1HQKA

Crystal structure analysis of lumazine synthase from aquifex aeolicus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
154
Chain Sequence
MQIYEGKLTAEGLRFGIVASRFNHALVDRLVEGAIDCIVRHGGREEDITLVRVPGSWEIPVAAGELARKEDIDAVIAIGVLIRGATPHFDYIASEVSKGLANLSLELRKPITFGVITADTLEQAIERAGTKHGNKGWEAALSAIEMANLFKSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE
publication title X-ray structure analysis and crystallographic refinement of lumazine synthase from the hyperthermophile Aquifex aeolicus at 1.6 A resolution: determinants of thermostability revealed from structural comparisons.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 55
structure length 154
sequence length 154
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1hqkA00
1NQVA 4KQ6A 1KZ6A 1NQWA 2O6HA 5IM5A 1HQKA 1KYYA 1NQUA 5IM4A 2C94A 1KYVA 1C41A 2OBXA 1T13A 1KZ4A 2A59A 1EJBA 2B99A 1NQXA 1RVV1 2VI5A 3MK31 2A58A 2C9BA 1KZ9A 2I0FA 1KZ1A 2A57A 2B98A 1C2YA 4J07A 1ZISA 1W29A 2C92A 1W19A 1DI0A 1XN1A 2C97A 3NQ41 2C9DA 2F59A 2JFBA 1KYXA
chains in the Genus database with same CATH superfamily
1WXDA 2JGFA 2WWXA 3PUKA 4FGWA 1CY1A 1DRWA 4PZCA 3PC8C 1TVEA 3VSAA 3EQ8A 1B6RA 1LSJA 2AB0A 1T9KA 1YTUA 3N2YA 4GT1A 5G1PA 4HGNA 4KUGA 5CM9C 4YRQA 4LHYA 3ZE8A 3RU7A 1AVTA 3TPCA 1RRVA 4OYYA 4QIHA 2LKCA 1KOLA 1Q0ZA 3GROA 4WACA 4F21A 1N2XA 3QYJA 3W9YA 5FIUA 4ZREA 5AW6A 4LPKA 1DPGA 3RIEA 3H3JA 3PR1A 4RESA 3MHTA 3LBNA 3SC6A 2NP6A 4KPGA 4FT4A 1H8ED 4BMOB 1U7TA 5K0CA 4E51A 4XW2A 2EP8A 4I1UA 4M8LA 4M9UA 4EENA 4EF6A 4BBZA 3C70A 5FI1B 4UULA 1MGOA 2QVYX 1MQ9A 1MNQA 3MS4A 3QVGA 1NLZA 4KK3A 1B16A 4KPUA 2JFBA 4OJMX 2BI7A 4TRJA 4YFYA 3FPBA 3PQ3A 2E4AA 1VA5A 4XEUA 4WA8A 2W2OA 2ZUUA 2O8NA 3ZDBA 2BM0A 2GARA 1TTHA 2ZJ3A 2YIMA 3GT4A 3NOOA 1FZTA 4H7DA 3CUKA 5H83A 1FRNA 1TKCA 1CZRA 1XO1A 1SG9A 1T91A 3LQKA 3EGEA 3JQEA 4HI0E 4N0EA 3ONEA 5TX7A 1GUFA 2IXFA 2HCBA 3W7AA 1SFRA 1S2GA 2E87A 4GOKA 4DAEA 5K0EA 3FOCA 2FEWB 3M6AA 2QRUA 5CA1B 1UBTS 1W5FA 4HS9A 4C5BA 1NG9A 4TV8B 3HB9A 5LPNA 2JI8A 4JCOA 1A3CA 2ZYWX 1X7GA 3M4YA 3U9LA 3H6GA 2XGSA 5IPFA 4B82A 1WVIA 4BVGA 3UO8B 3TTXA 3WV4A 3VR2D 3D0RA 3EA4A 4J4HA 1J5PA 2DY0A 2IP2A 1CRPA 5H59A 3BCSA 2YRXA 1IN1A 4XWOA 1V43A 3OTIA 3UJHA 1RYDA 2VZ8A 1PR2A 4CMEA 1MV5A 1I2DA 2I34A 4PIVA 4ETWA 4EW2A 4I6GA 1Q7EA 3RADC 1AKVA 3HLTA 4ZOLB 5F2NA 4ZVTA 2BFBA 4KNWA 1FW6A 3U9SA 4PC1A 3UZUA 1PIWA 3GDWA 4ZMRA 4OX9B 4ZVUA 3EZGA 2IU0A 1M6YA 1PZMA 3DKKA 1R0LA 2Y71A 5DGIA 3NTVA 3L46A 1XJQA 3E5RA 1J20A 1G4HA 2VPPA 3IILA 4EUSA 2DFNA 4D44A 4NJEB 2AG0A 3A9VA 4ZVSA 1Z7BA 2ARKA 3RHSA 1TU3A 2H1CA 4Q15A 2H2IA 1K6XA 4DC0A 1U63A 1KEEA 1UMDA 3NM5A 1YUNA 2QU7A 1B41A 4RHCA 1XR3A 2HCJB 3CO5A 3HZHA 1Y98A 2H9AA 3L0DA 4LS3A 1XZHA 4NF2A 4CNBA 5BR8B 3TVYA 3CR3C 3O8OA 2QUIA 4D3YA 4W5NA 1S3FA 1XEWY 2Y4OA 3A9SA 2QB5A 2VLBA 2BHRA 5E4JA 4CW7A 4CGZA 1X74A 5CA0F 2QMZA 2CB9A 2Z2YA 2XHEA 3D0QA 3FMVA 5CCEA 4RTNA 4R9SA 2YHSA 2DR0A 1GARA 4XWTA 3EEIA 3CUUA 3C15C 5K9ZA 3ABSB 3FYUB 2ZRMA 1Y4DE 4ESVA 2ZI6A 4PCAA 2I7CA 3VC1A 1FFBA 1D2NA 5BSHA 2QTVA 1HE4A 1Y1SA 4JJ4A 4B3GA 2I7TA 4JX8A 1COWA 2GTHA 2YRWA 2Y1CA 3L7IA 3ENNA 3LRTA 3LDGA 1YQQA 3NVAA 1ONOA 4Z9AA 4CEJA 5A3JA 2DERA 3OCJA 3VU0A 1S2DA 1XEWX 3ZUGA 1GPKA 5KMGB 4O59O 4URHA 3NHYA 4I50A 1CU1A 2YN2A 5AM5A 3AVVA 2WU8A 3PDHA 3KLMX 2P9JA 3IVGA 2QR3A 3OLZA 4B0PA 5IUJC 4PNZA 1OWPA 2JC3A 2DP4E 5AVWA 2ORIA 4Z6KA 1IOLA 3KHTA 3QVWA 4IM7A 1IZYA 1GNSA 1PV2A 3OQ6A 4LI3X 2FPLA 4WI1A 1I7LA 2DCUA 5DO9A 5EE1A 2PKEA 3UBMA 2WWRA 3H4VA 4B2YA 4ZJUA 5KHOC 1MLDA 1R0XA 2CHGA 1DWPA 3FXAA 3TE6A 3EVBA 3KYDB 2AG8A 4Q00A 4U8GA 2C58A 2GCNA 1NYRA 3G0OA 4MARA 3FCUB 1H5QA 2H4FA 3R5SA 5ALZA 1KDYA 4DLRA 1Q91A 4KHPB 1B0PA 1AQIA 4J75A 1L4UA 4KXWA 5HUHA 2IXTA 2P35A 3IEUA 2M2IA 3CPJB 2C61A 3EMKA 3QWHA 4UREA 2Y05A 4LHSA 3AG6A 2JGKA 4LC9A 2WQ6A 3GNQA 4F1JA 4DMRA 1C50A 2Q1TA 4U2DA 1KI3A 2AFIA 5F33A 2ZI9A 2ENWA 3U0VA 5E2IA 1Q6ZA 3RWOA 3KXDA 3GRVA 4ALJA 4MJ7A 1CR4A 3TMAA 3M9WA 2ZYGA 3ILSA 2GNOA 2WD8A 1PSDA 4CLHA 1GA1A 2BONA 2JJMA 3OSUA 1BHSA 3GLHE 2F3SA 2OORC 4G9BA 5HKBA 2ZU6A 3KPWA 4MDHA 2CCJA 3DQPA 4RSGA 4RULA 1M5UA 4PN7A 3NJRA 2BM1A 2XYHA 1RKBA 1WPQA 2Y1KA 2GB4A 1P7VA 3LLVA 5FLXA 3IEMA 2C5AA 3QBDA 2NT4A 1HYGA 5JJKA 3UNXA 1QBKC 4UTOA 3UW1A 1RWKA 1VL5A 4JITA 4LYAA 1S3GA 4UUNA 4WXEA 4MI6A 3UAZA 5KTNA 2VG8A 4E1VA 2NO4A 1T0IA 4O2BF 2JJYA 4GMGA 3R3YA 3IE0A 4LJLA 1GQOA 1PJCA 3ZD7A 4MRAA 1LPNA 2FZLA 4H4CA 4MQ6A 4CWAA 5K03A 3HA5A 4KQMA 3DKRA 2QP4A 4AS1A 2C8LA 1MRZA 1NDQA 2NOAA 1NVDA 3JYNA 2VF5X 4AP6A 1C7JA 3H5NA 1D03A 3JU3A 3TL3A 1HYEA 3DDNA 5CJJA 4RVOA 4B87A 1TTTA 2AFHE 5JJIA 4NMMA 3ZY2A 3G2KA 1LB1B 1XYYA 1L8AA 1JE1A 4JP8A 4DLBA 1TRKA 1ZL0A 4FVTA 3G2IA 1OGIA 1O6CA 3JD3A 3NETA 3W04A 2XB2A 2F3UA 5FL7A 2P3SA 3KEQA 5HF8A 5H3LA 3A1DA 1W9HA 3EF3A 2X4GA 4CMJA 3IEXA 2D0OB 2QN3A 3TQFA 5JCJD 3KVOA 3JYLA 1ORWA 2BDUA 4FR5A 4JB8A 3F9CA 3FUUA 5DXJA 2Q7DA 4H08A 3PQDA 3EULA 4R40A 3U7EB 2CD7A 2OKCA 5LU9A 2PMCA 2R1TB 4M7PA 1VPEA 3M34A 1IFXA 1QFZA 3H5LA 4IQ8A 3AUSA 1UM9A 1WMAA 2NUAA 3RRNA 2GEFA 5AVQA 3A0RB 1RLMA 4QOSA 3AB7A 4BNDA 4F91B 4I2NA 4OXYA 3SAJA 1MAUA 3CWZA 1RRMA 3QYAA 1OF1A 1X9HA 4RIGA 2FNAA 3ID6C 2PANA 3STUA 4OPMA 3QE4A 4JC0A 2GBLA 4OHBA 1JTVA 5EJ2A 2HFKA 2RHHA 4WNYA 4PZZA 3VFDA 1T35A 4MUBA 1PDOA 4J7UA 1A88A 2FSIA 1R88A 3EVEA 5T4EA 5TQ0B 3KSAC 1RAHA 3B9PA 4XA8A 4IKPA 5EHGA 1US8B 2FZCA 4XIYA 5HKKD 1GP2A 1UC5B 2W5UA 4TKVB 2RAPA 2XLCA 2J6HA 3D4NA 4ROTA 1Z0SA 3T1VA 5ABPA 3FHTA 1PGJA 1QZUA 1RWOA 3U48A 5AI6A 3B6MA 2C96A 2OHHA 3UWDA 3FPAA 1IXKA 2CW5A 2WK1A 3AUAA 1LVUA 1BYIA 3BF8A 3F7NA 1PJ3A 4CDMA 1RWXA 2OILA 3TMKA 4JNCA 1FX1A 2XUQA 4CM6A 1CW2B 5ESXA 1PVOA 2DTEA 3HDYA 4NNPA 2CXPA 4XYLA 1W96A 4KR6A 2RBGA 1JAXA 1PWYE 1RI2A 2FW7A 2WJPA 2ZJ8A 4M9RA 5IBQA 4ASUA 3LVFO 5BYAA 2ZB4A 3AF0A 4LVOA 3UUFA 3DT6A 3L7OA 1SXHA 3P45A 2PZMA 2Y0BA 4PINA 3LUDA 3ZHUA 3IIKA 3ZN2A 4LOJA 4X64B 5IKPA 4JT4A 1WXGA 3E4CA 3N0RA 3M4NA 4B7CA 5KDDA 5BYJA 2RC6A 3L0OA 5JW6A 1C1HA 4JYCA 3ROXA 3JQ6A 2O23A 3C1UA 4LFCB 4E5MA 4Q3KA 1EK2A 1R8YA 3DR3A 3EZ6A 4P53A 4QDXA 4TS4A 4EG6A 2AJBA 3ENQA 2N42A 1DKOA 3JWHA 1T8SA 4KJXA 3VZRA 3NATA 2YFHA 1JQLB 1PV1A 1WE2A 4OLJA 1C1XB 4P7GA 1T1IA 2JFNA 5EE0A 4HZIA 3HDHA 4EY6A 3DPUA 1Y7LA 1I80A 1QUFA 3NXSA 1M2FA 4LYFA 5CX1A 5HFNA 1P45A 3E58A 4J91A 3JVDA 2OCKA 3P9PA 4FFRA 1NMZA 4LJ9A 3JZFA 5GQSA 2X7JA 4DXAA 4F2GA 5FOQA 1I4OA 1PYDA 3QXXA 2EP5A 2BDEA 1ONBA 4HAWA 3D7RA 5KX5A 2FSPA 5DIFA 1BOFA 1QGDA 3P9QA 2WD7B 3UF0A 4GMHA 5BVGA 3AOGA 3B82A 2V8BA 4IDNA 3IE1A 2HU7A 4HAYA 2FDXA 3VVCA 3N2KB 2LR0A 4ME6A 5CA0B 1NBEA 3QF7A 5KEIA 1BC5A 2ZIAA 1KI6B 4A1FA 3QG5A 3T3MB 2QAGA 2J9FA 4FE4A 4GWKA 4CUJA 3Q15C 2X0RA 4QZVA 1A4IA 4DA8A 3I9LA 1JHAA 3P9YA 5FTMA 4EB0A 4EKDA 4BJ3A 5JCXA 2Z6AA 2PGIA 1NXWA 5GGYA 1A8HA 1RC8A 2IP4A 4X5OA 2X6TA 4R84A 2VRNA 4HV4A 3ICOA 1DT3A 2CKDA 1QDUA 2WZCA 3KQMA 4IH1A 4Y0VA 2EIXA 3H1AA 5L3SB 3AESB 2BEWA 1QH1A 1L7QA 3BH7A 5G2OA 2ECFA 3C3CA 3THWB 4HLCA 3TNJA 4ND7A 3OU7A 3M49A 1HA3A 1TA4A 2WSMA 1CB7A 5HNKA 3I61A 2HU2A 2OYCA 4RK1A 1CQXA 3KZXA 3FPHA 4PTYA 3RC3A 2BHSA 3LW8A 1CIJA 2DPXA 3NKLA 4Q3CA 4AQDA 2MYTA 4PTLA 3P97A 2D2EA 3QFRA 5I9TA 3I5YA 1ZH8A 3HY4A 2VT3A 1V5GA 1GG5A 3AKDA 3Q98A 5TF0A 3DZJA 1VHJA 2CLOB 4IZ6A 2XT9A 1PYGA 1GGNA 1FS6A 2E4VA 4I4IA 1Q7RA 5GJBA 1H9BA 2IU4A 1LWOA 3L4KA 1F60A 2FRVA 4KFSA 4GBJA 4Z4CA 4RLSA 4S12A 5LNK6 2H1OA 2CN1A 1AHHA 3KQPA 2AX4A 5KQPA 2NU7A 1M8PA 1ZCBA 3KAPA 1XMVA 2VT7A 1NOJA 2J4CA 1K9VF 3KE9A 5B2ZA 1NQUA 1EK5A 2A92A 4COKA 3RAEC 3E7XA 1MU0A 2P0EA 4Y2GA 3RC7A 4GLFA 5IFLA 5JRDS 1AKYA 4R9RA 1YKFA 2FDRA 4ZARA 5BV2P 5EYPB 3HN6A 3TVTA 3LVBA 2P4HX 4KQ2A 4XQ9A 5KYGA 1WABA 2QMYA 1Q50A 2AFIE 2Q6VA 1CUBA 1KR5A 2W6ZA 3AQIA 4PNHA 3LECA 3OY7A 5SV2A 1RXSA 4JOCA 1J1ZA 3GHYA 1LLDA 4Q1CA 3DPIA 4F5YA 2XZPA 3AHHA 3JQ9A 4BIIA 2REQB 3IHTA 2NO7A 2XCUA 3O3NB 5ALIA 3L1KA 3O1JC 2H31A 4J1TA 2HK9A 4ZU3A 1UFQA 5JYCA 1BTOA 1I3NA 1VE3A 4G85A 5EA2A 4YJ3A 3OM0A 5K0NA 2L18A 5THKA 2C3PA 1GAWA 3OQIB 1UJ2A 3LPCA 4O2BB 4PM4A 2ZVQX 3TSWA 1MORA 2W2LD 2ZRHA 4NYJR 2JLZA 4GZ5A 3MD0A 4I1VA 2X3FA 1KJ9A 2Q6LA 1FDIA 1XRSB 2QRVB 3GUHA 4UBLA 4XGRA 1OI3A 4AURA 3ZHSA 5LFAA 4L7VA 2PUBA 1O6ZA 2GETA 1MVLA 2AG6A 2PLRA 3UB3A 1EQUA 3CC8A 1U7WA 4D42A 1OXKB 9ABPA 1IULA 3BRWD 1JR3A 2IPMA 3RT7A 4HRVA 2ZR0A 4OOEA 2NZVG 3QW2A 1CR2A 4K5QA 4PIPA 5KWVA 3K4PA 5ALJA 3H87A 2H2WA 2WPNA 1JLHA 4J49A 3O38A 3N75A 4AZTA 4YBZA 3W7VA 1SCQA 4H7IA 4U3JA 3JVVA 4GGPA 3SHVA 3U40A 1H2EA 3AHCA 1VL0A 1CUCA 2FR8C 2EBUA 2MSNA 2ZUCA 3TJZA 4YEDA 3AWIA 3AR2A 1LLCA 3A05A 5GVSA 1X2EA 1A0OA 4MEJA 3AY7A 4L4UA 5K99A 1JG3A 5FTLA 5IKOA 2X8JB 2ZITA 4Q1BA 3O2QB 1E2EA 2O2GA 2ZU0C 3EZYA 2D7CA 3O4JA 3DO8A 3PEYA 1QX3A 1TJPB 1PT9A 1VPDA 2NSHA 2PWYA 4B3SB 3CH7A 2JG3A 3GJ4A 4OHRA 3GW8A 3ULKA 5CLHA 5CU7A 5C5DA 3FMPB 3OJWA 8LDHA 1ZW6A 3AZQA 3VSDA 1KZ6A 2J87A 4C22A 4EFNA 1QQTA 4R2WA 4AN1A 1SXIA 2M6RA 4EECA 4H0CA 4QOFA 4O6VA 1ZM9A 2R5WA 3GIWA 3RTEA 3ORRA 5NLLA 1XPOA 3D6FA 2SKEA 1PHRA 3JYQA 2XZDA 1YJQA 2G1AA 3MGKA 4QLOA 1MABB 3C41J 5F5NA 5TPWB 4BYMA 3MILA 4L73A 1P17A 2OQVA 4CKWA 3NP9A 4BFLA 5JRZA 4QOHA 1AUOA 2R65A 4AJ2A 2CVHA 1J7JA 3HKDA 2WVJA 2WM9B 3LGAA 2FMKA 3KR1A 4ZMBA 2FEPA 1H4QA 3HMKA 3JASB 2BYTA 2CV0A 3KQYA 4L4RA 5B1YA 2CK3A 1L7MA 1CFJA 1RYYA 2PX4A 2ROQA 5ALEA 4K9DA 3HJCA 4WE3A 1GTJ1 5C8YA 1MB0A 4CV3A 4HJRA 4O02B 4XI9A 3QU2A 5DWQA 3RS4A 4FCCA 4A6PA 4GKKB 1FXWF 3P26A 4FJ0A 1IQPA 1JBEA 3PE4A 2G1KA 4H0FA 1PI3A 3PB3A 4EBBA 3A6HA 1AQNA 4JA0A 2I3GA 4K3VA 2FQYA 2QDKA 1JPUA 4P4LA 2BMJA 3KSBC 1CY7A 2ZIGA 4M1TA 5JATA 5EKTA 3WNVA 3F4KA 4FOOA 1KAQA 2HMSA 3DQZA 1W87A 2ZKLA 2HJWA 3F4LA 2BFFA 3PNBA 1SQSA 2VO1A 3TTUA 4N76A 3Q3VA 3PDUA 2VTDA 3F1KA 1EDOA 4MW2A 2P9ZA 2J8ZA 3IRUA 4R9VA 3EX7C 2R79A 4J76A 4AO7A 5I6DA 2CLHB 3JAKB 4P0QB 5BOVA 4UTZA 4J29A 1WZUA 4POAA 2DEUA 3RHTA 4QASA 1LFDB 4MCIA 1L4GA 1Q17A 4Q7MB 3VGJA 4W5TA 1BSVA 1A8UA 3BULA 2JIZA 3KTDA 3EXFB 5L3RA 4KI7A 5M3BA 4E94A 4DUGD 3T99A 4LV6A 1V6SA 5C5EA 1BHQ1 4G0UA 2NPOA 3OE7D 4GH5A 4YQFA 5JJCA 4GI1A 5FHQA 2XWJI 2XTAA 4PZ9A 4UBMA 5EHQA 3NLLA 1Z4KA 2YUIA 3N1UA 3ONWA 1SBTA 4BWVA 1ACLA 4U02A 3O7WA 4TLLB 4UBNA 2QN1A 1A8SA 3OEEA 3DONA 4FC7A 4BU0A 1EJ2A 1M2JA 4DGQA 2ECQA 4YCNA 4GM0A 2CT8A 4AMGA 1M2GA 1BEEA 2XITA 2NYUA 2IK8A 4M76B 3OZBA 2VDMB 5F7ZA 3UANA 1ZRSA 5AI4A 3KQTA 5EMKA 4FMDF 5PNTA 1I1HA 2GFHA 2WV9A 3FIUA 4IHQA 4D43A 4EGSA 5IBCA 3PITA 4JH0A 4LXTA 4EG1A 4H1HA 5HKLA 2IIPA 4WX2B 4MYUA 1E3IA 4NDAA 1DKUA 4C05A 1XWFA 5HFJA 3IUSA 1WW2A 4LTDA 2BMWA 4CEHA 4MR8A 5FOSA 5ELLA 2FN7A 1UMCB 4Z0TA 1NYTA 1KJQA 4R8LA 5ALUA 2GMWA 1N1DA 1N4DA 5A4JA 4QOJA 3M83A 1LI4A 3NXKA 4CCWA 4X20B 4E3ZA 1I1OA 3CKYA 5CVEA 2IWHA 3TIVA 3RFTA 2PMDA 5B6IA 4LDQA 1XSEA 4Y98A 2Q45A 3DVAA 3LBFA 4PYOA 3V00A 4DRXA 1JKFA 4IV0A 3C4JA 3CPSA 4CN8A 2PBFA 3G82C 3CX6A 3QVMA 4D3DA 3WZMA 1UPCA 5KTYA 5L51A 1PBNA 1S4MA 4INJA 5BOSA 1RJGA 3BDVA 4RNCA 2Z43A 1TZJA 1QFXA 2EX4A 2JZOA 4EGFA 3AF3A 4KNVA 2FP4B 3B1KA 3OMWA 3S2FA 2R7LA 4HAOA 2FH5B 1T5TA 4D8TA 2QT1A 4D6YA 3T9EA 2AMFA 4QYSA 3L7KA 4RV5A 5E6RA 4AKGA 2Q5EA 3E3LA 3K2QA 2GPTA 5GM2A 1GGHA 3CA8A 5G4LA 3WK5A 2KX7A 2ZIFA 4Q82A 5AVUA 3VOAA 3RVDA 3N8HA 4F38A 3UXMA 2DXIA 4W1RA 2XUDA 3C87A 4PC6A 5E2AA 4M53A 2HNBA 3OF2A 5EP1A 2WE7A 1N6PA 2ZKIA 4OG2A 5A9TA 5KNCD 5LD2B 4BLPA 2G72A 4AYXA 1XMSA 4B3TB 3K3PA 2X5KO 3DBLA 3TW0A 4PG8A 3VKUA 4AO6A 5I48A 1VMIA 4D0NA 1CQJB 1SKAA 4XSVA 1KJZA 2EJBA 1UWLA 3E23A 4HXEB 4ARCA 1IL0A 1E18A 2IOFK 1VRWA 2VJAA 3N87A 1DO0A 1GZ6A 3PQCA 3UMCA 3KKZA 2IHTA 3V8BA 2GQ0A 4HY3A 4ZD6A 3WNCA 5CB8A 2XE7A 6ADHA 1DXQA 1ZY2A 4Y3UA 5DPMA 2EW1A 1T8PA 2IEDA 2BWJA 5GIOE 1KEVA 2C03A 3HWWA 1PJAA 3LE8A 1ZIXA 5JD5A 1M72A 3GBSA 1SG0A 3Q7PA 1T6BY 2DKNA 3Q12A 2PMEA 3WYNA 5K0ZA 3DD5A 2B5WA 3UMJA 1U3DA 2NUPA 3E61A 4FEYA 2XKAA 5CFNA 2CB0A 3NU1A 4XWGA 3TQSA 3JD0A 3F0TA 2FZVA 1IOWA 3O47A 4CQMA 5C3MA 1MJNA 1DHRA 4B3IA 5EMHA 2O3TA 1FDWA 1OZAA 2QL5A 3IAUA 1Y9JA 1XMIA 4L5CA 3OIUA 1WEKA 1D09A 2QLFA 2BKXA 1HSZA 2D0IA 1JB1A 4URXR 5CPFA 4PYRA 5KC8A 2FW0A 2WWWA 2D5CA 5TQVA 1IUPA 3D8TA 4J8PA 4GM4A 4F11A 1MHTA 1S5PA 3ICWA 5I5GA 2J3HA 4O4LA 3ZHBA 3MMPA 1TLTA 1U3UA 4AYTA 2YQ4A 1RBYA 3D3QA 4QAJA 3SQOA 3F3MA 3H2GA 4MLCA 4MWDA 3FETA 3N7TA 2RK4A 3HLKA 4B46A 1PJ2A 4LDJA 2C4NA 3G3EA 3WJAA 1HGXA 3O4HA 4OXKA 3Q6NA 4QJBA 5DM2A 3HFGA 1THZA 4QECA 2IBSA 1XAJA 2XMSA 4B4DA 4DIMA 3DYVA 5K05A 1F0KA 2NXEA 3BMXA 1ML4A 4EYKA 3WGUA 1QE3A 4MWTA 2AYXA 2BJHA 3O4RA 3LZDA 3DYBA 3NTLA 2V3CC 4CTNA 1ISJA 1XCOA 5CG1A 4ACAA 4RVNA 5D5HA 4BO7A 1ODSA 3TF5A 4CIXA 4Q9JA 1WTAA 2C54A 4JB0A 4EB6B 4XSHA 4PF1A 3GLIA 3NYWA 1I6KA 3AHIA 2Q3HA 5L4LA 2ZDHA 3CV3A 3GMIA 4ZHQA 2WKSA 2XNCA 2YX1A 2HLDD 3CVOA 1W8IA 3GD7A 2NZJA 4D92A 3L8ZA 1V16B 2FZ5A 2Q5OA 2NTNA 5LM3A 1QJCA 3F96A 3KT0A 4K9LA 5MFPA 1KARA 4GLJA 3C3JA 4J2TA 3FNGA 1MB9A 1AKRA 3QFCA 2GD0A 3ICQB 1W49A 3DZBA 4JEHA 3UW3A 3RSGA 3TNLA 2R00A 3PPXA 4FB5A 2VKTA 1LCIA 1OZHA 2RG7A 4AKSA 1RC1A 3KPYA 4MQFB 3RTBA 4ARAA 4LQ4A 1IN4A 1RAGA 4HT3B 4YRBA 1BVRA 4ZICA 3HA2A 2BM9A 3EQ6A 4Z4QA 1TEHA 3QE9Y 1T2VA 2AZXA 2EGHA 4J9VA 4RHYA 3C7TA 2YZNA 3OEWA 1R0ZA 4PQRA 4H3VA 3NUGA 1G4AE 3V2UA 1CUXA 4INOA 4Q66C 2HSWA 1R8JA 1J0EA 1OFUX 3SGLA 3ZPXA 5FTKA 2Z9CA 2A86A 2G9NA 5KNLA 5EI5A 4OLHA 3H9EO 1QAMA 3AFMA 4OUDB 2UAGA 4QNNA 4OHMA 1GRNA 5DTJA 2IIBA 2FPIA 1DXHA 3OCCA 3Q0IA 4WECA 4Q4DA 5DYYA 4ER5A 3NEJA 2B2XA 1NVXQ 4BNFA 3KHKA 1FCJA 2VZ9A 3G1TA 2CNWD 1K7SN 2QGFA 2ZI7A 1YDWA 3B2EA 4Q9KA 4YCAA 1KHTA 3KC2A 3ND7A 4YCLA 1KGSA 4Q7KA 1VYHA 2UZ4A 4TUYA 3AZOA 4WN9A 4X7MA 4FSHA 2GKOA 3HKCA 5A6SA 3U7RA 1BXZA 4L9SA 2EF1A 2YHUA 1O8CA 2RH5A 1M6VA 1R0KA 2GM9A 1E99A 3RU2A 4JBHA 4BVKA 1VLMA 1N5JA 4LCBA 4PYMA 4YPVA 2DULA 3OSZA 2HXYA 2IPLA 4MWGA 4QTUB 3QXHA 1EP3B 3L9WA 1PW7A 2PJRA 3WAGA 1GDHA 4LCEA 3F8SA 1W7AA 3JYHA 1FZQA 4CG1A 4PLPA 3A2KA 3MGBA 2XTZA 2ZUFA 1PUXA 4FMDB 4HN9A 4E5NA 2GCOB 2QSJA 3KPUA 2X7XA 3FFBA 4Z4FA 1AX9A 1QWOA 1JE0A 1VRVA 2CVOA 3E84A 3ZG6A 1B8UA 2WQ7A 1NSFA 1KZ4A 2BFCB 1B8OA 3L7AA 2ZJYA 1P2DA 2QUKA 4EI7A 4MPPA 4PVCA 3STTA 1G38A 1BAPA 5KKNB 4WTOA 3CSSA 4DLVA 1ZJ4A 5IBPA 4C07A 3MMXA 4QUEA 3EXG1 3HP4A 4ENQA 4ZN6A 1YQXA 4KVZA 4GYJA 1NUAA 1P72A 3OZRA 4M2LA 2XT0A 3BEOA 4V03A 2ZDQA 4L3VA 3RIYA 3TOCA 3VR3D 4BY9E 2R3SA 2Q2OA 5BYKA 3K7EA 1GNQA 4NVRA 2E9SA 1E1RD 3T4EA 2VRWA 5G53C 2WD9A 2IE0A 2VXYA 2IEGA 2ZSIA 2CNBA 4YGXB 1E89A 1CRWG 1P9NA 4UTRA 3O31A 2XJ9A 1ZD9A 5HS6A 1D1QA 4UU0A 3QOFA 1YUBA 3ADBA 1Z5VA 1HO3A 2OK7A 4WJKB 2JAQA 2EEZA 1UIRA 1LDEA 3MOGA 3ITNA 3HYTA 4MH0R 4BWFB 5F7OA 1VJGA 3LLSA 1YI8A 3Q8WA 4DNXA 3I9V6 1MFZA 2P41A 4MYRA 5EJEA 2J5RA 3JARA 4OU4A 1FP6A 4RLQA 2OWEA 3QKRA 3UKJA 4X6YA 4W8HA 3P9ZA 1JG2A 2MYNA 3IR6A 1GQ2A 4R1SA 1PL6A 4WCFA 2YTZA 3AMVA 2PL5A 1FDOA 2CXHA 2IOHA 1G8GA 1QAQA 2RJNA 3SZOA 5AUPB 4E2XA 1W5TA 2VQDA 2AC7A 5BRNA 3LSTA 3OETA 3UAXA 1R12A 2B3DA 1XJWA 3S5JA 1YQWA 1CUZA 3F78A 1INLA 1PK7A 4FQ5A 1UMBB 4WOPA 4QUDA 1Z08A 1KEKA 1BCSB 4LDZA 3LPDA 4JJIA 2F4VB 4NDNE 1ZIYA 5K51A 5BWBA 3WGZA 2FSFA 1T5BA 1WP9A 1GT6A 3KT8A 4B85A 3IP3A 1DTEA 3V9PA 1KH2A 5JDIA 4KFUA 4RKEA 3GN2A 3GYBA 3NP7A 3RF6A 3F6BX 1GU1A 4DBLC 1NOIA 2EKQA 3DR5A 4OF4A 5FQOA 4BKOA 5JPDA 1CEEA 2J33A 3OMXA 5L3QB 1KF0A 3OLVA 1BFKA 3ZWNA 1CPYA 5KJ6A 3SM9A 2ZXFA 3JZIA 3KHUA 2DR2A 2IUSA 4BO3A 2IF2A 3L1VA 3VI3B 2R62A 5TQ2B 4C06A 1J33A 1Q0HA 4A8PA 1QV6A 4BNTA 2BFNA 3A8TA 3KD2A 4BRUA 4A23A 5T5QA 3I2JA 3I62A 4JVMA 5I7WA 2G9ZA 3F2IA 1IVYA 4KUEA 4Z5XA 1P81A 3EZXA 4R0VA 1WCIB 4A82A 2O8CB 4UUPA 2Q5LA 4MDYA 3R4VA 1R8XA 4G0MA 4OFZA 1GL6A 5E9JA 3VGPA 3GUZA 2RHBA 1J97A 2LIPA 1CYEA 1S7CA 4DG5A 3K0AB 1E3WB 4PQYA 1YKSA 3L07A 4S1NA 1C4OA 3NAGA 3DGFC 5F78A 2GYWA 5ALNA 2PUVA 3ZH9B 5EWLA 4QODA 3QJ5A 4OQQA 2VPWA 2AZMA 1SQGA 3V3TA 2N75A 3VNAA 4HFRA 1EIWA 4LECA 1LX7A 1VI2A 5INTA 2EKPA 2G8LA 2ZANA 5TC4A 4FDTA 4J3JA 4UVGA 3N05A 2WJ3A 2CXNA 4XIGS 3U3DA 5LIPA 2R1VB 4C3VA 1E7WA 4OQXA 3CLUC 1JH8A 1GSIA 5F1OA 2CBXA 1U2DC 1C41A 2O3RA 2Y1FA 2XAAA 4OYLA 1KYIA 4P4SB 4QPPA 4TMTA 5HG0A 3Q8MA 2DLCX 3BG5A 1C7EA 3BKWA 3V48A 4P35A 4RJJA 2Q4DA 3AUKA 2ZRGA 3MWJA 2GTPA 3BTVA 4HGPA 2XB4A 4NZMA 4TV8A 5JWHA 1QF9A 4DY4A 5FWNA 1X14A 3H4MA 1Y3DE 3OWXA 5EMJA 4HEQA 3WE7A 2B1QA 3BE8A 4IIHA 3Q85A 3WMXA 2IYQA 5ADWA 1DOHA 2XHZA 1EB8A 3HJTA 4RD6A 2XYPA 3UHPA 2GSDA 3ZS9A 4DLPA 2ZG6A 1O5TA 2WUWE 2YW9A 1YMVA 1ZH4A 2PV7A 4OB6A 4YDSA 4C08A 2QJFA 2DMRA 2QLBA 2ZW9A 4ZOLA 3R5HA 2CJXA 1QRSA 3KDAA 1GG9A 4DV4B 4GPIB 4IDHA 4QOEA 3S2GA 4ZP1A 3VH4A 2JJ1A 1U7ZA 4BNHA 1FYVA 1YRYE 1VE1A 1YQTA 2WJVA 3S68A 4X61A 3VC2A 4CTMA 1S7GA 2QJOA 1YCFA 3PRJA 4NE9A 1UBLS 1YGPA 1A9SA 3PLNA 1NIPA 1EFRD 2AIRA 3JAWB 4N8EA 1AF4A 4NJEA 4QU5A 4F2PA 4L22A 4KFTA 4F9GA 1JT2A 1RT9A 2PTHA 2VWHA 3MTBA 4J0IA 1F1JA 5H7XA 4HDRB 4RSMA 3U3MA 1XN4A 3CTMA 3P0IA 3WLOA 4F04A 3KG2A 5JPIA 5AVSA 3ZCRA 2QNIA 2R6AA 1ZLXA 3DAFA 1RI1A 3GLKA 1L1RA 5FWYB 1VMDA 2ZM6B 4RQBA 2J0SA 3ZHRA 1POXA 2ZJZA 3WP1B 3SXPA 4L51A 3NG1A 2EATA 1PQUA 1F17A 4NBLA 4GQBA 5KCZA 2CMDA 3ITKA 3QKSB 2PN1A 3N8IA 3IJRA 3L4EA 3FYUA 1U04A 2DSNA 2VTEA 4RWEA 5DP1A 3KEFA 5AM1A 3ZIDA 2PXXA 2E5LB 4UC0A 2QRLA 5EZSA 3ZKWB 2PL9A 3B5IA 3E15A 5F98A 2FWIA 1LNSA 5HRCA 4OGKA 1JXAA 3KDSE 2GPYA 2FUEA 5KMGA 5EINA 2AT1A 4YYEA 1OE0A 1W30A 5K8JB 5IS2A 1I4EB 1K3FA 2PRIA 3CKMA 3KVRA 3LU1A 4K9OA 4NP6A 1T8UA 4AMZA 2BKVA 1I5OA 1R8QA 2JFQA 4NYMQ 4XVRA 4YALA 4YB8A 2F59A 5CNJA 4YPFA 3EHDA 4TXLA 2CMKA 5DCUA 1UDAA 5AOAA 5CFMA 1VCIA 3HHPA 2RI1A 3KJXA 4LXXA 3EAFA 4Z51A 1SC1A 1E3EA 3DCNA 4FU0A 2ZOSA 5U4XA 2EBHX 3F6RA 1IK6A 4K9PA 2H2GA 1MAWA 1R10A 3NTRA 2W6IA 4GAEA 5C51B 3DMYA 2GFIA 2PLNA 1QRAA 3A37A 4YRZA 4KFCA 3Q88A 4LY9A 4NOKA 3H84A 2Q8QA 4RK6A 4J07A 1LI7A 1YIAA 1M2HA 2PX8A 3HFSA 4NBKA 1I3OA 3VH3A 1GTSA 3DE1X 4X63A 4YMTA 3BGOS 1IUKA 3RYHB 3T34A 4XJTA 3BD8A 4BO0A 3DMRA 1RLJA 2A1IA 2MYPA 4ZZ1A 3OUUA 1V7CA 1VB5A 4MKGA 4WVFA 2NM0A 5EESA 4QRDA 5AJXA 4IKOA 4EO9A 3SY8A 2G17A 1XMXA 3AHGA 3C1TA 4GE3A 5F1KA 2XUHA 3ROEA 2QTLA 2OXEA 1L6RA 4WKOA 1XE3A 1HORA 1AY0A 2ZJ2A 4B3HA 5HDBB 2QRZA 2RH9B 3HB4X 3IRVA 1UZNA 1JNYA 2RHCA 3TBFA 1QP8A 3A36A 4KIJA 1U4SA 4LJ5A 3DAYA 3IPLA 1WF6A 2QK4A 4J1SA 4QTXA 4G0YA 2AV6A 3HBFA 2H0QA 4AI6A 4UEOA 3L82B 3GELA 4X9XA 3A2NA 3BFKA 2ZUWA 4C4PA 3VKWA 2A9OA 2J3JA 2I1VB 3K0HA 1YA6A 4NE2A 3KEOA 4J1QA 5F1YA 2NSYA 3A28A 1RP1A 2LBPA 1D8TA 2GK4A 2FDCA 1Z68A 2GZHA 2A33A 2UU9B 3HKEA 3KOOA 3R3UA 4KLAA 2OWDA 2BR4A 2GKGA 2ODEA 1X1DA 2YHIB 5ELMA 4DCTA 4CL2A 4JKIA 4JJ7A 4BXOB 2VHZA 3NGMA 5H80A 2DQYA 1YGYA 3TSYA 1EDBA 1A8QA 4GMDA 3IQGX 5EC8A 4IIFA 2QYSA 3O3CA 1EWQA 5CX4A 3K5IA 3U0BA 5IUNC 3L6BA 2BLNA 3COSA 1EXWA 1NVVR 1IJBA 3GVHA 3PE3A 4EHBA 3DEHA 1MB4A 3BDIA 5IDXA 1VP3A 4HB0A 5DM4A 4ZEWA 4M1EA 1MOZA 2Q28A 2WWVD 1IG3A 5CG2A 3UPTA 1YVUA 3T9BA 1Y48E 2FWPA 2WU1A 2IY9A 3EPPA 2Q6TA 1XF1A 4M54A 1HRDA 2IS4A 4PGHA 3X3HA 4D9MA 1T2CA 3OQVA 1T1EA 4C4TA 3F8TA 5HW0A 4QHYA 4BEJA 2O14A 3DXYA 3WL5A 2RFLA 3ZX4A 4B6OA 4DNFA 5JADA 2SCUB 1IHPA 1KGDA 2R1TA 2VJPA 3EIEA 3L8CA 4I1YA 4LMPA 2CLMB 4OJNA 4UQLA 1ECFA 2F7SA 4PSCA 4NHEA 1XYGA 4N5IX 4DMUB 3NCHA 2B37A 1P0CA 2OV6A 2ZJ7A 5DNYB 2ZBPA 3N6RA 1XD2B 5IHXA 2JVKA 2JGMA 4JOSA 4MNTA 4P1ZA 2H0RA 5LZ5A 3VH2A 3GLGB 1XHEA 4ZAYA 3TG2A 1UBHS 1SXGA 2XDWA 5CFPA 1U7XA 3B1WA 4DT1A 2ZJ4A 3TVDA 4CMHA 1BN7A 1NL3A 2VRCD 2GCIA 1W1IA 5TQ0A 1TI7A 1FSFA 1GU7A 2ZUDA 1US8A 3EQ9A 4O0MA 4EX6A 2EKZA 2ZPUA 1VG1A 2X1MA 4HBZA 4OFBA 2MIIA 2TMGA 2YJNA 1QFSA 1PZFA 2YV2A 4JJEA 4CUZA 5K20A 4PLWA 4HSEA 3KOYA 1UKYA 3MTJA 4MGKR 3LTEA 4TN5A 2AN9A 4RH1A 4M1YA 4MJLA 2DX7A 3B60A 3PGVA 1W88A 4CCSA 5GOTA 4K87A 2QRMA 2NXJA 1G3UA 4OYHA 3ZLVA 3OZFA 4RIFA 3R20A 4RM2A 4F2HA 1PG2A 3WL7A 3J81A 2V9PA 2DG2A 2X0FA 2AOTB 1T6NA 3GQBB 4TV9A 2VFAA 2VF8A 1WB6A 1U65A 4R1UA 2YL2A 3KX2A 4G5SA 2FEOA 3GGOA 5FA5A 2A5YB 3G9TA 4B1FA 3M4XA 2OCGA 4PLYA 3GVPA 5LQRA 3GLRA 1LI5A 1P4GA 4FYXA 3OECA 2GXQA 2HRCA 4R6WA 1CDZA 4IJKA 4UUMA 1RD4A 2JIDA 1OILA 1O95C 4Q9AA 1ZGHA 2A9RA 3SBOA 3PPWA 3WA6A 1SXPA 2GAAA 1KI1A 1NXOA 1H0HA 4FDLA 1C30A 4KACA 1NF2A 3Q7SA 4OYRA 2HTFA 1ZFNA 4Q02A 3I01M 3P71T 1QDLB 1YMUA 1GZ4A 1XEXB 3PWZA 1RHKA 4QXQA 3IELA 3VHRA 3WGMA 3IUBA 4KMRA 1NP3A 1O9BA 1OIWA 1GM5A 3DZ8A 1TO1E 1C1XA 1IY9A 1I3LA 2FFRA 3L49A 1OHHA 3MVEA 5JUWA 2NGRA 1DQPA 1UPAA 4B0OA 5KYYB 2GYVA 1YK1A 2JI4A 2V5AA 2ZVPX 3SLGA 1E62A 4F5DA 4ND8B 1KFBB 3I37X 1ENOA 4ZJZA 3FDZB 5BVHA 1O5IA 1RWNA 1DIRA 3UAGA 3AJDA 4L5JA 2WD7A 4NCXA 4AP9A 1YZFA 3I4FA 5IN4A 4PPGA 5DN9A 2GBPA 5A5EA 5K3OA 3EFHA 4N18A 1KOGA 5CA0A 1JLMA 1NKVA 4K46A 4PBSA 1W47A 2HXSA 5EMMA 2JIBA 5LQSA 1KI6A 4M7WA 3TZHA 4LWQA 3ZBUA 1OYOA 2CHUA 3VPCA 3OZIA 4FBLA 3WKEA 3PFGA 4OP1A 4EYGA 1LDYA 5AXAA 3KJIA 1JGTA 1JS1X 1KYYA 1O94C 1PWZA 1G7RA 1R4NB 3MSCA 3ZHQA 5DVZA 1YZVA 3AW8A 1E1CB 1RQPA 1RXCA 4YV1A 2UZ0A 3FPFA 4PHCA 2UV8A 1UXIA 4P34A 1QOQB 1TIPA 3TW4A 5DXFA 3BFJA 1QPGA 1H3NA 3RROA 1THMA 2EL9A 3TLKA 1X1AA 1SD2A 1KY3A 2HF7A 3AUTA 3JCZA 3I05A 5G0WA 4D4HA 1N3LA 4ZKDA 1GV1A 3CZPA 2CLDX 4K9KA 3THWA 3PDWA 1X7ZB 4JQYA 2GNAA 3CF4A 3F74A 4PX5A 5LKRA 2X4LA 4IFBA 4R8RA 5CNIA 4QXPA 1MG0A 3I58A 3T7RA 3UATA 4QQKA 1GZVA 1EG7A 4HG2A 4I6JA 2WLTA 5HJ2A 5DGHA 1Y8RB 1KYXA 1G0NA 1CVLA 1LU9A 2D2IA 2XDQB 3AR5A 1JIKA 2UYOA 4HNGA 4ODIA 4RPKA 4XLLA 4IIDA 5F2EA 2O2DA 1R0CA 3VHXA 1NX9A 1W36C 1EWTA 3ZE6A 3GG2A 3ESXA 2F55A 4F93B 1SC6A 2LP4Y 1JEYA 4IP0A 4MQMA 2IXAA 5AK0A 2E1PA 1WXEA 3SOZA 4DUZB 2OD9A 5JHGB 1ESNA 2IDKA 3PE6A 2OFWA 2VXOA 1Q19A 4HDSB 1DC3A 3U1TA 3IBFA 1KH1A 4Y9UA 2EZ4A 2FSHA 3JQ7B 2DFDA 5FPQA 4B8YA 2PLFA 2RKBA 2VR1A 3CZQA 3RR2A 4I5DA 1HXHA 4U5XA 1E1QA 1JMVA 4ZOQI 2BP7B 1ZAKA 3TQTA 3VPDA 2YVAA 4LF8B 1W35A 4RNDB 3R6TA 1G3IA 1T3GA 3L4BA 5EYPA 4Q3OA 3T7CA 1H1TA 2GAJA 2QUBA 3WC4A 2YJ6A 2I87A 5JE8A 9LDBA 1CXZA 1MAHA 4YREA 2GASA 1TL7C 2VSYA 1NXPA 3RODA 5BSWA 1GILA 4DDWA 2V96A 4N7JA 4I2VA 3WSWA 1V8BA 1XZQA 4N0DA 2REQA 4ZCRA 5ERYA 4KREA 2BBOA 1F9AA 1CZOA 1YZKA 3CWQA 4CLOA 3BQMB 4MSUA 1NDHA 1HLFA 3FCOA 4Q93A 3RCBA 3ZCQA 2QI9C 1JSCA 2YJ3A 2H6EA 3TLYA 2V7GA 3IMGA 5LBIA 1YRAA 3Q5DA 1CZUA 4QO8A 4O2BA 1SBHA 2DJIA 1W75A 2D2VA 4XEHA 4ZALA 1DMSA 3QFHA 4P08A 4TTPA 3LKVA 4PONA 1SUAA 1BJTA 2HWUA 4HLQB 4Q3LA 1XU9A 1Y5RA 3IP1A 2QRVA 3WMWA 4E5SA 1QHNA 3DV0B 4HD8A 4RCYA 3CLSC 2XBMA 4HDMB 3LUJA 1MRSA 2WF5A 4ONEA 3R7BA 4B71A 4KPYA 1JA9A 2Z6QA 1QRDA 2QTCA 3PT5A 4K1XA 3NH9A 5DB4A 1UBGA 5A4AA 1AK2A 2GBCA 2GJSA 2O2CA 3DFZA 1M34E 4FE7A 3VR2A 1WUIS 2CFOA 1D4OA 2HUPA 2WMOB 4LZZA 5EKDA 1PJQA 3RREA 4UNSA 2BEUB 1KVQA 1MENA 1Z74A 2DUWA 4OEHA 4EHLA 4MP3A 2RSLA 2B6HA 2GOYA 5CT8A 4OREX 1G59A 4H60A 4A10A 2ZJ1A 3INRA 1JG7A 2GPSA 2YDXA 5J40A 5BNTA 1FU8A 1G1MA 2FWRA 2OXFA 2X8JA 4MW4A 3T7IA 2HK6A 4LSGA 1ICEA 2CVPA 2I2BA 1A9OA 2GS9A 3KCNA 3P96A 3AR3A 3HRIA 1EX9A 4FW8A 4HO1X 5COBA 5BPFA 3SQXA 4YP9A 4JV5B 5EIFA 3PL1A 4MIOA 4W5JA 1OOEA 3FRHA 5GJVC 2OLEA 4YHBA 1RAAA 3JZDA 3RHFA 4C7VA 2BRUA 4D0GA 4MXDA 1TYZA 4ARVA 4EYQA 2JGRA 1WG8A 1FNDA 2V6JA 2WWFA 3OY2A 4TXNA 5LQCA 1E8NA 1W44A 1ZKDA 4HVAA 2CDCA 1X7HA 4OGWA 4CR8A 4YJ2F 1FLAA 2XUFA 3AIIA 4TWRA 4IFIA 4OHVA 2RHLA 1XTKA 3TRKA 2JEOA 1L5LA 1OZFA 1MABA 3PA6A 3KM0A 1B74A 3TB4A 2GN8A 4V24A 4Z3DA 1S4QA 4ICIA 2BTQB 2Z4SA 1W1WA 1H8HD 4OQYA 4R8SA 1BA2A 1ZC3A 1CIVA 3FRJA 2WOJA 3KQSA 3M9XA 3P1JA 4JBXA 3UV3A 1WMEA 3FSJX 5FP0A 3FPJA 4DUPA 4DY6A 2JCGA 5IRCD 1XX6A 3JASA 1L4EA 3SDSA 1UL1X 2PUHA 5IH3A 4ENUA 1IIRA 3AIMA 1Z56C 1K8ZB 1G16A 4DTCA 3ZTYA 1NXXA 4UDXX 1S01A 1GSHA 3PEWA 1JA1A 4M8NE 4UNNA 4M1ZA 5JNTA 1MNAA 4YMSA 2K5UA 4AUNA 2OUKA 3EPRA 4DQVA 5KVSA 2F1IA 2AI1A 1BHO1 1TCVA 1F51E 5JSUA 3AFGA 2EWMA 9GPBA 3MEQA 5CXUA 4IG4A 5K8TA 4AKTA 4NEQA 4JI8B 1J25A 1C0PA 1JJVA 1OAAA 1JFFB 3HWSA 1RPTA 3LQ1A 2QW1A 4FQ8A 4L85A 4NBTA 2D1SA 4YMWA 4LQLA 1FFAA 5DN6A 3WFZA 1HMYA 4I0WB 3ZWXA 4B35A 5CFLA 1OI7A 1P31A 4BV9A 2NO1A 2WZBA 3BXGA 4RPGA 4DV3B 5IKXA 4KK4A 1J21A 5KQLA 2YRFA 4MV3A 1YRHA 2JW5A 2YMMA 4J03A 3TOVA 1E0DA 1SC9A 1AS3A 2BN4A 4IO0A 4WPGA 3RC9A 4D0SA 1U9CA 2A7XA 4LJKA 3JAKA 2ABWA 1AKNA 2PKCA 3DOHA 4YRCA 4YT5A 3KZKA 3I30X 1SIBE 4XQCA 2WAOA 3FF4A 4JLWA 4DSUA 3FDFA 4BGEA 3TRHA 1TXGA 1HE1C 2JLSA 1XF9A 3D8NA 2SNIE 3EXFA 3BK1A 4A6DA 4DR1B 3PA8A 2WPDD 2H3EA 1E7QA 3N39C 2I8CA 2PGLA 2RJ3A 3BFVA 3L0ZA 1NGSA 4EJ0A 5LL6P 1O2DA 1TJ4A 4GVXA 5FT9A 3RJZA 2RONA 1DMRA 4ZAGA 1XXLA 1QQ6A 4DSZA 4G0VA 2O52A 2QTHA 3RU9A 1Z8HA 4OI1A 3REFA 3QUQA 2I1LA 1ZGZA 4G36A 3WIOA 1XLVA 1RBMA 4GC5A 4W9NA 4ABYA 4H7FA 1RKXA 4BFWA 3VR4A 3VR5A 2JFWA 1FDVA 2SHKA 2D54A 2IIVA 3CCBA 3M0EA 1Q7GA 1WY7A 1P1JA 4UZEA 4RTSA 2UVDA 2NVUB 5K8LA 2JFVA 4H3SA 1DC5A 1I10A 4L7QA 3L1HA 3P2JA 3RUAA 2BT4A 1UMCA 4R5MA 3UWKA 2GN0A 4BO5A 1DP4A 4UBKA 1V1MB 3PTAA 1JEJA 1EMDA 1CY6A 4X20A 1SQ5A 4GC9A 4XIIA 2VJCA 2ZRDA 1A96A 5BR1A 3GWGA 2YWRA 3ETLA 4JASB 3ASVA 2ZBQA 2D13A 2YZ7A 5ALXA 3TXYA 4CM9D 2XCIA 4HB3A 1FFDA 5AK6A 4RC9A 3U3OA 1DGQA 2C95A 3OT5A 3SN6A 3GJ3A 1L3BA 1IBRA 3NHFA 2Z3ZA 4GG1A 2VF7A 1KO8A 1D07A 4U4AA 1VE9A 5EP4A 2CF6A 3ETJA 5I3CA 2AC4A 3SCZA 4CL8A 3EOBI 3F6SA 4TTAA 4URZR 3ZDQA 4EFDA 5LXTF 3QLVA 1P9LA 4Z1OA 3FD8A 4PCVA 1CHNA 1ISSA 5EZ6B 2XBUA 5JMPA 4ECAA 3OZ7A 2FP4A 5FL3A 3T0GA 2EFYA 2X9LA 4XYMA 1E2IA 2OBBA 3AXSA 3BGWA 3MWGA 4CU2A 1B43A 3OJFA 1V1JA 1SHJA 2I22A 1D8AA 4U0JA 4OQZA 1TUGA 4RJ2A 4D9NA 5JAUA 3IKLA 1Y80A 4N7RA 1ZI8A 2XLBA 2G07A 3E18A 1DTWB 4JVLA 1I4LD 4ETMA 3R9IA 4W63A 4C6TB 3BMCB 2GZ3A 2IW3A 4GICA 3C4VA 1JI3A 2HSZA 3AVXA 4OM7A 1D2RA 1I2BA 3IV9A 1VPLA 3ED1A 3A14A 4JC4A 4LZOA 4NMLA 4DR4B 1RHQA 2F9FA 1WLSA 2AN4A 2IHUA 3HBMA 1NBOA 2V0NA 3G2LA 4C21A 1CQJA 2W8BB 2BBTA 4CMIB 2ZBUA 3WGGA 2V98A 4EHDA 5IC4A 4OI0A 4PZUA 5ALYA 1QJ4A 2H4HA 3VHLB 2OM6A 5LMUB 1XRNA 4N82A 2AF4C 3M89A 1XQVA 3HCWA 3ED5A 4JOQA 5KKAA 3S2SA 1JDPA 2J3QA 3DOFA 1NHWA 4QPJC 1E3SA 4Y9DA 4XPZA 4GXTA 3VXKA 1USIA 4DRYA 5LLTA 1AHNA 3AO0B 3EFBA 3DYIA 4JUFA 3WDMA 1BX1A 2FMHA 1WZEA 4B3JA 1FMLA 3D4PA 1GLVA 1QFYA 1RPNA 4U7JA 1T3SA 5BQ3A 2C7GA 2EVWX 2IKQA 4RY0A 4CEIA 4JMLA 2XNSA 4JUIA 3HEMA 1ECCA 3W06A 1VOTA 2V7BA 1QG2A 4KC0A 1JBKA 1FP7A 4HDOB 3WK4A 4YO8A 4YAUA 1VKHA 4FONA 4OMCA 3QPVA 4IVRA 4S1TA 4RLHA 4YRAA 4X1OA 5I7EA 2QZZA 3VDQA 4PLZA 3TLXA 2YQ5A 3DBRB 1P44A 3BC1A 3RS3A 4AXBA 1TAUA 1IB0A 1K6EA 1H6BA 3T54A 3D8SA 1H3EA 3GJSA 3A58B 5ALGA 3L6RA 4LZAA 1R00A 4NYIR 3SF8B 3B13B 3IODA 2IUEA 2WOOA 4FIDA 2O0HA 1ZCZA 5H3CA 3GGJA 1N0WA 2RBKA 4DCMA 1G291 3ZU4A 2O8FB 1QKIA 1JQDA 1IHXA 1XZEA 4MPTA 2VNKA 4L8FA 4E31A 1FRFS 5UKDA 2PVSA 4OHZA 2V7QA 2JCVA 2PX2A 3NBYC 3WR5A 4CF6A 5KOJB 1G8SA 3UJ7A 3ICVA 4KP7A 4B7ZA 2QD4A 1WNTA 3HDTA 1GPBA 3AEQB 5IVIA 5LUBA 1WXIA 4V0ME 5BSTA 3JR3A 3RO7A 1FSSA 2P9QA 2RC5A 1YCGA 4E09A 5A1JA 2V4MA 3DT9A 2WP0A 2G0NA 1HE3A 4LZLA 4YJ2B 1XUOA 4MIYA 5J2UF 1ZDMA 2PFSA 4Q3NA 3O82A 1MEEA 2PRSA 1PFKA 1DDIA 3OWHA 4WNIA 5T8KC 3V7FA 2FUKA 5E4FA 3EZ2A 4K9SA 3HB5X 3OKPA 5H82A 4I6EA 2OT3B 1XV5A 1ZGBA 1V16A 1U1IA 1BWRA 1J8MF 1U1EA 1OGJA 3D3KA 4RBNA 3MMNA 1KZ1A 3A1FA 3DDHA 5ICFA 2OD7A 2JLWA 1P3DA 2QM0A 3T35A 2VJBA 3FOAA 1LGYA 2C59A 2GCEA 2JARA 3I9NA 3SU8A 4KNYA 3BJEA 4BKPA 3WAKA 1LNQA 4IEEA 4KQWA 3UH1A 3HJGA 2YC4C 5AI8A 1C9EA 1Z18A 3ACCA 4GYWA 3I9KA 1FXWA 1KOJA 1Q1GA 2IA5A 3FCSB 4KH1A 4N3AA 4RZ2A 1MXHA 1UQRA 4B6EA 4YONB 5JS6A 2I3BA 4JK3A 1NQVA 1CB0A 3U1BA 1CHDA 1NVUQ 3ENWA 1KJWA 1EFHA 1KO5A 2ZJ6A 3K15A 3L06A 4U7WA 5KTRA 2AR0A 1JDSA 3WKCA 2YOGA 3RYFB 1S1MA 2PQ0A 3DKIA 3OIYA 4KLRA 2VK2A 3AYZB 2FETA 5IAKA 4AZVA 2BMFA 4WOBA 2PZLA 3ZHTA 5JBIA 2BCEA 1N6IA 2MSEB 3UJ3X 4FLEA 4MUIA 1GCUA 1I4TD 2HREA 2Q2QA 4OUDA 4RELA 5D3MB 2QX6A 3V8RA 5HRUA 2I76A 3CNLA 3NHRA 3K71B 2PPVA 2QMEA 3A11A 4L07A 3UTCA 3JSAA 1TCAA 1WMFA 2XVMA 3EF1A 2FVYA 3MT8A 3VMMA 4RSRA 2XEDA 2NPFA 1F8UA 3NWPA 4X00A 4JBIA 1QYDA 5K3DA 4GKVA 4CCAA 5DX1A 1O7JA 1SQ0A 1UWKA 2OGZA 2V6GA 3NORA 3FZEA 3QF4A 3DHEA 3T95A 4JR0A 4NQRA 5L7YA 1QYVA 4P58A 4F7DA 3KQOA 4U8HA 4F8EA 5JYBA 1ST3A 2VBGA 2QQFA 1XNQB 3PEFA 5IJ9B 1HZZA 4A0FA 2K7ZA 4MVJD 4F45A 4N01A 1YRLA 4Y1EA 4YN3A 5CMLA 2BGUA 3BIXA 4DZZA 1WEHA 2GCOA 3WNQA 1WAMA 1YMQA 3TPZA 1AHPA 3DFKA 2Q5QA 4MZDA 2YZMA 3AUXA 3K35A 2QT0A 5IXSA 3D6TB 1ZJJA 5GJCA 5BR4A 3W1VA 5HR5A 4LWPA 1NVGA 4J0QA 3AONB 3O9VA 2QLLA 4RMNA 2CNOA 2O8EB 1CETA 4R7GA 1BD4A 1ORDA 2G0AA 2FUG1 1N0UA 4JL8A 1GTG1 2B1JA 3S8YA 3MUOA 1Y7IA 1N6LA 3NJ4A 4BO6A 1W76A 3HY3A 1U98A 1EEXB 2YINC 3Q87B 4JLMA 4CLDA 4YCBA 4JJGA 1U9IA 4R4JA 1ISHA 1FB5A 2ZT5A 4J0DA 2PCLA 3GQVA 1XNHA 3SF0A 3STVA 4AMBA 2P75A 3TDNA 3V7UA 1SKQA 1M2VA 4E70A 1E69A 3ZTTA 4B73A 2B1IA 2E37A 4KW7A 1WUYA 3OF5A 1KQNA 5AKLA 3EEOA 5KZMB 1GTVA 3AERB 5HE9A 4S35A 5JOQA 5LXTB 2AOVA 4GX2A 2AYZA 1QIDA 5DM70 2I54A 1DEXA 3K9FC 1EYZA 2B8NA 3AWDA 4FYKA 4JGIA 1XQWA 5HEKA 3GA5A 3ZV7A 2Z9DA 3LX8A 4EI8A 2H1HA 2XCQA 3Q0TA 4W5RA 2APJA 2A57A 4NK5A 1NBMA 7ABPA 1GN8A 1E32A 1X1QA 3G7UA 2IEBA 1MJGM 1SCDA 3CUWA 5KYXA 2A3RA 3RSLA 4F97A 2B8JA 5JYEA 4NH0A 4LEIA 3OCWA 1ECJA 1JV2B 2ZJ0A 3ANYB 5CITA 3IL2A 3AOEC 1N7IA 4DTIA 1SHZA 2JCBA 5JAQA 4RGVA 1UMBA 2FKNA 1Z06A 1YVPA 1BCSA 1GZUA 2IS1A 3OE1A 3OAAD 4MW6A 1JJBA 2XQGA 3RRFA 5B5SA 1HR0B 1BVHA 4HWOA 2L69A 1WSDA 1YR6A 3Q1KA 4OVKA 2I2FA 4G86A 1YDMA 2QVBA 3O1IC 2AOWA 5DGDA 4QFCA 3W2TA 1K8YB 3L0YA 4A6EA 2NG1A 2Y8EA 4AZ0B 2YXPX 5L3QA 1U0LA 2F67A 4RF4A 1EINA 2NZ2A 4RETA 1SIOA 3PK0A 1DWUA 3OIVA 4RF5A 5TR9A 3LP6A 1F0PA 3PPIA 2I4MA 3F3KA 5HA5A 3IYLW 5TQ2A 1RRGA 5DT9A 3HGMA 4F4JA 2IL1A 2O1WA 4IOLA 4XGIA 4GXRA 1ZRMA 4PLFA 3RLFA 1E9BA 1FMJA 5IFKA 4YJGB 1E92A 2H92A 3ILVA 3VO8A 1WCIA 1NJFA 3KLNA 3RRZA 1NPDA 3DTNA 2PUDA 4KX5A 1JXQA 3GLFB 2W2VA 1G19A 4LJAA 1JN0A 3MWKA 2OE2A 4JFAA 3ZWWA 3SR3A 1YB2A 2K4MA 3I12A 3R0JA 4MINA 3IE2A 3DLBA 3MW8A 1X7WB 1E3WA 4TYYA 2PXCA 2ZS8A 3OIFA 1YIOA 4Z54A 1QCCA 1VJDA 2IHZA 3P9IA 4HADA 5J47A 4KQCA 3E9ZA 4LWZA 4RHFA 4DMCA 3FJYA 4QUHA 1SY7A 4EZIA 1E2DA 2Z95A 4NPAA 4PLHA 4CE6A 4EF5A 3A6FA 4URWR 3S1LA 2FN9A 2RGCA 4MPDA 4NV0A 1GGFA 3L18A 3N74A 3ZW8A 2BGWA 2GRJA 2YV3A 1PNQA 4HLUC 4JUBA 4BFXA 4ENRA 4PAOA 4ARUA 3L7LA 2R1VA 4YQZA 1K3UB 4ITRC 3VYUB 3KD3A 3MWFA 2J46A 4U7DA 3BIJA 2MSLA 1NMEA 3QOWA 4WNAB 3OPMA 1FTWA 3DVQX 5JSZB 3E1GA 1RMTA 1KI9A 4LKRA 4N54A 5I7RA 4DUGA 3CT6A 4BNKA 5AJTA 1WUJS 4BHTA 5J1SB 1D2AA 1JDBC 1XTVA 3OE7A 4KVAA 4PY2A 3R7SA 1LC3A 1WMDA 2I3ZA 3EXHC 1L9XA 3U56A 2GN6A 4DB2A 2W6NA 4KTVE 2YBDA 1O8BA 1PDVA 4NKRA 4UXHA 5ECYA 2C9ZA 5J2UB 4DCPA 2PKWA 2VNSA 5DX8A 4K05A 2Z8YM 3ON5A 1G8PA 2Q5CA 4G3XA 3CTPA 1KEWA 1IPEA 2OGWA 3D4IA 5H02A 3QITA 2FX3A 3ZDXB 2EHJA 4C5CA 4OH7A 4LF6B 1QZZA 1NR5A 1YB7A 3IURA 3JAWA 3MD9A 3NOVA 3WMFA 4DNQA 3F7OA 4BZXA 1NU8A 1SUCA 5J5VA 1Q2UA 1UEIA 4HDRA 1EFVB 3CURA 4D6XA 1ZXLA 1KHHA 1ADFA 4ZO4A 1NI4A 4ETNA 1W5SA 1T3TA 3Q3HA 5FWYA 1A9YA 4Z8YA 3PI7A 4UD6A 3UGQA 1M7HA 1N6RA 4FKZA 2C7PA 4Y2TA 2X6RA 5CGZA 1VLLA 2FG6C 3QKSA 1Q21A 2IHVA 2XGGA 2MCFA 2VUIB 1TLLA 1IXSB 1S6YA 1AKEA 1CUSA 1FFHA 4QKQA 2PKRA 2DECA 2QUAA 3NVMB 2W2QA 3D5TA 2PKQP 2H48A 3EC7A 5JO9A 3ZKWA 2NZXA 3ZZMA 5JAHA 1E4YA 3JQQA 1KE2A 2PKXA 3CLUD 2BGGA 3OT1B 3UHAA 4AMVA 3BTUA 3EZLA 2H5IA 4RYDA 1QMPA 4PW0A 3HXLA 3ESAA 5CVJA 5DWVA 4UNQA 3EVZA 4RO0A 2B25A 3SICE 1T3ZA 3X2EA 1N78A 1K63A 1LVGA 4BLOA 4PVDA 1W1UA 3HS3A 3UK1A 4FZ5A 3CLRD 4ZTUB 3PXBA 1Z2NX 4WBNF 4TL9A 2OBNA 2D6FA 1BMQA 1U8FO 3B9BA 4GPTA 2XA2A 3VNQA 5K6AC 1WB4A 4CT0A 4KWIA 2VH1A 2HK7A 4YT2A 5JCOA 3VAYA 4JYAB 1UUFA 2IGBA 5F64A 1SOUA 2B4QA 3I92A 3WTCA 2WF9A 3KP1A 1DLJA 1USGA 3IOBA 3PFCA 5FRDA 2XUZA 2RGBA 4DJTA 1CUFA 4KITB 5FJJA 3D2AA 4WL0A 1M2OB 2B5VA 3IIMA 1P33A 2NAFA 1O97D 1VYTA 2HWYA 2P1DA 1KKUA 2BH9A 3BZBA 3W5CA 5DTIA 1M6NA 3V2HA 3HPQA 4HC4A 4CFYA 4R2JA 4EJFA 1QONA 3WO1A 3E9DA 3KL4A 3M5CA 2B7CA 3G7NA 3BSYA 1GFIA 1F12A 4FGZA 1E6KA 1BS9A 2O7QA 2QP3A 2AA3A 2Q4RA 4JROA 1Z0IA 3PHIA 4OQEA 2R25B 4O1IA 2PR2A 1M0SA 1GTMA 2P6MA 3DJYA 5IASA 3I3SR 4NV3A 4PLGA 4ZQIA 1Z7YA 3HO1A 3U6KA 4G24A 1D2HA 4G84A 4ZI3A 3GJXC 4NI5A 3SX2A 3QNWA 4MMZB 4CKYA 3AG5A 2EWWA 3EDOA 3NFRA 3ZIAD 2HDHA 1FLVA 4OOFA 2XCOA 1JXOA 3D7NA 3OHSX 5DW3A 1V5FA 1Z4OA 2A9KA 1W6UA 1FJGB 2AGVA 1NUSA 1ZISA 3EB9A 3MINB 3HJFA 1E7MA 4DJJA 1Z82A 2Y0EA 3W9SA 2XXBA 1DIAA 1MT3A 1N2ZA 3E6AA 3I32A 4WWHA 3RKRA 3TLEA 3TZLA 4FB4A 1Q0TA 4A0GA 3HMQA 2H9IA 2YHIA 3QHPA 5J3JA 3VR0A 3RAJA 2BEJA 4O1HA 1H85A 3CVJA 1TYBE 3DOJA 4NRDA 3ROKA 4BXOA 3VC3A 4ALLA 3DW3X 4H6VA 3VUFA 4K88A 3CW9A 4AF6A 5LXTA 2WTMA 7MHTA 1UDBA 5HCIA 1YL5A 4RADA 2JK0A 3Q7TA 1NASA 2V3VA 3AQ4A 3QWAA 1V1RB 3RGWS 1N2OA 1QHGA 3I2GA 1TF2A 3Q7EA 4DDMA 5JD4A 13PKA 1FJXA 5CH3A 2R4QA 4IR7A 5IW8A 4UBJA 2OFFA 3C3YA 1RYHA 3MUEA 1U2GA 3K1JA 3EDYA 3SXJA 5EHIA 4RTOA 1E63A 2ATEA 3WQSB 1V71A 4Y2VA 1JVNA 3A1SA 2TMYA 5FB3A 4ZT3A 2IE8A 2P7IA 1XDBA 3S70A 3ZQJA 2PBRA 1X8JA 5AOBA 1C3OB 1EDEA 5A4MS 1P0QA 5AVOA 1YS9A 4LDRA 5BT9A 5BUSA 2PUTA 1WB9A 4PNPA 3A9WA 3E9NA 2XCLA 1MDBA 3HO6A 4M0KA 5HBRA 4AJKA 4G0XA 5B58C 4BL5A 1FSPA 1HK7A 4O0LA 5H68A 3HSSA 3LOUA 4D8UA 1Z2EA 4NENB 3MJDA 4R1QA 1VJRA 1XD2A 2OCAA 3AUYA 1BJKA 3EG9B 4H1UA 4X1IB 2WJGA 5ERXA 3S4YA 4NTZA 3CF6R 2TMDA 3UYLA 4HR7A 3FIJA 4RE5A 1GU0A 3K0CA 1KBZA 1LPSA 2AVDA 3PVCA 4UCFA 3KZOA 4XX0B 3U7HB 1HNXB 1JJFA 1XQXA 2I5PO 3QLUA 2F48A 5JH7F 4N8SA 2ZWVA 4FS3A 4IAOA 3SC2B 1QCYA 2XCSB 5HGXA 4CQLB 3Q5GA 4MVJP 2CUKA 3GJQA 3MGGA 4IDPA 4HGYA 4PYLA 3NVKI 3H42B 1DVRA 1Z35A 4QGHA 5JECA 3KOUA 3F5DA 4KV7A 1UBEA 5KOHA 5LQAA 3O9ZA 4IMRA 5K2MA 2JL1A 4IGEA 3NWBA 1DEOA 3EN0A 1II9A 5H1YA 4RZQA 1BMFD 1T1RA 2VJDA 3CEMA 4BC0A 3CQ9A 2AMYA 2XADA 2ZB8A 1QYCA 3LFTA 4MIKA 4ZVNA 1YOBA 5DHRA 5ENZA 1Y42X 4BUZA 3AJAA 1H1DA 4CLRB 3DAOA 3HKBB 2HOQA 3D2CA 1JB9A 3QTBA 2H1WA 1B3RA 2XTNA 5A1TA 2XUOA 1O6BA 1XWWA 3GQBA 1IRIA 3EBOA 4JYBA 2COEA 1BN6A 2GHRA 2ZK7A 1N9ZA 1TK2A 1XZJA 2CNWA 5EIAA 2JAHA 3CRRA 1D7AA 2UZ1B 2ZAMA 3BRCA 3K5WA 1NJ1A 4EB8A 4TXJA 2R8XA 2I67A 3CLTD 5EMNA 3CPEA 4NZZA 4LZNA 3SNHA 3VI4B 3TXAA 3ZZNA 1V9SA 2D2FA 2YWBA 1IJKA 1SUBA 2ZATA 4CM7A 1KYZA 3WWPA 3VR6D 3AP3A 5IAEA 3KXPA 3UG7A 3KJGA 1IZ9A 1BEZA 2Q3DA 3U39A 4NSNA 3MGCA 3EXEA 3MRTA 3T5BA 1Z34A 3DTVD 4V0SA 2DLDA 3IUNA 3QV2A 1JHMA 1EXNA 1JAIA 3HL4A 4II2A 1XEXA 2NSJA 4Q18A 4AP5A 4BNVA 1IONA 1M1YE 2VH5R 4BQRA 5EJ7A 2XE4A 2I6TA 3P8ZA 4O4HF 3LX6A 3ZLJA 1R6BX 5I9BA 1Z63A 1TJ3A 2I6SA 2HJRA 2QQ0A 2XEXA 3BZUA 3L9XA 3EAGA 4PZPA 1BVYF 2XUPA 1QK5A 3KVVA 1G20B 3ROQA 1XZCA 3N2LA 4LJ6A 3ZWDA 3W05A 5KYYA 1PS0A 1Y34E 1Y1LA 4ND8A 5LP6F 1G3RA 4GPZA 4H6XA 3AHFA 5IZCC 3FDZA 4MI1A 5TPZD 1XG5A 3A10A 3PYMA 2MR6A 2PSHA 3HGTA 4HAXA 3S40A 3PUHA 3ST7A 3WBFA 1CF2O 3ITDA 3ROFA 4BZZA 3UAOA 4M6WB 4K9MA 2ZI3A 2H8GA 4GZMA 2EL7A 3G1UA 4XUEA 2VSFA 4C30A 1O3YA 2GPJA 3AVUA 1SOAA 2F17A 3KB1A 2R751 4ZOBA 1HLDA 1ZUHA 4Z9BA 4WLOA 5TF4A 4BECA 5IT0A 2HH9A 1U8EA 3ZCXA 1IHDA 2G06A 1R6DA 4HKTA 2HF2A 4HWTA 3BGVA 4IZHA 1XROA 721PA 3AU9A 1TD9A 1JQBA 4TQAA 1BU5A 3P19A 1PYOA 4I1SA 5EE9A 5FPPA 1E1CA 1E1LA 3RYTC 4HNQA 4PSKA 7REQB 2OBMA 1U2SA 2B30A 3GUCA 1N6OA 2GN4A 3JVIA 3R3JA 3OX4A 2EF0A 4ZYLA 3O95A 3GJ0A 1U9YA 4N41A 3WLAA 2OR3A 2VHTA 3ZI7A 4AJPA 3R40A 4R3NA 3FDIA 5H5JA 1J42A 5ANRB 4NCBA 1E1DA 2IU6A 2HL6A 3TZEA 1X7ZA 5JEDA 3OQ1A 3DFIA 4TTTS 2JKZA 1HZJA 2QSUA 2XF2A 3VOBA 3VTFA 1H2RS 3IT0A 4WBNB 2CDNA 1T29A 1O95D 4BE9A 3KZVA 3R7NA 3OFSA 4ZYUA 4AX4A 3GFBA 3JQBA 3M7IA 2EARA 3A04A 4TWJA 2CLCX 3IQZA 4HATA 5TRTA 3BWXA 4RKRA 4UAUA 5L53A 2X8WA 1G8KA 1D4AA 2RHTA 3A3OA 4WW0A 4RJTA 3K70C 4RMIA 1PD0A 3BCHA 5E7JA 3HFJA 1VGRA 3L5OA 4CIAA 1E6UA 4RZUA 3WK6A 1OPXA 5JRJA 2ZFUA 3EDRA 3CFYA 1OXMA 1F8YA 1QH9A 1UBOS 3FZQA 3KT6A 3NZEA 4FXOA 4L8GA 4HDSA 1GFWA 3N2NA 1S9DA 3JQ7A 5D7NA 4AT1A 2WW8A 5IVKA 1UT6A 4YJKA 3KKOA 4I8XA 5HIKA 4FHZA 5I7UA 2WMYA 3EASA 1B2RA 2P2NA 3E9MA 4YWHA 5BW8A 4ZT5A 3G9XA 1RE1A 4G26A 1NV8A 1JDVA 3WAJA 2KBFA 5HCUA 2MDTA 1AS2A 1BKDR 1OFGA 3V1LA 1U2ZA 5AKGA 1Z33A 1RAFA 4CM8B 5IC5A 2H9YA 4KDFA 3PKIA 3M1YA 3M6FA 5JXWA 2X19A 1F4PA 1K0UA 3ANXA 2K6GA 1NQ5A 4Q1AA 1O94D 4XWKA 2O8BB 1O89A 1U2QA 1QBGA 3OFND 3SD7A 4OCZA 3HUDA 4J4TA 3FNEA 5BNZA 4OJYA 3B20A 4KFRA 2GBGA 3DV2A 4YLYA 2QE7D 5IZCA 1DKLA 1FUUA 2VAMA 4GLBA 3ZW7A 2IYSA 1FU4A 5E0OA 3IVMA 3WHIA 1PX0A 1K4MA 3G59A 3V1MA 1A69A 2ID7A 1I4DD 4Y2RA 3L04A 3E7FA 3FHJA 4FDAA 3VX3A 4Q1EA 1T5DX 2ZTVA 2WFAA 3BICA 3D7KA 4OA5A 1OFTA 1A7UA 2QWXA 3DV0A 2XWBF 3N5KA 3WRVA 1Y8QB 4HDMA 4EKEA 6LDHA 3WISA 1DRVA 1ZNZA 4WHMA 1BEUB 2NVOA 3WLLA 4F85A 5IT4A 3A9RA 3NCTA 2E0IA 4G4SP 2FLKA 4FGSA 1W36D 2AKEA 4NBUA 1SCIA 2Z9BA 4X3PA 3AU8A 1OT3A 1V5WA 4GWLA 2QLTA 2E6UX 1KI4A 3G8DA 3I9FA 1BQ4A 2CCGA 4R8KA 5AP9A 3F5QA 4Z2YA 2DWOA 4C9BA 2AUTA 4BNNA 4AY2A 4JHXA 1E3DA 5ER6A 3PGLA 3L43A 3C1AA 1VHTA 1Q57A 2BEUA 4IIUA 1JW9B 4BE4A 5I8WA 2BMDA 1T3LA 2ESRA 1ZINA 2UUPA 4AFNA 4ABTA 2ZZNA 1DAEA 5DHPA 3SJZA 2O59A 1E9FA 2ODWA 3K5HA 4DWJA 1A4XA 2FPPA 3RSCA 3FSGD 1JIJA 5DCWA 3PD1A 4B44A 4C7OB 4YS6A 2NYVA 3O03A 3JYOA 4KN8A 1V3TA 1Y8ZA 1XXHA 2XIJA 2CLIB 1Z07A 3O2JA 2WNIA 5KNCH 2MHCA 4GSLA 2FPRA 3DLCA 3H2SA 1EFRA 3CRZA 4M37A 4OQMA 2JFHA 1DRUA 3QKWA 3G85A 5CXSA 2QSYA 1QTQA 2GM5A 3L7DA 1NFFA 2H54A 4TXHA 3SFTA 3SKVA 2E4YA 3RQIA 4BP9A 5I7HA 1EM8B 2RBEA 5JI3E 1RIFA 4OMUA 4S1WA 4ZZ2A 4LQCA 1KK0A 3EXIB 1OT5A 4KQGA 4XFKA 4D9IA 4M9ZA 4E4YA 4BMXA 2ZRJA 4EYOA 1FUIA 1GFZA 1SHKA 1UJ4A 1R0BA 3ASYA 5JH7B 1GVNB 2E55A 1M2WA 4MRVA 4YRFA 1UJMA 4AIIA 2OP0A 1AOXA 3FI0A 2J9GA 2PUJA 1GZ3A 4ZC1A 3RUCA 3EMBA 3TEMA 4CMEC 1KPHA 4P5EA 2ZUEA 1VZ3A 2QTTA 3T3NA 1OD6A 2BTQA 2W83A 1EK6A 3BSWA 1Z6AA 1SN7A 4IXTA 3DMDA 1WPGA 4LIPD 2BFWA 2CBGA 4D82A 1QG6A 4CNQA 2BGJA 1V6CA 2D1TA 1YXMA 5FPYA 3SZMA 3E9EA 4OK6A 4R2IA 1F1BA 2PWAA 3QWFA 4I5EA 4X92A 4EB3A 5I8PA 3JWEA 3TOXA 1KP2A 4GYKA 1U0BB 4YRLA 4BO1A 3LUKA 3W4KA 4HOYA 4WNCA 5JARA 2OYSA 1YVDA 5FUXA 3CF4G 4ZDJA 3HU1A 3OU6A 4F5EA 3KYJB 4MROA 1N2CB 2V6MA 4IBOA 3V4LA 4WK4B 5BUZA 4RTMA 1P4JA 4HRYA 3W5BA 3CYFA 2DKFA 2JDIA 4RANA 1QLHA 3B12A 1PVDA 3SSMA 5HKAA 4GDFA 4D9EA 3WKBA 4AJHA 3EFOA 3ML1A 4ML3A 4QO7A 4LHVA 4WDRA 4ZQFA 5D00A 3AR8A 1JFFA 2I4TA 5A3QA 4XYEA 3JQFA 4IDQA 3MK31 4LMAA 2XXAB 3TRJA 1CJMA 3HFRA 2I55A 1QC5A 1U0HC 3SOPA 3KSZO 5GJWC 1EA5A 3Q9UA 1XFDA 1LPOA 2VZ0A 1NSTA 3E9CA 2I29A 4GPAA 1DRKA 5FBKA 3SJUA 4NG5A 4KXVA 4NQZA 3BL5A 4C3OB 5KNBA 4Q6WA 3F3YA 1NOKA 5IJ0B 5HZMA 2Q5HA 3NONA 5LP6B 3RK4A 1ECGA 2ZBRA 3G1WA 1ZGCA 3C3EA 1XA3A 2P79A 2V7TA 1STOA 1U8ZA 1YZYA 4MYHA 4A7PA 3GZ4A 2NAPA 4Z4GA 1H2BA 3CM0A 2EFHB 1FPMA 2FUG6 1FXSA 1PR6A 3FWHA 2RGNA 3NX4A 5E1BA 4ERNA 4PWZA 5IVDA 4C7MA 2B3TA 4K1LA 4OHXA 2ZVJA 3N58A 1PJZA 1OWOA 2FRXA 3CIOA 2PYZA 4KYTA 4XPIB 1WDWB 4AUEA 1FNMA 1LNZA 2W6JA 1KAEA 1HL3A 3W79A 2JHCA 4D98A 4EG8A 2H07A 5KSYA 1DB3A 3P4XA 4KIUA 4G1UC 5LC1A 4D9JA 5KPDA 3C3PA 4YRDA 4OK5A 2BFEB 5CBPA 5HQTA 1N4AA 4WOJA 1Z0FA 2GUWA 1NUUA 1FRZA 2OHJA 2VHXA 1T0JB 2P1ZA 2X86A 5CT9A 2QVGA 1CWUA 4CM4B 2DPHA 3OLCX 4FHCA 2EU8A 4I8IA 4EGQA 1P7WA 3N0TA 1X1TA 2NVUA 3HCCA 2C1XA 4U2KA 5EG5A 1ZIOA 3REQB 3VO2A 4B76A 1J24A 1RCTE 1V39A 3R3VA 4V0OA 3FR8A 3OBBA 5CVVA 1V1MA 1WSBA 1S0UA 5GONF 4JOBA 4LY6A 4IQ4A 5FUWA 5A5DA 4YJHB 2C9CA 2NV0A 2PFKA 3IR7A 2O3SA 3YASA 2ONJA 3ESBA 3LH5A 4AX8A 3IUYA 4M8IA 5AVKA 5BN1A 1GNLA 1T2AA 3CG4A 1K2VN 4UE3S 4S1OA 1JZTA 1MEOA 1RMYA 1UEJA 1YNOA 4B8WA 1BE8A 2X5NA 2QNBA 1E9CA 2TMKA 3C6KA 3LMKA 4IW3B 1XTQA 2XDAA 4FYVA 4JZKA 4RMHA 4YCSA 1I36A 5A2QA 3RK0A 1NZDA 1ZS9A 3KXIA 1PL7A 3VPAA 4RW0A 3IP7A 1FFGA 3ISJA 2QZ4A 1Q1QA 2RGUA 4F84A 4JLOA 4D46A 3LGXA 3D8BA 4LE1A 1QM5A 1N92A 2FG7C 4FI3F 2FFAA 1ZN8A 2C8VA 2G1UA 3V1NA 4DLUA 4UMEA 3IDZA 5JVDF 2O3UA 3Q8LA 2VYVA 3IEIA 1RWBA 1E3JA 4R1NA 1EDZA 3MB5A 2ZT6A 4B79A 2QD5A 2FSUA 1DTWA 3EMDA 1Q1EA 1QZXA 2QY6A 4JR1A 1IEWA 4QQRA 5EHZA 3BMCA 4GMKA 3TLAA 3D59A 4D9KA 2XRZA 2JZNA 4IG9A 2PEYA 5AVRA 2QN2A 3F2VA 5JR3A 5K45A 2VRCA 2GYUA 3RS7A 1IZZA 3I64A 4BMSA 3KYBA 3IKVA 4I08A 1ZGJA 2W8BA 1YQEA 2R7AA 5KBYA 3UMYA 4CTJA 1HDRA 4MDFA 2A3NA 3L0BA 3BWVA 3FBTA 3S1AB 4X7RA 3FFWA 4J3FA 1C0EA 2P62A 3FE2A 4PC2A 4EPYA 3MS2A 3PDJA 1P2BA 4P8RA 1WXFA 3RSOA 1FA9A 2XT6A 2EHDA 4IIEA 4ZEMA 1GCIA 3H5VA 3LCCA 2UVPA 4NJOA 4AM8A 3QOYA 4P86A 1ZUIA 1BOOA 4FOLA 4RV4A 1P5HA 4G8BA 1SNYA 2HRQA 1CUUA 4UAVA 4XSGA 4Z9XA 4Z3OA 4FS8A 3CXRA 1YE8A 1IN7A 3AUUA 3LA8A 4LXIA 4NABA 2HV9A 4HAIA 1DKPA 4QGSA 3KETA 2PM8A 1VIYA 1EIZA 1EVYA 4HGRA 1S1CA 3TYXA 1HEYA 2GBLC 1FK8A 1ZQ1A 3RTGA 4NWIA 5DNCA 4HTFA 5T4BA 5DYGA 1HE2A 1C3JA 2JI9A 3HWX1 3ZOZA 1Q3KA 2OEPA 1SXJD 1RWPA 2MOKA 2YOHA 2Z2IA 1L7AA 3ANNA 1XZIA 2A5LA 1T9AA 4GUDA 4WLEA 3PLRA 3DBRA 3WIEA 4TYPA 1KJNA 2WDPA 2X9QA 2AMVA 3PBKA 4EAQA 5JEEA 2C04A 2GWHA 2VPXA 3C7DB 3DTVB 1FUYB 2PV0A 4O63O 4EPTA 4R01A 4F5WA 4LTNA 1I0LA 2OXIA 4E30A 1A5SB 2J32A 4TMKA 4G41A 3WB2A 1Z8NA 1NF8A 2YS7A 4PQGA 4BKUA 2O8FA 1V7ZA 4Q7QA 1AA6A 5L8VA 3PXAA 1QPBA 3ZHVA 1LF0A 4ETIA 3EIHA 2GCPA 3T52A 3ESDA 4TKMA 1KP9A 1JHZA 3SKYA 3ZJ4A 3GP5A 5KOJA 3V6LA 1XXHE 2A59A 4UEWA 1T0HB 3QMPA 3AEQA 3LHKA 2ZWPA 1OBFO 3F9RA 1PEDA 3GZNB 3GO4A 1RXEA 3JALB 4EY5A 1XCPA 3UJ6A 4Y9TA 2VTBB 1M75A 1JG6A 1GIAA 2KPOA 3WJ7A 3WMEA 2PVCA 4KGZA 4DV2B 4YJ2A 1DT5A 4RPHA 3E9QA 2QXYA 1TADA 2FOIA 1YR8A 3AKEA 4HDCA 3B6ZA 2HB6A 4DL9A 1WV1A 2DWQA 2VJYA 5TB5A 1A71A 4BVAA 3EIFA 4FYYA 4XUDA 1RI4A 2W7TA 4RCZA 4BZWA 1I5EA 3PFFA 4IV8A 2VEOA 4BFUA 5DW0A 5JBQA 1XD9A 4WESB 3LXRA 4HZGA 3G13A 4YAJA 2Q2VA 1I7DA 2O3QA 2Q4EA 3KL2A 4IMJB 1COZA 1H4TA 1PK9A 2R7MA 3KOZA 4RHTA 1AC5A 1NWCA 4MVYA 1P2VA 1HTBA 1QZ3A 2QORA 3M5PA 4OH1A 5AKXA 1KE1A 3TO5A 3JQRA 5A5VA 3KQNA 1RWWA 3KAJA 4UUAA 5CB4F 3LUAA 4E12A 3I5MA 3PJGA 1ML3A 1RHRA 4XWAA 1AKQA 3FUCA 2R4UA 3D1LA 4NCHA 2G9VA 3QKTA 1PL8A