4HNRA

High resolution structure of chemotaxis response regulator chey4 of vibrio cholerae
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
120
Chain Sequence
TMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 43
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnrA00
2Q5CA 4KVFA 1C0EA 2PAFA 4KK4A 4ETIA 3RVJA 1ZHHA 4QICA 3RVQA 4NQRA 3RVNA 1UDRA 3H1FA 3RVPA 4P1ZA 4ZJPA 1QMPA 2M1ZA 2IDMA 1Z15A 2YHAA 4MQEA 4OLAA 1DG9A 1QNLA 4TLMB 1APBA 4KREA 4KRFA 2CHFA 4Z9AA 4RY8A 3FDFA 1F4VA 4MS4A 4FE7A 3A3KA 1NXOA 2RGYA 2ZAYA 3CHYA 3H5VA 4N0PA 3OLVA 3LUCA 3HJFA 2HPHA 2GKGA 3QELB 3CRNA 4RSMA 5FWYA 4GPAA 3UUGA 2J48A 1DRKA 2QV0A 3GL9A 1AB6A 4IMJB 1NY5A 1YK1A 1JLKA 2AYXA 3F7NA 3M9WA 4W5QA 4IGAA 4ZPJA 3DLHA 1KRWA 2GBPA 1D5WA 1NXTA 1SRRA 3L6UA 4HNQA 5JNUA 4NICA 1YS6A 3BILA 3QLVA 3B2NA 4RK5A 2PJUA 2FQXA 4KQCA 1ZGZA 4IMIB 3OLXA 4RY0A 1VLZA 3LUFA 1MB0A 2JK1A 4RKRA 1MB3A 2NUBA 5TQ0A 1Z13A 1Z17A 2L2QA 5TPZA 2A9PA 5HM6A 5IUJC 3I42A 1ZVVA 3IPCA 3KJXA 2H0AA 3SM9A 2WJWA 4MQFA 4N41A 1P6QA 3N75A 3C3WA 1FQWA 4Z4IA 4F12A 4Z4GA 3HUUA 1NXXA 3K4HA 5E3JA 4KZKA 1ZGGA 4F3TA 2O20A 1U0SY 1YMUA 3R0JA 4F06A 3ILHA 4NV3A 2LUOA 1XHEA 3QEMB 2PL1A 4IF4A 1D4ZA 1A0OA 1JYEA 3C97A 3LTEA 3KG2A 5TQ2A 4Q6BA 1BDHA 3CFYA 4Z4HA 1DBWA 4MR9B 2VUIB 2XDYA 2CD7A 3HZHA 1R8JA 1JDPA 2LBPA 3LOPA 4W5OA 4Z9BA 2OQRA 5B3JC 1EWKA 3O1JC 3A10A 2PKXA 4PYRA 3GWGA 4G0MA 4P98A 1NXSA 3IP5A 1ABFA 3LMKA 2FEPA 1DRJA 2JBAA 3QEKA 4JA2A 2RDMA 3JTEA 2WMYA 3TX6A 1VRVA 5FBHA 4LZLA 1JFTA 1ABEA 3UKJA 1JX6A 4WXEA 5CNMA 3GBVA 5JNWA 3NHMA 1DBQA 4MR9A 5TPWA 2JCGA 1KRXA 4EY3A 5EWMB 4KQ9A 2QVGA 4YGXB 4EYQA 1DCMA 2GWRA 2L19A 3LUAA 5GQSA 2IOYA 1VKRA 1ZH2A 4TN5A 3HO1A 4H3HB 4OBBA 1KMIY 3ILYA 3E61A 5HSGA 2CWDA 3HV2A 1JFVA 5ED4A 5C5EA 1PNRA 2JVKA 1D1QA 2R25B 4W5NA 4YLEA 3O2QB 2MSLA 3H1GA 4MQEB 4RXUA 3LUGA 2A9RA 3IDOA 2E4YA 2FLWA 5ABPA 4UHJA 4UHKA 3RVRA 3I5AA 1IIBA 4MS4B 4E7PA 4XFKA 4M88A 3KS9A 4W5TA 5IUKC 3DLBA 2CHEA 3OM0A 5IEJA 1NTRA 3OLWA 1LJUA 5JNTA 3KYIB 2H3HA 5EWLA 4B09A 2VK2A 3OQNA 1YK0A 1MVOA 3Q7RA 5FWYB 4DADA 1E2BA 1WETA 5JNSA 4KV7A 3VNAA 1Z26A 4RZSA 1JYFA 1QO0D 3O1IC 1BVHA 1PNTA 1Z25A 7ABPA 4MAAA 4NCAA 2FMHA 5TQJA 4W5RA 3M9XA 4MRMA 5IBQA 5HKOA 5JNRA 3LUJA 1L5YA 2FQYA 1NATA 3GT7A 2IPMA 3RVSA 1BAPA 4N03A 2P9HA 3OMXA 3URMA 5TQ0B 1NXPA 2E4VA 3RVLA 5FWXB 5KWSA 1TMYA 3IP7A 1ISSA 1GCAA 1CYEA 5T3YA 4RXMA 4RWEA 1D2AA 1W25A 3EULA 3NBMA 1NXWA 2B4AA 3C3MA 2VUHB 1KGSA 2PLNA 2PUDA 3NHZA 1JDNA 2PMCA 2R48A 2HQOA 4MQFB 4CBVA 1RXEA 1CHNA 1JL3A 1P6UA 3QLVC 1E6KA 1TLFA 1PUXA 2PL9A 5C5CA 3D8UA 1EAYA 4RK6A 4RDCA 1DBPA 1YIOA 5EWJA 4D6YA 3O74A 3H1EA 2WB4A 3JPYA 3KLNA 4KNYA 1FFWA 2WJAA 1M5TA 1J56A 4XXHA 3LUHA 2JRLA 3RH0A 2HQBA 3H5LA 4MS3A 2FN9A 5JS2A 5TQ2B 4KPYA 2RJOA 3OM1A 4TMYA 2FQWA 5KQGA 4G0YA 1U2PA 3EJWA 1JHZA 5FWXA 2ID9A 5PNTA 4ETNA 4YR7A 4RK1A 1QKKA 3RQIA 3EDCA 4PEVA 4L4UA 3MIZA 2F8SA 1TJYA 3E3MA 2QXYA 4KMRA 1LBHA 5DLEA 1EWTA 3P9YA 3QX8A 5JNVA 5IEBA 3OQOA 3QLUA 3CZCA 3BRSA 3IPAA 3LUKA 4IRXA 4H60A 4JAVC 2MYTA 1FFGA 1M5UA 3C6QA 2FXIA 1U8TA 2JBAB 4O1HA 3H6GA 2E4ZA 3LKBA 2QSJA 3EODA 4LE1A 3HDGA 4F11A 2IKSA 3DBIA 1RNLA 3D02A 5KQMA 6ABPA 4QYWA 4DQDA 3HVRA 2PUCA 2FVYA 1Z18A 4N0QA 3SNKA 5KC9A 3CG0A 4ZMRA 1CEYA 1PEYA 2YHBA 3NNNA 4YV7A 5TPWB 3EAFA 4EVSA 5IULC 2JVIA 1LK0A 3C3KA 3GYBA 3OLZA 2PUEA 1OXKB 1QO0A 1XWWA 3F6CA 5KI6A 1JF8A 3NNDA 3DGEC 1HEYA 2L18A 2PUGA 4O5AA 4G0XA 1RZRD 4EGSA 3CTPA 1I3CA 4MLDA 3N0WA 4RK4A 1FFSA 4FB4A 4MR8A 2A9QA 2I6FA 5CNJA 3T6KA 3T95A 1GCGA 1YVUA 2FMKA 3K9CA 3QLTA 3KLOA 1LBIA 4H3KB 1VPWA 3KYJB 1H9CA 1QQBA 2QW1A 2FEKA 5CNKA 1W9HA 3N8IA 3LFTA 4OTZA 3KHTA 1BDJA 1Y1LA 4YWHA 2PE5A 1ZAYA 4QYMA 4ZYLA 5F64A 3H5WA 5EWLB 2VYCA 3CKMA 1QP7A 3BREA 1MIHA 1LJLA 3HS3A 1YMVA 4N76A 1GUBA 1DC7A 1YS7A 2IPLA 4IILA 3O21A 4DN6A 5DGCA 1PEAA 3CLKA 1SXHA 4QPJC 1OXBB 3A0RB 3O1HB 4FE4A 1RPJA 3MM4A 4G0OA 2HQRA 3HSYA 4MRMB 1BDIA 3QK7A 1M2EA 4JB0A 4RKQA 1QQAA 3LUDA 2V0NA 5BRJA 4TLLB 1NXVA 1QP0A 3GV0A 4F8JA 3Q41A 3G85A 4Z99A 5BR1A 2TMYA 2FEWB 1YTUA 2KYRA 2R47A 1SD5A 1EHCA 3LKVA 4YS6A 3TB6A 3N53A 3Q7TA 1GLGA 5EWJB 3CZ5A 3HDVA 1XHFA 3TO5A 4YO7A 1USKA 4MS3B 3CG4A 5IC5A 4D6XA 3CU5A 1USIA 3T8YA 3MA0A 3EQ2A 4EVQA 1DCKA 2R4QA 4LE0A 4PE5B 4MLCA 4MR7A 8ABPA 4N47A 4LE2A 3HK2A 1QP4A 1RZRA 1MAVA 4WZZA 1FSPA 3JY6A 1Z2DA 1E6LA 1PHRA 1B00A 2MYPA 1QPZA 2FKAA 1F51E 4XARA 2PUAA 3N0XA 1E6MA 3QX9A 4D74A 3FFTA 1D1PA 1JFSA 2NZVG 4YRZA 2HSGA 5CHYA 1DZ3A 2BGGA 3SG0A 4G0QA 4OLBA 3HUTA 5KC8A 1U2QA 1K66A 5KQPA 4ETMA 2PUFA 3S99A 4S04A 3I45A 3GA5A 3MMNA 2E4UA 3KTOA 4WUTA 1T34A 1ZDMA 4RXTA 3OQMA 1JWLA 5JS1A 3RVKA 4WXMA 2PUBA 3H5OA 2M98A 2IPNA 3QLUC 4XAQA 4LX8A 5BRAA 3JVIA 1M2FA 3TD9A 3Q9SA 4YP9A 2LPMA 4XLTA 2FSPA 3IP6A 5FBKA 2JVJA 4WT7A 2WRZA 3FFWA 5HQJA 3BRQA 3OO0A 4E7OA 5IUNC 4OG2A 3Q7SA 2B1JA 2AYZA 3NNSA 2FMFA 4NCBA 3CS3A 1AB5A 4XASA 2W42A 1Z16A 4RV5A 3TMYA 1K68A 3HXMA 5KQLA 5DKFA 3O75A 3DGFC 3OLYA 3A0UA 4MR8B 4EYOA 5I4CA 3ROTA 2X7XA 3HCWA 4ML3A 2FLKA 4MS1B 1JH9A 4O1IA 3HM9A 4KK3A 2GX6A 3QELA 3O2SB 3Q15C 3JVDA 3W9SA 2MSWA 3RVOA 3IP9A 4G0ZA 2WWVD 1DC8A 1Z2EA 9ABPA 2NZUG 1ZY2A 1A04A 3KKEA 4Q6WA 2IYNA 1RXIA 1TM2A 2ID7A 3JS5A 4EVRA 4YCSA 5DTEA 4RU1A 4PZ0A 4ZMSA 5BQ3A 1C4WA 1JBEA 3H5IA 2LP4Y 4JP1A 4L85A 4PICA 2L17A 3RVMA 3SY8A 1ZH4A 3EGCA 3CNBA 3ROFA 2HJ9A 4EUKA 2OENG 4GNRA 1DP4A 2QVCA 6CHYA 4KFCA 3MQ4A 1S8NA 3F6PA 3H75A 2RJNA 4JB2A 4MS1A 1TVMA 3O2JA 4RK7A 4Z0NA 3SQNA 2FMIA 4S05A 1Z12A 4LDZA 4HNSA 3H6HA 2QR3A 3L49A 3KSMA 2F8TA 3SAJA 1P2FA 3FMVA 4HNRA 2MSKA 4Q7EA 2WY2D 1DCFA 2N9UA 5GOTA 3OO1A 3M6MD 2DRIA 2JB9A 4LDAA 3EQZA 1U04A 1A2OA 2QU7A 3T38A 1BA2A 3QEMA 5B3JA 4JOQA 1USGA 4Z4FA 1EFAA 2FW0A 2IPAB 4OATA 4LRQA 3HEBA 2GI4A 2P4UA 3UK0A 1ZN2A 3N6VA 3BBLA 3VNBA 4HYEA 2A9OA 4EYKA 3DZDA 3MF4A 3OMWA 5CNIA 5TE9A 1ISRA 3KCNA 2NT3A 4Y9TA 5DCLA 4MYRA 3FGZA 1EWVA 4MGEA 4WWHA 4MR7B 5TPZD 4Z4CA 1URPA 2LIVA 2NT4A 2ZWMA 3GBPA 2MYUA 4G0PA 4RS3A 4Z4EA 3GRCA 1SXGA 1DJMA 5D2CA 3I09A 2FN8A 4G86A 5IX8A 4RK0A 1L5ZA 4EYGA 4MPTA 4JASB 1P8AA 4RY9A 3FFXA 3H5TA 1GUDA 2E4XA 1ZESA 4G97A 5EWMA 3N0RA 3G1WA 3F73A 1ZITA 2QZJA 1SXIA 2FTKE 3JPWA 5T7BA 2MYNA 3MYYA 2E4WA
chains in the Genus database with same CATH superfamily
4S1NA 2II6A 3CWQA 3R9IA 1XLTC 3V5NA 1G6OA 1CUUA 1E79A 1JNXX 1ZGHA 1IEXA 5AW6A 3RVNA 1P29A 3CSSA 1R0YA 4G5RA 1QMPA 2BZ1A 1D0SA 5FOTA 1G8SA 2QYTA 1JKMA 4M46A 3G2JA 3T1QA 5KU7A 2JFOA 4QU9A 1SWVA 2QPTA 2Y92A 4IR7A 3OFVA 4J0JA 5AK4A 1GQFA 3FDFA 1XC7A 3FR8A 1KFCB 1R0LA 4OA5A 1XXHE 5EKXA 3A3KA 1FJXA 4BKRA 2LKCA 5JXWA 4FCWA 1USUA 2GZMA 3CW9A 3IKMB 2P2NA 1XBTA 2J08A 1HOTA 1SVUA 2HZBA 4QSHA 4MXDA 1E8MA 2A0YA 2X8BA 5H9VA 4NDZA 1DAEA 1U7DA 2IZ6A 3FIJA 4ODIA 2ZBUA 3TBHA 2FVXA 1YK1A 3F7NA 1KZ6A 3I1JA 4KYVA 2R6GA 4P2GA 1C1DA 1ZN7A 3GMTA 1WVMA 3PC6A 3AIOA 3EHDA 5HR5A 1WXFA 4JR2A 4LTMA 1TMOA 3ECAA 3AKEA 4X61A 1AZLA 3U3RA 3SYNA 1CY1A 3U7JA 2JAHA 5CIQA 1G2PA 3L40A 2WJHA 1BS9A 1C7FA 3IEUA 3A2KA 2CHUA 2QYHA 1Z6QA 1E1QD 1MB3A 2XA9A 4LQLA 4PRLA 1Z13A 5TPZA 2V74B 2IHKA 3DZHA 3WVNA 5THKA 1KEWA 4S2EA 3RYFB 2B8NA 1YB6A 3T52A 5CA1F 1N6HA 1V43A 2Z8XA 5BUQA 5KX5B 1G20A 3RE1A 3W7BA 3U1BA 4CEHA 3M5CA 1AD2A 2I29A 4WBNF 1FQWA 5BOVA 4IKEA 4N12A 4C20A 1JSZA 2YWJA 4R6XA 3AKCA 2YFYA 4ABYA 3P9ZA 1TF7A 5IKPA 3LTNC 2MMGA 2WUEA 1TJ4A 3LPNA 1FDVA 1O54A 3WYBA 1XE3A 4L4SA 1M5RA 3CPJB 1T4CB 4HOYA 3DB1A 3LX5A 4EKYA 4Q6BA 1RIIA 3DONA 1Q6ZA 2VOJA 4Q9IA 3LIIA 2QVZX 4QO8A 1Q0UA 4K9DA 3PDWA 1OXXK 1T5OA 2AG1A 3IAUA 1KJYA 4JJAA 1NLMA 2XKJE 1ODKA 3HZHA 1V8FA 4AP6A 3KYDA 4INPA 3W05A 1QLWA 4UTXA 2IPOA 1TX4B 2OVFA 2QL9A 2X3UA 4BQFA 1DEHA 4Z9BA 3AH8A 2OQRA 4MVXA 1EWKA 2UU9B 3CNLA 2JGDA 3GOHA 1BFDA 1SIOA 1IU9A 2PKXA 2A1UB 4JUCA 1FSGA 3IEKA 1V5FA 4KDRA 1NFRA 1EX9A 4ZVVA 4S1PA 2JBAA 1WUTA 1FYWA 1LFDB 3FTPA 4BTEA 5TF4A 4L57A 3WLTA 4DPMA 3UWKA 2J5KA 3U3KA 4GU5A 5ICEA 3GA0A 1HDCA 3I01M 1MO5A 1PV1A 1HV8A 1KFBB 2AEMA 3EZ6A 4BEVA 1JLSA 4XVCA 2YASA 2ZSAA 5GWXA 3ZH9B 2ZRCA 4OHPA 1RRPA 1G8KA 2YNMD 4WCVA 2XE7A 2BY4A 1C0PA 3HO1A 4R1NA 2K7ZA 5GTDA 1AGRA 4XZ3A 3CZ9A 4YP0A 3VGJA 621PA 2IYYA 1UM9B 1JFVA 4P81A 4QXMA 2BEJA 1ZEMA 2MWMA 3SLRA 1SK8A 4Q03A 5F33A 1TW2A 4CEJB 1L1RA 1NBMD 4M1ZA 4MLPA 4UMVA 4FFSA 5CX4A 5BOSB 4US2R 1EXDA 3PLRA 4EI2A 1TAUA 4R3WA 1Y7PA 3X1WA 1EVKA 2C2GA 1UM8A 1TD9A 2JIMA 2ZJ8A 1T26A 3KPWA 3NJRA 2DU8A 5DHRA 5K9ZA 4E7PA 5CA0F 3AK4A 1RABA 4AMUA 2WSIA 2GN8A 3H0EA 1VLMA 2EQ5A 4CF3A 5EIEA 5EZQA 5IT4A 5DNYB 1UFQA 1T6NA 2LNDA 2P4EA 2OV2A 2QU8A 2QX8A 4TWAA 2GCOA 4FFNA 1HL3A 4LGMA 3OE5A 3E18A 5AHXA 2I66A 3RADC 1IXZA 1RI3A 1CY7A 1Y8RB 2H51A 2LVBA 2NW6A 3KHUA 3LT4A 1UBGA 3HUEA 1NVFA 1Z25A 4HI0E 3WL6A 2FMHA 4D8VA 5BW5A 2WV9A 1AMOA 1J90A 1H1DA 1UK6A 2V8BA 1Y63A 2VQDA 1A9YA 1L5YA 1J8QA 3RSQA 1E5TA 4LMBA 5B30A 1NMQA 1GQ2A 4JI6B 1M67A 2AIRA 3RUFA 3VZDA 2VDOB 1CJVC 4HFRA 3URMA 3KZCA 2O3TA 2YFHA 2E4VA 3SR4A 2CNNA 4CDMA 1DWUA 1VJTA 3DR3A 1GAJA 1TMYA 3TSZA 2DFKB 1CYEA 3ORQA 1DWQA 4RWEA 5FL7D 2IV7A 1D2AA 4WZAA 3A4MA 4A6DA 3OZFA 4BASA 1FYDA 3OKPA 3E3OA 3W5BA 3GGJA 2JJ1D 4MQFB 3BMNA 5LP6B 3ADBA 2AUMA 3HN6A 1U0OC 5BNFA 1QYDA 1E2LA 2CLLB 4RV4A 3BOSA 2J3MA 3FKSA 1T2AA 5K8TA 2WR8A 1EAYA 2Q7XA 2C4NA 4KAJA 1G6KA 4MKXA 4CLRA 2O8BA 3FYUB 4MSUA 1UIMA 3PNKA 1IXYA 4V3CA 3L2OB 2JAPA 1M5TA 4UTVA 2JRLA 3CLTD 3K9BA 3PHIA 2QRLA 1U28A 2J3QA 4D3ZA 1KOLA 1GPLA 1CUJA 2JARA 2JJQA 2YV2A 4WJLA 4TMYA 4OHWA 5IHXA 2ACWA 2OT3B 3AF0A 3SKXA 3VZQA 1KI2A 1NKVA 1RKVA 2DQZA 3NOVA 3S8MA 1BOOA 5L3QB 3ZHCA 5JYCA 4TTIA 4HK4A 4JWTA 4MRAA 3PD0A 2QRUA 3OZBA 4Y1EA 2W83A 4QGFA 5CEFA 2P9GA 2QHXA 3IIJA 4V24A 2GPSA 4CCSA 4CM6A 4N48A 5T4EA 3VHRA 3GVCA 4DWOA 2VRBA 4EAQA 4LNAA 3GIWA 1VJGA 3AY3A 3CLSC 3N07A 3THWA 2WKWA 4DR3B 3PQ5A 1ISPA 3G0BA 4BP3A 2XMBA 4BRZA 3AEUA 4I1RA 4ND7A 1EMDA 1QO7A 1V4BA 2KHZA 3F7TA 3PFCA 4G4GA 4NVRA 1DIGA 1GTJ1 3VVBA 5C1OA 1Q2UA 2BFPA 1HUQA 4LYHA 4EATA 4EHDA 5KWIA 3IAM6 1KEUA 2FVYA 5DCWA 5JCXA 3DBOB 4OH1A 2JFYA 2O7RA 4LJ9A 4HBZA 4K88A 4QBFA 3B2QA 3C15C 3S2EA 3IV7A 5JUWA 4XWTA 3EPKA 5JXJA 1B0AA 5HJEA 1B6RA 1OJLA 2H9YA 4WEOA 2ZSHA 3HCDA 3NT2A 3SSNA 2YJGA 4Q9LA 1M8GA 3E5HA 4BLUA 4IX9A 1XZLA 1XL0A 1HNXB 1E1KA 1FNSA 4NLLA 1T0PA 3CMMA 3WDKA 5KVSA 2BFFA 1J4AA 1W5SA 2NAPA 4I50F 4DRYA 2AI1A 1XTZA 4RSGA 1AMUA 3H42B 1RMTA 1UIRA 2E89A 5F23A 2V4MA 4KPUB 2Z9DA 1HDZA 3X1YA 2QSUA 1CE8B 4L22A 1EE9A 2GYVA 3DPSA 1XJ5A 3LFUA 1P2SA 4BGEA 1RWXA 2V1UA 4Y6GB 1IM2A 1Z88A 1EB8A 2DT8A 4N39A 3TXYA 1KQFA 1YA4A 3AR4A 2WG1A 4MHSA 4NE9A 5IM5A 3T95A 2HK9A 4X1OA 5LZ4A 4WBSA 1BXKA 4GXRA 4YLYA 2BGIA 2R8ZA 5BSRA 1BWQA 5KYGA 4EIWA 4F4JA 5JH7A 121PA 1ZGAA 2DUJA 3NRJA 5EOVA 2OV8A 1ZAYA 1QF6A 1HDEA 1VYTA 4A36A 4ZYLA 1WF3A 1YCHA 3DKPA 1JAYA 3KP1A 1WL8A 2FSVA 2GDZA 3RB8A 3U4QB 1FIUA 2I4LA 1NOIA 2O8NA 5AVZA 4IOJA 4EFLA 1ACJA 1SIBE 3A04A 1OLUA 1J8YF 1JLRA 1XVIA 1NU8A 2A4KA 1V35A 4RC9A 1W4LA 2CUZA 3WA6A 5B2FA 2K2QB 4G81A 4BFWA 3IMKA 3DKVA 1MB9A 2AEFA 3HWSA 4RTLA 2FWMX 4ZT4A 1HG0A 2PG3A 2JJYA 3SZUA 3BGSA 2JAXA 1H65A 1XOIA 2GJSA 3EVTA 2HWXA 1L4KA 3RBAA 2C7OA 1CR1A 1RM4A 2Z04A 4IDAA 4O4IF 4L6CA 2WAOA 3PHGA 4KIFA 1IVNA 1JU9A 3FTEA 1W93A 3TLXA 4BXOB 1L5OA 1BOFA 4GUDA 1EHCA 1P4JA 2V03A 3D1JA 3D7NA 3IUPA 2EQAA 3IVGA 3NHPA 3PYLA 4HGYA 3D7SA 1R0SA 4JA0A 4LHSA 1LWOA 4XYGA 2Z6AA 7GPBA 1N4DA 1KYWA 3DKKA 1UBLS 1GA4A 2D2IA 2XF8A 3D2CA 3PUYA 4X60A 4UBJA 1I51A 1V1RB 3WICA 1TQ2A 1POWA 5ELLA 5K0JA 5IC5A 3U4GA 3AUSA 4XCXA 3MWDA 3T8YA 4CG1A 2HDOA 4EVQA 3L0DA 3P5SA 3OQHA 1ZM2A 1Y6ZA 3M2TA 4K40A 5ALVA 4DPLA 2SCUA 2Y6UA 4HDCA 3TW4A 4PZ9A 1JT2A 3IFSA 3KSDO 4R4JA 3OT4A 4PGGA 4N4AA 5CJPA 3JY6A 3GUHA 3KT0A 1E6LA 1H5QA 2CJFA 1I9GA 2DPXA 1JZSA 2OBYA 1CQWA 3H2SA 1JDTA 4N6GA 3DE1X 2O2SA 4LJ4A 2CNWA 2DFLA 2B5WA 3QF7A 4UEJA 4D3XA 6NULA 4QFCA 2ILVA 1TADA 3AMVA 4XUEA 4JVNA 1KEEB 4HWSA 1YS4A 1TM4E 3UT5A 2NLOA 1ZCJA 3ZU2A 1SC4A 1V37A 1QGUB 2LGJA 2PR7A 3GP3A 2V6IA 2PVPA 4V1CA 3HJGA 1THMA 3KWJA 5KQPA 1BMTA 3GH1A 1DO2A 4I5DA 4O2BA 3T1TA 2H0RA 3MMNA 2E4UA 1E1RA 4Q15A 3CZ4A 2BGWA 3QH4A 2XCLA 4C3ZA 3ZGNA 4DR5B 3V8QA 1PFGA 2IXGA 2PKWA 2Z43A 4YFYA 2CJXA 1X14A 1FK8A 3Q11A 1ECJA 1PG5A 1GPNA 2CLDX 5CM2Z 4QUGA 3UAWA 4PGHA 5EYPA 3JQEA 5ALSA 1KH2A 4V2IA 4WT7A 3WYDA 3ROZA 3EC7A 4Q34A 2VP4A 4AP9A 3NP7A 3P4XA 3Q7SA 4EEXA 8OHMA 1N2CA 1UBKS 1S2IA 2AZTA 1T6XA 2WMDA 1MZPA 1K3UB 4WDRA 2B30A 3RS7A 1VGRA 4BVEA 5L4SA 5BWCA 4AMZA 1NVXQ 3BQNB 4HVTA 3WK6A 1R0CA 1NM5C 3TLMA 2PLWA 2FLKA 1EFLA 1T8PA 2OORC 2Q41A 1Z5PA 3NTOA 1W85B 3P8ZA 4Q39A 4QQRA 5C8YB 1ZQ1A 3KLMX 4NOKA 3KAJA 3IV9A 1PFKA 1V8ZA 2YZGA 1GFIA 3LLCA 1A1SA 2VZEA 3FWZA 1DC8A 3L7CA 3EASA 4G4JA 5A5GA 4K9PA 3REOA 5DBOA 1L7NA 3A6ZA 2QWXA 4O02B 5EFOA 2BH2A 4BN0A 1E4OA 4YAFA 1SG6A 5E1BA 1K8XB 5HF5A 1C4WA 3RVMA 2C2XA 3P7MA 4KSYA 4B9EA 2Q27A 3HEAA 2G08A 1OVMA 1ST2A 4IGFA 1HEIA 1EXVA 3V8NA 2IEAA 1WB5A 4YUZA 2RJNA 3C6KA 3H86A 1RWMA 4M0LA 4LF8B 1UBJS 2RAFA 3ETJA 5FIUA 3K09A 3PKJA 4PIVA 3OTOB 3FD8A 4FGUA 3M6LA 4DR7B 1M1NA 4J3NA 3DFZA 1AS2A 1IC6A 1LZLA 2BEVA 3ZHZA 3ZTYA 4AB1A 2CLEB 4DEYA 4CDRA 1ESMA 4WPGA 1DCFA 1OXTA 4PC7A 3VPSA 1D03A 5DNWA 5EKSA 4EG5A 4NBNA 2JB9A 3HWRA 5C80A 1V3QE 4EUEA 3EQZA 2P1RA 3LX8A 5J4YA 4OLHA 1Y48E 4RHXA 2RI0A 2RKWA 4PX3A 1QIEA 2V65A 5JPIA 3W4JA 4U7PB 4CTJA 3VNUA 3GGDA 1ULSA 3N2IA 2BSXA 4J07A 4DXHA 4QZVA 5JSQA 3UMYA 4L8VA 2ZCJA 3IJRA 5DRTA 2GI4A 4GOLD 1QKJA 3AQ4A 4B3HA 4JYPA 3A6LA 1ZK4A 2VG8A 3SQOA 2VZLA 3HB5X 3DT9A 5SYNA 2D59A 4AT1A 2D6FA 3U39A 4O0MA 4G1EB 1JEQA 3K0FB 4MTCA 5DRYA 3TW0A 1UBCA 4CDNA 4Q3KA 3FGZA 2VAVA 1CUDA 4DV7B 3CR7A 1G291 2FUKA 4MR7B 3R7DA 4Z4CA 1URPA 3F9RA 3ZK9A 3FCXA 4YBZA 5JSZA 4LF6B 1U8UA 2QRMA 1U0JA 1XNHA 1UJCA 3JQRA 3WKEA 2AOWA 2FN3A 5D2CA 5JFOA 1JAXA 4QASA 4YJFB 1GHTA 5AVTA 1PGJA 2ZYHA 2H06A 4P53A 5TNXA 4QOIA 1ZM9A 5LLTA 2FF5A 2P35A 3BWXA 4L50A 3A6JA 4K0RA 2M32A 1JR3A 1MO4A 4TT8A 3BB3A 2Q4TA 1JWBB 2IS1A 1NDUA 3CF4A 4MKHA 2WKPA 4UEOA 5AVVA 2MYNA 3R3UA 4LY0A 5IYZA 2R1ZA 2VCHA 2DLNA 4PTYA 2X8JB 5IT0A 2GPYA 1XP8A 2ACVA 2Q62A 1UOQA 3HCFA 4X64B 3C48A 3RYHB 4QTYA 4QICA 2D5AA 3LG2A 3OHSX 4JT8A 2BM8A 1LDEA 5EE5B 1IY0A 5LBIA 3CVWA 2GARA 5K3AA 3RSFA 1EH5A 1EP1B 3TECE 4UE2A 1DELA 1GU1A 2VWPA 1XQ6A 3MJVA 4IO0A 4X6YA 4BMDA 4AZTA 1KI7A 1O3YA 1L5KA 2IX3A 1PR0A 1SVOA 4MYDA 3A9VA 3P94A 2GWHA 3U3DA 2XMCA 2EQBA 4BVHA 2NZ2A 2CJPA 2GN4A 2ZAYA 3CT6A 3FPBA 1COWD 4TMVA 4RTPA 2E5LB 3OLVA 3WY9A 3I5YA 4FYIA 2PX4A 4UJ5A 1BJTA 2VF5X 2ZI5A 3HJCA 5FRDA 4ASUA 3PYMA 1YFZA 2GJAA 4MI1A 4ZVOA 2EARA 1Y3BE 3O9MA 4N3BA 5K5EA 3JATA 5HJ7A 5C0OE 1KEVA 5ENVA 4WNAB 3GARA 1AB6A 4ZQFA 4D6PA 3A1CA 5FAXA 1KJ9A 3TZBA 2DKFA 1BE8A 5LZ5A 1FB5A 3OJOA 4MICA 4YIKA 3L6UA 4DJFC 4IH4A 4K28A 3ZLUA 1YS6A 2WF5A 5AOCA 4AZWA 3EVBA 3K8ZA 1GDDA 4KQCA 4YA6A 4ZEMA 2EJUA 1QANA 2C03A 2P2YA 4DYVA 1ESCA 1JJBA 5DTJA 1EFCA 5HZGA 1L4YA 3LA8A 4BTLA 3B1YA 3H9GA 3ROEA 2Q6KA 5ELMA 2VTDA 4HKTA 1KQNA 4Z4QA 4Y2RA 5TS2A 3OLQA 4WMLA 4JBYA 1J21A 1EE2A 3L06A 4UHCA 1W4CA 5EP2A 4XX1A 1C30B 1M1YE 2D5LA 1M66A 3W6ZA 2AC7A 3V7FA 4C4YA 4F12A 2FUEA 1ZKDA 4Z4GA 1XUOA 2WWWA 4R7GA 3HU1A 3K5WA 1VBMA 3TPZA 1XTPA 3W04A 3AW9A 3L1VA 3PL1A 2HJVA 3PQ6A 2Y1DA 5ALXA 2TMDA 4TROA 4YJ2B 3HKBB 1W5FA 3HQ4O 4BQOA 2DYKA 2HD4A 3U0VA 1JYEA 4HS4A 5A7HA 4BWGA 4NRDA 2H0QA 5EP4A 1ORWA 4X7PA 1GAWA 4BN4A 2X8WA 3L18A 1DBWA 4X9XA 2QROA 4X7RA 2JS7A 4BUJA 3ZJ4A 2NPIA 1QH0A 1ODLA 2P4SA 2UVPB 1JQBA 3DHWC 1TA9A 2WU3A 1ML4A 3MGKA 1C8LA 2QIOA 4K1XA 3MS4A 3ZWKA 2P75A 1RI2A 2IBMA 2PZKA 2V4ZA 3R3VA 5REQB 1MB4A 4XWOA 1ZJYA 3EVNA 4MMYB 1NR5A 3GXOA 3SX4A 4DG9A 1ECCA 4JV5B 1Z45A 2Y9MB 1PJ3A 4OJKA 4KPEC 4EWLA 2OY0A 1RS0A 1RADA 2CHGA 3E5RA 4I55F 1ABEA 1WM1A 2FLVA 5KYXA 2XECA 4R05A 3DOFA 3SI7A 2VQSA 7YASA 3NHMA 3VNRA 1DBQA 1N2JA 2BJHA 3BK2A 3PPYA 5JS7A 2CVQA 4K9MA 5K8IA 3A1WA 3E7FA 4KQ9A 3SIRA 4YGXB 5IJ0A 3QQPA 2RD2A 3TSAA 3DMGA 3OT1A 1X7YB 1V2HE 5CLHA 5KJ1A 3Q3HA 1REQA 5EJMA 2XNKA 4EUFA 5LQNA 2HB6A 2DWPA 2I3GA 4LHYA 1TVCA 1PLJA 2EZ4A 3DF9A 2RGWA 1VXOA 2ZJBA 5JMPA 4RYDA 2ZANA 2H1WA 2P9FA 4Q1DA 3FYSA 1QH8B 3HA3A 1TZBA 1F8UA 1U1CA 2HHLA 2VPIA 4KVGA 3GJ6A 3QNUA 1ZMXA 2XTZA 5ABPA 2RJ3A 2Z3ZA 3C4QA 5DGIA 5HF8A 1AX9A 1JQLB 2IWHA 1C8VB 1WV1A 2CMHA 1NVBA 3IKJA 5B2EA 2QVLA 3MJEA 4BJ1A 3BH6A 5E1OA 1XO1A 1M2HA 1PJAA 3RFUA 3OZDA 5I8WA 4YRBA 4Q12A 4X1YA 2XB2A 3GIDA 3IQZA 2WAMA 3WSWA 4X1KB 1E2BA 2UYGA 3MUEA 3JYQA 5FD8A 2DSTA 3BXZA 3E4DA 1JIVA 1QO0D 2B6NA 3BHJA 3F6RA 1E62A 4OAPA 4B2YA 2EYQA 1ULZA 4LF5B 2ZSUA 1V8OA 1EGVB 5TQJA 1Z2AA 2QR5A 4KPFC 4L28A 3O8OB 5KNDA 1SEPA 4YJ3A 3NAMA 2B3DA 1N6IA 1UMBA 2CNBA 3KWFA 4DCSA 4BP1A 2V9ZA 5AVYA 1V45E 2Y66A 3F71A 3PDUA 4RM2A 4UBIA 3LQ4A 2P6PA 3BD6A 1QGOA 5FWXB 1S2OA 3L1KA 1UBHS 3OA0A 3GAMA 1JJAA 3NRCA 3TQIA 5J1TB 2ZSEA 1GUZA 5G02A 4A1OA 4L1KA 2HWWA 2ODWA 3T7RA 4A3SA 1ZVJA 1SUDA 3F3YA 3IDFA 5K05A 4YJDA 2VP3A 1R4MB 4I6JA 3I83A 5C5CA 3M0EA 3D8UA 1OU0A 3EG9A 3PT9A 4N65A 4U9HS 5JYDA 5JG7A 3HVIA 2IUFA 4RVUA 2QX6A 1F8GA 3ZGVA 3KLNA 2BR4A 1VFNA 1GGVA 2WKSA 3GJ7A 3UWDA 4CQMB 3U4MA 5AHWA 3R8CA 2KS6A 2HQBA 1BHJA 2WM3A 2YZKA 2ZG6A 4MHOA 3RKSA 3EIQA 4OLFA 4WECA 3U4IA 1KU6A 3LQQA 2OGWA 5DYWA 5LUAA 2XYVA 1E1NA 2W4IA 2HK7A 3LK6A 3MW8A 1K1EA 3S29A 3VV3A 2IBTA 3UHFA 4B3TB 5PNTA 2WOJA 3BD9A 3EEIA 4IS3A 4J0IA 4JH0A 3B51X 4F6LA 1ZOPA 1AUQA 2J6HA 2HNKA 2NSHA 4FI3C 1YDMA 1WS6A 4ZYUA 4YMLA 5FPKA 3CZRA 2O0KA 3DTVD 3BWEA 1NDQA 1J70A 1P17A 2FWJA 1J0EA 4DQLA 1CNEA 1A4UA 3IOEA 3VU8A 1D2EA 5HRUA 3HCAA 3IPAA 2RI6A 3ONFA 5TGZA 3SJBA 2X76A 4JAVC 3H9UA 3COYA 1FFGA 1UMCA 5K0BA 1AS0A 1R0XA 4GI2A 1EK1A 1ODFA 5IKOA 1TF5A 2C3PA 5DK4A 1SKYB 3BRCA 3ZDQA 5KQMA 1ZYUA 3HGQA 3PCXA 1ZD3A 3QFHA 4LJ8A 2SECE 4TS3A 3RFXA 4F72A 3MWKA 1RWWA 3T41A 1DJPA 1G59A 2P0EA 4YV7A 3CZPA 5T41A 1T9GR 1U2ZA 2I87A 4DLPA 4ZOLB 3O26A 4W63A 4ER3A 2JI6A 1Q22A 1GA6A 1JF8A 3WLOA 2BFMA 1QVAA 3Q2IA 1XCJA 3IBSA 4Y2VA 3DSRA 3HGMA 521PA 4E46A 5L53A 2Z4RA 2PUGA 2QY9A 2AZDA 4E03A 3SZMA 1E7MA 1B74A 1Z37A 2WFMA 3CA8A 3WS7A 1C0LA 5UKDA 3DNMA 1YA6A 1G55A 2H2GA 1G4HA 3NIFB 4FMBB 5K6RA 2XMDA 2J41A 2IY9A 3OCWA 2D4HA 2GPJA 2EDAA 1KI4A 7ADHA 4FILA 3T6KA 2WV7A 3QLTA 4ID9A 2IQIA 4PQEA 2CJWA 1KC1A 1Z8FA 4JP3A 4ED9A 3L0OA 5L4NA 3KSAC 1H9CA 3HMKA 1W1WA 3KO8A 4DMHA 4U7FA 4CIXA 4YWHA 1YZNA 2LWIA 2WPDD 3OEED 5CB4F 1S3GA 4QBTA 5KNDH 3WGMA 3BREA 2GFQA 3K9WA 1PJRA 2PWZA 3ANLA 1B0PA 2ZI7A 3V8MA 1GUBA 1YS7A 2QT1A 2VSNA 2Z08A 3J80A 1C9DB 1P2BA 4MVJA 3B1VA 3WLMA 5K03A 1ID8A 1OXBB 4YQZA 1WJGA 2GTIA 3OPXA 3L93A 4K6HA 4F97A 5LU8A 1NHWA 2O0LA 3ZG6A 1KARA 1L4NA 4L08A 2VJMA 5KSPA 2VHTA 1DB3A 2V0NA 2OXTA 1VTKA 2D1FA 3MLEA 4TLLB 5E9JA 4QG3A 1X7HA 3D6UA 4KQMA 3VR3A 3X2SA 1BGXT 2EJBA 4LV5B 4WOKA 4U9UA 4EJ6A 4M53A 3GROA 4B31A 3EWIA 3PQ3A 1OW3B 1ZD2P 1LVHA 3S27A 1W35A 4QVGA 2KM1A 2PA3A 4JLKA 4WIAA 1BMQA 4EEKA 1YVPA 2IK8A 2PUVA 2VSXA 1XAIA 5LVAA 1TUBB 3M33A 4OQPA 4BYMA 4YDQA 2AFHB 2BHSA 5EWJB 1NA5A 2O9JA 4YDHB 5TMEA 5LZ8A 4HGPA 4W1PA 4EQ6B 1QOZA 3A8TA 2OHJA 4RY2A 3HFRA 3HZOA 5G41A 4ZT7A 2NTNA 3IR5A 2B20A 3ML1A 3CB2A 4CMIB 3NVKI 3G9UA 1BHQ1 2O5VA 5K3EA 3KXKA 5CTAA 3NHSA 3Q3IA 2GASA 2W2KB 4K7JA 4R9NA 4XDGA 1QYVA 4Q7LA 4UU1A 1NJ6A 1EFPB 4MYSA 4EY4A 5CFMA 2HBRA 3A6HA 1ENYA 3IEIA 4JBGA 3LJKA 1ENPA 4S2UA 3VYVA 3VJKA 4AN1A 3UB4A 1KAEA 1NVDA 4I1UA 1V3TA 4BP8A 4CV1A 5KYYA 2I4IA 1F51E 1R10A 1A9OA 1LTQA 1TLTA 1ZNYA 4XARA 2HA4A 3V80A 1PT8A 3HRKA 1E6MA 4YECA 1RI1A 3IEVA 4LOAA 4GSKA 3ZKAA 1NR7A 4YRZA 2DJIA 4ZMBA 3ENQA 4QG7A 1X1TA 4WFJA 3WZMA 5HWSA 3EVZA 2BUBA 4MUJA 2O2HA 1TU0A 2YUIA 3AHGA 2O8DA 4EHLA 1SZDA 4JLMA 4MGZR 2XVZA 4HQLA 3GNSA 1QE3A 3WZ2A 2WD7A 3HUFA 1Z8NA 3ESRA 4JNCA 2WMNB 3AI2A 3ETDA 1KP3A 3LHSA 3ZTWA 4CV2A 3K6RA 4BOYA 1H1LA 1N8SA 4LX8A 2AOUA 1GXSB 4X24A 4XAQA 1USVA 1V1MB 3HA2A 3LQ1A 4K6OA 2HNAA 5T4HA 4BZZA 5JWHA 1G3RA 2OP1A 4TWRA 4XM0A 3RRYA 5C1DA 1BN6A 1KFKB 2B3TA 3F2IA 2J9RA 3DJFA 4KNVA 4NG5A 4C0XA 4XASA 5K4HA 2R1VB 3NU1A 3A70A 3L7AA 4WOJA 4DUYB 4A8TA 4AK9A 4WCFB 1NMXA 3B1JA 5DKFA 2QM0A 5KSWB 4R7ZA 4PZYA 1ADBA 3P2OA 1U02A 1S6YA 3MPOA 4BMOB 1FUEA 1CVLA 1G8JA 5DZSA 5DBFA 3OQ6A 2X86A 3OUZA 1AUVA 4RMHA 1X7GA 3UAYA 5FR1A 5IG2A 3GPLA 1B1CA 2Q0QA 1KJJA 1GGMA 1LQTA 5K0NA 5E95A 2YBEA 1Z2EA 1ZMRA 3QITA 4GXNA 4MVJH 4ZQHA 2RGRA 1C4OA 2VHVA 2W58A 2Y4OA 5J2UA 3KKMA 1ONOA 1IXRC 1B42A 3D4IA 4KZPA 4LHEA 1JEJA 2ID4A 1LU9A 3BDVA 2BUCA 2LP4Y 2PFKA 3PDIB 2IWRA 1V7CA 1QXSA 3W6UA 1FU4A 3Q3CA 4DXDA 3NHFA 1O6CA 3ECSA 2P4HX 4UFOA 3W9UA 4REQA 2WHPA 3BPSA 5IHPA 2ONJA 1VPLA 3QPWA 1M73E 4NNOA 3AL0C 5AW2A 2WUFA 1JHXA 2XPCA 4OUDA 4RK7A 5AW9A 3SQNA 5JNTA 1FP2A 5CM9C 4HFJA 3MJFA 3RSOA 3M4XA 4ZVQA 5AP9A 5EJFA 3C6BA 3MTAA 4GT1A 5JJKA 4B85A 2OA0A 1XT6A 1DL5A 1IPHA 1L4HA 3FMVA 1YOVB 3OCVA 1MGOA 4ZGGA 5GOTA 3WADA 1XQ9A 3M6MD 1UMKA 1Z4NA 2Q3HA 1E2DA 3A6DA 2R7AA 5AIAA 4WSOA 2QU7A 3ZQ6A 5CBKA 3QEMA 2VK1A 4LVNA 4DG8A 3UZUA 2TMKA 3WIEA 1USGA 1FEZA 2GZDA 3FDZB 4MA4A 1BH2A 4JYBA 3UKDA 4LRQA 1FSZA 2H2AA 2WIKA 3OETA 4OB7A 4X41A 5FYQA 1J2UA 1ZN2A 2ZGVA 3BBLA 1D1SA 2RH4A 2CUKA 3N6VA 4G4IA 4V0LA 2OFFA 1GNTA 3KWMA 3DZJA 3FNHA 4QPPA 1XN4A 5L40A 1ESDA 4Q48A 1G8AA 1J2RA 4FDAA 1BEUB 4TLBA 3K3PA 5ARBA 5GIPE 4RQUA 2FSIA 1M83A 1G20E 4P4TA 1EJ0A 4WI1A 4CI9A 1VE7A 5MGNA 2QTBA 5FJIA 1VRWA 1R0WA 3HCPA 4HWOA 2CCGA 1VG1A 2XITA 5CRIA 2PBLA 4XFJA 3LHIA 1TGYA 3NB0A 4NH4A 1LFAA 1ORDA 3RASA 1GUDA 4U9IS 3F6BX 3R9XB 1JKFA 1J7JA 2F64A 3G1WA 1UOOA 1JQDA 2G76A 2JJMA 2PWYA 3ESZA 2A9QA 4KX5A 5DF1A 1D2MA 1GZ6A 1ZUNB 2Z95A 1SIUA 3B6ZA 4B4VA 4Z1MD 1QH1A 5MN4A 1YE5A 2EGHA 3BWCA 2FG6C 4NQRA 3UK1A 3Q8KA 2FEMA 4CQLB 3W7VA 2M1ZA 1LVUA 3D5EA 1RLJA 1MJHA 1OH6A 2WJGA 3I6ZA 4B73A 4JLBA 1N3LA 2C2OA 1APBA 1WW8A 2O2EA 2WYIA 2K4MA 4Z9AA 1Z7BA 8GPBA 4Y2SA 1PR3A 1Y4AE 4K86A 3ZWWA 1Z5OA 3I9FA 5F21A 2RAVA 4NJMA 3UYLA 2CYBA 2K5UA 4LUCA 5JMTA 2BE9A 1KZ7B 3K15A 5GGXA 4DA7A 2RHHA 3CINA 3F4LA 3AR2A 4JLWA 3FUTA 4AI6A 3PEWA 1YC2A 4LYYA 1RYZA 3ED1A 3ME5A 4YRDA 5B4UA 4NENA 4UDYX 2Y27A 2R6FA 1I3LA 3UGKA 3KYCB 2HF9A 1O8CA 2XUOA 3I76A 3U3JA 3D3JA 3E3LA 2XUFA 5JTTA 3M1YA 1ZR4A 3T7SA 4L07A 2IU6A 2PTGA 1R0RE 4WKBA 4BUZA 2K6GA 3W9YA 2PRJA 5G40A 3WLKX 5E6RA 1C8BA 1M2GA 3WKCA 2J4FA 4UDNA 4RZUA 2CXTA 3A31A 2XZTA 4I9GA 1AKWA 1Z2OX 3UK6A 3MS7A 1N2GA 3M6FA 5EMLA 1SO8A 3OCCA 4B5LA 1PZNA 5DSTA 2SBTA 2JLCA 2GB4A 4PXYA 1XP5A 1Q0QA 2O2ZA 5CPBA 5KQSA 4TVBA 2QN6A 3HYLA 3S1AB 5C4GB 5I4IA 3GELA 4GSLA 2VXYA 2QTNA 3FBGA 3ZX4A 4UDOA 5DM1A 5YASA 1U6IA 3WLPA 3BIFA 2HU2A 1W2GA 1P0IA 4Z4IA 1R66A 1OFGA 5EY5B 4TQUS 4FJ1A 1F38A 3EGXB 5EJ8A 3C1OA 3LC0A 2CBXA 1U0SY 1DI0A 4PLGA 3BZUA 1V26A 1BD3A 5ICMA 2C42A 3ASUA 1RRKA 4G24A 5AMXA 5CAEB 3SZRA 1RAAA 2PL1A 3D3WB 4DLXA 4AQ7A 2DWQA 1XDUA 1A0OA 1S89A 4GICA 1UPXA 3DD1A 1N7GA 4P8RA 4PAGA 4QU5A 3GCWA 4QTXA 4UNPA 5TSDA 2QP9X 1AGXA 4CV3A 1Y8ZA 3T5AA 4E5NA 1EAMA 2H7YA 4DQ0A 1XFAA 1EZ1A 3HU3A 3GT3A 2EL9A 1HFKA 3E53A 3RC9A 5KTTA 4H7IA 4J1TA 1T91A 4MKZA 3KAQA 4IVPA 4DRXB 1NLYA 4F5EA 1I4EB 4EZBA 1MD9A 1K98A 2I2XB 2VNJA 4PANA 4R54A 5T5QA 3RRXA 3USCS 4TUYF 2XF2A 2H4XA 2BN4A 2R65A 1YZGA 2X5NA 1W581 1B26A 5B1EA 2ZPUA 1Z47A 3P4YA 1X1QA 3HADA 1VRVA 2CNLA 1JDUA 1PFUA 4JLSA 3KOWA 4R1MA 1YBMA 2B2NA 4UVDA 1WIWA 5LLSA 1WZCA 3RHZA 2X2FA 4U8HA 3FA2A 3MTBA 2V7WA 1RC0A 3LYHA 5EWMB 5CX1B 4EY3A 4YAEA 4FTWA 2BTEA 1GNSA 1UK7A 4Y2HA 4KAXA 3WSTA 5E6UB 5GQSA 2P3SA 4ZJZA 4A7PA 1Y34E 5C7OO 3DM9B 1TT5A 3S5UA 1PNVA 1G8FA 1L5LA 2E1RA 4FHFA 2WP0A 4OBBA 4DB4A 3DYVA 3I05A 1PZXA 2WWGA 5JI2E 1X19A 3CVVA 4I66A 5KREA 2JVKA 3OE7D 1D9ZA 3E2IA 4GX2A 4I5GA 4YLEA 1DDOA 4M98A 4DLVA 3BL6A 5KYWA 5E6SA 4MW5A 5AM4A 3IDOA 3UW1A 1P5FA 4PCUA 3NAQA 1DJQA 3IUJA 3KKLA 5TB5A 3TIGA 3TOXA 1G8YA 4UPVA 1TMGE 3KS9A 2NO0A 4KQGA 1SC9A 5DI3A 1RACA 1TMKA 2WT8A 4EKGA 4H15A 3S81A 3UK7A 2IS4A 1NP6A 3VC1A 3WGYA 4IJQA 4IHQA 2HA7A 2FJPA 4E21A 3OTQA 2D06A 2X5JO 3USES 3C3AA 5J2TB 5LL6P 3KOXA 3N7TA 2YC4C 2FEOA 2XRFA 1UKZA 3PHCA 5BMOA 1X0XA 3O6VA 1BWPA 1YD7A 2WFLB 3O95A 3UEOA 1EK2A 1TM7E 2TYSB 3AZPA 1SD2A 3H5AA 4XTRA 3KEOA 1S2LA 4ENUA 3J81A 2CKDA 2DE0X 1KYIA 2O2DA 3FYDA 1FDOA 1B1AA 2IYPA 4M0KA 1T9DA 3QVGB 5DX8A 2DHRA 1L4MA 4MPDA 1NATA 4PFSA 3RVSA 2WF9A 3DL4A 2E85A 2ZJAA 3PDJA 3PLNA 1CJBA 2V9PA 3H13A 3OMXA 3PD1A 2QBYB 1CUFA 3RVLA 4C7KA 3HB4X 2C61A 1GCAA 2WYOA 2GEDA 3AESB 3FTNA 4PLWA 5I47A 5GAJA 2XMZA 1WXIA 1JFRA 1NXWA 1XLUA 1N75A 3IQXA 4IJMA 2PUDA 2JJ2D 2R48A 1UKBA 4PHHA 1VE6A 3O4GA 2Q9UA 4GX5A 1GTZA 3VDXA 1H93A 2RIPA 3DE7X 5EMMA 5J3JA 2N42A 2PKCA 3TCXB 3ZVRA 1MIOB 4CKCA 2J3EA 1EWQA 4UTNA 2P91A 1JLLA 1SN7A 5KJFA 4ZTZB 4U3JA 4OX9B 2B4QA 1K5GA 3INRA 4TSRA 1DNPA 4L3OA 2Q9BA 1PZMA 2XRMA 4RA9A 1YBFA 1SQ5A 3C3XA 5BWOA 4X44A 4C4SA 5KNBD 3D6TB 5EQDA 3SVLA 3G0CA 4PYOA 2QQGA 4I1OA 4RK1A 2OD9A 3WNZA 1IULA 2OHFA 4IQFA 1I3NA 3ORHA 2GJ8A 3PFFA 4HO1X 4D9KA 3NASA 1AOXA 4GPZA 1EWTA 3Q7EA 4DNFA 5C4MA 1JE0A 1QFSA 3QU7A 2APJA 4GMFA 1RM0A 2QLMA 5HZKA 6LDHA 1FMTA 5JU6A 1ZI8A 2FWPA 2VK4A 1E6WA 1JSCA 3NXSA 4YYZA 1T0BA 1NU6A 2JFFA 3AG5A 3FZNA 2VT3A 3GVPA 3B2EA 5BSHA 4M76B 1SA0B 3H8VA 2G80A 4F11A 1SBCA 3QVXA 3OPNA 4AJJA 1ABBA 7MHTA 3GRKA 4IDGA 1YR8A 4N0QA 1CEYA 2SICE 4UW9A 1CUGA 2VBCA 2VHUA 3COPA 2FDRA 3E2PA 4X84A 5HE9A 5TPWB 3VJLA 4BFVA 1SUAA 2QMYA 3O38A 3UMBA 1I3KA 2XB9A 4LJKA 4MRPA 2W7TA 3ZWYA 4PQFA 2ZRNA 3OQJA 5JJBA 1JW9B 3KPJA 1XA4A 2JFXA 4MI6A 1OYVA 1R88A 3VPCA 4XJXA 2PGLA 4WZBA 3FCEA 3B1WA 1XTTA 4ER5A 4M0PA 1IEWA 5JIBA 1SBNE 2YBDA 4PFQA 1T3ZA 1ACMA 1YHZA 1LQUA 5EJ2A 2V7TA 2X4IA 4B9AA 4D8WA 3HNOA 3EY9A 4MR8A 4OI0A 3BE5A 1BA3A 1PQUA 4FYWA 4DQVA 1GRCA 5DMXA 3ZKWB 1W34A 2WAYA 1GNRA 3CX6A 2AOVA 1LBIA 1FU8A 2W6JD 4H3KB 3W1EA 1H2FA 1EINA 2HPVA 1RAIA 4JMPA 1ISIA 4OY3A 5CNKA 2XA1A 1IRXA 5AKYA 1BDJA 2ECQA 2F1IA 4RESA 1IN8A 3IXMA 3PX3A 1KSJA 1LF0A 1GKLA 3R20A 3ZZUA 4HAXA 1CZOA 1KORA 2G5TA 5DLYA 5EWLB 4OKSA 4M54A 1INLA 3RS5A 4YRKA 6YASA 1JALA 3C8MA 4POOA 1SXPA 1ZIYA 1QF9A 3V8EA 5JBNA 4YLGA 2BMFA 2FH5B 2H92A 2O1XA 3NWJA 3QBDA 4GYYA 4O2BF 1VBFA 4P4SB 3DTNA 4RKFA 3RSLA 2D7JA 5JBIA 1Q15A 1UH5A 2XI4A 1H3NA 4FDTA 1FS5A 1I2AA 4KQ6A 1G2QA 1QFJA 1WB6A 4YRNA 3GLTA 2C7PA 3KVOA 3NEJA 2VBGA 1N2CE 3BKWA 1W5TA 4KC0A 1T1GA 1CCWA 3QK7A 4BNGA 3I58A 4ZYYA 1EESA 2QL7A 3BT7A 4TZ0A 2G70A 3LUDA 3R4VA 4DL9A 1YA8A 1GUFA 1O95C 2PXAA 5FNZA 3FSGD 5HMMA 3FE2A 1JH8A 2DT5A 1T9HA 1CWUA 1Q1QA 3DWGA 1W48A 2Q3DA 1T5DX 4QBIA 1D4FA 2C77A 2X2OA 3Q41A 4EUNA 1SCDA 2V4UA 4FMCB 4O4HA 3N2GB 1IQ0A 3W2IA 3HJAA 1I33A 1GZ7A 1LSJA 2A94A 3FB4A 3IT3A 4REOA 4WA8A 1IVSA 2AS0A 4J7XA 2AK2A 2RFLA 1DAKA 3KT6A 1PRYA 4MLZA 5AVSA 2O54A 1WQ3A 2NUTB 2XYRA 1O5IA 3DZ8A 4LBVA 1W2HA 4GBED 4DG5A 1C5KA 2MDTA 4A8JC 3UJDA 5CB4B 3CO5A 2IX9A 2BKAA 2X2PA 1E5XA 1NRWA 1IK4A 2CC2A 3DW3X 1Q1NA 4OK6A 4OIFA 3GFGA 2C7BA 5ANRB 2J0SA 4KXQA 1ZS9A 2Z5LA 1YJ5A 4LE0A 4KRGA 1HTTA 1K5PA 3C6ZA 3Q12A 4WW0A 4TKZA 4PN7A 1PWXA 2F8MA 5EN4A 1QP4A 4XIGS 4IO1A 3BXEA 4YT2A 3AETB 3FPLA 2AQKA 4N7MA 4Q1BA 3V00A 3HLTA 4KQHA 2Q0HA 1GU0A 1BVYF 2QN3A 1Z3IX 2YRFA 1GQOA 1U6KA 1P1HA 1YQUA 2DH6A 2OZLA 3AB7A 3LS2A 3PDHA 3FFTA 4PM4A 4E88A 4ABTA 1TM3E 1R8QA 3LECA 3P9XA 3I3OA 4YJHB 5JISA 5JJIA 2DPHA 1J99A 4DIUA 2AN3A 2WZCA 2EKQA 3VR6D 3FMFA 4ZO6A 4ZOAA 4Z6KA 4ENQA 1K66A 1VGVA 1J0CA 2HCFA 1ORHA 1NUPA 3AYZB 4S1VA 1CDOA 2WDPA 3SIWA 1GPH1 1SUSA 5H59A 1KR2A 2GAIA 3PGLA 3UJAA 1VA4A 2AZ4A 1EE1A 2GCPA 2CFSA 1VYUA 2I34A 2R96A 1J1UA 1W52X 3VYTB 2QG9A 5AJTA 3H5OA 1A7KA 3B48A 1QWOA 3IUMA 2XXJA 4GLJA 1GGEA 5G3YA 3Q9SA 4R8SA 1QHFA 3E15A 3QLEA 3CN9A 2Q4DA 1U4SA 3LHFA 1C7JA 1C14A 4FINA 4II3A 5DDIP 1Q14A 4EJSB 2V45A 4NC9A 4H0NA 4XJSA 4AJEA 4ZI3A 4KIUA 1RZUA 3BERA 1LLQA 2AF4C 3AB3A 4DZRA 3W9BA 2R62A 4KR7A 4WOBA 2PIDA 1U7WA 3DGFC 4X45A 5KQRA 4RL4A 1G7CA 2BC9A 2FZ4A 1QIMA 3AHFA 5HMLA 1TFUA 4QTUB 3UB2A 4EA7A 3BBPA 1C9NA 3QELA 2WU4A 1MDBA 2P2ZA 3H0KA 3OCZA 3T7JA 3IUBA 4HX9A 2QD4A 1GCUA 2W98A 3AEZA 3D9QX 4L95C 4Y18A 4D44A 9ABPA 1MC8A 2BDEA 2NZUG 3V8BA 3KKEA 1PIWA 4PYLA 2W4MA 2BCEA 3C6YA 2XADA 2WAAA 4MVJP 3UPDA 5K99A 4FNMA 5IYZF 1LBTA 4PYKA 3K4QA 2NZJA 4OBXA 1C2TA 4DIOA 5JMOA 3FPFA 1R9GA 1GTG1 2OBBA 1QYCA 4Y7DA 3M1AA 1X74A 3GEHA 1L5QA 2I7XA 3DVAA 1HSZA 1PQPA 2PFSA 5DE3A 5FBVB 1IUKA 4S05A 3VYRB 1OAAA 3GN2A 1J97A 3DG9A 2HF2A 2QW8A 3F5FA 4B8ZA 4WHMA 2P6NA 1HE3A 2B98A 2XLBA 1VG8A 3IAHA 5FA8A 4CPDA 1RBYA 2PKYX 1IPFA 3S1SA 4RO0A 4GYKA 3CGGA 4L76A 4RZXA 4LW8A 3G2OA 2GNPA 2G9QA 4EW6A 1Z75A 4HZUA 5A4DA 3OFNA 1T3LA 3T38A 1HLPA 1VDZA 2JLRA 3EQ7A 5LZ2A 2PL5A 1TZCA 4MRRA 5E4JA 4A03A 2QG6A 3DC7A 3LGAA 2H7XA 1ES9A 3A6KA 3OCYA 4HN4B 4NYMR 4ENSA 1RC8A 1HTBA 4JI5B 5K3FA 1YDEA 4RAQA 3UUFA 4C1NA 1VMEA 2VA8A 1P5JA 2B8JA 4HYEA 3U19A 2I2WA 2V6MA 3FDIA 2ZCUA 4TYQA 4TMXA 4EHFA 4HEJA 2B1QA 5FDFA 4RDHA 3QENA 1ISRA 2CV2A 5CJJA 1J9GA 4X85A 1YF3A 4MYRA 3LLSA 3HTXA 4GC9A 3CPHA 4AS3A 2VNKA 3PRHA 5DT2A 1YQGA 3Q88A 3WWOA 2Z83A 3PXDA 3QWAA 4LSWA 2ZJFA 4Z4EA 4EO7A 1DINA 4IHAA 2G9ZA 3WLQA 4P86A 3ZD9A 4JX9A 1PI3A 2BHRA 4J75A 4TN1A 3OOHA 2J0UB 1U81A 3CLHA 4HJXA 2NVOA 3X1ZA 4BNVA 2DBYA 2IF0A 1MC4A 4Y0NA 4BNXA 2W9XA 1TO6A 3OMLA 5BNTA 4ONEA 5DLDA 3PNBA 5D00A 3NV9A 2HA5A 4V02A 1BJKA 3QE3A 3RGWS 3CLSD 1V11B 3GDFA 3HA7A 1VIAA 3N9IA 1NMEA 3PP8A 4QBHA 4JNKA 3ZCSA 4KWHA 4DMUB 3L0BA 1SRRA 4G1MB 2I03A 5L7TA 1C0EA 5DNVA 3HLKA 4DUZB 1OC4A 1D09A 3FN4A 4TMKA 5J63A 5KJ6A 4DMKA 2F9LA 4EY7A 1Q50A 3MJ4A 2PSJA 2QSYA 4B2PA 3JYOA 5I5EA 3ZNQA 3DE2X 3C7TA 3OJXA 4KMSA 3C14C 1TKAA 4GBGA 3WJ2A 3T4PA 4R0VA 1RC1A 1B43A 1UK9A 4K81B 5IZCC 2GYYA 2O8FB 4XR4A 4FE7A 2WEKA 1JUDA 1OLOA 4DR4B 5K09A 2PL3A 2I1WA 3G82C 2VJOA 3GRRA 5EFZA 5IZCA 3WIOA 2DR3A 4A2WA 1IRIA 1CZKA 3QKWA 2HPHA 2O07A 4CL3A 5HA5A 2F1JA 3IE0A 1LX7A 4PSCA 3LH5A 4HNVA 1GPJA 2HHJA 3PHHA 1RPTA 1DIBA 1JKIA 1LI4A 2J48A 3KZOA 1EB9A 3WB9A 2ID8A 4IMJB 4ZGWA 1U3GA 4PC1A 1CJSA 3OU2A 5B37A 4M38A 1W1IA 5BV2P 1D5WA 1F1BA 2Y99A 3BDIA 4NBWA 1XZNA 5HM8A 4TLAA 2QRVA 2ZB7A 3ICPA 4JOBA 3R3WA 5EIAA 2ZYUX 4NU5A 1IQRA 4C0LA 1C7QA 5AJXA 4FHGA 1O96A 4BVBA 2XOXA 5AFSA 1XMIA 4QRHA 1HDRA 1M8FA 5AUNB 3H87A 5L45A 4I6GA 5EIXA 3NBUA 2XVYA 5FBLB 5BWNA 3PJEA 3O5AA 5B6JA 3RD5A 3MUFA 4FLMA 1Z08A 1ZVVA 3RS3A 5JO0A 2BHNA 1L4UA 1DFGA 1E4EA 1PZGA 4GECA 4ZRMA 5DTMA 4CMJA 4A6PA 1KI8A 3ZIAA 3HG7A 4MDYA 2UZ1B 2TS1A 4GBJA 2AWOA 4FGWA 3BSWA 4JLUA 3JAKB 4PZAA 1OFUX 5U4QA 3CLUD 1GT91 3UT6A 3W1VA 1JHAA 3K9QO 3MUNA 5KMGA 3O93A 1RFGE 3VSCA 1SUEA 1XLVA 5IU6A 1H9BA 1N8KA 3ZHUA 2JGFA 4X65B 1US8A 3I6YA 5JT1A 3O4VA 3C97A 3KG2A 4UHDA 1WG8A 3CW2A 2EBHX 1NQUA 1GSOA 1X3LA 1BXGA 3U7IA 1U65A 1XELA 4L0DA 4AP5A 2IZOA 3E0QA 4NAUA 2ZS7A 2E48A 3OESA 1S2GA 2AR0A 5G53C 1AUXA 1NN0A 1TE2A 2JIZA 2ZTVA 1TAGA 4UEWA 4YJ3F 5CLIA 4JUFA 1ZOLA 5EINA 4S1TA 3VR2D 1DQPA 1N9KA 5LBUA 5ELXA 3MRVA 5BNIA 1VL2A 4XIFA 4E5PA 1N5OX 3RAGA 3QEKA 2GK7A 4B83A 2ECOA 4JA2A 1QCDA 2GM5A 5AOBA 5B1DA 3VR0A 5A4IS 1Z6ZA 2AI2A 3CUKA 2VVTA 2PO5A 4MCHA 2WHQA 3RWOA 4PHTA 4GHWA 3OA2A 3GNLA 5C32A 3ABZA 4CIVA 2IS6A 4J16A 2D5IA 4UOEA 1RQRA 3ZEIA 2J87A 1H5NA 1RRFA 3E5NA 1G3QA 3CWCA 5MN5A 2OO3A 2PUHA 3PFKA 1T25A 4O8CA 4JP5A 5EJIA 1HTWA 1GPYA 4C14A 5EP3A 4K9QA 4KYIB 2BPOA 5DASA 2Y77A 4QOJA 3ZHRA 3R0VA 5HNKA 3OF3A 4UVEA 2J31A 2H11A 2ZS8A 4F9GA 5C5EA 4YP7A 3R7BA 2DLDA 3NG1A 4AY5A 3B38A 4B5KA 1TA4A 1LCIA 5DHFA 2ZYWX 2V7QD 4HDMA 5D85A 1JG1A 4RFSA 5SY4A 3MCUA 3JQGA 5COBA 4YXFA 1B41A 3BTOA 4UHKA 1J06A 4F9FA 3QF4A 1UP4A 4TTSA 3X1MA 3B13B 4QLAA 1QPGA 3C8ZA 3L7JA 4JUBA 2Y1WA 4FI3F 1CF4A 3TI9A 3WTCA 3ZLTA 2YMPA 3DMNA 4O6VA 4GRDA 4TUYB 2JHGA 4WKPA 4ZO9A 1RXVA 1EX1A 2RC5A 1CUVA 3OY7A 1RPAA 4C0WA 2IY7A 4QUJA 4URYR 5EXDA 3T3MB 7REQA 3EF1A 3KZKA 1NW8A 1KXZA 5HKBA 2Q5QA 3IAS1 1NI4A 1U2SA 3PFBA 3BL5A 1XF9A 2ODEA 1P91A 3IQHX 4FX2A 2W22A 2ZXFA 4QRDA 2G28A 2CF5A 3JARA 2CSUA 3SC2B 4B6OA 1PNTA 4NS1A 2WSYB 4EHHA 4ENPA 1FPMA 4IRMA 1BXRA 4QJ3A 2XGGA 1T9KA 1LTKA 2JFHA 4MRMA 2PNFA 4RJJA 1WTAA 1ZISA 2DHEA 3C7CB 4UVIA 4IJVA 4RPGA 5G0SA 4WV3A 2P79A 1ZC4A 2HSZA 1FFXA 4P22A 2RC6A 3G9XA 1OZFA 5LMUB 2JKYA 5EZSA 1LC3A 3WNDA 1P19A 2W6NA 1RPNA 5CPFA 2P9JA 5AJZA 5HXAA 4D45A 1H05A 2PLNA 3BXHA 4ESHA 4CBVA 1RRGA 2HQOA 1IEVA 3HCBA 1O5TA 1JL3A 1P6UA 2GF9A 2J6BA 3PHJA 1BX3A 4D4GA 1E6KA 3ID6C 1DAMA 3IIIA 3GGPA 1UBOS 2G9VA 2WNSA 2Y93A 3R3YA 3W2GA 4LFBB 1ZBDA 5H5JA 4GM0A 1GZSA 4XSVA 1FFWA 1YCGA 2OCDA 4HSEA 4KE9A 1MXFA 5E8RA 2HSEA 4Y6SA 2QRKA 2ZJ4A 2ECFA 2Q6IA 5JS2A 1ZOIA 3H2IA 5DNDA 4XWAA 4MVJE 1C0KA 4KR3A 3BM5A 3RC8A 2HHAA 4YP5A 1XRMA 5AOVA 1DAIA 2ID9A 4MWGA 1LLFA 2YZ2A 4MVJF 3VBEA 3T3NA 4DDWA 1GOTA 1JFFB 1ZW1A 2R5NA 3C8HA 3I6MA 3MJHA 1O03A 1GPUA 4MX8A 2LCIA 5IEBA 3BRSA 5JAUA 2ZYTX 1KDOA 5DW0A 2WHRA 3VDRA 3UXHA 2GEUA 4F92B 4AZ3B 3U7QA 4IIBA 2IA5A 3N2ZB 2HI0A 2PZEA 5AUQA 2XB4A 3EODA 2E4AA 1T9ZA 4P3KA 2BGUA 5BRNA 5AVKA 1NMZA 1UPBA 2AC4A 2C07A 1H9AA 4HMQA 4MP8A 2WTBA 4LXYA 1XEWY 4O4JA 4TGLA 2BM9A 3RTBA 3F6EX 4QJBA 4CT0A 4GPIB 5I9BA 5KOJA 2R6JA 1X42A 2CMGA 1G1AA 2X13A 1VE9A 5KOHB 1RQXA 1U4OA 3LWBA 4QPNA 4L6AA 1JHMA 1IN6A 1RXUA 2G82A 5FI3A 2W2TA 3P0JA 5F1YA 2X77A 4KQKA 3LV8A 1KYXA 4G41A 5FI1B 4RTMA 2ZB4A 4EW3A 1PEDA 1Z2PX 5HFAA 3FDJA 3ZYCA 1ST3A 3K92A 4ZU1X 5ALRA 3W0LB 4ZYVA 4CCYB 2O23A 3LX4A 4PFKA 1BYUA 2NVWA 1H1TA 5G4KA 1B4DA 1QS0A 3V1NA 4KUGA 4OO3A 5JWOA 1XQXA 1NW3A 3QKSB 2OXRA 1T1IA 2OHIA 3HVHA 3I04M 2XDQB 3N76A 5AT1A 3SBDA 4BLWA 1ND5A 2VDJA 3KUKA 1T2UA 5G0WA 4FQ7A 4HDNB 3TOCA 2XUPA 1YNSA 1OLXB 2D54A 3IILA 3VNSA 1QONA 2V7XA 3I9NA 2ZIXB 1L1EA 2YIVX 4C4TA 1I1QB 3QUAA 1E7YA 1GKKA 3QSGA 4N76A 1HQYE 3L46A 3H2KA 1FXSA 1V6SA 2IPLA 3IQIX 4CF4A 3Q3VA 4YP6A 4Z9YA 3M1LA 2YJZA 1PEAA 1DSSG 1Q0SA 1SXHA 3HY3A 3PSAA 3HGTA 5ARCA 1Z22A 4ZAYA 1S8AA 3TL3A 2JI7A 1N1EA 1JTFA 4AAYA 2I22A 3NDBB 2PLRA 2NO6A 1ZH8A 2DBZA 3DWFA 3WNBA 4LQDA 3OC6A 3O3OB 3GLKA 3JQFC 4OI2A 3O7WA 9ATCA 1KVSA 1EA7A 3DLIA 3CUVA 4PLFA 4PLZA 4CN9A 2HA6A 2XKAA 3F7OA 2CHQA 2TSYB 3VH3A 3ZU6A 1XD2B 4YV2A 2KYRA 5EZYA 2JH3A 1R6VA 2HKIA 4N6OA 4YT5A 3W4KA 2X0RA 2VPZA 3QFTA 3QI2A 4DZTA 4E22A 4L3WA 4UVGA 5J4LA 2HYIC 2QN2A 2ATXA 5D3MA 3MWYW 4EG8A 3ELWA 1ND6A 1QMGA 1T0JB 3BXXA 4JQCA 1SHLA 2VJAA 4LRSB 1HQCA 1LBEA 2ERXA 1ZLYA 3UWSA 4A0FA 3QX3A 3NH9A 3TCNA 3A6PC 2AUNA 2OAGA 3NHBA 4KO1S 4LOJA 3CH7A 2O2GA 2VYNA 1RWVA 1V2GA 2A2ZA 2A5FA 2OG2A 2YHIB 3LQ2A 4J49A 5E2BA 1TEVA 3SZLA 3MA0A 1X2EA 3DL2A 4JFRA 1FSFA 1EVIA 2VJCA 4OB6A 8ABPA 1JB9A 2P2GA 2H29A 5KNCD 4NOLA 4JWKA 1PUIA 4CWAA 3RAFC 5BNWA 4EGFA 1CRWG 1CUAA 1MAVA 3IALA 3KR9A 4R68A 3K9LA 3BHMA 5IAJA 4DCGA 4GW3A 4X8OA 3NALA 4IDHA 2WYWA 4IOKA 4WJZA 2POCA 3H1TA 4YJGA 2DC1A 4M7WA 3JAMA 4HV4A 2WSLA 1HETA 2WE7A 2CF6A 2R6CA 4I1SA 4RX1A 1QG6A 3VR5H 3W8RA 2QV7A 4GMKA 2HRCA 4ZV4A 4Z5XA 4M9CA 1JFSA 3W77A 1VCIA 3VJRA 5HQTA 1KQOA 1NX9A 3ABOB 4X92A 5EIOA 4ZOQI 2BGMA 1U80A 2OB2A 3GFVA 2OBMA 3IELA 3TK1A 3NCTA 2H4YA 3MINB 4PU0A 4ETMA 1P1KA 4YPFA 5LJLA 3O8RA 2EP8A 1RT9A 5ETJA 1T34A 1E66A 1OTXA 1Z6GA 3RVKA 4Z3KA 3BH0A 3KJIA 1BROA 4JC0A 3WSVA 1F7VA 5BRAA 3PEFA 3C24A 1V5IA 3QEAZ 4XM2A 5A5VA 3SF0A 5AK6A 1YZHA 3FF1A 3COVA 3OCJA 4L5JA 1RKUA 2FMFA 1H6BA 1I2CA 3T3OA 2GNOA 4S3MA 2VHEA 4EQZA 4QDJA 1K2WA 2BBWA 4OXYA 2VEDA 3NC1C 3AVOA 1KMCA 1E3JA 3CEJA 2GBGA 3OLYA 3GJ3A 4Q7JB 4EYOA 4HB0A 4TXMA 3TNFA 4XWKA 3LQRA 3P9CA 1DLIA 1I30A 5JVDF 1Q1AA 2CJYA 2ODQA 4QUDA 1WQ1R 4QVIA 3AR5A 2SKCA 1B6GA 3BE6A 2EGUA 3L82B 4XVRA 4P4LA 3HLYA 1RAHA 3I5XA 4GC5A 3ZCQA 2DKOA 4J4BA 2CL5A 2FRDC 2VPPA 1V95A 1A04A 3QXSA 1B23P 1E7SA 1E0KA 4CKEB 1DKUA 3PQFA 5DOZA 4PZ0A 2N3ZA 2RKBA 3NWPA 5DB4A 1ZAKA 3G8DA 3HP7A 3UMVA 3RIMA 3H5IA 4JP1A 4R1OA 5CB0A 2BRUA 1NKSA 2E0IA 3OOJA 4L5CA 4TRJA 4FWIB 5JSKA 1M6EX 1XEXB 2FG5A 1VMKA 2HBYA 2FSGA 2O3SA 4ZAXA 3STTA 3V1LA 1RHMA 1IY2A 4NFYA 4CHTA 2Y67A 1SG9A 1F6DA 3QW4B 2ZJ5A 3KT3A 4OGFA 1KGDA 4MS1A 3RYFA 3M6AA 3O2JA 5I7HA 5K4GA 3OFKA 5KX5A 5L8VA 1SB9A 4E14A 1Z12A 1JEQB 2REOA 5DHQA 3SJUA 3H6HA 3VPBA 2NGRA 2C95A 5IP5A 4M1WA 1N8NA 3PNSA 4JJKA 2ETXA 3U7RA 2WKQA 1OB2A 1GVHA 3O03A 1TAQA 4MEJA 3B9PA 3EUEA 4ZP1A 3WMGA 3DCIA 5B3JA 1C3LA 3A26A 3CN7A 3FR7A 4HG2A 4ZVPA 1T4CA 4UAJA 5KKNB 3CKLA 1X1AA 3LCCA 1A2KC 4JC4A 1NVEA 3KOUA 3D7MA 4ITVA 3B12A 4R81A 4DWWA 3DQQA 1EZZA 4FD3A 5KTNA 4WN9B 2XODA 3HL0A 5FJJA 2EFDB 1OF1A 3DF7A 3DVLA 3IGFA 4Q7KA 4XDYA 3KE8A 5FOWA 1KS9A 1O2DA 3N2EA 2WQ6A 1QRUA 3H3JA 4WNIA 2G8LA 4E2ZA 3MC1A 3O4HA 3GBPA 2A1UA 4KO8A 1DVRA 4M49A 2HADA 1J23A 3NONA 2CL6X 2V97A 4U00A 2OFXA 3TOZA 3ZXIA 4F9EA 5HKKD 1P61B 2QZPA 3N7AA 1JHPA 3K1JA 2HIMA 2F1KA 3WRYA 4DA0A 1AT1A 1JPUA 3H19A 1L5ZA 4F2DA 3OQOA 1I4DD 3C8DA 2Q9CA 4RY9A 1GEEA 4XSHA 5BQFA 3B53X 4IZ6A 4NQZA 3WJ7A 1AKYA 2A1IA 1T1RA 1XTIA 4S1OA 3N2YA 5AJHA 4BZXA 3TD2A 1J33A 1WB4A 1RVV1 1SOMA 1SFRA 1WBJB 2QL6A 3OX2A 2IH2A 3UMJA 1SC3A 1E9AA 4KVFA 5CLQA 2O0HA 3GDGA 4V38A 4RGQA 3F6YA 4HUQB 6REQB 5L3SB 3PJRA 2RE8A 3QPAA 3TDMA 1XZAA 1M6YA 3PX7A 2Q4BA 1UM9A 3RSZA 1YR6A 1L9KA 5LM3A 1YFLA 3HCOA 1B93A 3EH2A 3IRVA 1SXQA 4CEJA 2GBLC 1Z15A 1D6JA 2GPBA 2LD4A 3PEEA 1FFAA 2XUQA 3D0QA 4A82A 3H8WA 5BOSA 2UXCB 3PTZA 3QMVA 1AKNA 1N2OA 3DOOA 2ZRKA 4IDNA 4J0EA 1UZAA 4TXJA 1Z68A 4POAA 5JC1A 2DM6A 1QIKA 3T4XA 4WLNA 5I4BA 5DN6D 4AZVA 4Y0VA 3JALB 3AUUA 3ADPA 5IRCD 3K9NA 4OCZA 3TLKA 2ZIWB 3PXEA 4LRYA 1SEVA 1SQSA 2HCJB 2Z4SA 2OXCA 1X1SA 3ASYA 3DLAA 3R5TA 2YL2A 4FEAA 4FFRA 3SBOA 4DLNA 2MR6A 4X0EA 2QB5A 4YRGA 3ZE8A 2P7HA 4LDPA 2JHPA 3KDPA 3EDQA 1E32A 2J0VA 1OD6A 1Y8RA 4MVWA 1AKUA 1PR6A 3QKTA 4KQJA 1U0NA 2JL1A 3MMSA 4GL4A 1PK9A 1SVWA 4AY2A 3G5MA 1KYQA 2PMBA 3EPJA 3MJRA 3EN0A 4ZHQB 2FDXA 2O3UA 2R00A 5C8VA 1UDXA 3QUBA 2XCUA 5EHIA 1WSDA 2PJZA 2JIBA 2IYXA 4ZOCA 1KI6A 3B6MA 5FFNA 4DCMA 2V6BA 1QORA 1A76A 4RE6A 4NJEA 3S6JA 4Z9FA 2GTPA 2IZ7A 5E7MA 1DLJA 1HQKA 3DV0B 1S0UA 2V1XA 3KJXA 2FXVA 4OHXA 4D02A 1G9SA 4MQFA 5LP6A 2HH9A 3W5CA 4Z2YA 3WNVA 1WZ2A 5AXDA 3C3WA 2XE6A 4LFAB 1HE2A 2N1MA 3E6AA 3GJ4A 3FSJX 3K4HA 2C88A 4JBXA 4K9RA 5E3JA 5AVRA 1ZGGA 3FYUA 4D0RA 2HIAA 4A5OA 3OG9A 3ZDRA 1JR4A 1M7BA 2AFRA 3A11A 2YOFA 5LB2A 3SEQA 4RKYA 1YE3A 3LPDA 4QHSA 3ZI7A 3O3MB 3WQHA 3EYWA 1PQ4A 3CIOA 4K6CA 1HT2E 4PNEA 2WYHA 3K8YA 4FZVA 3E1KA 4Y1RB 1UKVY 4ILEA 1JXOA 3FJ1A 2VDVE 1PCXA 5EGSA 4PQRA 4DNQA 5JZ9A 2Z2YA 3ZDAA 5IBPA 2J4DA 1EP2B 2HMYB 2CD7A 2Q99A 3CX7A 3JWIA 2C5HA 2HSJA 1IONA 2J0EA 3I4CA 1H66A 4GX1A 4P4GA 1QF7A 3IUNA 2C83A 3LOPA 4UQOA 1ODIA 3AVWA 1ULUA 4V0MA 3T61A 3PNMA 2YV3A 4JEIA 4R51A 4C7VA 2HEIA 1PTJC 1KI3A 4DMRA 2R8OA 1HT0A 2VDMB 4NEHB 1VG0B 1MAUA 4P9NA 2C29D 3DXYA 4F2WA 2GZHA 3FAZA 3G2KA 1A97A 4B7UA 4BQQA 4OHCA 1L1QA 2XYQA 4U2BA 4IV5A 3UKJA 4B7XA 2OBNA 5AKXA 1RTKA 2QTMA 4GGMX 2COKA 2FG7C 2QN9A 4KQXA 2FSUA 2NU6B 4NAVA 4XRGA 4ALIA 3O4FA 1Z34A 2LDXA 5F9MA 1H22A 1B16A 1DPGA 2ZJ3A 4MOWA 4QBGB 5IBRA 3T7TA 1NW9B 4KXYA 5EG5A 3SC4A 1D0VA 3KQOA 5HUQA 4KBGA 4DS3A 1NC3A 2NO4A 3MCTA 1MJNA 4KPUA 1QDEA 5ED4A 4QDZA 1CE8A 4IWYA 4GXQA 4N7JA 3EMBA 2P77A 1PAUA 3ZX5A 4BVJA 1FLNA 4JYMA 1LDNA 4RXUA 2AOXA 1K6EA 1E1QA 3MBIA 4N5LA 3F0TA 5AXCA 1LPNA 3HCEA 3KAKA 4FKMA 4A0SA 4I1PA 1OGJA 1IIBA 4MS4B 3RRZA 4M88A 4NYJR 2IUEA 3BWYA 3VQTA 4M9ZA 1GA1A 2OV6A 3JTMA 4M1QA 4Q47A 4Z8XA 1EHIA 4X8LA 3DLBA 1MKYA 2JCXA 1G16A 2PRZA 3OM0A 3AUJB 3RHSA 1NTRA 3U0BA 4AUKA 3P0RA 2G83A 1QLJA 2ZI4A 2NNWB 4DWJA 2QX4A 4JL5A 4R2MA 4BBZA 3U4QA 2BKUA 2I2BA 4S12A 5GZ1A 3DDUA 1UOEA 4HB2A 4U0KA 5F2KA 1IZYA 2B83A 1CW2B 2WIJA 3AGPA 5AM0A 3G9ZA 1OASA 4QO7A 4XM1A 4EO9A 5CXQA 3CF6R 3L6RA 3DYIA 5IJ9B 4H7DA 1JHYA 2PHZA 5C81A 1CQIB 1LK5A 2OZEA 3ZW9A 3DOUA 4RD3A 4WLUA 1EDBA 3FETA 5IBQA 4W5RA 4WZBE 4ILKA 4ZTBA 3T7IA 4F96A 4CM5A 4XOUA 3TZKA 1Z7GA 4AJIA 2FPXA 4F6RB 3CNOA 1BAPA 1W44A 1FA9A 2YRWA 5IS2A 3FCSB 4C0BA 4C0SA 1ML3A 5ESRA 3M4NA 3SJAA 3IP7A 3L5KA 4BWYA 3KEQA 1KZGB 5JRJA 1WXDA 3INGA 1TK2A 4R8LA 4BXOA 4IUYA 4A16A 2A67A 3GHHA 3TX2A 2DQSA 3OVMA 1YL5A 2Q5HA 1CHNA 2EX4A 3F1LA 3KLPX 4OQ4A 4AN0A 4DNPA 5TX7A 5KAPA 2WQZA 5HKAA 1QIDA 3CF0A 3I1IA 2YNMC 3DHVA 3WMEA 1MAWA 2ECKA 1JIQA 3OEYA 2YWEA 3P9PA 2PWBA 2H5IA 2PTHA 5DX0A 3ZWMA 1V1RA 4PQYA 1SXJC 5FTWA 5TVKA 1Y4ZA 4ICIA 4FW8A 1WF6A 3I5MA 4O8ZA 2K7FA 2XT0A 1BWSA 3EXAA 3GMDA 1Q1EA 1KJIA 2HF8A 2XVXA 3Q8WA 4AY3A 3PK0A 1K08A 3PBKA 3WYNA 5BVHB 2P9EA 5IZ4A 4WK6A 4F46A 2MINB 2WTMA 2I80A 4BO1A 2JF0A 5FULA 3L84A 5HJ5A 3T5PA 4WDQA 2EG5A 2IGTA 3JD4A 1TJYA 5CD1A 4MRNA 1MFZA 5D3KA 1P62B 2P6MA 1THTA 4I5EA 2XEXA 4BDTA 3P9YA 3UMSA 4KXLA 3QLUA 2QDXA 1UWLA 1WXEA 3PL5A 3ED5A 4J0HA 1XRPA 4BKQA 1EXWA 2IITA 4RIFA 4ZAZA 1Y33E 1XDZA 4FN5A 2Y0PA 2PA0A 2C3MA 1FDWA 3LKBA 4LE1A 3HUDA 2NUAB 2IEBA 4QYWA 3AR8A 3HJBA 3ISTA 1OZAA 3PQ2A 3EK2A 1E4YA 1RJWA 2JFUA 5LR6A 1UANA 2QJOA 2QK4A 4LEIA 4XB6B 3MJDA 2PMEA 4BFZA 1Z4LA 3UFBA 5KJCA 4EB6B 3JD3A 1K3TA 1EG7A 5ADWA 2B61A 2RGNC 5JYBA 5KI6A 1A9RA 1YRHA 4EGCB 1FXUA 1MAAA 1YB2A 3NAGA 4MCAA 1CX9B 3S2YA 1Z4MA 3LSTA 5ALMA 3WGUA 2OYSA 2RGNA 1FX0B 2ZRFA 4R1SA 5D1NA 4F4DA 2ZW9A 4ROTA 1BVUA 1J2EA 2Q07A 3C8UA 1F9AA 2D1SA 3JQPA 1P81A 4JBIA 4KMMA 3KHKA 1YI8A 1XHLA 2HDWA 3V9AA 2P3OA 5C8YA 1R5BA 4WK4B 3ZWPA 1W85A 3K9CA 1WA5A 2ZSIA 4YUXA 2W71A 4K03A 4Y3UA 1JTVA 2AN1A 3I62A 2JJ1A 2ZXEA 3K9FC 2Q50A 2CVZA 2IRWA 4TXNA 4YR9A 1C4XA 4RENA 3K30A 3CLTC 4IIGA 2XNDD