4HNRA

High resolution structure of chemotaxis response regulator chey4 of vibrio cholerae
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
120
Chain Sequence
b'TMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
molecule tags Signaling protein
source organism Vibrio cholerae
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
total genus 43
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnrA00
3CTPA 3K9CA 5IUKC 4EYKA 2N9UA 2FN8A 5T7BA 3HZHA 2LBPA 3QLVA 5KC9A 1A04A 1YK0A 2L19A 3HVRA 1JYEA 3LUDA 3HEBA 3Q7SA 1NY5A 3CLKA 2QVGA 3LUHA 4MQFA 2HJ9A 1F4VA 2P4UA 1S8NA 1YIOA 1QQAA 2IPAB 3QX9A 1TMYA 4LZLA 2LUOA 5DCLA 3KG2A 5IEBA 2FEWB 1ZGGA 3LKVA 4RK0A 3H5VA 3CZ5A 3NNSA 5E3JA 3HUTA 3F73A 4RS3A 4Z9AA 1M2FA 1DCMA 1WETA 1LJLA 2CD7A 4UHKA 1JWLA 2XDYA 1U8TA 3SY8A 4WWHA 3A0RB 5DTEA 4G0OA 4XLTA 1PNRA 1Z17A 3T95A 5JS1A 4YCSA 2FVYA 1M2EA 1NATA 1PEAA 1YS6A 2E4XA 3RVMA 2PUAA 1F51E 4WZZA 4MR9B 4HYEA 1RZRD 2FEKA 3LOPA 3N8IA 5TQJA 4KQCA 4MAAA 1EWKA 1CEYA 1LJUA 3RVQA 3RVJA 4QPJC 1EFAA 2BGGA 1JDNA 2IDMA 3JVDA 4G0MA 3CZCA 4WXMA 1JBEA 4G0XA 4IRXA 2FMFA 5PNTA 2FLKA 5KI6A 1T34A 1D5WA 2JVKA 4MR7B 1D1QA 2QW1A 4IMJB 2FMHA 4MR7A 2WY2D 4PZ0A 2R4QA 2IOYA 5BR1A 3KYJB 2Q5CA 1DBQA 4DN6A 4NCBA 3W9SA 4N41A 3CNBA 4MQEA 4HNQA 2VK2A 5TPZA 6ABPA 3HO1A 2JBAB 4PEVA 3TB6A 4F06A 2A9PA 1PUXA 1U0SY 4EY3A 3A3KA 1ISSA 2PUDA 4OATA 2R25B 1XWWA 5ABPA 3FFXA 4YLEA 4Z0NA 1P8AA 1LK0A 2KYRA 2MYNA 3RH0A 1RNLA 5BQ3A 1NXXA 2FW0A 1JYFA 4RY8A 4EUKA 5TPZD 3FDFA 5KQLA 3IP6A 1YK1A 1TM2A 3BREA 1USKA 4NICA 3BRSA 5GQSA 4ETNA 1QPZA 1JLKA 4NV3A 1QO0A 3LFTA 5JNVA 1E6KA 2E4YA 3HCWA 3RVLA 1BDHA 3SNKA 5JNUA 4L85A 3ROTA 3H5LA 3FGZA 4PYRA 1ZDMA 1BAPA 3DZDA 4G97A 1NTRA 3H5TA 5TQ2A 1ZH4A 1CYEA 1ZAYA 4MS1B 5FWYB 2E4VA 3G85A 1KRXA 3KKEA 2WB4A 1YS7A 3N75A 1Z26A 3UKJA 3CG0A 1DRKA 3KLOA 4OLAA 1QP4A 2AYZA 2HPHA 3H5OA 2NT3A 3I09A 4KREA 3CG4A 2TMYA 5TPWA 3A10A 2PE5A 3EAFA 4D6YA 3OLVA 5GOTA 3LMKA 4EVQA 4JAVC 3O2QB 5HSGA 4LE1A 2PL1A 5JNRA 2RGYA 2CHEA 1EWTA 1ZN2A 4JA2A 4F8JA 5HKOA 3M6MD 3C3WA 3NNDA 3A0UA 3E61A 2PUFA 5IC5A 4S05A 4WUTA 1FFWA 1DC7A 4Z99A 1ABEA 2PJUA 1Z18A 1MVOA 5I4CA 3SM9A 3IP5A 3MMNA 1PNTA 3LKBA 1Z16A 4TLMB 3NHZA 4MRMB 3NNNA 4NQRA 3R0JA 3EDCA 4KRFA 2L18A 5IEJA 2HQBA 1JFSA 4KMRA 2R47A 4MR8B 4KQ9A 4RV5A 1MB0A 5FWXA 3IP7A 3FFTA 3T6KA 1Z25A 6CHYA 4MLDA 2HQOA 3KCNA 1XHFA 3QEMB 4XXHA 2WMYA 2FMIA 3VNBA 1TLFA 3C6QA 3H1FA 1GCGA 1ZGZA 3D02A 4G0QA 3QK7A 4Z4EA 3UUGA 2IPMA 3ROFA 4RSMA 3NHMA 8ABPA 2MYTA 4QYWA 5JS2A 2FQXA 4RKRA 4RY0A 4ZMSA 5TPWB 1JDPA 1OXBB 4P1ZA 4MRMA 4EYOA 3LUAA 2FMKA 2V0NA 3O1HB 1NXOA 1PHRA 2H0AA 3H6HA 4N0PA 4YS6A 3CU5A 2PUBA 5EWJA 5F64A 2OQRA 2FLWA 3HDGA 2RJNA 3Q9SA 4OG2A 3QELB 4OTZA 1B00A 2B1JA 5B3JC 3C97A 3LUFA 4MS4A 5KWSA 4YRZA 1JFVA 1IIBA 1JH9A 3KYIB 1GLGA 3QLVC 3OM1A 1GCAA 1MAVA 4YWHA 2F8SA 2VUIB 1JF8A 2B4AA 5HM6A 1YTUA 2JVJA 3O2SB 4E7PA 2PL9A 3Q7TA 4TLLB 5JNWA 1RZRA 1I3CA 2FXIA 3JY6A 2NUBA 4IGAA 1RXEA 1RPJA 1A2OA 3QELA 1BVHA 2ID7A 4O5AA 1KRWA 3CS3A 4HNRA 4LDZA 3I5AA 3B2NA 1DP4A 2VYCA 2NT4A 1ISRA 1U04A 3EQ2A 4MYRA 1QP7A 1NXVA 4RDCA 4ETMA 3GRCA 3HK2A 2P9HA 1FQWA 4D74A 4Q7EA 3T38A 5EWMB 2QVCA 3TO5A 2A9OA 3QLTA 1DCFA 1KGSA 4YO7A 3RVSA 1QMPA 1EHCA 4KZKA 3L49A 4MQEB 5T3YA 4H3KB 5KQMA 1M5UA 3CKMA 5EWLA 3ILYA 1DJMA 4RXTA 3GT7A 4ZPJA 2QXYA 2YHAA 1XHEA 3GA5A 4Z4FA 1Z13A 4NCAA 4LE0A 1A0OA 2IKSA 3DBIA 1LBHA 3H1EA 3ILHA 5DGCA 3LTEA 5TQ0B 5C5CA 3KSMA 1TJYA 3CRNA 1QKKA 1GUBA 4KK3A 3T8YA 4ZMRA 4JOQA 4Q6WA 4MR8A 3GL9A 2PKXA 3QLUA 1EWVA 2RDMA 1QO0D 3L6UA 3P9YA 4RZSA 2PUCA 3OM0A 3F7NA 3IPAA 3JPYA 3K4HA 3N0WA 3D8UA 3JVIA 2GBPA 3RQIA 3TX6A 4TMYA 5BRJA 3MA0A 3H1GA 3Q41A 4RWEA 2JBAA 2PUEA 3I42A 4LDAA 4JP1A 4N0QA 4RXUA 3M9XA 2GI4A 4Z4IA 1HEYA 4P98A 5ED4A 1D2AA 4F12A 2QR3A 1SXIA 5FBHA 5CNMA 3CFYA 3O2JA 2JB9A 1LBIA 3F6CA 3N0RA 4QICA 1D4ZA 3C3KA 4EGSA 1L5ZA 3N6VA 3OQOA 5CHYA 3SQNA 1Z12A 1Z2EA 3FMVA 3TD9A 2AYXA 5CNIA 1APBA 3DGEC 5KQPA 4KPYA 3SG0A 4MS4B 5BRAA 4ML3A 1ZESA 3RVKA 4EVRA 1ABFA 4W5RA 3H5WA 5EWMA 3BBLA 4MQFB 3HV2A 5IBQA 5TQ2B 2A9RA 2GKGA 2DRIA 3CHYA 5FWYA 4G0ZA 4TN5A 9ABPA 1OXKB 4MS3A 1W25A 1K68A 1JX6A 1YVUA 3KTOA 1USIA 4IMIB 4XAQA 2JVIA 1QP0A 2LP4Y 3GYBA 4IILA 4RK5A 1H9CA 1BDJA 4XASA 4YV7A 4PE5B 4O1IA 4KNYA 1Y1LA 2NZUG 1ZY2A 2GWRA 3IP9A 4Z9BA 4H60A 3I45A 2PAFA 4F3TA 1JFTA 5TE9A 1JL3A 3SAJA 3H6GA 5FWXB 4OLBA 3O1JC 2MSLA 2MYPA 3URMA 1FSPA 2FSPA 3N0XA 4KV7A 4IF4A 5D2CA 4DQDA 3RVNA 4Z4GA 4Y9TA 1C4WA 3IPCA 4LE2A 4N03A 4FE4A 1TVMA 2FTKE 3N53A 5EWJB 3OO1A 4JB2A 3HM9A 3C3MA 3HXMA 1P6UA 3MQ4A 1SXGA 3BILA 2PLNA 3LUCA 4G86A 2E4WA 5IX8A 1DBPA 2FKAA 1P6QA 1W9HA 2QZJA 4RK4A 1URPA 2QU7A 1AB6A 2FQYA 1ZITA 1E6MA 4RKQA 1CHNA 3Q15C 4G0YA 1VRVA 3LUGA 3OLXA 3KS9A 2QSJA 1NXTA 4Z4HA 2A9QA 3QEMA 4EYQA 2JK1A 2M98A 3KLNA 5KC8A 1ZH2A 3OO0A 3JPWA 4W5TA 4MR9A 5B3JA 4MGEA 4G0PA 5HQJA 4UHJA 1BDIA 1RXIA 1E6LA 2WJAA 1DCKA 1EAYA 4FB4A 2QV0A 5IUNC 3VNAA 1K66A 3Q7RA 4E7OA 4MS1A 3RVPA 2WJWA 3EJWA 5JNSA 5FBKA 2H3HA 3OMWA 1M5TA 5JNTA 4XARA 1KMIY 4ETIA 7ABPA 2MYUA 1L5YA 4O1HA 1U2PA 4EVSA 2I6FA 3GBVA 4GNRA 4LX8A 3H75A 2L17A 2FQWA 1USGA 4RXMA 4JASB 1DZ3A 2E4ZA 4MLCA 3GWGA 4GPAA 3JS5A 3EULA 2RJOA 1DBWA 3HUUA 3F6PA 4KK4A 3OLYA 4EYGA 1MIHA 5EWLB 3QEKA 2FN9A 4DADA 3LUKA 2NZVG 5KQGA 1AB5A 2ZAYA 3EODA 2IYNA 4F11A 2GX6A 1BA2A 4W5NA 2WRZA 4MS3B 4YGXB 2ID9A 3NBMA 3HDVA 2OENG 4Z4CA 4L4UA 4KVFA 4ZYLA 4HNSA 3MIZA 3G1WA 1E2BA 4N76A 3HS3A 2J48A 5IULC 3GBPA 3LUJA 2LIVA 2ZWMA 1P2FA 3DGFC 3HJFA 2CWDA 2FEPA 3GV0A 3O75A 4MPTA 3RVRA 2MSKA 3OLWA 4Q6BA 3M9WA 4LRQA 1Z15A 4WXEA 3MF4A 2JCGA 1U2QA 1MB3A 4CBVA 4RY9A 1UDRA 1YMUA 5IUJC 1VPWA 3S99A 2X7XA 3MYYA 1DC8A 1ZHHA 4OBBA 4PICA 4RU1A 3RVOA 1QQBA 3DLHA 4RK6A 3OQNA 4WT7A 1SXHA 3OLZA 1SD5A 2HQRA 2WWVD 4S04A 3O1IC 1FFSA 4FE7A 4D6XA 1JHZA 3DLBA 2MSWA 3BRQA 3MM4A 3UK0A 2CHFA 1VLZA 5DLEA 2VUHB 4W5QA 1DG9A 4B09A 3KJXA 1ZVVA 3EQZA 2HSGA 1C0EA 4YP9A 4KFCA 5CNKA 2M1ZA 2LPMA 4M88A 1QNLA 1Z2DA 4N47A 2R48A 1VKRA 4XFKA 1SRRA 1NXPA 2IPNA 1GUDA 3H5IA 3KHTA 3QLUC 3O21A 5TQ0A 3O74A 2W42A 2F8TA 4H3HB 3FFWA 5C5EA 2PMCA 3JTEA 1NXSA 4YR7A 4JB0A 2E4UA 2IPLA 4ZJPA 4RK7A 3TMYA 1DRJA 3E3MA 4W5OA 3OMXA 1PEYA 1D1PA 1J56A 2PUGA 3IDOA 5CNJA 1NXWA 2O20A 3EGCA 5DKFA 1YMVA 3OQMA 1R8JA 4QYMA 4RK1A 1FFGA 2JRLA 2YHBA 3QX8A 3HSYA 2L2QA
chains in the Genus database with same CATH superfamily
3ECCA 2C4TA 4NWIA 1E9CA 1ETHA 3CB4A 5CGZA 5DNUA 3QSGA 3VOTA 4F2WA 1L7AA 2R97A 3LL7A 5F7ZA 5B1SA 1L5LA 4A03A 1OC2A 2QROA 1RRFA 1TKCA 1WMEA 2PZJA 5IBCA 2I3BA 1E92A 3SKXA 3ZUGA 5C80A 1RXYA 3HXQA 2GPSA 2PH7A 4CMEC 1B43A 3ANXA 1XI2A 4BO8A 1TRHA 3EF1A 2X0KA 4YJ2F 5FLKA 3T9AA 2CKDA 2OG1A 2AOWA 3Q3IA 2FPWA 3T1QA 3OSZA 3OE7D 2AYYA 3EXEA 3T34A 1UKVY 1MG0A 3K2QA 3NKFA 4L02A 4RK0A 4ZEXA 3OQ1A 1OX4B 4HNTA 1PX0A 4Z5XA 1D2NA 1O5OA 2FZGA 2GZSA 4FQ5A 4JV5B 1BXRA 1DCMA 4DXDA 2B8TA 1MOZA 2CDAA 3PHLA 1JPVA 4OXXA 3D64A 4FYHA 3C1UA 4H7HA 4TZ6A 1ZEJA 1YJXA 5UKDA 1NP3A 2JEZA 2XUQA 4JT9A 4B80A 2NO1A 5FV4A 1LPNA 2BP7B 4UU0A 4RHEA 2DP4E 1UXKA 4PVCA 5E2BA 4OB6A 1KZYC 1S3IA 4JBWA 3VHXA 3VAYA 3L0YA 3N2NA 2XLBA 3IJ5A 4JKIA 5HS6A 1Z5VA 2Z2YA 3AEQB 3QU7A 5DYNA 3SQLA 2QY6A 3L7OA 1T34A 4MR7B 4LDJA 4IIYA 5ULLA 4CEHA 4FHDA 6YASA 1SVUA 3S1SA 4JLMA 1NOIA 5A0TA 2V6JA 5CK4A 3UAZA 3ZDZB 1TU4A 1G2IA 3RADC 2FUNB 1GRVA 2H4FA 3NOXA 5JMOA 5L4LA 4F3CA 1WPXA 1ONBA 2V4MA 1F06A 3IBFA 3SLRA 5DTIA 4B73A 2NO0A 1KMHA 3G7NA 3N87A 3C4VA 3ZD9A 1JP7A 4TROA 4LQCA 4TTIA 3AP3A 4EY3A 5I5EA 1XEAA 4AF6A 3FPCA 3WHLA 2GESA 3U9LA 4AKSA 5F1PA 4KVAA 3PFNA 1JG4A 3JCZA 4UTOA 1MNQA 4OBXA 2ZE8A 4PRYA 3I04A 4KXNA 4DG9A 3FDFA 1OBOA 1YK1A 2J4CA 1JR2A 3U4AA 2WF9A 2AMLA 4URVR 2ZJ6A 3KBBA 4FN5A 1E9FA 4QYSA 2QHXA 2NX2A 5LA6A 3UJPA 3ZN2A 5BSHA 1P5ZB 1QO0A 2H1IA 5K7SA 3TINA 1MXHA 2QPTA 3CF2A 2XGJA 3IPRA 4IOMA 3TL3A 2ADFA 4QOSA 2Y9PB 2M6LA 4LOJA 3B6EA 3H5LA 2QYTA 3CJTA 1PEDA 2GCNA 1Y3BE 2OPBA 3AF3A 3N2YA 4G37A 4A6DA 1JFLA 4K9QA 3GCGA 4Q00A 1PW5A 4YAWA 3E5NA 3SC6A 1M3SA 3LS2A 5HP4A 4G4JA 1FX0A 2WILA 4OA5A 2VL7A 1E2UA 4QO7A 1KK0A 4MVJH 3KKEA 1QYIA 4UBOA 4R3UC 3PJEA 2FYTA 4Z2AA 2A78A 1WZUA 3REFA 1OBCA 1Y6RA 1UMBA 3WGKA 2ZWOA 1PNQA 1CUSA 1GIAA 4YCDA 3GDGA 4UEOA 2QTMA 2V3WA 3H86A 4QUJA 2BR5A 1P8JA 2PUWA 4U2BA 1YDMA 3C3CA 3BHJA 4D9IA 4GU5A 4W82A 1MEJA 4AKTA 4YQEA 4KE8A 4DPKA 1T43A 1D6NA 4RVNA 4ZCTA 3M6MD 1L5SA 1OAKA 2Y1EA 4PYNA 2Z6UA 3NIBA 4OMFG 1XZ8A 2C98A 3WRWA 3R7FA 1V26A 4CMHA 3U44B 2XLCA 4PFJA 1HORA 1QH8B 4YREA 1LGYA 1PK9A 1PS0A 2X0EA 4GEKA 5L6LB 3KNZA 1J9GA 3ZTTA 3FD8A 1NFFA 3ZWQA 5ECYA 2OD2A 4AB1A 1PJSA 4L4YA 1IOWA 4AZSA 5CB4A 2F43B 4KUEA 2NVUA 5IEJA 1X8JA 3O92A 1PR4A 2H5JA 4XOUA 1O0BA 1OH8A 2VH1A 3K0HA 2DH6A 3S68A 5EOVA 4V24A 3DWFA 1N2EA 4IAOA 4IOJA 1TA9A 3GZJA 1GZ5A 4UW9A 4X9XA 3W04A 1QGZA 1Z25A 2B5WA 2PZAA 3MUEA 2HQOA 1PR6A 1BDBA 1HKUA 4PXSA 4DLNA 1NHWA 1TLFA 1I2ZA 4HDRB 3WQRA 2OLKA 3QLEA 5AVKA 4QOGA 2XUGA 1DX6A 3QFFA 2WM2A 3SJ7A 1U0BB 1I3KA 4Q9IA 1KDTA 2NQTA 5HRUA 5K4AA 4DARA 4X95A 5TMPA 3AR6A 4JBGA 4ARZB 5K8TA 2HNKA 2ET6A 4EVIA 4TMKA 2OBMA 3LUAA 1FS6A 1PLLA 4FT4A 2G4CA 5F52A 1NXOA 4BP9A 2M6SA 1KO8A 3R9XB 3FY4A 2DWCA 2QKYA 1A5TA 1N57A 4Q24A 1GPMA 4R2KA 2X14A 1KWGA 4M7OA 3EVCA 1M6NA 3CZRA 2SNIE 1TYDE 3ZNNA 3O3NB 1Z56C 1SUFA 2QRVA 5BR8B 2WAYA 3A26A 3D4IA 3PVCA 5CDFE 1BS2A 2C29D 3E53A 2VP4A 2P77A 1RCTE 4NOKA 1J06A 5BQPA 4Q47A 3THYB 5EPEA 5JYDA 4BCCA 2B4AA 4O2BF 3RSGA 3LT1A 3IP1A 3QYFA 8GPBA 3CCCA 1IJKA 3PGKA 1HZJA 3BAFA 3WYEA 1G6Q1 1S0UA 3O2SB 4DTIA 3F5DA 1G59A 1JS1X 2EEPA 3W7BA 4DR3B 2HA6A 4H6WA 4WV3A 2IQ5A 2VPIA 4WASA 2AXPA 2VXCA 4RF4A 4IGAA 4O4JF 3HDTA 4QUDA 4UTZA 2OFWA 1CQZA 3EVAA 4FNAA 1LW6E 3BZUA 3EGXB 2RHCA 1M8JA 4N7RA 5AXCA 1FP4B 4CV2A 2H11A 3SM3A 2OXRA 2C7PA 2O1WA 3KO8A 5AM1A 4FZ3A 2IYPA 2I7DA 4K28A 4BB5A 1N6HA 3PICA 4C0WA 1X80A 5C5IA 1S9DA 2GF9A 3GB9A 3H0EA 1QUEA 2E5FA 1IPHA 1TC2A 4MQLA 2GJSA 1M5UA 1UZNA 1J2YA 3FFBA 2QTWB 3H1BA 5KTMA 2B7LA 3B6JA 4BBPA 2YHAA 3H4IA 3F1KA 2EJBA 1HPLA 1NG9A 2I1VB 2VPXA 3DBOB 5C8YA 3MCZA 1KKLA 2LR0A 3OFNA 1K08A 1E2PA 2GRAA 2BFFA 3ST7A 4NNJA 3D7LA 4LC1A 2W2QA 5HF6A 4WEOA 1P5JA 1WUTA 5DLYA 3RUAA 2A3NA 3CE9A 5CAEB 2B7BA 4ZQGA 2CYAA 4JX9A 5CVDA 2PKXA 3RIGA 3RFCA 4BNGA 1KJ9A 4KAFA 4CM8A 1W87A 3UJNA 2RDMA 1ZR2A 3QXXA 4JEHA 1V7PC 4DS3A 3CH6A 3GJSA 4XUEA 1GNRA 1W49A 3VHLB 4WBNA 1ZNZA 3WE7A 3AB3A 4FMDF 4UD6A 1SM4A 1KYWA 1ZN9A 1CE8B 2GERA 2HY7A 2ZBGA 4LYJA 3ROEA 1R0KA 1XPRA 4N0QA 1R4MB 4R5MA 1KQNA 5IBPA 2QI9C 3C3BA 3QVGB 1EVQA 3H2HA 4HC4A 4TTPA 4KIFA 4Z3KA 2UYOA 1KPGA 6GPBA 4G1EB 2QR3A 1I6WA 1KIAA 1N9GA 1SXIA 3ENNA 1V3UA 5CNMA 1Z6XA 5IJXA 3ZCPA 1D2HA 1GNVA 3INNA 4LJKA 1GRNA 5HIAA 2QRPA 5G0UA 3ZDDA 2JA1A 3UY4A 1GPYA 1G0OA 2BEUA 2GJ9A 4KGZA 3L05A 3FMVA 2HA5A 2AYXA 3ON5A 4HN2A 4PQYA 1A9RA 3ELBA 1PKXA 3ITDA 4YA6A 2AOVA 5DN6A 4D3YA 1FB5A 3P2JA 3MJFA 5KQPA 2AUTA 4ML3A 3REQA 2AN4A 5EFOA 2VNKA 4HDKB 1ESMA 4W5RA 3H5WA 4W6QA 4UBMA 1L1FA 4CKYA 3IB3A 1N2XA 5IANA 1DGQA 4PPYA 1A9OA 5CBPA 3R44A 4GKJB 3RFUA 2BMAA 2RAUA 1NZJA 3KJEA 5DM70 1AZTA 1Z73A 3AM1A 1PVDA 3VR5A 5DJ5A 1Y6JA 4IHJB 4V3BA 5IZ4A 2Y0EA 3AMVA 1UH5A 5C52B 3KIPA 2GSDA 4R2WA 1P0FA 4ZAVA 1FMTA 2HU8A 4BLTA 2O19A 3JQEA 3K9LA 1G8SA 3DBLB 4Q1CA 4KQIA 1VIVA 1T8TA 2II6A 2P69A 4R1PA 4B0OA 4MHTA 5HNKA 1N32B 1YONA 2B20A 1TUEA 1DVRA 4ZYXA 1M8KA 1JU9A 4PRLA 5TE9A 4JI6B 2OXFA 3GGJA 4GI3A 1SWVA 3KEMA 1CY8A 4PSVA 2D2VA 1RI1A 1YQDA 5BNWA 3BE4A 3F0TA 1TQ2A 4GD3Q 3E58A 2JFGA 2B82A 2EJVA 3NBFA 4GX1A 2C7VA 3EVTA 5D2CA 3UMGA 4XOIA 5CBPB 4BB6A 1RYEA 1Y1SA 3MUOA 3IPCA 3PGLA 1M6HA 4P38A 1TF5A 1ZD8A 1MC5A 3T9DA 1TE2A 3WIVA 7MHTA 1V7QA 1MO5A 1NR7A 3V6LA 3P96A 3HY3A 1XWFA 4DBLE 3HM9A 3IX7A 3HXMA 1DKMA 1U7DA 2AN1A 3QVUA 1GTJ1 2H1SA 4QBFA 4B7AA 4YONB 2Q5JA 2DT5A 4EPWA 4B33A 1KXZA 1MOQA 1ODFA 1N6KA 2CDBA 1VC2A 4C22A 3I30X 1CYDA 1ZJ4A 3G49A 1II8B 2FQYA 3R0ZA 5BURA 4UEKA 1P1FA 4G5SA 2WAAA 1K63A 1VLVA 3OZFA 4YRBA 2FEXA 3TR6A 3WMRA 1SD1A 2C1ZA 4JDUA 4RPKA 5TMBA 4FFLA 4DA6A 4EB0A 4EECA 4YMLA 1ORRA 1P1RA 3L7KA 2H63A 2NXJA 4OV6B 4QELA 4LJYA 1N5IA 3PITA 4K8RB 3I2HA 3MCAA 1OASA 1UKZA 2PKYX 3C1TA 3RASA 4DANA 4FB4A 3AVXA 1U3WA 3GA0A 3UWSA 1OYWA 4FKZA 2ZI4A 5IDXA 4MS1A 1AGPA 4JKOA 4GGOA 3G3EA 5TMEA 4DL9A 4DUYB 1U7XA 5LOVF 5JARA 4CV0A 1RXVA 1GGNA 4YRNA 2FUG1 4EVSA 1OX4A 1TCUA 1X94A 2GZHA 2H48A 3PQ6A 2PAAA 4L4RA 4AKEA 2FPGA 2E1PA 2QM7A 4KL8S 1SXJD 1L4LA 1MRZA 2E4ZA 1ECCA 3WWZA 2XYQA 2WIDA 1Q15A 1V47A 2ZWAA 3OT1B 2HGSA 2P9CA 4MQMA 1DUSA 4YAOA 3CLSD 3PF8A 3F6PA 3FW1A 4EFMA 4EJSC 1O9GA 1SUAA 4JXKA 4B7XA 1PJ3A 1E4VA 4YALA 4F11A 1QCDA 3R6DA 1P0QA 4W5NA 3MFQA 3S2UA 3M2TA 3K9HA 1JEQB 1SXJA 4FYJA 4WCDA 2CLLB 4RPGA 4KVFA 2GCPA 4JJZA 5KX5B 2CXRA 2IKQA 3G8BA 4BMXA 1Y4DE 5LDHA 4CMBA 2O1XA 3GEIA 3HACA 2ZPUA 2JNWA 4U9IS 1HTTA 1RIFA 5JQWA 1UADA 1JKJA 1QHNA 2F1KA 1LLFA 1Y1PA 3NTRA 4YV0A 1CUJA 4XPZA 5DM1A 3TW8B 4AYWA 3H4VA 4C01A 4P3XA 1RC8A 1NP7A 4UNRA 1Y3CE 2PT9A 4QXMA 3QYAA 4MV8A 4WNAA 4GVXA 5GJVC 4EWLA 2QN3A 1KETA 1T2DA 3EWSA 4YI3A 3ZZUA 1A9TA 4RU1A 1T5IA 1XVTA 2M2IA 1H6BA 2W6ZA 4ZOEA 5SZJA 4AG5A 2B4YA 3TUZC 5KYTA 5IBRA 4IV0A 3VC7A 2WWVD 3T7AA 4OKSA 1UXHA 3H2YA 2Q45A 3H11B 1YUBA 3HXTA 3EUFA 2OYSA 2X86A 4MVWA 3ZY4A 3IHWA 1UFVA 5T3UA 4C14A 4MVJE 5DLEA 3ZHSA 4ZZ2A 1N77A 1I7PA 2RHMA 3C41J 2WWWA 3GGPA 3NTVA 4C4AA 3GPLA 2C42A 3FKSD 5BWBA 4DAEA 1TZ2A 2C2MA 3OX1A 4G25A 3Q1KA 1JE0A 4JCOA 4ZOLA 5AK4A 2LRHA 2PX3A 2ZEJA 1XQWA 1DHTA 4KLNA 5F76A 3SFTA 8OHMA 4EJ2A 1W36D 2H06A 3DHEA 1DL5A 2ZBEA 3KHTA 1T24A 4U0JA 3KB6A 1BVRA 4F04A 3ZY3A 4UBJA 4KMOA 1KVRA 4X0EA 3ZI0A 3ZXXA 3IT1A 3K1TA 2E49A 4JEMA 4YR7A 2CUKA 2ZWIA 2Q5FA 5E7JA 3DMPA 3I73A 1KI9A 3GVIA 1AS3A 3EYWA 1EVLA 2BMWA 2AHOA 2R2AA 2C0QA 3R3XA 3IDOA 5CNJA 2ZPTX 6REQA 1YZKA 3PI7A 4V03A 3O4HA 3PEYA 4NCKA 4DY4A 2YWJA 5B6JA 3QMMA 1ZUNA 4Y2YA 2GBCA 3U3OA 2C4VA 1L4HA 3K94A 1Z47A 2F3QA 1SB9A 1P81A 1VL6A 2EU8A 2ZTSA 3A36A 2W6MA 4KXFB 1FRQA 1R3DA 4B1FA 1RXWA 2BFCA 4AP9A 2JH3A 3AM3A 2A9KA 4BTEA 4JLWA 1ORTA 4V2IA 4DIBA 2OWEA 5B4VA 2G1AA 3L07A 4N7BA 3IV9A 5BSMA 4OVKA 4FOLA 3TIXB 1SUWA 3E4CA 3WLOA 4B3SB 3PRKE 4GZLA 1JA1A 1KPHA 5DCLA 3BWCA 4OAOA 4RFSA 3AF0A 3NOOA 4RFSB 1P39A 5CA0A 4Z49A 3QUAA 4Q3KA 5ECWA 3LPAA 4LQDA 3H0CA 4WOJA 5TT1A 4RHCA 2PR2A 3UYLA 3WGNA 1P5FA 3V4RA 3PE3A 1KMMA 4YAFA 4YP1A 4GBGA 2CD7A 3B48A 5G53C 1P1JA 2ZBDA 2PGOA 3GUHA 3OQJA 3GJ6A 3QH4A 2PD4A 4MW0A 4WWHA 1QVZA 3M49A 3UMJA 4X6LA 2QG6A 1DFGA 1KYIA 5F2EA 2YFHA 2FVYA 1ADGA 3E5MA 2Y71A 4I8XA 2OHIA 3OE5A 1E0AA 2IY7A 1FFDA 5I7AA 4M0EA 5JV5A 1W36B 2B5VA 2IY8A 4MUKA 4TPKA 3GD7A 5CDSA 1L3IA 4NE7A 4DLXA 4KQCA 5AOBA 1KOLA 5EG5A 4IINA 1XLTC 1RI5A 2P0AA 4EDFA 1YL7A 1S3SA 5C8DA 1AIPA 3B38A 2V5AA 2VO1A 4IG4A 3JALB 1KIFA 4IRXA 2AN5A 3R5XA 4ZOLF 2NYUA 2GBLA 2XTZA 2Z58A 1ZJWA 5DMHA 2G8NA 2OBLA 1L5QA 1P1BA 1Y8RB 4KO4S 1ECLA 4KGXA 4C0XA 4R0MA 1YDGA 3BFPA 4M60A 5FUMA 1JG3A 3ZS9A 1VLJA 2VHJA 3GAMA 5DMXA 4P84A 1DC6A 1Y6QA 2CBXA 1PSDA 3N8GA 3OT5A 4A91A 5I45A 1X1SA 1U5BB 3OAAA 2REQA 3P9IA 4RSHA 1GGMA 1R5JA 2IYFA 4RLFA 5C7LO 3TB6A 4WK0B 4YAGA 3N6XA 2ZXUA 4R51A 4H0CA 3RJMA 3D43A 1BJTA 1VCMA 2BLLA 3GGCA 1ISSA 4JBXA 3PNQA 4ER5A 2JLZA 2J9YB 3FFXA 3OD1A 4IO0A 3J7TA 3SWWA 3DTVB 1IQ0A 3WNDA 1Y4ZA 2FB9A 5F5LA 3SHTA 2Q3DA 1MAWA 3QFHA 1C3JA 2WT4A 2SCUA 1C9NA 2IYEA 1YZNA 2P9FA 2P7IA 2XD4A 2F00A 2NYAA 3M5WA 4RVSA 5CVTA 5LL6P 1ID1A 1ZM3A 2Q2WA 1JSZA 2RHHA 4PCVA 2BMFA 4B32A 4F5ZA 1J8QA 4L73A 2CSXA 4EHNA 1CIVA 4RKWA 4YWJA 2VHXA 2IZ0A 3UWDA 5EFZA 1EJBA 4JJGA 1X15A 2G6TA 4MGYR 3B20A 4MQ4A 4CM9D 5DHPA 3SNKA 3EC2A 1J90A 2ZSDA 1Z6PA 3CX8A 4PYRA 3LZ6A 3DZDA 1UUFA 4R84A 4YYZA 4WGFA 4GVLA 4BTLA 4FHEA 4G5FA 1ZI8A 3HY4A 1ZH4A 3FUUA 4KR2A 2BLNA 4UNSA 1C9JA 2WUFA 4WCFB 4E2ZA 3P2MA 4IRUB 4UPEA 4AN4A 2VF5X 3EA0A 4NZOA 2J5QA 2FDRA 3C74A 4V0RA 5H68A 5INTA 3C6XA 1M67A 2R8YA 2YXEA 3MAJA 2BBOA 1T2UA 2V59A 2YV4A 3H5OA 3QENA 5CGQB 1OB2A 3VHQA 1WCIA 5KYXB 4KE9A 1Y3DE 2VHEA 3EXHA 1AOXA 3D54D 2TMYA 2O8EB 1YS9A 2DVMA 4NV1A 4AURA 2Q0QA 4X7RA 5GOTA 1EYZA 2XMZA 3LMKA 2ZXFA 2AXQA 4DTCA 4LE1A 5FBZA 4XYLA 2YIDA 3CNHA 2RGYA 2HDOA 4XWAA 4OLJA 3ZGZA 4FJ1A 3E27A 2OO5C 1XZEA 1VL2A 1XD2A 3GLFB 3V80A 3CRRA 3RU7A 4E1BA 2RJ3A 4JHLA 3UFXA 2IE8A 1XMSA 3OA2A 5LB2A 4B4WA 4D2IA 4BATA 2FN4A 1QE3A 2LWIA 3AEYA 3QUQA 4R5HA 1KFKB 5DNEA 4IZIA 3SVLA 2BFWA 1PO7A 3HXOA 5KYUA 3V8BA 1SEVA 4M0UA 4MRMB 3GU3A 4BVBA 5AVUA 4D92A 2GZ3A 5A4IS 2HQBA 2QRUA 1JFSA 2D74A 3ICQB 3SX4A 4AJ1A 5C4MA 4RV5A 5KDOA 2BYTA 4Y2JA 1NSYA 1IULA 2W6JA 3ICWA 1G16A 2VKQA 3CSDA 3ZIUA 1AXEA 2ZUVA 1XEWX 1CR1A 3PUWA 3I9V1 3NLLA 3NYQA 4UNQA 4MDYA 2WD8A 1DKUA 1NYQA 1P0CA 2C1EA 3NRCA 3VU8A 5E8JA 4P4GA 3O8OB 3WHIA 3C5CA 3N2EA 4R2IA 1NSTA 4RL4A 5FHQA 2PKRA 2ZRMA 3W79A 4Z3OA 2JKYA 2PSDA 2QMOA 1DE0A 1UMDB 5AI0A 3U16A 3AVUA 2A84A 4QLAA 3FI9A 1NBIA 1Z2OX 3THWA 3LYAA 5C5DA 2V65A 3ASUA 4YS6A 2IX9A 1YAHA 4ZYZA 5IF3A 4LQLA 2ZUCA 1K1EA 4W4TA 3VSCA 4DPLA 5BYKA 2QP3A 3QELB 4UC0A 4RTQA 4I50B 5HA5A 4LJ9A 4D4IA 2QN8A 3IHTA 3PD0A 4A27A 1ZUHA 3OC0A 4IMRA 3NR2A 2C7GA 3TIGA 2Y1FA 2V6MA 3LWBA 3GEEA 1AZWA 3GLUA 1H2BA 1MAVA 3R5JA 5JXHA 2NXCA 4DJAA 1O7JA 3ITNA 4KHZA 1ZCJA 1O5TA 4A8HA 5KKNB 2IL1A 1I24A 2Y0BA 4QRIA 5AK0A 3T7RA 2PL9A 4IGKA 4DM7A 5JC8A 2PTHA 3D0KA 2A1IA 4LBYA 1YJQA 4QGBA 4WTOA 5EJ6A 3I9JA 1SU7A 4EI7A 3SZ3A 1U0JA 1UM9A 1UDAA 4TMXA 3KK0A 2I54A 3BHNA 1E1CB 5KUTA 2QK4A 1LU9A 3NV9A 1HT0A 2G83A 4JMLA 3RLIA 4LYDA 1TZJA 3K0AA 4GOND 5EIHA 4AW9A 3GRCA 2VDKB 3E48A 1CRWG 4MW2A 3P4YA 4KITB 1SG9A 1OFGA 5EWMB 5FO1A 3QLTA 2XE6A 3IKJA 1QMPA 1EHCA 1RAIA 3TBFA 1N5DA 2R1VB 1F8XA 4QDOA 5B36A 1WMDA 1E2GA 4CTJA 5KQMA 3RKUA 3CH4B 1ZJ5A 4EX7A 521PA 1PWZA 4J1NA 3E3LA 3TQHA 4FZ5A 4CEHB 1IBCA 2YASA 4DCSA 3ZWCA 2JGKA 2QQFA 2WTAA 4TT3D 4AUNA 1BMTA 1XTBA 2GNAA 3PUIA 3O7MA 5G41A 5C5CA 3W7VA 2HW8A 5FADA 1XVIA 5IJ0B 3WV5A 1U7PA 3Q8XB 4NBRA 2GK7A 2JK0A 3F7OA 4MRPA 1IZ0A 3RS9A 1YVPA 4AZ0A 3ZCUA 4DDTA 3GJ7A 1K3FA 2XGMA 4BQSA 3DMTA 1SKMA 2OSBA 3BGWA 2V9CA 1JFRA 3DL2A 3II6X 4UM7A 4XWWA 1G21B 4GL2A 3AHHA 3RANA 1V1JA 3TM5A 2I7VA 3BB1A 4ZK2A 1GZDA 1FVXA 3O8LA 4TSKA 4AWXA 4F5DA 2GKOA 4N3NA 2O2EA 4C6RA 2GD2A 3B51X 1G4UR 1HEYA 4YY3B 4TUYB 3IO5A 3FX2A 3RUDA 2OA0A 1YB1A 4GWGA 1M2WA 1S7CA 2B1GA 1JR4A 3O9ZA 3ONEA 4JQYA 4YMWA 1DUIA 4YJ3A 4BQFA 3O03A 3GK3A 1DKLA 4JQCA 4HNUA 4URXR 4S24A 4QICA 2PT6A 2PYIA 3ESZA 5GPBA 2R7MA 4P4LA 2XXAB 3VNUA 1YQWA 3GW8A 3L1HA 4LK3A 3MWEB 3PGXA 4LVCA 5C51B 3DBLA 1TTHA 1CY1A 3EOAI 2HA7A 2Y77A 2XPCA 4MICA 4EHAA 4D0GA 3VMFA 1V11B 3T0FA 1FYWA 4GM0A 3RVKA 1BU5A 1QVAA 4JQOA 3TCNA 4M9CA 1JKJB 1QRAA 1PFVA 4QOJA 2G63A 4FYYA 3AEZA 3TLKA 1CX9B 3WC4A 5FBVB 5JI2E 3ULKA 1IEWA 1E2NA 2OD9A 5JPDA 2D00A 2PWAA 4MUEA 1SC9A 1M33A 1JHMA 1C7ZA 1W25A 3TVYA 5JLJA 5AOCA 2XBLA 4IIVA 4KDRA 4BFUA 2ZRJA 4KR0A 3WQSB 1GEGA 2GYYA 4O4JB 1AK1A 1F6BA 3KEGA 4H31A 3K8YA 4Y0VA 1GQOA 1Z2CA 3UH1A 3QG5A 3A06A 2YZ2A 4LJ6A 4KNYA 3FDXA 1YFZA 4OK3A 1FW8A 2C2KA 3M1AA 4YTEA 3QBVA 3WGHA 1FSGA 4F3TA 4IS3A 4CNBA 2OAP1 3W1EA 4UDXX 2D2XA 5HBGA 5IPFA 3L1VA 3EC7A 4HNAB 1U5AA 5H3HA 4B31A 4TMVA 5B1EA 4ROSA 3SS8A 4KV7A 2P2SA 2FW1A 4MV1A 2X3UA 3DT8A 3Q3HA 3VPSA 2Y76A 3T1TA 5J23A 3SOPA 4ZREA 1TM7E 1GNLA 1VHTA 3NWJA 3E8SA 4FFMA 3CN9A 1SG0A 2INGX 3A2KA 1GRCA 4KLRA 1C4KA 3W9UA 1VSBA 4HYYA 4NH0A 1SXGA 3PBKA 5AM3A 5H16A 1ILEA 1MIOA 1V11A 2B21A 3AP2A 1URPA 2QU7A 1FRFS 5L3ZA 2BBSA 5FR1A 1UC4B 4L95C 5HE9A 3KOZA 4ZYTA 5HE8A 4IDHA 1KJZA 3KS9A 4E1VA 1Z5PA 3K0FA 4GX5A 5ESWA 4XA8A 2JZCA 2Y67A 2B2CA 2FFJA 5FI5A 2FPKA 4F85A 5AUNB 4H6PA 3H2KA 4YCAA 3A04A 3HP1A 4JBLA 1SHJA 3RG2A 4D6PA 5LP1A 5ALEA 1E3MA 3PIIA 3QLJA 1TADA 3EY4A 1YS2X 5J58A 1YKFA 1XDZA 1MBZA 3KV3O 3Q9LA 4ZYYA 1BX3A 1U3FA 3AJEA 4H16A 4IEIA 5MGBA 4RLQA 2Q3LA 3LSTA 1FK8A 2I4TA 3W78A 2DOKA 2XRFA 1U8ZA 4KO8A 4PBSA 4ZQCB 4BFWA 4MTLA 2H4XA 1E3LA 4J03A 4CIVA 1PL8A 5FBKA 2PMBA 4CF6A 1Z28A 3DKKA 2IW3A 4YC7A 2IYQA 3TPCA 3WL8A 4TYNA 5KWVA 3GT0A 1SRQA 3OVMA 3U7IA 1FYFA 3RTCA 3T7EA 1L4YA 2X5OA 2TS1A 4DY6A 2B5OA 4AMGA 5CD1A 1FEZA 1PFKA 2JIZD 1HDGO 1R0SA 1X8LA 3KZ1E 1N7JA 3WG9A 4BFSA 1YIDA 3A31A 4ZVTA 1BN7A 2HQ1A 2ZYWX 3EVNA 5H3LA 5TJ9A 3TUIC 4C29A 4BFLA 3A1VA 1LPMA 4NYIR 1NSFA 4DLWA 1C1XA 3VJLA 2D1QA 3WBKA 1M6WA 3QEKA 4TTVA 2G7MC 4E94A 3KDAA 1TK9A 4OFXA 4TWRA 1SGWA 4KH0A 4MPPA 4OK5A 3W2EA 1ZAKA 5JEDA 5HF9A 2XT6A 1WHSB 1A2BA 1R0LA 3EBOA 5D5PA 5T67A 3KAKA 1KO7A 2FPXA 2AEMA 1L5NA 3L0SA 5IXJA 4DT1B 2ATVA 1MXFA 3IOMA 3QPBA 1W5TA 4TS3A 1BW9B 3LHIA 2WF7A 3R0IA 4GOXA 1T9HA 3HJFA 3GV0A 5AI5A 4IDPA 1DC3A 3JD1A 2VYNA 1DV2A 1K6EA 4D3ZA 4C0QC 2YVLA 1U2QA 1QR2A 4CBVA 3D3EA 1EJ0A 3N74A 2CNWA 2I2BA 2PS3A 2WJZB 2WSSA 3VDRA 3RUCA 5JTUA 3MJRA 2ZAGA 3ESYA 5LA6B 1VPWA 1T0JB 1U6JA 2JFUA 3OWHA 3Q8MA 1FX1A 1QQBA 1ZHHA 3I2YX 2AD1A 4OFWA 4YT4A 1RI2A 4BFVA 4DV5B 2EXXA 1ESZA 3KZKA 4YRMA 3SFZA 4WT7A 2X8LA 1W44A 2GVNA 3LX5A 3PG5A 3LDGA 3CNOA 3RIEA 2QG9A 3ZDCA 2QTAA 3GUUA 1O94A 5FKJA 4Q1AA 3DLBA 3G0HA 2CDNA 1NW3A 2PRSA 3EB9A 4QIHA 1MO3A 4B87A 3A4LA 1WF6A 4MUGA 1D03A 1R8SA 4QJ5A 4BEVA 5DU2A 4DA8A 5C8YF 1V2GA 5BN4A 4WESA 3KQUA 3NBQA 1W93A 2HT6A 3IEPA 1QYDA 1W0KD 2VJQA 3A1NA 3AXTA 2D8MA 4M88A 5LB4A 4EKGA 3NT2A 4J4HA 3VV2A 4F1WA 5AQ1A 3IR7A 5I7EA 1VMIA 2W48A 1F4LA 2VDOB 4NXNB 4GP7A 4UQPA 2GO7A 4FILA 1G7SA 3IQXA 1FYDA 3KP1A 4JC4A 1EG2A 4Q4JA 4S35A 2W83A 5FNVA 3X1JA 3IBTA 2BMDA 4LDQA 4RNCA 2V7VA 1IM5A 1MORA 4PV7A 2QQEA 3DMTC 4OX9B 1Y9DA 2BD0A 3GJRA 5BY2A 1ZJ6A 5BMVB 1IDN1 3E3MA 3W9BA 4GGPA 4UM8B 4NZMA 4PLYA 1PEYA 3NGLA 4ZDWA 5K3DA 1MO4A 3W6PA 4DIKA 3F3MA 3WYCA 1XA0A 2O20A 4MJ7A 2ZIUB 3PEVA 4OP2A 2ISCA 2WZDA 3OM0A 4MKZA 4REOA 1NNEA 1QC5A 2WJJA 3K9CA 4DV3B 1D9ZA 1JEAA 1R64A 2JAOA 3QU9A 4DC9A 4G9BA 3NBZC 2QSZA 1IVSA 1GTVA 1YB4A 1HG0A 2L19A 4M21A 3HVRA 1MABB 2XWBF 4AZ3B 5BT9A 4ZZIA 4FN4A 3IUYA 1SBYA 2WV9A 2P9YA 3TSZA 1SO8A 3FYSA 2ZRDA 3DVSX 4Z0PA 3WK4A 1AMNA 1KEEA 1FPQA 4IIXA 4I1VA 2ID8A 1QQAA 1FIUA 5J4KA 4YDQA 3QX9A 1VG1A 1CXZA 1TMYA 3HFSA 2BBWA 2ZIAA 4IYJA 4XIIA 3RLFA 4B7CA 5BW5A 4C87A 3GJQA 4BX8A 3FNEA 2JKVA 4IV8A 1NYRA 3LYLA 3MRSA 5YASA 1NNSA 2AF4C 3RTEA 5E9AA 3L6OO 1WXIA 1IOZA 5DP1A 5E3JA 4AIRA 1RRKA 2NQ8A 1G9SA 2Q1UA 2Q27A 4MJ3A 1OJLA 4Z9AA 4UFPA 3F73A 4DIDA 1WETA 1NUTA 3JD2A 3W3AA 4OQMA 3LVFO 4EELA 1WZIA 4MDEA 2NSLA 4I9FA 4UDYX 4HWGA 4ZHQA 1DAPA 1EVZA 3H8WA 4HX9A 2G0NA 3IXMA 2CNLA 3OT4A 2DU8A 1U80A 1Z4OA 5I7FA 2ECKA 5DTQA 1EGAA 3VPGA 3DBVO 3NU1A 2APJA 3M0EA 2EZ4A 5FOWA 1L5HB 1C0KA 1JG7A 2RH4A 2XA1A 4NZZA 3FB1A 1KU6A 3HN7A 1LJUA 2F7SA 4F84A 4QPJC 2OFPA 2PYDA 5HRCA 5A9RA 3BL5A 4G0XA 4K3UA 5JAHA 3TQRA 3V4VB 5JFTA 1O03A 4IMJB 2WY2D 5LDDC 1BTOA 3ZV5A 4AKGA 1SURA 4JJEA 4NYIQ 1TD9A 3SBXA 3RROA 3OIWA 3UANA 4GLOA 2YMPA 4N5NA 4XCXA 3V7UA 4XWOA 1DIHA 4WUVA 4ND8B 4O4IA 4AMZA 1FTQA 2VT2A 1DAFA 1KJYA 4CM5A 4MQEA 1ZUWA 4XUGB 2BFPA 3E05A 3H3JA 1NBME 4AICA 3RS8A 4K9RA 1OT5A 2CNNA 4CUJA 1MH1A 3ZZ0A 4B3RB 4AJ2A 2D7JA 4EQ6A 2A9PA 3H5RA 3AI3A 2NV2B 1COWA 1XWWA 2RHWA 1KYYA 3UT6A 4YLEA 2ZIXB 4HRVA 2HT1A 4L0MA 4AWAA 4XQ9A 1Q7TA 1TCCA 4MI1A 3BB3A 4NLLA 1VECA 2PZMA 3MS2A 2C7RA 3PENA 3L6BA 4P58A 3GJ0A 3MGKA 5DWQA 3FCYA 3PXDA 4DREA 2I2AA 4EMUA 2O0JA 1CUHA 4M8NE 2EBFX 1QPZA 3FGPA 3RS7A 4I3GA 4DFDA 1R27A 2AI1A 2PWPA 3LP8A 4CYMA 1Q14A 3GJ4A 5AKJA 4DLZA 5JNVA 3KZCA 4F97A 3BK2A 2I2DA 1I1QB 2CLFB 3AUYA 4HAUA 3ZWBA 2OYRA 4Z7JA 3JV7A 4ENQA 1I7SB 1XIVA 3SQDA 1I6MA 1THTA 2NUAA 2VTKA 2ZB4A 2ZZKA 3DAFA 4LI0A 5JNUA 2JGLA 4JU8A 2B2XA 4ZGWA 3A05A 5EYPB 4CM3A 4HN4B 2QW0X 5A5DA 1LNSA 2FETA 4OM8A 4XWTA 2JANA 1UBOS 2R7NA 1U1EA 2FWRA 3PRJA 4GQIA 2PSSA 4HR7A 2WPDD 2W9XA 4MUXA 1YS7A 4BN4A 4F2DA 5LD2B 3N5CA 1M9NA 1U1DA 5HIMA 3OIVA 4OLAA 5DGIA 2EFEB 1CKEA 1YO6A 2WV7A 1ELOA 4HL6A 2K2WA 2GHIA 4EY7A 2FWIA 5AH0A 3TLCA 3OOYA 1U81A 2AFIA 3U1VA 4ZCSA 3UAVA 1ONPA 5BVHB 4ADSG 2JAXA 1MRSA 4UUBA 1IOVA 1KIMA 2FEMA 1SBZA 2Q3CA 3I83A 2HIGA 4JAVC 2BI7A 3F4LA 3UK2A 1ZSVA 2NTYC 1QU3A 4LXXA 3KPYA 3C6BA 1NW8A 4C6TA 1E9SA 3PUXA 4I4LA 3ELUA 1RRCA 3VOSA 2VEDA 2J7PA 3E61A 3V48A 3BXPA 1RBQA 1S3GA 2Y6VA 2C3YA 3UAWA 5CLLA 1R6VA 2JIQA 2HLNA 3WFIA 1D04A 2WYOA 2WTBA 3OY7A 3OTQA 1ISPA 4R8MA 4P5EA 2OCLA 3O8NA 4RH0A 4W1QA 3AM4A 1COZA 1WRBA 5AKXA 5A7HA 1Q11A 3P9XA 3H2ZA 1SQ6A 4UZEA 3UPDA 5E95A 3ZHUA 4FFSA 4GWKA 4NQRA 5KNLA 3GNSA 2ZM5A 5AHOA 3NEYA 4CLRA 4EJSA 2GAAA 2OBBA 3WKBA 1JW9B 5LYJF 3TJMA 1E7WA 4IDOA 4AQ7A 2MWMA 2MTBA 4FGKA 3PGA1 2MCFA 1MH9A 2JGMA 4Q5IA 10MHA 2V98A 1A9PA 1NVXQ 4OFZA 2LCFA 1ZVMA 3AVWA 1HZZA 1H66A 3AW9A 5LSAA 1XHFA 3PWZA 4XE5A 2YVKA 4NK4A 3AEXA 2YHUA 2ISSD 2H7XA 4G1BA 3TRDA 3EASA 3ZD8A 1K92A 2CNDA 2HRBA 3E15A 3PQ5A 3AY0A 3DP9A 2C4MA 3ABZA 2YIMA 4HB4A 5JU6A 4QU9A 4U5XA 2BFNA 1OD6A 4AJ4A 2ZBPA 3K4QA 4GRDA 1KRHA 3W2TA 1IZ7A 2FPLA 4HXFB 4M55A 3FLBA 4EY4A 4LYEA 1Y7IA 5LXTA 3EVFA 2V0NA 2QNBA 4OQQA 3WKDA 2WE7A 1ETUA 3UUFA 1PJRA 4G4SO 4E09A 5HIKA 4J0JA 3CZPA 4O4LF 4EQZA 3PQ7A 3SZRA 1GGKA 1QGUB 1RZUA 5JCOA 1CB0A 4QG3A 4OTZA 3T3GA 2Y1OA 4ODIA 3FN4A 4G85A 2FX3A 4W7SA 4QFCA 5ALRA 3HKEA 1XP8A 4DYDA 4F4IA 4I4TF 1F2VA 3QPVA 1I7DA 3N8NA 2W2OA 4I46A 3QLVC 2OP0A 5JJLA 3IFSA 3AERA 3KZNA 1BWQA 1CJCA 4G09A 4U02A 6NULA 5IYZA 1XTSA 2V3VA 1DKOA 4WFQA 3DUFA 4RZQA 4N1AA 4P4NA 3OAAD 4E5YA 4EX6A 2CF5A 4JP2A 3THSA 5MFZA 1FVFA 4TLLB 4CKZA 4FM9A 1E58A 2BR4A 3ESDA 3H9UA 4JVLA 4R9NA 5EJ9A 1DB3A 1UMCA 1UJ4A 1LBSA 1S8OA 3RAJA 4C2AA 4ZYVA 1LF0A 1RHJA 2ZDQA 2ID7A 3ZGLA 1E0DA 3EX7C 5T4FA 4LDZA 1ZK3A 1UBSB 2GN1A 3HV0A 3M4ZA 3MUNA 4XCVA 3CRZA 2RGCA 1QP8A 4U2CA 4YJ2B 3X43A 4C3VA 1JAXA 4ZYWA 1F38A 4G8CA 3MGBA 1TF2A 5EZYA 1I1HA 2P3LA 2H2DA 5FNVF 5B7GA 3D6AA 1ZNXA 5U1PA 4PC7A 1Z5NA 2J7KA 1SR8A 2ZK7A 3CUVA 3E03A 3L49A 2Q9BA 3NOVA 3ODPA 3PD1A 2OZEA 2XMCA 4UULA 4CF3A 1ECBA 1RCUA 4RXTA 2FPSA 4IDDA 1R0BA 3GA5A 5FL7D 3AOGA 2XNHA 1NURA 4M1SA 3BULA 5I9SA 5JY1A 2FZVA 3ECAA 2JATA 3IVCA 4GR5A 4RGYA 2CNOA 3AR8A 3QNMA 2R5FA 3HNOA 4G5OA 1VFPA 3F71A 5DHUA 3B6IA 4C4PA 4M6WA 1QG2A 4FFBB 2FCRA 2OZLB 3HKCA 1L1QA 1AA9A 3FNBA 3NDJA 3VVLA 1DEHA 3VYWA 3ZOKA 3ZDBA 4MR8A 2GLUA 3C15C 3V8RA 3L8YA 4B4OA 5ALLA 1WUHS 3WGLA 4A0HA 1L1RA 1CR6A 1JLRA 3MC1A 1F8UA 4GSKA 2QA5A 1IU9A 3RW9A 3AUKA 3D8UA 1B8PA 3RQIA 1VGRA 1XMJA 1PJ8A 3F6RA 3FNHA 3O3CA 2Z4SA 1W4RA 3MTAA 1PT5A 2F9FA 2VHQA 4NPCA 4R6XA 3F90A 2CZQA 5AI8A 1UC9A 3NW9A 4BJ3A 1GAXA 3ZV3A 4Y9DA 4M6WB 5DHTA 3M9XA 1V3VA 5JNLA 2R00A 3PJFA 3U81A 4KR9A 3ESXA 5BNFA 1RP1A 3W06A 1VJGA 3CX7A 3AUFA 2JJ2D 4P3KA 4OHBA 1H6AA 3I6MA 1B6RA 2QSYA 1I01A 1ML4A 2PUTA 1X7XB 1VTKA 1Z0UA 2XY4A 2YW2A 3EY9A 2A33A 1Z12A 1LLQA 2Z8YM 1G5PA 1K06A 2Y0CA 3AUTA 1E5LA 2IEDA 3LF1A 3OCWA 1UZAA 3P0HA 4IR7A 5G3YA 4A10A 1Z88A 4ANFA 1NC1A 4HGYA 4I50F 4G5HA 3Q2IA 4BLUA 1F1JA 4KDFA 5IN4A 2BAGA 1FQJA 1MABA 3S28A 3DM9B 1MO2A 3FE2A 2BKXA 2QE6A 2J0SA 1BFDA 1B15A 2H0RA 4Y2RA 1VSUA 1BFUA 1ACJA 1K5DA 3AK4A 1MG5A 1RKVA 1UBTS 1XYGA 2DWPA 2OV1A 3BB4A 4Q1FA 9ABPA 1LK5A 2ZI3A 4HDMA 4OUDA 5I3CA 2BF7A 2VYFA 3F5QA 5IT5A 1NONA 5LKRA 3OX3A 4GX0A 4PZZA 4QSMA 4RKYA 4F4CA 1PE0A 1ZCBA 4CV1A 2ZUBA 1O8BA 1OFUA 2Q8NA 1Y1TA 3OZVA 2BTQA 5EIBC 2WPNA 3O4FA 2OHOA 4L8WB 4HDRA 1PEKE 1DINA 4YMIA 4B5LA 5A9SA 3IP9A 4G5XA 1ESEA 1TW2A 2VK4A 2I6GA 3CBGA 5JCJA 1PI3A 1HYQA 3CN7A 4UATA 1YRAA 2P6NA 5C8VA 5K6RA 1T91A 4RO0A 2JFWA 3WYAA 2PZLA 3AWIA 3SAJA 1M1YA 1R0XA 1C81A 1GTG1 2JH9A 2KE5A 3AUAA 3EH2A 3FGOA 1FUEA 3I28A 1EA5A 3N0XA 4XSGA 5DRYA 2W6NA 1A9XA 3RUFA 4ISCA 4UTRA 3MJTA 3K30A 2EFDB 1WDMA 1GR1A 3UB2A 9LDTA 3JTMA 2R11A 2O7RA 2OAQ1 3IR5A 3D3NA 4FBGA 3NEJA 5HX7A 4BO6A 1CCWA 3DXFA 4B6JA 2O8FB 4CKEA 1PGNA 4GSLA 3TZQA 3Q0EA 1NKVA 1Y89A 2JFZA 4EG4A 1O2DA 3AFMA 3KL2A 2JLAA 2WAXA 2ZIFA 2ZS7A 3UKDA 1NLUA 4EITA 5DSXA 3AEUB 5DWDA 3V4LA 3CXRA 1J00A 4ATNA 1NI4B 1YHNA 2QTZA 2L0XA 3SYNA 1QVRA 3HCFA 2PDAA 1IN7A 4MJLA 2VP6A 4BBJA 2QM8A 2HREA 3OPYB 1WIWA 1SHTX 4Q01A 2VBCA 3I1FA 2OV2A 4EYQA 2M98A 3VH4A 3T5DA 4WE3A 1QG0A 1KMQA 2JI4A 3U09A 3IDQA 3PPIA 4DLYA 5TT0A 4YROA 3W8NA 3UV7A 4DIFA 5C81A 1RXIA 1L4FA 3V1KA 3DTTA 2WMNB 1XBTA 1R5BA 1L5FA 5IUNC 4V0MA 3BIOA 1PR2A 3I34X 2MHCA 4KOEC 3HGTA 3YASA 3VVCA 3Q7RA 4Q37A 4EI2A 3BF8A 5ALTA 1YDEA 2O2YA 1M5TA 2VBFA 5BXYA 2EHJA 2H5EA 3ZJVA 2WEKA 2YN0A 4O1HA 1FFEA 1GUZA 2REBA 3L18A 3M5CA 5CITA 1QVVA 3NTXA 3RRYA 5LYYA 3K8ZA 3OTOB 4YNBA 4IUCS 4MTCA 4BVKA 3MGGA 1QPBA 2G09A 1BN6A 3GVXA 3MUFA 1KSHA 1JDBB 2AJBA 1AQJA 1E8DA 2FN9A 5GMOA 4LGCA 5EN4A 3WB0A 1QM5A 1ZMBA 5D87A 1B76A 1LF5A 4J2HA 4GI2A 4ZU1X 3CX6A 3H8VA 5TJHA 3V2IA 2ATCA 3BRCA 3FWZA 5CTJA 1ODLA 4FK8A 4R0NA 4D0LB 1ATZA 2QLMA 4ZYLA 3GLGE 1H8HD 1SA0B 3COSA 3DE6X 3HJCA 3VZBA 4C9BA 1GY8A 4DMCA 4JCCA 2H16A 4OEHA 2DFKB 5EWJA 1PVVA 4IDCA 1QF9A 1HDRA 3SYTA 1UBLS 1SXPA 1GGVA 3SE7A 3BG5A 1QLWA 2Q3BA 4JEIA 2IEYA 4EO4A 5IZCC 1VJDA 4LRQA 5KNBD 1TGVA 2ZVJA 2AC2A 4RY9A 5TF4A 1TIBA 1YMUA 2UXBB 2CWWA 2H1OA 1WCWA 4U8HA 2PQ0A 4BKOA 1X7XA 2P6UA 2Z6VA 3ZV7A 1XQVA 3MYYA 3OOWA 4UUMA 5KOJA 2CLEB 3BD7A 3DLHA 3EXIA 3AKDA 3TQCA 2PWYA 3UJHA 1GQ2A 2ZT7A 5A04A 3Q4GA 3LCVB 2HCBA 2JFNA 3PPVA 4Y2GA 4DSUA 4HQKA 2I2CA 3L41A 1M1NA 1KQOA 3KPVA 2P6OA 1Y80A 2DFVA 2PY6A 2Z0MA 4WOCA 3N5KA 1QJCA 2G3YA 4F2GA 3UJ7A 3ZGYA 1G21A 2CL6X 4OHRA 5FLYA 3WP0A 1F8YA 2BGJA 1II9A 2XVMA 2I7XA 4YP9A 1N3YA 4NY1A 1CY7A 1YH3A 3C7DB 2BFDA 2D59A 4XFKA 5K2OA 3Q40A 2HXYA 3DWEX 3V8PA 3GRVA 2HSWA 2VHZA 2VJKA 1Y8QB 2WPDA 3AVPA 1ZGHA 4UQOA 3O74A 5AIAA 5CB4F 4S0ZA 1J6UA 1ZU5A 3A6EA 3FUVA 3L6EA 2I8LA 2IPLA 1FXWF 5BQ5A 3I9FA 3VR5D 4DQ0A 4Y2SA 4U00A 4TMTA 2DFTA 4FMDB 4E2YA 1NC3A 1CSEE 3ZXYA 2OQ2A 1TK3A 5C37A 1P7ZA 2O8NA 1OQAA 2XGGA 2YDYA 3B3JA 3PLNA 4I4CA 4BKMA 3O6VA 5DKFA 2FW9A 4PHHA 1C8KA 1JR3E 2KLBA 1GPLA 1DAMA 3MTDA 2VKTA 3FLEA 1H05A 2PGAA 2VLIA 5KVQA 3BMQB 1N6OA 2R751 2GJAA 3H2SA 4KX3A 5HXAA 3SLKA 1CD5A 4ID3A 3UATA 2WKWA 1YZ3A 3KJZA 4B44A 3GC6A 3CLKA 4P6VF 1AHNA 5M3BA 3SNHA 4A6EA 1J2EA 2PXHA 2MIIA 3O94A 3P9NA 3RHTA 3GFBA 5G3ZA 5AK5A 4IJ6A 4YMHA 2OSVA 1WUKS 2OD7A 3A3NA 1M0SA 1R9GA 1U7OA 1E20A 3NIWA 4OJKA 3AG6A 1VHLA 1U1FA 2RAVA 3QBTA 5CK5A 3KG2A 4TXLA 3P9RA 3NB0A 5EHIA 3OJ0A 5JSUA 3HI6A 4NFHA 4W8HA 3AGPA 3O47A 4ITVA 5CW2A 5HS4A 5LMNB 1T6XA 1OLOA 1ZZGA 2X19A 5F21A 5HMLA 2XOKA 2JBHA 3G2QA 4TV8A 5BSGA 1PZEA 1ZW1A 2RBKA 5D5QA 3ZJ5A 1QHEA 5CLFA 5BUCA 2JJMA 2F17A 1D1TA 1FMLA 1XRRA 2AFHA 2R6FA 3ORSA 1SZCA 4MPRA 1HE5A 3O82A 1Q16A 3A0RB 5DTEA 1SVLA 2Z9BA 1H2AS 5KU7A 4WY8A 5FPQA 1FLAA 4QNMA 4EFDA 1W1WA 3OOHA 3VNQA 4OH1A 4IW3B 4DUGA 4KPGA 2C5LA 3PFKA 2R8BA 3D5TA 4M87A 4MWZA 4UBLA 5LA6F 1KY4A 2HWYA 5A1TA 4Y3UA 2MSDB 3M6FA 5EKDA 1GUYA 2H2GA 3EF3A 2GRJA 3IQZA 4D9NA 2QZSA 2V6FA 4BV8A 4G1MB 1Z2NX 2HO4A 4C0BA 4CMGA 2E0IA 5JANA 4JI0B 1HBJA 2D62A 2ECPA 4PC2A 1IFXA 3FFAA 4IQFA 1YB2A 2CXSA 4JI4B 3GUCA 1SKYE 4EL0A 1JKFA 3ELWA 3FWNA 1IBSA 2BFFB 1OU4A 4NBNA 4EO7A 4LXYA 2NWQA 3SZLA 3LYHA 2O4CA 1KYTA 3HFGA 4JJ7A 1SHZA 5C4GB 3TWOA 4F2PA 5I9IA 1JHVA 2VRCA 4NCJA 1CIJA 1GU7A 4QTXA 4WXRA 3DHYA 4OI1A 3WL7A 4F6RA 2AR0A 2V7BA 1DKPA 1YV9A 1L9XA 3IQGX 4KSBA 5AW6A 2V5UA 3UAXA 1T8SA 3F6BX 1LS1A 4FW8A 1E1CA 3F9IA 3R5SA 2HJSA 2ERCA 1C41A 3BH7A 3RAFC 2Q5HA 4K5QA 5F51A 4PZ9A 3ABQB 4CODB 3LI2A 3C6YA 3H16A 3QE2A 4F0JA 3R6WA 5CXUA 2YHSA 3A6DA 1NBMD 2KJQA 2BI8A 3OIDA 2P2ZA 4JR0A 1V1RB 1OW3B 3W3AH 1CZOA 3FF1A 3TAUA 5BNZA 4AF8A 2H7CA 4X8HA 4Q02A 2GAJA 1ULZA 2FQ1A 3IALA 3EIWA 3VKUA 1WZEA 3GJXC 3ZWYA 4TRNA 3VU9A 4ENWA 4RJIA 1MLDA 4J90A 3M4JA 1EK6A 3MEQA 4GBMA 4C76A 4EB6B 3O83A 1DIBA 2LTAA 3KEFA 4RVGA 4XWKA 3FDZA 1IY8A 3O3OB 4D9MA 2DCUA 1LZKA 1CUWA 2BKAA 3TW8A 4RCYA 2O3JA 3R23A 5TQ2A 1A2QA 4C43A 1UDBA 3AR9A 4OHOA 1ZAYA 5DEIA 1ESDA 3V32A 2PLFA 3CM0A 3T52A 2CXTA 3VA7A 2HHAA 3NUQA 1L5OA 1VYVA 3DCYA 4M8KA 1LRKA 4BMZA 1TDJA 3ZU6A 1D4FA 1Y9EA 3ADDA 1H0HA 4DT1A 3O95A 1TEZA 1LUAA 1ZXBA 1J97A 1HY3A 3CPHA 3GXOA 3VR6H 5BVGB 2VIIA 3UTDA 5F12A 1LV8A 5E4JA 2A0WA 1IXSB 4PF1A 2TSYB 3HYSA 3LW8A 3HR7A 2RB5A 1O4VA 2DC1A 4B6SA 1J8MF 2P9QA 5J2UF 3WB9A 1CW2B 3PA8A 4DLVA 2ZJBA 3QE4A 2QMHA 4KQFA 2I8CA 1RC1A 4LDPA 5MGNA 2DEUA 1D1SA 1JPJA 1YR6A 4Z8YA 3HGMA 3ZGXA 4LV5B 2GM4A 4Q3CA 1BJKA 1OLXA 2XNSA 2J87A 2PJDA 4FZJA 4IDGA 5JR3A 1FFWA 5K8IA 5A03A 3HN6A 3RYCA 3WMEA 3TG8A 1F0NA 1A1SA 3P0EA 4N8SA 5AK3A 4ZAGA 3URKA 1LSUA 3H1TA 2CN1A 4I55F 4X8LA 2IP1A 4DDMA 3NHZA 4F91B 2DLNA 2OBYA 5JYCA 3NNNA 3T7TA 3W6UA 1F9EA 5J47A 4QSHA 4R6WA 4HTAA 1NWCA 3AR4A 3RCBA 4D42A 1C1DA 2O59A 3H2IA 1E6WA 1W8IA 3IP7A 1OLXB 4QULA 4JENA 4ZV9A 3L6CA 4QGSA 3TZKA 1YZQA 2VZ8A 1K6MA 3M6VA 3CEMA 4OXIA 4NAVA 3TRHA 4XXHA 4RTRA 1F8GA 4XQGA 1CDDA 1MNAA 1I8TA 5BQOA 2QL6A 2UKDA 2ZJZA 3P45A 4G0QA 5A6VA 5LN1A 3I52A 3NM6B 2CMHA 3ROFA 3GAFA 3UUGA 4EO9A 1KZGB 2A94A 4HB2A 1RXSA 4NF2A 4WCVA 3ZK7A 5JS2A 4EGJA 3KHSA 2XIQA 3SCZA 3M81A 5BSUA 1MRNA 3UA3A 4CT0A 1P75A 2DKFA 2TECE 1DKRA 4FEEA 4DCJA 2FMKA 3JR7A 1YBVA 1GR0A 1QLJA 1PHRA 3FKJA 3UCFA 4ES6A 5ITWA 5AKKA 5EKSA 3L5KA 2AGVA 4HOYA 5E9WA 4KIUA 1WXDA 1WD5A 3U7EB 2OHGA 2CLHB 5AOAA 4DR7B 1K75A 5LWHA 3K0EA 3EXG2 4NMXB 4KBFA 1FDTA 2FEOA 4R05A 3ROXA 1CB7A 4PZLA 4OX9Y 1X74A 1O54A 3ZVMA 1MHPA 2YN2A 3IERA 4Q21A 1JFVA 4UUPA 2J3IA 1SUSA 2JJ8A 3MTIA 4GLLA 1BE6A 3P1JA 1LTQA 3MELA 4HAXA 4D4HA 3F9CA 1JF8A 1EUCB 4PYLA 1NQAO 1N0VC 4TT8A 5DNWA 3JQGA 3BAZA 4BNVA 4A1OA 3OEHD 4DRZA 1ZVJA 5ILQA 1IN6A 5EMMA 3SXUA 4YIKA 3KWFA 1U0NA 2Z57A 3IPYA 3DPIA 3UGJA 4NDZA 5EIWA 4MCJA 3U4HA 5B7QA 4RJ2A 2ZRKA 4QYTA 4KGDA 3TSWA 1JUDA 1N2HA 3QZUA 1SK9A 4EB3A 4L2IA 1Q91A 1DP4A 2BSXA 2X42A 3KB8A 2QN9A 3KYBA 1EVIA 1LV7A 4RPIA 5A5VA 1ZCFA 2QD4A 3HSKA 5E7IA 2GHQA 3C7AA 1VKJA 4AULA 3HK2A 3MMXA 1F60A 1FQWA 1HFEL 2WUEA 3IQIX 3TO5A 3KQYA 1TW3A 4X6XA 4P3YA 5HEKA 2O2XA 3ZI7A 3ZZNA 2WFAA 1W4AA 2OTCA 3UBTA 5AUPB 1XRQA 4D4GA 4CQMB 3AFHA 2RD2A 2QXYA 3KZXA 3IS3A 3JARA 3QSYA 2WIAA 5EE9A 2XZDA 3G7SA 1C9DB 1XU9A 2GO1A 5E3HA 3WL5A 1XAHA 2WOOA 1T4GA 1QHGA 2Y2VA 2C2YA 3W8EA 3I3SR 3H1EA 221PA 4TXMA 1BQ4A 1DAHA 3Q3JB 5DO9A 4EHFA 3MFYA 1B14A 4E3ZA 3CRNA 1DX4A 2EX0A 2PRZA 5MDHA 3JWGA 5FFFA 4I3HA 4B5KA 1M2VA 1NBMA 1BGVA 4OHFA 4K9PA 3QLUA 1X0VA 1RWOA 4IUYA 2QVZX 1E6EA 4PXAA 1QHHB 4ACAA 2QMQA 4Q3OA 1U0LA 3HBMA 4HEJA 4ZOLB 1G17A 3TNYA 2GUGA 1UPBA 1B0ZA 4JLOA 5DHSA 4EG3A 1E1LA 2I33A 1NR1A 4EQ6B 4C4SA 4NCNA 3EPLA 2FW8A 5FA8A 4JZKA 2JBAA 4NULA 2HIMA 4RXUA 1PT8A 1KE1A 4GMFA 3PNYA 3COJA 5A4MS 1ZGAA 3PHIA 1C30A 3KM0A 4I1RA 4E5NA 1G98A 4WX2B 3VUFA 5KOHA 5ED4A 3OPNA 2FWPA 3NM4A 2QL9A 4ND8A 5HQTA 1ULHA 3E0QA 3OCYA 1IDOA 2XQFA 1S2OA 3EFOB 1JMYA 2HJVA 3NFYA 3S1AA 4AJ9A 2J0UA 3AU8A 3D5EA 4R2MA 2R9VA 2X15A 4YI5A 4WL0A 4NK5A 1POWA 4DVGA 2WWGA 4YP6A 4DIMA 1E1RA 1WKVA 3ADCA 2Y1XA 3IR6A 3I4FA 3RRZA 1CUCA 1U8XX 1Z0SA 2OY0A 1T8PA 2Q0XA 3PXEA 4NX2A 2Q21A 4YRJA 5CLIA 5DHAA 3DFKA 2ZS9A 1NBWB 2OOKA 4CM9A 2H5LA 4CKCB 1NGSA 3P7MA 4A1FA 4WRRA 1X42A 3EFHA 1EFLA 2GN0A 1EBFA 1NJ5A 4EGQA 5E7QA 4J1TC 2GN2A 1R9MA 3S2ZA 4FKMA 2XVZA 4F7DA 3CH5A 1USIA 3K1AB 2C61A 1J5EB 4TV9F 3DM5A 7GPBA 4OL9A 2BY4A 2WVGA 4ZVQA 2G71A 4HF7A 3KKPA 1AQLA 2IGBA 4TRJA 4G0NA 1P5RA 3TJZA 4D8UA 4QKQA 2GWRA 4RDIA 2C9MA 3AXSA 1WULS 3RFXA 5CDFA 3RB8A 3QBDA 4CHTA 1GL9B 3ND9A 3R3VA 1ID8A 4HCJA 4ZD6A 3H6GA 3I5UA 4Z0HO 4KQKA 3CIFA 1GKIA 2EWWA 5C4IA 2GD6A 2CL7X 4KTVE 2YX1A 1RWQA 4X84A 1UP4A 1K3TA 2BFDB 2NYRA 5JRZA 3OOEA 4LE2A 3MOSA 2QMZA 4MVJI 1P7VA 3SYRA 4UHDA 4EZBA 5JHHB 1E7SA 3S29A 2D2IA 3N59A 3NDRA 16PKA 2VA8A 3DJYA 5DBEX 2DWUA 2PLNA 1T3SA 2EBWA 2PVPA 4BP1A 4XPIA 1KQGA 1R74A 3E9CA 1LVGA 2A3RA 3X44A 4C1NA 2NV0A 1OKKD 3BL8A 5DI3B 3UG7A 1AT1A 1RMQA 1QS0B 1SCAA 2BCEA 3H9BA 5D3KA 3UHOA 3LUGA 3K70B 3ROZA 4LSMA 4UCXA 3DDZX 3T7IA 3DUWA 1UPAA 2QBYA 4ZC1A 3N9IA 1TUBB 1U3CA 4AD8A 3BCHA 2ZSHA 3BFVA 1Z4MA 1DQZA 2WKPA 4M2LA 4CCAA 1VJ1A 3JPWA 4PG6A 3ZLUA 1ODIA 3BTSA 2B99A 2DYKA 2WUWE 2C5GA 4E31A 5B53A 4X3OA 4QUKA 4DA0A 4M0LA 1SUEA 2IV2X 3BX1A 4XTRA 5AK6A 2YWDA 4WHMA 4MIEA 1W0JD 2X6QA 2P91A 3VNAA 2AI2A 4J7AA 1I4TD 3DV9A 1V0JA 4D9EA 3GD5A 4LHXA 5KVVA 2IYRA 1DUVG 1E61A 1VLHA 4XARA 2AG6A 4ETIA 4O4HB 2JCYA 2ZREA 1UM9B 5HUJA 1GKLA 1TAGA 4PHGA 2FRXA 4GNRA 1U31A 2AFVA 1Q84A 4K1XA 4C2UA 5AKEA 2ODNA 4JXZA 1M34B 4K1LA 1HWYA 1SXJC 1C80A 1YJ8A 5IYZB 2JAHA 3V2GA 3KJHA 4RORA 5TY0A 5KIAA 2H1HA 1W2HA 3BIJA 5F5NA 5HUHA 4D3DA 3OLYA 5EERA 1FLDA 4DIEA 4NABA 1PS9A 3ZBPA 4FEAA 3VTKA 2BL4A 4BFCA 2DR2A 4JLVA 1I1OA 3WTBA 1HT1E 4YGXB 2YICA 1Z29A 2ZQYA 3DAPA 1JSLA 1T6NA 2RAFA 4MROA 1RQGA 2BSAA 2CNWD 4M22A 5CLHA 1BRTA 5AJXA 2PO5A 2DAPA 5ITVA 4NOMA 3ICOA 4TM7A 4HH0A 3KFLA 4BJHB 1N2BA 2O54A 2ZWMA 4PFKA 2ZZMA 3TOXA 3NONA 1H23A 3O75A 1V71A 5DB4A 4YDSA 5LBUA 3IAAA 1G8FA 1JXOA 1A95A 2GVDC 2VNIA 4U7TB 5T6MA 4BMPB 5JAUA 2DKOA 3PXUA 1GSIA 3QWFA 2Z04A 3JZAA 4G4GA 4YYEA 4BFZA 4NS1A 4OHXA 3USES 2X7XA 1U8CB 1XOIA 1O95D 2VBIA 2OCYC 3EAQA 3QHQA 2WNSA 5EJ5A 2NUTB 4YXFA 2ARKA 3TXYA 3PX3A 4F5WA 1WQ3A 1DAGA 5AJVB 2HR1A 3KOMA 2C96A 3A3YA 1UM8A 3JQ7A 1Y8AA 3DAOA 4N3CA 5H59A 1EFPA 3COWA 3D9QX 2HHHB 3N7AA 3W90A 5ILGA 2IV3A 1SVSA 1M0EA 4X1KA 3WYFA 3HVHA 1KI8A 1YCGA 2XI4A 2C9DA 3R7AA 2YKGA 2R8OA 4E5DA 5JECA 5AESA 4FC7A 2OGZA 3QUSA 4H7IA 4J07A 3WNQA 1D6MA 2CJXA 3EW9A 1XLUA 3KUXA 1GTSA 3VSAA 3CVVA 4ZQFA 3Q7EA 1SB8A 1VRCA 1ARZA 2EG5A 2X1HA 3WLQA 5EP1A 4ROTA 3KZVA 2E4UA 2WU0A 5SY6A 2J5RA 4EW2A 2PK3A 4RK7A 4P0QB 3EEFA 3Q0TA 4HADA 5J9FA 2FMXA 1P62B 1TEVA 3B8HA 3JQ9C 3M5PA 5JWRA 3M5DA 2AXEA 3QOFA 3UV6A 5KYNA 4EKEA 1JZSA 1J56A 4IEEA 4K7JA 5CIWA 3RGGA 2PUGA 2RGUA 2WD9A 2GCIA 3BZBA 4QGFA 4XGIA 1K4MA 2FG7C 3AEQA 5KHOC 1ZJYA 3ZDEA 2Q6LA 2YFQA 4KXMA 3P9SA 1CERA 1B3BA 4DLAA 2HUPA 3ZHQA 3HZHA 3OTIA 4MUIA 3FVVA 4C4OA 1A96A 4GPBA 3I01M 2DPXA 4G01B 4HDKA 4NE2A 5DW3A 5JMPA 1LDGA 2QVGA 3OEED 2QJFA 1BEEA 3LCUA 3UWOA 4YUZA 2FSHA 1GPWB 2VA9A 4K6GA 5KKAA 3GMDA 3TNJA 1BMDA 3KWLA 1YIOA 4M1TA 1KNXA 3TEJA 1ZA1A 2WTNA 4V0LA 3TCKA 2EARA 1MC8A 2X23A 5FP0A 2XV1A 3DYIA 3QFRA 1VLQA 1YUMA 4BFYA 1DTEA 4MV3A 1XZFA 2PBLA 2ZRGA 1U90A 3HU5A 3LKVA 3H5VA 2WUVA 4LGYA 3HUTA 4QYIA 4FMCF 1B1CA 1K8ZB 2GXSA 2JLUA 4YJDA 4ARVA 4RABA 1Z7BA 4FOOA 1ZMRA 3UCXA 4X62B 1JWLA 4ABTA 1N2GA 1TJ5A 3NI2A 4HAWA 3SY8A 1HO3A 2WP0A 5JSZA 4EFKA 4KEAA 2PHZA 3FVQA 3IKMB 2VVTA 2PUAA 2PIDA 2QX4A 4PLWA 3QYPA 1CHDA 3WDSA 4EHJA 2PLRA 3LT2A 3D6NB 3UHAA 2CVZA 1MHTA 3C39A 2PUHA 1CG6A 4MVJG 4LUCA 4D81A 5DBHX 4LZPA 2QPAA 2AKEA 2XB4A 4M1OA 4H18A 2JH8A 1TU3A 2XA2A 1JDSA 3AB7A 4HAIA 4IIHA 3WRVA 2CB9A 4PIMA 4WPGA 2IDMA 2VR1A 2OGWA 4DBLC 2OZLA 3LQRA 5AM0A 5G0VA 5LIPA 3W5DA 3ABOB 1T3LA 1S6YA 1O5IA 2H17A 2Y0DA 1XZBA 3GLTA 3PIRA 4PONA 4PZ0A 4RAOA 3VSEA 4BRZA 4BWVA 3IQFA 3T7SA 3I8XA 4DXAA 4N41A 2GDJA 2ORVA 5BOVA 1K4YA 5KPJA 1ICEA 2G17A 3U4IA 4MYHA 4Z1MA 2OQVA 3H4MA 3W7AA 2J45A 3HZOA 3HO1A 4BMCA 3GA7A 2IXEA 1DBRA 5FPPA 4A8TA 1KVQA 2B94A 2Q6OA 3KYCB 5EQDA 2C4KA 1MN6A 3GRYA 4MWBA 1BC5A 4CFYA 1PUXA 2ORWA 1TO2E 1TIPA 1PVOA 2PZ8A 5FOXA 2HJRA 2WU1A 4V0SA 4TL8A 1CP2A 3O38A 3KT3A 1SD2A 5JSYA 1Q0HA 3IIIA 2YUTA 3V2UA 3WK7A 1MOPA 2MSCB 3N7UA 2IH4A 1U9IA 5CX4A 2VAPA 3BREA 3W2GA 1RM4A 4BVJA 2VS1A 2DBZA 4ETNA 1T2VA 2A1UB 3L2OB 4JJIA 2Q6TA 3AONB 5ECDA 5JXJA 1LI4A 1VLMA 3I5MA 4JYCA 4MW6A 2XW6A 2Q9AA 1G2OA 1RD4A 4EEZA 3HZZA 3V9AA 2X8AA 1LC0A 3EUWA 3VPHA 1PU2A 4QXRA 3SDSA 2O48X 3SIXA 4COOA 1TX4B 3EQ9A 4MGKR 1XTJA 5KVCA 3A1EA 1JE1A 2IYUA 2XE8A 3BWEA 4KYVA 3X2EA 2JDID 4G97A 1CTQA 3H5TA 1SU6A 3PWSA 2UXDB 3FMFA 1Q2UA 2E21A 4UPDA 1TYEB 2V7WA 4WI1A 1CULC 3CVXA 1MMFB 2AR9A 2UYYA 3Q9NA 3T9EA 2B7CA 4BWYA 1TKAA 4FVTA 3KLOA 3TOVA 4DMKA 2AYZA 4HMQA 3U6KA 2AG0A 2FWNA 4KREA 4C4XA 5K4HA 3F74A 1K0UA 3KKNA 3L43A 3BQMB 4HPWA 3RTBA 3CVJA 2F9LA 3HEAA 1SU8A 5HMMA 1CRZA 4QDJA 1K5HA 1QIFA 1SCUB 4Q4AB 3KSUA 3E7WA 4TLBA 4O25A 4QUGA 3V34A 3UMFA 3BFXA 3ENVA 5K3SA 3PJRA 4EKIA 1RJGA 4OHYA 1J2TA 1SQ0A 4NOLA 2O05A 1D2CA 4R31A 2CL5A 4ECAA 4IDQA 1Y37A 4MW4A 3OFSA 3DMNA 2ZR7A 3N2KB 1Z7EA 4FR2A 3RREA 4Y6SA 3VZPA 3F8TA 4GPTA 2AVNA 3IQDB 4R1LA 3ICCA 5IW8A 1Q2XA 3T4EA 2JCSA 3P9PA 1TL7C 3ICVA 4LY9A 1O95A 4NEGA 5I4CA 3SM9A 3FETA 5ENDA 4LWQA 4C1BA 4BGDA 1FMJA 3RTDA 2C78A 4FFWA 1MPTA 3QTLA 3OM8A 4TZKA 2IHKA 1C0IA 3EGVA 4MUAA 4UOEA 5AJWA 5JCJD 3HJRA 5LZ4A 3VR4H 4NCXA 2ZE5A 2ICAA 4KQ9A 2C77A 1RJ9A 3CNQS 2QBYB 1L8LA 2IXGA 1P19A 4LGMA 4MVJP 3U62A 5LIRA 4DW8A 1WDTA 2CLOB 2G9NA 3F78A 4QLBA 4A0RA 2KQUA 2W2LD 5AVRA 1BGWA 2YY7A 1GGJA 1FXSA 3BMNB 3GWZA 4IQ8A 4PIPA 3QOYA 2FPIA 4Z4EA 2DKNA 4R1TA 3SEAA 3EIFA 2VZEA 3L02A 2PZKA 3JATA 4ZTUB 2R86A 5L3VA 3AEUA 3BDVA 2NG1A 4JOBA 4MITA 1NY6A 2IEIA 4RQBA 1VBFA 2AQHA 1QG4A 2YC4C 3DBRA 4LZWA 2ZUWA 5CT5A 4BC1A 4YT5A 5KSZA 1JXMA 5ERYA 4DMHA 3D4NA 2HSDA 4OY3A 4N12A 1XCLA 1YA4A 5BQFA 5AVJA 2OQRA 5H9WA 3LKDA 4S1WA 1QX3A 3KB1A 1RQ7A 3ZBQA 3HMQA 4JLUA 2B1JA 2C0PA 2DR3A 2NSJA 4C89A 4LC0A 3KZMA 2GFHA 3U4CA 4PSDA 5T57A 3DOUA 1GLGA 1R6TA 1OT3A 2FZCA 2V9ZA 2VUIB 1AM4D 3IVAA 2ORYA 3M2PA 2W8BA 1JIQA 1L7VC 1T6ZA 4GC9A 2J0VA 3NBUA 3FJYA 3WWOA 4EJ6A 1N6LA 3HCOA 3TLZA 4IJQA 2O8BB 1NU6A 4K6OA 1PF7E 3D6UA 5FJJA 4DSOA 2RCNA 4P4TA 2WWFA 2DXIA 1RPJA 1UBMS 4QEKA 2AKAB 2NTJA 1WCIB 3V55A 1FU4A 2K5UA 5CXQA 4HNRA 5KYXA 1DJNA 3AYZB 2OLEA 4TL6A 2ACKA 5F3RA 1KBZA 3HCNA 2N1BA 1X13A 1NXVA 4QO8A 4Y1RA 4ETMA 1K7EB 3ZWWA 1P2UA 3FBGA 4QEZA 4D8TA 3T38A 2QVCA 1MDBA 1OLUA 1E99A 1DIAA 1T9BA 3LVQE 1D2EA 5G1NA 4JR1A 3RVSA