3NJRA

Crystal structure of c-terminal domain of precorrin-6y c5,15-methyltransferase from rhodobacter capsulatus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
184
Chain Sequence
MSQVPGRPESAFAHDGQITKSPMRALTLAALAPRRGELLWDIGGGSGSVSVEWCLAGGRAITIEPRADRIENIQKNIDTYGLSPRMRAVQGTAPAALADLPLPEAVFIGGGGSQALYDRLWEWLAPGTRIVANAVTLESETLLTQLHARHGGQLLRIDIAQAEPLGRMRGWSASRPQLQWSGQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-6y methylase
publication title An enzyme-trap approach allows isolation of intermediates in cobalamin biosynthesis.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Transferase
total genus 56
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.1.1.132: Precorrin-6B C(5,15)-methyltransferase (decarboxylating).
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3njrA00
5HIJA 1QAMA 2HTEA 3GDHA 1NKVA 5E9JA 2JHCA 4OA8A 5CM2Z 2VDVE 5CUQA 4HGZA 2O05A 3VYWA 2Z6QA 3LCUA 3LCCA 4QTUB 3IHTA 4LG1A 2AOTA 4X1OA 5GM2A 1DUSA 1G60A 1AQJA 5FADA 3FYDA 3KPJA 5GM1A 3DULA 5C0OE 5DX0A 3REOA 4CTJA 4HH4A 1R00A 3MAGA 3NVKI 3FTEA 2H00A 3TLJA 5DSXA 3TMAA 2CMGA 2ZW9A 4KWCA 3KQQA 1XJ5A 5D1NA 5K0LA 5JR3A 3OZSA 5EHIA 2EX4A 1SKMA 2ZIFA 2C7QA 4OX9Y 3NW9A 1KXZA 2UYCA 3SMQA 5CD1A 3GWZA 3RODA 4GC5A 3OZTA 3CJQA 2FPOA 4FSDA 3BUSA 3P9CA 5DRYA 2AOXA 5KVAA 3NWBA 4GOMD 4HTFB 4FT2A 1QZZA 4EQZA 2A14A 4RTJA 3ELUA 4PWYA 3HM2A 5LQNA 4QDKA 4A6DA 3FPHA 3I58A 2FK8A 4ZTBA 2R6ZA 1YZ3A 3A25A 2PXXA 3UA3A 1ZG3A 2PX2A 3FPGA 3HVJA 1VE3A 4OBXA 3BWCA 4RTNA 2ZZNA 4E30A 3FUVA 3HCCA 3MQ2A 3EVDA 3KPVA 2ZFUA 2B9EA 2I62A 1QAQA 4DF3A 4F85A 4YV0A 1YF3A 1JR4A 4IKPA 5FCDA 3A27A 3E23A 1SVUA 3CKKA 5E9WA 2AN5A 3O7WA 1DCTA 4R6WA 2NXNA 3M33A 3UJDA 3CC8A 3DMGA 3R3HA 4ER5A 1NE2A 1R6AA 2G70A 1JG1A 4H0NA 1D2CA 3MGGA 3TRKA 3KQWA 5DTMA 2ZWAA 4XUEA 1G55A 4OBWA 3VC2A 1Q0SA 3KQPA 3TM5A 3KQMA 2HV9A 1YB2A 3NVMB 5E9QA 1L3CA 4KDRA 3K6RA 2XVAA 3MB5A 2PWYA 3B3FA 4MWZA 2P3OA 2IDJA 1XCJA 3KHKA 3KR2A 3TR6A 4DZRA 5EZQA 4AZSA 5CIYA 3DXXA 1JQEA 4MQ4A 2OYRA 2OZVA 1NW6A 4V0RA 3HCBA 1N7IA 1JG3A 3NJRA 1KYWA 2P41A 3C6MA 3EGEA 3FTDA 4KRGA 5CCBA 2BR3A 2JJQA 2K4MA 1G6Q1 5D1HA 5K01A 4GOND 2Z6AA 5E1BA 5K0CA 3ERCA 2H1RA 1JSZA 4IV0A 2AOTB 1X1DA 2O57A 4FR0A 3NDJA 3S68A 4RTMA 2OKCA 3DH0A 4CWAA 2GPYA 3T7RA 4PYJA 4POOA 4DMGA 5KS2A 4PIPA 3KPYA 3MTIA 3MTEA 5DRTA 1VQ1A 4OQEA 3RIEA 2ZBPA 1NW5A 2AOWA 4BLUA 4GQBA 3CJRA 1ZKDA 5DM2A 3OU2A 3EGIA 4E2ZA 5K0BA 3LCVB 1RI3A 4R6XA 3T7SA 5ICCA 5GIPE 3VC1A 3GIWA 2JHPA 3GU3A 3ME5A 4DCMA 3GXOA 3KR9A 2CWWA 3G5LA 3UZUA 4A6EA 3K0BA 4PNEA 5IH3A 1R8XA 4M37A 3GRUA 4E31A 2CKDA 4E33A 1OR8A 5ICFA 1SUSA 5FWAA 2O0LA 4FZVA 1MHTA 3FUTA 4QDJA 1BOOA 3P9NA 1EQAA 4AUKA 2LD4A 3OFKA 2PT6A 2NYUA 5E2BA 1M0EA 3LKZA 4XUCA 1T43A 3EMBA 5F2OA 3UJCA 4RX1A 3EVZA 5FA8A 3EEOA 3LDFA 4QQKA 3GJYA 3QV2A 5HILA 1F38A 3LKDA 5K0FA 3GRYA 3HA7A 3BGVA 4QPNA 1WXXA 1R74A 5E1DA 2OO3A 3LX6A 2PVCA 1WZNA 3GRZA 8MHTA 3EPPA 5K05A 4YUYA 2C7OA 1AV6A 2P1DA 5EOVA 1JG2A 3TPZA 2OY0A 2PWPA 4PCAA 5FUBA 5GWXA 3NWEA 5HIIA 4CTKA 3JWJA 3R0QA 3FTFA 3GNLA 4RVGA 3U81A 4OQDA 4AX8A 1XVAA 3DR5A 2NNWB 4F86A 2CL5A 3T0IA 2QRVA 2ZTHA 5K0GA 4RTPA 5EVJA 2IBTA 3PB3A 4GEKA 2JHAA 5C1IA 1XDZA 2ERCA 2GAFA 1RJFA 3X0DA 2P3QA 2ZLBA 7MHTA 3HCFA 5T67A 3DXYA 3CGGA 1IM8A 3SXJA 3BXOA 4GC9A 5DM1A 4CKCA 2EJUA 2OXTA 2FHPA 5CCXA 10MHA 5F2NA 3FYCA 1IXKA 3EVBA 1NT2A 1O9HA 5G02A 4ER3A 3PX3A 4GOOD 2P8JA 2Y1XA 3FPFA 4PGHA 1NV9A 1TW3A 3KR1A 4B17A 4C06A 5FQOA 3P9KA 4KDCA 3A7EA 3KQTA 4PIMA 4U7TB 3EVEA 2OBFA 2YTZA 5HIMA 3SR4A 1YFJA 1FBNA 3BWMA 5P8WA 3QOXA 1EIZA 1NBIA 4BP3A 4QQNA 5LQJA 2OB1A 5CVEA 4RTLA 5EG5A 2O06A 1QANA 1ZGAA 3I9FA 3ORHA 4RTRA 2AVNA 1B42A 3P2KA 5GIOE 4DCGA 3HVKA 2PBFA 1HMYA 3EVAA 2WK1A 1UWVA 5LQUA 1D2HA 1XTPA 4RYLA 2NXEA 1I4WA 4AZVA 2NXJA 4YMHA 4GF5A 4QPPA 2IBSA 1VL5A 2PSSA 2AN3A 1ZHFA 2P7HA 2P35A 2NXCA 3R6TA 4LWPA 5E1OA 4BP1A 2NP7A 3DOUA 2Z6UA 4FT4A 3JWHA 2Q41A 3BWYA 4RTOA 3LDUA 5M5BA 5T64A 2P7IA 2ONZA 5K0EA 2ONYA 2IDKA 1JTFA 3FTCA 4LECA 2C7RA 3H2BA 1SQGA 1YUBA 3G5TA 1KYZA 5E1MA 2YR0A 5EMKA 2BZGA 2IFTA 2YXLA 1EAMA 3FPJA 3HTXA 1PRYA 3BZBA 3EMDA 3D2LA 4P7GA 5EIWA 4M38A 4YUWA 1JSXA 3OCJA 1ORIA 2QY6A 4GUAA 2BM9A 4KIFA 4MIKA 5ICEA 2HWKA 1QYRA 2QRVB 2WA2A 5FA5A 3PFHA 3KPUA 3V97A 4RV9A 3LDGA 4ER0A 3R9XB 3GCZA 2YUIA 2GH1A 1X19A 5EHGA 3IYLW 3KQSA 3HVHA 3BKWA 3DUWA 3A26A 3LECA 4PYOA 3UWPA 1G38A 1RJGA 3JWGA 1XDUA 2BR4A 5BW5A 4X61A 2IP2A 2IH5A 4DQ0A 1EG2A 2PX8A 4PYNA 3ER8A 2PXCA 3P8ZA 3M6XA 1F3LA 1XDSA 3DMHA 3NDIA 3FUXA 1BKYA 3BWBA 3CVOA 3DXZA 4PGGA 3PX2A 3HNRA 4P58A 4PYLA 2IPXA 5EC8A 3P2EA 3KPWA 5HIKA 1KP9A 2YXDA 4P7JA 4DM3A 3MHTA 5FWDA 3M6WA 3GGDA 4P7KA 5K0JA 5KQRA 1NV8A 3LL7A 3ID6C 4P7FA 1VP3A 3Q7EA 4RSRA 4RVHA 3AXTA 3UJ9A 3PVCA 1O54A 2UYQA 3CBGA 4Z2YA 2QYOA 1XCLA 5EGSA 3I53A 5C9ZA 1WG8A 2GA9A 3P9IA 4HGYA 4PCLA 1I1NA 1ZGJA 3FZGA 2ZBQA 1RI2A 1NW7A 4Y30A 3M6VA 2AOUA 3DLCA 4LWOA 3EVGA 2ZULA 5DTRA 4DKJA 2GB4A 3LBYA 3EVCA 3UFBA 5DSTA 2JH9A 3MCTA 1WY7A 5FULA 3LSTA 2O07A 4FGZA 4EMSA 3FUUA 2XYRA 1FPQA 2HMYB 3G2PA 5K8VA 1U2ZA 2ADMA 3DMFA 2I9KA 4BLVA 1KR5A 2OPBA 3QOWA 4PYMA 5IKMA 3AJDA 9MHTA 3P2IA 4E2XA 3FRHA 4E70A 1TPYA 1JG4A 2B3TA 1Q0TA 2V74B 3C3PA 3KQVA 2P3LA 2H11A 3OFJA 5K0NA 4CKEA 5HOQA 3NMUF 1XXLA 2PV0A 2JG3A 5EMLA 4C4AA 5E2AA 2B78A 3OU6A 5F2KA 2C7PA 3C0KA 4YUZA 4X63A 1L3IA 2ZVJA 4X41A 3SVZA 3SGLA 3MCZA 4PYKA 1VP9A 3TFWA 4G56A 4AZTA 2N47A 3KU1A 3HA3A 4IWNA 4EKGA 2VDWA 4RVDA 5U4XA 3B3GA 5DX8A 4YMGA 2PY6A 3KQYA 4XCXA 3IV6A 1JQDA 5DM4A 2DPMA 4RWZA 5K03A 2I6GA 1VLMA 3EGVA 4QVKA 4C08A 1P1BA 3KR0A 4FP9A 4YUVA 5B1SA 5FHRA 3TKYA 3B3JA 4GOLD 1P91A 1EJ0A 2PLWA 4R05A 1FJXA 1M6EX 2B2CA 4YV1A 3UJAA 3LBFA 1JTEA 2ORED 1RJDA 3NTVA 3PFGA 2IH4A 1HNNA 1KPGA 3A7DA 4EKIA 3OE5A 5EZSA 3DP7A 3UJ6A 5T6BA 3RW9A 4ER7A 3TOSA 2WA1A 3G88A 5BXYA 3G2OA 5EPEA 5K09A 4C04A 3EVFA 3P97A 1Z3CA 5HFJA 3SSOA 1X1AA 5DM0A 3G8BA 4XUDA 2FK7A 3HP7A 2PT9A 4UOEA 3WSTA 4YV2A 2R3SA 4JXJA 1P39A 1R18A 2AOUB 2XYVA 3R24A 3UBTA 2PKWA 4CKBA 3M6UA 1RJEA 3DLIA 2ZBRA 3VSEA 2F8LA 1PJZA 2ZZKA 4L7VA 1SUIA 4HRAA 5EKXA 1SG9A 2E5WA 4R8SA 4E2WA 4E2YA 2PGXA 5CVJA 1JQ3A 2AR0A 1G8SA 2ZWVA 1YZHA 4KVZA 1AF7A 3G8AA 1WS6A 5EEGA 5H02A 5HEKA 4K6MA 4O29A 3HCDA 4RTKA 3C6KA 2IH2A 4M36A 4RVFA 3TM4A 1RI5A 2GS9A 4WVLA 5EIFA 2XYQA 3G2QA 3AWIA 4F84A 5DLYA 4HC4A 1VPTA 2GLUA 5FTWA 2V7EA 4PONA 3ELWA 5EMJA 4MHTA 3V8VA 3THSA 3MERA 5LQCA 3EEYA 5ICGA 5KQSA 3ER9A 2BM8A 2KW5A 4R8RA 5LQKA 4KIGA 2AN4A 4M7RA 3A4TA 3HEMA 3F4KA 4U7PB 5FQNA 3AY0A 3UJ8A 4FS8A 1MJFA 2VS1A 5GP1A 5DWQA 3PT9A 2FYTA 4C05A 1IY9A 3SSNA 3PTAA 4IV8A 5LQRA 3M4XA 3OE4A 5FHQA 1KPIA 2G8NA 2XVMA 4PYQA 2XBMA 4HG2A 3PLAE 2FRXA 2AVDA 2HR1A 1EJ6A 3OPNA 1I9GA 1L9KA 3B89A 3LPMA 2BR5A 2VZ9A 1ORHA 3OZRA 2YX1A 4E32A 2UYHA 1FP1D 3FUWA 2PXAA 4RTSA 2ZIEA 3OU7A 4PYIA 2ZIGA 1NBHA 5DTQA 1O9GA 4DA4A 5BP7A 3G2MA 5E8RA 2NP6A 2B25A 2YXEA 2EG5A 1DL5A 1L3BA 3BGIA 4OA5A 5EMMA 3C3YA 2I7CA 2OB2A 3Q87B 3UA4A 2G72A 1VBFA 3M70A 3KKZA 3HVIA 2HNKA 3THRA 4BLWA 2AOVA 1V39A 1UIRA 3O31A 4EK9A 5BW4A 2VP3A 3TQSA 1RI4A 3SM3A 2BH2A 2AS0A 3I5UA 5EKUA 4V0QA 4C07A 3IEIA 3UJBA 4C03A 4BY9E 3E05A 1G8AA 2UYOA 2EFJA 4HTFA 1RI1A 2Y1WA 2AZTA 2IIPA 3BGDA 4Y2HA 3ANXA 4NECA 1YFLA 2P40A 3AXSA 5DT2A 3CCFA 5ERGB 3BKXA 5CVUA 1TW2A 5DXJA 3GO4A 1N2XA 1SQFA 3HCEA 4X60A 2CMHA 4ISCA 2VDUE 2FCAA 2PX5A 1ZQ9A 2EJTA 3FPEA 4WXHA 2IGTA 4AZWA 4ER6A 3P71T 1R8YA 3B5IA 4RTQA 5DXAA 4HSGA 1BHJA 1X1BA 1KIAA 5EQJB 3GRRA 1UFKA 1Y8CA 1H1DA 3CJTA 3ELYA 5DPMA 3HCAA 2UZ4A 3PS9A 3FRIA 3KQOA 3T7TA 4PINA 5E8JA 3GRVA 3G7UA 4KW7A 3JWIA 5JUWA 1AQIA 5GINE 3TKAA 3HA5A 4CXMA 4YUXA 1KPHA 2YQZA 3E7PA 1L1EA 1QAOA 2ZZMA 3G89A 1WXWA 3DTNA 5CVDA 5MHTA 2JH8A 2PJDA 3SX0A 2PX4A 3LHDA 3LGAA 2QM3A 1VIDA 1NW3A 4GBED 5CVVA 2ZSUA 1KHHA 3L8DA 2DULA 3E8SA 3ELDA 5HZMA 1BC5A 5LQAA 2ZCJA 2QE6A 4QTTB 3B7PA 3O4FA 1M6YA 3SSMA 4FSXA 1NW8A 5KYGA 5GOZA 2G1PA 1INLA 1N7JA 5EEHA 4ATNA 2YVLA 3I64A 2ESRA 1FP2A 3BT7A 2G71A 4EVIA 5LSAA 1X1CA 4MTLA 3UJ7A 5LR6A 4QVGA 1P1CA 5DX1A 1D2GA
chains in the Genus database with same CATH superfamily
1L5ZA 3PNPA 3IUQA 1DC5A 3FYUA 4LN1A 4HX2A 3E35A 2EKZA 5KNCH 1QPGA 3VKVA 1KTIA 3P26A 5D3MB 4PG8A 4LG1A 5A6SB 3ZE7A 1ZA1A 3C85A 5AK4A 1G60A 3DCYA 4NFSA 3CUWA 1GRCA 1XVUA 3NVKI 4RW0A 3URMA 3EFBA 4HRXA 3TD9A 2W6OA 3AOEC 3RRFA 2C5AA 1T10A 3O4GA 3WHKA 5K8CA 1SOUA 5H80A 4JXXA 4D9HA 1M7BA 4JODA 4RQAA 2C7QA 2WSLA 4PGAA 1TPZA 1YA8A 1PKXA 1KSGA 3GYBA 2JB9A 1GN9A 2RKBA 3VU0A 2XNDA 3GGJA 3F7MA 3U3JA 1KRHA 3T1OA 3TJZA 1OIVA 1RD4A 1EJBA 1VPLA 2HXGA 2Q9BA 3ACCA 3DHVA 4FT2A 4NZ9A 5HA5A 5IMBA 2A14A 4RTJA 1OY1A 1TAQA 4GGPA 4MRPA 2R6DA 5AKXA 4BMZA 5EP3A 3QUBA 1E69A 1FUKA 3Q3GE 3LO5A 3OCYA 4GPZA 4J43A 2VDJA 2DOKA 4X44A 5DGCA 5EUBA 3TCNA 2F43A 1GQ2A 8ADHA 1ISSA 5U9CA 3HVJA 1CFJA 3G9ZA 4RNDB 2PL1A 4P98A 1RMTA 1GT91 2BFBB 1AO3A 2D5BA 5B1DA 2P8SA 4MLCA 4BO8A 5TPZD 4DMHA 4M0DA 5LL6P 2Y1CA 1OD6A 2EOAA 3I8OA 3JQ9A 1BXGB 5IAKA 1B1AA 1JH8A 3HBFA 4CVNA 1YIAA 2C2ZA 2H3HA 4G89A 3CKKA 4HO1X 2O8CB 3F78A 3ROXA 1BN7A 3GMDA 2P67A 2VYFA 3MTDA 4IZOA 3MGGA 1Z0DA 3TRKA 3AUSA 4PLCA 3ZJYA 2ZXUA 1Y7PA 1QHGA 3IMGA 1XPUA 1Q0SA 3ZU5A 2L69A 2A94A 4FYWA 4BN4A 1SUFA 1ZGZA 4EOGA 1HKHA 3VZQA 2IDJA 2YCBA 4MULA 4NFHA 4U0JA 2GYUA 1U0OC 3DXXA 3JQBC 1WUYA 2M32A 4UD2A 3ZHUA 5F98A 3L4JA 3ZD7A 1REQB 1FRVA 4FWBA 4OLJA 4URYR 1QX3A 3HN6A 5CDFA 2OHXA 4YWHA 4PQRA 3M4ZA 3H83A 4PRYA 1WXIA 1V4VA 1QYIA 2HC9A 2PZJA 3UB4A 3GLVA 2PUGA 4GZ5A 2Z30A 3ANMA 2GERA 4FX2A 3T41A 2FWBA 4POOA 1EUCA 2R4TA 1N2EA 3C7DB 1Y3CE 3FR7A 3MTEA 1Z0JA 2ZBPA 3JQPA 3LXRA 1R5BA 2WFLA 5E7QA 4BMCA 4RELA 5BPFA 6ADHA 3BX1A 1UOPA 2OG2A 1I36A 1FLVA 3MJFA 4YGYA 5D8DA 2VIIA 1JR3A 2GPJA 3D64A 3KWJA 3T7SA 1II9A 3ZWYA 4BWGA 4ZTZB 1ZITA 2HO5A 3N2KA 3KR9A 4N8EA 1G63A 4ESEA 1DG9A 2XUIA 1QRSA 1XVVA 3GB9A 5BSEA 3QIAA 1HL3A 5JALA 1P7WA 2V8BA 4G85A 1YGPA 3FFBA 5ICFA 3KE8A 1QNFA 2YOFA 2RHDA 4HDNA 3T3MB 1CQXA 4CIWA 1ID1A 4AL4A 1PJ2A 5C3UA 5JYEA 1D3AA 1FYEA 1Z75A 1EVLA 3U40A 5IXSA 5EJ7A 3U9SA 4QJBA 3UY4A 5BWMA 4NXMB 4J0CA 1OFIA 3NBMA 1KK1A 1T43A 4P5DA 5ENDA 2NM0A 3H19A 3MJVA 3OT1A 1CERA 2A0XA 2H52A 3QWHA 4O2AA 3T5CA 3WL4A 5FWYA 3VZRA 3IHWA 1HY3A 1CVRA 1JQ5A 5ALKA 5K3BA 2AG6A 2VPTA 5HOEA 2ZETA 3OZVA 4BX9A 1WV0A 3DWGA 2WE7A 3EA0A 4YAGA 4HF7A 5CU7A 5IEJA 5JDIC 3S1AB 3C3DA 3CRNA 3AG5A 3FSJX 4GXQA 4B81A 5G3YA 1O0CA 2EZ9A 3JWJA 2DPLA 1G9TA 3BIOA 2XUPA 3KSAC 4V0LA 3E0QA 3K96A 1G8GA 1DXHA 1PEDA 1KRXA 2GJ8A 3BDVA 2G9VA 3MMXA 3R9XA 3WDSA 1CY2A 1KYIA 2OFPA 3P4UA 1HRDA 4GEKA 1AGYA 1NNSA 3N0VA 5JJIA 2FQ1A 3HCFA 1E3IA 1FL9A 4MOWA 1WKVA 3T34A 4BAUA 1TUIA 4I4CA 4KODA 5DM1A 3IVRA 4MV9A 2EJUA 1DQNA 1IY8A 3K5IA 2X3FA 2OXTA 3FYCA 5EJ6A 5CDYA 4B5KA 4UJ3A 4UAVA 3NH9A 4DXDA 3R20A 1DAPA 2I4IA 3FPFA 4RD0A 1IBCA 1M66A 1G4AE 1OBFO 3IBYA 5CJJA 4ENWA 4HMOA 3KQTA 1CVLA 1A1VA 2OBFA 2N3ZA 3LRXA 3KYDA 4WA8A 2YFKA 4QO8A 3QOXA 2JAUA 1EIZA 4ESHA 3W2TA 5BR8B 3G17A 4XYLA 2ZBDA 3RRXA 3R5XA 2O1SA 4TTAA 1XN4A 4Q3NA 4QDUA 4EHAA 3OHMA 4CLDA 2FUNB 5A5VA 2GBIA 1HNXB 1QHIA 1MENA 1F20A 2GCIA 3N5KA 1B0AA 3HVKA 3O5AA 2MMCA 2V8OA 2F1HA 2NQ8A 4YECA 2LCQA 2ONJA 4E07A 4C3OB 3HDGA 3K09C 2LVBA 2BDTA 4Y2PA 3R7FA 2PLAA 1AT1A 2OCAA 3LY5A 3K35A 4N7JA 3O9VA 3TI7A 1SQSA 3AEZA 2GWRA 4NBUA 1K8ZB 2AUNA 3N0RA 2FP4A 2AFHB 3KKNA 1R64A 4TVBA 3OQVA 3C6BA 1MQ8B 2YJZA 1KJ8A 2VJLA 2ZYRA 4WZ6A 4ZFNA 1XMPA 1MIOA 5JXIA 2ONZA 4RPGA 5HKBA 4BB5A 2C82A 2X1MA 3CLSC 3O8DA 4JLJA 5AW2A 2JDIA 1QCYA 1F0KA 1NYLA 3HPRA 1PRYA 3PDIA 3EMDA 4LBWA 1I5RA 3IPYA 1ECCA 5DNAA 3SXPA 3RO7A 1HR0B 3J7AC 1EQUA 2FV8A 3GN2A 1U2GC 4O4HA 3FOBA 3HL0A 4XVQA 2ODPA 3LC0A 4BLTA 2X8LA 2IYUA 4JU9A 4RXTA 1GPLA 1TVKA 3T9EA 3X2FA 1PZNA 3PUWA 4ER0A 2F1IA 3LDGA 4E08A 4B83A 2H63A 4AG6A 2G07A 3JY6A 3ND6A 1OBCA 4TV8B 1JHAA 3ZYZA 2CLFB 3B3QA 2AK2A 3I83A 1O03A 4IO0A 1WX1A 4JL8A 5DNDA 5JSUA 1T8PA 4CEJB 4BPRA 1XDUA 2DFTA 3HI4A 1RP7A 5FB3A 4EB0A 3OWOA 2A9FA 4LJ4A 1P2UA 2PX8A 2VBIA 3ER8A 3VV2A 4U7GA 1XTUA 2WDPA 3UOWA 1WMFA 4PZPA 4QT4A 3KJXA 4PC1A 4KE7A 4XCVA 5CK5A 1KH2A 5ER6A 5CXUA 3EXG2 2OQ2A 2VK4A 3ZQJA 1D6SA 4KR9A 3RYFB 3V8NA 4HYEA 2Q5QA 3EY4A 3V55A 4P3XA 5TMPA 2ZB2A 3SG0A 1Q1BA 3V8EA 1VHTA 1SVWA 4QWWA 2YYAA 4DLLA 1H4QA 3K20A 1F2VA 4C22A 4F38A 4DR3B 1O54A 3ZNQA 4C6HA 3HYRA 1E1KA 1V47A 3I09A 4ZHQF 5H16A 5INTA 2QP9X 5CFZA 2F1OA 1J25A 1VKNA 2B0JA 2IU6A 3P9IA 5KHAA 5SZKB 3A3YA 3WGQA 4B3XA 1UJ5A 1VPDA 4JEHA 3TTXA 1M0EA 5DJ5A 4D8XA 2KS6A 4QLBA 5C18A 2GM9A 2JH3A 5DTRA 1KJQA 3LBYA 3M2TA 2HMTA 3ZZNA 2WD7B 1YUNA 2R8XA 3ROGA 1QIEA 1HXHA 1MX1A 1C0IA 2JZOA 2ZUDA 2BFDA 1OF1A 1JHXA 4LDAA 4LJRA 1WNFA 3L6DA 2XB6A 1XDBA 2ANCA 2EL7A 3D1VA 2G7MC 2GDZA 3A6LA 1X94A 2Z9CA 4MDYA 1CR2A 4CU2A 3ZVLA 2PKQP 4MP6A 3RBXA 2IU3A 4G0MA 3I6QA 1IC6A 1GGJA 1L4FA 3PV0A 4JUFA 2WC1A 5A1JA 1TYCA 4JI8B 4IFEA 3AUTA 1LNQA 3RYCB 4D8TA 1VJCA 2OV3A 3ETJA 5LOVA 2WEKA 4BBJA 3DLBA 5CLQA 1ECPA 3TPCA 2WG1A 3N5CA 5EJ2A 2C7PA 1LBEA 3BMCB 1ZW1A 2FFAA 3I1YA 2R6CA 4BQSA 1XMOB 4YMTA 1MEJA 2FSSA 2I76A 1CFZA 2PWAA 1SXHA 4PLGA 1SBIA 1N92A 3W7VA 2H2GA 2I55A 2J4DA 3Q7SA 4URVR 4EARA 2VUUA 4QXQA 4LHVA 1Y34E 4LDZA 4RESA 1JQDA 1DTEA 2UZAA 1CNMA 4RIIA 5D7NA 1FMTA 2X76A 4MPRA 2V5AA 4CI9A 1NY6A 4DMKA 1FMJA 5FPTA 2XI4A 4DC0A 4B6JA 3Q98A 3RUCA 3IDQA 1ZA2A 3AINA 3AV3A 4LZLA 4P82A 5JY1A 4Q1EA 1IZYA 1RE1A 4NAHA 3LT2A 4R05A 1M6EX 8ABPA 3AT1A 1J0CA 3AGQA 4NE9A 1Q6ZA 2Q2NA 3HY3A 3R9IA 4I36A 2XZTA 1ZN9A 1KPGA 4EKIA 5IS2A 3JWPA 5K3DA 3QG1A 3K5HA 3NTRA 3ON5A 4QGGA 1IN6A 3KTOA 2FF7A 3NALA 4HVAA 5CJ2A 3TKLA 1FK8A 2A9VA 2J3QA 4WUTA 1EWTA 1U28A 3AIIA 1KI2A 3L4EA 2FK7A 2WM9B 5DM0A 3WY9A 1I7SB 4NJEB 1LC3A 4F96A 3CW8X 1UXGA 2H9IA 4YV2A 1ULZA 4ARUA 4XR9A 3C97A 4GBMA 1GAXA 4J76A 3E9ZA 1RYYA 3RRZA 4KBYA 3OSUA 1NPTO 2NPIA 2QMHA 2EZ4A 3AHGA 4MKGA 5DHAA 9GPBA 1SUIA 5E3JA 1T91A 4P6VF 4WE3A 3U4QB 3WLJA 4DNOA 5I9BA 3IP5A 7AT1A 3E5NA 1U7ZA 4ZI7A 4DYHA 4BAZA 1GLGA 2NV2B 4G0VA 1AF7A 4BQFA 2GBLC 1YQGA 1FU4A 4YP1A 1LNSA 2OQVA 3LX8A 2ON6A 2A33A 4KWHA 1I2BA 1UDAA 2VBCA 4TL8A 5F1KA 2J46A 3PC3A 3G2QA 3OM9A 4QNMA 3BTSA 1IATA 1P9NA 1FRQA 4R8LA 1J8VA 4PONA 3ONDA 3P9SA 3W79A 1YVPA 1KA9H 1JWAB 1K75A 3DPIA 4LE1A 4Q9LA 5EKDA 2I3GA 4RY8A 1EZZA 1W85A 2I29A 1W88B 3RVKA 2E4AA 3NBXX 3BF7A 4LZZA 1SWWA 3C3MA 3H2SA 2K87A 3OZUA 2C3MA 2BTQA 3SNHA 2C20A 1NJ6A 4UVIA 5LLSA 3WZMA 3N6RA 3OTHA 8ATCA 3N9IA 5FX2A 3G2NA 4DLXA 5JANA 2I5PO 3NUZA 5IJ0B 3L2OB 1ZIOA 1WULS 1LRLA 3EB9A 3ICWA 4JXKA 2Q1YA 1FLDA 1VBKA 4K9MA 4M1ZA 3I2KA 1YTLA 5DOVA 3VNRA 2YX1A 1FFWA 1RPAA 2ZBGA 2BEWB 3TOZA 3F7OA 2ASEA 2WJIA 2ZIEA 5TGDA 4DJFC 5CIWA 1GV0A 1E8NA 2E1PA 5BPHA 2EARA 3ZE1B 5JADA 2F8MA 4XJXA 1K4KA 1WZEA 2ZUBA 3HGQA 5DV9A 2A58A 3OVMA 2EKBA 4H7EA 4M0CA 1ZNXA 5GJWC 2CY0A 1ZRMA 3NHPA 1AUOA 3D7NA 3S8YA 1D5CA 3B2NA 3DTYA 4B3GA 3TOVA 3VI4B 2PUJA 1J49A 3D5QA 3BRSA 3JZIA 1JQJC 3WIDA 2DT8A 2ZVDA 1E5VA 4OI1A 3TQSA 1E2PA 5JWOA 5K6AA 5C8VA 1MO2A 4CEIB 2C4KA 4DPLA 1KQPA 4IUBS 1EAYA 4MW2A 2ZT7A 3L7IA 5EFZA 1DT5A 3WK8A 1QONA 4LV6A 4DG8A 1PHRA 4A82A 5LQSA 4MP8A 2QV0A 3U7QB 5JSKA 3QSYA 1RCFA 5KYXB 1IXYA 2X9GA 4YRGA 4WECA 4PLVA 1D2AA 3T4XA 3QVSA 4ZJYA 3E8MA 4NS1A 3W7AA 2EJTA 6YASA 2PZ8A 2W2TA 3SVTA 3U7RA 3Q9NA 1DGQA 4B3HA 3G13A 2DHRA 1PR1A 1CIVA 3FSGA 4EA8A 5C35A 3A1NA 5CCEA 2P2GA 5L3QB 1H1DA 4REOA 4IY1A 3WK9A 4HEJA 5K0ZA 2C4TA 3FRIA 3IALA 4NCHA 3T7TA 1CNFA 1IHDA 4HAIA 1FNCA 1PNTA 2QAJA 3EHDA 3NTQA 3DE6X 1IHOA 4LV5B 1QYCA 3PK0A 5EJ9A 1FTSA 3HR8A 1PT9A 1C9JA 4C08A 3IV9A 4NCJA 3SKYA 3QWBA 4EPVA 3K4HA 4GLFA 2HADA 1M2NA 1V37A 2BMFA 4G1UC 5BN3A 1U7DA 1I14A 1M8GA 4JJKA 4ND8A 5FQOA 2RC5A 2IODA 4D81A 5HP4A 2V59A 4GI2A 3E7DA 2R5NA 4LSWA 1EKXA 4KWIA 1B8VA 3VAAA 3BG5A 3VJKA 2MSDB 4N6OA 1N7JA 4OYLA 3TBHA 2OHOA 1U8TA 1T1SA 3C3AA 3IIMA 3D9QX 3LMKA 4CG1A 3PNVA 1LF5A 4GD3Q 4L3WA 5BSKA 3OHSX 2IZ5A 5LR6A 2IYXA 4BQEA 1P1CA 1Z39A 3L1KA 1RAGA 4N9WA 4IQ4A 1EE9A 3KOWA 3WWDA 4MW5A 1YJQA 4G81A 4Z7QB 4I5FA 3LCUA 4MZXA 2XMZA 1IM2A 3BXZA 5SV2A 5BRNA 3O90A 1UBHS 5C8DA 1U8AA 4R2HA 4ZO6A 3TG8A 2ECFA 3UOAB 4U5QA 2R44A 1P8JA 1R00A 3BXGA 3HUFA 3NHRA 2JAPA 1Z83A 4HH4A 2FWRA 5CHEA 4ZAVA 2Q5JA 3DZJA 3OPYA 1P6UA 4UW9A 5JO9A 3S27A 2Z3ZA 3JATB 3MJDA 3TMAA 1Y80A 2YFHA 2HK6A 2ZI9A 4WZBB 3NTOA 1JNYA 3ASVA 3MILA 3GQBB 4MV1A 3GLUA 3KVOA 4CDRA 1KS9A 1AXEA 1HKUA 4M1WA 2JAOA 1KDVA 4PCVA 5DRYA 4JBNA 4IIJA 4QU9A 4BNKA 1WV1A 4PY2A 1C4KA 3ICPA 2A3RA 1T36B 3CB4A 4GE3A 4HNRA 2FK8A 5KQPA 5ARCA 3G82C 4EKYA 2PXXA 5HGXA 5KSZA 2HF8A 1W75A 2H59A 1NMYA 4R54A 2PQ6A 4UVGA 4X66B 3BJRA 3D8NA 4QTZA 1GAWA 3M9XA 2C92A 1R9NA 3C45A 4J1SA 2X0FA 4YX9A 5A04A 5KTSA 1ST2A 5ALGA 3DC7A 5LUAA 4B2LA 3PNKA 3TAHA 1UBUS 2OAGA 3MCUA 4EHFA 5E3HA 1DUVG 3A0UA 1XZ8A 3GXBA 2OORA 1VZ3A 4R9UC 1YJBA 2AFIA 5BW6B 3TWOA 3FOZA 4ALMA 3JVDA 2Z4TA 3W34A 3W9UA 1GL6A 3R40A 3H7IA 1SMKA 3EUWA 1KFBB 3JQEA 1R9JA 1A2BA 3D8RA 1LV7A 3TR5A 3AI1A 3K94A 4B79A 1AQYA 4K3VA 1A8IA 5ALEA 2HV9A 1I3CA 1QGED 4J3NA 4CMEA 3M6MD 2P6UA 1HQCA 2YV4A 1WU8A 1IN5A 5E3IA 4YAKA 3AEUA 1WCIA 1HH4A 4MUYA 2P3OA 2PCLA 2VJDA 3QVUA 1IZZA 4YRMA 1EVJA 3LV8A 4MV0A 1GZ3A 2IIBA 3KTAB 4BQQA 2XVXA 1E6EA 2WTEA 1LVHA 4J7CA 4XASA 4EVQA 1IPEA 3CIOA 3FCCA 3H2YA 3R7DA 4BYMA 3D8TA 5ADVA 1RYFA 3AM3A 4GPD1 3GX1A 1QIGA 2AUMA 3IVAA 4D26A 3NDJA 2CBXA 3FTQA 3WLEA 4B33A 4R3UC 4EH1A 2QSUA 3X1MA 3R3UA 4RIGA 5C32A 4IZHA 3RYHB 2PZEA 3GA5A 3ANTA 3FWKA 3OZ7A 1UMBB 1WSAA 2VDRB 2G25A 1T4BA 3AVYA 3I73A 4EIWA 4BLUA 3DNMA 1B1CA 2QXTA 3NWPA 4MRVA 4QUHA 5LBIA 1Q1EA 2MR6A 5I9SA 3R7LA 2WICA 3T5TA 1F1JA 1K97A 3VC7A 3LQ1A 1M3SA 2Z2ZA 3OPYI 1OLOA 3RD5A 3RVDA 1N2OA 3ICOA 1BCRA 2B1RA 1NN5A 3EODA 1IIBA 3D4PA 3QW4B 4KHZA 4O63O 3WL7A 3ZEIA 5FR1A 1XX6A 1GPJA 1BE6A 3DO8A 3HL4A 5DCUA 4FFNA 4KJXA 4R16A 2FI1A 1Y89A 2R96A 1NSTA 3VKFA 1ZJYA 3H18A 4I5IA 1WAMA 1QB7A 4HFRA 2BHTA 5TSDA 4C3UA 3D8BA 4W5QA 1KFEB 3R0VA 5HILA 1X1TA 5BQOA 5I48A 4L7QA 4WUVA 3LUAA 4LWQA 1HE4A 2B4RO 3DOJA 1KSFX 3QWIA 4LXGA 3SJZA 5AQ1A 9LDBA 5GONB 5KHOC 3FNIA 3WC4A 4KXLA 5E1DA 1KQGA 2RAUA 4ZT3A 4BV3A 5MGBA 5ELMA 4FU0A 3IQFA 4P4NA 1U31A 3BRWD 4RJTA 1RC0A 621PA 2DBVO 2QQ5A 3JD0A 4QGHA 3WMEA 2J7KA 2NUAB 1DPFA 2J6BA 4JCCA 1SKYE 5JSYA 4EHDA 1QTQA 5DISB 5CDHA 4RVGA 2QXYA 4Z1MD 2DEUA 4L0MA 2XCTB 4F86A 3GD5A 4HJRA 3T0IA 2X9LA 2QRVA 1K88A 2AH5A 2ZYIA 2ACWA 3ABRB 4FFWA 4PFSA 4Q18A 1PYOA 5FNZA 3BFPA 2IBTA 4OHBA 2X9NA 4TS9A 1L4YA 4BWFB 3B1XA 3V1KA 3X0DA 1E9BA 2P3QA 3O91A 4HDOB 5JCZA 4HXEB 2O8FA 4C7KA 2AA3A 1L4BA 3EG9A 3GCDA 4JC5A 4UU0A 2Q3EA 5CH3A 3QOFA 3PVZA 1RQPA 3ZX4A 2FHPA 2ERYA 3QYJA 2D06A 2R4UA 4S1TA 3AUUA 1UQUA 1UMCA 1OMOA 2O8VA 1AKUA 4OB7A 4ZOAA 1L7PA 3KR1A 3UK1A 4LJ5A 3H75A 2RGXA 2OCLA 5A4MS 1E99A 2FPGB 1ZIDA 2EYQA 4PIMA 1CS0A 1ZD2P 2ZRKA 4B3SB 5LJIA 2DBQA 1UJ2A 2NUBA 1Z5UA 3I5MA 3IIJA 4HDRB 3SQWA 1DKOA 2LNDA 2R8BA 2ZUCA 4BFZA 5DM70 3B20A 2QRGA 1RQGA 4TRRA 4RTLA 1PZXA 4ALKA 1SBCA 2RGUA 1J24A 3QF7A 4IIFA 4R3NA 3RU3A 3I9FA 2ZITA 2CMDA 4J16C 1JDZA 4EI9A 4JGBA 3VPSA 5M34A 1LDBA 4W7IA 2M98A 3N76A 4GL4A 5JQGA 1SN7A 2PWZA 1I80A 2R6FA 3G6KA 4UHEA 4C7VA 3IEXA 1J07A 2XPCA 3G8YA 4YRNA 4L76A 3ZWMA 4BXOA 2I33A 2CVOA 1JIXA 3B6KA 4JYZA 4QPPA 3HMKA 5C4IA 2QTHA 2FUKA 2OV4A 4GWLA 3U3ZA 1VYTA 2C97A 3TB4A 4EX7A 2QT1A 3QEMB 3QBDA 3DT6A 1MH9A 2A4MA 3QH4A 1XTBA 2WKPA 3AESB 4QLOA 4BTVA 4ZIRB 1ADBA 1C3XA 5G3ZA 1PI3A 1R4ZA 5K2OA 4NBWA 5B4UA 4LECA 2Q2VA 5DI3B 4A5SA 1CF9A 1Z2EA 2OEPA 3O1LA 2ZB8A 5TQVA 4GUDA 5ERYA 2MSLA 2V5VA 1VBMA 3UCXA 4AJLA 2GZMA 1RM4A 2JLRA 1Y3BE 2AG0A 3LPLA 1K3FA 1TMGE 1Z38A 2IELA 2P2DA 4H6XA 4QHSA 3WTCA 1JLSA 2VLBA 3PCXA 3VJRA 3K53A 5HJ7A 2RK6A 1E79D 2Y05A 2NSJA 3NP9A 1J5PA 1IMOA 4URHA 3V97A 1Q0LA 1UM9A 2PS3A 2J0UB 4NENB 3GCZA 2I6SA 4C30A 4TKVA 4QJ3A 2HJVA 1KJWA 3SEQA 2O3TA 5IZCC 2CYCA 2QM7A 4PX2A 3WMRA 5B55A 3CVUA 1G38A 4MLDA 5AKGA 1RZVA 4M21A 2JLVA 2JGLA 5E4TA 5T6BA 2E21A 3DZCA 2E1RA 3MQ4A 5AVJA 1G3QA 2UU9B 1GD1O 1RYHA 5FJJA 2GZHA 3D3NA 4LF4B 4W5HA 2J4CA 3P8ZA 5AJWA 3NHLA 1H0SA 5FOWA 3UK6A 3NDIA 4N8DA 3BWBA 3CVOA 3C39A 4UCXA 1P4GA 4PNPA 3CRVA 1XXHA 1P3Y1 3HNRA 2A30A 4P54A 5JZBA 3MHTA 5LWHA 3VA7A 2ZJ1A 3RKRA 4K9LA 2B98A 3DZGA 3KWFA 4AULA 1Z4PX 1NZFA 1Z68A 2PZFA 2QT0A 2ZS9A 3LF2A 4G65A 4K9DA 4D6PA 4XB6B 1IZ7A 1V2GA 1EWVA 2WWTA 4LQCA 1KQFA 2CUKA 2LBPA 1LGYA 2PTGA 2NIPA 5BSFA 4A6PA 4I9HA 1TJ3A 5FPSA 1UDXA 5CT4A 4Y30A 3UMGA 3VR6A 1EXDA 4E3ZA 4W8GA 4IWXA 1RQXA 3QX8A 2XKAA 1NGSA 2BDUA 2YIVX 1SD5A 4ZGWA 2V1UA 3VUFA 2WJGA 3E53A 2JGKA 2HK7A 2Z57A 2P9FA 3SZ3A 1ZUNB 2JW5A 1LU9A 4PU0A 3U49A 3VPHA 4CIBA 2R66A 4AWXA 4AIRA 1X86B 4KLRA 1VMIA 1R7RA 3GUUA 5AM1A 5HG0A 2OPBA 4CF6A 1L8AA 3RM3A 1NNEA 1D7AA 4ETWA 3DVQX 1FFDA 4M8SA 1HBJA 4F9GA 3EEIA 3FOAA 1QV9A 3PE3A 1I2DA 3HKBB 1TUGA 2QG6A 5NULA 1W19A 2E89A 4ID9A 1VDMA 5ABPA 3O2QB 1R5OA 2WWFA 3NU1A 2G4LA 2GI4A 2W5UA 1WW2A 3RJ5A 4BTEA 1DXQA 2OM6A 3NZEA 2R6AA 4JJ8A 5BN4A 3LUCA 4ZU1X 3RFVA 3X1XA 1U4OA 5LQMA 3C0KA 1MO5A 1M2OA 3B1KA 1P29A 1KF0A 1COZA 1C7ZA 3A3NA 3IODA 4QPCA 2WIKA 4I4TF 5ECGC 1S2MA 2K7FA 1ISPA 3VR2D 5J4HA 1P2BA 4Y2SA 2JFOA 5ALJA 4ND1A 5H68A 4JKIA 1YQXA 5DX8A 4RU1A 4MIEA 1R9MA 3CUKA 3AVPA 4XCXA 1SVSA 3RAGA 4J90A 3I9JA 1ZK3A 5JCOC 3ST7A 1NFRA 1VLMA 1NXSA 4IILA 4J1NA 2QPAA 1SQ5A 2B4KA 4G1BA 4EGAA 1QVAA 1T8SA 2P2CA 4MCJA 1UJ6A 3MUNA 4XWOA 1H5QA 3MRSA 4QL3A 3VPBA 1CEYA 5FWXA 3GOHA 1AC5A 4YLYA 4CLHA 5CB4B 2C8KA 5JCPA 3PD7A 4YV1A 1RAEA 3KB8A 4DMLA 2ORED 3DBHB 3Q10A 4Z3DA 4P7BA 3BRCA 2IQIA 2JL1A 2H57A 3QE9Y 3B13B 4O2BF 3ET5A 3DP7A 5AKJA 1STOA 3R7AA 2DUJA 3TOSA 5IM4F 2HTFA 2A5FA 1ABFA 4QRIA 5EPEA 1L5KA 3G0BA 2Q5FA 5HFJA 1X1AA 2VDLB 3IP7A 3HP7A 4UOEA 3SS8A 2ROQA 2P6MA 2PGIA 3UJ3X 2XRZA 2EAUA 3CO0S 1H0KA 2PKWA 1PJCA 2CL6X 4X7RA 5L4SA 3DLIA 4R71A 4Q3BA 1UF9A 4KV7A 4DLTA 3UC9A 3CLRC 4TXHA 3TLMA 4LHWA 2OC4A 3C98A 3O8NA 1FCJA 1E9DA 1JEAA 3GLHE 1A8SA 1BX3A 2GCNA 4LPSA 3U44B 4O29A 5AUOB 2P9JA 4O4IA 3W1VA 1TYDE 3H5OA 4PRKA 2FPXA 2QW1A 1V43A 5H3CA 1OT3A 2RI6A 3PUIA 5T3YA 3WOVA 4CKEB 1H1LB 2W6ZA 2V7EA 1JKXA 4QQFA 4PX5A 1JHQA 1YE8A 3QY0A 3RQIA 3TI9A 1E7MA 2I9PA 5KYUA 3UK2A 3C7CB 3EEYA 4INAA 3AVOA 3DYVA 2EF0A 3NWOA 3K6SA 2H2FA 1T8UA 3NUGA 2HRBA 4KRYA 3A4TA 5BOSB 5IBQA 4O2RA 1EM8B 4E22A 5I9NA 2O6HA 2Y67A 2QRHA 1FZQA 1TZJA 3UGKA 1VSVA 1A9RA 2VDWB 3MFYA 3MT8A 2C2XA 2I1LA 4FCWA 2GK6A 3N86A 3S2FA 4J7UA 1PS8A 1X70A 1A8HA 4IHKA 1NR5A 4N5NA 3Q9LA 2IHVA 3B89A 4WFKA 4H3HB 1RJ9B 3NPMA 3ROTA 2FGKA 4D9EA 1ZVKA 2VR1A 4R1OA 2GAJA 3ZZ0A 1RABA 3UAWA 4OREX 4RTSA 1KI7A 2Q7XA 2OBYA 2ZIGA 4GKVA 1IJEA 4BMOB 5CD9A 1CUFA 2GESA 4FB5A 2Y6VA 1OFUX 4GIBA 2WZBA 4M9QA 4B80A 4EW2A 2O19A 1JE1A 3UXMA 1NPYA 3B1VA 2AQIA 1XI2A 2Z3VA 2ZRFA 1PWYE 3ADOA 4PQGA 1NNI1 2R97A 3PEEA 4F3CA 1S4MA 5ALXA 2GKOA 4QUIA 1HORA 2HCRA 1IHXA 2YVAA 1QGZA 3BH0A 3EZFA 2AJBA 2V7PA 1GCGA 1ULHA 3L0DA 3THRA 4B45A 2QRKA 2DGDA 1ZM9A 3JSXA 3MGCA 3CLVA 3MOGA 4XX0A 5ALDA 1TL7C 1UQTA 5F5LA 3SM3A 2OQIA 3WRWA 5EKUA 4V0QA 1MB2A 2X0RA 4O4LB 4OQXA 3W5SA 3IEIA 1RFLA 3HYTA 2P5SA 1U9IC 1U9JA 2BGWA 4FEAA 1Z37A 1DHRA 1KDTA 2CMKA 1RU3A 3FI9A 3H0CA 3UMMA 3NCHA 1RSZA 4KZPA 1UKYA 4BE4A 3AH8A 3NOVA 3R5KA 4YLGA 4CLRB 3ND9A 3CCFA 1O9BA 2IOHA 1BHQ1 3HDYA 4PC3A 3T3DA 5BYAA 1QCCA 4RK0A 5IUKC 3WKDA 3VTFA 4B7CA 3B8HA 2YIJA 1GFZA 2IGTA 2ZRNA 2X1HA 4BNTA 3WKAA 3EIQA 4HVCA 1Y8CA 2XE8A 2CXOA 1K3UB 4ZPXA 3ELYA 2PGNA 4LOKA 3ZY5A 3WGUA 1OE0A 4PINA 4K1XA 1GPBA 1CUWA 2FEXA 2QHXA 3CISA 4KW7A 5IC5A 2O2EA 4DNQA 4F9FA 3N8HA 1NZJA 2XVZA 1SKQA 4W6ZA 1SKUA 4QELA 1ECBA 2B20A 4V0NA 4BNWA 3RSSA 4G3XA 2QTZA 1KVQA 3SBEA 2JVJA 1SBYA 2BP7A 2PX4A 3P2MA 3PG5A 4L4ZA 3DQPA 4EB6A 2QM3A 4QUGA 1I7DA 1CUZA 2ZTMA 1KP2A 3JZAA 3L8DA 5CVVA 3GNSA 3MTAA 1M75A 3LK6A 3I05A 4MI6A 2VF4X 1NNUA 2XDAA 3DKVA 3RFXA 4Z6KA 3MMPA 4LY0A 1WETA 4BNLA 1PJ3A 4UNPA 1G9XA 3RUDA 4YYZA 3KJNA 1ONPA 4GEGA 4NICA 1UBKS 3M6LA 4TRJA 1P5FA 4A8JB 1WU7A 3LQRA 2Q50A 4MB6A 3G5AA 3WRYA 3ZTYA 4ZI7F 1QAMA 1N9ZA 4E2FA 1LLCA 4YRFA 1YCHA 5CUQA 2QGFA 3ZV3A 3MIIA 5EUMA 4YLEA 5SZHB 2FOXA 1HDIA 3A11A 1J33A 3FAKA 1Y8ZA 4W5TA 1QK3A 3KUUA 1P4HA 1HI9A 1RHMA 2PUEA 1NN3A 3MXOA 4E94A 4KWCA 3O1HB 1JGTA 1Z13A 4C7MA 4ED9A 4PX3A 1ATZA 1UMKA 3UPUA 4YACA 1ONSA 2QYSA 3ZE2B 4E1AA 3JQRA 2UYCA 4G1EB 4INOA 1P5JA 1XGKA 1A9QA 5K3AA 5G41A 3BGSA 1XZKA 3TTSA 2I4NA 3A1WA 1UBLS 2GJ4A 1FYXA 3MJ4A 4ZKEA 1Q1QA 6NULA 3EXIA 3O4RA 4GXTA 3BOSA 3KB2A 3PC6A 3RABA 3OOWA 2W6ID 3S2SA 1X77A 3EC1A 5T3UA 1DC7A 1JIKA 2J33A 2QPLA 3BC1A 2RHGB 1C9NA 3CHYA 1YB1A 2YBEA 2TS1A 1N75A 1KI1A 2EX0A 5U4QA 4R83A 1JR4A 1QZTA 2PZKA 3NC4A 1FB5A 2I22A 1IZ0A 5BYKA 1JJFA 1PP4A 3ZV6A 4JKYA 3RJ9A 4K6KA 4Z7JA 4WCFB 1K92A 3T35A 2G70A 3L1VA 4DQKA 2V6BA 4JELA 3PL5A 1Y4UA 4MJ3A 3BICA 4R2XA 3UT5B 3OEHD 2QKYA 1XEAA 2NYAA 3DL2A 5DIFA 4LAFA 3FVVA 1KXJA 3KYBA 1PT6A 2ZKIA 3G23A 3GMSA 4KLCA 1R6BX 1L3CA 1W87A 2QK4A 4GAEA 4YRLA 2PV7A 3OD5A 4I3GA 3FB1A 2EEZA 3FYSA 4KIJA 3D6MA 1UEJA 1IB6A 3MN1A 2ZRDA 3QU5A 2LKDA 5E6UA 3RS4A 5KJFA 1ULBA 1MXHA 1W59A 2H1IA 4MJ7A 2BF7A 4KNYA 1VIVA 3G2IA 4WGGA 4AVYA 1N36B 4M0KA 3EWNA 5TRTA 2QM0A 3O38A 4Z4IA 4KRGA 1C3OB 1RQNA 1Q21A 2FTKE 2B1JA 5TQ2A 3ZJTA 4J03A 2Z6AA 1K66A 1YC5A 4LY9A 3A9UA 1S7GA 4ITUA 3GCGA 3GEHA 1NUHA 5KNBH 4C0XA 5IFKA 3RTAA 2D7DA 1F17A 4DMGA 2BD0A 4B35A 4OKNA 1HE1C 3SQLA 2JF0A 3MFQA 1NU8A 4FFOA 1NW5A 3EEFA 2IZZA 4EA6A 4HAVA 5DW3A 4OL9A 4YRPA 4ROTA 3K2BA 4CV2A 2DHDA 4ML3A 4PQFA 4X92A 4YP7A 3SLKA 5DNEA 3JQAB 4X3CA 2PKQO 2QS9A 4WIAA 4EATA 4LF8B 1SCIA 3G5LA 2I71A 3GV0A 4EMBA 3K0BA 5E6SA 2XTMA 4DOMA 2P4HX 2CKDA 1IXZA 4IHJA 5FWAA 2IYEA 3LUGA 5BV0A 1E7SA 5JZSA 4J49A 1GKLA 3FUTA 5FAXA 1EQAA 1ZD8A 4L5BA 4PAOA 2J45A 4PZLA 2NYUA 2AK3A 3F96A 5FUYA 5C81A 4FMCB 1M0SA 2BMWA 5GVSA 2GN1A 2HR1A 5LYJB 2NZYA 1TQDA 1FZTA 4B2IA 1QKKA 4TKMA 4UBLA 5GOTA 5BRAA 3GJXC 4II2A 1NVMB 4WQMA 4D9IA 1WXEA 3IEVA 2Y6UA 4GPTA 2QZPA 1TQ8A 4IJQA 3ZCQA 3V8PA 1E6WA 1T8YA 2OBNA 4NYJR 3DVLA 4IIHA 1GL3A 4TSRA 1O94D 1C9EA 3NDBB 5JPDA 3COWA 3M5DA 1QF9A 421PA 1XZNA 3EARA 5HIIA 4DCTA 3FLAA 4XZ3A 1YRBA 3M8KA 2PUTA 1S6YA 4GM4A 4AX8A 1V3UA 4W5OA 3AR2A 3WWPA 4F92B 4UZFA 5J1TB 1SOVA 5EWMA 1PDWA 1ZVMA 4F9TA 4JY7A 5JLJA 2H06A 3CWZA 4JEUA 2C78A 4N5LA 5IDQA 1MO4A 1GKKA 2EX1A 2H0AA 4PO3X 1EVQA 1A8PA 3B1JA 1GVNB 2ID7A 1JDJA 1JMVA 1UPTA 3BXOA 2N9UA 3CBQA 3S6JA 2EQAA 4YRSA 1PEKE 2E85A 5JATA 3DCIA 5D3ZA 1K0FA 5AW0A 1P1HA 3RVOA 4UNRA 1IG0A 3ACBA 3T9AA 1HG0A 3LI2A 3RAPR 2I6QA 5DNCA 3JQAD 4N47A 4KX5A 5JJCA 1KY2A 3H1GA 4U7TB 1YTUA 1T9DA 1X7ZA 2HF7A 3NYRA 3IP6A 1UDRA 3A1CA 3ZKWA 3M82A 5FLEX 4RK4A 4ZYZA 3ZWVA 4D92A 3GZ4A 4ZMBA 4HEA1 1YQEA 4TQ9A 4ZZ2A 4Y7CA 3U7IA 2CFCA 1X8XA 2FRDA 1GU7A 4WZAA 2WI8A 1CJVC 4XJTA 4KPEC 1U8EA 1OFVA 5EIXA 5L45A 5JAIA 2WNSA 2EFDB 3HUUA 4C4RA 2X4IA 1A8QA 3A3PA 1XTPA 3FCUB 3LA8A 4K9RA 1M76A 3ZOKA 4AZVA 2AI2A 4GF5A 4E5YA 2ZYUX 4LRSB 2Q4EA 5CRIA 4B8WA 2FSPA 1LB1B 4NEGA 5DGDA 2FZCA 3OT4A 3FOEC 4JLOA 1UUFA 2ALJA 3DOUA 5JMOA 4IDHA 2ORWA 5IKPA 4W63A 3OAAD 5HS4A 4AO8A 4ZVNA 2GNPA 2DCMA 3IP9A 2P7IA 4U4AA 1ZH4A 4AJIA 3EXFB 4PCUA 2P9HA 2W6JD 4L78A 3N2NA 5FI5A 3TO5A 1KO1A 2BZGA 2IFTA 5D51S 1LFAA 1FX1A 1Z88A 2J7PD 1AE1A 3Q0IA 5HJ2A 4DDMA 1HTBA 1PG2A 1Q95A 2DUMA 2Z9DA 4X8OA 4P7GA 3HWSA 4EUHA 3EZLA 2CLKB 1FC0A 2AW3A 5SZIA 1KYXA 4LJ7A 3ZN2A 4XGQA 1EUQA 3OIDA 2P62A 4HRYA 1SUPA 1LDNA 3MWDA 4H4DA 5EI5A 1A4RA 1LPBB 3VQTA 4AKIA 1DBIA 4C9BA 1R3UA 3RJMA 2YUIA 4OYRA 3SBDA 1EGMB 1ZD4A 4NBLA 2J9XB 5IBCA 3D3WB 1M9NA 2PL9A 1P9RA 1QPZA 4Q4JA 4P38A 2DRIA 2OFXA 3A26A 1HRKA 1S3SA 3JWGA 4HDSA 5K3OA 3BN3A 3C5CA 2RJNA 3O1IC 2H48A 4CR6A 4E4TA 4MUIA 4UC0A 5FKJA 4DQ0A 3E1GA 4GHWA 4MVJG 3RIXA 3RVQA 5IH7A 4PYNA 4D43A 5BRJA 5I7WA 5EWJB 4B7ZA 2XD9A 1RMQA 1N32B 4X84A 4POAA 2ZIZA 3HKDB 2QYHA 3EGWA 5HK9A 4G0WA 1JECA 2IXGA 4L8GA 1B7GO 1DX9A 1VL0A 1YQUA 3VNSA 3W5JA 4EEXA 5ESXA 1YAHA 4DM3A 4DQVA 1W0KA 5FWDA 2RH4A 5K0JA 3EF3A 1Y9JA 1EFUA 4TL7A 3ID6C 2B30A 1HLGA 3LYUA 3M2PA 1IWOA 4RGQA 4TL9A 4EG4A 2YHUA 1JA9A 3FFXA 4RIHA 4KQ6A 4HR7A 4WSOA 2VSYA 1J97A 1E2NA 4EMUA 4ARZB 1E9RA 1QIMA 4WXMA 2ZBQA 1T2UA 4TLAA 3UMJA 2VK2A 3N75A 3TSZA 5IYZB 3IERA 3IVCA 1ESZA 2WV9A 4X20B 5FTNA 3KEQA 4D45A 4YREA 5A4JA 3GIDA 3F6CA 1GGVA 3MCTA 4QG7A 1XK7A 4IIBA 5HSGA 4FGZA 4BUCA 4MLPA 4RZXA 3AHFA 1MPXA 4AXXA 4BLVA 3HLTA 2P2NA 1XUOA 3AOEA 1YO6A 3IB6A 4L50A 4YCDA 3S29A 4D8YA 2HBYA 3P2IA 3T52A 4DR1B 4E70A 1Y6GA 5CA0A 2E87A 1IK4A 4HNQA 1CZHA 4IXNA 2V74B 3OHPA 3BHJA 4JBWA 5FL7D 1JQAA 1DQPA 2UV8A 4JFRA 3TQHA 3WNVA 5HMLA 5T8KC 1RQ7A 4YI3A 4YJGA 3TIFA 3V00A 3AR4A 1YKSA 1JB1A 4IQ8A 1GIAA 4OIFA 3ESZA 3WIOA 1HX7A 4MROA 1F2TA 2Q9UA 3C8MA 1P0QA 2I3AA 2RAFA 4GOJA 4KAAA 4XYGA 3SNKA 4BQNA 5CTAA 3GMIA 3PGVA 3HABA 2HKIA 2DM6A 2GZRA 2IYOA 3IQGX 4MKZA 1HETA 3JCZA 4NBRA 2C3UA 2RIRA 2JRLA 3PSAA 1UBFA 1ZQ1A 1JYSA 1KYTA 3E5RA 1Y1PA 5TGZA 1U98A 4RJJA 5M29A 3JZDA 4BGVA 4QSMA 2OGWA 1DRWA 1FRNA 2F62A 3MWEB 1RKUA 1AM4D 4WINA 3GZNB 4AJ9A 4BU0A 2QRJA 1DOZA 3LTNC 3KEMA 1L7VC 2VHCA 4TTVA 2Q07A 2DWPA 2PO5A 1KZGB 4N49A 4QOJA 2OXIA 2IS4A 3LBFA 4M9RA 3LWBA 2ICAA 3BXPA 2EHJA 4QHYA 1MAAA 4CR7A 4DCSA 1NQ5A 5I7UA 1QH8A 1N5KA 1IPFA 4H7HA 1Y7LA 4RL6A 2O8DA 3F9CA 4G8BA 1PKEA 2WY2D 5FO1A 4O4JF 1B3BA 1U0NA 2HGZA 4QO7A 3VTZA 3ZXXA 3BF8A 2C0CA 4IBOA 5ADWA 2FW6A 2QVLA 5AK5A 3RTCA 5K8LA 1QWSA 4A0HA 1DX4A 5DH9A 4EQ6B 1N3IA 1U0EA 2VRCA 4UATA 4CKBA 3NHUA 2PAFA 5E6RA 2FZKA 2PD4A 1Z4NA 3AF3A 2ZZKA 4AS3A 5C4MA 1JYFA 4JDPA 2WUDA 3ZHXA 3NAZA 3H2KA 2Y66A 1G8SA 1IWPB 3SYNA 2V7TA 3AIOA 3I6ZA 5CFPA 1AZTA 2FJPA 2XX3A 2K7ZA 3BFVA 3FA2A 3C6KA 3VI3B 4XFDA 3H5WA 2PUAA 3TD6A 1T3SA 3T5DA 5AKEA 1U8CB 3PQEA 1H8EA 4B3FX 2CE7A 3LIIA 1XTZA 1VPTA 4R2WA 1LSSA 1O58A 4L4RA 1NJ2A 4P3PA 4Y6OA 3T4PA 4C4XA 4BN5A 3UMVA 1AGNA 4KIUA 3V8VA 2VWGA 4DSTA 2B3DA 4QUJA 2UVPA 3BZUA 5AM2A 4N3NA 2NZJA 2AN4A 2OYSA 4LOHA 3DMNA 5IVDA 3AY0A 5JJBA 1T35A 1EFDN 3U31A 3HDVA 4LSGA 2YHIB 5HKAA 3UW1A 1M6VA 2P78A 2PFGA 2H31A 1OXBB 2DG2A 1XZDA 3PVSA 1YRQA 3PT9A 1PDVA 1R8SA 4G37A 3G0CA 4BVEA 1YRAA 1H0RA 4PLTA 4BGEA 4F1JA 5G0WA 1W94A 3BL6A 4OQLA 4AZ0B 2Q5LA 3IPLA 1V4NA 1J90A 1O0SA 1XD2B 1PEAA 3HCOA 4DMUB 5JMTA 1MOZA 2I3ZA 2VZ9A 2HYDA 2VVTA 3DEHA 5CYOA 1ZOPA 3ZCXA 5CNJA 2TMDA 5CLHA 5CEJA 1Z5OA 2XT6A 3EEBA 1F2UB 1UWLA 2R1TB 5I6DA 4DREA 5TS2A 3G2MA 2MWMA 2I2FA 5F7ZA 4OG2A 1E89A 3NBUA 4S2EA 1X7HA 4Y8VA 1U1GA 3DDHA 3ES9A 1PU2A 1Q7BA 2Q6LA 2FR8C 2KHZA 5JDCC 4XQGA 4OK3A 3TQIA 1GJRA 1CY1A 3KXPA 3SJ7A 2XB2A 2PS0A 3SQMA 5JI2E 3GFPA 4PR0A 1FTQA 3HHPA 3PD0A 3VNVA 4YJFA 2BEVA 1RDFA 4OUDA 4QOEA 2BH2A 1TM3E 3CNEA 1YCGA 1CF4A 3WKEA 4PVCA 4Y1EA 4BJ1A 4JAVC 2QBYA 1TIPA 1EYZA 2LDXA 1AVTA 2OGSA 4GO1A 1QH1B 4NZNA 5CHYA 2GN9A 1QBGA 1A5BB 2YFQA 4GWGA 4HTFA 3D6HA 2V9PA 4H1HA 2AV6A 1YFLA 1LWNA 1NI3A 1ZONA 4MYCA 4ASUA 1V0JA 1JI3A 2PEZA 2G80A 2JAQA 1HURA 1EI9A 1RE0A 3HCEA 1IDN1 4HLQB 1P3DA 5DXJA 4B4WA 4DIKA 3ENZA 2GN8A 3GEGA 3VPFA 2FQQA 2LCFA 1TJ5A 2I65A 3COZA 4TWBA 1R8YA 3CZ4A 1OXKB 4DCCA 4KDEA 5EQJB 1BA3A 1UFKA 1FFHA 4HH0A 2GF2A 3HCPA 4LDJA 5JAZA 4KN8A 2HK8A 2R5WA 1CUYA 1KDRA 2B34A 3HCAA 4PSKA 1E2DA 2LZ0A 3X1JA 2UZ4A 3KCNA 3K09A 1MORA 1LI7A 1WPRA 1GTZA 1XMQB 5FBKA 2DERA 5CYFA 2ZAGA 4BBAA 2YQZA 1XLTC 1L1EA 2WF9A 4DV7B 5I4IA 1NLYA 1D6JA 1BVRA 1XNGA 3AHEA 4EP1A 1H2YA 5ILGA 3WLAA 2ODTX 3KJGA 5JXHA 4FGKA 3D2BA 4H17A 4N7BA 1IUNA 1C1XA 1C7FA 3UWDA 1Z28A 3FNEA 4Z3OA 3ETEA 4I4NA 2AI3A 4MVJF 2G1PA 1D8TA 3GH1A 4IICA 1ZGGA 1FP2A 1GZUA 1LDYA 3BT7A 2C1ZA 1OAAA 1N9GA 3QTTA 4EZEA 3OLQA 3FVQA 4WI1A 1SELA 5B6IA 2JGMA 1F9AA 2IYVA 3KD2A 3D1JA 3SM9A 4KQMA 5E9JA 5HFNA 5EZ5A 1NC1A 4H18A 1U2GA 1MB9A 4P33A 1QOZA 3V5NA 3VU3A 4J0JA 4LXTA 1PD0A 4HNTA 3SYLA 3NC0C 2CL0X 3ZJVA 4JT9A 3FYDA 4C78A 4PW0A 1ST3A 3FBTA 1EM6A 2CL7X 1EDBA 4X97A 3TLJA 3EPHA 1AKRA 3ICEA 4RDHA 1VLHA 5E38A 5K0LA 5DYYA 1JX6A 1Z2OX 5AMXA 5FIUA 1HLPA 2VDNB 2HCTA 2IYYA 4TLBA 2C2BA 1WHSA 2CLOB 3GMTA 4V0ME 2UUCB 3B78A 3E8XA 4RCYA 3OZTA 3CJQA 3U3XA 3V2GA 5C7YA 3AP2A 4U39A 4Y6RA 4NULA 1T0PA 1TVMA 5ITVA 2ODWA 4QXMA 1QIJA 3LNTA 3S5UA 5LQNA 1V3VA 2BH9A 1W5TA 2HRQA 5KIAA 1U0LA 1VCOA 2X8BA 1YZ3A 5J5AA 1NULA 3L06A 4W5RA 1X7GA 4RTNA 4C5AA 2IXBA 1Z47A 1MP0A 2ZFUA 3DCNA 4TTPA 1GFWA 2GXSA 3C15C 4ENQA 1P60A 3IAM1 5LZ8A 5FCDA 2XDQB 1TLTA 2HV8A 3AO0B 4B43A 3TJMA 1O57A 1O94C 3FSRA 3MS2A 4WOPA 1EVZA 2XYHA 3QXHA 2P6OA 4GH5A 1H2XA 1OVMA 1W5FA 2A9KA 3M3PA 5HVNA 4WW0A 2GKGA 2GWHA 3KJEA 2QX4A 3X43A 1YZUA 2QL5A 4CLOB 1PK7A 1ZSVA 2DPYA 2BEJA 3H5TA 3E1SA 3MB5A 4LXIA 1DFIA 2CB9A 3BB1A 4R1NA 4EHLA 4MUFA 3H9UA 3RS9A 3GJ6A 4ZQIA 1QGOA 4I55A 5AUNB 1IY2A 1YOBA 2PDAA 3GYGA 3T1NA 1JG3A 4FC6A 1EFPB 3PITA 5CCBA 1H22A 2HHCA 2FSHA 3FYUB 5JVDA 1U7WA 1V3TA 5E1BA 1SBQA 4I8DA 3PFBA 1VZ2A 3AETA 3WLMA 5JYDA 4R40A 3DH0A 1QGUA 4OLAA 5AD1A 3GA0A 1E0SA 4JOCA 4OK6A 2V0NA 1XJCA 2F6RA 2RJ3A 3WAJA 3U4HA 5A6VA 4IZ6A 2VTDA 3QHQA 4V0SA 2JCSA 5A7FA 5KU1A 1O95D 1YZQA 3QX7A 3QPUA 3RC1A 2AOWA 4KAFA 1H8HD 4EYGA 1V9SA 4X71A 1NP6A 3S1LA 2KI5A 3KQLA 3IELA 5CEFA 1Z2NX 2UYYA 4L8YA 4B73A 3FVTA 2Z2KA 3G59A 5GPBA 1M8PA 5IC6A 5IT0A 1CIJA 5DHSA 1MVNA 1SU4A 3KV3O 3JQFC 1WB5A 1G6OA 1U02A 5CDGA 2OBXA 1JJBA 4E33A 3U39A 2UVDA 1NW9B 3KL4A 2A86A 1DBPA 1ORRA 1BOOA 3OY2A 4YCAA 2LKCA 3T38A 1GZVA 1M8FA 1GUZA 2IYLD 3U26A 2F43B 4RFLA 1QU2A 2A3NA 2VSFA 1G4HA 3NATA 3NBFA 2PUCA 4MKIA 3UAOA 3NHSA 3DW3X 4YIKA 1V5IA 1MFZA 1T2DA 2RARA 5SZJA 1VPWA 3OQMA 2HJRA 4DT1A 3CRQA 3A1DA 2W90A 3DAPA 3CEMA 5BYJA 3AFMA 1UC4B 3ACDA 3STXA 4A73A 2J6CA 2JFPA 2OLKA 3C7TA 3FZEA 4FYHA 5AIBA 2JLZA 2HJWA 4RSMA 4RS4A 5EIBD 1H4SA 1WZNA 3QFCA 3BCHA 1WF6A 2H7YA 4TUYA 1K8QA 4IUCS 4NFLA 1PZHA 2VTVA 4OXYA 5K05A 2VQEB 1SHKA 3EW7A 1JDBB 1F5NA 3GJ7A 3E0XA 4KKVA 3TF5A 1OYWA 2AG5A 1IJFA 3E6AA 1PVDA 5JRDS 2GBLA 2CL5A 4F2PA 2VN8A 3BK2A 2ZAIA 3KKKA 4L28A 3W8FA 4GGMX 2QRUA 4QU8A 4TV9A 4EUSA 1CE8A 1BRMA 1C8KA 2ET6A 2QN1A 4RH1A 2VQ3A 4C3VA 3CMMA 4DTCA 4ZI5A 5A3SA 2VPQA 1YOVA 3C4VA 4JIGA 4ZCQA 5KJ6A 1XVTA 5BY2A 3IV7A 3N2YA 4BJ3A 1O97C 1SHJA 3O21A 3F8TA 3OPQA 3H3JA 3PHGA 4W6QA 4CIDA 1TTPB 2Q2WA 4MS3B 1VL8A 2ISQA 1WHTA 1MOPA 1PUJA 1Q1GA 1ULTA 3O47A 4PO8A 2XNDD 1I0LA 4UM9B 1FFYA 2PUBA 1GZ4A 4XVCA 1EUCB 3WLPA 3EGDA 3NHYA 1EVYA 5P8WA 2ZR9A 2WFLB 1UADA 1NBIA 3M9LA 3SVLA 4BP3A 4PICA 3U4AA 3L7NA 3M34A 1N2BA 2VTEA 3N2KB 4IXMA 5A4AA 4RTRA 2WHRA 4ZVTA 3S7TA 5GIOE 5LQDA 2ZWIA 3NT2A 3A6PC 1O6GA 3AUXA 3E5MA 4HDNB 2PKEA 1IN8A 2XB9A 1IQRA 2QGZA 3CT6A 3NM5A 4OPMA 2WJVA 1R4MA 4PAMA 1LVGA 4YMHA 3HJBA 3WGIA 4YY3B 2JFQA 1EDEA 1CDOA 1PVVA 3IKMB 1BMDA 1T9KA 1LA2A 2GT1A 4IJVA 1D1QA 1P7CA 4LMPA 4BP1A 2NPOA 3OT1B 3TRFA 2WMNB 2XCLA 4O2AB 5FWYB 2X2PA 3IKLA 4PS0A 3MS4A 3RU7A 2VRWA 3H86A 2IOYA 3ZDQA 4O33A 4UBIA 1RXEA 3RC3A 3O4IA 1JZQA 4H15A 3O3CA 5CYGA 2QJWA 1EAMA 4CF3A 5I8WA 3HTXA 2AJTA 2JKZA 1LK0A 2P2ZA 5H83A 2PX6A 1XFAA 3AF2A 3N2LA 4TSFA 1YCFA 3OOJA 3WYAA 2H1OA 4PVDA 5ALNA 5K99A 2WFMA 1LPSA 4Q5IA 1DFHA 2UZ1A 1Q7TA 1T1GA 3L7DA 1G20E 3WAGA 1N2ZA 5EXDA 4UD6A 4NBSA 3UAXA 4EJ0A 3R9XB 3VPAA 3LE8A 1QHEA 3ED1A 3N70A 3VO2A 4UM9D 4MEBA 1PBTA 3UGJA 2RGYA 1I4EB 4WNYA 5I47A 4YDHB 5DU2A 5LM3A 1LDEA 4H16A 3HS3A 2QENA 5A0FA 1U9CA 3UWPA 2PR7A 4DWOA 5BV8A 4H35A 3ZOZA 3R3JA 1K9VF 4FFVA 2OQRA 3ZVMA 4XR4A 4TWAA 4KQWA 1JR3D 1GLNA 3R9WA 2IS6A 5DBFA 1O5IA 4KR6A 4QIHA 3OO1A 4Y6QA 2JCXA 1Y8AA 4O5AA 5D7BA 3KYDB 5TMDA 3D3KA 3CF4G 4LJLA 4EBBA 2HLNA 2JJYA 1XMVA 4FLFA 2H29A 3RG2A 3U3DA 3PYMA 2Y1KA 4QXPA 5MF6A 5BQ5A 4EG0A 1PGNA 1IWBB 3KTFA 5J1SB 3UJ9A 2D4AA 3VBCA 2XNKA 4F4HA 5ADHA 3BXXA 1T3HA 5CGQB 4DJTA 5G1PA 4MUMA 5I7AA 1QFMA 3EAQA 4IH9A 5B4VA 2MU1A 3ABSB 5JTUA 1OJLA 3PSHA 4J0QA 3ZWDA 5B2FA 1K06A 1NW7A 1QO9A 2VATA 2PN1A 2F9MA 1S96A 1ZEJA 4NAVA 4PFKA 2FVYA 4TN1A 4HNUA 3SHOA 4F8JA 1OA1A 4MV5A 4NARA 1GTMA 3A6JA 1YVRA 2FP4B 2R6GA 4OEHA 3SX2A 1K7FB 2CFIA 3EPRA 4JJFA 3TEMA 1ZK2A 2YOGA 3FZQA 4UHKA 3E9NA 2J5KA 2I9KA 1MIOB 3MYYA 2FPPA 1K6EA 3JXEA 1PLLA 3NHMA 4HADA 4RS3A 4B6SA 3ZCUA 1VGQA 4ZMSA 1HNWB 4EKDA 1QE0A 1V8FA 3FOFC 1VE6A 3JALA 4XX1A 1MC5A 3DHNA 1L7AA 2GQ0A 3AFHA 4IGEA 3CZMA 5JJKA 3OFJA 4HGOA 4IIGA 1AQUA 1BNCA 2OCPA 3ZS8A 3PDIB 2V9CA 1KI9A 4PZ9A 4NLLA 2R6HA 3ESQA 5BNZA 2FA9A 3GFQA 1JXQA 1KNQA 3D3JA 3OU6A 4O4HB 3Q7PA 4B5LA 1FXUA 4OY3A 4K28A 3R44A 1L5GB 3SJBA 1QV7A 2WW8A 4LYDA 1QK4A 3W2IA 4JEMA 1HV8A 3PCTA 2N47A 4ADSG 3HA3A 3KKPA 3EDOA 1YKGA 5TNXA 1N4DA 2FP3A 2VXBA 3N2ZB 3RTDA 3UHJA 2X0IA 5JFGA 3U4DA 2JIBA 3I9KA 2C84A 4RZUA 2OGTA 4XUGB 2R85A 5HZGA 1EBUA 4MCHA 4XDYA 5BT9A 4Y9DA 4MLZA 5B3JC 2HRDA 5JS6A 1ZDMA 1GTRA 3BCUA 3SR0A 1VXRA 4FIZA 4EUKA 1P2SA 1W47A 1NX9A 2I6TA 2ILTA 2R8RA 4J4TA 4PZEA 3B7GA 4CCWA 4XSHA 5GJCA 3PNSA 2F1KA 3SICE 2HHHB 4CM9A 3PXEA 5HM6A 4MYTA 3GFOA 3HACA 4JZKA 1D5WA 3OE5A 4RETA 3BHNA 4QGFA 2QTCA 5LP6C 5AUPB 4MIYA 1D8AA 1TU4A 3F67A 2YMLA 4F4JA 1ZI6A 3EVFA 4R9VA 2X8AA 3QNWA 1RXUA 3F5QA 3USES 5AW3A 3WSTA 1J6UA 3V1TC 3EQZA 1XZQA 1ZKMA 3I4FA 3LW8A 5J2UB 4H1WA 4B1FA 4UREA 4PTLA 5JZ9A 3WFZA 2GPBA 2JDID 2XBLA 1ACLA 1ETHA 2BKXA 3PKZA 4HRAA 1OREA 2FZ5A 4N0DA 4U63A 4XFJA 1JHDA 4ZCMA 4GKKB 4I08A 1CQPA 5T57A 4XB2A 1L9XA 1ONBA 2BFDB 1YJXA 4FQ5A 1FNDA 2GETA 2JAXA 3JASA 3PFFA 4KVZA 5EN4A 5EQFA 3UTCA 1HFWA 5GZ3A 5JWRA 1S9HA 2ZRHA 1IDOA 5DP1A 4PC2A 5HBGA 3WDKA 3NBAA 4B84A 2AMJA 4ZV4A 2R68A 3C6ZA 2FJ0A 4UM8B 5DLQC 3FG9A 5C46F 2YMMA 5CJPA 1D2MA 4MHTA 3UAZA 1WTAA 4G6ZA 2ODQA 1CB0A 2XWBF 1P1KA 3I6BA 4MJLA 2KW5A 1W5AA 2WJAA 3QNUA 1Q19A 2VRBA 2WB4A 3EYWA 3GRKA 3HC7A 4KMRA 4OGWA 4CE6A 1JSCA 5ILQA 2BGRA 5DSZA 4YA6A 3ORRA 3ZLJA 4ETMA 1A04A 1QYWA 5AHWA 4D9NA 2JKVA 1DEOA 2WKQA 3Q6MA 1WR8A 3GUCA 5I45A 2JI9A 2ZDGA 4WNAA 5LQRA 1KPIA 5FL3A 5CLFA 4L08A 3OX2A 3PTZA 3MJRA 3GGSA 2AIRA 3MGKA 3LPMA 2L17A 4QXRA 2NZ2A 4MNTA 4AURA 1E0KA 2DE0X 5A2GA 5ISMA 3Q5GA 2CBGA 3G2HA 1W48A 1YH3A 2PYDA 3GOQA 5JH7A 3GR6A 1QVVA 3AZPA 4F5DA 2BGNA 1AKMA 1O9GA 1Z5WA 1O87A 4KZKA 2Q6KA 4MEAA 5E95A 4ZYXA 3CF0A 3IVGA 1MR3F 2ACVA 5B7NA 5BSVA 4JK3A 1GXSA 4I1IA 2R1VA 3ZV4A 5EMMA 4S0ZA 2F4NA 1KVTA 4WN9A 2OB2A 1LW6E 4AJEA 4HNVA 4UM7A 4AN1A 3C8HA 1UPXA 1V39A 2X4DA 2Y77A 5D01A 4EK9A 4ZDKA 2RB5A 2Z5VA 4P86A 3DV2A 2C5LA 3GLSA 4UBMA 4N48A 1ZFNA 5A3JA 3W9BA 3GVXA 1XKTA 5JW6A 3FNRA 4J1TA 3UO8B 1M2HA 2Y9PB 3ZZ1A 5CXSA 5KX5A 4RULA 1FOEB 2GCGA 3I6MA 3UAGA 4OHCA 3BIJA 3SQOA 1PVOA 4US2R 4GNKA 4FZ3A 4GRDA 2D5IA 3CKYA 3LUHA 4Q15A 1Z6AA 4RF5A 3BGDA 3VMFA 4A0QA 2PH1A 1T2EA 2AMLA 2YV5A 5DT2A 5IUJC 5DEIA 5AHXA 1DAGA 1K63A 1SQFA 1Y48E 2GN0A 1OJ7A 2WU3A 4LXXA 1WBBA 2P27A 1TMYA 1Y5MA 3DUFA 1AUQA 1R6DA 1U0RA 1XYGA 3DFZA 1JHYA 1NUAA 3M83A 4FGUA 4R1UA 3VUEA 4XSGA 1Y63A 2YC2C 4RCZA 1X1BA 1OLUA 4J16A 1AKTA 3HH8A 5A9RA 3D0OA 3DAYA 3U09A 5A06A 1UODA 5E8JA 5DVZA 3AMVA 2HDHA 2HSEA 5AKZA 3WLKX 3JWIA 1W85B 1DWPA 1H85A 4YJKA 5DFAA 1BCSA 3X1KA 2QZ4A 4PRZA 4EFNA 2C9YA 3G89A 3O9MA 3TQTA 4IIUA 1EX9A 2BTQB 4JROA 5KYYA 1VG9B 4CMCA 1RTTA 4S35A 2CDAA 2G36A 4BBPA 4DG9A 3TVYA 3TK1A 4XRGA 4AJ4A 1P2FA 3AERA 1MH1A 1M6YA 3PHCA 1NW8A 1L5SA 1FXWA 4ESOA 4WV3A 1P72A 1QIKA 4ATNA 2EKQA 1CHNA 3OOYA 4XGRA 3CG0A 5BVGB 5FXMA 2D5CA 3GK3A 4MTLA 1SXIA 4D6XA 4S1PA 1PJTA 3OCCA 1KMQA 4FMDB 4OXKA 5IDWA 2NU6A 4D3DA 2W58A 3F8SA 2ZPUA 3OPMA 3NEJA 4LKOA 2QJOA 3UT6A 2YV3A 1LW7A 3EK2A 1M2EA 4LY3A 3CNNA 1VGVA 4OA8A 1XQYA 4X1OA 5GM2A 2QUIA 2VBFA 4HV4A 3HI6A 4C6RA 2F48A 1QIHA 2ATVA 1GGFA 1LV8A 1RAFA 2VNKA 1GQYA 1KH3A 1N6HA 5J4YA 5K51A 5IZCA 4YC7A 1G8JA 1RWNA 4KQCA 1OLXA 3GVHA 3KXDA 3MZ0A 2CNDA 3K30A 1ENZA 3BD9A 4RORA 5KC8A 5K7SA 4ZU3A 4AP6A 4XWYA 3VR4A 4KOAA 1QH9A 2XCIA 2GJAA 3W3AH 3B82A 1ARZA 2YHAA 4QD3A 4Y0AA 1CZUA 2EFEB 2HWXA 2J31A 3DTVA 1W96A 4WNIA 3I92A 4JC8A 3RTEA 3R7WA 4RZIA 2ZT5A 1XRSB 4H6VA 1LRKA 1RXWA 2AB0A 2BSQA 1Y6ZA 3WIVA 3PR1A 2VHZA 3LRPA 4MWCA 3FWNA 4BMYA 1LH0A 4E30A 1W46A 4KLNA 1E6UA 2B9EA 3ED5A 1SHZA 4YRRA 2CWDA 4BDTA 4TTQA 1S2LA 4W7HA 2AUTA 4IOMA 4F85A 4D9FA 3OICA 2XCRB 1W2GA 4CLXA 1ZC3A 2Q5HA 3WK5A 3VR3A 2CXQA 5A02A 5EIBC 2ISSD 2NXNA 4QJ5A 1JW9B 3COVA 4EG1A 1UOOA 5CITA 1RWKA 1C8BA 2X4GA 4MI3A 3F8WA 4RMHA 1E3MA 1WKBA 2WJPA 3ZTTA 3MNFA 4ND8B 4YQYA 4C4YA 5BN3B 1QVWA 2A6PA 4I5DA 1MF7A 5E9QA 3UCEA 5KTYA 3JWEA 3QKUA 4EBFA 1QCZA 2WHEA 3N39C 5BUZA 1GRNA 3TZKA 4UPEA 1R2QA 5BN1A 3BDIA 3GZTB 3IPXA 1HDRA 1XCJA 3IS3A 4DZRA 1A7JA 1JNXX 1QP8A 1QO7A 1U0TA 1CHDA 3QV1A 4RPKA 3HB1A 5CM9C 1GDTA 4H7KA 5CX1A 2B8NA 1KO5A 2P41A 3NO4A 4R41A 2AN1A 3V7FA 1UOQA 1YASA 1P6XA 2OSBA 2B37A 2ZE7A 3DYIA 3I8SA 5EJEA 2OK7A 2V03A 4PG5A 1Z18A 4QYIA 4N0QA 1X1DA 4YUAA 1IUOA 1M8JA 1TQ6A 2P79A 4JVOA 3T61A 1VCHA 3ZWOA 1EBFA 2M6RA 3T7RA 4W9NC 2ZCVA 4ZN6A 4QDZA 3CVYA 3O75A 1RXCA 4PIPA 4UEWA 2BE9A 3EDMA 4JHLA 1G18A 1VTKA 2Q6VA 3OPYB 5BW8A 4YFVA 3QXSA 2ZJ5A 3RIMA 4TSKA 1ZUHA 2VHVA 5JCOA 3CCBA 2CXHA 4MRNA 2D0DA 3TXXA 5AVXA 4A8TA 5JJLA 1P9LA 3MSCA 1QPBA 2WJ6A 4K86A 3HSYA 2VZLA 4IIJB 3AUJB 2QUHA 3FSGD 3EIUA 3MINA 2CVHA 1A2QA 1OR8A 4MUJA 4XVUA 1NF9A 1OGJA 2QD4A 1AB6A 1CJCA 1HYHA 1RWVA 4FZVA 3GLKA 5IBRA 1NDUA 2IS2A 2N1MA 1Y6JA 3A1EA 2ZJOA 4MYHA 4IX9A 3UENA 2PT6A 4UMDA 1VMDA 1EU1A 1AKWA 1KO4A 3MAAC 2BM1A 1XCBA 3IEUA 1HL7A 1H2WA 2ZSJA 1SCUA 4FYIA 3VPCA 3HYCA 1NMEA 1HDZA 3GT0A 3ZIAA 5B6PA 2RB4A 3GRYA 4HNHA 4ZI3A 1BRTA 2BBWA 3QG5A 3F0TA 3BJMA 1YZNA 1PWEA 2DKFA 4FGJA 1XHFA 4D4IA 5C52B 1U0BB 2C7VA 2O1EA 4GI5A 1NLUA 1A96A 3DONA 3L8FA 2X23A 4MRRA 3AZOA 4LRTB 1JIIA 3CO5A 2FMIA 8GPBA 3ZLTA 2W4MA 2B21A 2FX2A 2EATA 2QQEA 3AC0A 4OQDA 4D4KA 5KNDH 4MPJA 1IQ0A 1PK8A 2GCEA 3DE2X 3NIWA 4GI1A 3AEUB 3BD8A 1PWXA 1WCIB 2A1IA 2X7HA 3EPJA 3WLTA 3CX7A 4ZAXA 1XDZA 1VKOA 3DYBA 2MSNA 2R48A 4QBGB 1DT3A 2EKLA 1R0CA 3LJKA 3GAZA 4R69A 3FWHA 1YBAA 4O08A 2W8BA 4UMEA 3GLHA 1RTKA 1PSZA 2QRMA 1R6TA 2FMHA 5EAIA 1B2LA 4EG6A 1JFFA