3FIJA

Crystal structure of a uncharacterized protein lin1909
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
242
structure length
224
Chain Sequence
LKPVIGITGQQRYVDAIQKVGGFPIALPIDDPSTAVQAISLVDGLLLTGGQDITPQLYLEEPSQEIGAYFPPRDSYEIALVRAALDAGKPIFAICRGMQLVNVALGGTLYQDISQVETKALQHLQRVDEQLGSHTIDIEPTSELAKHHPNKKLVNSLHHQFIKKLAPSFKVTARTADGMIEAVEGDNLPSWYLGVQWHPELMFQTDPESEQLFQALVDESKKTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin1909 protein
publication title Crystal structure of a uncharacterized protein lin1909
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
total genus 65
structure length 224
sequence length 242
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07722 Peptidase_C26 Peptidase C26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fijA00
4GUDA 5E9AA 4P36A 1P7YA 1QVVA 1GGEA 2YWJA 2ZUVA 1PDVA 3TTSA 1A9XB 3CY6A 1OX4A 4AULA 1FY2A 3PQ4A 1QVZA 3TTVA 1I7QB 2VXOA 1JDBC 4UOZA 2R1VA 5K4AA 3L3BA 3SF8A 1PE0A 3OT1A 3NONA 4P35A 3P9SA 1GPWB 4Y1GA 1GPMA 3SOZA 1Q7RA 1Q2UA 2A9VA 3FIJA 4E5VA 3B36A 4WXYB 1BXRB 3B38A 4AJ9A 4MGHA 1OX4B 5BV2P 2R1TA 2FEXA 1VHQA 2VDJA 1GG9A 2WJZB 2R1VB 1P81A 3FSEA 4I2NA 4Y1RA 3SF8B 3EWNA 2YWCA 3MGKA 4L8YA 3TTYA 3OT1B 3ZJ4A 1I7SB 3EJ6A 3KKLA 3L4EA 3PQ6A 4N12A 3NORA 4HCJA 4L8WB 4Y0NA 4AUEA 4ENVA 4UCFA 1FYEA 1CS0B 3RHTA 4ZDJA 3UMMA 4Y1RB 2D7JA 5SY4A 4ZDIA 3ZR4B 4L8FA 4B7AA 3TTWA 3P9QA 4GE0A 1VCNA 2W7TA 1K9VF 3CZ9A 1QDLB 2ISSD 2LXNA 3EZGA 4ENRA 1KWGA 4L7QA 2GK3A 3TTTA 1QWSA 2RK3A 4GE3A 4ENQA 4K2HA 4ZGGA 3PQ5A 1QF7A 2ZUTA 1KEEB 1O1YA 3BWEA 1P80A 4QYXA 4B40A 1P5FA 4BTEA 4ENUA 5DFAA 1R9GA 4P2GA 3UK7A 1C30B 3P9PA 1OX5A 5SYAA 1J42A 3F71A 1PDWA 4I4NA 2YWDA 4LRUA 4MNTA 4UZSA 5JZOA 4B5KA 3TTXA 3B3AA 1C3OB 2V4UA 3CNEA 1IZYA 4P5PA 2VPIA 1KXJA 2ZUSA 1CE8B 4OIFA 5SY9A 1OX6A 4L78A 1GGJA 2H2WA 1T3TA 3CZAA 3BHNA 3NOQA 1SY7A 3P9RA 4ZDKA 1KWKA 4OGGA 2R1TB 3NOVA 4OQ4A 4JQSA 2ZUUA 1JVNA 1VCOA 2OR3A 3GRAA 2YWBA 4L95C 4MTCA 4S0ZA 5SY6A 3R75A 1SOAA 2GHRA 4QYTA 1CF9A 1OI4A 3NVAA 5LIRA 4AUMA 1ONSA 2XF2A 4E08A 3L7NA 4LGYA 1U9CA 2RK6A 3PQ2A 1IPHA 1IZZA 4OJYA 1GGHA 4UOQA 4AUNA 3MIIA 3F5DA 1G2IA 4UNIA 1GGKA 2VRNA 1OY1A 1M6VB 3R74A 3VU3A 2IUFA 3ER6A 1P7ZA 4B2YA 2NV0A 4D1YA 3PQ3A 4PXYA 4N0MA 4RKYA 2AD5A 2ABWA 4B31A 4ENSA 4OFWA 3TTUA 1T0BA 4ENWA 3UJNA 1GGFA 3R76A 4WINA 2RK4A 4XLLA 3NOOA 1I1QB 5JZMA 4Y1FA 2AB0A 2R1UA 1VCMA 3D54D 3TQIA 3WFZA 1UCFA 4ENPA 3M3PA 4BIMA 4ENTA 3EFEA 1N57A 4BFLA 1QVWA 4ADSG 1KA9H 4OGFA 1WL8A 4P34A 3ZJ5A 3EN0A 1T36B 3CYFA 1S1MA 4RKWA 2ZUWA 3PQ8A 5IP5A 3PQ7A 3UGJA 1PV2A 4R7GA 3L18A 2VKTA 3N7TA 4I46A 4Y1EA 2NV2B 3UOWA 1L9XA
chains in the Genus database with same CATH superfamily
3M6WA 1BKDR 3QPAA 2JLWA 2GJ8A 3KJIA 2O07A 4HX2A 4MEBA 2H18A 4TV9B 1ECPA 4LF6B 2RCNA 1XUOA 3WGJA 3KKOA 2XKBA 3GPDG 3H2ZA 4OI1A 1VG8A 1MGOA 1NVUQ 3LSYA 4PG8A 1QIDA 3IMCA 4JJ8A 4R40A 5C5EA 1HDXA 1JH8A 1OAKA 1P4AA 1ZGZA 3NP7A 4TUYA 3SOZA 1US8A 2P7HA 1WMFA 3HI6A 1E1KA 1Y7IA 5BUSA 4M0PA 2B30A 3RCBA 4JJAA 4OMDA 1SU4A 5JAHA 3U0BA 4C0WA 4DA6A 2IE0A 2YFYA 3AUTA 3OZIA 4OHYA 4TXNA 2FG5A 4WA8A 2MMGA 4TUYB 3FFWA 2I1LA 2HLPA 1US8B 1YCDA 2FPRA 2NXWA 2O1SA 3E8XA 2FPGB 4HQFA 1DUVG 4RMHA 1IG3A 4IIDA 4Z54A 1IK6A 1VPEA 1ZG3A 1RQNA 2O3TA 4M76B 4YVFA 1GKUB 1HEUA 2QXYA 2NU6B 4G0YA 2X1LA 5A6SB 3QF4A 4UXHA 5AKZA 1LY1A 2CK3D 2DY1A 2GYWA 2QMQA 3D6HA 4QXOA 5CTJA 3SOPA 4EUKA 3REOA 2BJWA 1DIGA 2FY8A 4PTZA 4F91B 2G9UA 2ETXA 2ZW9A 2J0UA 1RHQA 1ZP6A 4EL5A 3OLCX 5JADA 3QF4B 3DG9A 2H1IA 5DNYB 1P33A 2YVAA 4HB0A 1G59A 1QIMA 2OCAA 3ETNA 3EBOA 5HWSA 1DRVA 1Z6XA 2ESRA 2ST1A 4F6RB 1SBQA 2XVAA 4MCHA 3UANA 3ZHRA 5B3AA 5ER9A 3MQ2A 1H69A 2QDKA 4BFXA 4K9PA 2H2WA 3LUFA 3DL2A 5BRNA 2H0QA 3UB2A 1WQ4A 3ICOA 2J0UB 4HPXB 4AVYA 3T7KA 4BKPA 3VKFA 4UUOA 4Q1EA 2IEBA 1M8FA 4Q3DA 2IIQA 2PL1A 5MHTA 4BU1A 1TRKA 2B34A 3I0MA 2WKPA 2ZE7A 5E4JA 3WWCA 3ZVNA 1X0VA 3FFBA 2QRNA 3AUSA 3BQMB 3F4LA 4FX5A 4KFSA 3N2GA 3UQYS 1Z0DA 4EJ2A 3KLBA 2ENUA 5B2FA 3OZDA 3FPSA 4Z9YA 4WFIA 2ERYA 4V38A 4IWNA 4WOJA 2Q2WA 2A4KA 3FNHA 1H1LA 1OOEA 2ZSIA 1ONPA 2A3NA 2D2VA 4HLUA 5CJ2A 4GBMA 5AUNB 2GK4A 2PX2A 4ZT7A 4H7EA 3N2GB 2Q5JA 3SHTA 4G9BA 3P7MA 4ZO9A 5EZQA 3BH0A 3KOYA 1EJBA 3NT5A 2DUNA 4EUHA 3NLLA 2C4WA 5AK6A 5LWHA 3MUOA 2ZWOA 1GPH1 1H1LB 4DNPA 1Z75A 1IULA 1TGYA 1ZONA 3CO5A 4G26A 4YRCA 2JGFA 4QUDA 5AO9A 4EGCB 3GT3A 4GKAA 4EYOA 5BWMA 3WQBA 1E9BA 3Q87B 5CPBA 2OB2A 4FD2A 1IWPB 5I9IA 3KJXA 4F9FA 2PSFA 1YWGO 4PNZA 3CG0A 3CUYA 4L9WA 3LP6A 3F98A 4FE4A 2QHXA 1JA0A 3N9IA 4TL7A 2FNAA 1AGRA 2CDCA 3KOWA 3H65A 1KF0A 1JSCA 2HU2A 3QVMA 4WAUA 4YV7A 1RI2A 2Q8NA 1PUIA 5DK4A 2PQ0A 3IP3A 3ESXA 4FDMA 4XB2A 3TNDA 3HVUA 1LLDA 1VECA 4LQCA 5D85A 4LZNA 4HQ6A 2PNFA 1KORA 2VRCA 4H08A 4A2WA 1QQ7A 5KWJA 1DE0A 2WILA 4KV9A 2V3VA 2I4IA 3O73A 2YWJA 3UATA 2PWAA 1I0LA 2VA8A 4Z8XA 3OLWA 5K0EA 1VLMA 4GICA 1NJFA 3TIFA 5JYBA 4GLBA 3ROXA 3FFAA 1YI1A 5TQ0A 1QIFA 3WYFA 7MDHA 1N2XA 1YQ9A 2MSEB 3OQBA 4WLEA 4LG1A 1BC5A 3P0EA 3L6UA 4OMFG 5GJCA 1ZN8A 5E6SA 1VL1A 1POWA 4MUJA 4QU0A 5G3YA 4CCYA 3JD1A 4YAUA 5K0FA 2BEVA 1MB2A 1C0EA 1A9SA 1DAHA 3TD6A 4K6HA 4YUAA 1IJKA 2WJVA 5TQ0B 2IYLD 2O50A 1K8XB 4IDDA 4D4IA 4QM7A 2PH1A 4R9UC 1Q95A 5DE3A 4HLQB 3D1LA 1JFSA 1Q44A 5E6SB 4CCYB 2BSAA 2XZPA 4ENVA 7MHTA 3H6KA 4ZDJA 5IJ9A 4OVKA 1SOWA 4WXRA 3DCIA 2RFLA 4LOIA 3WK5A 1M2WA 3B5JA 5HEKA 3WV5A 1ORVA 3FI0A 1SB9A 1V0JA 2FX3A 2XAAA 1UXOA 3P2OA 3OZXA 3QMMA 4HB2A 4K03A 2GM9A 4I50F 1HXHA 4J0FA 4QEZA 5E4FA 4BZZA 6NULA 1OGJA 2DWUA 3DWEX 2EDAA 3MA0A 4M83A 4ZAFA 4KWEA 1V7CA 3T1HB 1K6EA 2VP2A 1AKNA 1KMIY 2QU7A 2CDAA 3E9NA 3O7WA 1PWYE 2H9AA 4OHBA 1RI5A 1P7PA 1XZPA 2QRQA 3BHMA 3NBYC 3PCXA 1CYDA 4MQEA 3RUPA 2ONZA 2QAJA 3FPGA 5ALQA 3WKCA 4Q39A 5AM1A 2QD5A 2GA9A 1Q12A 5FNVF 3W5SA 5DMHA 5C35A 5CEEA 3BBLA 1CUYA 1HI9A 1WF3A 2I66A 4MQMA 5DEOA 3UH1A 5HJ7A 3K1AA 3ZNNA 2PX8A 4C4YA 3GI1A 1Q20A 1NASA 1YF3A 2PSHA 1KKMA 1KVRA 3FOCA 3OH8A 3P9IA 1CB0A 4MQEB 1L4FA 4MA4A 3T5BA 121PA 1ZD9A 1EVJA 1MO3A 3ELWA 4YYEA 4LYAA 2UVPA 4B3TB 221PA 4WX2B 4B09A 3K1AB 5JNLA 1U3TA 2BM8A 1E1LA 1VE9A 3AMVA 3D7LA 1ZICA 2QTZA 1TCVA 3WHKA 1TM3E 2VJCA 1JQ5A 1CZHA 3FDFA 1JAYA 5DU2A 1M73E 3O6VA 3C74A 5A5GA 1ABEA 1Z8NA 5FH9A 1DDOA 1L3CA 1GA1A 2PQ2A 3FETA 4CMGA 2M6KA 3A3PA 5D6NA 4ZMBA 1CIPA 2F43A 2W43A 2E18A 2QTNA 4Q1VA 2YZMA 3RG8A 3S2EA 3BL8A 3UB4A 4AY6A 1KQPA 1C1XA 1N3BA 3K9HA 4JX8A 2HB6A 2WWHA 4TKUA 3SIRA 2PRSA 2I7CA 2P69A 1F6WA 2BFPA 2VAWA 2HWWA 3BFXA 3EA5A 4UVHA 5K0SA 1DKOA 1SVSA 1R0SA 1WW3A 4QKQA 5HIIA 2F43B 3IR7A 3L0YA 5TPZA 5AIAA 5DH9A 4B3JA 4BX8A 1XVLA 4MUKA 1C1XB 3EG5A 4TV8A 3GAMA 4OHUA 1DXYA 1TO1E 1ONBA 2FWAA 3B6EA 4ME6A 5A71A 3LRTA 1JV2B 4KVGA 5M5BA 4OAOA 2JD0A 2J6HA 4G37A 3SEFA 3PQ8A 3PUKA 2Z1NA 2REBA 4O25A 4PRKA 3R7WA 3OMWA 2PN1A 3HMKA 5BN3B 2F6RA 1WTAA 4Y2GA 2FJ0A 3BXXA 1E2IA 1GGEA 1TYDE 4Y2JA 4I8IA 2BSQA 1U0LA 2BY4A 5CYOA 3VRHA 3EDQA 7ABPA 5K8UA 1IC6A 3E5NA 3D0QA 4KJZA 3BB4A 4ZRNA 3R7WB 1X3LA 1PK7A 5HJ2A 3RB8A 1TD1A 1P74A 2EX0A 2QX6A 3QVXA 4A2QA 2PAFA 1H2EA 1VP9A 1Z35A 2O7RA 2F2TA 1E5VA 4CWAA 3TFOA 1H0SA 3H5VA 1J1UA 3S5JA 1W9MA 2BDEA 3DEAA 2WHPB 4ZTZB 2F8TA 3A4NA 1XU4A 4MRVA 1CS0A 1H8ED 1MX5A 3PR1A 3QKWA 5KSYA 5FOSA 4XQ9A 4RAOA 3V8NA 4BP8A 5ARDA 1SU6A 2VT3A 3QJGA 3OJEA 4HYTA 4WNAA 2BGKA 2V74B 3L0DA 3FR7A 1A27A 1CS0B 1PQ4A 3H8JA 3OTHA 4P3XA 4WXHA 2A9RA 2WUVA 4BNJA 4MYDA 3MYRA 1KEWA 5ALHA 4RLFA 3U5TA 2BFEA 3R40A 3IEVA 1LTKA 5I4BA 4JJFA 4LVUA 2PG3A 4GMFA 2C99A 3AX6A 4PANA 3N6RA 4WNAB 2IUEA 3K05A 4OUDB 3RTCA 3VHQA 2OG2A 5HR5A 2GN4A 4GR5A 4KP7A 3RVJA 4BQPA 2IV7A 5ISMA 2Z6QA 4NXNB 2EJBA 2OT3B 1Q7EA 4M1TA 2YZGA 2PUCA 2R7LA 2F00A 1BFUA 2JJYA 3CRZA 4YI3A 5KYVA 1O87A 1UPTA 3MWEA 5BRJA 5JMTA 4WOPA 1RP1A 3AINA 4BKMA 3CVVA 2UZ1A 3QV2A 8GPBA 1PR5A 3A2MA 5KNCA 5DI3A 2PSEA 2VPIA 1FQWA 1SC6A 1OASA 4JQCA 3QVKA 4R1LA 3ZYCA 1E0DA 1NNSA 2ERXA 4BB9A 4DSAA 1EP9A 2GEJA 4Y6LA 3ICCA 2OYCA 4YRZA 5HUQA 1VL2A 3TBKA 1CIVA 4EAQA 5LL6P 2WM9B 1CD5A 4I2VA 3TJMA 4MV9A 5AVSA 4V24A 4FI3F 4Z9AA 3EYAA 3R3YA 4NBSA 5GZ1A 1SBTA 5DI3B 1LDEA 3ZHYA 1UFRA 1JHRA 4A82A 1Y7PA 3QYAA 3W5IA 2ZVDA 1UC5B 3A7EA 1QTIA 1Y1PA 1JTEA 2H1RA 2CWWA 3ZDXB 1SUBA 4MIOA 5ALYA 3CEAA 3Q6IA 3SLKA 1GZSA 1L5QA 1JDBB 2QAGC 3IVMA 4BCCA 3B85A 2DFNA 3U4IA 1G9XA 2OYRA 1E7YA 2REOA 4G0OA 1U2QA 1CULC 1U65A 4DM4A 1GPJA 2EZ4A 1APBA 3JPYA 4II3A 1LSJA 2JB9A 4MVYA 3FHLA 4FSDA 2ZJAA 1KBQA 5EINA 2QW8A 5G1PA 4C1NA 1WKBA 4NU8X 4TZKA 2L2QA 4XE5A 1QX3A 4CM9A 4B2LA 1KH3A 1M34A 3O95A 4OG2A 4REOA 4N7BA 1BJRE 4S35A 1OYVA 4JL6A 2BEKA 3VTFA 3ZVRA 2O59A 1T8SA 3H2YA 4BN0A 4YEDA 3N3AC 1PL7A 2OLKA 3ZX4A 1C9MA 1Q0UA 2WU4A 4GYJA 3WBFA 1X3SA 3A6DA 1JH9A 1J56A 1RTKA 1J2JA 1KJQA 1M34B 1TQ2A 2R86A 3FFXA 3LPMA 1U5CA 1SVKA 2I3BA 2NTEA 4LY3A 5JW6A 2O4UX 1GUDA 3A37A 5JNSA 2WZBA 1ZI6A 2IEZA 1YB6A 3PFHA 1EE2A 4JJ6A 5K7SA 5G41A 2F67A 1V16A 3HUTA 4LSGA 1Q92A 5LMNB 4IDCA 3AKEA 3D59A 1RC0A 3L7LA 3MUFA 4CCSA 3VPHA 3PA6A 3MCAA 3SK0A 1JHUA 3CPJB 2RIRA 1NDQA 4P3KA 3OZFA 1KK1A 2PH5A 4JY7A 2CLOB 4R1TA 3EUAA 3JPWA 1K5PA 1O8BA 1XALA 3R5FA 3FNFA 4HQOA 1E3SA 2OFXA 2P7IA 4TTAA 1FRNA 1VKOA 1W4AA 4WK0B 5DW0A 1QKIA 1A8IA 2NP6A 2A14A 1Y0BA 2WYIA 3VKGA 4B43A 3R0VA 1WDKA 3KRTA 4W99A 3PXBA 2GEDA 4AZ0B 5DT9A 4GZ5A 5GJVC 4FOOA 3F46A 1NX9A 5TVGA 1F06A 3KFLA 1FSZA 1QH1B 3SBOA 4YRNA 1G5QA 1YS6A 3SYTA 1JPNA 2VZ9A 3QELA 3WYEA 4R2HA 1Q11A 2O3RA 2ZEJA 3OJXA 2QYOA 3PNPA 1RQPA 1W85A 3F74A 3IAS6 3USES 1UBFA 4E7PA 2VCYA 1P3JA 4ZDIA 4MV1A 1H93A 2V4MA 5IRCD 2QTHA 4LV6A 2X6RA 3NATA 1J99A 2W6PA 1WZ2A 2D6FA 3QELB 4B3IA 1EDOA 3PVSA 1NMEA 1AD2A 1RWPA 1XMJA 3QKSA 1W85B 4IDNA 2G25A 1OXBB 4K1LA 3MRTA 3BAFA 1JHDA 3PC6A 3PFKA 1GSOA 1DPFA 1N1DA 1L6IA 1WULS 2RC5A 2VJLA 1N2IA 2PX0A 2W6QA 4JROA 2NMVA 3HEAA 3G59A 2LCQA 2HMUA 1Y9JA 5ESXA 3M5PA 1TMYA 5GGXA 2WHEA 3QKSB 5BNZA 1M0TA 2OM6A 4HYYA 1UFVA 4WW0A 5KVQA 3AERA 2X7JA 2I6SA 4N9QA 5DVZA 3NBUA 1Y3BE 3H2HA 1UPFA 1QC5A 4MPPA 3OQHA 1PJQA 4OTZA 4BLTA 5GV8A 1L7DA 2B2NA 3HCRA 4WL0A 2DB3A 1AN9A 4NZPA 3ER9A 1UKYA 1V8PA 2A59A 1D2RA 4MDFA 3TMKA 1KE2A 5IULC 1NVTA 2ODQA 1H2BA 2BFFA 3Q1KA 2NNLD 2QN9A 4IWXA 4MUGA 1FMCA 1U28C 3NFYA 3AM1A 4JENA 1OZGA 4MB2A 2GI4A 3AUFA 4GWKA 3NW9A 3UJ8A 3IVXA 4ZO7A 4MAFA 4XFKA 4F9TA 4LXUA 1RYDA 4CMIA 1A5TA 1MN6A 4GL2A 2NZYA 4EELA 1JMVA 2AC4A 4DDUA 2NU7A 4ZYTA 4QXPA 2BFFB 2QJFA 1L0BA 5DTJA 5LDGA 5IBRA 4ZZIA 1QORA 4E13A 1T4CB 5HIJA 2HSDA 4KXLA 4B3DA 3IP5A 4QUHA 1Z5OA 4QSMA 2X15A 4C0SA 1J0XO 1ZJWA 4QM6A 1FRZA 3WP0A 1OTYA 4CMIB 4BKUA 1F8YA 2ONJA 4CJXA 4CN9A 2QK4A 2C31A 2Q1TA 2NU7B 3PIRA 4MKRA 3ZEIA 4M7PA 5EP1A 4UTVA 2BEUB 5HBRA 1N5LA 1USIA 3P5SA 4KN5A 3WTBA 3BAZA 3O8RA 4AJKA 3PGXA 4CU2A 2DERA 2JFUA 1IY8A 3SICE 4RWZA 1LV8A 3I64A 3X1MA 4K9QA 3TQHA 3NM5A 3WHLA 1QM5A 1S2OA 2P4EA 3DDCA 3QUQA 1D3AA 2B36A 4JGGA 4PX9A 3SX0A 5HXAA 2B99A 3IQDB 2BMVA 3ZXXA 5JOQA 3K5HA 2BGUA 1U0BB 1EGQA 1RMQA 2WJAA 2EW2A 3UV3A 4ZIRA 4RVCA 2V7XA 4KUGA 1KPGA 3WWEA 4FKZA 1R6VA 3OQVA 5C32A 3AK4A 5IKOA 5LU9A 4WK2B 1TUBA 4W63A 2ZXUA 4MZXA 4PSUA 1CR0A 4GYWA 4O8ZA 2JEYA 3UMCA 3M4XA 4ZIRB 4FYVA 2ZSEA 3CUEF 2OLEA 3HB0A 2FPMA 3UA4A 2NUTA 5LZ2A 4ZODA 2XGMA 1QZZA 1EJ2A 3GJXC 1J2YA 1PR1A 2HWYA 1QFZA 4UUMA 3WIVA 2EATA 2LKCA 1JAHA 4M98A 1R0YA 1V4NA 2NUTB 4MUYA 1AQYA 3RVRA 3U4AA 4KJXA 5TVKA 5I8PA 3N8NA 2P2YA 5CNKA 1EP1B 1NLFA 1Y7LA 2ZULA 3BZWA 4M49A 3M1AA 4C7XA 1ODLA 3ZWPA 3HMQA 4BEVA 1U1IA 2HCTA 3Q41A 4FMBB 4Y18A 4ZEXA 3CBGA 2HF7A 4C5CA 1YUBA 4M0CA 1A8HA 1W29A 1DDIA 3B5EA 3MWKA 2EU8A 1XZBA 1A82A 2ZTMA 3QV1A 5KNDH 1XTUA 2D1QA 4GI5A 4KAXA 1H5QA 1LNQA 1PRYA 2C07A 2D5CA 1C3JA 2RHGB 2XADA 3G49A 5JHGB 5JASA 2WV7A 2TMGA 1J22A 4JQYA 3TLMA 5B3KA 3CHYA 1I1HA 2J3LA 4G5GA 4WLVA 1USUA 3UN1A 1JBQA 3H83A 4PSDA 1Y5MA 8AT1A 3QXXA 3P9RA 4LQDA 4M8IA 4I1PA 2ZRPA 1PGNA 4AX4A 3HACA 2E21A 1E5DA 1L5VA 1PYOA 3BCUA 4AMVA 2CHUA 1VP3A 1R64A 2R60A 3H4IA 3H97A 1QCCA 4HEJA 2Q2NA 1MX9A 2HIHA 3L8HA 2QZZA 3KUKA 2DPXA 3OKAA 3HYNA 4L75A 1V6SA 2WMNB 5IM5A 4C4SA 4AT1A 2HRBA 2AG6A 3LC1O 3QUTA 4Y2UA 3PK0A 2AEMA 3I45A 5KZMB 4MICA 1PFGA 3IOEA 3Q7TA 1EXWA 1ZISA 2PQ6A 1W0KD 4U2BA 5FJIA 3RDPA 2HLDA 4ZXFA 2Q2OA 4GMHA 3WL5A 1ZIDA 2RB5A 4PGMA 5AHXA 5CXUA 5EJ9A 2NSDA 3IUEA 5THQA 5D86A 3NS7A 4JITA 2O05A 3GJ7A 1ONOA 3ZD9A 3V97A 2PKRA 4GX2A 2QL6A 3F96A 1AZTA 3S6JA 1FUYB 3DOEA 3U7QA 3TVYA 3IRVA 4WJLA 4D9HA 4XGIA 2IWRA 1PKXA 3ZU3A 2LW7A 3V5NA 3TPZA 4MPJA 5HQ3A 3UOAB 1I1NA 3CH4B 4DXAA 3DKRA 5LSAA 1XNHA 2EAUA 3H87A 3LLSA 2D7DA 3VDMA 1X9IA 1RAFA 2XVMA 1E2MA 1WB6A 1KJ9A 3NTQA 1Q7GA 3GZJA 3GFQA 2C4UA 3GN2A 3JWIA 2Y0BA 2VSFA 3NIBA 3K5IA 5HQ3B 2I91A 3KIPA 4RKWA 3DZ8A 2PQMA 4K9SA 4BX9A 4YRSA 2MSDB 3TLBA 1IHXA 1TQ4A 1FX0A 1XQ6A 4YCDA 3IR6A 3H1FA 3IL2A 2DY0A 2I9KA 4UMVA 5TSDA 1NBWB 1MJGA 1UKEA 3CV3A 4R2MA 3TZQA 3PWKA 5JRJA 3VZSA 1QMGA 2QN6A 1W2HA 3FCCA 2ZB4A 1S1CA 1JKJA 5CNJA 1I7QB 3BUSA 1FX0B 1HLFA 5HCNA 2WG2A 3HZOA 1KI9A 4WZ6A 5AHRA 2LPMA 3OPQA 5BP7A 4YJDA 3JSXA 2OQIA 4HEQA 4X1KA 1E60A 1QV6A 2BDTA 1VHTA 3DLBA 1Q19A 1JKJB 3HUEA 1R3DA 1PHRA 1VHQA 2C9OA 3ED5A 4CZ2A 5CDSA 1C7EA 3VNAA 4LJ6A 1COWD 5AUQA 2FPPB 1XJ0A 4X1KB 3OTQA 1KGDA 2FUG6 1E9DA 2O8NA 3OE1A 1J6UA 3KALA 2EARA 4HLNA 3D6VA 2GM3A 2ZTSA 4P5DA 2GO7A 4FJ1A 3SYKA 4BEWA 5JWOA 2IU3A 1YDWA 2WU1A 3E9CA 4DIDA 5ADVA 2AX3A 3AXTA 1FQOA 3K0EA 5D1HA 1B14A 5DULA 3L1JA 5JZ9A 3CKYA 4NX2A 1IQPA 4EWLA 4W9MC 3LUGA 3UMSA 1GL6A 2WJ3A 1P80A 3IDFA 4XJSA 5TRTA 3FYUA 4ZZ0A 3TQSA 2XMBA 1O94C 1EVYA 3E1GA 4UNQA 3K70D 4C3OB 3JALA 1OX5A 3EDOA 1VJ1A 2M1XA 3WOVA 1I7NA 3DF7A 5KYWA 2D4HA 3QFCA 3O75A 5P21A 1U3UA 3JQRA 1IN6A 1PJ8A 1QYCA 1YZTA 2C3OA 4K26A 3FYUB 4D02A 1A97A 4BP9A 1GYPA 4P3NA 2CT8A 1CIJA 4NONA 2G9RA 4P4SA 4N0PA 5HF8A 2XQKA 2QIOA 2R1TB 2P5SA 4E2FA 1FTSA 1M6YA 2PX6A 3LZDA 3VMFA 2I6QA 4Q9DA 4F7DA 4W9NA 3IKTA 4EPYA 2IY8A 1SD5A 3LCMA 3MWGA 4N8EA 5I8WA 3PP8A 1F20A 3DTVA 1IL0A 3GRZA 4NBLA 2GR9A 4BYGA 3C3PA 2WSMA 3FROA 5FUVA 3RS9A 5JZSA 1MJFA 3MT8A 3GAAA 4H2DA 1CR1A 1HORA 3KEGA 4JGIA 1YZGA 1LLUA 1NXXA 2QTAA 4ZVKA 5AKEA 4CQMB 4DGSA 3ZU4A 4F6RA 1QAMA 1BDMA 2NYUA 1LRJA 2P8JA 2XVYA 3KAJA 3KXKA 4HMOA 4JIGA 4QG3A 1OXTA 5JFGA 4QJ5A 4XVUA 1JG3A 3DTVB 3FGZA 3TCXB 1I3LA 1Y4SA 2VYQA 3TMYA 3L92A 3QSYA 3IVRA 1YL6A 1VE6A 2QW1A 2Q0QA 4RKEA 4UEWA 3SXPA 4BWYA 2WE8A 3OC0A 4B81A 3ZGNA 3C7CB 3J80A 1URPA 4HTAA 2CVHA 3FWZA 5HSGA 2V59A 1MD9A 2EG5A 1RRCA 5J4YA 3Q85A 4YJ3A 2Y1DA 3TAHA 4H18A 2HY7A 1NU8A 4WGGA 2XQVA 3IKMB 3QXCA 4E5NA 5DTMA 4LEIA 2XDWA 3NHMA 2ZPUA 4RS3A 2OZPA 1ZK3A 3LVQE 5ALFA 3F6SA 2JIOA 1TJ3A 1ZRMA 2PA0A 5KNBH 1QHEA 4YJ3B 4K6KA 4R01A 2Q07A 1G8PA 3GEEA 3EZXA 4RENA 2X5JO 4LJ4A 4EX6A 1PZEA 5AI4A 3PQ7A 4I3FA 5C1OA 3DZCA 4KQKA 4EHLA 2O5RA 2PUJA 2XXJA 4RDCA 1XRLA 4RK6A 5AM4A 4MUEA 3OIVA 1A2KC 1TT5A 2D0DA 3E3OA 3JD2A 3UXYA 5CU7A 3CE6A 3ITKA 2IPLA 1ODFA 1DKNA 2VHUA 3OFNA 3Q12A 1I8TA 1GSIA 1GAXA 1I6MA 2YFQA 1DG1G 3IQZA 5FADA 1IEQA 1MBZA 3B6JA 4ZK2A 5A1JA 1UR5A 3FAZA 3KETA 3LWBA 1ZIYA 8OHMA 5IFLA 1TT5B 1KHHA 3ID6C 4YO7A 3OTWA 4BFCA 2X41A 1JIVA 2JFXA 4TROA 2DQZA 1MRSA 5IM4A 4MP3A 4D4HA 3D0KA 2ODPA 3ZE1B 1XTPA 3GVHA 4MV4A 4RFVA 2RB4A 2ZJZA 1U6IA 3TW6A 4XYMA 2VJPA 3D5QA 3NC4A 3NP9A 4JUFA 3VBCA 3RRJA 2GFQA 4JOCA 4PEVA 5NLLA 1Y6FA 4EKYA 1PEAA 1OA0A 1XQXA 3NORA 1F2VA 5EWLA 4XYLA 1REQA 2EX4A 3OJWA 5AXAA 4EHJA 5L4NA 3L4JA 2OGUA 3INGA 1Z5ZA 4W5TA 4X54A 2FHPA 3ZJVA 4FQ7A 2KQUA 1J4AA 1P2DA 2OOKA 3KOMA 4QFBA 4BB5A 1MJNA 3MWLA 2GGSA 1Q3TA 4G89A 2Y77A 4JP8A 3IV7A 4PX5A 5EWLB 2NWQA 4RANA 5BNWA 1RI3A 3JQBC 2WB4A 3Q5DA 3FNEA 3L6EA 1NBHA 1XFAA 1P5FA 5I51A 2VSYA 2P2GA 1HTWA 3OT5A 2FVXA 1JIQA 2Y68A 2ZUCA 4OLJA 4BO0A 1BQ4A 5BSFA 2BM9A 3K96A 3WWDA 4CG0A 2QBYA 4V2IA 5CYPA 2D0PB 5CA1A 3G5MA 2QEQA 1YQDA 1M1ZA 5EIEA 1ML4A 3GDWA 2RHOA 1F2UB 3WNCA 3TJZA 4B17A 4EL0A 1VKJA 4EABA 4L51A 2Q4DA 2C2GA 3ORFA 1YMQA 3A3YA 3HP4A 4IRXA 2DT8A 4U2DA 2PMFA 4FIZA 1G8GA 4IYJA 4XWGA 4Y6SA 3L0OA 5DDIP 3RIYA 5E8RA 3KV3O 2L17A 4DC1A 3GZ4A 2YOFA 2W8BA 3KVYA 2Q7OE 4RD4A 2PY6A 1BCRA 4EB8A 1Y89A 1GDDA 1FU8A 1RBQA 2A0FA 2FSVA 4CLHA 4U7HA 2DFTA 5A06A 2O2SA 2OCYC 3GBPA 4IS3A 1C81A 1QH0A 2E89A 1XZDA 2IY9A 3KDAA 4FC7A 4K8OA 3TQOA 3WP1B 1K0FA 1MJHA 3MEQA 3PZBA 4IOJA 2CXXA 1MZVA 4M9QA 4MZDA 4E08A 2ZSBA 3KS9A 1BCRB 3SQDA 1JR3A 3MILA 1TMGE 4OHRA 4IRUB 2QD2A 2BOVA 3UG7A 3BD7A 1FRVA 3BCHA 1CQWA 3ETHA 3JV7A 3OU2A 3LHFA 3DP7A 3I2HA 5EZ6B 3TTUA 1YDEA 4EEXA 4XUDA 2GXSA 1L7OA 2OMKA 4DS3A 4JP1A 1SZCA 4A5OA 2O52A 4EFLA 5B7GA 1T3LA 3B9QA 1GM5A 1QG6A 4HDNA 5BN5A 3W5DA 3CUKA 1AG9A 2BW0A 3IVCA 3FF1A 3JWPA 1U2EA 3OIGA 1K4KA 1SRQA 3CWQA 1NJGA 1M10A 1XZ8A 1ZMRA 4AMYA 1GNSA 1YB2A 3CF4G 3MMXA 3RC2A 2G28A 5BN5B 5CXSA 1XD9A 2Q0SA 1P73A 3L18A 1MHPA 4FCWA 1P77A 3LQ2A 4QOJA 2ILTA 2JAWA 1PG5A 3BH7A 3DXYA 4XUGB 2IYQA 4OREX 3WBKA 1E58A 2IZ0A 1O4WA 1Z7GA 2ZSUA 3AHHA 3QY9A 4TLDA 3LM8A 3LOQA 4QFDA 1PFVA 3E35A 1ODJA 3SKYA 3OF5A 1KR5A 3JVIA 3L8ZA 3CUSA 3ISJA 3PQ4A 4V0MA 3KQLA 2RG1A 4JKIA 3HCWA 1BXGB 1R5JA 4Q3LA 3EGWA 1FMTA 1DJPA 1HWYA 1P9LA 1ST3A 1UAYA 4LBYA 4MWOA 1Q7TA 2EEZA 3A9CA 5J40A 2B4KA 1V96A 3RC3A 4WJKB 1BEUB 3Q5GA 4FBLA 3LL4A 1E6EA 3THXA 4UM9B 3ADDA 3CLHA 3F6YA 5HMMA 4AJPA 3UAZA 4PQRA 4LECA 5BWCA 2IZOA 3QE9Y 2PH3A 3DW1X 2GCEA 2B61A 5JDCA 3EX7C 3DMTA 3BD9A 4H4EA 5HDBB 4YUVA 4CHTA 3QENA 2PXHA 4JP2A 4XA8A 3THXB 3RSHA 3KPWA 4UCQA 5A9SA 3GLSA 4X00A 9GPBA 2LXNA 1AB5A 3N75A 3WQHA 3TTTA 5TT0A 1KAGA 1CBUA 5AJYA 2HQRA 2WZQA 5E2AA 1TIKA 2HCBA 2C84A 3AB8A 3RS0A 1V9SA 4N76A 3ZGZA 2O2JA 5HKLA 2WHXA 2YMQA 2NX2A 3IIIA 5TXGA 3LPDA 1BGXT 3V1YA 5A9SB 1PYDA 1JIUA 2HLNA 4KEAA 1DPGA 2FVYA 5KJEA 4IGFA 4ALMA 1CETA 2YHBA 1XWIA 5JUWA 2OGZA 3L04A 3T3MB 1S6YA 2W0SA 3GUZA 2VUTA 1RBZA 1IBRA 1YS4A 1LQUA 2DU8A 1QQ6A 1Z17A 2V03A 4OHFA 1ZCBA 1K8YB 2W11A 4QUKA 4B46A 2RGNA 4ZDKA 1V7ZA 2OXEA 2YQ4A 3L7CA 3MUNA 2D0IA 1VYHA 4HZUA 3RSFA 2O23A 4XZ3A 2BH2A 2LUOA 1KY3A 2HMTA 3JYPA 2D4AA 1X1TA 3VC2A 4KLZA 5ALXA 4NQZA 1WVIA 4EMUA 3HFGA 3RUDA 2J30A 4EHBA 1U7OA 1EDBA 1G8YA 2PXCA 4INOA 4O2BA 2YJTD 5H83A 4EPXA 3QVGA 4YWJA 4OJYA 4NYJQ 1YA8A 4FS8A 5FQNA 4X41A 3OA0A 1P44A 1QG0A 4MAAA 1OXKB 1YAHA 2PL9A 1FNDA 1DB3A 3HI4A 3NNSA 4WZBE 4IFIA 3ITNA 4M1MA 1XZHA 3ECSA 2NSHA 3QVGB 5DLEA 4MPRA 4ARSA 3R3VA 3MCVA 5FBZA 2C78A 4IEFB 3N8KA 1E5QA 1E7QA 1Q6YA 4ND8A 3BDIA 1L7BA 1W4CA 2M2IA 2BDUA 5EP2A 3FPEA 3NANA 5JALA 4BGUA 5BURA 4RQBA 4QJ3A 1BOFA 4D5GA 2DECA 1ZUHA 2P75A 3ENWA 3ROQA 3LXMA 4EFMA 1G8FA 3T7DA 3DCJA 4ND8B 2CL0X 1ETHA 2NUPB 2PYZA 2NG1A 2SNIE 4FYHA 1VJRA 2QTVB 4QOSA 4UULA 3SQLA 1E1CA 2HWUA 1F9AA 1TZBA 2ECQA 3KLNA 3QFTA 1JMYA 3IP6A 1UBCA 1XE3A 4JNCA 4MXDA 4A0GA 2UYGA 1E4YA 1L7QA 2FPKA 3AR8A 4MJ3A 1C9YA 1H1TA 1LB1B 1RLMA 1WPRA 4EK9A 2I34A 1QVVA 2PBRA 4L8GA 3RUEA 3OOWA 4FIDA 2LWIA 5EE3A 5HM6A 1P4HA 3D8NA 10MHA 4H9GA 4HDOB 1E1CB 2FEKA 4I4LA 4XKJA 1L5OA 2AFIA 4PYQA 3TKLA 3Q11A 4Z2YA 1XGKA 3CX8A 5CVTA 2A84A 4D3XA 2R0QC 4C2AA 1DSSG 3HY3A 1YRQA 3TIGA 1KY5A 1QGYA 2GQ0A 3TRJA 4M60A 4B9AA 4R4JA 2QG9A 3PRKE 1F4LA 2NVUA 2AFIB 3RVKA 3KPJA 4RF5A 1X87A 3A4IA 3ZJ4A 3GNSA 1ZRHA 1YOBA 1YE5A 3A9RA 2DUUA 3JR3A 4MVJM 4AYXA 1OLUA 1V7PC 1O58A 4O3FA 4MWSA 1GKIA 2NVUB 2V0GA 3L1HA 5GAJA 2CFOA 2ZRCA 3C70A 3X1JA 1C2YA 2DQKA 1NNUA 3AJEA 1IB0A 1LRKA 1QYWA 4LX8A 4QICA 4U4AA 4WXPA 3TVDA 3WRWA 1IHUA 1FMLA 2C2ZA 3ZV4A 5K8LA 2ZUDA 1Y48E 2QLMA 2NNWB 2VO1A 5AW5A 3I01A 4G8CA 4MWCA 1OLUB 5E9QA 2C7BA 3N07A 4AG3A 2GH1A 1W9HA 4JU9A 2PLWA 4MYRA 4QUEA 2C5FA 4BMPB 1K5GA 3LFTA 4QJIA 5K6RA 5CLFA 2CFSA 1B0ZA 4QWWA 1ZAYA 1XTZA 1H4TA 1NULA 4PX3A 3GOQA 4TYYA 2YWDA 4Z0TA 3EODA 4DCUA 5FDFA 1FTWA 1FVFA 3CCCA 5CDFE 2C77A 3GRVA 4D9KA 4IP0A 1KZHA 1SG6A 1QLHA 1U9IA 5D7BA 4Z4GA 1KXJA 2GAFA 4KYUA 1E3JA 1TLFA 4Q93A 2XRFA 5KMGB 1AN0A 3TLAA 2H3HA 4KDRA 1WSWA 2WJHA 4L95C 2M6LA 1UDRA 1R18A 4M0UA 1S8AA 4Q4DA 4KSCA 1Z36A 1ADJA 3B9RA 1NUSA 5TV2A 3ZDFA 4LK2A 2UUOA 5IEBA 2HHJA 2G82A 2OVBA 1MA0A 4KX5A 2H5IA 3TYXA 3EPLA 1RXVA 4CL2A 4PINA 3UHAA 3RIHA 4U7WA 1RQRA 3BEDA 1WZNA 4CUJA 1P7ZA 2VNAA 1ZEJA 1U8YA 2BFAA 2WK1A 3C3BA 5KX5A 4IILA 4KWCA 3AHEA 4L9RA 5GM1A 3FGPA 1WZIA 2PX5A 5CTAA 4JDPA 4E09A 3UJNA 5ESDA 3JZDA 4I3GA 5FOXA 3DR5A 4CF7A 4KPEC 4CTKA 3M1IA 1S3FA 4AP6A 3RYTC 1XNGA 1XDUA 4UHCA 5ADUS 3AEZA 2H1LA 5KX5B 2VUSA 3R5HA 3RUHA 1XJ5A 1MV8A 1MKYA 3A36A 4N3AA 5CLHA 3TXYA 3VC7A 4JEHA 2A9FA 3HFRA 1U80A 3K1TA 4NNPA 4PZUA 2FE4A 4EHFA 3DO6A 1M74A 2H08A 4RESA 1OROA 1L8QA 2W2LD 2X2PA 3PKJA 5AM3A 3HM9A 3T7IA 1OILA 1TU3A 1EUDA 1M0WA 1OFVA 1OLSA 1K5HA 3GELA 2MWMA 3K9CA 3FLBA 4BBPA 1PL0A 3OHSX 4A0RA 2PUGA 2BUAA 2QTBA 2V0CA 3PCRB 1EE9A 4ERXA 2QJTA 5IHXA 1IH8A 3OQPA 4MWGA 1M8PA 3UFXA 3WLAA 1VDZA 1EUDB 1OLSB 3OF2A 4DB4A 1K7YA 3WLRA 3PDCA 4UUQA 2Z4SA 1R4AA 1Z8HA 3AWDA 1SGWA 1QPBA 5BSGA 2B8JA 2XTMA 5C1DA 1Y80A 1ORRA 1KO8A 3NHKA 4QYMA 4AJJA 5AH0A 3SJCA 5HCIA 3QU5A 5EPEA 1R9NA 3UFXB 1S8OA 2GESA 1RKVA 2VF2A 3OIWA 4JR1A 5AK3A 1EUQA 2VNKA 5M2QA 3MHPA 2MSLA 1OW3B 1J09A 3LPAA 3TKAA 2NZUG 3D3EA 4FKBA 2RSLA 1ZM2A 3F6PA 1N1EA 3USZA 3GLIA 3V2IA 2HGZA 1CZKA 5E3JA 3BN3A 3VH2A 2I54A 1W36C 1OWMA 3MGCA 4L8FA 3LVRE 3DBVO 2FUG1 2BBSA 3K9QO 4JUCA 1ZD1A 2GD2A 3T4UA 3KYBA 1VPTA 2CDBA 4LVOA 3GJ4A 3SBXA 3COJA 3ZV7A 4B3HA 4IZ6A 1U2DC 1S2GA 3MBOA 1N2GA 3D3KA 3WRXA 3SYMA 5K8JB 3FCUB 4C03A 1A3CA 1G5IA 3F2VA 3TEFA 2ATXA 1J8QA 1CP3A 4FDTA 4E15A 4JT9A 4YUYA 5J4HA 3MLAA 2A7XA 4E6EA 3ZHSA 5B53A 2F1OA 2PPVA 5BVHA 3TOXA 3C5WP 1TZKA 3UK6A 1JJIA 1ZA2A 1W0CA 4KL8S 16PKA 4DJDC 2QLJA 3VNRA 4IIXA 2RGWA 4LE1A 1D6MA 4CM7A 1XQYA 2VYNA 1H94A 2XUAA 3G8BA 3OECA 1EXNA 1PT6A 2HF2A 4GW3A 8MHTA 2X9NA 1SKAA 3LCRA 5BVHB 3QFRA 2WSSA 3BHJA 4R9SA 4DM7A 5FXMA 4TS1A 4Y9DA 3KXPA 5IDWA 3PC2A 2X6TA 2FFRA 1GCOA 2Z5FA 1CDEA 1Z0IA 1SO8A 1K08A 2BHRA 3O92A 3WK9A 2OQ2A 3SU8A 1UIMA 4CV2A 2JAHA 4BIIA 1VB3A 1W8DA 1GO2A 2Y76A 3GLFE 4XM2A 1ENYA 1K98A 1T1RA 1SMKA 3NXKA 1ODIA 1GGKA 4PHCA 3S81A 3DCYA 2VA9A 3RVLA 4G5SA 4ZI2A 1SCIA 2ZU0C 3A4TA 1U2TA 1P5ZB 1S96A 2CJXA 1E1MA 3PT5A 4N0MA 3WQSB 1U8TA 1DWOA 1E3MA 1KMHA 3Q7RA 3VZCA 3H5TA 1F2TA 3HNPA 2WPDD 4PG7A 4DLNA 1XZNA 4BLRA 1JQJC 5F1YA 4ZU1X 2E3JA 1NVWQ 1S4MA 4IVNA 1JLKA 1UMCA 4YS6A 5EMNA 3W1WA 3NM4A 4YAKA 3AVWA 1KMHB 5DM0A 4K40A 2XUFA 3SSOA 3FTQA 2OL4A 3RSLA 4BDTA 1UFKA 2IHJA 2B9EA 3GVXA 4NS4A 2I55A 2OQVA 4CLEA 4CDRA 5HRAA 4C05A 2A0KA 2REQB 2OBYA 4HFMA 3LG2A 5EIHA 3A6HA 4KXNA 4R2JA 3KP1A 3ZJUA 3EHDA 2VPXA 2YY7A 1F48A 2GZSA 3KAPA 3KQQA 3TI7A 1ULSA 2BL4A 3RASA 3H1BA 1NR5A 3KAKA 4EEZA 4NFYA 4Y9RA 3C8HA 5MN6A 3A2NA 4U9UA 2XNDD 1KJNA 5KKNB 4V2UA 4C4XA 3RVSA 1IN5A 4OGWA 4V0LA 1GPBA 4KQWA 2ZIUB 4ZVQA 3DYVA 2BMEA 1NQWA 4I8DA 2YMMA 1SQGA 2JJ1A 1DAMA 1FTYA 1AUOA 2G76A 4V03A 3FMPB 4XWYA 4B0OA 5JI3E 1NVBA 1JHXA 3FRJA 3P2EA 3CVUA 3T1YB 4YMWA 1KOLA 3LBFA 4FQ8A 1DBRA 1DUIA 2WTBA 2PYDA 3IJEB 4CIVA 4ECAA 5FB3A 1KQNA 1SK8A 2GVZC 2PMWB 1DOZA 4PZZA 3PTAA 4PC2A 1CZNA 4RPCA 1JEQA 1WZCA 4RY0A 1UMBA 4TMKA 5B7QA 3NDBB 3CZ4A 3UY4A 4TQUS 1C7ZA 4A03A 3L1IA 3OPYI 3FWNA 4N0EA 1GTVA 4HI0E 4BNLA 1PS9A 1U7UA 2R8OA 3ASYA 4X65B 3NBAA 2QOEA 2QX4A 1PWEA 2OV3A 5FPKA 2H7YA 1JEQB 4QOIA 3TUJC 3RODA 4RF4A 1QDEA 5DNCA 2BGGA 4B3RB 2ZXEA 3RK0A 3KEQA 3MOIA 3ZY6A 4HVAA 3GUCA 3EPPA 3HCNA 4MRRA 4D4KA 1MT3A 2IDMA 3EC2A 3A27A 3M0EA 5L3QA 2QV0A 2H5EA 1PDOA 3JD0A 4YTEA 4ZCPA 1K7FB 1FXUA 4NU0A 2R6R1 2V0NA 2DFLA 3BG5A 4J0DA 4EG4A 4WBSA 4OQNA 4ALNA 1L7XA 1N7HA 3OCVA 4C08A 5FWXA 4F06A 1Z9BA 4QODA 5DHFA 1W4RA 4C4OA 1Z13A 2IYVA 5L3QB 3G5AA 4X3PA 4NEQA 4ZWNA 2PXXA 1EP3B 1U8CB 4JP3A 4CNQA 5AXCA 3WKEA 5KQGA 2IYXA 5JPDA 1GTG1 2WYWA 4PZEA 2VHZA 5FWXB 1I1OA 5F21A 3PXEA 4C14A 1B6GA 1Z82A 5IUJC 1MX1A 3ORQA 4ZPJA 3V46A 4EFDA 2VNHA 3RSCA 3HBLA 4CM1A 3DDSA 3GNLA 1GU0A 3WMEA 4MKFA 5HE9A 5CB8A 3F6EX 4BQSA 2XOXA 1NF3A 2HQOA 4L85A 4YJHA 3GT4A 1VG1A 1KQOA 3CISA 3ST7A 1I7LA 1M5TA 2P78A 2ZYSA 4DV1B 3MAAC 4UC0A 1X7YA 2H9IA 1FFHA 5FWAA 3RHSA 1AS0A 1Y6ZA 3ZKWA 3A8TA 1PZHA 3PGA1 3O83A 2LIVA 2C2HA 3VU8A 3W06A 1HLDA 1NHGA 1WMBA 2DH5A 3U13A 4B7CA 5IJ0B 5IXYA 1HQYE 4LYEA 3ZLUA 4YJHB 3V1UA 5AXBA 2VATA 2P6OA 3O7MA 3K2QA 4OH7A 2Y05A 5IAOA 1PR9A 3P32A 4F3TA 3ZKWB 1JAZA 3CVJA 4HWRA 4HDCA 2Z3VA 4MV5A 3L8FA 2IFTA 3GB9A 4RIFA 4HAZA 2ZJ5A 4RY9A 2G1JA 2FWJA 5GP1A 5L40A 1R4MB 4K2AA 3ZQJA 2GNOA 4GEKA 4PZ0A 3D4IA 1CNFA 3ZW9A 5B1EA 4DIMA 1KEKA 4I1SA 2OP0A 4PZ9A 5BWNA 1Z83A 2HJVA 2ZCVA 3ZNOA 5K45A 3GP5A 1M75A 3LS2A 1IEWA 3T3IA 2XXAA 1DL5A 5EEHA 4CFSA 4E51A 1II9A 2Y27A 1O9HA 2WU0A 1T13A 2H7VA 1VKZA 5A1TA 3TZ6A 3G7SA 3NC1C 3SF0A 3PD7A 4F11A 5LP6A 1LGYA 1D4ZA 2GEFA 1QIHA 2JK0A 3VPAA 5HTOA 3RU3A 2ZUVA 2XXAB 4DCVA 1EVZA 1X13A 2EJVA 4WWHA 2IYSA 1B7GO 1T25A 1Q74A 5FAXA 3ZZ0A 3TZBA 3TUZC 4X20A 3RJZA 2XCIA 4AX8A 1L5SA 4CTOA 1PJBA 1ZFNA 4IV5A 2D3WA 3A9WA 2AVDA 1TLTA 2BGIA 1NBIA 1BYUA 2ZJ7A 1VMIA 4HS4A 4OEHA 1ZNXA 4XPIA 3TH5A 4BZWA 3H75A 1T15A 2X23A 4EUEA 2DLCX 5DYWA 1VLJA 3HCDA 3Q40A 1RRKA 4CE6A 5J1SB 1TKAA 4NDNE 4C4ZA 4HNRA 1KDVA 4X20B 2JNWA 4IHAA 2YICA 4TV8B 4CYMA 3PWZA 2J9ZB 2WLSA 3ROZA 3ZWYA 2C04A 3PFBA 4GAEA 4FINA 4GM4A 4UVDA 1U9ZA 1JG1A 2JA2A 4X6UA 2IV3A 3VM6A 4I6GA 3ZV6A 3M7IA 1Y63A 4PYLA 4WEOA 4KQXA 1BHQ1 5C7IO 1N1GA 4Y0VA 2IS1A 5B1HA 3DONA 2XWPA 2GZMA 3L7JA 4WKPA 4EJSA 5IC5A 1M8KA 3ENZA 2RAPA 3S5UA 4YB8A 4NZ9A 3VVBA 4ZGGA 4B40A 2BAGA 4BFTA 1W5TA 4OGKA 2IKQA 1SXJE 2NT3A 1D1TA 3C5EA 2DKOA 2H2IA 4U2GA 4LSMA 2JIBA 1H85A 3AI3A 4FFPA 4EJSB 4I5GA 1X80A 3OOYA 4NARA 3ZTTA 1G98A 1HZZA 4TWIA 2FZCA 2NVBA 1XHFA 2HDHA 2QUAA 5H70A 3ADOA 5EZSA 1WW8A 2IYWA 2B4YA 5L6LB 1NRWA 3PUWA 4GUAA 2Y1WA 3IT3A 3W2TA 1X80B 3JXEA 5DHQA 2XSZA 5IN5A 1E3TA 3UFBA 1W5SA 4O4HA 3S2IA 4DUZB 1NP6A 4XEHA 3ANMA 5I6DA 1SEPA 2R8RA 4WBNF 4KRGA 3KXDA 4ID9A 5LPNA 5B36A 4FXOA 4U8GA 5EHGA 2VJQA 2VF4X 1IWOA 1EFDN 2MYPA 1O6CA 1CKEA 3H5IA 5D3ZA 5KNCH 3NQ41 2UZ3A 3OSZA 4KO2S 4GRAA 4O4HB 1UJ6A 1SXHA 2EC5A 1D8TA 2XBUA 3ONVA 1D2GA 3GJSA 1E3EA 1O94D 3PKIA 4G0UA 1YR8A 3B2EA 1G8HA 2BZGA 4D3SA 1NRXA 2O8BA 2JH3A 1AK2A 3EW9A 4AZTA 1W0JA 2Y0EA 5B3LA 3Q8MA 1ZWLA 2HSJA 3K1JA 4Q7JB 4W5OA 2FV8A 1YGYA 1OE0A 5KINB 1UK8A 3N53A 5EKSA 3EIHA 4KIGA 2ZVJA 3FPBA 5L3SA 2QVCA 2V3WA 4MINA 4DIOA 4KSBA 3MGAA 1TYCA 3BORA 4CN8A 1HLPA 1Y1RA 3WQRA 3M3HA 4NKRA 1YFJA 4K87A 5E8JA 3S1LA 4X8MA 4Y6OA 1IZ9A 4GRDA 1NOKA 3OG9A 2PTHA 5L3SB 3HB4X 1P75A 2XF8A 3PPXA 3UGJA 1JEDA 2AL7A 4HQKA 4P2BA 3HGQA 2P4SA 5MN4A 1VSUA 2IVFA 1E9SA 1DO8A 1B16A 1U7PA 2QZ4A 2VDQB 3CJQA 3ND5A 5I9BA 4AS3A 1FDTA 3EVZA 5A4AA 2H4HA 1BWRA 1BXRA 5EP3A 1U0GA 3ENNA 4AULA 3QW4B 3N86A 1PBNA 2GPSA 5HF5A 3INTA 1UOPA 4DJAA 3L1KA 1CCWA 4LHSA 1BXRB 2CL5A 3I8XA 5A4IS 1KI8A 4RPGA 2EJUA 1Z18A 5HKKD 2AZMA 1SBYA 3S2FA 1RI1A 4NL4H 5KOJA 5FPPA 1QFXA 1VKNA 4ZCLA 1VLZA 5JNTA 1ZESA 4GL4A 3G5UA 2Q29A 1KL7A 3HFJA 5ITZB 2G4CA 4PLZA 5IYZA 1VGRA 3HXKA 3A1WA 2JBHA 2SCUA 4PLTA 2RDMA 1SZPA 1OXUA 1KRHA 3OEHD 1YGPA 4UKDA 1NPTO 2HRQA 4Q48A 3KG2A 4QUBA 4ESEA 2IXBA 4QAJA 5G4KA 5AW2A 1YNOA 1JWAB 1Z88A 1DG9A 4CMEC 5IYZB 3DYIA 1FFBA 4QTUB 2SCUB 4HXFB 1C7RA 4DL9A 4O2AA 1CLUA 1YZVA 1KH2A 1RVV1 3LHDA 2O8CA 1KZ7B 2JI4A 2HNKA 4PVDA 3N2IA 1R5OA 2BFDA 2BIFA 5ALZA 3PUXA 4FHEA 5G4KB 4O29A 4UU8A 2P3OA 2I4MA 4WCFB 1PR3A 2PEZA 1KU0A 3WXMA 2B3DA 2HN9A 3FUWA 3AGPA 3NGXA 3S3TA 4O2AB 1UM8A 4CQLA 2Q28A 5LMUB 2O8CB 3TFWA 1PLLA 1XZCA 2FP4B 3GA0A 3I5AA 4XX1A 1B3BA 1XTVA 5HF6A 2FFBA 5IN4A 5F33A 2GBGA 1P0MA 2XUOA 3KYDA 1X7XB 3QEMA 3V8PA 2EBFX 1DJNA 4FGJA 2HA6A 3N39C 2PUFA 3L0BA 3PQFA 4G84A 3ZW7A 5FJJA 4EKNB 3DUWA 1JSXA 1UKZA 1KJWA 2HJSA 1GLNA 1GWNA 3QEMB 2P4HX 2VHCA 4JELA 2I2CA 4L6AA 1N2OA 1WNTA 2DQYA 2ZOSA 1Z25A 2ZIEA 2EWMA 3A3KA 3FN4A 3L7BA 4X90A 3FR8A 3WSWA 1XDZA 1ZJYA 2ZAGA 3PYXA 4EGJA 1E2LA 1BEZA 4KGVA 3JQFC 1M2GA 3LO5A 1OI2A 3L7AA 3PD1A 4KIJA 4TXJA 4AKTA 4EI9A 1LF5A 1U3CA 2PGJA 3QE4A 4PPNA 3QEBZ 1T1EA 4WINA 4XGRA 1BS2A 1U8AA 2BCGY 2VSNA 4KO1S 1NUQA 3UVEA 5AJVB 3IOYA 5CT4A 3IAFA 4FP9A 4B6PA 3AOEC 5LYJF 1CX9B 1UCFA 2AYZA 1I4OA 1R10A 2CYBA 3N87A 4ZYLA 1U0OC 3AV0B 3GUYA 2JZCA 4K46A 5EZ5A 4O33A 2OCPA 3A28A 3LY9A 1YZHA 2H1VA 3MNFA 4DUGA 4JLUA 3GRRA 3BIWA 4UBLA 5AICA 4BE9A 2CLCX 2CDNA 4Y2QA 5KSWB 4EIWA 3DE1X 3W8RA 5TB5A 3VOBA 1V7QA 5AKXA 3UHFA 4IXNA 1Z5VA 1F2DA 4F5WA 4ARAA 3TE6A 1E20A 2X4LA 3KZKA 2IHNA 4A6EA 2EEPA 2P1DA 4GZ6A 1W59A 2DQ4A 3UBMA 3P52A 1O5TA 4CIDA 1XNQB 1SCBA 3H3FA 1HDGO 2IUUA 2B98A 5AVTA 2V3CC 1WF6A 2VNSA 1TEVA 4XJVA 3G13A 1OYWA 3JQDA 3PXXA 4TKMA 1YBMA 3AKDA 3U48A 3IJ5A 3QGMA 2J0SA 2ZZKA 1T0IA 2P3SA 1GRNA 1E5XA 3GLQA 2PUVA 1YJ5A 4Y1RA 4GOND 4FB5A 1C7IA 5ILQA 3GX1A 1YR3A 1R6XA 3Q15C 3LBAA 3EMKA 5ER6A 4TMTA 5LYYA 3LH5A 5PNTA 2OP1A 3DP9A 5J3JA 2O5CA 1P4SA 3W2HA 2VDLB 4JYZA 3WDSA 3IAXA 2QMHA 4Y1RB 2D7JA 1VSVA 4XPZA 4DV5B 2J07A 2NXEA 2BKLA 3H17A 3KSUA 5HF9A 4NJEA 4DYDA 1BDHA 4IDFA 1QWSA 5M34A 4ODIA 3TBHA 1G64A 2PKXA 4PN7A 2H63A 5M29A 4TM8A 1NGSA 3CH5A 4G07A 5B2ZA 4JLDA 4H6PA 4YCLA 3LMKA 1GPLA 4IAOA 4NJEB 3UJ6A 1EM6A 1V45E 5M7EA 4KYTA 5AQEA 3AEXA 3JATB 3ZQKA 3BMQB 1U0JA 1P5RA 1NVVQ 2V7BA 5KWSA 4JBGA 1YR6A 4KITB 2KW5A 3QLUA 4L78A 3GFFA 5EUBA 4Q3OA 1WXEA 1R4ZA 4J6EA 4NE2A 3QBVA 5E7MA 3TIVA 3CZPA 3ZWQA 2QYSA 3WTCA 4TQAA 4WUTA 3ZEAA 2OCBA 1IXSB 2XMRA 2I4LA 2Q9AA 1EBFA 3B89A 3TO5A 2ORVA 4ZJUA 1ZH0A 3JQ9A 4FHCA 3UCXA 3LA8A 4BGEA 1FEZA 1RI4A 3DDZX 4KUEA 3DLAA 3UUWA 3EMDA 3Q9UA 5EIBC 1HDEA 3E9QA 4Q1AA 5FUXA 5E4TA 2H9YA 1TEXA 4MROA 4RH1A 4ZC8A 1I5RA 5KU1A 1FUUA 1Q15A 2PO5A 4GZMA 3UAYA 3PC8C 1U9CA 3FX2A 3BCRA 2FEOA 5CVJA 3WIDA 3LX6A 4YRMA 1KAMA 2H2AA 2H4JA 2Z56A 3EA0A 3K4QA 3QWAA 4BFUA 4CDNA 1XQVA 5CDHA 1N3IA 1T24A 1YVDA 2AQIA 2I2AA 1YIDA 3IYLW 1A04A 2Z8XA 4DVGA 3J81k 2Z6VA 4MYCA 1WY7A 3T4XA 5A03A 1ZGAA 4F21A 4HHEA 3CN9A 2D5IA 2ORED 1U8ZA 3WRYC 4KPUA 1IFXA 2AK3A 3IAAA 3KFVA 3OKPA 4J29A 4LXXA 3EY4A 5TNXA 3RI3A 3WYNA 4BFLA 3WGVA 4PLYA 3QPDA 3C3JA 4ZAWA 3KQUA 1V9CA 3EE6A 1N8TA 1UEIA 3B70A 1E0JA 1CR2A 4BRSA 1VBFA 1XRMA 1JHMA 2VUUA 3GD5A 4KPUB 1OHHA 2YL2A 3HDHA 3MJDA 2JAOA 4P32A 4UUBA 4W8GA 4X95A 5DHPA 1A0OA 1WUTA 1CV2A 1I4EB 4HWKA 3PDWA 4DV7B 4Q1DA 1L5ZA 4CT5A 5IZCA 3A58B 3N59A 2WA1A 1WLYA 3IDZA 5IZ4A 1XTKA 4TSFD 3L4BA 4HATA 1KRWA 2OPBA 2IYZA 4G4GA 3T3EA 3G1WA 1CJMA 3VVCA 1MNQA 3HBFA 5HK9A 2VEDA 1FSFA 1S3SA 5LXTA 1DC6A 3IB6A 4G4IA 3HVHA 4UFPA 1JQAA 3VHLB 3L6DA 4P83A 5JSZB 2FQYA 1EM8A 1EUCA 4KPFC 3D5TA 3DYBA 1L4UA 2VHXA 3F3MA 3OKCA 1DVRA 2B7CA 1Z33A 2GUWA 3GGCA 1P1HA 1NY6A 2Y3IA 5LXTB 2Q6LA 2Q3CA 3QEAZ 4BPBA 1IHPA 1SOVA 1XA0A 5B6PA 2X6QA 4XB1A 4C3UA 3KKPA 4OF4A 3DKVA 1PT8A 1EM8B 1EUCB 4TQGA 3I9V6 3QIAA 3FVWA 2VZLA 3GLKA 3SM3A 4ZOCA 4DMKA 4F97A 2BP7A 5C2JB 2Z8YM 2XD9A 1BGWA 3H42B 4KQJA 4ZCSA 4CG3A 2AT1A 1EFTA 1YBHA 1AKQA 4M7WA 2J9YB 5CT6A 1X15A 1E7RA 4YCCA 3BGWA 2CMKA 1Q6ZA 1W88A 1N0WA 3UA3A 3AFOA 2BP7B 3SGLA 2VC2B 1D9XA 3HS3A 4IDAA 2VHEA 1C3VA 1CW2B 3IHKA 2N3ZA 2ZI4A 1YB1A 3M6FA 4PC3A 4RPHA 3WIUA 1ZCAA 1W88B 3O8BA 4NYJR 2JJQA 3CX4A 3V1KA 4MP8A 4BASA 2HXGA 1QU3A 3AF6A 4U6QA 1P1KA 1ZGCA 4Q4AA 1XJQA 3W1EA 1RQLA 4H1HA 1WE2A 4AYTA 1H2AS 2OR3A 3S0JA 2Y0CA 4R51A 4YJGA 2QQ0A 3FDXA 1Z0KA 3CGWA 3K32A 4EARA 4U9HS 4B80A 4V1CA 1J1IA 1NW4A 4D4GA 1LJ8A 1WP4A 1K7XB 2FPWA 4ZJYA 2W2KA 1AUVA 4Q4AB 5CG1A 5KTRA 4JASB 3BE4A 4L76A 2JH8A 1CLEA 2QQGA 5KHOC 1LPSA 1GGHA 1OBOA 3UIEA 4DWJA 3LY7A 3R3JA 2BFBB 1IHDA 4OIMA 5JNRA 4MV8A 1ISFA 2G88A 5I3ZA 5K99A 4CKZA 2W2KB 1P2TA 3KKEA 4ZXPA 2DHRA 3TI9A 2CVOA 2JJ2A 1DJMA 5F12A 1R6DA 2CJPA 2DF8A 3HKDA 1S2MA 2AK2A 5K0JA 1SA0A 5I7SA 1ORDA 3S1AA 1CUBA 2QP9X 5JLJA 1WXGA 3R7SA 4BMVA 1C5KA 1MRZA 3GQVA 3NOOA 1SKQA 3FHJA 4OBXA 3NNDA 4U63A 3MPOA 3CUTA 5DGHA 5EAIA 3C4VA 3K0CA 2YASA 4IJ5A 3VVMA 4OHOA 1EX7A 5K3EA 3HKDB 2WUGA 4Q4CA 1D6NA 3GQBA 3JYLA 4N0QA 1SA0B 2Y93A 3GP3A 3S1AB 5FF9A 3T1VA 1MZPA 2W2NA 4L3VA 1AUXA 3VTKA 4URXR 4P58A 4MCAA 5TARA 5BSHA 1MW9X 3NHSA 4BQNA 1RD4A 3D6AA 3H0EA 3UPDA 4NBVA 2FMTA 2J31A 3N2ZB 3GQBB 4UFOA 3H86A 2A5YB 3U3ZA 1YONA 2I8CA 4OU5A 1NW3A 2FPIB 4JUAA 3OQ1A 4RNDB 4MRPA 5CGZA 4PS0A 1KTVA 1PW7A 3QKRA 3DAGA 4WD3A 4ZVRA 5EJMA 2F8LA 4GVXA 4HN4B 2WIFA 5P8WA 4D3FA 2ZYIA 3AIMA 4C0BA 1BH2A 2WNHA 4DLBA 1KPHA 1QCYA 2OLJA 3EYWA 4Y6GB 2FETA 4D0GA 3MWJA 3V48A 4BMNA 1DKQA 4BVGA 2ZS7A 4L5IA 4EW1A 4PV7A 3QKRB 4DMRA 3N6VA 1UFOA 3ACCA 2M98A 4MRAA 4J7XA 3PXAA 4MLZA 4ONEA 3VR2D 3I8SA 1Q3HA 3TQCA 4B84A 4YRGA 1IQ0A 2DHQA 2X1MA 3HGMA 1ATZA 3GUVA 3CW2A 3W4IA 5ALIA 2OZLA 2AUTA 2ASEA 1B3RA 2H5LA 3SFZA 2IHKA 4ALKA 1ACLA 1CG6A 1YDGA 4YRBA 1X1QA 1LI7A 5ED0A 4EKIA 3G1UA 4LHVA 2GYUA 4D6YA 2A5LA 3LP5A 3FUXA 2VT6A 4D9MA 3RNLA 4CBVA 1BJKA 2I29A 3NZEA 2VJNA 2GPWA 1XCGB 2BKEA 1G6OA 3R9KA 1NJ1A 1H4QA 1SCQA 2AWOA 1D5WA 4UMEA 1O77A 4PLGA 1GCUA 5DHUA 1OH7A 5COAA 1UDWA 1VJCA 2BMFA 2DR2A 4KWTA 3O1IC 1HL7A 4ZZ1A 2AA3A 5JBQA 3PEYA 4Y2TA 2VYVD 2Q5FA 5EJ5A 5JZOA 2AMYA 3AF3A 2AZDA 2Q4BA 3PNKA 4IOKA 4N6GA 4CQJA 1KOGA 4EAAA 5EMHA 4GH5A 4IXTA 1T3TA 2CK3A 2BONA 3MTQA 2WWXA 2XZDA 4M54A 3WZ2A 1WDTA 3ETGA 5DHTA 2O2CA 3O8LA 3C1UA 5AOVA 4CKWA 1T0UA 2G1AA 2I6UA 3MRXA 4YROA 3NMUF 1ZS9A 3GFRA 4LJAA 4RORA 3OBIA 4DNFA 1OB5A 1W36D 3O9VA 3ZYZA 2A3RA 2J0EA 3DJFA 2WP0A 1A1VA 1CUDA 2R6FA 1NONA 4HX9A 3B1FA 4X64B 1IOWA 4LXTA 1OGIA 3G2HA 2YIDA 1AURA 4RQUA 2P6NA 5FBWB 5C7LO 2C9MA 1A95A 4CKWB 4BNDA 3T3PB 1J8DA 3T3DA 4K6CA 5IH7A 4FJ2A 1NNEA 2Q0XA 1Y8ZA 3FYCA 4M7RA 3W9BA 3IAEA 4WY8A 1KSJA 1MOZA 1Z63A 2I0FA 4J7CA 3DEZA 4N39A 4ENSA 3EAGA 2H06A 4OAPA 2P41A 2R8BA 1GG2A 1T4DA 2WSYB 1FJHA 2CL6X 1N3LA 4CW7A 2XHZA 2P6PA 3M9LA 5NULA 4DLVA 3U7JA 2GWHA 4IINA 3MD0A 4M1EA 1SKYE 3K0SA 4OQQA 4DRXA 1QP4A 2WIDA 4PR0A 4TXMA 1HT3A 4TZ0A 1QNFA 2YV5A 3D7NA 4G63A 2XY4A 5LBTA 4UATA 2A5FA 3EMBA 4ITRC 4WLUA 3TLKA 3GEIA 1M33A 1D0IA 1UJNA 3C87A 3A1DA 4WDQA 5BMVF 2TECE 4P38A 4DRXB 4RMIA 3ZBTA 2J5RA 2VAVA 2WOJA 2NYRA 4Y2YA 5DBHX 1AQUA 3NIGB 3W6PA 1UJ5A 1X77A 3IAUA 3IQWA 3I23A 5DSZA 4BCDA 3FNQA 2G9VA 2XOKD 4FN4A 1CVLA 1U2ZA 1QHFA 2ORIA 2CLFB 1F7VA 1MUUA 3D4LA 2PRIA 4N8DA 3SF8A 1JXOA 5CBPA 2OWEA 3BWXA 3O4FA 2XTJA 5AI5A 4YPVA 1UOEA 3TNJA 5KJFA 4E5VA 4HNVA 4R8RA 5CH8A 4AY2A 3URKA 5LJIA 5AM5A 1UBJS 3W34A 1BH6A 2ODTX 1WXXA 3S2YA 4NFHA 1M2EA 5G3ZA 1AV6A 1Z07A 2X4DA 2OHIA 1JDNA 1BIFA 2KJQA 2YWCA 3SF8B 5F5NA 4MKXA 2WT8A 3KV1A 4I1RA 3DKKA 2H11A 4QRHA 3ZY2A 5KVCA 3VJRA 5IMSA 4FK8A 3KSBC 1DTSA 3HKEA 2CN1A 4OHKA 3AESA 3A32A 1CUCA 3A6FA 2FSGA 2IXEA 3EUEA 3RYHB 3TSWA 4ZYUA 1E4VA 1YXMA 4AY5A 1CWUA 4EDFA 4MB6A 4KVAA 5D87A 2DTDA 4AO8A 1CFZA 2HYDA 1SVUA 2OV6A 3B53X 3TGPA 4KXWA 2UDPA 4DCSA 3ESQA 2GF2A 3FB1A 3C3XA 1XEXA 3HKEB 1C0IA 1RLJA 3AESB 5KDDA 1RHKA 1ZPDA 2NGRA 3Q3EA 1A9QA 2GEVA 2ISCA 2ZWVA 3PQ5A 3QLEA 4IKPA 3TLCA 3W90A 4EPWA 3AFMA 4PTYA 1B6RA 1VGQA 1UK6A 1M72A 2WAYA 2C54A 4ZU6X 1CRQA 4HLUC 2I2WA 1XEXB 2KPOA 2QSUA 2Z09A 3G9ZA 4RM2A 4AURA 4CF6A 2JLSA 2PKWA 2Q5OA 4IYRA 4CETA 3N0VA 3RIMA 3AR4A 3HABA 4KE9A 1A71A 3QKIA 1ODCA 4RTSA 1E6CA 1KWKA 1SY7A 2HRCA 5B6JA 3A25A 1PJ2A 1P31A 4PY2A 2YYYA 2GKSA 3UXMA 3JRXA 4YRFA 4E5SA 3FG9A 1W1UA 4D99A 1Z8DA 3DHVA 4PQFA 3VAAA 1I30A 4JSRA 4YH1A 1IIBA 1W1WA 1RVDA 1FU7A 2C0QA 2B8NA 2WHQA 1EPUA 2B8EA 2Z0MA 3CX7A 3CPHA 1C3XA 3JRWA 2V54A 4YAWA 5ELMA 5CCXA 2PWPA 2QRHA 3D6MA 4BVJA 5BPFA 2HK9A 2D1TA 4U7FA 5I4KA 2O3QA 2X8JB 2E1PA 2ROQA 4L28A 4DQKA 5A0VA 4P08A 3R74A 4TRNA 3ECAA 3U7HB 3ZUPA 3ZDCA 3LJKA 1PV4A 3CA8A 1DFHA 1IATA 1C7QA 2Z9DA 3GCZA 2IYPA 3MTIA 3N1UA 4OQFA 5CVUA 3D6NB 5F1OA 3U4GA 1R6BX 2GDJA 2VDRB 2AJCA 4P4UA 1WZEA 3A6LA 4R05A 1N7JA 4UTPA 3QOXA 2CCJA 5I9SA 3OEED 4LMPA 4P8RA 3SSAA 5KYTA 3EVGA 4JXJA 4EJ6A 5JARA 1IN1A 4DUYB 4G1FA 2YN4A 1BNCA 4LBZA 5J4LA 1WDMA 1JSRA 4FGKA 1XZFA 3CRRA 2XUDA 3D3WA 4P34A 2ZROA 1J8YF 1XTTA 3C3AA 5B30A 5KTOA 1T36B 2FDRA 2NOAA 2OBNA 1FVOA 3LD9A 5LP1A 2R8ZA 1NLUA 3N2NA 5E1BA 3WISA 1M9NA 1PV2A 3MGBA 3UBTA 2DPGA 3VO8A 4RMJA 4WZZA 2IWHA 4TM7A 5JHHB 2ZWAA 1FLVA 3BFJA 4B3BA 3VISA 4B2PA 1G6KA 3LUDA 3I30X 3FOAA 3PYLA 3SX4A 5J23A 1ZCJA 5D6OA 2XEDA 2CXOA 1Z0ZA 3Q0TA 5EE5B 5I9NA 1DX9A 1XRSB 2R7NA 4OBBA 5T6MA 4LCJA 3VYTB 3MERA 2R1ZA 2ZI9A 3B9BA 5LR6A 1NU6A 1PNOA 2ZBDA 3OLXA 1UXKA 5LQUA 4TLLB 5AHWA 1WJGA 2DLNA 2H1HA 5F76A 1Q0LA 1OMOA 4QGSA 1KY4A 4UUNA 4ZMSA 3GPLA 2IYNA 2XMZA 2UUAB 3GZTB 2UXBB 2R6AA 1GYQA 4YPFA 1KDOA 2AF3C 3RLFA 4QQFA 3U9LA 4ACBA 3OCYA 4B34A 4YV1A 3FF4A 5KYXA 3SFVA 1PLKA 4JVOA 2X42A 1I4TD 2LV8A 2ZS8A 4KVFA 3NNNA 2N1MA 5AK5A 5AR1A 4A8JA 3ZVMA 3ORHA 4KIUA 4H7JA 4U3JA 2V58A 1JWLA 4TWRA 4GI2A 2QQFA 1QDLB 3K73O 2BGJA 4DSZA 5JATA 5KYXB 5KNDD 3B2QA 4A9AA 3ZW8A 1EFAA 4K2HA 1M2FA 2JCXA 3D3NA 3JWEA 3KC2A 4OK3A 3KXIA 2XA1A 4KOEC 3SLRA 5HUJA 4YASA 4MLPA 2OQRA 3BCSA 4U3JB 4NCNA 1U2GA 5C53B 2KBFA 2YFHA 3ELBA 4LY9A 2UZAA 5ENVA 2C9ZA 2A7QA 2V7WA 1OLOA 3R24A 2HHHB 4RVDA 3JWJA 1L8XA 2WF9A 3NHRA 2PBFA 4WASA 2ZB8A 2AZTA 2YYZA 1G8SA 1QB8A 1F0PA 4CTNA 5BY2A 2Z98A 1KBZA 1VKHA 2AFHA 4GM1A 4DCCA 3KE8A 5B4VA 1DCKA 4OQ4A 2D5LA 1ZJ5A 4WLOA 1D1QA 3M81A 3NEYA 1RRVA 1ZMBA 4H1WA 3HJAA 1L4MA 4ZD6A 2ZR9A 4L02A 3G5TA 2JCVA 3FPHA 1AS3A 3E2IA 3INRA 3NVAA 4RABA 3KBOA 3K6SA 2AFHB 3KD2A 5ALNA 3U37A 2E4ZA 4GMGA 3RTGA 3SVLA 5JJBA 1XN4A 5DN6A 2V6GA 4RULA 3EIFA 4QFCA 4D6PA 4BB6A 1KI3A 1L1FA 1SQFA 2R84A 1F4PA 4QLBA 2O5VA 2Z04A 3NX4A 3L9XA 3O93A 4GR4A 1DFGA 1RJGA 1V47A 4X85A 2Q1XA 4QLAA 3OFJA 3K6SB 4TZ6A 1CQIA 1UUFA 4R1SA 2ZIAA 1TA0A 1I24A 1PJRA 2PWZA 3LLVA 1J33A 1XU7A 4IRMA 3ZZ1A 3CXUA 2FPOA 2CXNA 1PVDA 2CL7X 4HWSA 1RKXA 5IAKA 2PFKA 3AKZA 1L5RA 1UJBA 2ZSDA 4EY6A 2JIZD 2HHAA 1M3SA 1GRRA 3RHFA 3E9EA 3H4MA 4YC7A 4F9GA 5IFKA 2R6DA 5K4GA 2OG1A 1CQIB 1L5LA 1KO7A 3R6WA 3O5AA 1SU7A 2EFYA 1T9ZA 4FS3A 2Z30A 3V2UA 1F14A 5K5EA 2YUIA 2ANCA 2QMZA 3JAKA 5E9JA 3SYRA 3JQPA 3ICEA 4XGNA 3QVVA 2I1WA 4AWBA 1EESA 4ZQFA 4O08A 4P7JA 1VA4A 4MV7A 5KYYA 4B9EA 1VB5A 4HRYA 5IP5A 3EVAA 4FYXA 4KE8A 1QIJA 4KZKA 4I46A 1FLDA 3AY3A 4ZKEA 1E59A 4ZC1A 4DQDA 4PAGA 2QZ9A 1IHYA 1B76A 3JAKB 1CP2A 4S04A 2Q49A 5JQGA 4CM4A 3KB1A 3I3SR 4ER3A 1XHEA 3T9EA 1QGZA 3NKFA 1OA1A 4F71A 5KYYB 2H52A 4PLVA 4UAGA 3ORYA 3HO6A 9MHTA 2WSIA 4M8LA 2QVLA 4UNRA 1F6DA 2NV6A 1Z38A 1V2HE 2ISQA 2VL7A 4AP5A 5JQGB 5JWHA 4DMFA 4G0MA 1T26A 1X1DA 3NRBA 3CZQA 1JFLA 1QG2A 4LCBA 1Q57A 2J09A 2P5TB 4JK3A 3FDZA 4G1MB 5B58T 5J2UA 1YTUA 4UTZA 1K8ZB 3DFUA 4NBNA 4TRMA 1KYYA 2G6TA 1KJ8A 1NXQA 3E22A 3D4NA 3Q9NA 5J2TF 4KDEA 2C7RA 1JKXA 1ZRSA 4GKVA 4QTXA 3QOFA 1USWA 4WGFA 4AB1A 4DMUB 3L82B 1K68A 3K09A 2Y0DA 3RARA 1WXQA 4OYYA 3B1JA 5A3QA 1QFYA 4B7XA 3AEKA 1N2CA 1ZK2A 3FDZB 4MVJE 2YXBA 2R79A 4KQ6A 1CUSA 1KVSA 1MG5A 1NR1A 2EX1A 3E22B 2QXTA 5CB0A 4P0PB 2FWBA 2OD9A 4GMXA 1D03A 3IBGA 5D51S 1B0UA 1PJSA 4HQRA 1RWXA 4DWWA 3GRYA 3G2PA 2FF7A 2BJHA 3CEJA 3AEKB 3ZJYA 3FWKA 3GNTA 1QP7A 1FFYA 5T8KA 2QX7A 2Q4TA 2VHWA 3COSA 1J0BA 5T5QA 2QE6A 4B87A 2F9LA 2IQ5A 1XDWA 2O7VA 1C0KA 1J5EB 3OFKA 1FXWA 4YRJA 4LPSA 4F5YA 1IXYA 3RYCA 3B3GA 3IOBA 3W4JA 1OXXK 3G9UA 3MM4A 4NH4A 5E7JA 1KFJB 4KXYA 4K8RB 4LVNA 1CY1A 1G5HA 1YJAA 2H4FA 1LA2A 3FXAA 3QMWA 3QKTA 4JNKA 2RH8A 1JPUA 1EK1A 3HE3A 2A33A 1KETA 4RKQA 5FOUA 3RYCB 1KOJA 1HDOA 3VDQA 1LK5A 1XVVA 3KU4A 4HRXA 2D59A 1Z73A 3F5FA 5DT2A 5LA6A 1M6VA 3MD9A 4E5PA 3DMPA 4UHEA 4YAJA 2GPAA 2KMLA 2W6OA 4AUMA 4O4IF 3D02A 2GERA 3HDTA 2QGNA 2XA9A 3GEPA 3RAGA 1FUIA 3QIVA 5FPSA 1A9ZA 2ZBGA 4M8SA 1IOZA 2F4NA 2HMSA 3KR9A 1FBTA 4RGYA 4LISA 5LNK1 5TGDA 2AR7A 1R8JA 1YA4A 3EK2A 3MQFA 5LA6B 2ANBA 2VRNA 1M6VB 1DFIA 3SC4A 3AFIA 1CUFA 2FQQA 3E3LA 1IUOA 3SIXA 4AICA 4DYHA 3ENQA 5K9ZA 1F7UA 2JFOA 5EFZA 4IDOA 3OKFA 3S2GA 4C6TA 4JQOA 2DBVO 1E79A 3S99A 3K8YA 1O08A 4CF3A 1N75A 1H4SA 4JH0A 3AVUA 1N6RA 4F6CA 2XVZA 4NPAA 4HVCA 4RTNA 1BJTA 2VOJA 2OESA 3CT4A 4OYHA 1DIRA 1S9HA 1X7HA 5KNBD 1JHQA 1CUJA 3FMOB 4DBLE 3L43A 4C6TB 2CLHB 1L4KA 4CKYA 2C9CA 2JKZA 1P72A 1WSDA 3NV9A 4ENTA 2LE0A 1EH5A 3FPAA 2PZFA 4U0KA 3AY7A 1THMA 4PXSA 3U3DA 4BQOA 1D8AA 5KTKA 1AQLA 2P3LA 3T38A 4EJMA 2F3PA 2ZUWA 4JZYA 4YBRA 3S40A 3BFVA 4F8EA 3FCYA 3GA5A 3CSUA 4CV0A 4HAVA 2RGAA 1BQ3A 1CZLA 4ALLA 2HUPA 1Z6ZA 4HYQA 1K6XA 3V8RA 2VYCA 3TRDA 2ZIXA 3L6BA 4IMPA 4MJ7A 4NV3A 3X3HA 2I87A 2AKEA 1XTRA 4H7FA 2HADA 3ADCA 3EUWA 2FZ5A 1IY1A 5HVNA 3W5BA 5F5XA 3CRQA 3I61A 1GPWB 5H59A 3OZUA 5HS6A 1BO6A 1ZN7A 2GJ9A 4BNWA 4ZGWA 1ZOPA 2EW8A 4FGUA 5KTSA 4MGHA 4V0RA 4PZPA 5IF3A 2D2FA 1LJUA 1Z0JA 3UJ3X 1NUPA 3FHOA 1XVUA 2BH9A 2NN3C 1HQKA 3OAAD 3CXRA 4QUGA 3ZE9A 3EPKA 4XVCA 2ENWA 1NXPA 1SQ0A 3ITDA 1NXOA 1T4MA 1MTOA 4D98A 4KQMA 2BR5A 1GRQA 3T0IA 2Q99A 4NWIA 3PZRA 3GVCA 3I4CA 2R8XA 1R0ZA 4ZT6A 4DLZA 4WSOA 2OC4A 1J2EA 2G40A 4YDHB 1I9CA 4E14A 4DJTA 3E0QA 4R0MA 1JQKA 3JR7A 3WNQA 1SC9A 1XT6A 2J5XA 3LC2O 2ZANA 1M0EA 1GQOA 4Q18A 1P2BA 4OAQA 1ARZA 1MO4A 3RANA 1WOMA 3FTCA 1LC0A 1UBEA 4CNBA 4B5KA 2VP9A 3E9RA 4UAJA 2HJWA 2E0IA 4XCQA 2F17A 1RWVA 3ZV3A 4GI1A 2VAPA 3HKCA 4FEGA 1JDVA 4NNJA 1XKQA 2I2FA 2PVPA 2QAIA 3NTOA 1J49A 2C7VA 4TT8A 4M4SA 3ZHZA 4NE7A 1JLSA 3WVNA 5JSFA 1WVMA 4IFEA 1TTTA 4XVRA 2I3DA 4RZIA 2EFEB 4G09A 2E5LB 5CNMA 1U81A 4PGGA 3UNXA 3E7FA 4AF6A 2WMDA 1ZD8A 2OCKA 4I1YA 4B3FX 2QTFA 4ZCMA 3ZWNA 1GTSA 1T10A 1SKMA 5JYCA 4CDGA 1SKBA 3HL4A 3IO5A 4BLUA 3T5MA 2ECKA 1QVRA 2X4GA 1OWNA 4F46A 3BEOA 1EVKA 2ZJOA 2C61A 1RADA 4M9XA 1HRDA 1MIOA 2FQWA 2GILA 4GKBA 1VIYA 2PRJA 3F7NA 1FPMA 1WUYA 4HDMA 3AJRA 2EQBA 4HZIA 2R47A 4LWOA 5EWMA 3B7PA 3MRVA 1RDFA 2OXTA 4MTLA 4KOAA 3GEBA 2G9NA 2BGLA 2IYTA 3O84A 2JATA 4BNKA 4OPMA 1UC9A 2C29D 1U7ZA 4A0HA 4B35A 5CJPA 4F12A 4GX5A 3CO0S 4B6EA 2QMYA 4HDMB 3RK1A 5A7FA 1QSGA 2YW9A 3CEPB 3RFXA 5EWMB 1LS1A 4AZ3A 1SHKA 4MW9A 5CGQB 2UXCB 1DHRA 1R37A 1TGVA 3OM1A 4RVNA 3UQZA 3I9OA 1PL8A 1QIKA 1FE8A 2EWWA 2P5UA 1ZHHA 1NI4A 1DWPA 2CBZA 3A10A 3O74A 4K81B 5EIBD 5E3IA 2IP1A 3WYDA 2WD8A 2YVQA 4WN3A 4RSMA 4KFCA 4QEKA