2FDXA

Clostridium beijerinckii flavodoxin mutant n137a oxidized
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fdxA00
1DXQA 1YOBA 1ZWKA 2MOKA 3B6JA 3KAQA 3FNIA 2AMJA 2OYSA 2QMYA 4FGKA 2KQUA 3K20A 4LTDA 3SVLA 2FZVA 4PTYA 4C0WA 4S24A 3OX3A 5TGZA 5F12A 5FA6A 1YCGA 1AKVA 1WSBA 1YKGA 2FOXA 2QX4A 2XOEA 3ESXA 3FVWA 1SQSA 4HEQA 4D02A 1C7FA 1D03A 3HLYA 4ICIA 4ZVKA 1RCFA 4BMPB 5EA2A 4QODA 5LMCA 5NLLA 5LBUA 2FDXA 4DIKA 4YAOA 4YAUA 3W7AA 1ZX1A 4XDGA 1FLNA 2Z9CA 4U7FA 4QOHA 2Z9BA 1CZOA 4LAFA 3NHWA 2ARKA 1B1CA 2N1MA 4H2DA 1AKRA 4U7GA 5EMNA 1OBVA 1FLDA 1H66A 2R97A 3OX2A 4QOFA 3G5MA 1XYVA 3F6SA 3QFRA 4N9QA 5ULLA 3O2NA 1X77A 2BPOA 1D4AA 4CF6A 2KLBA 4GI5A 4F8YA 3NHKA 5JROA 5LVAA 3OJWA 2QWXA 3OWHA 4XDHA 1JA1A 4QOGA 1RTTA 4H6PA 4HS4A 1NNI1 2V5UA 4ZVLA 1AKTA 4QOJA 1FX1A 3EDOA 5F4BA 3GFRA 4DILA 1DX9A 1YCHA 3ESZA 5NULA 1SG0A 4CETA 5LBTA 5LJLA 1BU5A 3UXHA 3FX2A 2MT9A 1J9ZA 4C14A 1AKQA 1OFVA 5LJIA 2RG1A 2HNBA 3ESYA 3B6IA 2QX8A 2XODA 3B6MA 1V4BA 2BZSA 3NHSA 4GQIA 4Y7CA 3TE7A 1AKUA 3W78A 5FUQA 2ZKIA 3P0RA 3QFCA 4FGLA 4QOIA 4YALA 4N82A 5A4KA 1GG5A 3GFQA 1XT6A 3HA2A 3N3AC 4LA4A 3W79A 3NLLA 1FUEA 4GR9A 3U7RA 1AKWA 3L9XA 1BVYF 1DXOA 1D04A 1CZUA 2BMVA 1CZNA 1YCFA 4FX2A 4OXXA 4YAWA 1I1OA 2FCRA 4Y9RA 3OJXA 1OBOA 2FAXA 2B3DA 2M6SA 4ESEA 1FVXA 3F2VA 4FGJA 3QE2A 1KBQA 1XI2A 3L9WA 1H69A 1T0IA 2F1OA 3N39C 2MWMA 2GSWA 3EYWA 3F90A 5F51A 3O73A 4YQEA 2OHHA 3R6WA 1FLVA 3NHFA 3ZHOA 3NHYA 4BMOB 4C76A 3UXEA 5FX2A 1AHNA 3HR4A 1E5DA 2W5UA 3GFSA 1RLIA 3NHJA 1CZHA 1AMOA 2QR2A 3KLBA 4R81A 2X2PA 4ZVMA 1QRDA 3RPEA 2WC1A 3OWXA 1JA0A 4U7HA 1F4PA 1FLAA 2FZ5A 5EAIA 3U7IA 2R96A 3F6RA 3TEMA 2QX6A 1TIKA 3ES9A 4NLLA 5B3KA 1VMEA 2MTBA 3NHLA 2FX2A 1QR2A 3OVMA 2QMZA 3LCMA 3KEGA 2Z9DA 4Y9UA 1TLLA 2V9CA 2HNAA 5BUCA 2HPVA 1YDGA 3D7NA 3NHRA 4N65A 1YRHA 6NULA 1T5BA 1J8QA 2BF4A 1AG9A 3OX1A 1WSWA 3TZBA 3NHUA 2Z98A 3GAMA 2Q9UA 2V5VA 1XYYA 3B6KA 3FJOA 1ZWLA 4LTNA 1QHEA 4DY4A 1RLJA 2X2OA 4PTZA 1QBGA 3NHPA 2FLVA 3S2YA 3NFRA 4M0CA 3FW1A 1FTGA 3JSXA 4J8PA 2OHIA 4PU0A 4C0XA 4LTMA 1J9EA 1KBOA 2M6RA 1CZRA 5B3LA 1AZLA 3KAPA 3W77A 2BN4A 1J9GA 2D5IA 3LT5A 4NULA 1CZLA 5LLDA 2QX9A 4QOEA 1CZKA 2FVXA 3N3BC 4YAFA 4ZVNA 1C7EA 2Q62A 3K1YA 2A5LA 2OHJA
chains in the Genus database with same CATH superfamily
3RU9A 4YP6A 3KAQA 2HK9A 2DX7A 5K8UA 4EHDA 3CTPA 3N7UA 3IALA 4RMJA 2VBIA 2ASVA 4AKSA 3THXA 1CIJA 1JG1A 1W85B 2QVYX 1DT3A 2JFGA 4ARBA 2CXSA 1RWKA 3RYTC 4DLYA 5LP6B 1LQTA 1MFPA 1G3RA 3UKJA 4JNKA 1H1LB 3VR2D 4EH1A 3IEKA 4Q1EA 3LBHA 4AI6A 2QD4A 2UYOA 4FKBA 3D4NA 5GINE 3KSMA 4LAFA 2X8BA 1V39A 3LIIA 1S89A 5IS2A 2PUCA 2XEXA 5EGNA 1QRAA 2OO5C 3ZWBA 1GXSB 5DB4A 1SCDA 2UUPA 3FRIA 5K2MA 1INLA 4GL2A 1Y34E 1C2TA 4ETWA 3A7DA 1KEUA 4LWQA 1U2RA 4XUCA 1AIPA 5H1YA 3NZEA 2V6IA 4BDTA 5A0TA 2WM9B 1OIXA 2B8WA 3NT2A 4OQXA 3WMWA 4BATA 4UTPA 1Z63A 3QEBZ 2W2MA 2W42A 3FNRA 2ZI6A 2G8LA 1F9AA 2QMEA 2XJ4A 2HR1A 3KQWA 1E89A 2B3TA 4MW7A 3T7KA 1FU8A 2ZSFA 1BQ4A 3PE6A 3V2UA 4Y7CA 1BA2A 5HZMA 1WY7A 2FF7A 2ZJ0A 4BX2A 5K8TA 1E58A 4MPDA 4EJFA 1DBWA 1H23A 2O2DA 3A58B 4I4TB 4HTFB 2WMNB 4EJSA 4IHAA 4NPHA 4PLPA 3DWFA 1BVUA 5M29A 2XYVA 4M1OA 3ZX5A 3WGIA 2FPUA 3RR2A 5G40A 1NPTO 5HUHA 3TPZA 3LVBA 1TF2A 4FGJA 5KVSA 3ZTWA 4AW9A 1AQUA 5JS1A 5C37A 1LSSA 1N9GA 1L4KA 3N8NA 5DNDA 4TM7A 5BY2A 3IOBA 3CEJA 4OQNA 4NCKA 1IN8A 3R7AA 5K99A 1V5EA 2IYUA 4L85A 4MEBA 4UHKA 1UJCA 4LFAB 1LKZA 3REOA 1EWVA 4Q05A 3RPEA 3FTFA 1O08A 3SQXA 1QLHA 4Z5XA 1OKKD 5FJJA 3TE6A 3GOHA 5G2OA 3DR5A 3ODPA 2LXNA 4YLEA 2GXUA 1DINA 5BQPA 1Z2CA 1GTG1 2NUPB 3RKRA 4PCAA 4E33A 1K3UB 5A5EA 3ANLA 1NN1A 3H17A 1TKBA 1MOQA 4YIKA 3VZSA 1Q16A 4G01B 4IGEA 3ZOKA 2I9PA 3NVMB 1FRZA 1NVVR 3LGAA 5IAKA 3S2EA 1NP3A 2BEJA 4GMXA 1S8OA 5AW1A 3GJ6A 4RBNA 3IMGA 2UZ3A 4U63A 3J80A 2C61A 1U6JA 3WMEA 1FVOA 3GRUA 4J0KA 2E0IA 2DUWA 4BEJA 2Q5JA 3SHTA 3WBJA 4XRRA 3DDOA 3ZNQA 4HVCA 1DIRA 2WZDA 2GPAA 3VOTA 4HN2A 5BV1A 3MWYW 4DTCA 4QUHA 3SK0A 3TG2A 1RWVA 2F9FA 4FYIA 2QW8A 1ZM9A 4WK4B 2YVKA 4H7JA 4Q7QA 3RRFA 5TMPA 3FZQA 2GBGA 3I9JA 3FKSA 1HDZA 3OZEA 3O8QA 3A2MA 2ORWA 4L28A 2X0DA 1HLFA 5AW5A 1H8HD 1K6EA 2COUA 1HNNA 5CVDA 1W88A 3H84A 3U1TA 3JALA 4G5QA 2XNCA 4N8DA 2D7JA 1O6FA 1QV7A 3P2JA 2FPIB 3E7FA 3OQBA 4CR6A 1UMCB 4IICA 4CCYA 1PO7A 1ICIA 1XAGA 3IAM6 4HWOA 4TL7A 1RJ9B 2ODAA 4MUJA 2M98A 1NPDA 2F4VB 3QTBA 1ZSYA 1ZM3A 3ZY5A 4QDJA 2AOVA 2ZTVA 4INAA 4OQFA 3WTBA 3QI2A 4LZNA 1UBFA 4C2BA 1YQ9A 1BXGA 3KVOA 4KI0A 4MQ6A 1YFJA 2A6PA 1DELA 1SK8A 5H4GA 1KZ4A 1LEHA 2NU8B 3H8JA 3ZY2A 1CCWA 4L9SA 3EXAA 4DYVA 4HR7A 1KOJA 1QRUA 3NBKA 3SFTA 4HLQB 4ZDIA 3EXIB 3CE9A 3RHFA 5HKLA 2G70A 3HMQA 2JLQA 4L95C 3OF3A 4JGBA 1JKJB 1NW6A 1W5TA 1KO5A 4ZT5A 3TLGA 3V1KA 5HFNA 3IPLA 3G0BA 3D6UA 1GL6A 4W8OA 4GX1A 4GQIA 2CL5A 3PKJA 2JGEA 3CNEA 3SKYA 5F35A 3CZAA 5CVEA 3NIFB 3HXMA 1N9ZA 1M2VB 2ZI3A 4CU2A 5ARBA 1ZVKA 3WLOA 5J1TB 3TXYA 2QXYA 2PR7A 4PWYA 1U94A 2DBQA 3FYCA 3O74A 2I7CA 2MSDB 4IJQA 3EVGA 3U7RA 4X0EA 1ENZA 1VL2A 3AVUA 2O9JA 4TS1A 2ATXA 3V9AA 4AMUA 1S2MA 2RK6A 3VZBA 3SMQA 4XWYA 1U8CB 3G2OA 3OJXA 3HYTA 3VKFA 2B3DA 5JXGA 2B2XA 3II6X 1OE0A 1VDMA 4JA0A 4UPVA 1EHCA 1BE1A 1WPXA 4Y9TA 4GMHA 2DFPA 3OEHA 4UHDA 3R7WA 2EFCB 1S2LA 3UUGA 4Q6BA 2B36A 1SXIA 3V8QA 5CFRA 2UYHA 3RHTA 2GEVA 3QWIA 1FSSA 3FTNA 4JJIA 1YU6A 4U02A 2HMWA 4WH0A 5C1PA 3Q9LA 4OGFA 2ZYWX 1Q3KA 1E5LA 1X3SA 1D9XA 2HB6A 2R87A 4RELA 2OXIA 1GDTA 4JR1A 1TM7E 1E4EA 2QTZA 1E4OA 4HH1A 1NU8A 4KIJA 1W2HA 3C1AA 1XEAA 4E7PA 4OXNA 1YQEA 1PEDA 5CDFA 5JMOA 5ITSA 2FR0A 2H4WA 3PRJA 4IMIB 1ODCA 3PXGA 3SBEA 4EYSA 1R64A 1XAIA 1G17A 2ZJ7A 4XEHA 2BTQA 1TZBA 2JIBA 3FHCB 2O3RA 3H6KA 3B36A 3GMSA 1DRJA 2L69A 4DNXA 4B6GA 3GPCA 2IDZA 3IDZA 1M1ZA 4M2LA 2CYCA 2E18A 2QV7A 5CTJA 1LQ2A 4BP3A 2HJSA 1LVUA 1P4JA 4DNPA 3PD1A 3FTCA 3E82A 1VPEA 4N7JA 5CBPB 3ZGLA 2J6HA 2BUBA 4RW0A 3UJDA 3L6CA 3A1FA 4O4JA 4RK1A 4B7ZA 4BKUA 4MJLA 4HS9A 1G38A 3ZS8A 3UJAA 3B1FA 1EJBA 1OR8A 2RGCA 4XDYA 1C9KA 4BO0A 3QW4B 1NR5A 1P0IA 3RGWS 2OGZA 4JLWA 5FPPA 4B6OA 2J5RA 4CV3A 4MR9A 1XEWY 2WKSA 3QVJA 1LS1A 3GJ3A 4M1QA 4KPUA 4N5LA 1S5PA 5HG0A 1M0EA 4BOYA 4M38A 4NULA 5FWXA 1DJQA 4PE5B 2GN4A 1XXHE 1CZKA 5CMLA 1P7YA 5AESA 1N2CB 2ZJ2A 3T4EA 1ZMXA 4AU1A 2XI4A 4Z4EA 3ZHSA 1TO1E 4Z1OA 4PANA 1E0JA 4YAJA 3QITA 4NI5A 1UJMA 5FBLB 4CL0A 2IPOA 2IA5A 4ZRNA 3DGEC 2HF8A 3DDWA 4K6GA 2CMFA 4L8GA 4DBLE 1KEVA 2JGAA 5BSFA 5AW8A 3CHYA 1N4DA 1VCHA 3EAQA 1K0FA 5HA5A 4CKYA 3SVTA 5EOVA 2IP4A 1Y48E 1OXBB 5DPMA 4KX3A 4WY5A 2VP5A 3Q7RA 1JDUA 4GYJA 4F06A 2Y93A 3GH1A 4OUKX 4BKRA 3RK0A 4WOJA 1J09A 1W2GA 2O1SA 3P94A 4OLJA 4Q4JB 3GCWA 5AK0A 5JWHA 1PF7E 1ABFA 1Z0SA 1ZRNA 2ZCJA 3SLKA 3S8EA 1LW6E 1PS8A 3HJRA 3S44A 1YR9A 4GICA 3WKBA 3MS7A 3L1IA 4YAIA 2AN5A 5BR8B 4ZEVA 5KNCA 2ZRQA 2ILVA 1Z82A 2R6JA 3IEUA 3S70A 3U4AA 2I62A 2YY5A 3WDSA 4LISA 3R23A 3EXEB 1UP7A 5ALGA 1N7IA 1RWMA 1UZLA 3JQ7A 4BRUA 5BW5A 3FI0A 1PS0A 3M33A 3C5WP 2P5TB 2DH6A 1M6HA 2NTNA 2Y1WA 1X7GA 3QYFA 1KDTA 3PI6A 1B15A 2O07A 5K0GA 2H5LA 1R4MA 4A1OA 4N82A 2B69A 2K2WA 5DTJA 4BBAA 3B2EA 3AFMA 3R3UA 3W79A 5I9SA 3RTGA 1NHWA 2AZDA 5AK5A 1JU4A 4AS3A 4ZPJA 4W8HA 4HDRA 2FCRA 1TM3E 1TPZA 2JFZA 2RHHA 3DCIA 1RADA 2IITA 2WFZA 3LC7O 4WNCA 3H1PA 4X60A 1MQ8B 4Q4CA 3TYXA 5KTOA 1JLLB 2H1SA 4CEHB 3DDCA 1X0VA 1NA5A 3MT0A 3W1WA 3REGA 2BD0A 3HXOA 3D3NA 4RETA 1QGAA 1U1DA 4F6RA 3L7JA 3BPSA 1AKMA 2P0EA 2VBGA 4OHCA 4CJXA 1KYQA 4J0DA 3WNCA 1JT9A 2Y0EA 2C2GA 3B52X 1G21E 3NKVA 4Y1EA 5EHIA 3W2HA 2V7VA 3ECAA 4RVSA 2R0QC 1RXUA 1IVYA 2GPYA 3BE6A 5TMEA 1MAAA 3WLMA 2OV1A 2FZ5A 4CLRB 4XIIA 3RRBA 2WF7A 4HGZA 3W04A 2A78A 4U9UA 4PAOA 2KYRA 4OU4A 2F62A 3TW4A 1JVNA 8LDHA 1JR6A 1BDIA 1Z8HA 2CHGA 1UZMA 3KSBC 3DL4A 1AO3A 3GBPA 5AJVB 3ZWMA 1M74A 2B37A 2JGLA 5HGXA 2PDAA 1VSUA 1CRPA 2P9BA 1E9CA 3A3OA 1F8GA 4NZMA 5AVUA 2WM8A 4LE1A 4U00A 2IE8A 3PGKA 1TFUA 4RSHA 3WQSB 4UHBA 3C3PA 3OQIA 3DLBA 5CG2A 4GXQA 2GPTA 2NOAA 4L7QA 4R3NA 1ZG3A 4ZAWA 4X1IA 5F5LA 3UA3A 3ZQUA 4WIAA 4AY5A 1E59A 4WLOA 2VDOB 2FSSA 4B76A 5FR1A 4MUYA 5ALLA 1OILA 1EBUA 4PRYA 5JSZB 3ZKWB 5JSZA 4UMEA 3EOBI 2CV1A 4RUKA 2I80A 2VQ3A 2P0AA 1G9TA 5E4FA 4OREX 2FVXA 5KWIA 5KEIA 3FWPA 2X9LA 1O0CA 2D0IA 3L6UA 4Z54A 4L0DA 4RZUA 5HNKA 2CNDA 4ND2A 4NF2A 3D43A 3QLUC 3EXHB 3H18A 1GZVA 1QVRA 2X5OA 5GOTA 4DEVA 4KKVA 1P3Y1 1JB1A 4R01A 4ZFNA 1L8LA 3CY6A 1WSBA 2O48X 3Q12A 3RVSA 4AY2A 5EKSA 1JBKA 2FRDA 1M1UA 2CVQA 2GTIA 1YZGA 2J3MA 1E1DA 3OPXA 4XSVA 3R75A 3BE5A 4KWHA 1I7DA 2IODA 4XGIA 2XSZA 2Q5LA 2ZWVA 4KQHA 3JQ8A 4YAOA 4JR2A 4MVJA 2B83A 5KJ6A 2NMVA 4XVQA 3RVLA 1IXRC 1S3IA 5JYBA 3ZDFA 3PL1A 4H08A 1NX6A 3B9QA 1TO6A 4RHYA 5C4MA 3OPYI 5I5GA 1JEQA 1NZDA 3AUAA 5CFZA 3I2YX 3ROMA 1LLCA 1ORWA 4IIVA 2AVNA 4O0MA 3NUQA 1Q92A 3AJAA 4M60A 4QA9A 3RVJA 1NNI1 1YNOA 2R85A 5LUBA 1N6HA 1M73E 4AY3A 4PX2A 5JD4A 3GL9A 4EA7A 3M1AA 1PWXA 1SVWA 2GYVA 1KYVA 5B30A 5J2UF 1MB4A 4IM7A 2Q5EA 3WGJA 3VPBA 3L82B 3NPMA 5DN6A 5J47A 2QAGA 2HNBA 1PZGA 3O2QB 4FUQA 2HREA 3BXZA 1M83A 1GGKA 3DVRX 4B0OA 1KEKA 1QHHB 3VI4B 3EIOA 1ZJ5A 1CUHA 1R15A 2C3MA 1PJ3A 5ALKA 5BV7A 2PMDA 1E9AA 3VJMA 3HDGA 2X86A 3ZW7A 2W4IA 3HBNA 1QF6A 3AU8A 1GUAA 4QT4A 1Y9AA 1XD9A 3L04A 4FIDA 3DVAA 1TZ2A 1JU9A 3IEPA 3M8KA 1CSEE 1Y8CA 1U65A 4JGIA 5K05A 1XI2A 3SEQA 4GOXA 2JLCA 3SDSA 3BMNB 3T3MB 2XXAA 3KC2A 4XCXA 3SG0A 4DQKA 4PZAA 1QRRA 4V1CA 3CF2A 1VSQA 4Q12A 1SO8A 4LMBA 1G1MA 1ADJA 3UK0A 4JBLA 3WGVA 3RRXA 2W5UA 1WHSA 4BV3A 4Q3LA 1LNSA 5JYDA 1CUIA 4R5MA 2A1UB 4YRSA 4NDAA 2PAFA 5KX5A 3EIEA 3NB0A 1JDNA 2QT1A 3EFEA 4FOTA 5EAIA 3PENA 5F98A 2JH9A 2BFFB 3V4RA 3T12A 1QONA 4GP9A 3D6VA 1CU1A 1M5TA 2CXXA 1YAHA 3A04A 2ZSHA 5HILA 3CS3A 2P9ZA 3KEFA 2W6ID 4C20A 4RL4A 2CJYA 4EYQA 5HTKA 3NGXA 4K6CA 2BFBB 4Z0PA 3G8BA 1XPRA 4XEUA 2C94A 3IAFA 4JP1A 3ZI0A 1GQSA 1P18A 3VV2A 4HNUA 4KXNA 2QHXA 3NM6B 3ESBA 3LCVB 3TG8A 3EPJA 2ZRBA 4W63A 2YHAA 5JY6A 1TM4E 1M6WA 4QPCA 4CCAA 3BOSA 5BMOA 2J0QA 2BFEA 3O9VA 5CXSA 5GIPE 3KB8A 2HJWA 4LTMA 3WY9A 1P6XA 4NU6A 1RWNA 4L5AA 3C48A 1HDOA 4RADA 5LQDA 3P19A 4R2MA 1IBKB 1PJQA 2PH3A 1JSRA 2UVPB 2UZ1A 3K15A 4GBGA 4PR3A 4RV4A 3OD1A 1MORA 5COQA 5JCXA 1CG6A 1HQCA 3VR3D 2PLAA 1FYVA 5ABPA 1Z88A 4OPMA 2Q1SA 2GK7A 2HTFA 1V37A 4YRRA 1GG8A 1I4DD 1XU9A 4WRRA 4JXZA 2AOWA 1KXZA 4JLPA 3TKAA 3RAGA 2G5TA 4ENSA 4OKIA 2ORIA 3ZCQA 2SHKA 1YS7A 3L6RA 2BTQB 2XA9A 4BV8A 1FPMA 3AW9A 4YECA 3KSZO 3RT9A 3TLJA 3AUUA 3D4BA 3IOMA 5LSAA 2H1OA 4BXOA 4RPGA 1EM8A 5I7HA 4PZDA 4KOEC 3RKSA 1L5YA 2HWKA 4N9QA 5BNZA 2XVMA 3SYKA 1WW3A 4WI1A 2JKYA 1L4FA 2C7GA 3DGFC 3QVXA 4KB5A 5JNUA 5F4ZA 2DHEA 3AINA 1WXEA 3NRBA 4ENRA 1FJGB 3COVA 2XZPA 3UJ9A 3H9EO 2AF3C 1QCYA 5C7OO 1M5RA 1HZZA 4MTLA 2YOFA 3FYUB 2FUG1 4HMOA 1AXEA 2YX1A 3IP8A 1XNJA 3QX8A 4WCFA 5E4JA 5AWFC 3UAGA 4UFNA 4LJ8A 2X3FA 5K45A 1X6VA 4QDZA 1GGNA 2IP1A 4HAIA 2J85A 2CXTA 3LQKA 5I7SA 1X7WB 3T9DA 3C14C 5A5DA 3MBKA 4I4TA 5CBPA 2YMLA 3KKZA 4G2NA 3GLGE 3PJEA 1ZONA 1OQAA 1PV4A 1BCSA 2HHAA 5KWEA 3R0QA 1KAEA 3U44A 1I33A 3QVGA 1XNQB 1XN1A 2QVGA 4LECA 3OM8A 4XJSA 4RTOA 5BUZA 4KXLA 1AUXA 3DL2A 1SXPA 4TWRA 1ODSA 2PRSA 3R5TA 4JJ4A 5F51A 1B4DA 2WB2A 1XPOA 1DAKA 2ZAOA 3VHXA 1LV8A 1L6RA 1HQDA 2O7SA 1VI2A 5CRIA 2EJBA 2J08A 4UAJA 4AC9A 2PJUA 1HL7A 1UC5B 2A1TR 2LR0A 3A25A 1SUIA 3KLBA 4QRHA 2FWIA 1NVMB 3BUSA 3C87A 4N49A 3VDXA 2ICAA 2QAGC 4CHTA 4NMLA 1Y4DE 2DULA 2NO0A 4N03A 5IYZF 2JCGA 5L95A 2QVBA 4QXPA 2V1UA 3O8BA 4E03A 1LSUA 4MXDA 1EP9A 4IMRA 1XOIA 1U0EA 3DQPA 3HZHA 3NOVA 1N6OA 4E3WA 5KU1A 4J0QA 5CDHA 3W5VA 4AQ7A 4ND3A 4K3VA 4PCLA 3AI7A 1WZEA 3LWDA 3ON5A 2H65A 3LO8A 4RGQA 5D3QA 3ORRA 1A9TA 3TTXA 2IX9A 2E2WA 1NPYA 3VM6A 3LQ4A 1BHJA 4HO1X 4EA9A 1E3WA 4F86A 3VQTA 4DY4A 3LTNC 3O90A 1BGVA 4B3IA 3CLSC 3P0FA 3RBAA 1DU4A 4PPNA 1ZGAA 3KK0A 2Q7DA 4WZZA 3PJRA 4RF4A 2HKIA 4ZCTA 3JSXA 1BRTA 3IQXA 4KLNA 3WGLA 1V3UA 2RBEA 3VKVA 4AZTA 1GGVA 3PVZA 1H8ED 1Q15A 4TZTA 1U63A 4YC7A 3H2GA 3TLGB 3O3CA 4U7DA 5KVQA 3MD9A 3GDGA 3ZJVA 4DA7A 1O87A 4MIKA 2QZJA 2I6TA 4LRQA 4LDZA 4RH0A 1CE8B 3W78A 2JD2A 2PKYX 1JXAA 2QMYA 1OIVA 2X4GA 3QBTA 4FGKA 5COBA 2VDNB 3I2KA 5AM3A 3Q5DA 3HV0A 4G5RA 4GEKA 4F2PA 4BVJA 2ORVA 1T6BY 3EZNA 4YRBA 5LFAA 5ALHA 2H92A 4MUKA 5IJ9A 2VG8A 4INPA 3OTOB 4AQYB 2EERA 2EL7A 1DUVG 3ZVNA 4QTZA 1UPBA 3T7RA 5ICEA 5G0SA 3UMRA 4CMIA 5JUWA 1GFZA 1RJ9A 2AX4A 1VJTA 2MSEB 3GBVA 3PG5A 5JBIA 2PK3A 2JCBA 4QOHA 3UMCA 1NIPA 3PEEA 3KUXA 2CNWD 3RSOA 2DOKA 4AM8A 5FOTA 1RQ7A 2R97A 3JYHA 2DEUA 2UUBB 3CMCO 4M8KA 5DZSA 1Q2UA 4UQLA 2Q99A 4QREA 4JMPA 4GDMA 3EGDA 2X0FA 3U3XA 3QE0A 4NBUA 1REQB 2AMFA 1RWBA 3G6KA 3AVOA 3OTHA 4FOSA 3OEED 1SCUA 2YJNA 4IKOA 3DHEA 3UO8B 4JXXA 4JQCA 1QHYA 1FW6A 3O9MA 3BT7A 3WHLA 2CLFB 4XB1A 3MJEA 3T9FA 1ZIYA 2QR5A 3UENA 3VTFA 1VLJA 1ZCAA 1JL3A 1UF9A 4CIBA 4LWPA 3MWLA 1VLMA 3DKKA 2XTMA 4H1UA 3STXA 3TI9A 3TQQA 3DEHA 3BBLA 4FGLA 1WNFA 3HB4X 1A5AB 1EI9A 5CB0A 4E5SA 1SC1A 2EJWA 1MD9A 4GKKB 2G17A 1YZHA 2VNJA 1UPCA 1MQ9A 2OFFA 4R83A 1P72A 4KUHA 3QFFA 1N57A 3P9PA 4I0WB 2ZUTA 1QJ4A 5IT0A 5AXDA 3TFQA 1E2IA 5HCNA 1WA5A 1A9YA 2A9RA 1V1MB 4ARIA 2OCKA 3G0IA 4X1OA 4Z4QA 3G23A 1H93A 5AKIA 4JDUA 5DYNA 5FBQB 4C6TA 3OZAA 2X23A 4EQ6B 3PL5A 2NU7A 1WMAA 2JKZA 2O2HA 5KX5F 5GGXA 4LXIA 2OHFA 2MMGA 5ALSA 5AXAA 4HFMA 2H57A 3SSOA 1QTNA 3G59A 1FLAA 4FDAA 2AFVA 4P54A 1IHYA 3D4IA 4HXGA 1FTNA 2TMYA 3NT4A 1GT91 1UFKA 1R0LA 1KA9H 2PIAA 2WUFA 3DFKA 4HWGA 4IRXA 5LC1A 4BNNA 3W5SA 4OHXA 1DE0A 4XIYA 2W6JA 5CT9A 4DDTA 4EFLA 3AL0C 5IKOA 1IWPB 3KQOA 2VJYA 3GZNA 3KB6A 3ZD6A 3IUBA 3AF2A 1G3IA 4C1BA 1IZ0A 2Y67A 4MVJF 4GP7A 1F0YA 3O75A 2I22A 1VJ0A 1N7JA 2QJWA 2OUIA 5BSRA 3S8YA 4C3OB 3L40A 3VO1A 1E6MA 3ELBA 1KBZA 2BFEB 3QKIA 4U6QA 1W96A 4MS3B 1H5QA 3T7DA 5JECA 3OLCX 4DLWA 1A04A 2BFCB 3ZLUA 1I80A 3L0BA 2XUJA 2HQBA 3RABA 1KTVA 1CZLA 3ZH2A 5C5IA 1HV8A 1Z8FA 2IH2A 3ZVRA 3UWMA 2H9IA 1C29B 1WLYA 1RRMA 5HJEA 2EZ8A 3UTCA 3FNIA 3H1BA 4GOJA 4UFOA 4X20A 1QIEA 1RE1A 4L5IA 2VA8A 5FAKA 2IIBA 2JEYA 1VE7A 1YRLA 5SYNA 1R9NA 4IGAA 1W4BA 4D3ZA 3OU2A 4PZCA 3AR3A 5AXBA 3ROGA 3UWOA 2FEAA 5G1OA 2O2IA 5A4FS 1KJYA 3GGOA 1PJTA 1ISPA 2MU1A 1C3JA 2HWXA 2O0HA 3IUJA 5IC6A 3TW6A 1ORTA 2Q4EA 4GZ3A 5EJ4A 3N2YA 4U7FA 2B4RO 2I6GA 1YL6A 1UT6A 4V24A 4Y2HA 1NXWA 3KQMA 5B2ZA 4Q3NA 1KK0A 3NS7A 3PDIA 1PJZA 4ZXPA 5CAEB 1U1CA 2YXDA 4LBZA 4Y6OA 3HCCA 3R6DA 3FZNA 3N2GB 3UOWA 3IELA 2XSZD 4KE9A 4E2ZA 1A50B 4EZIA 1D2EA 1NVAA 2W6QA 2ZUWA 3HDVA 4M36A 4OLBA 2QA5A 4K26A 4M1WA 4S1NA 1GKUB 5HQTA 4JN6B 5E1OA 1H5NA 2BZGA 1DVRA 2XEDA 5DV9A 1ZMBA 1GYRA 1TYEB 1Z5UA 2G5PA 3GHYA 4P5EA 3RAPR 3TE7A 1FQOA 4X44A 1TA4A 2BW0A 2BFBA 1UM8A 3SXPA 4LQCA 2JLWA 3FOCA 1TM2A 4K05A 5B4VA 3B1ZA 4LFCB 2A0WA 5F9HA 2XCSB 5CVUA 3ZGXA 1N8SA 1NVBA 4DZZA 4XX0B 3JAKA 1L7VC 2EIHA 1ZGZA 1XKXA 4GVLA 2PKRA 4HQ0A 1V48A 4B9EA 2BRUA 2OE2A 4WFKA 4YJGA 1NOKA 4JGGA 3RAEC 2G4CA 2IK8A 3AMVA 5JRDS 2IHNA 3EGIA 4TS3A 2AJDA 3EC2A 5JQGB 2R1TA 1GUYA 4WKBA 3AV0B 2G6TA 1QRTA 3C3EA 3NHFA 1G3QA 1HQKA 1PDOA 2ILTA 3P8ZA 1Q0RA 3SLRA 3OZTA 5CFMA 2R84A 2CMDA 1H05A 1Z83A 3ONEA 1R0YA 3EF3A 4PCVA 4ZCMA 4FQ8A 1R3UA 3H8WA 3LCJA 3CNBA 3MCWA 4EY5A 2HIHA 3COSA 4XM0A 3UV3A 2HUPA 2WJVA 3FHLA 1KEEA 3HP1A 4L76A 1T4DA 2HJHA 3S3TA 1HE1C 4P7KA 4WZAE 4YO7A 3TVYA 1Q11A 1QS0B 3I42A 2V7TA 3CLVA 4BEVA 4WBNF 1IN4A 2FPLA 3DO6A 3OCVA 2ZIFA 3PE3A 5KMGA 1EESA 3C7CB 4FFOA 1SZDA 4X5OA 3VPFA 1R5BA 1MX1A 2WWHA 1EFKA 2V5VA 2VUTA 1K4KA 3CUWA 4LVOA 2GEFA 4Q9KA 3EBLA 4LTNA 1I7SB 1T25A 4MAAA 1U6IA 3AFNA 5SICE 3Q85A 1L5HA 5C8ZA 4C5CA 4Q00A 2GN9A 4CQMA 5ALUA 3UAWA 3KQPA 1EE1A 1D3AA 3G49A 3H1GA 1URPA 1HKHA 2C5LA 1UPUA 2QAJA 2VNIA 3IQEA 3KUCA 4ZO7A 4J2OA 1S3FA 4J9UE 1E0KA 3FKQA 3AW8A 2FY8A 3C0KA 3LPMA 4K8RB 3DXYA 3I01A 4TWJA 5C18A 4YT4A 1PLKA 1JDSA 1SHLA 1HE8B 1NBEA 1JHOA 2QTBA 1DDIA 5FHQA 4KIWA 5I5EA 1TZJA 1L7RA 1SULA 2GH1A 5EVJA 1RHKA 2I7DA 3HKDA 4J75A 4ENPA 1IRXA 3CB2A 3NBUA 3PTAA 1KDVA 2XUAA 2BFFA 2J9YB 4P92A 4E1BA 5U9CA 2OCGA 4TYPA 1SOVA 4UNPA 1SU6A 5HTOA 3G5LA 1XRSB 2O3SA 3ASYA 2NU6B 4MEJA 3SR0A 5HFJA 3RIXA 4TVBA 3OQNA 2PVCA 4LJYA 5IDQA 5JI3E 1BWSA 4S35A 1M0WA 1G20A 2H18A 3C8UA 3RFUA 4EI7A 1W5BA 2CHQA 3S7TA 1BYUA 3EDCA 2C2KA 3KJQA 4CE6A 3DL7A 1UIMA 1RSZA 2DWPA 1A5BB 2ID4A 2GZ3A 1M54A 2H29A 3UJBA 1R8QA 1M6YA 4IF6A 1GCIA 1NNUA 1OBHA 2PZEA 3S0JA 4DA4A 2P79A 2RKOA 3ORFA 3CPHA 1XZKA 3R5FA 3T5CA 2FZWA 1B0PA 5TRTA 3BJZA 1W93A 2F6RA 4FFRA 1LDEA 1BS2A 4O2AB 3SHQA 4LEIA 2FG7C 1A5TA 2PYIA 5AJZA 1ZOPA 4CETA 1O5IA 1K5GA 2YJGA 1JHDA 4IDCA 4PFJA 1T9AA 2XT6A 3S1AB 2NYVA 3VYWA 5HYVA 4DCUA 3FDIA 2VYNA 3IIJA 2C9MA 3ID6C 5AKHA 5ARDA 2FEMA 4A1FA 2UKDA 2JIZD 3FNQA 4QOIA 3WS7A 4F2DA 1TTTA 4KUGA 4A0SA 2P77A 1CQXA 4G07A 3LX8A 4BYMA 4X66B 3THYA 1EWQA 3ITEA 1RKUA 4OGLA 1VRVA 1RJWA 5B5SA 4CIDA 4D42A 1CZNA 1MXHA 3E9QA 3EQ8A 3IHWA 2JLYA 3QKSB 1GADO 4FD3A 4NEGA 4A4DA 3L0IB 4JP2A 5DM70 4WFQA 2AFIB 3L5OA 4N3AA 2AFIA 4Q3KA 1IBCA 5HP4A 4CGZA 1ZMTA 1GNTA 2R1TB 3EYAA 3LQQA 2N47A 3VXKA 2X0JA 1X7YA 4BMOB 3ZDAA 5AVTA 2GX6A 3LLSA 1UM9B 4EP1A 4AS1A 2ZSJA 1ZA2A 1DEOA 4QYTA 1SCJA 1U3CA 1Y1SA 4FLMA 4WXEA 1HSZA 5A03A 1P6QA 1HC7A 3GFVA 5EN4A 5DCUA 4IDEA 1BRMA 1GOTA 2IW1A 5C32A 5CCXA 2Z30A 4EB6B 1XMQB 1W34A 1SUBA 4I5FA 2YIVX 4YRPA 1NNSA 4KSYA 2H31A 4I6EA 3QTTA 1W581 4MB6A 5DX8A 4JHLA 1SOWA 1SD2A 1B41A 1PGNA 2BKLA 2M9MA 3T54A 1E94E 3BXHA 2AYXA 3DYVA 2HF9A 3KZNA 1FSFA 2OO5A 4KH1A 4EF4A 4C2TA 4FGUA 2BGMA 2CV0A 1KJQA 1TVMA 2A33A 4C7XA 4OMUA 2WG0A 1YQUA 1THGA 4OH7A 5L3VA 4TV9A 5EL0A 4FFSA 2QE7D 4I9NA 2F3TA 2QU8A 2FOIA 3IVGA 4QRIA 1E7YA 5JQGA 4GI7A 1R8XA 4G5SA 1BROA 3ZDRA 1SA0B 4TSFD 2OM2A 3U9TA 3VYUB 1JLSA 1RMTA 3GEMA 5HS6A 3TTSA 4GE3A 2CJWA 4C5AA 1GR0A 3IVAA 2QM8A 4JL5A 3WGGA 1AF4A 1TAQA 2R6AA 4D8WA 4HS4A 1ZHFA 4IJWA 1APBA 1H4TA 2IOFK 4JI4B 3OZXA 2VRBA 3C15C 3EWAA 4LTDA 1ORDA 2NT4A 2W00A 1IK6A 1N8NA 1EG2A 3V8PA 2AC2A 3T35A 4II7A 4V03A 3C6ZA 3WAGA 1Z56C 3B7PA 3AH8A 3O38A 2QNRA 4UM8B 4WKGA 1F38A 1GIAA 2GHIA 4FMCB 4YP0A 1MG0A 2I8AA 4ZGWA 5A5GA 1XTSA 3HN2A 1RI1A 5CB4A 1KZ6A 4YAUA 2CKDA 3L79A 3OT4A 1CYDA 4LKRA 2IYPA 4H2DA 4Q1VA 4DREA 1NFFA 3ADOA 5ERXA 3RHZA 5DYIA 2GARA 1KC3A 1P1RA 3OY7A 5IXYA 4J0EA 1TEXA 3SC2B 4HWKA 3CZ5A 2EWMA 4PYMA 5M3BA 2A86A 1LGYA 1U9IA 3VR0A 1H0KA 1RZRA 1P7VA 2WF6A 3AP1A 5K3DA 3ESZA 2JD0A 2WSSD 4UNRA 4LMRA 1HGXA 2AXQA 3NC4A 1AO0A 4O4HB 1YS2X 3VU0A 2J9GA 2QZ9A 5EC8A 3I01M 3OBBA 3A4NA 3BGSA 3UJPA 3CW2A 3QIVA 4PHHA 3B8EA 5EKXA 4UNNA 4IDOA 3EG9B 1DBIA 1G21A 5J63A 2PX4A 4PLWA 4KQ1A 3ZWDA 1NQWA 3IHKA 2XUHA 3SZMA 3UIEA 4BVKA 1FUEA 5LN1A 2JGMA 1L5NA 1AMUA 1A7JA 3R2JA 4I55B 3DHNA 3KR9A 4GBED 2V4ZA 3ZXXA 3Q7SA 1GNQA 2TECE 3B2QA 3FPKA 5BN3B 4TS9A 5I4KA 2QUAA 5KSWB 4N0PA 2R47A 1TYZA 4NTZA 3CX6A 4TMFA 1P2VA 4E32A 2I2FA 3O1JC 4XWOA 3IKJA 3IL2A 2VDWB 3IP6A 4GI1A 4WUTA 2CFIA 3R0IA 1DOAA 5CM9C 1D1QA 4LHVA 2B25A 3VH1A 1JECA 2GAIA 2VF7A 2RC6A 2I1QA 5BYBA 2P2CA 4F1KA 4XR4A 3OTIA 1AB5A 3KNZA 4GFDA 5C8VA 2O54A 1CUGA 5K3OA 2ZAIA 2V6GA 3ES9A 3KOUA 4U4AA 1NOIA 1P33A 1RZVA 1VIDA 1PWHA 1KS2A 1NM5A 1ORVA 4P80A 3K6SB 1V9CA 1JQ3A 1JZSA 1QS0A 3MGAA 4Q9HA 1STOA 4DUPA 1IZ7A 3UFXB 4K28A 1SM4A 3JAMA 4HQLA 3WV4A 2G88A 3NOOA 3AJDA 3TLCA 4CT4B 4XRGA 4HYEA 4FCVA 4ISCA 2OHOA 4IMPA 3HADA 4WCVA 1NATA 2Y6UA 4WJLA 3C4VA 1CQJB 2W2TA 4KYUA 4TT3A 3EGDB 5DM4A 4M1KA 3EXFB 5AJYA 3G2KA 3IUMA 4J7XA 5D8DA 4J91A 4NX2A 2HT1A 2X8AA 3KOWA 3ZHTA 2PX8A 1KXJA 2FPGB 2G9ZA 5EY5B 4CIYA 2Q9CA 3NNNA 1T8WA 3QUBA 1R7RA 3Q7QA 4DARA 3SHFA 3IULA 2ZRLA 2DHCA 3KYIB 1SKYB 3MFQA 1XFAA 2GCOA 4HNSA 5MN4A 1U7HA 3OCUA 1E92A 2AT1A 2AG0A 3E9MA 4EJMA 1KFCB 3UFXA 5JSFA 3IESA 2WW8A 3AHHA 3I72A 2HPAA 4H6VA 3V2HA 2FOXA 2G08A 5DLYA 4HEQA 4P31A 2YTZA 1U8UA 1QTRA 1VL8A 2D5BA 2KWIA 3QKTA 3SM9A 3RUPA 1XVLA 2B9EA 3NEYA 5AD1A 1BE0A 4W1RA 3GEEA 1W7AA 3GT4A 2IYQA 5LL6P 3KO8A 1L4EA 1T4CA 2KSQA 2J87A 5LKRA 4EBFA 1TUBB 4O0LA 4AP5A 5ECWA 1QHNA 3U6BA 5TJ9A 2QW1A 4MQFB 4UBLA 2C8VA 3L05A 2JA2A 3NH6A 1NVUQ 5K3FA 3A14A 1HO3A 3HVRA 3GNSA 4G6ZA 4UBIA 1W76A 1V4NA 4DLLA 2YV5A 1ZH0A 1OC2A 1ZQ9A 2X8JB 2Q0QA 3DZHA 4CG0A 3DEKA 1R0CA 1PT8A 2R5WA 5JS2A 4DDUA 1FEZA 2FV8A 5LU9A 2QTLA 1I3OA 3EXIA 4DC0A 1RRFA 1ORRA 1E6UA 2VXYA 1I2ZA 3A0RB 3DP7A 3JQBA 4FN4A 3LECA 3UGTA 3ZE2B 2G1KA 2DT8A 1BD4A 1ONPA 3RFTA 2DERA 4L4XA 1KZ9A 2WDZA 3BE4A 1OIWA 4G8CA 4CHGA 1SKQA 4Q3OA 4LXQA 2BUCA 1NUAA 3PJFA 1AA6A 4QU0A 2IHTA 3C1TA 4YALA 2BC9A 4OGWA 1IN1A 4DM7A 4URYR 2F43B 1K7EB 2ZXEA 1PP4A 1OY1A 3I5AA 2BM1A 1U2DC 2JVIA 1PW5A 1GNSA 1KAGA 3BMXA 3VPXA 1DC4A 4JUBA 4BFCA 1GVHA 1UMCA 2OB2A 1XQYA 2YZ2A 3I6MA 1BG6A 2P2NA 4TTVA 3AOGA 3DZKA 3DTNA 3EZ9A 2HDHA 1G0OA 1WSAA 2CHVA 2IYEA 2A9OA 3PYLA 3SJ7A 3WKCA 1O77A 4OCZA 2JI6A 4K8OA 5J5AA 4BECA 5KNDD 4MV1A 2IE0A 4OQZA 4YP1A 1GL7A 2CLCX 4KQFA 1U99A 4TKZA 4MDYA 2ZZNA 4G5FA 4KL8S 2GBIA 4CM3A 1W35A 3SE7A 4RTSA 4QTXA 3HNOA 4XUDA 3PRYA 4P0TA 1ODKA 3Q0IA 4B79A 1WDKA 4MULA 5HF5A 3RC3A 4MR7B 3UJHA 1W36D 2PL1A 4YS6A 3PNOA 2XWBF 4PHTA 3BMOA 1DJNA 2A14A 2VS1A 1Q0PA 4YJKA 3ZZTA 1AQJA 1R9MA 3WDKA 1ECLA 1I9CA 2GD1O 2HNAA 2ZAMA 5K8VA 1P2SA 5IT4A 4Q93A 3C45A 1SJ9A 3QA9A 3SC6A 2D0DA 1BXRB 1QP0A 1EJ6A 4TV9F 2BTOA 3SYTA 5K8LA 3BG5A 3ZX4A 3A6GA 3DKIA 2B4AA 4GRDA 5EG5A 4OQLA 2D8MA 2HX1A 3S1LA 5DHSA 1CJKC 2WPDA 4AG6A 1BWRA 2H85A 2LD4A 3KZXA 1T3GA 2JGJA 5TQ0A 4EW2A 2ACEA 2ECKA 2ZS7A 3ND5A 1C9MA 4YI5A 2B61A 4KIGA 3FOBA 4UVGA 4PZUA 3GVIA 4U0JA 3OJWA 5JI2E 5KYKA 1CVRA 1Z5ZA 1AK2A 2X9NA 4LDNA 1S2GA 4PSAA 4D43A 3PWTA 3BFXA 4FFVA 1F2UA 5IJWA 3DOOA 3KTAB 3DUWA 5CVVA 4FWTA 3Q7PA 4CLOB 2C4UA 1OFUX 4IEEA 4Q82A 2AA3A 2Q6TA 3AZOA 5JJBA 3GRPA 2PKWA 3PIDA 4EMUA 4M0MA 4Z51A 5CFPA 4IIJB 2FPIA 5AKEA 4JIGA 3SAJA 1YUBA 4WMLA 4DNFA 5KWSA 3R8FA 4BKOA 5TSDA 3JQGA 1ZGHA 4IRMA 2JGNA 5DK6A 1Y4ZA 1SUCA 3PHJA 1J4AA 1X8JA 2ZCVA 4IH4A 2B1IA 1DIOB 3D3JA 2QTNA 3K0CA 3TNDA 1V0JA 2X5XA 3AYXB 3B1KA 1UBEA 1TFRA 1V11A 3HA7A 4EG7A 2FRDC 4G1EB 2PKXA 4M21A 1OHHA 1NN5A 4ZQFA 2IHZA 4E22A 1LSOA 3EZ2A 5BPFA 2J45A 4BNHA 3S6JA 1T8TA 3F46A 2NNLD 3BREA 5EWLB 1J33A 1U3UA 4TZKA 4ZGGA 4OTZA 2PMBA 4G1FA 4YMLA 3ITNA 4KJZA 2X0NA 1ORIA 3GZTB 1EWTA 1JMYA 4XWAA 2IHKA 3ML1A 1ZM2A 4RDCA 2PS1A 5FPQA 3I34X 1QBKC 1XLVA 2CZCA 4GHWA 4L8LA 4BRSA 1H3FA 3PPWA 2ZUDA 3K4PA 4QGAA 1ZRSA 3PGVA 2C58A 3MUFA 4US2R 4ROTA 3ICVA 3UK1A 1TZMA 3T9CA 3DD1A 4BFWA 1OX6A 3VA7A 1FFHA 4U8HA 4HQ6A 4X95A 2OCAA 1ZC3A 3DNFA 4P7GA 1RM3A 4KGVA 2IKSA 4CTJA 4JJ7A 5A5VA 3IAM1 4NBTA 1DS6A 3OZRA 3NHYA 4TPKA 3S2IA 5B3AA 3U19A 3BYZA 4C7OA 3HKEA 1GGEA 1K9SA 1JAIA 1AN9A 1U2PA 2WHEA 4HXFB 4F1WA 2R4UA 1OOEA 3HY4A 4EG5A 5CX1A 1UAYA 5TV2A 3BGDA 2ZRMA 2J7PA 2E1RA 2QD3A 3T4PA 4BPRA 5I7RA 3E4DA 1E6WA 4U1RA 4DM4A 1ESNA 1BJKA 2WFMA 4JOBA 1GUBA 3EXG1 1NVXQ 4R69A 4C08A 4DQVA 4Z4HA 3HUDA 3KKLA 2BEUB 1ZD2P 3CRZA 2OLKA 3CCFA 3DH0A 3ETCA 1PVVA 4GECA 2Q5CA 3QF7A 3P5SA 4QG7A 4P58A 1R8JA 5M04A 5IH7A 1QP7A 5B1HA 3TS1A 4A10A 1U7DA 2E21A 4ASUD 4D4MA 1KZYC 1X7DA 5ITWA 2BVNA 2QPLA 3PDJA 1X7XB 2PKCA 3O8CA 1CEQA 4IXMA 1QCZA 2W2LD 3HP7A 5IMBA 2B7BA 3L4BC 3GJYA 1ND6A 3F4BA 5DCWA 2WQZA 2VK1A 4XX1A 3KKNA 3IO5A 4ESEA 1L7XA 5CYOA 4BZXA 2ECFA 2DQKA 3FD8A 1A7KA 1VJCA 1XTUA 4ES6A 3W77A 1CNMA 1Z38A 2V74B 3KEQA 4HYQA 4MV5A 3H13A 3L01A 1MJHA 1W6UA 1ZHOA 3HDJA 1U3TA 4Z3KA 3W9UA 1Y9ZA 1GN9A 2B6HA 2Y76A 2YV3A 4CIAA 1MZPA 1QLJA 1TYDE 2FLKA 2JI4A 2IU0A 2G0TA 4F91B 1XQXA 2P3LA 3L1UA 1MBZA 3FWNA 3GGCA 1ZQ1A 1AKVA 1H3NA 1TYAE 2X0EA 5K0NA 4EVQA 3EODA 1UOQA 1Z2AA 3GH3A 4Y98A 4Z53A 1D0SA 2J5KA 1XQ6A 1XQVA 2PZBA 6AT1A 4Z4FA 4MQLA 1SOAA 4A2QA 4X7BA 1UADA 3HDHA 2B2CA 1WB5A 4ZYXA 5IC5A 4PVCA 2C2XA 1PTJA 4DRZA 3D1LA 4MPRA 2I87A 3I6IA 4MNTA 1Z2EA 2FFQA 4JX8A 5DLQC 5K3FB 3SGLA 3HU2A 3ZU2A 1MDFA 1ICEA 3DTVA 1MIHA 3GLHB 2GLXA 3C2QA 1N2HA 4EG6A 3GC6A 5ULLA 1FDRA 2XWPA 5C8DA 1LJ8A 3IDSA 2QP9X 2KLBA 1L3CA 3EGCA 4NP6A 4X1IB 4BNXA 4BIMA 5KQPA 1KWGA 2NVWA 3WMRA 2HCRA 2BSAA 1D4OA 1FP4B 3W5JA 5IM4A 1RLTA 2EZUA 5ED0A 4BFXA 1P4GA 4MRPA 4C78A 3N70A 4UBKA 4DRXB 2VNAA 2BT4A 1UKYA 2NO7A 1AOXA 4RKQA 2H4FA 2QSYA 3GR6A 4YCAA 5KTNA 5KJCA 3STTA 3ZC3A 3UAXA 1MEEA 2C59A 4Q48A 4N1AA 3CWCA 3GCXA 4HBZA 4OB7A 3WK6A 5LXTA 2IHJA 2ZTUA 1A9QA 1DBQA 2DP4E 5BQ5A 2GXSA 3CLSD 5JMTA 2B8JA 3NV9A 4GU5A 5CGQB 4ZOAA 1KZ1A 4NK4A 5BSVA 4JI7B 5CH3A 2EP8A 1QOZA 1RJGA 3ZQJA 4QEKA 3GLSA 3IX7A 1FJHA 2A9QA 4GPD1 4RA9B 1IEXA 1V7ZA 3FUVA 1RACA 4ALMA 3EWNA 4MPTA 4E09A 2JJ2A 4KR9A 1CF9A 4AZ3A 1JQ5A 2CVOA 1W4RA 3BHNA 3FAZA 4RHXA 1DKQA 3R6WA 5D5PA 3ZKAA 5FWXB 4B3TB 3AERA 4OXRA 1VYVA 4X97A 5AW3A 4K1LA 4JI3B 2RGNC 1BEZA 1NVEA 4IHJB 3QYJA 5CA0A 4ZVMA 4CI0B 2Z95A 2A1IA 4G8BA 2RAFA 3V32A 1QO7A 1J0EA 3KWLA 3C70A 1A8HA 3RYIB 1J8YF 1TAHA 1E2NA 3H6GA 1DLJA 1KEEB 1X92A 4M76B 4E08A 2C2HA 3BM5A 4WBNB 3N0TA 1R0XA 1VKOA 2NQ2C 4LGCA 4PFQA 4GT1A 2OSVA 1XZDA 3H5LA 4W9NC 4E11A 3ETJA 5DNVA 3PA6A 3AFHA 3BQ9A 3HZRA 1AY0A 3Q5EA 3VDQA 3CVWA 1ZW1A 4B7XA 3R09A 4ERNA 1YB5A 1CQPA 1T9GS 2HC9A 2WD7B 2QV0A 3B51X 3PYXA 3WK7A 1HFKA 2Q1UA 1G7TA 1PUXA 4KE7A 3KCNA 3IJPA 1U0HC 4PNZA 3RWMB 1YJ8A 1HX7A 2EKQA 3CLUC 1V7CA 2NQ8A 1CVLA 2WWRA 1GGJA 2PYZA 1BIFA 4BTEA 1G6HA 3JYLA 1X1CA 5AVQA 4CUJA 3HO6A 4NK5A 2CLDX 3HABA 5LLDA 2CJXA 1K7FB 3TMKA 5HRAA 1RC8A 4N76A 1DXQA 2DFLA 2G9RA 1ISHA 2ZYAA 4I9UA 1MOPA 2ONCA 1NF9A 1D7OA 1B43A 1F14A 3ZJYA 3GG9A 4B34A 4NYMR 3TQFA 1U5CA 4C4OA 1GSOA 4X8HA 5FR2A 1RHQA 2VTVA 1EDBA 3ZI7A 3MTIA 2G4LA 4D02A 2B34A 5DX1A 5ER9A 3DLPX 2JIOA 1K68A 3QJGA 1DTSA 1RI5A 5CFQA 1VZ3A 5G4KB 3BB4A 2BMWA 3L8FA 5F78A 1Z6YA 3FOZA 2ZRPA 2JHCA 3G2JA 1TYBE 3R6LA 1F8UA 3JCZA 1MJGA 1V2GA 3TINA 1EFVB 1EXNA 2QQGA 4CM8A 4DIOA 4EGQA 1SN7A 3O8OB 4JYBA 1VOTA 4AURA 1G6OA 4U2EA 1SIUA 3INRA 3E1SA 1W9MA 5BPHA 3H99A 1OMOA 4QSHA 1EFDN 1AT1A 2GVZC 3V42A 1KVRA 4NFLA 4D97A 4OQMA 4BZPA 4F8EA 4NENB 2BIFA 3TQHA 3LHDA 5JHHB 4LDPA 2A35A 4ZAXA 5LJLA 3LCUA 2EC5A 5L8VA 1XA0A 2AS0A 5ESRA 4AY6A 4CQNA 4R1PA 4WOCA 3K0CC 2PZLA 4PZEA 2WU3A 3V80A 1HR0B 3MJVA 1GTRA 4R2HA 2P27A 3GPDG 4LX8A 3Q8KA 3OJLA 2PL9A 5DISB 3BK7A 1UC4B 3BCRA 2RC5A 4UQPA 2TRSB 4PC3A 4EWLA 4QXQA 4YCNA 3CRMA 5M2QA 2XVZA 3N6XA 2HLHA 4BUZA 3OQOA 3LZDA 4G0MA 3RUFA 1CDEA 1OBOA 4TUYA 3EPLA 2R8PA 4JBIA 4XKJA 4EB8A 4E2WA 4ZVSA 2V03A 5BSUA 2J46A 1X70A 3BMNA 4D96A 3F5MA 5IJ0B 4GDFA 3VYTB 5HOEA 2PH5A 1T36A 3TM5A 1ZUWA 3NJRA 4LSZA 4RPKA 2HH9A 3TUJC 4WACA 3KLOA 1OLUA 2R6HA 5CA0B 4L5YA 5EJEA 1FFWA 2DFVA 3M83A 4GPZA 2DHRA 3K8ZA 1DG1G 2OAP1 4B2LA 3FYUA 2XB6A 1M2OA 2H48A 3LA6A 3PNSA 4KXWA 1HDRA 4HDNB 1X9IA 5KJFA 4UJ3A 1I2BA 1JUDA 1AXGA 1OZGA 2FN3A 3QNWA 4PICA 3VDRA 1EGQA 1HE3A 2BGKA 1KVTA 4HK4A 2H5IA 4HN4B 4JMLA 5EXSA 4YMTA 4I1RA 4NMMA 1D2AA 1TB4A 1CXZA 1ZXXA 2WINI 5H70A 4DPLA 4NJMB 4PX3A 1Y4SA 5IAAA 2ZDHA 2P91A 3G5TA 4MCAA 2GI4A 2OZEA 4DMCA 4TYNA 5LD2B 4HUJA 2GKSA 2YWGA 4PIMA 3A10A 3PNQA 1ULUA 2VWGA 3JPYA 4JLVA 2YWCA 3TRIA 4MRNA 2E6KA 2R7KA 2OC9A 1Q7GA 3C6QA 4NDZA 3GIWA 1MJ5A 2W93A 1AZSC 4H7DA 1L3BA 3DEZA 4ZCPA 1R5JA 2K2QB 4D9FA 4E07A 1V3VA 5ELMA 3PITA 2NPIA 2Y8EA 3AR7A 3BZWA 2BFAA 4ZT2A 5GMOA 5ALZA 4Q4AB 3QEJA 4G23A 1M7HA 1ZI9A 2PFSA 4NBWA 4ICIA 4D92A 4F9FA 2VFAA 3WL6A 4O2BB 1L7NA 2HHJA 3GQVA 1NSFA 5SZKB 1IQUA 1Q44A 1Z7WA 3MRVA 4CZ2A 1YTUA 4IJKA 4KGXA 4ZJZA 3X1YA 3W5CA 1P0FA 2OCLA 3QPAA 4QYXA 5AOBA 2WEKA 5TLSA 2PMEA 4UDOA 3HEAA 2Y1CA 2NM0A 1VL0A 1NN3A 1MH9A 1XD8A 3LA8A 2W43A 3PR1A 3THWA 4F2GA 3RQIA 2QTWB 2XGMA 3R5SA 3NCTA 2EAUA 4TYWA 1X1DA 1GCOA 2PIDA 3OTGA 2D7DA 5JISA 4O1MA 2XNDD 3QVVA 3MYRA 4CNQA 3FYSA 3MW8A 1K7CA 2V7QA 4LJ7A 2C7RA 1F6BA 1JTEA 4HB0A 3UY4A 4YGYA 4B35A 3EWSA 1M75A 2CBXA 1UEIA 3FOWA 4KMRA 4K87A 1WDLA 3FSRA 2VKTA 2H59A 4RJ2A 3IPYA 4DA9A 3R20A 4W9MC 1MJGM 2FQXA 4WNYA 1BJRE 3PWZA 1EFPB 4RANA 4BO1A 4B3RB 3U7FB 1L4YA 4YJHA 2WWTA 1XK6A 5SY9A 2WSBA 2NZWA 3ETEA 4BMVA 1VB3A 4MRAA 2ODQA 2PUEA 4Q1CA 1T9BA 3BXFA 3K31A 1OFIA 1QX4A 4HDAA 4IZIA 2AC4A 3WZMA 2C42A 2P9GA 1JLLA 1BVHA 4AKIA 4RS3A 1UC9A 2BR3A 4O2RA 1RJDA 1KMIY 3MN1A 5EJ9A 2FMHA 1BKYA 2GHRA 5FOXA 3GLRA 3V8NA 2HZBA 4ZGBA 1K2VN 3Q8WA 1PEYA 5D86A 3AGQA 1W47A 4RHFA 5E0KB 3KTAA 1H2RS 1SVUA 3G9TA 1N1MA 3RUDA 3EEYA 5KSOA 1JIUA 1BN7A 2WKRA 4P4UA 4QXMA 4BCDA 4J7AA 4ETMA 2D1TA 3QEOA 2XYRA 4EUKA 2A5DA 1QPZA 4G89A 2GEKA 3SJCA 4ZAZA 3WLQA 1C3OB 4K88A 3AVTA 5CU7A 3R9WA 3IBFA 2F8SA 3Q6IA 4OSEA 1M6VB 1YRHA 2DC1A 3ENWA 5CJPA 4D9HA 1Y5MA 2X3YA 2PD4A 3IYLW 3MRTA 4B6PA 4MYDA 4C4YA 1R18A 4J0HA 3L49A 2IKQA 5ANRB 1RIIA 1CUFA 4RYDA 3WL3A 4DLUA 1T5HX 3C8DA 2LIPA 3I32A 4LJSA 1IDOA 4JVSB 1CUAA 3V7NA 5J2UA 2NU9A 1JR2A 1LZLA 2RGEA 3GIDA 3I4FA 1VBFA 2GRJA 3EVCA 1N1DA 3FWHA 5GQSA 1WDTA 4NXMB 1DC6A 1VKRA 3EGVA 3HYLA 3JYOA 3MMSA 4H6WA 4PYRA 2CF5A 2YHIB 5JCPA 5IM4F 2HHHB 3QVMA 2XZOA 1KRHA 1ZUNA 1SD5A 2GN6A 3MPOA 4G0YA 4GKAA 2B35A 4I50B 2I4LA 2QM3A 4I50A 1Z7YA 2AMJA 4MKZA 5T6BA 3ZNOA 5B3JC 5HK8A 1C8LA 1OT5A 4IPTA 1W85A 4AJNA 3RIGA 2X22A 3H0KA 4C0SA 1EVEA 1OASA 3OLWA 3BIXA 1GPAA 1T8UA 4B44A 3DJFA 5GGYA 2B5OA 4EAAA 1NUQA 3Q7TA 5CEEA 2PMCA 1PFKA 3CZMA 1E6KA 5JPIA 3T1NA 4BAGA 1U90A 4I9HA 4NYJQ 2CVPA 5FLKA 4JSTA 5T64A 4W5TA 3LUBA 1LJLA 2AE2A 1GPNA 2A9PA 2NADA 4NARA 2BDEA 4Y2VA 4CKZA 1E18A 1EXMA 3H9JA 3WLRA 1WBBA 5JS6A 3LWBA 4P98A 3PT5A 3WLHA 4HYYA 1DMRA 3UUFA 3ZCPA 3WYEA 5JROA 3B1XA 2YJ4A 3RG2A 3IQFA 5THQA 5DW0A 5ERGB 2FUEA 1BEUB 3IVCA 2EW1A 3V00A 4QJBA 3AFGA 4FU0A 1X38A 4XDZA 1AKTA 1KEZA 3LZ6A 1MENA 1IVSA 2OR3A 5FAXA 4DILA 3AP2A 1AHHA 4X92A 4I4LA 5J5VA 1BNCA 2BR4A 3T6KA 1ESDA 1BU5A 4IDBA 2PX0A 2HCFA 4P81A 2XUZA 1UBGA 3Q8XB 2ZK7A 4O63O 1A2OA 5J23A 4KACA 1NQVA 3MINB 3WOVA 1BGXT 1NP7A 1U2GC 4G1MB 3IAS1 4K6FA 4TVKA 4ZV4A 5BW8A 2JEZA 5B7QA 3M5WA 1W88B 1XG5A 2O0LA 3KKQA 4L9RA 2C9CA 1ZP6A 2F59A 2CC2A 4LYHA 4MUBA 4PEVA 1EVIA 4BRZA 4PNPA 2W6PA 1OAAA 1XE3A 4FW8A 4KDEA 2W6OA 4K9LA 1N6NA 1GDDA 5DYYA 3JVVA 5EE1A 3C6KA 3ZU6A 1A1VA 3AWIA 3HB1A 3N9IA 1M34E 4UU7A 4B74A 4OFZA 1L7AA 2XD9A 3NP9A 3IIIA 3KYCB 4UU0A 5A7FA 1PR2A 1I32A 2FYTA 4EATA 1OV4A 2R8EA 4LHYA 1WX1A 3OMWA 3NHBA 4FIZA 4RZXA 2PWBA 3WQRA 4URUR 1E7SA 3ANMA 4KGZA 4YLYA 2PG3A 2XHZA 2C98A 1BDBA 3DMTA 3VZCA 2MYPA 3ZZNA 2YJTD 3PXDA 3WLJA 2AZ4A 2R60A 2ZP1A 2JCXA 4TL6A 4KFSA 3PUXA 3T3PB 2JHGA 5DTIA 3P26A 4QASA 5AJHA 1SVSA 1ZIDA 3E81A 5JW6A 4JJAA 4KW7A 4HAWA 4MUGA 4RHUA 1BH2A 4KU4A 4MPJA 3IBTA 2YVLA 1CBUA 4E5MA 4F1JA 3O83A 1UPXA 1W1WA 1ECPA 1X1EA 3FWZA 5DTRA 1NF8A 2CLHB 5CK4A 3PVSA 3GJ7A 3HCRA 2NTJA 3ZK9A 8ADHA 1YZ3A 1PFGA 2VPYA 3I12A 1Z0UA 2G6BA 1E2LA 1YJ5A 3NDPA 5B1DA 2O8BA 4M0CA 1E98A 721PA 4YJ2F 2O5CA 1ISJA 3UJ3X 1PGQA 1TQ4A 4IKEA 1WULS 1LLDA 2B0CA 2M6RA 2RI1A 4U9HS 3RK4A 3TNFA 4DRXA 3RYFB 4BQRA 3P52A 3MD0A 5DLEA 4YAFA 1TQ6A 1F5SA 3HA5A 4W99A 3K6KA 5C31A 5IZCC 4RK5A 2WHXA 4R8MA 1R66A 2AQIA 2CLOB 2WKQA 1C7RA 4XCVA 3S2FA 3WL5A 3ZIUA 3DBOB 2DH5A 2QZZA 4WXRA 2Y05A 1E9EA 1QMGA 2PZMA 5BORA 1B6RA 3OZCA 5LYJB 1V8PA 2C95A 2QX4A 1P4RA 1U8TA 1TJ3A 1RAHA 2C54A 2VRNA 1A9XB 3F6YA 4GLFA 4Q02A 5AKGA 3W05A 3C3YA 1WDMA 2E48A 3EGXB 5DMHA 1Z6PA 4M7RA 3PEFA 4RM2A 4QODA 4A8TA 3DE1X 3AM4A 5IM5A 2O20A 1KPIA 1LQUA 1CJVC 4ZKDA 5IDWA 1Z7GA 4EKNB 3KR2A 4D1YA 2GZAA 1AKRA 2GFHA 1N3IA 4YMGA 2GTPA 4KQIA 5AW7A 1KETA 2H3EA 2H1CA 1SH7A 5ALEA 3WKEA 1LH0A 4DMUB 4C21A 1NV9A 2YS6A 1LDMA 1Y4UA 3K3PA 4JT4A 3U80A 3D2BA 1CUSA 3TW0A 3VR1A 3VJKA 4IHKA 4ZHSA 4BVGA 4AMVA 4EHIA 3PCXA 1D0IA 1YTLA 2YICA 3D8RA 3N74A 1MO2A 3EPRA 3AKDA 4B75A 1J1IA 2V7WA 1QFXA 4KO8A 1NJGA 1ZXLA 1E5TA 2V54A 3RVMA 4OP2A 4MZXA 4NL4H 4L4UA 3TFWA 3VR3A 3IUPA 2O1XA 2HNKA 4H59A 1ADGA 4QYIB 3JZAA 1ZCBA 1DKOA 2EV9A 3HWRA 4YVFA 1VBNA 5DBIA 2I99A 2XUKA 2XHEA 2WUWE 3L7CA 4LY6A 1LWOA 4OBEA 5LB2A 3VR4D 1HURA 3BL8A 4MUMA 1P1BA 1MB0A 2HTEA 3MTDA 4I1OA 4C88A 2BGGA 1CUDA 2C84A 1JR3A 4AKGA 3T4UA 2I0FA 3DKVA 3MWKA 1P3JA 2AUNA 3TQTA 2WV9A 3LBIA 4ER5A 2YN2A 3ETDA 4MIOA 4O4LF 5FUYA 4B9AA 1IL0A 2Y4NA 3K9BA 4FHFA 3FUUA 3VDMA 4FYHA 2C31A 1W52X 4H4DA 3LY8A 3UVEA 4DQXA 6CHYA 4DB4A 2C2YA 1KY3A 1YZLA 1AMOA 5DWDA 4GF5A 2WHQA 4L9WA 2CUTA 3GMTA 1UFOA 2CGEA 3SP1A 5BN1A 3KHSA 1DWQA 2HIMA 4JROA 4FFWA 5L3QB 1SY7A 1SG6A 3RLFA 4ZQIA 1FS5A 5E1MA 1JPUA 4C7VA 3UATA 3HCOA 4XWTA 2VP9A 2DHQA 1SRRA 4XPIB 4MJ7A 4JBGA 2OBBA 3GCDA 3A1WA 4CF4A 3QM1A 3ZU4A 1CB0A 1H4QA 1E2FA 2Q3CA 4OHZA 5EXXA 3D7NA 3GZ4A 4QUGA 1WU7A 2AJCA 4G5OA 2G7ZA 4AO8A 3RUCA 4GBJA 5SZHB 3VPDA 2GO7A 5I01A 3GLIE 2IZ1A 1UH5A 2AYYA 3O8OA 3UEOA 2DB3A 2PLWA 1CEXA 1RR6A 1TF7A 2GFIA 5LB4A 1BH6A 1DL5A 5F76A 1JLKA 4BMYA 2VRWA 3D5QA 3OEEA 4ON9A 4ENUA 2HSEA 4LY9A 3TPCA 2O3UA 3AIOA 1T9HA 3NTRA 4KFUA 4WN9A 5D01A 4B4OA 4C0XA 4Z9BA 5CDTA 2RGGA 1MVOA 2XMBA 1DKPA 1MUUA 3LT5A 1Z6QA 4K9RA 4EJ2A 3LY9A 4NZ9A 5BT9A 1OYVA 2H17A 5C51B 2GUWA 1LI4A 4YCMA 4PLHA 2GN2A 3MMNA 2PJDA 1MX9A 1FMJA 2BRUC 2FFBA 3G17A 1ZRMA 1AK9A 1NF3A 3OCWA 3PDUA 4JQZA 1QH8A 3DZFA 3INYA 4O3FA 4UCWA 1X15A 4KOAA 3T1QA 1YR1A 1U6KA 3ACDA 1UEJA 2P3OA 3SQOA 4JI6B 1ST2A 1WKVA 4YUVA 1K3TA 4G5HA 4XR9A 3R74A 3MJ4A 4RZQA 3ZDCA 1EZ1A 3MRXA 4MLCA 2XGJA 5EE9A 4PO8A 3W6ZA 3CH4B 5F1PA 3U17A 1CUXA 2BFDB 5IJXA 2WWIA 2BFDA 3TIVA 2HSJA 1N77A 2DR0A 5HM8A 5DSTA 4PQRA 4E5PA 2HJGA 2JAPA 4GOLD 2FZKA 2GOYA 5KQMA 3A6ZA 5IAGA 4KUEA 4J76A 1XDBA 3U4GA 2RHBA 2ZBGA 1CQJA 4TL9A 4ZREA 1RPNA 4I9FA 4JAVC 1K5DA 3NCHA 4IY1A 4QWWA 2OAEA 1USWA 1SOUA 3KKEA 2E4WA 4CFYA 4OJTA 3RYIA 3BMCA 1O0SA 2IYZA 4Y1FA 3OU6A 3K9LA 5EJAA 5DNAA 1PKEA 4IXWA 2TMKA 2Z58A 5G3YA 3EUFA 1ZESA 1YZUA 2REXB 2H0RA 1ZPDA 4J7CA 2OZPA 2VPXA 4MKIA 4HAVA 3GNLA 4PC2A 4IIGA 2O8DB 1TF5A 2C1EA 4GAEA 4BB6A 1O6CA 2EZ9A 1VE6A 3D7RA 1B74A 4DIDA 1KR2A 4PG5A 2PUGA 1SELA 4KG7A 3W5DA 2AZMA 3H4VA 5CYPA 4EJ0A 1GPKA 1U3DA 1WU8A 2HK6A 4DLAA 3NVKI 3M5DA 1SEVA 4L73A 4ZYYA 4ZVTA 4OMFG 1P31A 3WSWA 3CVYA 1Z4PX 2WYWA 4FXPA 1QZXA 4L0MA 1ISGA 1F2TA 2WVHA 1JEQB 4EYOA 1OLXA 4M22A 4IMJB 4RTMA 3DFZA 3PC8C 3TNJA 2JLBA 4RK0A 1EQUA 2AN4A 2VXOA 3K0FA 3KXIA 4WEOA 5CT4A 4P5DA 3CXRA 4I5DA 4ER6A 3HKDB 3KKOA 1JA0A 1EA5A 3Q8MA 1EQAA 2WICA 3IAHA 2IYRA 2WI8A 4Q9AA 4BQOA 5LPNA 2H1VA 5DHUA 1JDTA 1Y5LA 3P9SA 4UDNA 3ZVLA 3NHLA 2XECA 5AHRA 2GA8A 4YGXB 2ZTHA 3AWDA 3SQMA 4CCYB 3BC1A 5D7NA 1ULTA 4P08A 1TCUA 2RDMA 4G4IA 3QOXA 1PJ4A 1QQTA 3DZIA 2ZRHA 1SVLA 1LBHA 2B78A 4YTEA 4S1OA 3RFFA 1POWA 2HBYA 3M3DA 4U5QA 4IYRA 4PHGA 4LJRA 1UJBA 4P2GA 5CK5A 5DCYA 1QWOA 4D3FA 3OAAA 2RCNA 1VIMA 3H2JA 5LWQA 3BJIC 5BNIA 5KOHB 1GILA 5FPHA 4Z6KA 2YFHA 3EXG2 3PBKA 3WWEA 1FZQA 4I5EA 2JKVA 4X00A 3QU5A 3S1AA 2VQ6A 3F78A 5HZGA 3ZLBA 1XTBA 1LB1B 4OB8A 1CDZA 1EDOA 2PV7A 2X4DA 1X80B 4PF1A 4CMEC 1A4UA 1A82A 1WM1A 5CB6A 1QHHA 1UUFA 1VG8A 3CVJA 4S1TA 4XIJA 4CFSA 4D9IA 1IN7A 3V7YA 3EDYA 4DIUA 4HN9A 4KLCA 4P3XA 3G7UA 4QRDA 2HD4A 3LVQE 3A2LA 1Q19A 5EP3A 3GVCA 2ATCA 3EQ2A 4NMHA 3SZLA 3N8KA 1PQ4A 1YKGA 5KYWA 3URKA 2JJQA 3OPMA 2GESA 5GONB 5JAIA 1JMVA 2EX0A 2Z5LA 3COWA 3HVJA 4M1MA 2Q9BA 5CNMA 4EMTA 2BSQA 3I0NA 4BGDA 1D2GA 4YRAA 2FI1A 3DE3X 3K94A 3TPFA 3U4HA 5BWBA 3HK2A 1U04A 2V0CA 1QK4A 2GK3A 4Q4JA 5EMNA 3E5RA 1K98A 2NYRA 4Q9JA 3B7WA 5HK9A 4DZRA 3GJTA 4WGGA 2ZDQA 1F8FA 3DT6A 2FF5A 3BSWA 4DNQA 3AEKA 1F12A 3VYSB 4LKOA 3FVVA 2B82A 4Q24A 4AUKA 3F0TA 5T8KC 1FMLA 1NAIA 4R9NA 3X2SA 1ZK2A 1K1EA 1TZCA 3OLZA 4X54A 1E9SA 1WXFA 3LUJA 3FGZA 3PIRA 4ZO4A 5ALNA 1ZD5A 5LIPA 5KSPA 2EKDA 1M6EX 1PFWA 1XTVA 1SUSA 2KM1A 3PEWA 2V6FA 4JSRA 3DM5A 4OHUA 1JEYB 1TVCA 1VIYA 2CCKA 1OH5A 3VR6D 3UWDA 2GRUA 4B09A 2BLNA 5FTMA 2G25A 3QYPA 5HZHA 1R4MB 1V43A 1KRXA 3QUCA 4OA5A 1EK1A 2KLHA 2VDRB 2K6GA 3OOSA 1RCUA 2QRPA 2N3ZA 4PG6A 2HDNB 4IGKA 1DXOA 1D04A 3CNQS 3EVZA 2VSQA 2F55A 1GQQA 3RJ5A 2PNFA 3LFUA 4X94A 1D1TA 3GAFA 3HWX1 4BNYA 4AZVA 2MSCB 1W0JA 1Y1KE 3I1JA 4PQGA 5AI9A 5KOJA 1EUQA 1VLQA 3FYTA 3MELA 1LK7A 1PX0A 4BCBA 5DXJA 1SUFA 3LFHA 4GSLA 1YOVA 5L4LA 3VNBA 3MTEA 3IT2A 3D64A 4TWIA 1TK2A 3SNKA 4WE3A 5EMLA 2UV8A 2LP4Y 3E48A 3MS2A 4BLRA 4M54A 3OY2A 2WIFA 1CEEA 4ECEA 3PUVA 3M0EA 3NU1A 1XKLA 3RRJA 3Q15C 2B98A 3LP8A 3O1HB 2CFTA 5AKLA 3PUYA 1ZIXA 2A8YA 1T9ZA 2AJLI 2GR9A 2P90A 3DBVO 3T15A 1CDOA 1N78A 2HO5A 1ZBQA 3AIKA 1JFFA 4UJ5A 2NZJA 2I4RA 3KHKA 4QDUA 4WEQA 2NVOA 4QUDA 3WB2A 3WA6A 3W5HA 1MC1A 1J0DA 1W75A 2HF7A 4DJ5X 2IXAA 4CR8A 3NIBA 3UJ7A 4YCSA 4RQTA 4XWGA 2JVJA 3AHFA 1HXHA 2HGZA 3E53A 4KTTE 4R3WA 1SBNE 2H7XA 4I2VA 2LZ0A 1XJCA 2AWOA 1N8TA 1T6ZA 4G37A 4ZCLA 3OE7A 4D4LA 4F5YA 3SR4A 1Y3HA 1Z8NA 2GWRA 3Q87B 4XQEA 4DA6A 3OP4A 3T3NA 3UMVA 1J9EA 2PH7A 4JJEA 4G2TA 3VMFA 4J1TC 2D5IA 3QOFA 5IWAB 4A73A 2PXAA 2QRKA 1GM5A 2CLMB 2KX7A 3PUIA 4FVTA 2EZTA 4IVNA 3QF4B 1EK5A 5A1JA 4ZQHA 2R8RA 3OZIA 4X93A 4CM4A 4C0KA 1O0BA 2XVYA 4KSBA 3ECSA 1Y1TA 3DOUA 2ZUUA 3L7IA 4JB2A 4YRFA 4Q15A 5K0LA 3TSCA 4A23A 1NBMA 4BE4A 5U1PA 3MQFA 5AT1A 5JSYA 3M6LA 2IIVA 1A8PA 4KFRA 3UAYA 5EA2A 1MIOA 4TKUB 3P2OA 2O23A 3U3OA 5CEFA 5CA1F 2E6UX 2RG7A 4AMZA 4EPRA 1GQFA 3PS9A 1Q1AA 3MHPA 5B53A 2DHDA 1YA6A 5C3MA 1ZUD1 1KPGA 1C1DA 2ZETA 1CR2A 2OC4A 3WIVA 1JJBA 3AF6A 3T0FA 1XN4A 1JWLA 3ICQB 1XQWA 1EFHA 1M2JA 4TYQA 4DAEA 4ZCIA 4J29A 2J6BA 1PJBA 3HE3A 3WQQA 4B7AA 1KOFA 1WBDA 4FYJA 1OPXA 1Y6RA 4FOOA 4CMKA 1RTTA 3I28A 3KJHA 1IMOA 2EZ4A 1K8RA 1XDZA 3A1TA 4NENA 2IWRA 4BTVA 4I4NA 2ZWMA 5EEGA 1L4UA 4BFTA 3CRRA 4LNUA 1N75A 3V1MA 5E8JA 2RH9B 1V9LA 2QX8A 4G26A 1R1DA 3MB8A 4IUDS 3CPEA 5B3JA 5FUQA 1L5RA 2VDJA 3HUFA 1GV0A 3K5HA 1WCYA 3JAWB 4IRUB 3O82A 4B6SA 2CF6A 4GG1A 3F6EX 3B2NA 3TB6A 5ALJA 2X6QA 2ZJOA 3I5XA 4DHWA 4LXXA 2ISCA 2F3SA 1J6UA 2B1RA 1US8B 2WF9A 2ZT7A 3KPWA 3ND8A 3OFVA 4HQKA 2G04A 3MUOA 4NU8X 1P9NA 1Z0DA 4Q1FA 3O5AA 2Y9PB 4JK3A 5DBFA 3E9RA 3OCJA 3WXBA 4V1CI 1XMSA 1T4CB 4ZICA 3L9WA 1F0PA 4ZCQA 3E2PA 2RHWA 4HRAA 3V46A 3WLEA 1KQNA 3KQHA 3ICWA 1LLFA 3DV2A 1HLDA 3RYFA 4AIIA 2Z4TA 3T1TA 2NP7A 5LCXA 4CR7A 3GLIB 4CKBA 4RYLA 4TV8B 5D3MA 5I4IA 5IT5A 5KOIA 1GZSA 5L4SA 2WSLA 1EE2A 2A9FA 4DB2A 1ZY2A 3C6BA 3RJTA 3RIHA 1K97A 1LBIA 3H4IA 2FEWB 3T5DA 1Q0TA 1XVTA 3Q11A 1WMSA 1JHXA 4ODIA 4OQQA 1N0VC 2FN8A 3A4IA 5BVHA 4FHDA 5AVRA 3MWEA 1PJAA 4OFBA 1GZ5A 3WADA 2HRCA 3OPVA 3C8ZA 3CEHA 1AS2A 2CLSA 1U0LA 3DLIA 3E5MA 4XFKA 1FVFA 3G2HA 1X1TA 4K9MA 2Z98A 3X0DA 2EXXA 3NOQA 1CY1A 2J32A 3NTQA 1K66A 4B84A 2GKOA 2PGXA 3BRCA 2J48A 3DE4X 3FNHA 3SY8A 2BMEA 3JS5A 1P1HA 1T2FA 4BS9A 4DXDA 5BNWA 2VSFA 1O95C 1XMXA 3QXHA 2CEKA 2WU1A 3D8TA 2BJVA 1Z16A 4ZQBA 3CSDA 3PNBA 2CVFA 3T7CA 4R05A 2FWPA 3GJRA 4MVCA 4OAPA 4OH1A 3ISVA 2CSXA 2QN3A 3L7YA 3TL6A 4D99A 4XLTA 4AN0A 4IO1A 4W9NA 1Q0SA 3R6TA 4N7MA 4WT7A 2ZBQA 3AONB 2GUGA 1UBMS 2M1ZA 4B2PA 1XRNA 2YINC 2OEPA 3NGMA 5F7OA 1SCQA 5IARA 3DFUA 1ZL2A 3LPDA 4FQ5A 4OHWA 2CXRA 1NC1A 3GK3A 3HXQA 3HI4A 3A32A 3DBRB 1BCRA 4X3CA 3TJMA 1Z68A 2GD2A 3MEQA 2JGFA 4TKUA 1V47A 2LCIA 1UFRA 1YQQA 2ZSDA 3LNTA 4EELA 5B57C 1NXOA 4J16C 4UAVA 2Z6AA 1Z9BA 2G06A 3CLTC 4V1CB 4RPLA 5JCOC 3GJZA 4BLUA 3ELWA 3STHA 5AHKA 4QOFA 2WJIA 4YRLA 2ERCA 3LX6A 3GVXA 3QMVA 2R8BA 4UCXA 3UPTA 4RXTA 1Z4IA 4NG5A 1VP3A 3F5SA 5IYZA 3ROZA 2LW7A 1PQYA 2FR8A 3GA7A 2J3DA 3U62A 2Z1NA 4GH5A 5LBTA 4EQZA 1XTKA 4XGNA 3T5TA 1LWNA 1A9RA 1PL0A 4B7UA 2BTEA 1KS9A 4GMGA 1RPZA 5EJFA 1E1LA 1DJPA 3QUSA 4RCVA 1YA8A 4JB3A 4A5SA 2CJFA 4TMVA 3DV0B 2YFYA 3DBHA 4FE7A 1H42A 4BO8A 3D6HA 3LDFA 4XSGA 2PTHA 4H0CA 2IEZA 4MH0R 4B43A 2VAWA 3RRYA 2D0OB 4DR7B 1QZUA 3EULA 1U3WA 4JI2B 4KRXA 1EGMB 3OSUA 5E4TA 3DE5X 2XE4A 5C8XA 4W5HA 5HUJA 3A36A 1Z35A 5U4QA 3PA8A 2GEJA 3Q88A 1EAYA 3QLUA 4HWTA 1XD2B 1I1NA 4R40A 3RBVA 3WGHA 3UHFA 1WMBA 4C0QC 4YRIA 3HCNA 4FBMA 4EEXA 2QPOA 5FUVA 2WMDA 2CUZA 3BSSA 3L7BA 1XZNA 2PT9A 3FLMA 1AHPA 3DZCA 3AI3A 2UZ0A 1KMHA 4LHEA 1DAHA 5CM8B 1BS1A 4CKCB 2UYCA 2H5EA 5F1KA 3PC3A 4Y6SA 3ZU5A 4JXJA 4D0NA 4EDFA 3VSDA 4YX9A 3OE1A 4N5IX 1WIWA 2IPLA 1AH2A 1CZHA 2XOKD 2NSDA 2PVPA 4DR1B 1RZRD 5BN5A 1RT9A 3OQHA 1KMQA 4XQCA 4L72A 4LRUA 1QKKA 2ZBEA 1E6CA 4LY0A 4YH1A 5BW6B 2FQ1A 5B3KA 1I01A 1NASA 1FBTA 4KYIB 7ABPA 2IGBA 2IXEA 4U2DA 3MOSA 4EVRA 2CFSA 2TMGA 4FC7A 1YDEA 2R1ZA 4I1SA 4DSOA 4IFBA 1FW8A 2JJMA 1E7WA 4C0JA 5EZYA 2XA1A 1NBAA 2GJAA 4E31A 2W2PA 2AN1A 3FJOA 1HOTA 4RV5A 2YFQA 4DMLA 1IUNA 2C7PA 1M7GA 3R3XA 1M0TA 3OP1A 3KJZA 1YIAA 1W73A 4IFEA 5LUAA 4V0ME 3RVQA 4I9GA 2SICE 2FMTA 3C5VA 1AURA 1FK8A 4YMIA 2V4MA 2NUBA 3BRQA 4FI3F 2GBLC 4GL4A 1LJUA 1OAKA 4ZOBA 1M8JA 3LG2A 4BDSA 3RT1A 2Q2OA 3NP7A 4K40A 1PR5A 1R0WA 5EWMB 5CXUA 1VI5A 3K1AB 3B9RA 2ZYUX 4UARA 3V4SA 1T1JA 1G3UA 3EQ7A 1WL8A 4LYDA 1POXA 4JUFA 5C81A 1JXQA 3GFPA 3WL7A 5IBRA 2I4TA 5JO9A 3QOYA 5CA1B 1JFFB 3C24A 1GRRA 3CU5A 1CS4C 4PN3A 2YZMA 1AKYA 4LFBB 1ISSA 2EVWX 1CW2B 1FX0B 3G8AA 1V1MA 1PG0A 4G4SO 4HSEA 3UBMA 4YBZA 5FL3A 1ONOA 3G0HA 4TSKA 3VR6H 1TVKA 1I5EA 2JFQA 1T8YA 2O8CA 2YBEA 2EFJA 2R4TA 2HRZA 4KC0A 1U8EA 3TWOA 2ACVA 3V4OA 4MQ5A 3TVTA 1THZA 3HU5A 1WW2A 3ADKA 3UHOA 4CQMD 5DNUA 5K0BA 4D45A 3AJRA 5ERYA 5G0VA 1YIOA 4P4GA 1U0OC 1J0CA 1P9OA 3IURA 3Q0TA 3FMVA 4F5ZA 2QG9A 3FX2A 4B4WA 4EMBA 3FROA 1XXHA 3H19A 2GD0A 3U4MA 4ILKA 3TGLA 1AKUA 2AXEA 2Y1OA 5TMBA 3L41A 5IVDA 5ED4A 2CKMA 1O6GA 1QH1B 1DV2A 1HFEL 2VXCA 4H3VA 4B47A 1WQ1R 4K6HA 1DXHA 4DQDA 1CR1A 4YXWA 3STVA 3LIPA 1RXEA 2XMGA 1EK2A 1Z39A 3LUGA 3R4VA 3WRXC 3CJQA 3DZGA