4HNRA

High resolution structure of chemotaxis response regulator chey4 of vibrio cholerae
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
120
Chain Sequence
b'TMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 43
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnrA00
3LUHA 2PUGA 3FGZA 4EVQA 5IX8A 4MS1B 2JVJA 1W25A 5TPWB 3MMNA 3O75A 2F8SA 4EVRA 2IYNA 2FEWB 2PE5A 3O2SB 3T8YA 3KLOA 2HQOA 1PNRA 1Z13A 3OLZA 3A0RB 3Q15C 4TLMB 1BA2A 2GKGA 1DP4A 3OLWA 3LUJA 5IC5A 3TX6A 2E4VA 2FMIA 4RXTA 3LUGA 4MQEB 3HDGA 5HKOA 3E3MA 3MIZA 4W5QA 1NTRA 1R8JA 1SXGA 4G86A 4GNRA 4QICA 4YLEA 2VK2A 4HNSA 2PUFA 1USIA 4ETNA 5DTEA 1KRWA 5TPWA 1RZRD 2RJOA 3FFXA 3QLTA 3ROTA 3BREA 6CHYA 4EYKA 5EWLB 1SD5A 4YWHA 5ABPA 4RK4A 3Q7TA 4GPAA 1GCGA 2WWVD 3LFTA 1EAYA 2MSWA 3LUKA 3N8IA 1D5WA 4PYRA 1QO0D 2JRLA 3KYIB 4HNRA 4MGEA 1FQWA 5BRJA 4KFCA 1A2OA 4L4UA 4UHKA 2HQRA 4IF4A 1KRXA 1DC8A 3IP5A 5EWLA 4OLAA 3EGCA 1ZESA 1QQBA 2FN8A 2JVIA 6ABPA 1RXIA 5JS1A 2JVKA 3RH0A 3LMKA 4XARA 3O74A 3KJXA 1U0SY 3ILYA 4ZMSA 2IPNA 1YIOA 4YP9A 3JTEA 3KS9A 4MQFB 5KC9A 1DBQA 4QYMA 3QEMA 5FBHA 4KREA 4PE5B 1DC7A 3QLUA 4EUKA 5TQ0B 4MR7B 3KHTA 1DCMA 3GT7A 3K9CA 4ZMRA 1NXXA 1P6QA 1WETA 2OQRA 1ZGGA 2PUEA 1MVOA 3A0UA 1M2FA 3MYYA 4Q6WA 3DLBA 3IP9A 4G0PA 4XAQA 3JVIA 5JS2A 4Z99A 4YCSA 4RK7A 4FE4A 4H3KB 4JB2A 4MQFA 4OBBA 4W5NA 3SY8A 3W9SA 3O1HB 2R25B 4P98A 2PKXA 4RKRA 5TQ0A 5BQ3A 1Z25A 3MM4A 3SQNA 2PAFA 3FFTA 3RVMA 1YK1A 3OLVA 1D1PA 5CNIA 5IBQA 2B4AA 3GRCA 5ED4A 3EQ2A 3VNBA 5JNTA 2BGGA 5BR1A 3UKJA 2CWDA 2AYZA 2L17A 1FFSA 3CKMA 2RJNA 1Z26A 3G85A 2QR3A 4LRQA 1DZ3A 2IPMA 3JS5A 3CTPA 4LZLA 2L2QA 3F6CA 2WJAA 2LUOA 1MIHA 5KWSA 5C5CA 2J48A 4XFKA 3NHMA 2PUAA 1VRVA 4O1IA 1KMIY 4RKQA 4RY8A 4RS3A 2PJUA 4IMJB 2WRZA 3C3WA 4W5RA 4Z4FA 4ETIA 2P4UA 4TN5A 3CS3A 3OQOA 3NNNA 2QSJA 1APBA 1DRJA 2FQXA 1LJUA 1FFWA 1JX6A 4EYOA 5HSGA 4ETMA 1H9CA 2HSGA 4RY0A 4M88A 1BAPA 2CD7A 3KG2A 4TMYA 4ML3A 3RVNA 1TVMA 1DBPA 4RWEA 3H6HA 3TO5A 2L19A 3HZHA 3H6GA 4WWHA 1Z12A 2F8TA 4RK0A 5FWXB 3NHZA 1E6MA 3OM1A 3JVDA 2JBAB 3KYJB 3TMYA 1LK0A 4NICA 3FFWA 4WUTA 4ZJPA 3OMWA 1ZGZA 2R48A 1NXOA 4G0ZA 2GBPA 1URPA 4PICA 1Z18A 3C3KA 1EHCA 4EYQA 1JLKA 4RZSA 2QXYA 2KYRA 4KV7A 1ZN2A 3F7NA 5CNKA 1PEAA 1BVHA 5GQSA 3EDCA 2LPMA 3HS3A 4PZ0A 4XXHA 4EYGA 5FWXA 1S8NA 2NT3A 4YGXB 3IPCA 4Z9BA 4Y9TA 2E4XA 3OQNA 3QLVC 5CNMA 4MS1A 3A10A 3KLNA 3NNSA 4HYEA 3URMA 2GWRA 4Z0NA 4OATA 3NNDA 2IPAB 4G0MA 1ZITA 3H5IA 1NXPA 4LX8A 5IULC 3IDOA 4N03A 5F64A 4IGAA 1XHFA 3SG0A 1GLGA 1NY5A 2E4ZA 4RV5A 5DKFA 4PEVA 3G1WA 1EWKA 4E7PA 3CU5A 1ZDMA 3H5TA 4G97A 4MQEA 3DZDA 4JP1A 2WJWA 2PUCA 2QVGA 3HO1A 1QKKA 1L5ZA 3CG4A 2W42A 3L49A 2FMFA 5EWJB 3T6KA 1L5YA 4H3HB 3RVLA 3CZCA 1JHZA 2FTKE 4S04A 3OLYA 1EWTA 3Q9SA 4FE7A 1PEYA 4WZZA 3NBMA 1DJMA 2HQBA 4S05A 4Z9AA 3E61A 2PUDA 2XDYA 4QYWA 1Z2EA 5KQLA 1JYFA 1YVUA 3H1FA 4N0QA 3HJFA 2HJ9A 4IILA 1U8TA 3N53A 1DRKA 3H1EA 4LE2A 5EWJA 5IUJC 5FWYB 3KTOA 1LBHA 3N6VA 3GBVA 3QX9A 1A0OA 2M1ZA 8ABPA 2PUBA 1DG9A 1T34A 3ROFA 2FEPA 3D02A 2M98A 1F4VA 3BRSA 3TD9A 5KQPA 1QP0A 4IMIB 2JK1A 3LOPA 5E3JA 1E6LA 1CEYA 4RXMA 3SM9A 5KQGA 1M5UA 4B09A 3IPAA 4D6XA 3MQ4A 1Z2DA 2X7XA 4YRZA 5FWYA 4JASB 1M5TA 1IIBA 3B2NA 1PUXA 4Z4CA 1MAVA 5IUKC 2GI4A 3DBIA 3ILHA 4JB0A 1YMUA 1YS6A 3SNKA 4MR7A 2MYNA 5BRAA 2E4UA 2PL9A 1EFAA 5DLEA 4XASA 1JDPA 3H5LA 5IEJA 5JNRA 1I3CA 4LE1A 5KC8A 3N75A 5KI6A 2MYPA 2NZVG 4D6YA 2I6FA 5TQ2B 3RVQA 1VLZA 1NXVA 2ID9A 1ABEA 1VKRA 3GL9A 4MYRA 4XLTA 5T7BA 2E4YA 3EODA 4NV3A 5GOTA 3UK0A 4F06A 1SXHA 5HM6A 3I45A 2HPHA 3Q7SA 1JH9A 1C0EA 1E6KA 2E4WA 3HCWA 4EGSA 3HUUA 5B3JC 2AYXA 4Q6BA 2CHEA 4RY9A 4ZPJA 4QPJC 1ABFA 1RXEA 3LKBA 4G0XA 2ZWMA 3N0RA 4O5AA 4UHJA 1P2FA 1TLFA 5TQ2A 4F3TA 4Z4GA 2IKSA 4EY3A 2CHFA 2WB4A 3OO1A 3JPWA 4NCAA 4KVFA 2N9UA 2ZAYA 2FW0A 1QPZA 1YS7A 3DGEC 5JNUA 3RVRA 1PHRA 2NZUG 3KSMA 1OXKB 4MS3B 4N76A 4E7OA 4RXUA 1P8AA 4YV7A 3QELB 3UUGA 3N0XA 3T38A 2QU7A 4OLBA 4MLCA 4Z4HA 1GUDA 1ZHHA 1ZVVA 1F51E 3OO0A 3K4HA 1DCFA 5T3YA 4IRXA 4KNYA 2QV0A 1FSPA 3LUDA 3I5AA 2YHAA 2FQYA 3M9XA 3H5OA 5TE9A 2IDMA 1AB6A 3CLKA 3GV0A 3L6UA 2PL1A 1QNLA 3CFYA 2WY2D 3QELA 1YMVA 4RU1A 1QP4A 3QK7A 1K68A 3BILA 4DQDA 4LDZA 4MRMB 2V0NA 4F11A 4EVSA 2RDMA 1FFGA 2A9PA 3QX8A 1TJYA 1SXIA 3M6MD 4N47A 3S99A 1TM2A 1Z17A 4W5OA 4NQRA 4JA2A 2JBAA 1M2EA 1DBWA 1GCAA 5IEBA 1CHNA 4OTZA 3EJWA 5CHYA 1D4ZA 1A04A 3LTEA 3MF4A 1W9HA 3DLHA 2P9HA 1JYEA 1ZH4A 3C6QA 1JBEA 2QW1A 4MRMA 4CBVA 1QMPA 3A3KA 3QLUC 2RGYA 4N41A 2IOYA 1B00A 4LDAA 1XWWA 4RK5A 4WXEA 2VYCA 4RK1A 5DCLA 1MB3A 4KK4A 3OLXA 1USKA 1BDJA 2LP4Y 3RVOA 1QP7A 3R0JA 3HVRA 2QZJA 3EQZA 2PMCA 1SRRA 4MR9B 3T95A 4KQCA 4W5TA 3CNBA 1P6UA 3P9YA 1TMYA 3M9WA 3I42A 3VNAA 2NUBA 3OM0A 4G0OA 2H0AA 2FLKA 3HV2A 2FN9A 4F8JA 3H5VA 3BBLA 3KKEA 1D2AA 3GA5A 4WXMA 2ID7A 4ZYLA 1VPWA 3LUAA 4MR9A 4WT7A 2FLWA 1USGA 4RDCA 2VUHB 2MSLA 4YR7A 5CNJA 4KRFA 1BDIA 3QEMB 1XHEA 3GYBA 2R4QA 2MSKA 1PNTA 3RVSA 2FVYA 4JAVC 2FXIA 2WMYA 3FDFA 3IP6A 5EWMB 4LE0A 5JNWA 3F73A 1NATA 1UDRA 2H3HA 3QLVA 4DADA 3N0WA 3JPYA 1K66A 1EWVA 4KMRA 3CHYA 3I09A 4MAAA 1NXTA 2FSPA 4TLLB 2B1JA 2LBPA 2JB9A 3O2QB 5DGCA 1OXBB 5TPZA 5JNVA 1HEYA 4JOQA 5KQMA 5FBKA 3D8UA 1JFTA 3LUFA 3HM9A 5IUNC 2VUIB 3FMVA 2A9QA 2OENG 3QEKA 3OQMA 5EWMA 3H5WA 3CZ5A 4OG2A 1QQAA 4NCBA 4Z4EA 3H1GA 3CRNA 1ISRA 9ABPA 4RK6A 3RVJA 2O20A 3HDVA 4P1ZA 1DCKA 1RNLA 4G0YA 2R47A 1BDHA 3LKVA 1CYEA 3OMXA 4FB4A 1ZAYA 1KGSA 3RQIA 1RPJA 3EAFA 2FKAA 2NT4A 2PLNA 4KQ9A 1Z15A 1AB5A 2FMKA 2JCGA 3O1IC 3RVKA 3DGFC 3EULA 1U2PA 1ZY2A 2YHBA 1JF8A 3H75A 1JL3A 4L85A 1U2QA 3C97A 1ZH2A 1MB0A 2FQWA 1U04A 2L18A 4MLDA 4G0QA 3TB6A 1JDNA 3Q7RA 1GUBA 4RSMA 3IP7A 5TQJA 3KCNA 7ABPA 3MA0A 5JNSA 1LBIA 4MS4B 1JFVA 3O1JC 4MR8B 3BRQA 5TPZD 1C4WA 3HSYA 1NXSA 1Y1LA 4YO7A 4O1HA 2LIVA 3RVPA 2Q5CA 2MYTA 3CG0A 4H60A 2QVCA 3LUCA 1D1QA 1RZRA 4Z4IA 4MS3A 4N0PA 1J56A 1NXWA 2FMHA 4MPTA 3SAJA 3JY6A 2FEKA 1JWLA 4F12A 3O2JA 2A9OA 3Q41A 4KK3A 3GWGA 4HNQA 1LJLA 3HEBA 4YS6A 4KZKA 5D2CA 4DN6A 5C5EA 2TMYA 5I4CA 2DRIA 3F6PA 3GBPA 4MS4A 4MR8A 1QO0A 1Z16A 4KPYA 5HQJA 3HUTA 3C3MA 4Q7EA 4D74A 3HXMA 1YTUA 5PNTA 3HK2A 1JFSA 5B3JA 2IPLA 2A9RA 2GX6A 3O21A 1YK0A 1E2BA 1ISSA 2MYUA
chains in the Genus database with same CATH superfamily
4KOAA 3RF6A 3N87A 1SBZA 4XCQA 1IM2A 2F8MA 2VQFB 1BKSB 2XOKA 2DFVA 2WYVA 2GN1A 5DBHX 3CMMA 4D8YA 1B41A 2QAJA 4CIWA 4IIBA 3TCXB 1H42A 3C5VA 1PNRA 4QJBA 3GRPA 2JI6A 4QJIA 4GL2A 4AIRA 3OZCA 1QH8B 1NW6A 2PUWA 2VBFA 4KE9A 4OFBA 2ZIVB 4RZXA 1NTRA 2ZRNA 3W8FA 2G8NA 2F1IA 1ML3A 2VK2A 1C3LA 1S9HA 2IOFK 2MMCA 1QTRA 3EC2A 4LMAA 4BNVA 5JRJA 3RHTA 1F38A 5JEEA 4B3RB 1GL6A 2ZUUA 3Q12A 4O1MA 2X6RA 3K73O 1G5FA 1I2DA 4WBSA 4I4TB 1F2UB 2IUTA 2F9LA 2PX2A 1B1CA 1SD5A 1NIJA 3NHFA 1Q14A 2IXDA 4J1TA 5ABPA 2X3UA 2PKQP 3CEAA 3G8DA 4X95A 3M4XA 1XPUA 4N7BA 4LRXA 1YDEA 2HCRA 1CHDA 3P0JA 4QPCA 2ZSJA 4NCIA 2OYCA 3RYIB 4NK4A 4X84A 4K9PA 1ZVKA 4B6JA 1X80B 2WTXA 4Q3EA 3I8OA 4PYRA 5FCDA 2EJWA 3GAAA 1UBUS 1E7SA 3KYIB 2O5CA 5BRJA 5LZ9A 5F9MA 2ZKLA 4ZHQF 5J47A 2X42A 4MUXA 1IY0A 2JFGA 3ASVA 1DC8A 3RJZA 5I9TA 4QFBA 5JO0A 3H8WA 3TQHA 4TT8A 1OVMA 3IR7A 4M9ZA 4RORA 3VC3A 4B84A 2H7VA 3KSRA 1CTQA 3BUSA 3H13A 3MGAA 2E5FA 4WCFA 3UXMA 4LSMA 3RYHB 3WRVA 1U2ZA 3D6FA 4DNQA 3T61A 4ZYTA 3L7AA 1A5TA 1G5PA 1I24A 4FM9A 3CNEA 1P2DA 3UJPA 2Q9BA 4DC1A 3GPCA 1ICEA 4OQDA 1RAIA 3VPFA 4GP9A 3RGWS 3ZX5A 1UWVA 2X22A 4ITRC 1YA4A 1DFIA 1ORWA 4ZYZA 2G0NA 4GLOA 3M6AA 3TOVA 4E5KA 1N2BA 3QE9Y 2D0PB 3WYFA 2WAOA 5D86A 3TNJA 2JLRA 3TOZA 4IDQA 5AICA 1KAEA 3WKCA 5CVJA 3AMVA 5EJFA 4DUYB 2OQRA 2WAMA 3BA1A 4ZI5A 4QARA 5D01A 2YNMA 2ZIAA 2J5XA 3KFXA 4CEIA 2GCOB 4LJSA 5DTQA 2RHJA 2EX1A 1O4WA 1SA0A 5JNLA 3GUVA 5EKXA 3FCYA 3ESQA 2PX3A 1EVEA 1MFZA 1YCDA 3Q1LA 3O1HB 2E4AA 2R25B 2QN8A 2REQB 5I8ZA 3LUPA 1W85B 2QJWA 2W6MA 1XLTC 3G6KA 2XCUA 3DT8A 3P0HA 4QQ8A 3RVMA 2ZIEA 3IKMB 4NDAA 3V1KA 4J16A 4JSRA 3L8HA 1C14A 5ED4A 3ST7A 2GLXA 3CX6A 2VT3A 4KDEA 4KXMA 3GQVA 2CWDA 1GL7A 1MRZA 5EEHA 2P5YA 2D1FA 3TTVA 3ZXXA 3W78A 3RYCA 1M2OA 5J2UA 4KIGA 5HW0A 3A4IA 2WM9B 4BC1A 4I2NA 4HGNA 1MD9A 2QTBA 3HCAA 5JC8A 5JH7B 1DWOA 2AZTA 2PGJA 2PKRA 1E77A 5EVCA 2JG3A 4YMVA 1T1RA 3EQ7A 2GZ3A 2O54A 2EERA 4RHFA 5JSZB 4AU1A 3LDGA 4BPRA 1U28A 1MO4A 3HADA 4NZPA 2D74A 2B99A 4GXNA 1CJCA 3UTDA 1CUYA 3F4BA 2WHQA 4BYMA 4BZZA 1YACA 4EENA 4G8DA 1P1FA 2WWIA 2RIRA 1UBFA 3N9IA 4RQTA 1QLJA 1KJZA 2CHUA 4CU5A 2PA0A 2WI8A 1KYZA 1FFAA 1KFKB 2VJKA 2Q4TA 3KSAC 5AYVA 5D00A 2Z6AA 4TWIA 4V3CA 3T7SA 1ZC3A 4MVJA 5FO1A 4DA7A 1AQNA 3EVEA 4XD7D 3UW1A 3K0BA 3ZXUB 2W0SA 4LJLA 5KNCD 4YQZA 1I6MA 5EP4A 3ZCRA 4BQRA 3SQDA 2HSGA 4HSGA 2NQ2C 1FJXA 2V5VA 2IBMA 1BAPA 1P6XA 1CSEE 1PK7A 2VJMA 2ZIFA 1M54A 5T4FA 1TVMA 4ID9A 4IDNA 3R7NA 4EHDA 4RE6A 2IL1A 3CNQS 1D8AA 3V4PB 1C7QA 1DAHA 1ZIOA 3GPLA 1EQUA 3OOEA 1HYHA 3RANA 4ZGGA 5C1OA 1B6RA 1U5BB 3K9GA 4RMIA 4WTOA 1UMBA 1NM5A 2A5JA 4GOLD 3CWZA 4L8GA 4EPXA 3FFWA 4F9EA 4NV0A 3SMVA 2VF7A 1ZC4A 1D1TA 1R0WA 1ZD3A 4PG6A 3GO4A 2AN5A 3U3OA 2VJDA 3GI1A 4HKTA 1GO2A 2WD8A 3DONA 4CKCB 3JD0A 4AJIA 4TTJA 1N6KA 3F7NA 2ZKIA 3ER6A 3ED1A 3L77A 5FV4A 4X7RA 1QFJA 3HWX1 4JCCA 5U1PA 3RRFA 3HS3A 4YAIA 2XWJI 2ZJ7A 4OHFA 4BNDB 3KZKA 2X8BA 1OAOC 2OBYA 2BF4A 3QWBA 4H59A 4AJNA 3EQ6A 3H8JA 3R6TA 3NNSA 4WZ6A 3PR2B 1HDRA 4RHTA 2A4KA 1J8YF 3S40A 1PS8A 1RACA 3B36A 3AEUB 1QO9A 1VI5A 3H5IA 5T57A 1NLMA 1FNBA 2FUG6 2ST1A 2YV3A 2ZJZA 3BORA 3QU5A 4LX8A 3WGVA 3ZHYA 4HT3B 4KLZA 1LW6E 4RVGA 3VZCA 2BI4A 4MQEA 2OO5C 2O57A 5EPOA 1ZS9A 4A8JB 3M70A 3UGJA 4WFJA 1R8QA 2OBBA 2QVGA 3HDYA 2LZ0A 4TL9A 5JCPA 2ZSBA 4GBMA 3LVFO 5AJWA 2OG1A 3I0MA 3U3RA 4DVJA 4U02A 3T5AA 3L7LA 5AI4A 3IE1A 5CCBA 1E5TA 3VPDA 1GTZA 1MG5A 4XOUA 1SFRA 2W83A 3GVPA 1GDTA 2P6MA 2WDZA 7MDHA 1IN4A 2ZJYA 3G2MA 3HJFA 1QZXA 2HJ9A 3OOWA 4YXWA 1ENOA 4S3MA 3IUNA 1O96A 3G59A 2Q8PA 1WMSA 3U31A 4CNQA 2HF7A 2I7DA 4JYBA 1K8XB 1E2QA 3BHMA 1CG6A 2XD9A 3KV3O 2FPSA 4DJEC 4OQLA 2M6SA 3M4NA 4LBVA 4OQEA 5B57C 1SPXA 5C18A 3RAJA 1Z2AA 3E05A 3BRSA 1Z2PX 2C2OA 4MQMA 3FRIA 3IC5A 3EGWA 4FKBA 4Z53A 2B2XA 1MXHA 2JI9A 4JBYA 3B1WA 2HQSA 3STUA 3AJDA 3U4QA 1QFXA 2EFGA 1FYVA 2R8ZA 4JU8A 4NX2A 4TVKA 1N57A 1NNI1 3T94A 1Z4IA 1KH3A 2BKEA 3D6NB 4GRIA 1EVQA 5K45A 3RI3A 3DZHA 4M7RA 4XEUA 4CL0A 4UBKA 4HNTA 3LCCA 3E5RA 4CLOB 4I50A 5TY0A 4F5YA 1JG4A 3VR3D 3GZNB 2V7VA 4OMFG 5E9AA 1C0LA 3SNKA 5J4YA 3DCYA 3R9XB 5AKZA 3MLAA 4E03A 5E7JA 3QYAA 5H4GA 1QE3A 2QBYA 4B3IA 4URXR 5JFOA 5AKLA 1NW5A 2IYAA 3I53A 4BBZA 1I4TD 2RC6A 2RGRA 2J5QA 4L02A 5CFNA 3VR0A 4FN4A 2YXBA 2QTMA 5T4BA 2V7GA 4XLTA 1OX4A 5KCZA 1KL7A 1GVNB 4NV3A 5GOTA 1KIMA 2XITA 3HCEA 4OIFA 2WJ3A 3VPAA 4U4AA 4JJFA 3VUFA 5A5GA 3ZQ6A 1ZN7A 1K27A 1K1EA 1O6GA 3C5CA 4R8KA 5ALVA 5B3JC 1DG1G 3KKPA 3RROA 1KEEA 1G38A 4I81A 2ZU6A 1GFSA 3GOHA 4WOJA 5GOZA 5A3RA 2VWQA 5CD1A 4WCDA 4RPLA 4LTNA 3G8YA 5AK4A 1G7CA 4UXJA 4F3TA 3K72B 3R9KA 1QO7A 4MPRA 4I1YA 4KXFB 2E21A 2Z2IA 3R3VA 4DSOA 2IBTA 1JS1X 4JOSA 3AQIA 1P4JA 1KO7A 4IDPA 1VIVA 1AK9A 2FJUA 3FTDA 3QU7A 4PN7A 1KRHA 2PS0A 3UAGA 3IB3A 1MT0A 3EXHC 3HB1A 4PX2A 1VHDA 2JLYA 4DR6B 4PS0A 4R9RA 4MLCA 1CULC 4TSFA 1SIOA 1QWOA 4KYUA 4QG3A 1X1SA 3G5UA 4ZCMA 4CT0A 2EQAA 2Z8ZA 2VUTA 2Q1SA 1CQXA 3FNRA 2OCDA 3G2LA 2TECE 4PQFA 4TKZA 3AIIA 3UY4A 2FQYA 2J3JA 5MGBA 1GEEA 3M9XA 2TYSB 1KYQA 3KTFA 4CF6A 2FP4A 2BAGA 4IINA 2YS7A 1FFEA 1OSNA 1R6AA 2I78A 2PL1A 2PVSA 3CGGA 4KFTA 3KELA 2X9LA 5FBVB 4HNAA 4B85A 1D6MA 1Y5IA 4GOKA 5DLPA 3TLZA 4RFVA 2WKSA 4MB2A 4QJ3A 2YFHA 4O4IB 1AO3A 3M6UA 1BX0A 3W4IA 2AHOA 2CMFA 2VDWA 1M6WA 2UYGA 1HYQA 1S89A 4JT2A 4F11A 5I48A 3IUSA 2GZ1A 4L95C 3E58A 3KQNA 4HAUA 4LYJA 4YP1A 2F67A 3T0GA 1SXJA 1IXZA 1FC0A 1FP6A 1L7DA 3WYCA 1F20A 2XIQA 1JHRA 1THMA 1DBWA 4JFAA 4FDMA 2AE2A 3T9FA 2D7JA 3PRHA 1OZHA 4LQ4A 1NJ1A 2XNHA 3M5CA 4HY3A 4E4TA 1UZAA 1ULSA 5ITVA 3EGIA 3NT2A 4P31A 1N9GB 1PVOA 1PEKE 1Z22A 3ZDYB 4BMNA 4YJ2F 1YFLA 3I3SR 5HDBB 4CBVA 2YFYA 4Q4HA 3UK6A 4CMBA 3IQWA 2QMYA 4KXLA 4NP6A 4N41A 1U6JA 2ODTX 1WPGA 1G8HA 2VZ9A 2AOUB 3I4FA 5K3OA 1PT8A 1BGVA 4MGZR 1F3OA 2XQGA 4GUDA 1E2GA 1YC5A 3WLJA 2C54A 3FTQA 4QU9A 4CL2A 1J0EA 2R7AA 4JYAB 3MBOA 4FHZA 2VIIA 4OHMA 1WNTA 2Q1YA 2QS9A 2ZSKA 2VOJA 4AF7A 1TMYA 1KYVA 4QNNA 3AOEA 2ZG6A 3IIIA 1SEVA 2OCIA 4WKGA 3EXEA 4EG0A 4FUQA 4JSTA 4X3CA 1TC1A 2ZJ1A 1YZVA 2VBCA 4KE7A 4RNCA 1EFPA 1FP2A 2X19A 4B4WA 1U4NA 3SIWA 1XU7A 4HXFB 3DT6A 3SOPA 3OOHA 4RAQA 4EJMA 1XQ1A 1QRTA 2XW6A 3R7WA 1P81A 2X4GA 4TZ0A 4UAGA 1L1RA 3HPRA 3ET5A 5AVKA 2MSKA 1TMKA 1Q7BA 2HJGA 2BJWA 3G8CA 4FMCF 1ODCA 3GEPA 4FYMA 3M2PA 1HSZA 3UF0A 4Q9HA 4F3KA 4EJ6A 4OYHA 3L8MA 3KKMA 2QZ4A 1NBHA 2A86A 4DADA 4QU0A 1UOOA 2XVAA 2Z0MA 3FWHA 2YR0A 5L3RA 2ET6A 3UT5A 3VTZA 4DREA 3THRA 2AMLA 2FSPA 2Z8XA 4Q24A 2JB9A 3LX4A 2G1KA 5JQWA 3H16A 5BVHA 3NUQA 1CRPA 3RS7A 8LDHA 5KIAA 1QK4A 4I8DA 2F59A 4RTPA 1GNSA 5D3KA 5HFJA 1O9HA 1QAQA 3PHGA 2JZOA 4KQKA 4G01B 3NX4A 3P0EA 4UHEA 4W5WA 1WBBA 5ES4B 2AZXA 2PLWA 3RS3A 1NVVR 3H1GA 5I9SA 4KPYA 5ICMA 1ZD4A 1ISRA 1XMQB 4ZK2A 3HVUA 4RK6A 1ECBA 2BFBA 5IYZF 1FVFA 2B92A 3NR2A 4DHEA 3IYLW 3R7SA 4WE3A 3PD7A 2IIVA 2NZXA 3FCSB 3LKVA 3WL4A 4P7JA 2G5PA 4QXOA 5DK6A 1E9EA 1KDTA 2VDQB 4WAUA 3TB4A 1JAZA 1H2FA 4Q4DA 2L0XA 4HX9A 2PLNA 4G09A 3OU6A 2WYOA 4ND8A 1D04A 1JVNA 2X14A 2WWHA 3MJTA 5HXAA 1SKAA 1AUPA 4Y3UA 1YO6A 5K8TA 1E20A 1Y4DE 2Q2OA 1KI8A 2ZK7A 1SUWA 4LF7B 4ND2A 4NAHA 3GA0A 4M37A 4K9OA 2FQWA 1M0WA 4TTSA 4BLOA 4TTPA 4IJWA 1AG9A 2KPOA 4D9NA 2W00A 1LBEA 2PR2A 3IE2A 4OP2A 4W1SA 1XP5A 2IE0A 3CT6A 4DV1B 2OMKA 1JDBC 1FA9A 3K71B 2PY6A 1PHPA 4H08A 4DSUA 3ZK7A 1IONA 2G25A 2WA2A 2BTOA 1U0RA 1S01A 1DKPA 4YP7A 5JVDB 2ZULA 3HU1A 3V2GA 1SQSA 3DG9A 1UC5B 1U8EA 3I0ZA 1E7MA 4AKHA 2N75A 1W44A 4KQIA 4V38A 5EKUA 4EW1A 2VP2A 3I30X 2GR9A 4LWPA 1GCOA 4AJ1A 4DYHA 4KK3A 3GWGA 4HNQA 2QTFA 2LKCA 4ZTUB 4QA9A 4R6WA 3OJ0A 3AEYA 2CNDA 2OKCA 1DVRA 2BCEA 2PFGA 2R1VB 2V65A 1QO0A 3JR7A 8AT1A 1B16A 1N2IA 3PYMA 3UJCA 1D2NA 5DH9A 1EXDA 1DC5A 1DX6A 1RXSA 4Q7EA 4E1AA 3AHEA 1G42A 1RHMA 3CRZA 5ALKA 1UMCA 3RK0A 4C43A 3G9ZA 5G4KA 5JJ5A 5JBIA 3IV7A 1O89A 1ZA2A 4B3TB 3TOCA 1P2GA 1ISSA 2MYUA 2ABWA 1JMYA 3LUHA 1E1CB 4ENPA 1S8OA 4IZOA 5IX8A 1PW7A 1W25A 4BYGA 3PVZA 5E6UA 2VZLA 1JR4A 1XC7A 3WB1A 3LRTA 2BTQA 3JTMA 4RSHA 1UBJS 1IBLB 1UZUA 2Z1NA 2B1GA 2SHKA 3CUEF 3E5HA 4IAOA 4KVZA 3A0RB 4LW8A 2FOXA 3FF1A 2XODA 4W6QA 3U4IA 2H0QA 4RXTA 1HY3A 3LUGA 2C2XA 1IVNA 4MMYB 1GYQA 5KOHA 5JECA 2WP8J 4RKYA 1PR3A 4NFHA 2NO7A 2FEXA 4B71A 1KI6B 2EIXA 5J58A 3W5VA 5JWOA 4NZNA 4QICA 4EDHA 5K8IA 5LQAA 4CEJB 4MUKA 2PX6A 4PLTA 3ZTWA 1KETA 1OH5A 2Z6QA 2AZ4A 1QHSA 1RJ9B 6CHYA 3KB2A 4Q66C 3S29A 1J0AA 2IELA 2NW6A 4JUIA 3NHJA 1MX5A 4YRQA 2XNKA 2IHUA 4BE4A 3G82C 5TB5A 2PSJA 4PCUA 5IKEA 3HDQA 3AWIA 1KO4A 5HQ3B 3F71A 1P5FA 1W19A 2QGFA 1BGXT 2JRLA 5HF5A 1RIFA 3JZMA 1WPQA 1XTQA 4M89A 3QA3E 1FTNA 1GFWA 3DWIA 2CFSA 4RHCA 4EA9A 3D4PA 4FOPA 1TZCA 1JHYA 4HDKA 3E9NA 1OB5A 5FKJA 1WAMA 2ILVA 1P33A 4FONA 1QYWA 3EWIA 1TKAA 1EGQA 2BONA 3KD3A 5FTLA 3DZBA 4JR0A 3NHWA 4LRSB 2QOEA 3H2IA 3DAGA 2HNKA 2H4JA 4TUYA 3RH0A 3A3PA 3T3PB 4CDGA 1TQ8A 1N2ZA 5DGHA 2PRKA 3ENKA 1NBAA 1WXQA 2WFLA 3C48A 4MQFB 3L6CA 2PU7A 4JIMA 4R51A 4R2HA 3U09A 4W5HA 3NIBA 5FBHA 1FYFA 3OIDA 1V16B 3MFQA 4L8VA 2O19A 2F8LA 2BCJQ 1L5RA 3AU9A 4ND4A 1BS9A 1T5OA 1R4MA 3UJNA 2XCOA 3L1JA 5J2UF 1YASA 2ZFUA 1RQLA 3K1YA 4HHEA 4HQ0A 1WETA 2A5DA 1MVOA 1LQUA 4IBOA 2BUBA 5GINE 4G3XA 3ABQB 1H69A 3TGPA 3WAJA 5HZGA 1VE1A 1QV7A 1Y48E 3E1GA 3FKSD 3P26A 3T54A 5IPFA 3A9RA 4R16A 2B94A 2V7EA 1Q19A 2JHPA 3SY8A 3W9SA 2P9BA 4P83A 2XEDA 3HSKA 3ESXA 4L8FA 1NQVA 2GZRA 2N3ZA 3DR3A 2QI9F 4II2A 5EY5B 5KKAA 4LHEA 3K2EA 4KRYA 2IP1A 3BA6A 3MM4A 3SQNA 4MMXB 3RV3A 3LQRA 2PZJA 4J0CA 3UIEA 5HJ5A 2XYVA 4XI9A 2QX8A 3L0PA 1WVGA 1GJRA 1XRRA 2QTZA 4M1YA 4AL4A 4D6PA 3GLTA 1GA6A 3EMKA 3HDHA 5F3RA 2QG6A 5H83A 4KP7A 3JZFA 4PSKA 3DOFA 2B4YA 2HHLA 2OXFA 2R8RA 4IDAA 4MQBA 3WQHA 4AECA 1GT6A 3FVTA 5KYYB 2Z9DA 4JLNA 1QIHA 4QYSA 5KOJB 3CTPA 3BE6A 5CDGA 1DPGA 2W9XA 4A15A 1QBKC 4KN6A 2LUOA 4UVIA 1H1LB 4JVMA 5G53C 3DMYA 3TKAA 1OBFO 3MPUA 4NYIQ 4QD3A 2ONYA 4XFKA 3T7EA 4OHCA 3ZX4A 5GADl 1E2JA 1KMIY 2AFIA 5THQA 4ADSG 1CY4A 4YRFA 3KM0A 4RHEA 3N3AC 5LQNA 3QVVA 1KQGA 2O4UX 4B8ZA 5ALMA 2PJUA 3KD2A 4H0FA 4Z7OB 3A4NA 1N7IA 1UWLA 3KSBC 2AJBA 3AUFA 3B82A 3ANSA 4LX0A 5CDYA 4BU1A 1C7IA 4TPKA 4K0KB 5CTJA 4UHBA 4GP6A 5JR3A 4HWKA 4WKOA 3KB8A 3CZ9A 1WE2A 4X8OA 1MTZA 4EHNA 3GY0A 3VU8A 5JMOA 5BYJA 1JHOA 4AX4A 4QRHA 3MK31 2Y0PA 2AT1A 4RZHA 3UJ6A 2Q46A 4YUAA 3FTFA 5LR6A 5IH3A 5LQKA 3TO5A 1U9IA 2QTLA 3RYFA 1ZMBA 2OM6A 3OIUA 4HRVA 4BZQA 2IHNA 3CXUA 3ITDA 1J0XO 2AG6A 5IP5A 2PT9A 1HFJA 1N6RA 5IKOA 3STVA 1V5IA 4B9EA 3JX9A 1V11B 1E6MA 1Q3KA 3GW8A 3C7CB 1LDEA 3HEMA 3OM1A 4LK2A 4XX1A 3TMYA 3ZE7A 1SKUA 4BFWA 3KJEA 4CMEA 4HRYA 4N9WA 2GBPA 1GRQA 1WDMA 5LLSA 1Z18A 3C3KA 2GZ2A 1OUMA 4BB6A 3DJFA 1FDSA 3KOYA 1HLDA 5JXGA 4JY7A 3H19A 3O8BA 3G0OA 1H05A 2YXDA 4ZICA 5I9NA 3TLCA 2V9CA 3JATA 4YGXB 4AIIA 4URHA 1TQHA 4LNHA 3ZC3A 5IDVA 3R3SA 2ZTVA 3LF2A 1V8DA 1WUTA 1R0CA 2NOAA 3D1LA 2BISA 3VH4A 2J8ZA 2VDKB 4HGQA 4M98A 4QT0A 4W8GA 1I7QB 1F8GA 5IAJA 5LB2A 2GK7A 5KHAA 3OPYB 3EGDB 3VJRA 1RCUA 4NU0A 4OMUA 3GDWA 1H2RS 2EWMA 5IANA 4HDMA 5DSZA 5CCXA 3ENVA 3PF8A 3X1KA 2UXDB 1A2QA 4Q3DA 3I76A 2F2TA 3TRKA 4CCWA 5AM0A 3AINA 3GGDA 3L1HA 4FIZA 5AUOB 1VE5A 2QTRA 2XRMA 2W42A 4LWQA 2Y0EA 1P44A 1WABA 2FTKE 5JW6A 5FPSA 1E9RA 2NN3C 3F98A 3IA7A 4HLUC 5I9BA 3UCXA 1LH0A 1CY1A 4HZGA 4OI4A 3RIXA 2QGNA 2YMQA 5LA6B 4RIEA 3PUJA 2ERYA 1QTNA 2B30A 3MUFA 4I1IA 3T1OA 4BVGA 3EX7C 3FPFA 3EFBA 2DT8A 1Q44A 3H42B 1VZ3A 5BRNA 4JJGA 1EWYA 2C88A 2P77A 2E48A 1HDCA 3VBEA 1QHNA 1I01A 1LLUA 3N53A 4I50F 2VF8A 3DE0X 4JVOA 2JA1A 3HXOA 2I2XB 3KXLA 3ZU5A 2PUBA 1GILA 4EY4A 1JFFA 2GJ4A 3FNHA 3VHLB 2BL4A 4A0HA 5DASA 3B51X 2CVFA 2NXNA 3OIFA 1Y1TA 3TD9A 2V97A 1FF9A 2CUTA 5TC4A 5HFNA 2X1HA 3WWZA 3X3HA 1UPUA 1KZ1A 4MITA 3H05A 4AF8A 1W35A 4C78A 2M6LA 1OH7A 4R9VA 1RWMA 4R4JA 4DCUA 5LFAA 3RRJA 5K20A 3O8CA 5KTRA 2X7XA 1Z82A 1VB5A 4KL8S 2IU0A 5FWYA 5K9ZA 1GLVA 2YCLA 4P35A 2PJZA 3QY9A 4Y6OA 4BN5A 5IABA 1MAVA 3QRWA 4U5QA 3SD7A 1CE8A 4PLGA 1UEJA 4ZI7B 1SKMA 1CJSA 1F14A 4KO4S 3LOQA 1LFDB 4W4TA 3WVNA 2IW1A 5HIJA 1GPAA 1YVDA 4FW8A 1GZUA 1DIAA 3OZVA 4MK4A 1C1YA 4JJKA 2HU2A 3AR3A 4PG4A 2QROA 2ZIUB 5A0TA 1XQVA 2MSEB 1VKRA 4ZT7A 4DCSA 1A69A 3D64A 4FWTA 4DIMA 4NYMQ 1SD2A 3BB1A 4YP5A 3NRBA 1SGWA 2JGIA 4YIKA 3W1WA 1AUQA 3ZNPA 3IAHA 3ZY6A 4POAA 2XF2A 4M1QA 3EE6A 3FMOB 3NTQA 1JHUA 1V3QE 3EDOA 4PFJA 2GFHA 3QBDA 2CHEA 4XYGA 5JXWA 2J9RA 1X7YA 1R8SA 4Q48A 1NVBA 2WHXA 2LE0A 2AJLI 4O5AA 2HTFA 1Q91A 4DUGD 4EGFA 1DJLA 2E49A 3OO1A 5JZOA 4CF5A 3QFCA 1TTTA 2HYDA 1FDWA 5LLDA 3TLAA 3V8QA 6REQA 4IYRA 1CS4C 1M8GA 3S68A 1N2SA 4EX6A 4RD1A 2Q3BA 1RXWA 2J9YB 4H1TA 1T35A 3IV9A 3ECCA 3QWHA 4X20A 4UVGA 4IIHA 1ZM7A 3P5SA 4H17A 2RGBA 2XUDA 1RRKA 3BEOA 2ORVA 4S1NA 4D3XA 4V1CB 1DCFA 2O05A 2DPMA 4NEQA 4CHGA 5JFTA 2QV0A 5BMVA 4LZOA 4WPGA 2RAFA 1PDOA 5B53A 3V7NA 2JI8A 3PVCA 1AO0A 1FUIA 2QRMA 3OLQA 2P0AA 3GT0A 2B5OA 2R00A 4V0QA 3WNQA 1PFQA 4FSXA 5CCDA 1RBYA 4GPIB 4C7BA 1G8AA 4J0QA 4RU1A 5KPJA 1G0NA 2YMMA 2C00A 3DDSA 3KQKA 1CY0A 1QYIA 2AG8A 2JIOA 4PW0A 2VA8A 1WHSB 1KAQA 3BILA 4MZDA 4P7BA 4PZ9A 5EXDA 3BKXA 2G83A 1VPLA 2RK4A 2IYTA 1Z8FA 2ODNA 2XBLA 2J7PD 4IZIA 1Z6YA 1TM2A 1W5AA 1A2KC 1AC5A 5HIKA 1JEEA 4FQ8A 4NKRA 1NV9A 4D79A 3W4KA 4Q4AB 1YBAA 2VN8A 3KVNA 3CLRC 3N8HA 1T10A 1FLAA 5D7BA 3AILA 3LXRA 2AJTA 4DT1B 2IZZA 3GEBA 3SNHA 1KXZA 3WGGA 1B93A 4DV0B 4BCDA 4I1RA 1GTL1 1J9ZA 3N7AA 2P9HA 3SHQA 3D2LA 3QOXA 9GPBA 4Y6GB 1MB2A 3CIFA 2EFEB 2IOYA 4XDGA 4NXMB 3H2BA 5DCLA 1RWBA 1OWNA 4P6VF 3KNZA 5LZ2A 3FCCA 1K4YA 3IKJA 3U26A 4DLLA 5LPNA 4KYTA 5HJ7A 1LSUA 1TF2A 1BDJA 1VSQA 3HDJA 3KT8A 3ZHOA 3A3NA 2BKXA 2Z5LA 2HQ1A 4CQMD 1XEWY 1NJ8A 2PRIA 1HXHA 2RI1A 4M83A 1D03A 4KQCA 1R1DA 5JSYA 3UWSA 3WADA 1U6KA 3ZW9A 1CJMA 3BWVA 3R3XA 4AMBA 2OHVA 4GI2A 2B61A 4YUVA 3W6OA 2VYFA 1JAYA 3FDIA 3FKSA 3SXUB 3THSA 4QIHA 4R8MA 5I51A 1YJBA 4TSRA 2EGGA 2JI7A 2XWSA 3HV2A 3K30A 1J1IA 3EN0A 1LK7A 4YECA 4BC0A 1ZOPA 4AG5A 3WKAA 1EJ0A 1EFUA 1FXSA 1ZMOA 2Q62A 1B2LA 2UZAA 4H77A 1ULAA 4QKQA 1SB9A 1SUBA 5ESWA 2Y2UA 2JD0A 1OGIA 1BDIA 3N8KA 2J31A 1HZJA 2CKMA 4IQ4A 1D2RA 2CDRA 1Q5PA 1M7BA 3OPVA 5E9WA 1VHLA 3ZCUA 2WU1A 2G07A 2Z1MA 1Q11A 4HZUB 4IDHA 4RD0A 2H3HA 1JQ5A 1MEJA 4ES6A 1QYDA 2ZRLA 3QKRA 2ETXA 3L93A 2PX0A 4DQKA 2W2LD 1GFZA 5MFZA 2W98A 2ZBVA 4FNMA 2BDEA 3AK4A 4EMTA 1QMGA 3ABZA 1PV4A 4OHPA 2I91A 2Z2XA 4S1TA 2RG7A 1XAHA 3E8MA 3OUTA 4JOQA 3TRHA 3UV7A 3DWGA 4LEIA 2GAJA 2OQ2A 5H0IA 1QIKA 3DPIA 4RTNA 1X7DA 1ETUA 2B7BA 2NUTB 5EWMA 2BIFA 1OF1A 2IOQA 1JH8A 4OQYA 5DBEX 3CRNA 5HYVA 4FS3A 4YRMA 3RVJA 1Q1GA 1DAMA 4FT2A 4AS2A 3RFXA 5IJZA 4FNAA 2I76A 4AG3A 1T4GA 4E4YA 3IESA 3LT2A 3RIGA 5KKNB 1V35A 1UFKA 3VGJA 4MYDA 4AJ4A 3TCKA 1N8SA 4L6AA 3O0DA 1MJGM 1KTIA 3AJ8A 4KMMA 4ZCQA 2XECA 3RQIA 4H7HA 3SEQA 5C51B 5J2TB 3H1AA 1KZ7B 5DWDA 1JJ7A 5A9SB 3SJCA 2QRQA 1V95A 3HABA 1GNTA 4FXPA 4UJ5A 1Z15A 1AM4D 3ZDCA 1L7XA 2WV9A 3NATA 2IXAA 4HFMA 2D5LA 4HEHA 1ZWKA 4K05A 1HT3A 2W2KB 1EBUA 3G0BA 2VDNB 4J29A 5ALWA 3RU2A 1S4QA 2WSYB 6Q21A 3FLBA 3DBOB 3TIFA 4OBEA 1II0A 3W05A 3A4VA 2IH4A 3SF8B 2X9VA 3IP7A 4I14A 1EESA 1KI3A 2AE1A 4MVJE 1RYYA 4HH1A 4IDEA 5EG5A 5C80A 3PGA1 5DSXA 3OAAD 5KNDH 3JQEA 3CLTC 2P69A 2O8DB 1I6KA 2C1EA 3DPUA 1QF7A 3HNRA 3M6XA 1NBMA 1DC4A 3CG0A 3NC1C 3I9V6 4BE7B 1WD5A 1XAIA 1WKVA 1OZFA 2VTEA 3OQPA 2WIFA 5CXSA 2Y77A 3PHHA 4L5AA 3PWSA 2VSNA 3KYBA 1YONA 4OGWA 3U3KA 4D4IA 4D7AA 2W71A 3Q41A 2H2AA 1A77A 2Q2NA 4YMSA 4BGEA 1KPHA 2GBLA 4DM3A 1Q2UA 4YRAA 2YN4A 1WDTA 3HFSA 3DH0A 5C5EA 2GN4A 1E4YA 3LY7A 2ZBFA 4XRGA 1JTFA 4U7DA 2DOKA 1X3LA 1ZVMA 4HNGA 2CXRA 4WNAA 5AJYA 1G8YA 4YN3A 3SE0A 5K8UA 1IH8A 2PH1A 3KQVA 1Z33A 5DJ5A 2YINC 3NJ8A 3PFBA 3RFUA 1PG5A 4PVCA 4D97A 1HOTA 2A9RA 1L2TA 2QMUA 4OK6A 4AJPA 4H7KA 1E2BA 1XNRB 4RA9A 3M49A 2GEVA 3VX4A 3KXIA 2YQ4A 3G0IA 1ZI9A 1JU9A 2DWOA 2VXOA 1V0JA 1IUNA 1HA3A 3AFOA 2PWZA 4OVKA 4TZTA 5CRIA 5H3LA 4DJDC 3AF6A 3GLVA 3OPYI 5A06A 2IYNA 4MTCA 3EFOB 3T1HB 2XBMA 4K5QA 1UINA 2JC3A 3DOOA 2BMVA 2E1RA 3N2KB 4M0DA 5C8YA 3ITNA 5FI3A 5GWXA 3T9DA 3ZJTA 4D9FA 4OU5A 4UMEA 3ANXA 2B6NA 4UUMA 5JZBA 4JEMA 1BCRB 2VJBA 2F00A 3E9MA 3GH3A 4HWOA 3T1QA 5JCJD 1WF3A 4YRIA 4JNKA 3B3AA 5H3CA 3LY5A 4WN3A 2I1QA 3BXEA 4G9EA 1R0RE 4I4NA 2O2SA 2W37A 4G2TA 1Y5RA 2J6CA 4BX2A 3U0VA 4S0ZA 4TUYF 3NVMB 4URWR 4NMMA 2OG2A 5CLGA 3CWCA 2I9PA 2RIPA 4LC1A 4ZRNA 3D4LA 4L4RA 1EUDA 2WWVD 1P5JA 2B0JA 1M6HA 2FY8A 4GICA 1O57A 1T8PA 4G65A 1KI7A 1D5WA 3D0KA 1T3ZA 1RZVA 3TGWA 1BOFA 1S8FA 1GPH1 4F45A 3EZFA 2AZDA 3OFSA 2GF0A 2WDPA 3FPLA 4M4SA 4WKNA 4JZKA 4DAEA 1HNWB 2YRFA 1NNEA 4EYSA 4WOBA 1ZK4A 3HGQA 4N8EA 1TPZA 4B4VA 3PPVA 3QW2A 4NCKA 2JIDA 3NKVA 3A6GA 3KCQA 4N6OA 2BFOA 5F2KA 1C30A 2DXIA 3PEYA 2Z98A 1XMPA 1IRIA 2P3SA 2R4TA 3DMPA 3JD4A 4UCQA 3KQOA 4O33A 4DUGA 4RTJA 2UXBB 621PA 2M6RA 3TW4A 2WHPB 3U5TA 3VU1A 3CSDA 5COQA 3DYIA 3Q5GA 2QR2A 2QN2A 3TTWA 4U63A 2C82A 2YJGA 1I1NA 3A05A 3VYTB 4TV8A 1NVDA 4JUBA 4AYWA 2HMTA 3LCVB 3AI2A 1C9DB 2QIPA 1K3UB 1UMKA 5CJJA 3BMOA 5B6IA 1MZPA 1GQFA 2BCGY 4D57A 1FJGB 1ODSA 1XX6A 1TW3A 2WF6A 3SFVA 1ARZA 3TLYA 1SXQA 2IZ1A 1PJLA 4IIEA 5TQ0A 3U7FB 3MG9A 1GTMA 3G1TA 4C6RA 4DWWA 4HQLA 1E98A 2PO5A 1NPDA 1ZCFA 1L4UA 5DM60 5K3FB 3C0KA 1K5PA 1QS0B 1W34A 2FE1A 4LXHA 2J0SA 1G6OA 4FGJA 4DRYA 3CKMA 5EZSA 2CVQA 1ZQ1A 3U56A 1OC4A 2V6MA 4JODA 2RBKA 3L92A 3S27A 4OHWA 2AI3A 4PX3A 4Q18A 4UPEA 3VYUB 4OJQA 4MVCA 4U7TB 3B20A 3CNLA 3EZYA 4IV0A 3K0FA 2KS6A 4NZZA 4UE6A 1JFLA 2PUAA 4WBNB 1BVRA 5FBRB 4DARA 4V1CI 1DI0A 2YYYA 4P7KA 5JZMA 2J0EA 4JJ4A 2G71A 4PWYA 1UPXA 4RLSA 2TRSB 3AV3A 4EKIA 4Q3NA 1TYCA 2OAQ1 4BCBA 2XB9A 3I34X 1F4PA 4I1PA 5IT5A 2A35A 4P2BA 3RWMB 3ZD9A 3ZDZB 5CXXA 3DD1A 4REQB 2DWUA 2COKA 3D31A 3L0OA 4GUAA 1KZ9A 2G1JA 1L8OA 2C1XA 3W5AA 3I37X 2QW8A 3R09A 3G0DA 1L1EA 2AEEA 4K6MA 1G41A 1AIPA 2F1JA 1QRDA 3AXTA 3JWHA 3UJHA 5I47A 1WBDA 2FWJA 2IYWA 5B7QA 1KDYA 1IL0A 1TUEA 2R6R1 3MSXA 4PAMA 4WWHA 1Z12A 2XOEA 2XT6A 3RNLA 3WBFA 3NHZA 4UUQA 1SXJE 2GERA 1P9WA 3I6ZA 3KBBA 3U44A 2DR3A 1MVNA 3GGJA 1G2OA 1KPIA 4XSHA 3DA8A 4Q1BA 1L5HA 1JQEA 2P6NA 4PICA 4TYNA 1Y3DE 4BEVA 4JI2B 2WWFA 4L4SA 3ND6A 4HH4A 1HG1A 1T36B 1F6BA 2FB9A 2NSHA 3GLSA 3H9CA 3IRUA 1U3FA 4GPD1 4KFSA 2NO0A 1G5TA 4QNMA 4DV4B 5MN5A 3M1LA 1M2VA 3QW4B 4ZVTA 4D3FA 1JQ3A 3QWAA 3CLSC 2H0RA 1XXHA 4X91A 1ZJYA 4YCDA 3IEVA 3DOJA 4H1VA 3CRVA 3TFOA 4KXVA 3KKZA 3ZE1B 1WXDA 4H0CA 2GN8A 1UBMS 1XA4A 4QGGA 1Q15A 2JLVA 2CXNA 3Q5DA 3TOSA 1NXPA 1GIAA 4MXDA 2VHJA 1QGED 2GYYA 1PVDA 4NFYA 1HX7A 3GJXC 3KL2A 2B25A 3T9CA 2X41A 4JQCA 1GLGA 2GVDC 1ZNQO 3NEJA 2ORED 3S55A 2CSXA 1Y4SA 1Z7EA 2UZ3A 3SBDA 2BM8A 1Y9DA 1QKKA 1VSUA 4RZ3A 1GQSA 5EWJB 1D0SA 3VHQA 3RSZA 3VO2A 1A2BA 2YY7A 1CZUA 4M0EA 4RH3A 3LLVA 4BDSA 3CVOA 1UJ4A 4PYQA 2DQYA 3TTUA 3OCVA 1ESCA 1XK7A 3JQAA 4KXWA 2HNAA 3MJCA 2W6QA 1XG5A 4ZQFA 1WCIB 1P72A 2XWBF 2H7XA 1QYXA 1RLJA 4LF9B 3K8OE 5D3QA 2O3RA 3T4XA 4XB1A 4L5BA 1ODFA 4AKTA 4Z86A 2WIAA 1Z83A 3R20A 1EM8A 1IBCA 2ZJ4A 1M1UA 2ADOA 4OMCA 1QRSA 4LDQA 5JQGB 3THYA 1EP3B 5JJIA 2FI1A 2OFXA 2B4KA 3R9WA 3RO7A 1JAXA 1Q84A 3EXIB 3HN2A 4OBXA 4X6UA 6YASA 1DMSA 2FEPA 3S2YA 1GGVA 1Z0IA 2PYZA 2ODBA 3QVXA 3VKUA 5DOZA 4Q9JA 2VR1A 3X43A 2DERA 4FFWA 1JIXA 1IHYA 3KB1A 3ORQA 4L74A 1X1CA 2RBGA 4M22A 3WLMA 4B4KA 4S1OA 2HMYB 3M6IA 4CI9A 3R8XA 5BXYA 1TJPB 1TK3A 1ZZEA 2KWIA 1K63A 3DBLA 5E7QA 4BEBA 1TEVA 4A6DA 3NWEA 5C1IA 3T5BA 3LHIA 1G3QA 1B23P 2GTPA 4FC6A 4DIUA 5ESDA 2Q99A 3RASA 3GJ7A 3SXJA 1MZVA 3EH1A 4KQ2A 4OHKA 5G2OA 5I7AA 3V2IA 1C9KA 1CEQA 3WYDA 1MGOA 3AFIA 3D6HA 1F17A 4GE0A 3IJEB 3IDQA 4QE3A 5CU7A 1U3TA 3NBZC 4FBLA 5E3IA 1K9SA 1NR5A 2Q4BA 1TM3E 1FZTA 2E0IA 2GRAA 4BBJA 2Q2VA 3GRYA 1V7PC 3ONNA 1WMEA 4MEAA 4EUHA 2E9SA 2R1TA 4GOMD 4CMCA 4BQQA 3N8NA 1E2EA 5DV9A 1G8FA 2KB0A 5C3MA 3HUUA 3AM5A 1L5FA 3STTA 1X7ZA 4OY3A 5L7TA 2QZPA 4RY9A 1O95A 1OX6A 2JFXA 2L69A 2O1WA 5I5EA 3DCNA 4B0PA 1IBSA 4PQRA 1UKZA 3UPUA 1TLFA 4K46A 4YJHA 1VSTA 1EBBA 3UATA 4Z4GA 2PQ2A 2C59A 1N2CE 4DAOA 3IUMA 5DDIP 4UEQA 3DQZA 5TV2A 1E3WA 4KODA 4M1TA 4MGKR 1HQKA 1R50A 2DAPA 4B32A 4US2R 3TUJC 4MWDA 1CR4A 2QLTA 3AC0A 1C1DB 4NCJA 4DR2B 4AY2A 2H9YA 3LAWA 4GBED 3HWWA 3CMCO 1ORHA 4G4JA 1CXZA 1U9JA 2HX1A 2W8ZA 4MAFA 4XSGA 5DTIA 3P96A 5HS6A 2GEKA 3HYSA 1XEWX 1WWKA 2YXEA 5K6AA 1ZVVA 1MPXA 1OZAA 1LRLA 3B5JA 3CIOA 2QD3A 1NFQA 3LUDA 4HVTA 3NGMA 1EHIA 5JCJA 3RFTA 1RMTA 2X2EA 4R2JA 1HSOA 2ORWA 4RWZA 1SJ9A 3I9KA 3MWJA 2YX1A 1ZD2P 4B87A 5HUJA 3WK4A 1VIMA 2YJZA 5SYAA 1IJBA 1C8VB 1HK7A 3OQIA 2W2VA 3OE5A 5LJIA 2GOYA 3EFHA 3F9CA 1BE6A 3QG1A 4L0DA 4L7VA 4O4HF 1RAGA 2HC9A 3GJSA 2CMDA 2FETA 4ZGBA 2HRRA 2K7ZA 1DO0A 1HQDA 1T9ZA 3EBOA 3GNLA 2EF0A 3R40A 4M99A 2P3OA 3NTOA 3SF0A 1FFGA 1DTWB 1WVIA 3WNBA 1XCPA 3QLEA 1GCIA 2P75A 3P71T 2HMUA 3OZIA 2ZCVA 1J39A 2VL7A 2I2AA 4QBHA 4D9CA 1D2MA 1VE7A 3AY6A 3B6JA 2JBAA 3ZWBA 4BO6A 3JD2A 5L4LA 3SQXA 1LI4A 1Y7IA 2QP4A 2YVKA 3IE0A 3Q7PA 2CY0A 1Z63A 3IKLA 3RSQA 5HKAA 1P77A 2XUPA 2ZREA 3KLPX 4BAZA 1LNSA 5B1HA 2BFNA 3GLHA 1A9RA 3UHJA 5B4UA 1R27A 4L9SA 1PJRA 2F3PA 2IXBA 3H17A 5F1PA 5JAUA 2NZYA 2QTWB 2EL7A 2JGMA 4AJ2A 4X85A 1JSZA 3N2ZB 4Z1OA 3CZ4A 3TPZA 2BZ1A 2WICA 1USKA 5JS6A 2F3SA 2I22A 4U6QA 2AKAB 4YMLA 3AJAA 2O52A 3E2IA 4QUAA 4C3UA 3MS7A 4FEAA 1JZQA 4D8WA 3EPKA 3B13B 4G1CA 4W5TA 3Q0IA 4HMPA 4K2AA 2EGUA 2ZDHA 3SQLA 2PBRA 4IXTA 1IHDA 2A58A 1ZO8A 3LCRA 1JDTA 1NBIA 3OM0A 2D1SA 3LQKA 4IX9A 2O7VA 4E11A 3O6VA 3MAJA 2A0KA 1H6DA 3EA5A 3L5KA 4IIUA 1DXHA 4TLEA 3MINA 3ZHRA 1VPWA 4OI2A 1UFRA 3EW9A 3W7VA 2FSIA 3LXMA 1G20E 5ICEA 2SBTA 2Z04A 3H3FA 2VUHB 2QY6A 3BHNA 1CDZA 1FDTA 5IKPA 1E3DA 2ZTMA 5SYMA 3AIKA 1Z5WA 3RSSA 4PPFA 4QDTA 5H1YA 1FSGA 1PJZA 3DE4X 4GM4A 5GY7A 4TSKA 5AJHA 3ZJ5A 3HJGA 2PMBA 3OLCX 3T7TA 3MWEB 1LDBA 3GN2A 2OGSA 4LE0A 2EP5A 3W8DA 3QX7A 3J80A 3A6ZA 1UM8A 1XZBA 2UXCB 2IU6A 3AJEA 3U4AA 1A4RA 5AOCA 3NHAA 4MAAA 3ZV3A 3RADC 4HK4A 4J0IA 4JXKA 1NUSA 5DGCA 5LYJF 3IHTA 2J08A 1P1RA 3DFMA 3ZIUA 2OMEA 4J1SA 2OBXA 2LDBA 3DWFA 3G9TA 2P40A 3FMVA 3F9IA 3P9CA 4LTMA 4QEZA 2CL7X 4X65B 4WQMA 1NVUQ 5K6TA 1L4YA 1ZJ6A 2PCJA 1KAOA 3DE2X 3FYUC 1B42A 4QRIA 3BZWA 4V3BA 5B5SA 1YKFA 5D84A 4CQLA 3K35A 2JFOA 3KPUA 3DMHA 3B5IA 2A57A 2HBZA 4Z8XA 1EFRD 1LKZA 5D3MB 4OXYA 4PTZA 4W7HA 1NSYA 1Y4ZA 4FK8A 2FSSA 3OMXA 3HY4A 4OXXA 2AS0A 1G4UR 4LF6B 1U7DA 4L8LA 1JJIA 3G2HA 4B17A 5HM8A 2FFRA 4DCGA 4BP1A 1FMFA 1XD9A 4RZIA 1S2OA 3N2IA 2AFIE 3HUEA 1K7EB 1Z6PA 4U0JA 4E6EA 1KK1A 1ZY2A 3HCFA 2P67A 3KJQA 4KX5A 1ZGBA 5DTJA 1W59A 5EYPA 5EMNA 3G17A 2IHTA 2GUGA 1E1KA 1NJFA 4DGQA 3U49A 2L18A 2GLUA 1FSZA 2QRGA 4EKDA 5ARCA 3IDZA 4Q39A 1E61A 1ODLA 1U1DA 1V5GA 2GN0A 4LJ5A 4P33A 4DNFA 4LTDA 5FD8A 2H1WA 2HHJA 4M0LA 5ENDA 2CJWA 2R8YA 3C6XA 4HMOA 2ICAA 3C4JA 1O97C 1KVTA 2E18A 2HKIA 2WAAA 1IQ0A 2IS2A 4J9VA 1USUA 3PBKA 1KVUA 1ONOA 4YO7A 3RVPA 4AZSA 3O7MA 5CITA 5L8VA 10MHA 3EISA 2P2ZA 4DZRA 4UMVA 2HPZA 5KTKA 2QTGA 4AZ0A 5IFKA 1JKMA 1WZCA 3MMPA 3M4JA 1CVIA 3IJPA 4U9UA 3ZQJA 1EUQA 3CRW1 3R6GA 3NC0C 3D4IA 3Q3EA 2G28A 4KG7A 1QVZA 4J75A 1F0PA 5C8YF 4GEGA 5TARA 5KTTA 3GBPA 1FQKA 3T52A 1ECPA 5EZYA 2J9FA 4RVDA 3RBZA 2XBUA 1XRPA 2QAGA 4FYKA 3C3MA 5GJBA 1K7YA 3D8HA 4Y2PA 3K9LA 1WDWB 1O7JA 1FU4A 3IT0A 2XWQA 3VR4A 3EXHB 5K99A 2QORA 1YDGA 4JBXA 1I2ZA 4ALNA 4H7FA 1T6ZA 2Y6UA 1W0KA 2NSJA 2PXAA 3E53A 3FB4A 3IA2A 3Q88A 5TPWB 4GKKB 3RRBA 1ZKDA 4EVRA 2YTZA 3AP3A 3OZSA 5FOTA 2FG6C 1ECJA 3O2SB 1M7HA 3T7IA 2ZWOA 5FUYA 4YLYA 3LZDA 2WSBA 4PBTA 4TLMB 4XWAA 1JSCA 4BLPA 1TECE 4YRSA 4X71A 1BIFA 3AF3A 2JGDB 2B21A 2WJPA 2NV2B 3GFRA 1OI3A 4NJEA 2PS9A 3PWTA 4E33A 3Q3GE 4C14A 2ZXUA 5ILGA 3BTUA 3GEHA 3RUAA 2Y1XA 2D1RA 4AYXA 4YT4A 1QDEA 3NRCA 3Q6NA 1YSCA 4MUAA 3QSYA 2R4UA 3VSEA 3V4SA 2QPAA 4QFCA 3CBQA 4P38A 5ADUS 4IKOA 3DM9B 4C3ZA 1PN3A 5EHQA 3NOQA 1J4AA 1JG7A 3RUPA 3IPYA 1QH8A 4KBFA 5H5JA 3RE1A 2XB8A 4J0KA 4Y2GA 1RWXA 1EFDN 2XXAB 2O8EA 4BVEA 3TRIA 2FZEA 1GYRA 1E99A 1G64A 1A2OA 4UHKA 4DCMA 1ZK1A 2XV1A 4HDQB 4WXPA 1FE8A 4MUYA 4I4TA 1F2UA 2HO5A 4K6FA 4FYPA 5E3HA 3EGCA 1PJTA 2FSFA 3P8ZA 3AR9A 3NKFA 2B20A 4XJXA 4CKBB 4AKGA 1KTVA 5EIOA 2ZRMA 2RI0A 5TGDA 4JT8A 1U65A 1RQXA 1SQ5A 2WM2A 3NEYA 3WWPA 1M6VB 2G1AA 5KC9A 1DBQA 3AL2A 3QEMA 2Q5HA 4QYIA 3ZWVA 1QKIA 1XL1A 2K6GA 1E3QA 2QMQA 5J4HA 2HGZA 3P94A 2JBHA 4KXXA 3RYHA 1DCMA 4X3PA 1XLVA 3IOBA 4G0NA 4WERA 2VBGA 1EA5A 1Z6TA 5I7HA 2FMXA 1DC3A 3JALA 4ZREA 1KARA 4XDHA 2VT6A 521PA 3THOA 1J5EB 3L8GA 1P5ZB 3BIFA 5TJ9A 1YZTA 5KYGA 3B6MA 2W6PA 1VGVA 2VAXA 3DEKA 5C1PA 2HK7A 1ND6A 2EFYA 5BNIA 4IH4A 4FZRA 4C7KA 3KZCA 1XDGA 3ODPA 3S2SA 1SKYE 3O8LA 4LJ8A 2ZRAA 5JYCA 2XRZA 1WDKA 1QIFA 3C98A 3C16C 2I7XA 4AMUA 3NHYA 4YJGB 2GBIA 3ASYA 1GTVA 3KZVA 1UOEA 1QX3A 3B78A 1E3JA 1COZA 3ANYB 3OKAA 4FHGA 4YWJA 3D6TB 3C6ZA 1FMTA 3W1VA 4F86A 3GNSA 2Q7XA 5BSUA 3RS9A 3V9PA 1H2AS 5L3VA 5ITZB 4LZLA 2G5TA 3ZHTA 5AVYA 3I6YA 4CMAA 1KY2A 3NHMA 2BGRA 3VHXB 4K9SA 2IIQA 2FOIA 2ZJ2A 4A26A 3W90A 5DX0A 4RKQA 2V7PA 3OJCA 2BGWA 1RRCA 2RGGA 1CCWA 4RS3A 1WSWA 2RHWA 1W46A 4KSBA 5GONB 4CF7A 2BP7A 4ZC1A 4OJMX 1A76A 5JH7A 1BFUA 1RKBA 3D3NA 2H1IA 2IZ6A 4KFRA 4OP3A 2OK7A 3MZ0A 5BNTA 1D0IA 1J20A 5JSZA 2DWCA 5JTTA 3BX1A 1H9CA 5DNDA 1IY2A 3MRXA 2J85A 3RRXA 3WFJA 4DCVA 5KOIA 4XVUA 5FR2A 3E5NA 4G5HA 2L19A 3W5BA 5BWCA 4KW7A 1YCGA 1JJVA 3OZFA 3IMFA 3GZ4A 1GU0A 2D5IA 1XHLA 4CETA 4NMHA 2BPOA 4I8IA 3PNBA 1SY7A 2JH3A 3KYJB 5JZSA 4R2LA 1QDLB 3WQBA 3WL5A 4ZJPA 5HRUA 1ZGZA 4G0ZA 1Z6ZA 1JDBB 1EB9A 1UJ5A 4BKOA 1LDYA 1H6CA 2P4HX 5DM1A 3TZQA 2GM4A 2BM0A 2FUCA 1EHCA 2AUNA 2I1LA 3RD5A 4F3NA 5ELXA 1VG0B 1NKSA 2VEOA 1F1BA 2FSVA 3HP4A 2DQ4A 4QNRA 2G63A 1GRCA 3JQQA 4AJJA 3ESDA 3EUFA 1P0IA 1X42A 1XZJA 2HA6A 3JVEA 4PNEA 5LWQA 3OM9A 1U5BA 2X1VA 3I4CA 2XYGA 3JQ9A 4XSVA 3BWXA 1SQ0A 4AZTA 1RI3A 4GZ3A 2ZLBA 3KLNA 5F3WB 3QKUA 1VIYA 1OYOA 3JW8A 4ZOCA 9ATCA 1EK0A 1MU0A 1RC0A 3PDHA 1QHGA 4CKCA 1BHJA 4FBMA 4KC0A 2GRUA 3N39C 1YQUA 5KQSA 2FSGA 5E9QA 3ICPA 4DY6A 4M3NA 2B37A 3GUZA 5C8VA 1GPJA 1PKEA 1U2GA 1YB1A 4JUCA 3DZDA 3UMGA 4ARVA 1NF8A 5P8WA 4Y67A 1E7RA 2OCAA 4BNDA 2BMJA 4UTNA 1AHIA 5I7VA 3CXRA 3QITA 4JK3A 3ZDEA 3SR0A 5K3AA 2FMFA 5AJXA 2P9QA 2C8LA 2W6JD 1VL2A 4KR6A 5E1OA 2WF5A 1DUIA 3CJQA 4D26A 3AKEA 1YRHA 3AEUA 4OO3A 2A7QA 3ZOKA 5L9AA 4RYLA 2Q3LA 3ZE9A 3HB7A 2JFFA 2WF7A 2G7MC 2ZU0C 2C83A 3E61A 3L6DA 4FD2A 3WK8A 5JV5A 1ZR2A 2XGJA 1JYFA 4X97A 1G6Q1 3AHGA 4HRXA 3E6AA 2HMWA 1EFRA 1FUKA 4TLDA 4R2MA 2D06A 3Q6IA 4WNIA 2MTBA 5EJAA 4AMZA 4CTKA 1M1NB 2JLZA 4BMSA 1XN4A 5KYWB 3H6KA 1QQ5A 1IXYA 1Z4QA 2IIPA 2CHGA 2VDVE 3REQA 2X58A 4ZZ1A 2EFHB 2VPPA 2GHTA 3WYBA 3R75A 1R0XA 4EAQA 3LC7O 4P82A 3V80A 2PBZA 1RKVA 4GNKA 3PUVA 4GX0A 1WXEA 4B3BA 1E6LA 3PXXA 1BXGA 1Z5OA 2F3TA 4LZPA 3TQSA 4D6XA 2WQ6A 2JJ2D 3AM1A 2XUGA 1FJHA 4GX2A 3K94A 4LY9A 4B79A 5MN4A 3ADPA 3W7AA 2ZR7A 4W7SA 1UP4A 5DWQA 3UAZA 3V2HA 4WY8A 3U7JA 1V7ZA 4S24A 5AI5A 1YB2A 1QG4A 2QLFA 3KWJA 4AB1A 5DSTA 1GQRA 1V43A 2NU8B 3ZY2A 1H23A 1XDWA 2JHAA 4BO7A 1EA7A 4XB6B 3PEVA 4IUDS 1AXGA 4D81A 1XTJA 4M87A 1JKJB 2TMGA 3LYHA 1DUVG 1QC5B 2EW1A 4RLHA 1QU2A 3QUTA 4JLBA 3JQFC 4LF8B 2GF2A 2N46A 2VHCA 3IMCA 1X9HA 4ZEMA 1DRVA 4BWFB 3TRDA 2ZAGA 1C9NA 2R2GA 1YRWA 4EYEA 3PE6A 2XB6A 4A3SA 4OKNA 3SZOA 3FKQA 4A2WA 3JYPA 2WT4A 5FTKA 4EGSA 1FOEB 3R9XA 2BFFB 3EB9A 4IJ5A 1WMDA 1XF9A 4K81B 3DQQA 4PTLA 3UMSA 3VZRA 3IV6A 4W9RA 3GEMA 2VG8A 1BEZA 2WB4A 1GQOA 3VUEA 4RD2A 3U4CA 1QUEA 2HMVA 3BCHA 5B55A 1DXOA 2B83A 4ERXA 4UDXX 4IPTA 1NBME 4FU0A 1GPDG 2NZUG 1Y9JA 3KR9A 5L4SA 1BCSB 1TYZA 3ZV4A 3VPGA 1N9ZA 1Q0UA 3GNTA 3O9ZA 2WTBA 3FN4A 1NP6A 1VG1A 2XHZA 3ZWWA 2AD1A 1IZ8A 1QHHB 9LDBA 5I7SA 2Z3ZA 3S2IA 2CHQA 1RI2A 1GGHA 1F51E 2BFMA 2Q3JA 3K6RA 2PGDA 4FSHA 4MIOA 2D8MA 4CG1A 4CKWB 4P08A 4OYLA 1COWA 4MVYA 2O5EA 3H5OA 3MD9A 2EDCA 3KQPA 3FVVA 4ZT2A 1L1FA 3UXHA 5U9CA 4O4JA 5DHUA 3MTQA 2GUWA 3ANTA 1SHJA 4R1QA 4XIJA 2ZSAA 2W2XA 2IV3A 3RC3A 4WK4B 1NG9A 5DNUA 3BULA 4NYJQ 3G88A 3BEDA 3GLKA 2V7WA 3AHCA 3A58B 1JHVA 3INNA 4Z8YA 4RF4A 3GJ0A 4XGKA 2ZYAA 1EIZA 2PMWB 1NHGA 2Q0XA 3F5MA 3WISA 1XTPA 4HAXA 2Z4TA 3PKIA 1L5OA 3W3AD 4DYVA 3B70A 1CRWG 3GX1A 4E21A 3OQOA 3SMQA 4NQRA 1X8JA 4BKUA 4XA8A 1TM5E 5TNXA 1YQ9A 4TXHA 5CLQA 1XCOA 4JMPA 4JI5B 2OV8A 4ZFNA 4DMCA 4OTZA 1HF3A 2BRUA 4Q02A 3CCBA 2VJNA 3FPJA 1V8ZA 4ZT5A 1CUSA 1SC6A 4O4IA 1W49A 3IUQA 2HL6A 3MF4A 3HB0A 4CUJA 3NP7A 1WLYA 1QMPA 2RH4A 3A04A 4MINA 5EJ2A 3CRMA 1GL9B 1AE1A 3HN7A 3ZDQA 2TSYB 5HNKA 2MR5A 4E5DA 5FYDA 3SFTA 3AY7A 1NYLA 1C29B 3NJRA 4M8NE 1L4EA 1ZICA 3QKWA 2FUEA 4KKXB 4JIGA 3PKZA 2KX7A 4K9RA 4M9CA 4YP6A 2H6EA 1M9NA 1HE2A 2QZJA 3TK1A 3RBVA 4EUNA 4NJOA 3HR7A 1VLQA 4C4PA 2RE8A 2D8AA 4FFPA 1ONBA 4JC0A 3VYWA 1XNQB 3SIPA 1K8ZB 5C4GB 3TIGA 2G70A 1ANKA 3FIUA 1E6UA 4G4GA 4EQZA 3DAYA 4K26A 1XU4A 4L6CA 4F92B 4XWTA 16PKA 4ENRA 2HLDD 3V4VB 4NENA 2FLKA 1T4BA 4JEIA 3LI2A 1CETA 3FVWA 1SBQA 4IH1A 4XGRA 3ZWPA 1LF5A 2V3WA 3EMBA 4HN9A 4B74A 1L7EA 3CUYA 2GETA 5CVEA 1JJFA 2G3YA 4YR7A 3E3NA 5J59A 4X8MA 3R7AA 2O2YA 4OXKA 1VM6A 2PWAA 2Q6LA 3RGGA 1R6VA 1XHEA 1TJ3A 1WUYA 4C4AA 4DGSA 5BNFA 1E2PA 2FKNA 1TL7C 3BTSA 4IDCA 2ZR9A 4ZO8A 5ARDA 5JNWA 3MTEA 3VAAA 1BO6A 1FU8A 1UXKA 3NAMA 5C52B 1J8FA 1VJ0A 2DUUA 4M2LA 3RLIA 3OSZA 2HJSA 5K4GA 1LU9A 3EPRA 1CQIB 2YZKA 3BIXA 3D7NA 2YHSA 3L7BA 3OG9A 4L75A 4Y9SA 3A9CA 5LYYA 4EH1A 4E5VA 2XVMA 1CV2A 1JMKC 5IUNC 3A1FA 3WLSA 2A9QA 1G21E 1QGDA 2ZQZA 4GI5A 4MA0A 5IJ9B 3O2NA 4XYEA 4WNYA 4EJSC 4Z4EA 2DULA 4RIHA 1QGZA 4OJYA 5K6AC 2NMVA 4FYJA 3IAUA 4JVNA 3WNCA 1MQAA 1JEQB 2Q3HA 4HMQA 4LDJA 5K3EA 1IQUA 1KAMA 1TM7E 3DS8A 3IJ5A 2G6BA 3U7QA 1PEDA 3CF2A 4YROA 1NC3A 1OILA 1QZZA 1Q7TA 1W9MA 5C34B 4MRSA 1NPTO 4F3CA 1BMDA 1EX1A 4O2BB 3T3OA 3ESZA 1U6IA 1KGSA 3L0IB 4IKPA 4UNPA 2ZTHA 3KXKA 5LQSA 4RPKA 1F4LA 1JR3D 4KQ9A 1D2GA 2H1CA 1RZUA 4FWIB 4M1SA 4AO6A 4F0JA 5CIQA 4BMOB 4B48A 3EULA 4YAEA 3BSYA 3IODA 3FR7A 2B4RO 2YICA 2BEVB 1GZSA 4NI5A 4G0VA 1U2QA 4NCXA 3UAYA 1ZH2A 4RVUA 4PZCA 2CLCX 3OTGA 1J2EA 4R7TA 5G1NA 3NBKA 1D3AA 5EZYF 1FXWF 2IDJA 4N54A 1JEAA 2GILA 4L8YA 3UC5A 3I61A 4JJAA 3DHYA 1L5NA 1MA3A 2XCSB 1T2CA 3GRFA 4EUEA 3CKYA 3WIEA 3T3MB 3TLGA 1HTBA 1RBMA 2YFQA 4M0UA 4MR8B 4MHSA 2DBQA 4OM7A 3CWQA 1REQB 2VPZA 4OQNA 3RT1A 1Y1LA 5DPMA 4YMHA 5KYXA 1XXLA 2Q6OA 4OIMA 1FRNA 1H1DA 1D1QA 1PT7A 4A9AA 2GSDA 2GBFA 2FMHA 3CZPA 3LGXA 3SZUA 1ZISA 1ENZA 1Z36A 3G2NA 1N6LA 1Y6GA 2YUTA 4F12A 2LNDA 1KA9H 3CLVA 1YR3A 3LE8A 4AAYA 2QUIA 1NUTA 4C2AA 5CIYA 2BGNA 3ZCXA 1XD8A 1QDUA 2B36A 3FX2A 4JC8A 2UYQA 2A0YA 5D6NA 3W5IA 3QSGA 5JVDA 4PC3A 1Z39A 2FGKA 3D5TA 3EPPA 4R2KA 3MC1A 3IL2A 1JFSA 1B0ZA 4NC9A 2IPLA 1VFPA 1WSAA 3LP8A 1OXXK 2C2KA 3CPJB 4CPDA 3QPUA 1JB9A 1EFKA 5BYKA 1JTEA 3LVBA 4QZVA 1JHXA 1L9KA 1P7VA 3AI7A 3CQ9A 3EF0A 1XNJA 1ZCAA 2GJSA 3D7KA 5ERYA 4Z5XA 2PE5A 3KLOA 3JASB 1GPWB 5CFQA 2ON6A 5IXSA 3VOBA 3MRSA 2ZS8A 4PU0A 1CBUA 1OTYA 1X14A 2FMIA 3BMQA 3HI6A 4MQEB 3A4TA 3SZRA 3OCXA 1NI5A 4G86A 1JW9B 1SXGA 4I4TF 1CUVA 2WE7A 1E1CA 1OH8A 2EHJA 3QE0A 1T3HA 1RWKA 3QFHA 2HXSA 3MT8A 4KUHA 5ALEA 3RIYA 2I55A 4D80A 2BDUA 4IIGA 3G0GA 3Q11A 3Q2KA 4P36A 4QGBA 3UYLA 4HAWA 2VATA 1NY6A 4L0CA 4D46A 4DE5A 5GJWC 5L45A 2WG2A 2VBIA 2DY0A 5KJFA 4B83A 1QHEA 1TD1A 1Z5PA 2QT0A 5JYDA 1U8YA 1QVRA 1KI6A 4CEJA 2CNWA 3H8SA 1EJBA 1O96B 4FFLA 3P4UA 4HNRA 4RC9A 5AVOA 3FWKA 2ZITA 3MTBA 1UKCA 4EB6B 3OPMA 2AG5A 5K5EA 1DB3A 3EMVA 4N4AA 1E2IA 4BWGA 4ARZA 2XE7A 4YCAA 5CEFA 4Y2QA 4DR3B 1PF7E 3VDRA 4OLAA 1K8YB 1WCV1 1FW8A 4TKMA 3WTCA 2CVOA 2FWIA 1MQSA 2AK2A 2RAVA 3BAZA 2REOA 1LI5A 3PR1A 4ZAZA 4ZVVA 4ISCA 4D96A 4R7ZA 2H8KA 5C7LO 5JISA 4I2VA 3U4QB 4YBZA 1AKRA 1VCOA 3NV9A 1V47A 1MFPA 2G36A 5HQ3A 1HE1C 1KYWA 3FNEA 5BSEA 2W48A 2VDPB 4ZQBA 1E64A 3MNFA 2VZ8A 2HAEA 2CMKA 3AUYA 5IVDA 3H7IA 1KC3A 4RTOA 3ICVA 4DXDA 3QLUA 3KEFA 2O8CB 1Z5UA 1CIPA 1D6SA 2CXSA 4FP9A 4TQ9A 3W9YA 2P6PA 5IZCA 1V39A 5CVCA 4IHJB 5BWOA 3LDHA 1Y3CE 2NP7A 1C8KA 5DX1A 5A4FS 2QBYB 1F7UA 1F9AA 4FLEA 4OGGA 4XGQA 1A50B 2IYLD 3GCXA 5A2GA 5GVRA 2VC2B 2VUSA 4IDBA 4R41A 5A3JA 3VMFA 1N0IA 1Z8DA 2PYIA 4MQFA 2GNPA 2OZLB 5AO9A 3TQIA 5CEJA 3WMRA 2YRWA 1DG3A 2R8PA 2HZBA 3N74A 4WA8A 5SICE 1V16A 3FCUB 5CA1B 2FR0A 2ATVA 3FFTA 4R31A 4YALA 4OP1A 1JKIA 4ESOA 3KYCA 3ELYA 4IQ8A 1RQRA 1D0VA 1QCCA 1YBHA 2P9EA 5BQPA 4OLHA 4AURA 3EQ2A 3VNBA 4BKPA 4C5BA 1N33B 4DJAA 2HF2A 5BR1A 5B2FA 2L17A 3C6YA 5JH7F 1V8OA 4IGIA 5B7PA 2NSYA 4M1MA 2C2MA 4N3BA 1GARA 2YC4C 4DKXA 5KAMA 1J42A 2IXGA 4E30A 2X13A 2NADA 1WXHA 3F6CA 4ZCRA 2CFOA 4W82A 2H2FA 1VSVA 5KWSA 2HDNB 1SOVA 3F9RA 3IQDB 3NBQA 1KP3A 3LLMA 3QIAA 3W3AA 4R3WA 5GM1A 1I2BA 1OFVA 1YQGA 3KQUA 5I6DA 3R77A 7MHTA 1B3BA 1IU9A 3H4IA 3OEED 4RY8A 5K2MA 3L4SO 3Q0TA 1I94B 1FFBA 2HTEA 2JFUA 2P3QA 2PIAA 3DV9A 4G2NA 4Z4FA 1NGSA 5KYYA 1KQ3A 3EGXB 4C89A 4HR7A 2Q0HA 4MKFA 1UXHA 5KOJA 2J59A 5K8JB 1TM1E 1P0QA 5IN5A 1NN1A 1CVRA 2FE4A 1ZGCA 3FPSA 3TJZA 2F9FA 1Z34A 2QD5A 5AOBA 2ZRPA 3D8SA 1ESNA 4WJZA 1DJQA 3ZS9A 1LC0A 1UP6A 4ETMA 1MO5A 1BXKA 4NDZA 2XLCA 4CMGA 3FPCA 2BHRA 3IELA 3E8SA 3FTPA 4TMYA 5DBGA 3PFKA 2QW0X 2VDWB 1YA6A 2Y2VA 4J90A 5FFNA 3AVWA 2IVFA 2R65A 4ZXFA 2CDNA 2BF7A 4J7XA 2C98A 2GAIA 2Q07A 5CT5A 5L51A 2F8TA 3OCWA 3CINA 1AX9A 4DILA 2GHQA 2PWBA 1NT4A 4WUTA 2QP3A 3KZXA 4UNSA 2JDID 5IG2A 4N39A 2TMKA 1HYEA 5CLLA 1EQAA 2HV8A 5DI3B 4TQGA 3LQQA 3DCIA 5FFMA 1NASA 4J4TA 4UAUA 1T8WA 1QTIA 2CBZA 2D13A 3G5MA 3GLHE 1PEAA 4Q4HB 4EZBA 2HIMA 1OXSC 4IKEA 1GYPA 1X13A 3K1TA 4TMWA 3RV4A 4DR5B 1V11A 4S1WA 5LDHA 1DEXA 3SN6A 1N0HA 3QLVC 4B7CA 4ZDWA 5LQRA 3HYCA 4RVNA 2ADFA 3WK7A 1NVKA 3ZCVA 1QGAA 4ZV4A 1YZHA 3IIKA 2PXHA 2CDAA 2EX0A 4M0PA 1XELA 3BE5A 2RAPA 3D0RA 2ZT6A 3E5MA 5D87A 5F64A 1P9RA 2O23A 3B12A 3WP0A 3G1WA 3IHKA 3U4DA 1L4LA 1ZDMA 4NDNE 3DD5A 3OFKA 1VI2A 4FMDB 5C0OE 2AXEA 4Y1EA 3ID6C 5ENVA 4RO0A 4URVR 4TTIA 4URUR 5IAKA 4OSOA 3BF8A 3KOMA 2MR6A 1DFGA 1LTKA 4TKUA 3OPYA 2RGNA 3WA7A 4E14A 3EGDA 1BRTA 1HMPA 2GBCA 1XRLA 2XDYA 1G98A 3QYJA 4MV5A 2XMRA 3VNSA 4MSUA 5BP7A 2RSLA 1UR5A 3E15A 1U1GA 2C97A 2QTTA 3ZI4A 3L06A 5JXJA 1E2HA 4LE2A 1HMYA 5KNDA 2REBA 1A0OA 2M1ZA 2P5TB 4FGZA 1XFDA 3GUUA 2Q4OA 1JR3A 5U4QA 4E3ZA 4FI3F 4NU6A 1UPCA 2ZE5A 1EG7A 2AEJA 1V7CA 5EUMA 5TGTA 4FDVA 1A8PA 4LSGA 3CC8A 3WQQA 3HBFA 4XIGS 4D9MA 4IIVA 5E3JA 4GPBA 1CEYA 1X8KA 2ZBRA 2ZIGA 1C9EA 1MR3F 4OCZA 2VQDA 4Z7JA 3OZTA 2FWNA 5SY6A 3TKYA 4YHBA 5IK2D 3NWPA 1EHYA 1RHUA 2PBLA 3OKCA 2O2IA 2ZEJA 5DGIA 3W3ZB 4HQFA 1W0JD 4KN9S 1S02A 4XFJA 1PGNA 1PUXA 2VHEA 5TMEA 2V5AA 2EU8A 4KDRA 1FP4B 2P2CA 1JWAB 1E9DA 1YMUA 3JQ7B 2H2DA 4JB0A 4YC7A 5GV8A 3B9QA 2DEUA 2AC7A 2XF8A 1XVAA 4PC2A 2NTJA 4U7FA 4ENWA 3KJFA 4URYR 3N75A 1FVXA 7YASA 2XKAA 2E82A 2ZR0A 121PA 1II9A 1QIEA 4FYXA 4IQFA 5TQ2B 2R9VA 1WUJS 2H06A 4XLLA 1TMGE 3JQBC 4DLYA 5T7BA 4BNTA 3GU3A 3TGLA 1DQYA 4EGJA 2CV2A 2JEZA 2P11A 2IP2A 4PC1A 2ZYIA 1ZRNA 2PH3A 4ZI7A 4XPIA 4RM2A 1GAEO 2P9JA 2OD2A 1Z6AA 2HRCA 1EMDA 1QQTA 3NTVA 3P9ZA 4I0WB 3KETA 1SR8A 1UDWA 1ECFA 1X86B 3O3OB 4QJ5A 4UHJA 1GKLA 1HYBA 5KTOA 3N0RA 3SX0A