3NJRA

Crystal structure of c-terminal domain of precorrin-6y c5,15-methyltransferase from rhodobacter capsulatus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
184
structure length
184
Chain Sequence
MSQVPGRPESAFAHDGQITKSPMRALTLAALAPRRGELLWDIGGGSGSVSVEWCLAGGRAITIEPRADRIENIQKNIDTYGLSPRMRAVQGTAPAALADLPLPEAVFIGGGGSQALYDRLWEWLAPGTRIVANAVTLESETLLTQLHARHGGQLLRIDIAQAEPLGRMRGWSASRPQLQWSGQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An enzyme-trap approach allows isolation of intermediates in cobalamin biosynthesis.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Transferase
molecule keywords Precorrin-6y methylase
total genus 56
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.1.1.132: Precorrin-6B C(5,15)-methyltransferase (decarboxylating).
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3njrA00
3G2OA 3LKZA 3FUVA 1NBHA 1NW5A 3T7RA 3IV6A 1XDSA 1IY9A 4YUXA 3FYCA 4NECA 5BXYA 5M5BA 1DL5A 3G2PA 5EMKA 2CMHA 5K05A 3CGGA 1X1BA 1NKVA 2UYOA 3M4XA 4BLVA 3EGIA 2LD4A 2BZGA 1X1AA 3EVGA 4OBWA 3UA4A 4F84A 3NVMB 3FUWA 4HG2A 3KPWA 5GM2A 2AN3A 2FPOA 1EJ6A 2I6GA 2IFTA 3OU6A 2XVAA 5CCXA 3KQQA 1YFJA 3TQSA 2Z6QA 3PB3A 1FPQA 3NW9A 2GPYA 1R6AA 2PVCA 4QVKA 2B9EA 2PGXA 4P7FA 4HSGA 5CUQA 3UJ8A 3KPJA 5D1HA 1TW2A 3EGEA 4QPPA 3UA3A 4E2YA 3QOXA 1ORHA 2EX4A 1JG4A 1D2HA 2I62A 4FGZA 1DUSA 1VP9A 1KP9A 2PLWA 5LQCA 4PYKA 2ZIFA 3CVOA 1P39A 1EAMA 5EPEA 2NYUA 1X1CA 3A27A 3I9FA 5HIIA 4AX8A 3KQVA 5CVJA 1ORIA 3SMQA 5CVDA 4E2ZA 5LQUA 2GA9A 3UJ6A 3NTVA 2WK1A 3KQTA 4IV0A 4EVIA 3SVZA 3TM5A 1WXXA 4GUAA 3KPYA 3NDJA 1PJZA 5ICEA 5LR6A 3GU3A 1YFLA 1QAQA 2B2CA 2V7EA 4C4AA 3UBTA 5DRTA 1MJFA 2NXCA 2VDWA 4RX1A 2O05A 4PYJA 4LECA 1G38A 5DTQA 3HVHA 2R3SA 1VQ1A 1KPHA 5MHTA 2AOUA 3GRVA 5EZSA 3C3YA 3OU2A 1R8YA 1HNNA 4DF3A 5K0BA 1KPGA 3BXOA 3TFWA 3M6UA 3GRZA 5C1IA 2H00A 5E2BA 4GC9A 4H0NA 2FRXA 4MWZA 5EGSA 2HV9A 3LDGA 2AN4A 4ER0A 4OX9Y 1SKMA 3FPHA 2YR0A 5DM2A 1F3LA 1WZNA 2HWKA 4RVHA 3C6MA 3KHKA 5LSAA 3O7WA 3ANXA 2IPXA 3MCTA 5C9ZA 2IH5A 5F2KA 3EVEA 3GCZA 3HM2A 3UWPA 2ZTHA 1Z3CA 5E9QA 2PY6A 5EHGA 1I4WA 4PYLA 5EC8A 2EJUA 2YVLA 2IH4A 4E32A 4AUKA 3AY0A 1OR8A 3ME5A 2PXCA 4POOA 4GC5A 2AOWA 2O07A 5K0NA 4E31A 2P3LA 1JSZA 2PT9A 3HCEA 3IYLW 3T7SA 3PVCA 2V74B 3U81A 3KQPA 4MQ4A 1P1BA 3HCAA 3FPFA 2Y1XA 2IGTA 1O54A 3EPPA 4ZTBA 4HRAA 4XUEA 2P40A 2JHPA 4C06A 4PINA 3UJDA 3LCVB 5E1BA 2AR0A 2KW5A 3B3GA 5FQNA 2ZWAA 5ICFA 5BW4A 3HEMA 3G2QA 1WY7A 5KVAA 1M0EA 1JR4A 4YMGA 1EJ0A 1INLA 2IBTA 3BKXA 3KR1A 3P71T 1VBFA 5K09A 4R6XA 2NP6A 5DWQA 2PX2A 2Y1WA 4A6EA 4RSRA 4X41A 2UYHA 3G5TA 2AOVA 3SSMA 5LQJA 1KHHA 1RJDA 3D2LA 3HP7A 3LCUA 5IH3A 10MHA 1IM8A 5FQOA 2IH2A 1RJGA 3GGDA 2OXTA 3TR6A 2ZZNA 3TM4A 2ZZMA 4X61A 5DM1A 1VLMA 5E9JA 3LDUA 3DMHA 2G71A 3EVDA 2BH2A 2JHAA 5CD1A 3MTEA 5EKXA 4AZSA 3EEYA 4GOOD 1O9HA 4XUCA 3FRIA 1RJFA 2OZVA 2XYVA 4GEKA 3G2MA 5DT2A 2HR1A 1QAMA 2EFJA 4XCXA 2CWWA 2P35A 3DLIA 1NE2A 3L8DA 1G6Q1 1RI4A 3MGGA 4LWPA 4AZWA 3UZUA 4MIKA 4A6DA 1RI2A 5CIYA 4YUWA 4CKCA 3NJRA 4QDKA 1BOOA 1YB2A 4F85A 2GS9A 3P2IA 3QV2A 3RODA 4CTKA 4ER6A 2ERCA 3BWBA 1AQJA 3AWIA 3BWYA 1NW6A 3KU1A 2OB2A 2OO3A 4KDRA 4RYLA 1RI1A 2BR4A 5HZMA 3B89A 5KYGA 3FTCA 1BKYA 2OKCA 1D2GA 1R18A 2CMGA 2EG5A 2P3QA 4BP3A 2YXLA 2DPMA 4V0QA 3R9XB 4M37A 1N7JA 3BZBA 5HOQA 5EZQA 2C7RA 4EK9A 1QAOA 1TW3A 1YUBA 3LECA 4BP1A 3QOWA 1NW7A 2QE6A 1KXZA 4LG1A 4YV1A 4C03A 3JWJA 5FULA 4FP9A 2ZBQA 4EKIA 3G7UA 2OBFA 3SGLA 3G8AA 5E1DA 5EHIA 2AOXA 4DCMA 2ZIEA 5T67A 2G1PA 3NMUF 3KQWA 1NV9A 3P97A 4U7PB 5E8JA 5EIWA 3RIEA 3HCCA 2BM8A 5DM4A 4BLWA 4WVLA 5K0JA 1FJXA 3KQSA 2ONZA 2FHPA 3REOA 2B3TA 5K0EA 2ESRA 3UJ7A 5EVJA 2AN5A 4FSXA 4GF5A 3E23A 3ELUA 3LSTA 3A26A 2YQZA 3K6RA 2AVDA 2I9KA 2HTEA 3VC1A 3LBFA 1UIRA 3LKDA 4RTNA 5DX0A 3UFBA 5T64A 3PS9A 4YMHA 1FBNA 3NWEA 3G89A 1NT2A 3C0KA 1R74A 2HNKA 3T7TA 4YUYA 1U2ZA 3IEIA 5CM2Z 5FADA 1VP3A 2R6ZA 5GOZA 2IDKA 1R8XA 1G8AA 3OE5A 4K6MA 2Z6UA 4G56A 3EGVA 3M6WA 3FZGA 4KW7A 4QTTB 4GQBA 5GM1A 3MTIA 5CVVA 3OPNA 2PXAA 1JG2A 2P3OA 3BUSA 1RI3A 4FSDA 4PIMA 3SXJA 2WA2A 2CKDA 3DXXA 3ORHA 4RVGA 4U7TB 3VYWA 1IXKA 1JG1A 2K4MA 1ZQ9A 3BWMA 1XJ5A 3HA3A 1M6EX 4RTOA 4ATNA 1QYRA 3LHDA 3A25A 2H1RA 3CJTA 3RW9A 3IHTA 2PX5A 8MHTA 3AXTA 4RTSA 2N47A 2YTZA 3JWHA 3BGIA 1SQFA 4QQKA 2P7IA 5F2OA 3WSTA 1XTPA 4P7KA 2YX1A 4HGZA 1FP2A 3FTFA 3GDHA 2ZIGA 5FCDA 4EMSA 3EVCA 3DLCA 4Y2HA 1D2CA 4DA4A 5GIOE 3DOUA 5CVUA 1XCLA 3KR0A 3FYDA 3Q87B 3UJCA 4E70A 3DMGA 4QTUB 4C05A 2O57A 4PYMA 4YUVA 2ZW9A 3HVKA 5GWXA 3V8VA 3UJ9A 2AS0A 5K0GA 4OBXA 1YZ3A 4LWOA 3FUUA 2OPBA 3H2BA 9MHTA 5BP7A 4YV0A 4OQEA 1DCTA 5LQNA 3OZTA 5K0LA 1UFKA 2VDVE 2GAFA 5G02A 5K0FA 3HA5A 2O06A 4HTFA 2NXEA 4PWYA 2P7HA 2VDUE 3OCJA 3HVJA 3S68A 4R8RA 5K8VA 4HH4A 4EQZA 2B25A 4RV9A 3THRA 5KS2A 4DMGA 1KIAA 3GRYA 3OFKA 3HCBA 1UWVA 4AZVA 2JG3A 1N2XA 1YZHA 3HTXA 2UYQA 4HTFB 3KQYA 2PJDA 5LQAA 3HCDA 3M70A 2I7CA 2OYRA 5K03A 3GRUA 3TKAA 3KQOA 2VP3A 5EEGA 4QVGA 2P41A 2DULA 5LQKA 4AZTA 1I9GA 2YXEA 1XCJA 3CJRA 2C7OA 2B78A 2FCAA 2HMYB 3K0BA 3V97A 3HA7A 5EQJB 3VSEA 1XVAA 5EKUA 3PLAE 1G8SA 1EIZA 1QANA 3LDFA 2ZFUA 4R05A 3ER9A 1PRYA 2ZZKA 2C7QA 5FUBA 3TKYA 4PYOA 3DUWA 1QZZA 3OU7A 3EVZA 4YV2A 2A14A 4QDJA 2QM3A 5FHRA 3LBYA 2PT6A 1WG8A 1KPIA 1XDZA 2YXDA 5B1SA 4CKBA 2ZULA 5K01A 2JH9A 5U4XA 2NP7A 5DM0A 1NW8A 4WXHA 3X0DA 5JR3A 4MHTA 4CWAA 4RTKA 3F4KA 3DR5A 4PCLA 3FPGA 4C04A 2C7PA 4PGGA 3G88A 3GWZA 3SM3A 3BGVA 3TRKA 2JHCA 2FYTA 3TPZA 3GO4A 1KYWA 1Q0SA 1P91A 1L1EA 1X19A 2EJTA 3GNLA 5HIJA 5DSXA 2ZCJA 1Y8CA 2GH1A 3BGDA 2ONYA 3GRRA 3NVKI 1X1DA 3ID6C 1YF3A 3MAGA 4PNEA 3DH0A 1Q0TA 3ELWA 1I1NA 3OE4A 4MTLA 2PBFA 3NWBA 3OZRA 4CKEA 1L3CA 1SUIA 2ZBPA 3A7DA 3B3FA 3DTNA 5DTMA 3UJBA 4E30A 2GLUA 3FPEA 2AOTB 1EG2A 3LGAA 3KQMA 4OA5A 3SR4A 4UOEA 1MHTA 1M6YA 2FK7A 3A7EA 3R3HA 4QQNA 3LX6A 3THSA 4KVZA 2PSSA 3LCCA 5CCBA 3KR2A 3R0QA 2Z6AA 4O29A 5GP1A 3DXZA 5HILA 4CXMA 2AOTA 3MCZA 5C0OE 3ELDA 5FWAA 3CKKA 4BY9E 1SUSA 5LQRA 2AVNA 1ZGAA 3HVIA 3CCFA 5FWDA 4E2XA 4EKGA 2XYRA 2WA1A 1XDUA 2XYQA 2BM9A 3B3JA 3DMFA 4L7VA 3JWIA 3FUXA 2IDJA 4OQDA 5EIFA 5FTWA 3LPMA 4ER3A 4PYNA 5EMJA 2ZVJA 5DLYA 2BR5A 5FA5A 1VPTA 4ER5A 5ICGA 3P2EA 3EVBA 3EEOA 5HFJA 3BKWA 5DX1A 3MB5A 2QRVA 2ORED 3P9CA 4DM3A 3MERA 1BC5A 2PWYA 1H1DA 4CTJA 3EMDA 4KDCA 5F2NA 1N7IA 2ZBRA 2ZLBA 4RTLA 1T43A 2BR3A 5E8RA 2NNWB 3DP7A 3SX0A 2GB4A 5FHQA 3VC2A 3AJDA 1RJEA 4RVDA 3SSOA 4C07A 5KQSA 1JG3A 1SVUA 3FRHA 2VZ9A 2PX4A 4P58A 1SG9A 4GBED 2H11A 4GOMD 3GJYA 4KIFA 4B17A 2JH8A 2F8LA 2NXNA 2P1DA 3M33A 4DZRA 3R6TA 3MHTA 3PFGA 1FP1D 1R00A 1VE3A 5EEHA 4HC4A 4DQ0A 5IKMA 4RTMA 4IKPA 3C6KA 5BW5A 3E05A 4X63A 5EMLA 5EMMA 2OB1A 5HIKA 7MHTA 3LL7A 3PFHA 2PWPA 4FR0A 3MQ2A 2XVMA 3P8ZA 1AF7A 2ZWVA 1G60A 4FT4A 1ZHFA 3KR9A 2CL5A 1SQGA 2QY6A 2QYOA 5FA8A 3CJQA 3I5UA 3B7PA 4JXJA 1ZG3A 5D1NA 3M6XA 4RWZA 1RI5A 2E5WA 3A4TA 3B5IA 3P9IA 2NXJA 5DXJA 5E9WA 5ERGB 3TMAA 3E8SA 2IBSA 4M38A 3TLJA 4RTQA 2G72A 3TOSA 3EMBA 3KPUA 5EG5A 4YUZA 3CBGA 2G8NA 3O31A 3HNRA 3FPJA 4KWCA 4M36A 4QPNA 5E2AA 1L3IA 5EOVA 3DULA 3P2KA 1JSXA 3R24A 5GINE 4KIGA 3O4FA 4C08A 3G5LA 4E2WA 3FTDA 1JTFA 3PX3A 4DCGA 3I53A 4RTPA 5CVEA 4HGYA 4P7GA 2XBMA 3I58A 1WXWA 4DKJA 1VIDA 2FK8A 4Z2YA 5K0CA 1AV6A 3KKZA 4PIPA 4IWNA 5GIPE 1TPYA 5KQRA 5DRYA 1XXLA 1EQAA 4PCAA 4M7RA 3JWGA 1KYZA 3P9KA 1NV8A 2YUIA 2ZSUA 2ADMA 5DXAA 3PTAA 4IV8A 5T6BA 1ZGJA 3PX2A 3EVAA 3C3PA 1AQIA 4PYIA 3PT9A 2JJQA 1P1CA 3HCFA 5ICCA 3ERCA 2O0LA 4RTRA 4P7JA 2P8JA 4PGHA 3BWCA 2UYCA 2PKWA 1HMYA 1JTEA 4GOND 4XUDA 5DSTA 4F86A 1G55A 5JUWA 3BT7A 5DPMA 3SSNA 3FUTA 1KR5A 3EVFA 1NBIA 3ELYA 4KRGA 3UJAA 4FS8A 4OA8A 5DTRA 2OY0A 3ER8A 2UZ4A 5HEKA 1V39A 2QRVB 2AOUB 2VS1A 3NDIA 4ISCA 4PYQA 5E1OA 3KPVA 4FT2A 3OFJA 4X60A 5HIMA 2PXXA 2PX8A 3P9NA 1JQEA 4BLUA 3FTEA 2PV0A 5H02A 1L9KA 2IIPA 3DXYA 3AXSA 3GIWA 3GXOA 1L3BA 3OZSA 3Q7EA 5P8WA 1JQ3A 4RVFA 2Q41A 1F38A 1ZKDA 4R6WA 4V0RA 4E33A 1NW3A 4GOLD 1VL5A 4R8SA 3CC8A 1O9GA 2G70A 3I64A 1BHJA 3M6VA 4FZVA 5E1MA 4ER7A 1JQDA 3E7PA 4X1OA 2AZTA 2IP2A 1WS6A 4Y30A 3T0IA 4RTJA 3G8BA 4PONA 1B42A 5DX8A
chains in the Genus database with same CATH superfamily
2QTGA 2R5FA 3IQZA 2CB0A 4R2KA 3T7RA 4CKCB 2A1TR 5H3LA 5BXYA 5M5BA 3CE9A 3TAUA 2C8KA 3G2PA 4DG9A 2QTFA 5JYCA 4L8WB 3OFND 3LP5A 3U2QA 4HN4B 5C5IA 4O4HA 4FXPA 2NW6A 5JLAA 2QN7A 4D41A 5IBRA 1ZR2A 1DTWB 4NDNE 5AM4A 4UVEA 1GG5A 2HBZA 1FJHA 3HQ4O 1EM8B 3EASA 3HXLA 1PGPA 4LF8B 5J1TB 3LO5A 4O1MA 3D2BA 1A69A 1U98A 2VEOA 3VZCA 2R1ZA 1DKQA 4B2IA 5BR7A 3RYFB 4G0QA 3IPRA 2G67A 3L7DA 4JC5A 1WXGA 4DGQA 1E3TA 3EGEA 3L0OA 1ISIA 3RS2A 3KP1A 4ABYA 4DA9A 2AD5A 3INTA 4Q93A 1CXZA 1GHTA 2O2YA 4TS3A 5EPEA 4O4LB 1NRJB 2MSWA 3COVA 3OIYA 4MA5A 3EGOA 2CE7A 2IGBA 4GOKA 1MDBA 4HMQA 4JOQA 4X3OA 3LLCA 5CJJA 5H9VA 4EW1A 3RVKA 2XZLA 3IGFA 1DRUA 4AY5A 4M7PA 4KGDA 4O02B 1ZUNB 3NTVA 2HJRA 2FE4A 1TM5E 2WK1A 2Z4RA 4XH9B 4B81A 1UQTA 2FPUA 3NDJA 3N9IA 1VKOA 3RSHA 2HQOA 4NARA 1WV0A 2WI8A 1UH5A 3KDAA 3MFQA 4L9RA 2BJHA 2BP7B 2QT1A 5F33A 1P7ZA 1MJFA 4L73A 1J1IA 3ZQJA 4ZYWA 1U4NA 1TEZA 4LXQA 3E2MA 1RDFA 3PJDA 1VQ1A 1CRLA 1NLUA 2X42A 2YL2A 4WNYA 1T5HX 5EAIA 5JI2E 1BFDA 3VR4A 3NJ8A 1N5MA 4WY2A 3GUYA 1KI7A 3TDMA 3VHQA 3OT4A 1FYWA 2XHEA 3K0FB 3M6UA 3L79A 2B9VA 1J8VA 4D96A 1Y5NA 4Z7QB 3LQFA 1DQRA 1F6DA 2JKZA 2ZG6A 1AE1A 4K6CA 4LA4A 2O8EA 1E7YA 2W58A 3NUQA 3I9OA 4HVAA 1KJYA 4XCQA 1B6RA 1Z3CA 3OT5A 4O4IF 1DV1A 3GAAA 3GT7A 1D4ZA 2ZTUA 2C4VA 3AUYA 4L8YA 1X77A 4PYLA 2JFYA 4BMYA 3VNVA 4FHGA 2A1IA 2BLNA 5CXXA 4KO1S 2GXUA 3GPIA 5FEMA 3WOHA 2XZTA 4B3IA 4CIXA 5J2UF 2BGGA 1U04A 4C5BA 1XAIA 4IH1A 2NUTA 2QB5A 3WGQA 5A9SB 1EZ4A 4ZTBA 3SLRA 3BICA 4MICA 4TVOA 3UOWA 4WSOA 1J33A 3EHDA 4XE5A 1SCUA 5FQNA 2HHJA 3O8CA 1SULA 2QM7A 5BMVA 1Q3KA 2GXSA 2LDBA 4BGVA 4QBGB 4Z4HA 1K92A 4CMGA 1QFZA 2LKDA 4U1RA 2C3YA 3L8ZA 3RSCA 4AKGA 1C7FA 1O8CA 4IDGA 5M34A 2RBEA 1PZNA 3G5TA 4HEA6 5BOSB 1N1DA 3BK1A 3EIFA 4QJ5A 3WQHA 5JASA 4CTMA 1APBA 2GZ2A 1ZCFA 5DYWA 4L95C 4X61A 5DM1A 5A3JA 2C5FA 1XTUA 4GG1A 1AHPA 4OMDA 3CWZA 2RK6A 1U2PA 1DTSA 1QHEA 3A9TA 1L4HA 4B9EA 5KYKA 4R8VA 4ZYTA 3EARA 3OURA 4HUQA 2OZVA 1V4BA 5AJWA 4F5DA 1LI5A 4UUBA 1QAMA 2R5NA 1Y8RA 4ZJYA 2ZJYA 1XWWA 1OB2A 2O2CA 4X1KB 4C4RA 4RV5A 1N5JA 1NVVQ 1E2NA 4BASA 2IEZA 2WHQA 5J4HA 1JS1X 3FMVA 1SXGA 3EZGA 4Q7KA 2DFVA 1U2EA 2O23A 3ZE0B 4ER6A 1R1DA 2OUIA 4HBZA 2ERCA 2GYYA 5E6RA 3DUFA 5C5EA 4FOOA 1T1SA 2VSNA 4I1PA 3UHAA 2OC4A 3F6EX 2GAOA 2QP3A 2ZP1A 5TPZA 3B53X 5IAJA 2IYTA 4BP3A 3NIWA 3W90A 1QZTA 2F9FA 3L8CA 1KK3A 3CA8A 3L92A 4M1SA 4YASA 1DKMA 3QU9A 1IY1A 4LV6A 3UEOA 1XVLA 2E48A 4F2HA 5JSUA 3DD5A 2HD4A 5FULA 2ZBQA 2O8NA 2ECQA 3OIVA 4J7CA 3VYUB 3E9EA 4JS0A 1AUQA 1XFDA 2AMLA 1M76A 4O2AB 2ZIEA 3KZVA 1HDOA 4LNAA 4TMZA 3HCOA 2J8ZA 3G5MA 4ZVSA 3ZHYA 3KDPA 1UMCA 4PG8A 4JYZA 3S28A 4XWGA 2ONZA 3R7SA 3F3KA 2DQKA 3FFTA 1NLMA 2AN5A 4FZ5A 4A27A 1C1XB 2EQBA 2XB6A 3JQDA 4WJLA 1E4EA 2GM4A 3DC2A 4GGPA 4MTCA 3TDNA 1SIWA 3M9XA 4JB0A 4B35A 4ILEA 2ILVA 2CNBA 1J9GA 2BKLA 3P0RA 3UB2A 3EPRA 1BVHA 5BUQA 3UPTA 1NTRA 3PS9A 4MVJD 4Z1OA 2RH4A 1E4OA 3EPHA 1ECFA 1R0CA 1UINA 1P9RA 1Z6YA 2OCKA 2RHRA 3C0KA 4FCTA 3T0GA 3G2JA 3BRCA 1CB0A 4Y8VA 3UICA 3V46A 3N58A 3ZE8A 3JYPA 3RAGA 1GCAA 4P31A 4UARA 1O5OA 2IDKA 3T4EA 3PJFA 4I50A 2ZUDA 5J58A 1E6WA 5HQJA 2C83A 2PYIA 5CVVA 4CCSA 2QRLA 1HKUA 5HG0A 2H31A 1SEVA 2HRRA 4U2DA 3U09A 3SK0A 4NHOA 3W7AA 2Q7DA 3B12A 1YJBA 4IIJA 5F21A 4ATNA 3U48A 5LNK1 3OHMA 4CYMA 5B3JC 2CYAA 1S96A 1GM5A 2XGMA 3JWHA 2PYDA 3ZDZB 4YRLA 3HKEB 2B20A 2A0XA 1OYWA 4TVSA 3GDHA 2CSXA 2PX6A 2RH5A 4IIFA 2E4ZA 3ZH2A 3WFZA 1XCLA 3CEJA 2QLMA 3TRHA 2CHVA 1DAPA 3BL5A 1NMZA 4WMLA 2W6JA 5AK6A 2KHZA 5LYJA 2O57A 5DNUA 5JRZA 1YRYE 4KE8A 3MBOA 3GQBB 2GERA 4PC3A 3FYUC 5HM6A 3OAAA 4MYCA 4TQ9A 2ZS7A 1P80A 2EBHX 3ZBUA 3NV9A 4J0FA 3IELA 3MS2A 3KIPA 1ID1A 1RE1A 1DAGA 3JQRA 4FB5A 4Q34A 5K0FA 3AP2A 3CB2A 3IQFA 3HU5A 3KZKA 2FZEA 4K46A 4BLTA 4S1OA 3Q8MA 4JBLA 1OAAA 3GEHA 3LX8A 2B25A 5GZ6A 1FNMA 3UWOA 3WTBA 1GA1A 2QEQA 1M72A 3A9UA 3HU1A 1QHNA 1COZA 4KMMA 4NOLA 4WNCA 5H0IA 2GAAA 3RNOA 2NZ8A 3O3OB 5TPWB 1PJTA 4BUCA 2PBZA 1A88A 4DJTA 4X8LA 3MN1A 2ZTSA 3F78A 3A6EA 2QRPA 2IIBA 4MWSA 4QVGA 1XCMA 2WB4A 1EDOA 1DZIA 1YTLA 1QFJA 1RHMA 1GZDA 3KRTA 4JA0A 2ORYA 1XVAA 1JIXA 2HWXA 3T5AA 1ND6A 2ON6A 3G0OA 1T9KA 3CLTC 2IT1A 4ENVA 2Y0DA 4DB2A 3IEUA 1ZHHA 3OU7A 2JZOA 2Q1YA 1HOTA 2PT6A 3H5TA 4QODA 5AXAA 1NVAA 2A8YA 4P0QB 1Y8RB 1D4OA 3IHKA 3LUDA 3BWVA 4HEHA 1UODA 2WTEA 3G9XA 4NTZA 2EXXA 4W5JA 2GYUA 4RXTA 3RT7A 4JOCA 1R7RA 4E09A 3KCQA 1W6RA 2HHCA 2QIOA 5DBFA 3VDQA 3VI4B 1U8TA 1F14A 5KVSA 5F51A 4FYXA 3MJDA 1BN6A 5FNVA 4E4YA 5MFZA 1ONPA 4YCJA 2QTWB 1J0BA 1SC4A 1FP4B 4IRMA 1FNCA 4D3ZA 1RXVA 1D0SA 1U6IA 4P3XA 2AQ8A 3A6KA 1ZI9A 3BBLA 3GL9A 5HGJA 3WIDA 4PCUA 3ETCA 4PO1A 3ZCQA 3DH0A 1JJAA 2QRJA 1I1NA 4OM8A 4TTPA 4B2YA 1NVDA 1PUJA 2VDKB 1ZRNA 1HYHA 4K03A 4AY2A 2J3JA 1L3CA 1H6CA 2YQ5A 3DMYA 3D4PA 3QVLA 4TWRA 5BVGB 2EFCB 1I3LA 4UOEA 1PK9A 1XJWA 2OESA 3KG2A 2FK7A 3IBSA 5LJIA 2WKSA 1RP7A 4KVZA 2V0GA 3KR2A 4L75A 3U1VA 1JHPA 1CEXA 2XQVA 2ZVPX 2LDXA 3ISJA 4HRXA 5F2EA 1V7CA 2IPMA 4V0LA 5I7OA 4L8VA 3ROGA 1ZGAA 2PLRA 4EKGA 3DMFA 3ICOA 4DTCA 5DFAA 3PVZA 3OQHA 4OQDA 3EPLA 4KPEC 3ROZA 5LDGA 3QXHA 2FSIA 4LTNA 3T12A 4FYWA 4LK3A 1ZK1A 2LE0A 5DLYA 2BM0A 2FEPA 4ZOCA 5L4SA 3HXMA 3FNFA 3LTNC 3FOWA 5CFOA 4GI1A 1XNJA 5HKAA 1ZIPA 3IMCA 1J21A 1GKKA 2C5HA 4O63O 1PD0A 1MD9A 2DC1A 2PLNA 2D54A 2C84A 4RTLA 1SFRA 1Y4AE 3SAJA 4CUZA 4DAEA 2FWIA 1RIIA 5J47A 1GPDG 1VA4A 2C2BA 1KSHA 3KEOA 2X1VA 4WACA 1UPTA 3LSYA 2MSEB 4QOIA 5JH7F 3WWCA 4DR5B 3AEUB 3G9TA 1XCPA 1E89A 1PJAA 2D1YA 1WHSB 1XRMA 1JEOA 1ZMOA 1R64A 3TKLA 3E58A 1U7ZA 2XQKA 4GVLA 1L5SA 3CU5A 4DC9A 2VH5R 2BFNA 4P4LA 4OQXA 4WOCA 4S1WA 4I3HA 4NCXA 3RRYA 1KVRA 4AJLA 4MP6A 3BJEA 2GT1A 1ZHFA 3L7NA 1QK4A 3KR9A 4TRNA 1YR2A 1GZ6A 3UM9A 1MX9A 1USKA 5D1NA 1T5LA 4J0IA 1Y82A 1MVNA 2I4TA 3CS3A 2WVHA 1ONNA 2W6CX 3ABQB 2P4EA 2VK1A 1QC5A 3VSDA 4PY2A 5C7YA 1AUOA 1CK4A 2FUNB 5DOZA 4M36A 4EZBA 2I1WA 1CF2O 4ZVTA 4L3OA 4KREA 2QJOA 1O3YA 5IK2A 3I0NA 3E81A 3R24A 1Q6ZA 3M34A 5HJ7A 1F8UA 3ETNA 3EOAI 2DM6A 3R8XA 1LK7A 3JZDA 4NV1A 2F8MA 3FDZA 1DI0A 2B4RO 4ZK6A 1H9AA 1LPMA 1PHPA 1VIDA 1KYYA 1ODKA 3VO8A 4ANFA 4ZI3A 4B83A 2J9ZB 4KE9A 2AMVA 3UOGA 4KIWA 1XXLA 1B8UA 4RDCA 5GGYA 3UANA 5K8TA 2BOVA 2W2TA 3HPRA 2HC9A 3L6UA 3WSWA 4ONEA 4B2LA 1JLLB 5CCEA 2QMZA 2TMKA 3Q72A 3RFCA 1E9DA 1ZCZA 3CRMA 4C7VA 4IV8A 5FPKA 4KKXB 1VMEA 1H1LB 2PLAA 1U8AA 2IYZA 5ES3A 4N9WA 4D6XA 4HDAA 4DUGD 3FOCA 1TUIA 3HRIA 3VU0A 4LGMA 3CF2A 1VYVA 2WHPA 3B1YA 4B32A 2WJIA 3OPYB 1NNUA 1YJ5A 3VKGA 4LF7B 3NLLA 3W79A 4OA8A 3AL3A 2ZM6B 3HU2A 4QUHA 1TYEB 2I1LA 4L2IB 2PS1A 2WU0A 1R4ZA 1Z35A 1RVV1 1T5BA 1P45A 2BFBB 2NV6A 3KPVA 4J76A 4UQPA 4X3CA 1C9DB 5C34B 2AC4A 4OHXA 1SGWA 3GF4A 4HP8A 1PFWA 4DRZA 1UXOA 3K5IA 3JTMA 3R9IA 1RKQA 3OLXA 4N12A 1QRAA 3H6HA 3PE4A 3WLOA 1O89A 2MSNA 2UKDA 3EHEA 4MDFA 5TE9A 1DO2A 3K6JA 1FNNA 1QGDA 4LOLA 4QWWA 4U7JA 3ZHZA 4CR7A 2BFEB 5B58T 4NMWA 3KVOA 5FOXA 7ABPA 1QTNA 2JLWA 3L0CA 1JSLA 3O1HB 1FP4A 1ZJ4A 4R5HA 1QH0A 1PEDA 4DMCA 2IP2A 4RLHA 1M1YA 2B1QA 4ZVMA 2I6UA 1YO6A 1QP8A 3K0AA 2GOYA 1E3QA 2XNDD 5JV5A 1E5XA 3EZLA 4P36A 4JDUA 5AHRA 5EIBC 2C61A 3QPDA 1DX6A 1S02A 4OJTA 2EX0A 1N2EA 2WTMA 2I54A 5TQ2B 1IH8A 2XF8A 4Q1BA 3T7CA 3GGCA 2ZIUB 3PRHA 4BB6A 4C4XA 1DPGA 2XCIA 3LUGA 1V37A 2BDTA 3L8GA 1CTQA 3AEQB 3LX5A 3OPYI 4DC0A 1L8LA 1HE1C 1SC3A 2GZ1A 1AG9A 2NO7A 2QR2A 1XELA 1NG9A 1G21E 2H9AA 1NYRA 2JIQA 1I3NA 2QOEA 1PZHA 3AY3A 1NXTA 3NTXA 4IMRA 5ECDA 2EJBA 1AURA 3NIDB 4O4LA 1DEOA 2W2QA 4II3A 3OOEA 1KEKA 5FBWB 5JD5A 4QPPA 4RVCA 1IBSA 3ACBA 3AL2A 3GC6A 4JC4A 3H9EO 4GRDA 2R68A 2Z2YA 3JASA 1M6NA 4A2CA 3X1MA 5JJLA 1XALA 4Q9KA 3ZWXA 3MJ4A 2WILA 1HE5A 2CFOA 2H06A 2QA5A 2ZRAA 3PUXA 1D2NA 2QX8A 1CJTC 2HBQA 3NP9A 3B52X 1DIGA 1RM5A 3A32A 4NESA 1E3LA 3C1UA 1ZGZA 2I0FA 3VPCA 2V7BA 1FSGA 1LNQA 2MSCB 3ILXA 1U8ZA 1N9KA 4S1VA 1IHUA 1KU0A 4BMOB 5AI0A 3RIMA 1M0SA 1AKYA 1FMCA 4K6KA 4M0CA 4NP6A 1RMTA 3KU4A 1KPHA 2BAGA 5J5AA 4UD6A 4BVJA 1CFJA 4OKIA 4MW9A 3E3LA 4C3UA 1D04A 1UMBB 1IHPA 1CNFA 2E49A 3E1GA 3L5KA 4Q03A 4WKBA 4NS1A 2FP3A 2VNSA 4MWZA 2BDEA 3JW8A 2C5LA 2AN4A 4MUFA 4QA9A 1QO0D 3QVGB 5LKAA 1SKMA 3DLBA 3GG9A 2BW0A 1N6LA 2CVZA 2CZQA 2FWMX 2NX2A 1PX0A 4MGIR 4RPCA 4U2KA 1SK9A 1XP5A 4EG3A 3ANXA 1L1FA 1MG0A 3D8NA 2IH5A 1M5UA 2P0AA 1CQJA 2ZTHA 5THXA 4CT5A 3O0DA 1IEXA 1QHXA 1A77A 1U7WA 3L9XA 2LCIA 3F67A 3FHLA 3E22A 3L8EA 2V7VA 4HH1A 4GC5A 3RYTC 4OLHA 2GASA 3ZHTA 2GN2A 4K6GA 4NYMQ 3KQPA 5JAOA 2ZAOA 2FN7A 3OEWA 2HA0A 2I6XA 2PN1A 5TMDA 1ETUA 2NU8B 1JQJC 1O54A 5IH7A 5JVDB 3B5JA 1TA9A 3SZGA 4AUNA 5B2ZA 3RT9A 4E1VA 1H2FA 4IGAA 2VCHA 4L0DA 1N6KA 3N0VA 1WY7A 3U4IA 4EUNA 3ZHXA 1JR4A 3RTEA 2E4YA 2PFKA 3DE7X 4JQZA 1A0OA 1DC7A 1XN1A 3PSHA 2GJAA 4L02A 4R2HA 4R6XA 3GEEA 3OF5A 4RETA 1FX0A 3NFRA 1BU5A 2FKNA 3I5XA 1E7SA 2UVDA 2FDCA 3FBTA 3D2LA 2EW2A 2RHJA 3AR5A 4HGNA 2H59A 3H42B 4Q4AA 1BYUA 3GGDA 2I9PA 1KEPA 3SVLA 2ZZMA 3QENA 2YV4A 4FBMA 2VHCA 4ND1A 4WFJA 5EJAA 5A5GA 4ENRA 2C98A 1KO4A 2QLJA 4OO3A 5KNBA 4DRYA 3OA2A 4A1FA 3DHYA 1YTUA 5IVIA 1Z6GA 2I99A 2WM8A 2YWRA 3B20A 2CNOA 1DXYA 3OMXA 2HA3A 2HNBA 5AR1A 3RYHA 5JS6A 1YVRA 4XFKA 1Z29A 2FVYA 1EESA 1H8ED 1ACJA 2CBGA 3GN1A 5IF3A 4NZNA 3AKZA 2P9YA 2AJLI 4NQZA 1K8ZB 2TSYB 3A2KA 1U7DA 3CE6A 1AS2A 1WDLA 3W9BA 2PRSA 4Y0AA 4OTZA 5EYPB 5IYZB 1OC4A 3REQA 2HLHA 4WY8A 2WU4A 4LJLA 3EZXA 4K26A 2BRUC 3KJEA 4EFNA 2DR0A 4MGEA 3V4VB 1X1SA 3NAGA 1UDRA 3WI7A 4CLDA 2ODPA 2RK4A 2W43A 3I2KA 3FTCA 2Q1XA 1BXKA 4FE4A 4Q9NA 4ZQFA 5GAJA 5JXHA 3R9XB 4KPYA 2YXLA 3RC2A 3K9QO 1N75A 1YCFA 1I7NA 5EZQA 3L4SO 2K87A 3RJ9A 4Q1AA 2R00A 1PGNA 4YN3A 1DQZA 2QD3A 3DDOA 3V5NA 4MI9A 3B38A 3CLRC 1FLAA 4DQVA 1Y33E 3G7UA 2I6SA 4O4IA 5H83A 3VR0A 3PNBA 2JAXA 1L5VA 2ZIAA 1NV9A 1WUIS 2P2LA 4I4IA 3JRWA 3FJYA 3K6SB 4Z0PA 3IDZA 4W9RA 3K8ZA 1T6ZA 4XVHA 1B74A 2KWIA 4I55B 4EPWA 1FS6A 4ERXA 2XGSA 1VB3A 4HY3A 4XJVA 3RAPR 2GK7A 2EDAA 2W2XA 3DG9A 5FP0A 2IITA 4C30A 1UIRA 3QMWA 5ITZA 4LAFA 3P2OA 1VRCA 3QPAA 3RS8A 4QNMA 4RABA 1MC4A 3NM6B 2FDRA 2QK4A 1K97A 4UBKA 3NC0C 3NHYA 5AVJA 4GM4A 5HUQA 3A4LA 3GJ0A 5IF9A 2FPGB 1IZ8A 2B3DA 1W4ZA 3DQPA 2VDMB 5EZ5A 1OWOA 4MW1A 2CNWA 1GNTA 2JH3A 1PK8A 1R10A 3H1AA 1LW6E 4JGGA 3WWYA 2Z6UA 1EJBA 1EHYA 4G56A 4JYMA 4D3DA 4CDRA 2VRNA 1RABA 4GDFA 2IOYA 1DC4A 3G3EA 2B8JA 2JRLA 4O0LA 4JSYA 4A0RA 2ZPTX 4JLKA 3NTRA 4DSNA 1G1MA 3DFZA 5L7YA 3O74A 5A04A 4DJAA 5AI9A 1NMXA 2ZBUA 5AIAA 1ATZA 1OCEA 1JEDA 1MEJA 2OAQ1 1KIFA 3EZ6A 3H3XA 1KGDA 3AM4A 3B2EA 1U3WA 1XJ5A 4IDNA 4KR3A 4JN6B 2EKLA 5F9FA 1L4GA 1I32A 3VBCA 1QYRA 1X1EA 3L49A 4ZCSA 1DKRA 1RC8A 1R16A 3GW8A 4RZUA 2DFKB 5DE3A 3WGNA 3AVVA 4KG7A 3WSTA 1FS5A 4ZD6A 2O8FA 3MJSA 3J81A 4A16A 3NYQA 3ETJA 4YRPA 1IPFA 2W6OA 4CODB 5FCDA 4G0UA 2Z1DA 3EVCA 3VDRA 2P9JA 1LSJA 3H9BA 2JGAA 3HPQA 4PBTA 4M60A 1E1RD 4M53A 2CL7X 3RF7A 4FFBB 3FYDA 1HX7A 4U3JB 4E70A 1GPWB 1V4VA 1BE6A 3OO0A 3ZXIA 1M2JA 3CUWA 5DW0A 4ES6A 3A3KA 2B69A 3D0RA 4MEBA 3UCXA 3UGTA 5C1BA 1ZC4A 2XYHA 3AOGA 3UJ9A 1RRCA 4WOKA 4BEBA 1U3VA 3INNA 4LWOA 3CRQA 5BP7A 4F8EA 2NTNA 3NBFA 2QX9A 2F4VB 2QWXA 3COPA 5BRAA 1Y6ZA 4XM2A 1TADA 4G5OA 2GAFA 4JT8A 1DCMA 1I94B 2PUDA 1XZLA 4AT1A 3P0IA 3RV4A 2NXEA 4M54A 5LU8A 3L02A 1FE8A 1XLTC 3F98A 4YNBA 4JEHA 3IV7A 3MOSA 3L4KA 3K09C 4Q15A 1AX9A 4UZFA 4BIIA 3VH4A 1T91A 1XDBA 3WK9A 2GM3A 4W82A 3M70A 2YFQA 3A3OA 3LW8A 3KBBA 4H1TA 3DAHA 1JHYA 5KNDA 2VJKA 1E5VA 1AGNA 1A5BB 4G1MB 4TN1A 1QVRA 4Q3KA 4L0MA 2JGIA 3C8DA 1WW3A 1YBMA 2YXEA 3SJZA 5BQ5A 2O8CA 2C7OA 3JD0A 3O8QA 3L5OA 4LGVA 5EQJB 4QFDA 2BE7A 1OHHA 3H75A 1EWRA 4FHDA 3PIDA 2VNKA 2OCIA 1XKTA 2P79A 3C6XA 3C6YA 3GLGA 3J7TA 4N49A 3QEJA 1Q1AA 4MWGA 2RGRA 5AK3A 4I4NA 4E5PA 3PK0A 3DUWA 3OPQA 1CUVA 3EVZA 5IKPA 3NETA 3KM0A 5C4GB 3Q2IA 1M54A 1Y80A 5B1SA 2G0AA 2OV4A 2ZYDA 3OJCA 4I4LA 3D5QA 3KXIA 5LMNB 4OQPA 4H1HA 2Q28A 3IB3A 3DB1A 4BBPA 2IODA 2ODTX 3RLFA 4C04A 3K9HA 1JEAA 3GWZA 1ZD5A 5CA0A 4YIHA 2OO5A 3IDOA 1IC6A 2ZBEA 1SU4A 3TPZA 4XLZA 1X19A 2HCBA 1ODJA 1RWXA 1XYYA 2EJTA 4MR7B 3BGWA 1AKTA 2H7VA 2XWSA 2HZBA 3L7BA 3AKCA 3MT9A 1ADGA 3EXHA 2ONYA 4D5GA 3R0JA 1X1DA 1EWQA 4JK3A 3KHSA 1IZ9A 1S1MA 2HU7A 3MAGA 1YF3A 2C8LA 3I32A 1GXSB 3ELWA 4KQ1A 3ND8A 4F6LA 1XPRA 1TUGA 1XT6A 1RWQA 2VPTA 4HYYA 3SN6A 3OIUA 3IJPA 4JYCA 3JQAA 1XHLA 4WESA 2ZSEA 2E3JA 3A7DA 3CLSD 4HPWA 2VF8A 3FMOB 4E30A 2JLAA 5BMVF 4UTXA 2AOTB 4AVYA 4F11A 1ESDA 1B73A 1C1HA 3GRAA 2OMKA 3IIJA 5CURA 3KJXA 1V11A 1KJWA 5AM5A 1XTSA 5IVHA 4E5KA 4S35A 1HT1E 4F71A 1POXA 2NYRA 5GP1A 3QA9A 4MULA 5JDCC 3DJFA 1Z38A 4NNJA 2VJDA 2WD7B 2HPZA 2BKUA 3Q0EA 3U4DA 4KLZA 4GIBA 4EAQA 2CZGA 3W2TA 1L7PA 2RJNA 5JH7B 3ASUA 3WYGA 3FPCA 4BX2A 4AWBA 1TKRA 5J2UA 2WA1A 3T1YB 3OE1A 4I2VA 2IS1A 3CG0A 2ZYGA 2YVQA 3LPMA 1DSSG 1NZJA 2QD1A 3CWQA 3U6BA 2R97A 4QAQA 2BGKA 2GPNA 3EVBA 2FAXA 3IXQA 3CLHA 2HEIA 5DN6D 2ORED 3PXGA 4KKVA 3IUBA 3KFXA 1WP4A 2Z8ZA 1FCJA 1Y3FE 1C30A 3O8DA 1I8TA 2OZLA 3SYNA 1N5DA 2Q46A 5FLYA 4ZU3A 1WV1A 3UUGA 1ZCBA 2BVNA 4P3KA 4C14A 4TYWA 3D43A 1JPNA 3SSOA 4CG1A 3N8GA 5G53C 1JG3A 4P58A 3WRYA 2ID7A 2WUFA 3GVPA 3QFSA 4FZRA 3Q12A 4INPA 1SU7A 4KQWA 4RD1A 3WLLA 1G6KA 4DANA 2ZIWB 2CMDA 1Z7WA 2P1DA 2QUZA 5A7GA 3ZEAA 3NM4A 5KOJB 3LK7A 1G0OA 1OUMA 1QPGA 1RWNA 2ZUBA 2VC2B 1XKLA 4X63A 1J7KA 3F4BA 1NR7A 4ND2A 4DV2B 3GV0A 3HO6A 3L6BA 3T9EA 3ZY4A 1D8AA 1LF0A 2WR8A 1C81A 1OI3A 4M8LA 1YI8A 4FR0A 1KP3A 1Q84A 1UBHS 3DA8A 4J1SA 2XKKA 3DBHB 2Z4SA 5EIBD 4L9SA 5IWAB 3I30X 3RSLA 3WMGA 1T1IA 4C6HA 2H65A 5K4GA 2F3SA 4CV0A 5D3MB 1BYIA 3P9IA 1WUJS 2H85A 4BE7B 4DDUA 1NASA 4YCAA 2R8ZA 3DMTC 5GADl 4AYTA 2HHHB 4RFVA 3C14C 4WDQA 1CDOA 5E2AA 3SHQA 1EFVA 4CKWB 3DULA 3SEQA 1VL1A 6NULA 1MW9X 4KIGA 3O4FA 4RK5A 4IDQA 2W6JD 3NEJA 3EN0A 1AHIA 1WXWA 2H4YA 3G17A 2G88A 1JU3A 3BXZA 1EUZA 1HRDA 4K6FA 2ZJBA 4GKAA 3ROEA 2QP4A 1B2RA 1Z4IA 4KFCA 4ZP1A 1K98A 3TI7A 3VZRA 3ZD6A 1Q11A 4A15A 4IGKA 1AK1A 4XCVA 1W4AA 2VA9A 4B6FA 1GRQA 3HBNA 4G89A 2BH9A 2FA9A 4BECA 3U16A 1NFQA 3FPAA 3ZZTA 4NL4H 4DRXB 1M8JA 2OXEA 1T0JB 2IYOA 2J6HA 3T3MB 5EESA 4MR8A 3ASYA 2JANA 1YHZA 4JLSA 2GGSA 5JUWA 3FUTA 3M81A 4KRGA 1GCGA 2YIJA 4HMPA 2FP4A 1VBMA 2XTMA 3WYDA 1MX1A 2WAAA 1W25A 2UVPB 2IRWA 5HEKA 1PR5A 2FN9A 3NUZA 3PXAA 5K3SA 4FC7A 4F8JA 2CUZA 1W0JA 3SYRA 1I1HA 4HKTA 1H66A 3D4OA 1FSSA 3EJ6A 3PHIA 4S2EA 4D9FA 2ZYUX 1VJ5A 5C8XA 4IHKA 4ABTA 4WPGA 2QTCA 3GXOA 2PJRA 5L53A 4EUFA 1JE0A 1GSHA 5AKKA 4J2HA 1L7NA 4B0PA 1LTKA 1P0PA 3QMMA 3RUIA 1HV8A 1LGYA 1NW3A 3DDHA 3VGJA 1E2DA 1NI4B 1W5SA 4IF4A 2X4GA 2GK3A 4FYIA 1OA1A 1I7SB 1NUQA 3DONA 1JWAB 3TD9A 4LI3X 1ADFA 1B8NA 4X1OA 1DT5A 3A3PA 2BE9A 4JX8A 1XAJA 1X7XA 1XPUA 1WS6A 1YDHA 1YFKA 4P53A 2FH5B 4AWAA 2ATEA 2I2AA 3LA8A 2H1LA 3K05A 4NFHA 5J59A 1ABBA 2CV2A 2O8DA 2JAHA 4HK4A 4BE4A 1NOKA 5IAGA 1W4RA 4D99A 3I3OA 1M2FA 1QGAA 1NSTA 1XOIA 2GCIA 1L0BA 2RHGB 2VIIA 3CN9A 4ZJUA 1N8TA 1KMCA 4QOSA 1Q7TA 3GY0A 3TFOA 5E6SA 1SQ6A 1Y4UA 2B98A 4KSBA 4PTYA 2UUOA 3VNAA 1L4MA 3EZNA 1CY0A 3IP3A 4FNAA 4GLFA 3MMNA 4NFLA 3SLKA 1MTZA 4NY1A 5M29A 1EFVB 2ICAA 3VGPA 4CKWA 4YY3B 1JQKA 3GNSA 4KQJA 1ZD4A 2X23A 1JB9A 1CQXA 2IDZA 2WFAA 3ENNA 4RH0A 1SRRA 1SWWA 2EW1A 4Q4JB 3O2NA 1AMOA 2IV2X 3HJUA 3D3QA 4DIEA 2C92A 1TW2A 2FXIA 3UMJA 4P0TA 3NJ4A 1ST3A 1XI2A 8LDHA 4CEHA 3M0EA 3NCHA 2Z08A 4WKCA 5EL0A 1O2DA 2ZIFA 3RUHA 1HE2A 2WWIA 4QJ4A 3DTTA 1FXSA 3QPWA 5IUJC 4Z8YA 3GFOA 4WJZA 3UWDA 1JAXA 4L5YA 4ZMSA 2G4CA 4RHUA 2VWGA 3GJZA 3PG5A 3V80A 4CMJA 4EHBA 3MWKA 1KYTA 2IEIA 3UJ6A 4C9BA 4EPTA 2QZ9A 1WMSA 1OWPA 4KQCA 2QF7A 1GVHA 2HPAA 3KPYA 2FMKA 3NM5A 3AP3A 2FPRA 3E9YA 2DUWA 1AQNA 5EJ6A 1A7JA 1RHJA 2P68A 3G0BA 1SHJA 1V9SA 4N6OA 2FHSA 4LECA 4OATA 5IASA 1RM4A 5FR2A 4ARSA 1UWKA 4EA8A 5MHTA 3MXOA 1G2OA 2IXTA 2ISQA 1FFSA 3R0IA 3PFKA 4MJ3A 3CM0A 1HNNA 2NQ2C 2PUBA 1UT5A 1QOPB 4PZ0A 4TMVA 5KTNA 3AUUA 5EZYB 3O4VA 3J80A 3FSRA 2AG8A 3H5IA 3DFIA 4WZAB 1G7RA 1IHDA 4EG6A 2QN8A 2X76A 4ZI7A 1DGQA 4Y6OA 3IDQA 4GI3A 1W1IA 4IJMA 4CQMB 5C9ZA 2A0YA 2XOXA 3HYRA 5IC6A 2VRCD 2J5RA 1VPLA 2WFMA 5IJ9A 2AT1A 3DMDA 4OV6B 4U5QA 5EHGA 4BVLA 4KMRA 4NV3A 3FCAA 4LHSA 4YMWA 2VVTA 1UKEA 4XWYA 1RXEA 2VQDA 4U7FA 3IT0A 3UGQA 3AJAA 1Z4PX 2OSBA 1KMIY 3IYLW 4YRAA 1X1RA 2FF5A 3OOYA 1CRQA 5EJ5A 2I03A 3GA0A 3PNYA 2O8DB 2A1TS 4PTZA 4D42A 3AZPA 3ROFA 5FOTA 5JIBA 3BGOS 2QTAA 1SUEA 3EPPA 5JSYA 4XVUA 2FEWB 2ATCA 3T34A 1FRVA 5AJXA 1D4FA 4LEIA 3QH4A 2HIGA 5K8IA 1CS0A 3MGAA 2QPTA 2J67A 1UR5A 3QJ5A 2ZWAA 2J31A 4MW7A 4EHLA 4ZI7F 3G2QA 4IX9A 1SUAA 3HZOA 4UCXA 4FHEA 1INLA 2RAPA 3LT5A 4NEQA 4JB2A 4LZJA 1E79A 3WIVA 1OJ7A 1ZICA 3HUFA 4YDSA 2QNRA 1C2YA 4KIUA 4MX8A 2VP5A 2YWHA 3QKIA 1F7VA 2WJVA 1EBBA 4ALMA 5DHQA 3UFXB 1XXHA 3N70A 5A3RA 4XGIA 1ZOSA 1Z4JA 2IK8A 2B1GA 5FQOA 4G09A 1ZM9A 4AM8A 4A3SA 3W2EA 1I6WA 2FR1A 2YOGA 4FS3A 4Z3KA 4C6RA 5JNSA 2P75A 3LF1A 2OFXA 5LOVF 5LL6P 3L1IA 2XWJI 3GUCA 1P44A 2VT6A 2GCOB 3BMQB 3FCUB 1U9IC 2P9QA 4KLAA 3BMCB 5AVYA 3KSAC 1ZVVA 1WLSA 4BJ5A 4DVGA 2YXPX 4D3SA 4Y67A 5JS1A 1JVNA 2IIVA 1QFXA 1J42A 3MGGA 3R0ZA 1Z2EA 3QPBA 4LXXA 1JLSA 1LUAA 3IHLA 4UHFA 1GKLA 4YUYA 4MZXA 2I6TA 3TLZA 1U0HC 3Q2OA 2EOAA 4WK6A 1YB2A 3JTEA 4S05A 3PUYA 2Q0QA 4RC9A 3BWBA 3WGYA 3N2IA 3WRWA 3JD4A 3I1JA 2GBGA 1GGKA 1IZ7A 1DBSA 2Q3HA 1KZ9A 3FDJA 3BAZA 3IAEA 4G9GA 3KSDO 2EFHB 2P6NA 2P3QA 3S1LA 1R18A 5LIPA 1KMMA 3MJCA 3JAWA 4II7A 2AR9A 5F98A 4B3DA 3GOHA 4QRDA 2C7RA 4EK9A 2BHTA 5IDQA 1K68A 2BFWA 2EP5A 2H1CA 1E6MA 3B1ZA 4KB5A 4M1WA 4RSGA 4BP1A 4BHTA 5I9LA 3I1IA 3HCPA 3L6CA 1KWKA 3ADDA 4ZO6A 4PQEA 1E9VA 2R1TB 2ZTLA 1SBYA 2YNMC 3E5RA 3JY6A 3L3BA 2X0FA 2BGWA 5CH3A 2VYQA 3L9WA 5K8JB 2ZRMA 3QUAA 2IU6A 4BMXA 3EXAA 2P6MA 1VJGA 2QAGC 2BM8A 2WIKA 2QMQA 3Q15C 1PNQA 1A98A 1DX4A 4OFWA 4RCVA 3T35A 1GG2A 1M2EA 3TIIA 1ZOLA 1B0AA 4P83A 1JF8A 4XTRA 5CDHA 1D6NA 4RIIA 2VYVD 4E5VA 4A82A 4RA9B 2AVDA 1D7AA 3DXFA 4YO7A 5GPBA 1NXSA 2A9PA 2M6RA 3UK0A 3IE1A 2FR8A 1T29A 3OC6A 2VTBA 1XEXB 5DJ5A 3HYCA 4C2AA 3JAKB 2XB4A 4BQEA 4B8YA 3DO5A 4IUBS 2GILA 4PV7A 1TU0A 1B00A 2J1LA 5AI4A 4D6PA 1BWPA 3PRYA 2OWEA 1Z82A 4DV5B 3THYA 4YECA 1UWLA 4C6SA 2W6ID 4KO8A 4NBRA 5CD9A 2PSFA 4XQGA 5JFTA 4LYGA 3E8MA 1XSEA 5HDQA 1IWPB 2JKYA 4L4XA 1CY7A 2R6ZA 4KMOA 5EJ9A 1VSUA 1T2CA 3FCSB 2Z83A 1J24A 1LDGA 2R11A 5GV8A 3KQHA 2V7TA 2P62A 1HEUA 1TM7E 2ZRDA 2G80A 3NG1A 4CKZA 3IP6A 5AW0A 1S9HA 4JI7B 4D25A 1UQRA 3SXJA 1QOZA 5JCJA 1P60A 3DXXA 1OWLA 1TI7A 3D9QX 1X86B 4BWGA 4LCJA 2VHVA 3G7SA 3P2JA 4P93A 4BMZA 4HUTA 2GQ0A 4L4UA 3LNCA 4F9TA 1KRXA 3BMCA 1HFJA 5HWSA 5C80A 1XJ0A 4KXMA 2DB3A 1XF9A 1ZNQO 1CUSA 2IL1A 2X58A 3BGIA 4EMTA 5BYBA 5C8DA 1C3VA 4HGZA 4JX9A 1OQAA 4YPFA 3ZHQA 2GNAA 1Z2PX 4XDYA 2CYCA 1DAHA 1XLUA 3IO5A 2XQIA 4JHLA 5ALHA 1V8ZA 3IP9A 3Q0TA 2IEYA 1W7AA 1D03A 4GM1A 4MQ5A 3Q87B 3UJCA 3DMGA 3QKSA 4NVRA 3V1LA 2UZ4A 1N3IA 4HQOA 2X3YA 4G2TA 4QOJA 3NHRA 1A8PA 5A4KA 4IZHA 2IXFA 3KOMA 5CA1A 5BMOA 2NU7B 2QUIA 1MTOA 2V8BA 1IIRA 3BTUA 3FKSD 5IANA 2C96A 4R68A 3H2IA 4MQMA 1I6MA 2O3UA 3WQQA 3O2JA 5ALRA 1SVMA 4LCEA 1RE0A 1V71A 4LGYA 1Z17A 1ZH8A 4CT4B 3V6LA 5K9ZA 3CF6R 1V1JA 2AC2A 3AC0A 1CF9A 2O2GA 3G23A 4FNOA 2WDZA 3NBUA 4OQQA 4HNVA 4YB8A 3Q4GA 4GBGA 2Q8QA 1GL3A 4PSAA 4IICA 4U8GA 3AEKB 4RE6A 1GZSA 2H2IA 2EERA 3A4IA 5FOUA 3HTXA 2UYQA 1DS6A 1NUUA 3T3HA 3V42A 5LQAA 2XBUA 3TSOA 2Y0BA 4G5SA 4ID3A 3LP6A 1PQ4A 3BQNB 5E6RB 1SEPA 1ZIDA 2CEAA 2A94A 2HWWA 3H18A 3TAXA 3TKAA 3VHRA 3LFUA 1CU1A 1NR5A 4IMJB 1NLYA 1I9GA 4WWHA 2FPSA 5KINB 4TLMB 4A6XA 4IDHA 1VCIA 4CZ2A 1A50B 1O97C 2FCAA 3E84A 4UHKA 5DP1A 3K35A 1EIZA 4IIBA 4R3WA 4XX1A 5FT9A 4Q3AA 3VC3A 3WIOA 3RABA 1PRYA 2ZZKA 3T94A 4A23A 2OV8A 3L43A 3ZD8A 1SCAA 2C7QA 3D8RA 3VOBA 2E89A 1G21B 3AUJB 2K7ZA 3ENZA 5FHRA 2YRWA 2C3OA 3I72A 2R6JA 1C41A 1P1JA 3EUWA 3W3AH 1T8RA 3UTDA 2V0CA 5DM0A 1VKJA 2RJ3A 1UMCB 3MA0A 4YMTA 4Z5XA 1MO5A 4RTKA 2A9OA 1AUXA 1WNFA 1PS0A 3QPVA 5EXSA 4ZVQA 1A4XA 1RRKA 3TRKA 1CUYA 3INRA 1ZVQA 1Q0SA 4KQEA 2C95A 4OD0A 1QZXA 4KR9A 3NCTA 5DNEA 3X1DA 4MRMB 4EG5A 2OORC 5D7NA 1KL7A 3IOYA 1Q17A 2AGVA 1RFLA 3IJRA 3PC7A 4M0DA 4PM4A 4WX2B 5A0TA 2OR3A 2D1TA 3AV3A 1N7GA 4IDCA 4L22A 1NM5C 4BVBA 3WLRA 1B0ZA 1C1DA 3MT0A 4ZZ3A 3PJGA 5TJHA 4A2WA 2ZJ4A 3QE0A 3O84A 1SUIA 2RB4A 2WZCA 3UK6A 1KQGA 5BURA 4QKQA 5DI3B 3SZMA 1JZTA 2EGUA 2R5WA 2HRZA 2XLCA 3HXPA 1DJLA 4KSYA 4MO2A 2J6CA 1RZUA 3T3NA 1L8AA 4Q3OA 1EUQA 4Y2RA 2MSKA 1U81A 2O5VA 2PSSA 2DFPA 4O29A 3DXZA 5HILA 3KZXA 1A9ZA 4RWEA 5EXTA 1Y3DE 5FWAA 2I3DA 3TX6A 1SUSA 2OHXA 1LJLA 1PNTA 1AHNA 3HVIA 1WB6A 4HNAA 3OQOA 2WIJA 4OHFA 3KZOA 1X13A 3B3JA 3PHBE 5CK5A 2O3JA 3UGJA 4P4TA 1F9EA 4R1PA 4ER3A 5ED4A 3SR3A 3ZBPA 3FWHA 3X2SA 4EBFA 4F8YA 1G8JA 1A9YA 3L6RA 3PGVA 2H1OA 2R1UA 4Q3CA 4PZUA 2ZRPA 2I7XA 2WKWA 4KC0A 5U9CA 1L8OA 2RI6A 1U0RA 2XNSA 2H2AA 2QRVA 3HKEA 3OLVA 4RY8A 1N3YA 2IIQA 2ORIA 3MERA 4MS4A 5G2OA 3S2GA 4KPUA 1K8QA 1ZN9A 1H9CA 2OZPA 4N5HX 4WA7A 1OI7A 1RXIA 2I2XB 5E8RA 2PRKA 1ONOA 4I5IA 3HBAA 1BHQ1 1K4YA 2ZETA 3T3PB 3ZUPA 1WCWA 1RBMA 4EKEA 2PX4A 2XCQA 5ABPA 3HI4A 4FSHA 4GBED 4NV0A 3WB0A 4K0RA 1DWPA 1P0MA 2I4NA 1T1RA 2HA7A 2ZR8A 4HDOB 4MRVA 5KVQA 3KTAA 3GQVA 4EGJA 1D1QA 1UP6A 2AEFA 2HQBA 3LWBA 4HC4A 3DLTA 4JR1A 5BORA 2EBWA 2ONCA 3FFXA 3QEMB 5DGXA 1CEEA 3B82A 1UPXA 3P9XA 1YRWA 3C3KA 4JJEA 1TZJA 1XKQA 3KUUA 3R4CA 1P2SA 1QQ6A 2W6PA 2XUKA 3QI2A 3QYAA 1SN7A 3V8RA 5M3BA 2UZ1B 1GR0A 4K2HA 2QY6A 1W0JD 4UBNA 3THWA 3RYIB 4ON9A 4P6VF 2PRZA 2OBNA 1GQ2A 1RI5A 2V59A 1DKOA 2ZITA 1VG1A 5ESWA 2PCJA 3PDJA 5KYWB 2G72A 4G0VA 3M2TA 3H9CA 1R0LA 3AOEC 4QYTA 1L3IA 4X91A 1TU4A 3NIGB 1VIMA 5FO0A 2WJ4A 5HBGA 3I34X 3DMNA 1Q0HA 4E2WA 1SK8A 4PPQA 3DYBA 3E82A 1JTFA 3CUUA 4OHPA 4DCGA 5KC9A 3CLUD 4IQ0A 4L50A 4YMSA 1TF5A 4DKJA 3T1OA 4Z0NA 1XMXA 4UAGA 2RGNA 2Q5FA 4KN5A 3IKMB 5BUZA 5AW6A 5THKA 2X13A 1TGYA 4LF6B 2V1XA 1EUCA 5DRYA 3W8FA 4W1RA 1SH7A 4M7RA 2HAEA 1G4HA 4AS3A 1JDUA 1PSDA 4OIFA 3PU6A 2YUIA 3WQSB 3K1YA 3PGLA 5JJCA 3ZU3A 2JW5A 2P9HA 4MRNA 4V03A 4R16A 2WICA 1CC1S 1G2QA 3PT9A 2JJQA 1JU9A 3BWDD 4RTRA 4AQDA 2P8JA 4B6GA 5BWNA 2M32A 4G97A 4F86A 3L1KA 1RLIA 2AX4A 2XUJA 1MX3A 3AHDA 3QKTA 2QBYA 4ENTA 1TX4B 5KYNA 2Q3FA 3HB1A 3ITEA 1R2QA 5DM70 2PT5A 2DE0X 1JMKC 2UYGA 3OQIB 1FMFA 1WOMA 3CGWA 1OGJA 4BFTA 3GJ7A 3QLVA 2VXYA 3DLHA 1RHUA 1F2VA 2OBLA 2IS4A 3I01M 4ITRC 4PQRA 3TZ6A 1PR4A 3GVIA 1SG6A 3VM6A 5DWVA 4PSKA 3ZZ0A 3BILA 4X60A 1SUDA 1Q92A 1N2ZA 1E1QA 5B2FA 2GD1O 3CRVA 4KO3S 2X1MA 4CMIB 3FTEA 2WWRA 2IIPA 2CE2X 1M8PA 4QL3A 2VT2A 1S3FA 2JBWA 4DJEC 1L3BA 3SJBA 3Q6IA 5AMXA 4W7IA 5SZHB 3P9RA 2DKOA 5LA6F 3UXYA 3R3SA 4PO3X 3MWGA 3ZWAA 1QH9A 5JHGB 2G8LA 4WFQA 3FDZB 3EIOA 3CC8A 3RBVA 3TQHA 3V4OA 2FFHA 5FJJA 4Q18A 3UAGA 1BJTA 4MRMA 1EK6A 2PRYA 4CL3A 1JDBC 2HLNA 3G0GA 2A9RA 2I4RA 3CG4A 1YZYA 3GLIB 1HSZA 1E0SA 3LK6A 3OX2A 2VRBA 3OJ0A 1UBRS 1VPVA 2NSHA 2ETVA 1YHYA 4R2XA 4R54A 4UM8B 3WBKA 1WXQA 2ZBDA 3VVCA 3G2OA 1H1LA 5AOAA 4GDMA 5FBQB 5A1TA 4GLLA 3R8CA 2IW3A 1JEEA 2F17A 2J0VA 2XI4A 3FYCA 3ABOB 4ZI5A 4M21A 4N9QA 3N0WA 1T5IA 5AFSA 5CLJA 3CGGA 1G7CA 5B1DA 1I2DA 1R4AA 3I5AA 2BZGA 2QYHA 1HKHA 1AB5A 2JVKA 4N7MA 1VIVA 4YGYA 2IFTA 1FUIA 1EJ6A 1Y1KE 1Q0LA 1ZO8A 4PZCA 3TTTA 2DFLA 2XVAA 2OQ2A 4BC0A 4NABA 5FUWA 5IDYA 3Q3IA 1BH6A 2QRUA 2R6HA 2ZJ8A 3A9VA 4IYJA 3WB1A 4X1IA 4NX2A 4MWEA 4XWTA 5H1YA 3JD3A 2CLLB 3BXHA 3OY2A 4BMNA 3EEQA 1PN3A 2GO1A 1DUSA 2W90A 3AUKA 1PJLA 1F8XA 1LLUA 1X7WB 4NOMA 1PNRA 1IMJA 4F06A 3ROPA 4CL2A 1HGXA 2NYUA 2P0YA 2ZUWA 3C7KA 5AH0A 3KOWA 4ZGBA 3A27A 2R6AA 5KTSA 2ECPA 2VFAA 3MF4A 4UC0A 5CVJA 4C1BA 1H93A 1T2NA 1V41E 1BD3A 3T5CA 1RRVA 2H2FA 5CVDA 5A7HA 4DC1A 4IV0A 1XR3A 1CY8A 4C5AA 4RZSA 1W2WB 4RM2A 3H5VA 4UHDA 4L4ZA 2EARA 4JQOA 3VZPA 4TZTA 2RGBA 1GAQA 4YBRA 3MUEA 1XMVA 3GK3A 2R4UA 1HE4A 3G5UA 5C5CA 4NCIA 1GYRA 2WT9A 8ADHA 4DJFC 2YKGA 1SOMA 3DPUA 4MLDA 4XWWA 4KAFA 1YACA 1KBOA 4DILA 4JY7A 4OP1A 2WU1A 2YCBA 4HNRA 3V1YA 2VPQA 2CXPA 2GESA 2JI4A 1EFPA 3PIIA 1E5DA 1IWOA 2WF9A 2IHNA 1XZQA 1DTEA 4R0MA 2QJWA 1H3NA 1NC1A 1LU9A 2VWPA 4OP3A 3A2LA 4GC9A 3H86A 3FI0A 5E2BA 4ZRNA 4DIDA 4H0FA 3TNYA 2E7ZA 4QE3A 5DO9A 4YHHB 1TZMA 1RMQA 1KXJA 4IOMA 1UP7A 4EJ6A 3DZGA 1YVEI 3KHKA 4BAZA 4HCJA 5C32A 3T9BA 5JD3A 5C46F 3H4IA 1J0AA 3OHPA 4TUYA 1PTJC 1YQEA 1TA0A 2FPWA 3KAQA 4POAA 5G0SA 4LUCA 3TQTA 4E32A 5DCYA 2YYSA 5E7IA 2R8BA 3BCUA 3MGBA 2FX3A 3ONNA 4R0NA 4MEAA 1CE8A 2Q1WA 4Y18A 1JSZA 3F5MA 4FR2A 3I62A 1P5HA 3K9GA 3LFTA 4MUHA 3U81A 4BFSA 5K8LA 3KKMA 4INZA 5FI5A 5KYVA 3T7DA 4KBFA 4A26A 1VKHA 1VTKA 1FFDA 1H9BA 2O2JA 3JD2A 4XTCS 4YRFA 1WDKA 2C3UA 2WRZA 1CDEA 3BL6A 2AZ4A 1VGRA 2PHZA 4JR0A 4BTEA 3G0DA 4PLPA 2NVUB 3PE3A 1TC1A 1Z5NA 4UW9A 3DBRB 4TMFA 2ZJAA 3MTAA 4MUMA 3IQHX 1G8PA 1R3UA 5K3FA 3WK4A 2P1ZA 3GFQA 3OT1B 5CP8A 1EXWA 4DCVA 4HDSA 3ICQB 2PX2A 3KOXA 5DOVA 2Y6VA 1JLRA 4TTTS 5CLLA 4K86A 3GXBA 3R7BA 3PWSA 4DMKA 1G16A 1KH2A 1XMPA 4LX8A 2ZZNA 1GZ7A 1XRPA 3EQ6A 3NDRA 4GFDA 3DF9A 5ALOA 3HMKA 3QLTA 5ILGA 2IX3A 4NQRA 4RORA 1S8OA 1PV1A 3JALA 1OD6A 1EE2A 1RXUA 3MGKA 4RANA 3WV4A 3X1YA 1CPYA 3AB3A 3PQ3A 4KFRA 1TYAE 1OVGA 4BN5A 2W6QA 1J00A 5TV2A 3B9RA 4WDRA 1GARA 3DLIA 4ZREA 5H4GA 2NYVA 3C85A 4E13A 1TU3A 2R4QA 2A5FA 2X0JA 2FLWA 1MDFA 3ZV6A 4EVQA 4MIKA 1SVSA 1XNHA 3CLUC 4GUDA 4KFUA 3UXEA 4CKCA 3T6KA 3IT1A 4TLCA 3NHZA 5JD6A 1F1BA 5IFLA 2PE5A 4H27A 5EJ2A 1WX1A 2AG1A 3X1XA 4IBOA 3PDIA 5AO9A 2OO3A 1JDSA 4JUIA 1XDDA 1JKMA 1SQ5A 1YBFA 3PX7A 2CBZA 2IQ5A 3LCJA 4GYWA 1PWXA 1FFAA 4CCYB 4D2IA 4F56A 3GT4A 3QLEA 1EM8A 4V0QA 4OBEA 1TIBA 1P0CA 1FLNA 1YA8A 2FRDA 2W6ZA 3IUEA 4G63A 3VUEA 3ZX4A 5DB4A 4QDXA 1J5PA 3VJKA 3O95A 5JRJA 3K94A 1KO7A 4Q66C 3VSCA 1E9AA 4LQLA 3FVQA 3LAWA 4TLEA 1FUKA 3KWJA 1F9AA 4ADSG 3K1AA 2AFHE 2HQ1A 1VSVA 4KO2S 4Z4EA 1GJRA 1WSWA 1JXAA 1HQCA 1LQUA 1O95A 2WAMA 5B3AA 4WNIA 4NOJA 4G85A 2W2KA 1U5BA 2RFLA 4PBSA 4ZT7A 4PG6A 4OAOA 3ZWVA 4B6QA 2IYYA 4W99A 4LHWA 4GOJA 2YFKA 1OH6A 2YJ3A 2PGOA 3SZLA 4GQIA 2WJJA 5EJIA 1C2TA 4F6RA 2FPLA 1OLSB 1U2GA 2D5CA 2NZXA 2JEYA 1LK0A 2ZUCA 3G02A 4YP9A 3WK5A 5IUKC 1A7UA 3G89A 3HN6A 4RFLA 1WD7A 3R5JA 4MGKR 3ZBTA 4CLEA 1BE0A 2JAPA 4RA6A 3STYA 4K2AA 2QRZA 3H7AA 3C7TA 3PNMA 3A06A 4RZ2A 2ZE5A 2GCNA 3IVAA 4GZLA 4LHYA 5KOIA 1E2UA 1Z6AA 1BG6A 1SVKA 5A5EA 1HDXA 2RI0A 3TNJA 1H94A 4C0QC 3WHIA 4EA9A 3CUTA 4C1NA 1C80A 2PXAA 4GZ6A 2H3EA 2WC1A 3B78A 3IE2A 4FSDA 4QU8A 5CFPA 4CF7A 4DUZB 4E08A 2ZI9A 4ZCQA 1TJ3A 3C4VA 2R6GA 4OP2A 2SKDA 3X3HA 1R4MB 3UHFA 3V7YA 3WK7A 2YC2C 5F35A 4O4HB 1SVWA 5KYTA 4LVUA 3AEXA 1H2EA 2F3TA 2LWIA 4AG5A 5TIIA 1DDOA 4X1YB 4M1ZA 4HAUA 3IXMA 3S40A 4PHGA 2ZAGA 5AHWA 3L0IB 4P7KA 1PFYA 1SCNE 3DL0A 4HVTA 2WMYA 3WNQA 4BNGA 3U3DA 5KWSA 2ZRNA 3VPAA 5GIOE 4RAQA 5E2IA 3DKRA 4KAXA 4ZALA 3T3IA 1X9IA 1L5QA 4GEGA 5BPHA 3BS4A 2MINB 4LDJA 3JQFC 3QF4A 4ND8B 3OIGA 4AKHA 4OHBA 1Z7BA 2YH2A 3F74A 5HZHA 1C1YA 4OQEA 3TB4A 1DCTA 3KK0A 4QPCA 5HXAA 2GLXA 4QFMA 3H2SA 4NE7A 5AHKA 5KQGA 4OI4A 1A97A 1G66A 4WOPA 4QAJA 1YUMA 1X7ZA 2ZRGA 1PFUA 3RC8A 1U3UA 1MJGM 2WPNA 3OMWA 1EFAA 1X0VA 3EW7A 2V3VA 4KN8A 3UYKA 1H8HA 5KTMA 1YGYA 3OPYA 2B34A 2J3QA 4N76A 2N46A 2PJDA 1Y7HA 2I7CA 4EPVA 5KTRA 1KYQA 1PI3A 1IEVA 2BEWA 5T3UA 4ZYYA 1USWA 1N2JA 2C42A 5EEGA 4D4GA 2W2LD 2DULA 1VGQA 2PCLA 3N3AC 4HFJA 1Y34E 2R44A 4KUHA 3PEYA 3IQDB 1H4VB 3K0BA 3ZHOA 2ZWMA 4BZZA 4R3UC 3C8ZA 1UAGA 2Q5OA 2P9FA 4J16C 3DAPA 3LVBA 4RGBA 4MMZB 3S2YA 2QMUA 3ZLTA 4MJXA 3WLEA 4YQEA 4YV2A 2H1IA 1C7EA 2QM3A 2BUAA 3IVRA 4XD7D 1GRNA 1UC4B 1AN0A 1WUKS 3BH6A 4ARAA 4QUBA 2RGYA 1P2DA 2KSQA 3DMTA 1V5EA 1RJ9A 1D1PA 4FOSA 2XWQA 1NC3A 1X6VA 2VJNA 4H7KA 5TJ9A 4ZQIA 1USIA 4JAVC 3QBDA 4Z9XA 3BGVA 4W9MC 2AK2A 2DHRA 3T1QA 5KNBD 1JU4A 4BNJA 1DAKA 1MIOB 2FSSA 1P5JA 2Z1NA 1Z15A 1SCDA 1PGJA 4A8JC 3LT0A 4RIGA 1QKKA 4MS3A 3WDMA 2Z1MA 3GLQA 1QIFA 4PNEA 4O25A 4NICA 1I2CA 2OK7A 2ZYWX 4FX5A 9LDTA 2ZT5A 4TKUB 3N05A 4LOHA 5TVKA 2BMEA 4BQNA 4CM4A 1AO0A 4KGXA 3IAXA 3OKAA 4BL5A 3ZXXA 2UXCB 1PUXA 1EGQA 1EPUA 1SXJD 4TT3A 3O3CA 4XPIA 3WXBA 1MHTA 1LTQA 2CLOB 2FJUA 2J32A 4IW3B 3LOQA 4WASA 4YT8A 2ES4A 3HFJA 3ADOA 5F1KA 4MYTA 1LFDB 4X66B 3D64A 1DC6A 1Z34A 3DFKA 4L8FA 3IPXA 4QX6A 4X5OA 3R3ZA 1SC9A 5ECWA 1Z36A 3AR4A 4JBXA 1R9NA 3TR0A 1EZZA 2H4WA 3HL0A 2VHWA 1PR9A 1Q19A 4JJIA 4ZQCB 1IL0A 5SZIA 1WABA 5CFNA 1PW7A 1KETA 4V0NA 1GNQA 1U6JA 1A8IA 2JCSA 4RLFA 1G20B 1PDWA 2QQGA 2RBKA 4LJAA 4CDNA 4GHWA 4L27A 2ZYIA 1T15A 1GLGA 4Q00A 2MMCA 1WKBA 2A92A 4BX0A 1WR8A 1E59A 4MR7A 3V4FA 4RVDA 1IVSA 4OCZA 2R84A 5MF6A 3HUDA 3HEAA 5KQPA 1IEQA 1X8JA 1KJZA 3U7HB 1O6GA 1W47A 2TMGA 4PLVA 5ESXA 1I80A 1UFQA 4GOMD 3F7MA 4K9PA 3WMEA 2HFJA 4B17A 2JJ1A 3EWSA 4W1SA 3GMIA 4MQEA 3ND9A 2DY1A 3JQAB 4FQ5A 4WESB 4OK6A 1NZDA 4O2AA 1R4MA 3R5SA 3HO1A 3L0ZA 4BJ3A 5CM8B 4ERNA 1QIIA 1XZBA 2OB1A 4RJIA 3SHOA 5HRAA 1P62B 5EERA 5ECYA 2O19A 4LF9B 3EB9A 5H70A 2JFGA 4J3NA 1G8GA 3GEGA 5LQSA 1C1XA 1PWYE 4NDAA 2QYOA 4CLHA 5AW2A 4OHVA 4YPOA 5FA8A 2VSYA 5IFKA 4IG9A 2PS3A 3IVGA 3LZCA 5DNCA 4X7BA 1K0UA 3BFPA 3STUA 3RFFA 3H0CA 2AMJA 1S2OA 4ND7A 2BMAA 3G0IA 4DL9A 2E37A 3HNRA 4P54A 4DLBA 5AKEA 4P3PA 3GRFA 2POCA 4K5QA 2X14A 2FRDC 1NDUA 3OAAD 4XA8A 5AVZA 1XAGA 5L4LA 4OHRA 1OXMA 1Z4NA 2VDWB 1DG1G 4GPBA 3FXAA 3I53A 4Q4CA 4K3UA 3Q3VA 5E7JA 1X15A 2FK8A 4W8OA 2F8TA 2AKYA 4HRYA 2JD2A 4MVJF 3VO2A 4RD4A 1UKBA 4PIPA 4C78A 4URFA 4EHFA 3NAZA 4MI3A 2GRJA 5H81A 3EDMA 3W7VA 1SNYA 2ZQ5A 4WXMA 4BBJA 5IVKA 4URZR 3RJTA 2Y1OA 3ISVA 4OREX 2ZSUA 2RC6A 1WB9A 1A76A 2DYKA 4CM3A 4DUYB 2V5VA 3I0MA 1Q0ZA 5MN4A 5TLSA 1MA0A 2BEUA 1W52X 3HCFA 2JRCA 4MUXA 4P7JA 3WNDA 4M9QA 2PZAA 3PP8A 5B3JA 1J1UA 1Q74A 3Q9UA 4IJ6A 4BDSA 4HWRA 2C88A 1CUFA 1F12A 2G25A 2JFBA 2Y0PA 3VR3A 3W8RA 4BFYA 5JQGB 3ZCTA 1GKUB 1GO2A 1JZSA 1U1FA 2ZUEA 1GAEO 1KJ8A 3U1BA 2SKEA 5LLDA 4BNDB 1IJKA 4XSGA 1IVNA 4HNGA 3OJXA 5CXQA 3P9NA 3HZHA 2HMSA 1CX9B 2EQAA 4BNYA 1N2OA 1BGVA 3DXYA 1TZBA 4IF6A 3N8HA 1GNRA 4G0OA 4BMVA 1N6PA 2GYVA 3T7EA 3GLFE 4ZEWA 1AY0A 3E7FA 3NT2A 1IULA 4JITA 1QGYA 1J8FA 1OW3B 1V9LA 1MUUA 3L7CA 4WJKB 2OPHA 5IU6A 2XXAA 1BROA 1F38A 3V33A 2XYGA 3K31A 4Y9DA 1IB0A 4LX0A 3OETA 3AQ4A 5EJEA 3AKEA 2AFRA 2HSDA 5JSKA 1AMNA 3GEBA 4BKUA 1E2JA 3E1SA 3EVNA 4QGHA 2DHQA 1U11A 4XPZA 1Z12A 2QXYA 1Y63A 1LVUA 4FE3A 4D0NA 1XL1A 4ZZIA 4FW9A 2ZYRA 1F51E 5A0VA 1PTKA 2QTTA 4GR5A 4M6WB 3V2GA 4AZ3B 1VCOA 1ECPA 3TEJA 3V1MA 1QIEA 1X70A 1GPH1 3LLSA 3RVRA 2Q9BA 3FN4A 1DG9A 3TR5A 5FBRB 1ZU4A 3WL3A 2GEUA 4DXDA 1PYOA 2I33A 3ONVA 2B6HA 3PUIA 4EAAA 1KOGA 2FOXA 1IQPA 3T95A 3CXUA 1QIHA 2WNHA 2REQA 2OK8A 5EHNA 2E1RA 3I4LA 1BQEA 3KQQA 1LWOA 2GVZC 2QW1A 3QNMA 4E4RA 1CEQA 2KE5A 4G3XA 3K9NA 2Z6QA 4US2R 4ZICA 4O5AA 2VO1A 1IBMB 4HSGA 5ECGC 2GJSA 3K0HA 3KPJA 3W5CA 3AERB 3IDSA 3QG5A 3RJ5A 1OH8A 2HU8A 3O8LA 1MMFB 4WAUA 2QG6A 1UMDB 4JLMA 1EHIA 1HSOA 2W42A 4G65A 1UOOA 2AKAB 3VI3B 3VU9B 1QK5A 2CDRA 4BO6A 2IX9A 4G0NA 4I5GA 4M55A 4UJ5A 4Y9TA 1OREA 4EELA 1O97D 1YZFA 5IULC 2PUGA 4AX8A 3KQVA 1J5EB 3KO8A 5ANRB 4CL8A 5F3DA 2A9FA 4MJ7A 1V8OA 4XOUA 4EL0A 1DHRA 3PNKA 2ZTMA 4EHDA 3WK8A 4GUAA 3LHKA 2D1SA 4REOA 2Y1CA 4TV9F 1SQSA 1O77A 5DTEA 1L5MA 3ZCUA 3IDFA 4ZOLA 4BMDA 3RVPA 4AO8A 4R1TA 2K5UA 2GYWA 1G38A 4HAYA 1LBQA 1F48A 1QHHB 3ITKA 4L28A 4CTOA 5FAKA 2FR0A 4I08A 3C3YA 5JMOA 3K8QA 3AQIA 4UNQA 4D8XA 5GTDA 1TKBA 4JT2A 3VSBA 2RI1A 1VFNA 5CCDA 4DSAA 2YW2A 2IS6A 4M1OA 1ZAYA 3AX6A 4AJ4A 4YCBA 3AR8A 3W1WA 5K6AA 4CIAA 2ASEA 5DM2A 1F3LA 1WZNA 2QDKA 3JVEA 3C6MA 5K3CA 3PFFA 3PQ4A 1OSNA 4Z3OA 2XR1A 1Z63A 3HM2A 3VR2D 5FYQA 5THQA 3O4RA 5TQ0A 4YRNA 3LVQE 3HGQA 1PJ3A 4YDRA 3ENKA 4E7PA 1JIQA 2KB0A 1BE1A 2R6DA 4D4KA 4GYJA 4E31A 1HEYA 4R4JA 1Y6FA 4U00A 3OFVA 3EFHA 1QUEA 3VR5H 2PGJA 1LBEA 4YJ2A 4TSFA 3RRJA 4MQ4A 3TMYA 1ZJWA 2F64A 3AFOA 4CMEC 5I51A 1GQYA 4M8KA 4XQCA 3PHGA 1UDCA 3TZHA 4B2PA 1PWHA 2E0IA 3KEQA 1N6OA 2AR0A 3VU1A 3LYUA 5BW4A 2Q07A 1CIJA 3T4PA 5FPYA 2GBFA 4EW3A 3T1NA 2IP1A 3ZGNA 3WMXA 1E1CB 3PGKA 4C0HA 3KCNA 3P71T 3A1NA 4GD3Q 4J7UA 5FIUA 3V1KA 3LI2A 3STVA 5K09A 2I91A 4NENB 3FROA 5DWQA 4YMIA 1K7EB 3WJ2A 3WWPA 3KQKA 1EA7A 4P3NA 3SSMA 1VL0A 4YV7A 5IH3A 3B48A 1U3DA 3ZV3A 1E8DA 1NXVA 1U90A 2GM9A 1TIPA 4UU8A 3BJRA 1ZL0A 1PT6A 3DMHA 3PC4A 3ZIAD 3GMTA 5LDDC 4HLUA 3N5KA 5DXFA 2H2HA 4FFSA 3G8DA 4DQLA 4BNTA 4BUZA 1I6LA 1G18A 1LSSA 2BSAA 1N2HA 2CWDA 2X40A 3BF7A 3EVTA 1AKVA 1XV5A 2VT3A 2XKJE 3NNSA 4UUQA 2J3IA 4Y98A 5F1OA 4AJ2A 4BMPB 5J4YA 1G8FA 3KKPA 3RM3A 3CYFA 2XB2A 4LNUA 2P67A 5I45A 2G9ZA 3K0AB 4PZPA 2D0IA 4PPNA 3I3SR 2PKCA 4GPAA 5D51S 4ZWNA 4JI2B 4HB4A 4C7XA 5IYZF 4DWVA 1PLJA 5MGNA 1VJ1A 4DT1A 2J9GA 4CM6A 1F6BA 1N92A 1ZKMA 2IOQA 3TRJA 5HW0A 4F38A 5SV2A 2JGDB 1U31A 4RMNA 2REXB 4RYLA 5BW6B 3TQQA 4BZPA 1CUUA 1H22A 3AEQA 3QQPA 5KYGA 2DPXA 4JVNA 1E2PA 1GA4A 2FZGA 2JDID 2E4XA 2POQX 3DZDA 1UXKA 2HGZA 3L06A 1C9KA 3LX4A 4GMHA 4GZ5A 4HPXB 4IO1A 2PAFA 4GMFA 3EFBA 4RQTA 4F3YA 5LUAA 3KXLA 1VRWA 2E9SA 4IMIB 1YC2A 2CMFA 2GKSA 3CINA 4R5MA 1KQNA 2WJ3A 4AKTA 1HQKA 2QE6A 5JZVA 2NV2B 1O95C 2J9FA 1Y42X 2W2KB 4G1UC 3A4VA 2OBFA 3BA6A 3H16A 3LT1A 3PPWA 1KZ1A 2MT9A 1ISHA 1J49A 5DTJA 1BEZA 2WWWA 1H2XA 3ZIDA 2P9ZA 5BR1A 5FL7A 3B6JA 3HHPA 4RJJA 4OL0A 4W5WA 5A06A 1XWIA 1E99A 2Y0EA 1C3OB 2GD2A 3L0YA 2O48X 3UJ7A 5ILOA 4K6OA 3K6RA 2V4ZA 3ONFA 4KZPA 3CPSA 1BU8A 1QV7A 2RHHA 1RAFA 1JLMA 1V48A 3P9SA 4W1PA 4BRUA 4KQMA 4EF4A 2I5PO 4L57A 1ZNWA 2J45A 4TS9A 5GMOA 4D3FA 1N33B 1RLOA 2VG8A 3I5MA 4M86A 1GFSA 1NP3A 3HLYA 2HNKA 5KSYA 4NOKA 2WW8A 1Z75A 2DHEA 3I76A 4CQMA 1MXHA 3RSOA 3ZLBA 1R8XA 4K6MA 4QG7A 3EYWA 4Q4LA 2DQZA 1L7VC 2Z9DA 1XB2A 3KB6A 2IJGX 4WH0A 4WK4B 2QSUA 1C4XA 1LLDA 3KUKA 2WUDA 3PNQA 5BNWA 1D1TA 5C3MA 1FSPA 3EGDB 1BVUA 2GHRA 1HDCA 3WZ2A 1NPTO 1YHNA 3DCJA 5FNZA 1QG6A 2J7KA 3A11A 4YGXB 4Y2SA