 1LPPA 4AS2A 3SXUA 5CFPA 2EFCB 1SEVA 1GR0A 2YASA 2WAAA 3H16A 5EIXA 2Q28A 4GC9A 5JMOA 1EUZA 5CJPA 5A6SA 1YA6A 1DC6A 4PX9A 5TF4A 4F2GA 3PPWA 4MKGA 4L1KA 4GT1A 4F91B 4X66B 3TGLA 3QPVA 2FRDC 3UTCA 4P3KA 3CQ9A 3LVFO 5F5LA 3VPFA 5LUBA 5CM9C 1PAUA 2WPDD 3GP3A 1ISFA 2QUKA 4K87A 4V0QA 3EXFA 5LQMA 4TX1A 1IXSB 5KB3A 1II0A 2GN6A 2H2GA 4NHOA 2V9ZA 3ESQA 1QIEA 2JIDA 2W8BA 1TKCA 2FN7A 3OLWA 1R4ZA 4CU2A 1PNQA 3ZOZA 5KKNB 2BTQA 4DVGA 3SBDA 5IMSA 3H6KA 4DJFC 3NBYC 4PLWA 1DKRA 5BSGA 4J91A 5FA5A 5BVGA 5L7TA 3HA2A 3QOWA 4N7BA 1TDJA 2Q5OA 1JLSA 1WMDA 1X87A 2UKDA 3DLCA 3E3LA 4OG2A 3TZHA 4EJ2A 5ALOA 2G3YA 3UHOA 2VAPA 3H99A 4PNZA 2XEDA 4N5LA 1LLFA 1KVRA 2X3FA 4IG9A 4DKJA 2ZUSA 4WKNA 3V1LA 2WKRA 4FUQA 4JXKA 4NCHA 4B3JA 3HBLA 1YRAA 2QRVA 1F2TB 4A8TA 4W5RA 1B2RA 4GL2A 3F4LA 3W2TA 1S2MA 2QGNA 3MGCA 1WWKA 3TRFA 1SXJE 4L75A 5BQXA 4NQRA 2EQAA 4KH1A 1QU2A 2IPXA 4PHTA 1ORIA 1XFAA 4GG1A 4G5FA 1YO6A 2V5VA 2DSTA 5AOBA 3L6DA 4OQXA 4CMEC 4MMYB 5I7EA 2O50A 3DP7A 4YCDA 3IIJA 2G9QA 1N6LA 4HY3A 2WFAA 1PS0A 1IHPA 3E58A 4ZAGA 2A1TR 1NG9A 3PNLA 4LX0A 3EGOA 3FE2A 3PCRB 5LQSA 3HUEA 3JARB 1EUQA 3PXDA 4JLDA 1MX3A 4Z7NB 4D6XA 1EP2B 1XPUA 2ZT5A 1L4KA 1AN9A 1WXFA 2HMUA 1OT5A 5KYYB 3DZDA 4X63A 7GPBA 4N8SA 2N47A 3NH9A 4U7GA 3VMMA 3BSFA 4FDAA 4ESOA 3LUDA 4WN3A 4O4JA 4X6YA 2WB2A 1IYZA 4LQDA 1E3WA 3L04A 3L18A 1L7BA 5KHAA 3GRYA 3NG1A 4G24A 3WK6A 4ABYA 4AZ3A 1SKQA 3GX1A 2AYZA 2R1UA 3M5WA 4WN9B 1Q44A 1XU4A 3B8EA 4P54A 3T3PB 4YYEA 1QYVA 1NXVA 4GZ5A 3HLKA 4JAVC 4G5OA 1R8SA 5IJAA 3UMYA 3T3OA 2GD0A 3CLTC 1W7AA 3EOAI 2QTLA 1SXPA 3BG5A 1LBTA 1MQ9A 2F90A 4GL4A 4IWNA 1KK1A 2WU3A 2DCMA 5EP4A 5JOQA 4ZCQA 4D8VA 3MYYA 3PLRA 2QR2A 1ZJ4A 4Y9TA 5AOCA 1RDFA 1SD2A 5AHWA 4QFBA 1YOVB 4BMXA 1JMYA 1DUVG 3SJ7A 1NLZA 1SHJA 1JEQA 1K5DA 2K2QB 3PRYA 3D7MA 3UWSA 5KOIA 5C3MA 1GN9A 4H35A 3BT7A 4QFDA 4PS0A 5D7BA 3INGA 5EZ6B 3TVDA 1EVKA 4C3ZA 4PSDA 1U98A 1J56A 2C1ZA 2H2DA 2B0CA 3ND9A 1LWOA 2JNWA 3AUJB 1PVVA 3IVAA 1SFRA 3NOOA 1HGXA 1R4MA 2Y1FA 4WLVA 1R7RA 2QLFA 3F6RA 3B3FA 3FWHA 3RM3A 1R00A 3T3EA 5IM4F 4RDHA 5FO1A 1HOXA 4MIKA 5T3YA 1U2DC 3ZZTA 3PYLA 3O83A 3Q2OA 3HFGA 4DQVA 3R09A 5J3JA 1JL3A 4Q3KA 5ALUA 3E81A 3O74A 4BJ1A 4YYZA 1V5FA 2DHDA 3KXLA 4IDOA 5BW4A 2G1PA 3LBAA 5E7JA 3LXXA 3CVVA 4NHEA 3PQDA 4Y2TA 1N2CA 1F8XA 3T1NA 3F3MA 3WWPA 2IITA 4DGQA 4U7DA 5JSZB 4KK3A 4AUNA 4QGAA 2NP7A 4NABA 2C3PA 3PGA1 4UU1A 3SSAA 5M7EA 1CRWG 2DPYA 3PRJA 2G4CA 2A78A 1EE2A 4NYIR 5CH8A 1AH2A 3VISA 1UBUS 3GFBA 4Q3AA 4BTVA 1ZH8A 4BCBA 4JMLA 1PGQA 3GFFA 2WJPA 1YULA 2DHEA 2RARA 3QMPA 4TMXA 3EIOA 5TQ2B 4BBAA 3FROA 1JYSA 2OOKA 3KQMA 1KI2A 5L7WA 1WR8A 1Y8ZA 4YTEA 5D8DA 5ECDA 3EMBA 4ZICA 3UC9A 3QEAZ 4G85A 3QEOA 1KOGA 4HJRA 2HO5A 3OJCA 1HDRA 4OXYA 1QFMA 2WM9B 4MRMB 3H2KA 3WGKA 2I91A 1F38A 1HXHA 2C2HA 3OCXA 4DM3A 1PEAA 4FYJA 5HGJA 3L41A 4E4RA 2BBTA 1W34A 5FI3A 3OJWA 1SBTA 4M3NA 4LN1A 4PHFA 3TINA 3DP9A 2QZPA 1BIFA 5I4CA 1VHLA 4K6HA 1DRVA 2GBLA 4E94A 4IDAA 3D3KA 3R7WA 4N82A 3EXEB 1C3EA 3KT6A 2W22A 3A3KA 4JJAA 5AICA 2WY2D 5C3UA 3C39A 4OQYA 3VKFA 1IPHA 4WUTA 4QLBA 5D3ZA 2ZAYA 3MCZA 5BMVA 2AWNA 2ODWA 4ZYUA 5JYEA 5KTOA 1NZDA 3GJ5A 1RM3A 3VKWA 1AKEA 2QRNA 3ER9A 5L6MB 5ISMA 1ZZEA 3NIDB 1R0YA 2H48A 3SC6A 4NV0A 2W8ZA 1JIXA 2JLCA 3JR7A 2Z4SA 4FLFA 4XSHA 4WNCA 3R23A 1B8PA 5DN6A 4X41A 2NUTA 3D7LA 4MS1B 5A7FA 2P27A 6LDHA 4Z53A 1JA9A 3IBYA 4CMBA 4U00A 4AXBA 4YN3A 3FYDA 5JYDA 2A9VA 4HGQA 1G19A 1KE2A 1PBTA 2I6TA 2FSVA 2RHJA 3TW8B 2F1JA 3RYCA 2PMBA 1JWLA 4NFHA 4IKPA 3UJ7A 4O4HA 4M8NE 1FP2A 1BDHA 4LRXA 2C5GA 1U7ZA 5DW3A 4ZHQB 3LLMA 1GAJA 4A7PA 1OXUA 3MS2A 4WASA 2PUEA 3HUUA 4EGQA 1Y9AA 4RPCA 5C7IO 2BDTA 4OLFA 4R2LA 3CVXA 2X76A 4FFLA 1A95A 2Q3HA 3K5IA 1LNQA 2WIKA 3I3SR 1R64A 4N0QA 2ZB8A 3P0IA 1E9EA 1IRXA 3F47A 4ZTBA 4GI7A 4M38A 3GFRA 4FFRA 1JAIA 3NYWA 1ETUA 1WS6A 1NX9A 1RZ3A 3SNKA 4AMZA 4D81A 5JC1A 2OKGA 4LRQA 4L22A 5MN4A 1IDN1 1LFAA 4P2GA 4U39A 3CVWA 5JRDS 4NCIA 1BDMA 2E4XA 2H9IA 4ZHQF 3NC1C 4AZWA 3O8NA 4ZDJA 1GA4A 4OP2A 2CT8A 1CULC 2E21A 4P3YA 1E1RA 5DBIA 4NG5A 3ETNA 2JCBA 4I08A 2X42A 4P3XA 4BEVA 2XUJA 3CSSA 4PZUA 1NOJA 4Z3DA 1CVIA 2FQWA 2JGEA 3AW9A 1JLHA 2Y99A 1V47A 2GHQA 3ANTA 1FDTA 1HT3A 3BX1A 3P27A 4M0PA 4EA9A 2HHAA 4QXMA 3C4VA 3VYRB 4X20A 3A37A 4JEHA 4FOTA 2AD1A 1TK2A 3B5EA 4K9OA 4KXWA 1ZH4A 2UVPA 3THWB 2HA5A 3USCS 4OXNA 2VC2B 2ABWA 4AF7A 1YZHA 3G23A 1DQZA 2CDCA 4ISBA 2ZYUX 2PKYX 1OWNA 3JVEA 3NWBA 3NTRA 4LKRA 3RU3A 4DSZA 1ZN8A 4F1KA 1JQ3A 4UU8A 5DIZA 1MDBA 1PKEA 5BWCA 2IZ0A 4KMOA 1T25A 4CETA 1QU3A 2AN5A 5K0FA 2XR1A 1F6DA 3OLXA 5DNVA 1NJ5A 5CLIA 1KQFA 3LUHA 2NMVA 2BONA 2VYCA 4BP1A 3H2BA 5B1DA 2GM5A 2PGDA 4W1RA 1XZBA 2XCOA 3LP6A 4MI1A 4RCYA 1NRJB 1JDUA 1V26A 3F90A 3HEAA 4IKEA 4YMSA 3TZKA 1R1DA 4QZVA 3LBYA 5DWQA 4C0KA 3E3OA 5REQA 1JKJB 1AQ6A 1ZM3A 4CM4A 3AVWA 5JALA 1UK9A 4H3HB 4AUMA 1WL8A 4WNAA 1Y5NA 3NIBA 3GN2A 1K27A 1RLTA 1U1DA 1ZCBA 3HKCB 3OFND 3OO0A 2A5GA 3NWOA 3KXPA 1VA5A 4WDQA 1VJDA 3SC4A 1SY7A 2YXPX 1JHXA 2PCJA 2ZRLA 1E6WA 4FNAA 1GARA 2AHOA 1YZKA 4TWJA 1K97A 3JQQA 4S0ZA 5K0LA 2ZUVA 1R6VA 4J1QA 4RENA 4Q4HA 4Y2QA 5DBEX 5DU2A 1UZNA 1NATA 2EW2A 1YTLA 2QL7A 2QP3A 4EPVA 2PMEA 1FQWA 5JY6A 1SBYA 3FOBA 4CV1A 3C3XA 2CL7X 2IHJA 3QG5A 4G4SP 2QM0A 3KCQA 3LOQA 5ETJA 4JV5B 5KSPA 5D84A 1EVQA 5DX0A 1SQGA 2X0KA 1NC3A 1GEGA 4GKKB 1LEHA 5KPDA 2I2BA 1OC4A 1RPNA 1GNPA 1HI9A 3AETA 4LY3A 2OFOA 3QRWA 5TE9A 4ETMA 4C1NA 1T35A 1Y4AE 1VQ1A 2XOKD 3KQSA 3ZWKA 5EMJA 1D0IA 4PYNA 2WDPA 4YK7A 1X7HA 1VKJA 2HBQA 4TLAA 3D4PA 3JQRA 2AOWA 3UWPA 3TLBA 3OT1A 2FVXA 3P4XA 5BVHA 4BFXA 4H0NA 2E48A 2CVHA 4BNIA 3JD1A 4PPQA 5H3HA 2X5NA 4DLXA 5HE8A 1ZBDA 2CFIA 4H77A 1XQ9A 5CNIA 3S2IA 4F3RA 2GCNA 4DJEC 3DE1X 1GV0A 1O89A 1RYMA 4NV3A 1FYDA 5I3ZA 1PTJA 2REXB 2HSJA 3RRBA 2FMXA 4CKWA 5EXSA 2JD2A 4UTZA 2AN9A 1UBEA 3DDHA 1V7ZA 4UCWA 3ICQB 3ZLVA 1Q0ZA 3SM3A 5A0TA 3NYQA 4BTLA 4ZO6A 2J7PA 5C37A 1IVYA 1GYRA 5FH9A 3AI3A 3DOCA 1MABB 4O0MA 4BQEA 3KB1A 1FYEA 3UY4A 1AN0A 6NULA 3PTAA 2WIDA 3IP5A 3H6GA 3PEWA 3H9UA 3R76A 3V9AA 1RBMA 4UM9D 4YCSA 1MG5A 1QOPB 3NHYA 4GPBA 2B5OA 4R40A 3F96A 3I1JA 3LPAA 1CVRA 3R0QA 1LTHR 1QIGA 1EFHA 3G68A 4YCLA 1K9VF 2ZRMA 4KQIA 4RVDA 4AJLA 1F12A 4L72A 4MPTA 1MPTA 2M32A 4FX2A 4EJ6A 1RRCA 4S1PA 4DR4B 2C4WA 4Y1RA 5AFSA 5FAKA 5KC9A 3EA5A 5B5SA 1W85B 2CXXA 3S8MA 2C7QA 4JA0A 4YPVA 1V16A 3SYNA 3LLUA 3D6VA 1A2OA 2RGWA 2X8AA 2Z5VA 1ZOPA 4PPYA 1T9GR 4IRXA 3GJ6A 3FCXA 3K94A 3QXCA 4BMYA 5EJ8A 4C22A 4R3WA 3ZWAA 5BNTA 2QBYB 3NHAA 3ZH2A 1OZHA 3TQQA 1J2TA 1V7CA 5MGNA 1SIUA 2AA3A 4WOPA 2JAWA 3AERA 3KKZA 1EJ2A 3QNUA 3ZG6A 3ZYCA 4DMHA 4XVQA 4BY9E 1RLMA 3G88A 1PJZA 4R41A 2JFGA 1OOEA 2YV2A 3B85A 1G8AA 1AE1A 4LPSA 3V7UA 2NO1A 3CZ4A 1B0PA 1L5VA 3AYZB 4ZRDA 1BC5A 4RL4A 4X90A 5LQAA 2FWIA 5AKGA 4DEXA 3M9XA 3VGJA 2O3RA 1R4AA 4WL0A 5EC8A 2HQOA 3QFSA 4O4LB 3DLIA 2X9LA 3CXRA 1EP9A 2C58A 2F8LA 1N57A 2HF9A 5HA5A 5A06A 4EF4A 3A0UA 2ID7A 1ES9A 1HM5A 2PWYA 3FVTA 4JUFA 2GJ9A 2Z09A 2Y66A 3NFYA 4FN4A 2OXIA 4HT3B 1OI3A 4XA8A 5CCXA 1UT5A 2PFSA 4AU1A 1AQNA 2X86A 1BTOA 3K53A 3IA2A 4WY8A 4C0JA 3HH8A 2OG1A 5IKEA 1AQUA 1SVIA 1SVOA 2DFVA 3EGXB 1U1GA 3K4PA 3L1UA 5EE5B 4ZYVA 3OFJA 1HE2A 2R1VA 5AW5A 4L4RA 5KNDH 3DDOA 3VR2D 2O1XA 4FEEA 1NP7A 2Q5HA 2ZJ0A 4MKZA 4MV3A 3TPFA 2WUFA 4ARUA 4CMKA 5KREA 3L7AA 1KMQA 1USIA 4KXUA 5BSVA 4E5SA 4O4LF 3K9HA 2H1OA 4QGSA 3S3TA 1L5SA 2X1LA 3JQ9C 3GEDA 5LZ5A 2YXEA 4UU0A 5KOYA 1OI4A 3U5TA 2B98A 3ACDA 4E2ZA 3N2IA 4TLEA 3VSEA 4HUQB 1OYYA 2XSZD 1NXQA 4HAYA 3KOMA 1KI8A 2VJDA 1UODA 4X1IA 5HJ7A 1RWWA 4J43A 4G5XA 4D9HA 1SB8A 2HC9A 1AG9A 3EFOA 4MWEA 1KP9A 1X7YA 3QLUA 3TSWA 2PD3A 3TOCA 5ITZA 1JHDA 2Z30A 3SNHA 3R77A 5TGDA 3T3IA 4D9FA 4ZCIA 3RC2A 4ZKDA 1PX2A 3ZCSA 2RBGA 5LLSA 1GTVA 1Y3DE 2QP4A 2QZJA 4M9UA 5HIAA 4FBGA 4RDXA 3HYCA 4IO1A 3MT0A 3LL4A 2HGZA 4W9RA 1OA0A 3IBTA 2EEZA 4WA7A 2F43B 3NUQA 4RF5A 1NNEA 1QQAA 4MUMA 4OYLA 5GZ3A 3AWDA 3IYLW 1E98A 3C1OA 2Z2YA 4G1MB 4RELA 1OIWA 2HAEA 3FN4A 4G5QA 5TNXA 3B38A 3ZV6A 4DANA 5EHQA 1NTOA 3BFXA 2H4YA 4IGKA 3OP1A 2BFNA 3V5NA 1E3EA 2XCLA 3QKRB 3GYGA 4GYJA 1M76A 4KO3S 1B73A 2NW6A 5AW7A 3QX3A 4HWGA 2GLXA 2H3EA 5SICE 3FCAA 4DLBA 2ZQYA 3AM3A 5FUWA 4G56A 5JSHA 5LNK6 3HXPA 4KXFB 3K35A 2J5KA 2B94A 2F4NA 2ZWVA 1WF3A 4O5AA 1E58A 2VYND 2DPXA 2GX6A 4XE5A 1A9XB 1I9CA 1NJSA 2C2GA 3E1SA 3JZDA 4FHCA 2ONCA 3HNRA 2JI6A 4LJYA 1U04A 4KSCA 5K05A 3FUWA 4C07A 3I6MA 2I65A 3EVTA 2VHYA 1A97A 2IH2A 1OZAA 3WISA 2G67A 1Y6ZA 3AB3A 1XWWA 3MUNA 1X15A 5AI5A 2NP6A 1T6ZA 4B3XA 4OYRA 4TRRA 1DRWA 4BLOA 4RD3A 2CUKA 3I01M 4IDPA 4OUKX 4ZU3A 4JJZA 1XV5A 1XEFA 5FWYA 4LJAA 1UM9B 1PL0A 3M6UA 3GLVA 2O8FA 1GGNA 1U3GA 3OO1A 3KELA 4D3FA 4I55B 3WL6A 4PQYA 3DVAB 4EEXA 3VGPA 4UUBA 5JAOA 4OX9B 3FMVA 2J45A 2YWEA 3GJ3A 2FR0A 3PD7A 1LZLA 4RFLA 5DCWA 1WHSB 3R1IA 4KX3A 2GESA 3EBLA 4GAEA 3H87A 3OFKA 4EEZA 1AQLA 4TS9A 1ADYA 1E2GA 3F5MA 4G5YA 3FPLA 2IUUA 2FDCA 1QLHA 3R3UA 2YWHA 4G26A 3CY6A 4UHEA 2DTDA 1R50A 2XX3A 3RS8A 1SB9A 1X8XA 2FQXA 2CB0A 2ZROA 1I2CA 1YR2A 2QGZA 4YMIA 4JI7B 3RK4A 3OT4A 1E6KA 2AIRA 2SKEA 3QEKA 4DIFA 2XXAA 4B6SA 2DVMA 2FLWA 3QWBA 4I55F 4IQ0A 2ECPA 4QXQA 5NULA 4C1BA 5A4AA 5BYKA 3SEAA 1GQRA 2RH5A 2ZRNA 3ZEAA 4MHTA 4R9SA 5CXQA 1LS6A 1BXKA 3ICWA 2O19A 3QSGA 5B4TA 2A0UA 2Q4BA 3K6KA 3E35A 3H42B 4YJ2B 2PBFA 1YAHA 3UAGA 1H2BA 1Z0AA 3OCVA 3P32A 3Q1KA 1G5HA 2O9JA 2FZGA 3FMFA 4OHBA 2IXGA 4QOGA 1AT1A 3BGWA 2PMFA 4TLCA 1P2VA 2C99A 3HY6A 2O8EB 1XBTA 2XRZA 5B6PA 5IWAB 3WZMA 3P9SA 3AJDA 2OP0A 3QFHA 4JY7A 5E1DA 1EXDA 3PUJA 4EENA 1QHGA 1I0ZA 1ZIXA 4M1ZA 4MDFA 1U4SA 2HUNA 4DXAA 4WK2B 3T7JA 1BE8A 1W29A 4KSYA 5DM4A 5AIAA 1D6JA 3LYLA 1WB5A 1T0UA 1OFUX 1XZ8A 2JVJA 2NX2A 3K1AA 4YJ2F 3L92A 3NVMB 2BKXA 3INRA 1P2DA 1VMKA 3OQIB 4FNGA 4OI2A 1UKAA 2H7XA 4B81A 4PN3A 1BQ3A 4DBLE 1ISRA 4YAUA 1QBGA 3L4EA 4IDHA 3ROXA 5KO2A 5DGIA 1X0VA 4OOFA 2FAXA 2Z9DA 3ETHA 3WX0A 3EPKA 2LVBA 5LWQA 1HTTA 2G9UA 3AJAA 5IK2A 5CH5A 3TRHA 3UMRA 4XLTA 1XRJA 1VHDA 4JEIA 2V55B 5BPHA 3Q3VA 3V8VA 1PZHA 2WRZA 4JKIA 3KQTA 4AO8A 3O95A 5ICGA 5DNEA 1K1EA 2YVLA 1BE6A 3FSGA 1LGYA 4LZOA 4Y6GB 2J4DA 2QRGA 4MKRA 4C14A 2ET6A 2IYEA 3WRVA 4TS3A 1PV4A 4UARA 2TYSB 2REQA 3AC0A 3FPFA 5KNDD 1KEEB 1U5BB 4GPTA 1LTQA 2EKPA 2HA0A 2GZSA 2ZE7A 1AIPA 2RGDA 3D8UA 4AO7A 2ZUTA 3RYHA 3OCJA 5JARA 5K4HA 2I5PO 3SGLA 3RAJA 3WLOA 4DLYA 1CQZA 1RI1A 4LI0A 1T2FA 4JBIA 1AA6A 4ZYYA 1N9GB 2GWRA 1YE3A 4E33A 4YJHB 3ILXA 5C2JB 3UMMA 1SULA 2B99A 2PZMA 2VDUE 3SP1A 1BX1A 5C35A 4Q9JA 5AM0A 2VPPA 2COEA 3E9RA 2XUPA 3IV7A 3FSJX 4JNCA 4MJ7A 4UNQA 2WINI 2ZRFA 4J2HA 4DMUB 2CXRA 2RGNC 1H9CA 3VV2A 1M66A 3OOEA 1ZK4A 3WNDA 1ADFA 2VCHA 1DGQA 4RD4A 1FVFA 3U7RA 3AIOA 3NHJA 2Q2WA 1NRWA 4GMFA 4JB0A 3S1SA 4P93A 3TCXB 4Z4EA 2JLQA 3F5SA 3FYSA 3TF5A 4AK9A 4F3KA 5BNIA 2IX3A 2ZSAA 5D01A 2CL0X 3MQ2A 2B34A 2OZVA 2IYZA 4IMPA 2QDXA 2F67A 2V7PA 4R2IA 1ATIA 1JEDA 5E95A 1I94B 3ORHA 5T6MA 2Q4EA 3M81A 3KL4A 3DE5X 1XJ0A 4FIZA 5FTMA 4JYAB 2QPAA 5IH3A 3MILA 1R5OA 1C7IA 1CPYA 1P1JA 3DE3X 1M75A 4I14A 2G8LA 4I0WB 4BNXA 2WD8A 2QU8A 4MA0A 4G8DA 5DO9A 4BMVA 1QF6A 1F5SA 1ZMRA 1N2EA 4QUKA 5FL7D 5FUYA 3IJPA 5DLPA 5J47A 1F60A 3QY0A 4BP9A 4O3MA 3TTWA 1XE3A 3RD5A 1P45A 5EKDA 1SOUA 5IX8A 1TX4B 1QO0D 4A2QA 3A31A 4IHKA 4L6IA 5EZQA 1WUYA 1JFSA 3LBHA 3NEPX 5J4HA 2ORWA 1VKOA 3EJ6A 1M0EA 3KUUA 4TTSA 2LE0A 3M4JA 1BMTA 5CT9A 1WVIA 5F5XA 2ZDHA 2AD5A 1GG8A 3AR4A 4QEDA 1LC3A 4E15A 1ZINA 1FOEB 2C2KA 4QT0A 3IKVA 2JL1A 4PIVA 5AVYA 4LG1A 3DULA 4LV5B 4TV8B 5HS6A 3SS7X 5CFOA 3K9FC 4GDFA 1V7PC 3EEIA 3PV0A 1FXWF 3QKUA 4QATA 2GEDA 4OBEA 4URFA 4C7OB 1ZRSA 2C4VA 3LQKA 4MCHA 3TH5A 1TTTA 1P9NA 1ZPDA 3GLIE 1VCMA 5LP6C 5A0VA 4NL4H 2VP4A 1UBSB 1BE0A 2ODPA 1W4RA 5ALFA 4BTEA 2XEXA 1A4XA 1O97D 1BMFD 1KH3A 1IY2A 1ZBQA 2FOXA 3A1DA 1JHOA 2JIRA 2ZJAA 3MW8A 4UHDA 1FNSA 1P61B 5G3YA 2GTPA 5F2NA 3SF8B 2W2XA 3C45A 5TDHA 1QAMA 1KC1A 2JDID 4WGGA 3G5UA 1ODSA 1EEHA 4JGIA 1PSWA 3H5OA 3LUBA 1K2VN 2GZDA 4M49A 4TV8F 4UMFA 2QN6A 1BCSA 5IC5A 3W6UA 2HUPA 3ITDA 1TKAA 2X0RA 9LDBA 5J40A 1Z3CA 2HWWA 4ODIA 3EDOA 5E4FA 3GGDA 4I4TA 4FZ3A 1JAXA 3PWTA 4EA6A 3LF1A 1COWA 3VU9B 3L8FA 3NHUA 3KQLA 4FSHA 3W9UA 2OBFA 2A1UB 1ZD8A 5G40A 2MJLA 3QVOA 1P2GA 2B1GA 3QWHA 3T9FA 5T41A 5A3RA 1QKJA 1MH1A 4MVJH 5BQ5A 4EB0A 1OYVA 4BDSA 2EERA 2D1QA 3KB6A 4QULA 1J2RA 4A03A 4MWDA 4DNXA 4GM4A 4BP8A 2FFJA 1VLHA 2C00A 2IOFK 4B6QA 2BLNA 3DUWA 1Z25A 3OOWA 4Z99A 1CDDA 4DMGA 1WPQA 4DE5A 3FPJA 3LX4A 4BQPA 4NC9A 3ABQB 1OKKA 1T4CB 3O03A 2FEWB 1HYHA 5ALJA 2JLVA 1K8YB 2HRRA 5T4FA 1TO1E 3MUFA 3CUEF 1DDOA 3SE0A 1M7HA 2PX4A 3G2KA 4EYOA 3OZTA 5JZ9A 3CEPB 2OBLA 2P6OA 4GKJB 1GHTA 4RJLA 1FRNA 3BWBA 4DCCA 1Z26A 3WLNA 2FG6C 2QYHA 2CYAA 4C29A 3IUYA 3DKIA 4BZQA 4IH4A 1VPEA 4FGKA 4X60A 2R8ZA 1FUIA 1Y5MA 4BMSA 2BE7A 4IVNA 4WK6A 4X1OA 2HD4A 4GI1A 1HDZA 2E7ZA 3LQRA 4KYIB 2FPPA 4UVDA 5EP3A 3VH3A 4UPVA 4K8RB 2AG1A 1NVDA 3DLHA 1DKQA 1LWNA 3WBBA 4CQNA 4DB4A 4Q4DA 1HDEA 1KR5A 1XTTA 2EX0A 2PT6A 1O9GA 5KKCA 1EKXA 2GN4A 2RI6A 1D07A 2A92A 2P2SA 4DLPA 3T3NA 3PR1A 3GP5A 1U3VA 4KN8A 4Q9DA 1WEHA 1U2TA 3LCRA 2YY5A 3P71T 4R2KA 5HZGA 1XK7A 4PG7A 3U6KA 4G41A 2QJWA 1BJTA 2HNAA 1SIWA 2Q2VA 2NNWB 2BE9A 4JI8B 4BEWA 3FUUA 2BHTA 2NTYC 3K70B 5I45A 1IJFA 1M2VB 2SICE 2V7BA 1RE1A 1RWVA 8OHMA 1XC7A 3I83A 1PR3A 1REQA 3CYFA 3DW1X 4LSWA 4ER0A 5BRAA 3WKDA 4ONEA 1W73A 4TWIA 4X8HA 4LYDA 2XKAA 1XZQA 4CF7A 1FMJA 3RLIA 1M1YE 2J5XA 2MHCA 3PE3A 4RZ3A 4EG8A 3PQ2A 3TZEA 3CRRA 2DWQA 1DZ3A 3W7BA 4YCMA 1ZVQA 1JJFA 1PWXA 2O0HA 4WJLA 1IHYA 4GRDA 4LWZA 3FGNA 3COWA 3NWEA 5K2MA 2ZXEA 4L95C 4R8SA 4Q66C 6AT1A 4B3RB 1WE2A 4RCVA 1WTAA 1YR8A 4I1OA 1BU8A 1JDBC 2CHQA 3ZH9B 1JKIA 3GLFB 3EG9B 2WA1A 4WFQA 2NXWA 4UZSA 1TLLA 2UYGA 5AO9A 1BO6A 1YJXA 3VVLA 5JRJA 2C5EA 2O6HA 1Z5PA 4FBMA 5ITVA 2RI0A 4AFNA 4CFZA 1W93A 5CAEB 4QTUB 5CDSA 2R9VA 4V39A 5KOJA 4ESVA 1SOWA 1NUAA 5KYXB 1T3LA 1N3YA 1YE5A 2R6DA 4E5VA 4XWKA 3WKBA 1RXUA 4R51A 2JLAA 2MT9A 3JQAA 4TSRA 1THMA 3G6KA 4BATA 1SC6A 4C4YA 4MQ5A 5B37A 1RTKA 2CB9A 3ESDA 3F2VA 1JSZA 3L8EA 1BEEA 2OL4A 4PLZA 1BVHA 4G9GA 4HWPA 3FZQA 4YWJA 3QXXA 4HATA 4R81A 1FNCA 4M9RA 4TTTS 3AVTA 1I2AA 1NW9B 2YY6A 4UCXA 5B4VA 4FYPA 2Q3CA 3QPBA 4HGYA 2C9OA 2ONKA 1ISIA 1GLGA 4AUKA 5FBRB 1DI0A 2CDRA 3HFRA 3I73A 2Q9AA 4K05A 2MMCA 3BIFA 1KPGA 3BRQA 1L4EA 4XGRA 3VSAA 1VRWA 3SC3A 4DV4B 3SEFA 1EBFA 1G38A 4LSGA 5CVUA 4MB2A 3QFFA 2YS6A 3E22B 4NVRA 3RS3A 3RSOA 4BNDA 4F97A 2ZOSA 1LSUA 5J63A 4LVCA 4MRVA 2M98A 3PUYA 4R1QA 2J3JA 1G55A 1TAGA 1UFVA 1ZVKA 2EATA 2HGSA 3H7IA 3NAMA 4Y2PA 4FK8A 1K8RA 4JB2A 3WB2A 3O0DA 4G81A 4M6WA 2BTOA 3NAZA 1L7DA 5JNTA 1HMPA 5AP9A 3B1YA 3KLNA 5F4ZA 1ZUIA 1ECFA 5HP4A 3UF0A 3PK0A 4OHFA 1NG1A 4B5KA 1C30A 1ZD3A 3PPVA 3O8OA 2IV3A 3SJZA 1DBSA 3ZI4A 4BNHA 4YX9A 4ICIA 3PWZA 2DRIA 1JG7A 4FS8A 4JJ7A 3ORFA 4M1KA 4N03A 5C1OA 1U2GC 3A14A 2VPXA 2GUGA 1ZC4A 4X7MA 1Z0KA 3NRBA 1H2WA 4LRWA 4JC0A 3SOPA 2G4LA 3X1JA 4DDVA 1QGUB 5I7HA 3PQ6A 4FX5A 1TJNA 3KP1A 3X1DA 1NT2A 4ABTA 2P6RA 2J3EA 2I3AA 4HDRB 1Z38A 5E7QA 3LBNA 5AVOA 3QA3E 5HF9A 2DBYA 2FF7A 3A26A 3ELBA 2ZSIA 5K6AA 1QPZA 4XZ3A 4XB1A 3CKYA 3RU9A 1U7DA 3M6FA 1ABEA 4FT4A 2XB6A 5KJ6A 3MGBA 4LF9B 1T36A 3K5WA 3LT5A 3I09A 5ALTA 4QQ8A 3IOBA 4ENUA 2IBMA 3EF1A 5DN9A 4ESHA 2IVZA 2Q0HA 4CVNA 3WJ2A 3RVQA 2HA3A 2QTCA 5C9ZA 3ABSB 4HOYA 5KUTA 1G7TA 4P83A 1ZD2P 1JJBA 1EJ6A 3DPUA 1F2DA 3VBCA 3E2IA 1DKUA 3VDQA 3W6PA 2QT9A 1Z37A 1QQTA 2H1SA 4QJIA 3JYQA 4FYKA 2JKVA 5DULA 3TSZA 4UDYX