2B6NA

The 1.8 a crystal structure of a proteinase k like enzyme from a psychrotroph serratia species
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
ADQPSPTWGIDRIDQRNLPLDNNYHTDYDGSGVTAFVIDTGVLNTHNEFGGRASSGYDFIDNDYDATDCNGHGTHVAGTIGGSTYGVAKNVNVVGVRVLNCSGSGSNSGVIAGINWVKNNASGPAVANMSLGGGASQATDDAVNAAVAAGITFVVAAGNDNSNACNYSPARAADAITVGSTTSNDSRSSFSNYGTCLDIYAPGSSITSSWYTSNSATNTISGTSMASPHVAGVAALYLDENPNLSPAQVTNLLKTRATADKVTDAKTGSPNKLLFSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords proteinase K
publication title The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species
pubmed doi rcsb
source organism Serratia sp.
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.4.21.-:
pdb deposition date 2005-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2b6nA00
1AH2A 3BPSA 1ZVJA 1NLUA 4KPGA 1TM5E 4C3UA 5AQEA 1SBNE 1S01A 1P7VA 2Z56A 1TO1E 3WIUA 1SCJA 2P4EA 2QTWB 4DWWA 5SICE 2Z2YA 3QMPA 2TECE 3GCXA 1TM7E 5AVJA 3WHIA 3T41A 1THMA 3A3PA 5FAXA 1KDZA 3VYVA 2G4VA 4HX2A 1PTKA 1VSBA 1AK9A 3L1KA 3SICE 1R64A 2B6NA 1AV7A 2PKCA 2HPZA 2GKOA 1DBIA 2DUJA 3BX1A 1GNVA 1SIOA 4OMDA 1MPTA 1BFKA 2ZWPA 5AMXA 1Y3CE 4WOBA 1Y4DE 1BFUA 2HD4A 4OMCA 3DWEX 4B5LA 2V8BA 2DP4E 2SNIE 2WUWE 4JP8A 1GTJ1 4CG0A 1R0RE 1SUDA 3TECE 2W2NA 3I34X 2PRKA 3SQOA 2W2OA 1TMGE 3TI7A 1LW6E 4J94A 3LXUX 1EA7A 1CSEE 2X8JA 1HT3A 3QTLA 1SBCA 1PFGA 3CO0S 4ZOQI 1WVMA 4M1ZA 1SN7A 2X8JB 4GI3A 1V6CA 3DE7X 3DW3X 2XRMA 3QFHA 5JXHA 1C9NA 4NE7A 1Y3DE 1AVTA 5FFNA 1Q5PA 1SBTA 1Y3FE 4KB5A 1TK2A 4CFZA 3A3OA 5AVKA 4BWGA 3WQBA 1Y4AE 2W2QA 3DYBA 1R6VA 3TI9A 2DQKA 4C3VA 1WSDA 1WMFA 1IC6A 3OSZA 3I37X 2E1PA 3LPDA 2WWTA 4I0WB 1PEKE 1SCAA 1BE6A 3DVRX 1YJCA 4FONA 4AKTA 1Y1KE 1SH7A 5ARBA 3EE6A 2Z57A 4RYDA 1P7WA 1Y33E 3DDZX 2Z2ZA 1MEEA 1SBHA 3GCWA 3DVQX 1BE8A 1YJAA 4HVLA 1C9MA 1P8JA 3I30X 4H6VA 1SELA 1C3LA 2W2MA 3EDYA 5K7SA 1SUAA 2PMWB 1AU9A 5JXJA 3Q40A 1UBNA 2Z30A 5JMOA 4NMXB 1IAVA 1OYVA 1AQNA 2XTJA 1TO2E 5I9SA 1YU6A 1JEAA 2ZRQA 3DE2X 1GTL1 2IXTA 1S02A 3DE0X 3BGOS 1XF1A 4K8RB 3ZXYA 1CNMA 1GA6A 3AFGA 1KE2A 3AJ8A 5ARCA 1T1EA 4YN3A 2Z2XA 3VV2A 1S2NA 3DE5X 1Y34E 1KDVA 4AKSA 1WMDA 1SCDA 2ID4A 3EIFA 1GA4A 1ST2A 1SVNA 1Y3BE 5B1DA 3LPAA 1SIUA 3VV3A 5JXGA 1WMEA 2SICE 3F49S 3UNXA 1KE1A 1TM4E 1T1IA 1GA1A 1Y48E 1GT91 3DE4X 1SPBS 3VSBA 3CNQS 3VTAA 4KG7A 1BJRE 5B1EA 1SBIA 1GCIA 3DE6X 1SCBA 1SCNE 5JXIA 4Z2AA 1OYOA 1AF4A 3I2YX 2W2PA 3D9QX 3D43A 3Q5GA 2Z58A 4DZTA 1GNSA 1OT5A 2ID8A 1ST3A 2SBTA 3DE3X 2PQ2A 2SECE 4LVNA 2ZWOA 5ARDA 1TM1E 3DE1X 1YJBA 1Y9ZA 1T1GA 3A3NA 1BH6A 2PWBA 4H6XA 1EGQA 3GT4A 4NE9A 1DUIA 4DJ5X 5FBZA 3DVSX 2ST1A 1C9JA 3VHQA 3H42B 4LVOA 1NDUA 4WOCA 1A2QA 4MZDA 1V5IA 3P5BA 3HJRA 4ZARA 1SUEA 4H6WA 1SUCA 1TM3E 3GT3A 2PWAA 3DW1X 1GTG1 2WUVA 3PRKE 1KDYA 1SUBA 2IY9A 3AJ9A 3ZXXA 1SUPA 3WIVA 1NDQA 1TECE 3F7OA 1ZVKA 3LPCA 4CFYA 5CW1A 3F7MA 1PJ8A 2WV7A 2PYZA 3PTLA 1SIBE 4OV6B
chains in the Genus database with same CATH superfamily
4RTLA 7AT1A 4QXPA 4JYCA 1ZVJA 2BR5A 1NLUA 1WX1A 2HSGA 4RPCA 1LLUA 1V7CA 1C2YA 1X3SA 1QF9A 1KMNA 1EVIA 1MABA 5J43A 1XJWA 5SZKB 5EZQA 2NO1A 2RARA 1TLLA 3H75A 1K8QA 1O97C 4ENPA 4J2HA 4GUAA 3EXHB 3HS3A 4FOSA 1LNQA 4ZPXA 3T7AA 4W4TA 1IVNA 1IM8A 1FE8A 2FSSA 2IA5A 2VFAA 3HV0A 4S1OA 3WIUA 4BE7B 3WGIA 1NVWQ 4GI1A 2QUZA 5AW1A 1U6KA 5EKXA 3ZHYA 1T25A 4JL5A 4TTTS 3DZKA 3MF4A 3NWPA 3TGWA 1NPDA 1XXHE 2H18A 4HLCA 1RQXA 3AZOA 4ALJA 1PK9A 3KVOA 5CNJA 1QDEA 4TGLA 1W5AA 2WU1A 1B8UA 1NFFA 3L82B 3MS2A 5D86A 3R7SA 3WHIA 1W7AA 1GUFA 2XMQA 1LLFA 1XCBA 3HPRA 2GM4A 5ALHA 4WL0A 3VYVA 3AETA 3WX0A 1PD1A 5EXXA 1LF5A 1VYHA 2ERCA 2O4UX 3CGGA 3NIGB 3V4SA 1AGXA 1KDTA 3CR8A 2H31A 4FI3C 3KX2A 4NZMA 3CPEA 3EUWA 4FE7A 4REQA 2VPWA 4NKRA 4TS1A 2DTXA 2V6MA 2EVWX 3I6YA 5KWIA 1TQDA 3V7YA 3C98A 3DBLA 4BLQA 4QAQA 4Z9XA 2YUTA 1Q1AA 4F1WA 3OJEA 1N5RA 4C04A 1U8UA 1LW7A 4Q02A 4FGKA 2BFWA 3HLYA 1QVAA 1EUCB 3HP4A 5EPEA 1H6AA 5DLDA 4P0TA 3TZ6A 3V1TC 4DGSA 2OLKA 4EY8A 4CTJA 3KQLA 4MDEA 4NQRA 4GL2A 2HCRA 2BD0A 5IK2A 1WY7A 2ZJFA 1AN9A 1R15A 5U4QA 4AICA 4LRSB 3ZY2A 1JSZA 3F6SA 3ZHQA 3FKQA 2D1RA 3GJRA 2IE8A 5IASA 3BXFA 5FADA 1WDMA 3ZWAA 2I5PO 2VYVD 4AMUA 3HNPA 4C06A 4N65A 3P9NA 3N39C 1TZJA 1IXSB 1WL8A 1I1NA 4EJ0A 2EFHB 2O8VA 3HCWA 5EP4A 5EUBA 3OTIA 2Q5OA 2ZJ8A 1F2DA 2XZDA 2O52A 4KWTA 5GQSA 1VSUA 1JKMA 1IUOA 4MWGA 1OLUB 4KXFB 1GDDA 4MGEA 1XK6A 2P7HA 1SC3A 4KR9A 3T3EA 2JF0A 3FGZA 2AL7A 2XQVA 4X8MA 1K8YB 1AUOA 2OCDA 4IV5A 5C3UA 4EF6A 4AJNA 1KZGB 1V6AA 2H92A 2PQ0A 4DUGA 4LFBB 3UFXA 1X8LA 2HFKA 5SV2A 2DJ5A 5KSYA 3HFJA 1Z4MA 1RI5A 1JMVA 2VSQA 1Q22A 1PTJA 3GDOA 4B9EA 4D9BA 421PA 1J23A 3G5MA 3M4ZA 3Q7IA 3GT0A 3FHCB 2HCTA 3EBOA 4X1KA 5IAKA 3IV9A 3MA0A 4BPBA 1MFZA 1G20A 4CR6A 3DAFA 1PWEA 3ZUGA 4QHTA 1KYIA 3P2JA 5IBRA 5ULLA 1K06A 4WBNF 1HGXA 2FHPA 1R5NA 2QPLA 2YHBA 1UKVY 4QUGA 1EGVB 4R8MA 5EJ7A 5EQFA 2R751 2VWPA 1P6QA 2HIAA 2V1XA 1QDUA 2HU2A 4DUPA 4P2BA 4PYNA 1PFKA 2G5TA 2ALJA 1SRRA 1E1RD 4OQMA 1LQTA 1TMOA 4MQFA 1DX4A 2A0XA 2VXCA 5KMGA 4JB3A 4RK0A 1VE5A 5D3QA 1XV5A 3UJ6A 5H1YA 3EOZA 2QUHA 2GM3A 5FWXA 4OSOA 3R3ZA 1VKNA 4FSDA 5JJ5A 2H16A 2J6CA 2B1IA 2XCTB 1ISIA 1SJ9A 4MVJP 3AM4A 3DW3X 2IUUA 3HTXA 3H18A 1Q1NA 3MJSA 2Q2QA 5C2JB 2J0EA 3AFMA 3IKJA 4BX8A 1SURA 2CNLA 4HZGA 2DTEA 3NYRA 1FRQA 5TF0A 1JQBA 4OBWA 4L5AA 5LU9A 1PN3A 2H6EA 3TSAA 3OUUA 3FFTA 3DZBA 5DNDA 1TK2A 2QT9A 3RGGA 1FJXA 1XUOA 4OJYA 4QHSA 4ZAWA 2VP0A 1II8B 3CVVA 5DEOA 3KQYA 2GEVA 1TKBA 4ZAXA 1MR3F 3UENA 3E2MA 2G5PA 1VTKA 1IHPA 2UXDB 4L8VA 2D8MA 3D02A 2YY7A 3KTOA 4YAUA 3CLHA 4PICA 4Z4EA 4ESEA 5K3CA 1RJGA 3IT3A 1E5XA 1QGYA 1BA3A 1T9KA 2D74A 1WUIS 1W30A 5C37A 1FFBA 2OOSA 5AK0A 1ZQ1A 2NZYA 1TJYA 3AG6A 4XFKA 4BKPA 1T8UA 2W9XA 8OHMA 1FW6A 4GPBA 1QU3A 3MHPA 1OD6A 2WWRA 1RLMA 5C81A 4P34A 2C83A 1IC6A 2I33A 4TN5A 5CTAA 3ZXUB 1JKXA 1Y0BA 3B5EA 3STHA 3JSXA 2OTCA 2CXHA 3QY9A 5ECDA 5HDBB 4CLOB 3EAFA 3TGPA 3A6FA 1JLSA 4I4TA 4ESHA 4YCNA 2WY2D 1N3LA 1ZBDA 3VHLB 1P9OA 2O3JA 4X5OA 1GPKA 2P62A 1DEXA 4RADA 4FHEA 3UTDA 1KJNA 3C70A 3GEEA 4AXBA 4B76A 1OZ0A 2QN7A 5HUJA 1APBA 2CFTA 3QEKA 2R11A 4D8TA 3QW2A 4MVJM 2P9QA 4CV1A 3V6MA 1E2PA 4XX1A 4ZV7A 4XGNA 4K88A 4Q18A 3KZ1E 1P17A 4OP1A 5IT4A 3QJ5A 3W9SA 1G9SA 2XB6A 1NE7A 4XIYA 1OROA 3AL3A 4XWKA 5EAIA 2WM3A 2DWUA 1U1EA 1QANA 2QV0A 3OPNA 5HJEA 2UVPB 4I66A 4DSUA 5KKCA 5KUTA 4W9MC 3TTYA 2GARA 4HB3A 3HK2A 4OM8A 4WY8A 4DZRA 1T9GR 4DMLA 3DEFA 2ATVA 4WECA 1UBSB 3HB9A 2O06A 1DOHA 2XGOA 5AI4A 1PFVA 1P45A 1NNUA 2QG4A 4EDHA 3EISA 5BQOA 4B7CA 1ML3A 1O7JA 4M49A 4MWEA 2HA6A 4XUGB 4I55A 1TVEA 1D04A 2NAFA 2IHYA 5A6VA 4KTVE 3EARA 5T3UA 1JYFA 2AN4A 1RBQA 3QLEA 4B84A 4ZI7A 3BXXA 4OMFG 2XCOA 4RF3A 3BK7A 1G8FA 3RJ5A 3WZLA 5JAMA 1P2FA 1QHSA 5H8WA 1E7WA 2VT6A 1PLKA 4JQYA 1U8YA 1JHMA 1UWCA 1WF6A 3FAKA 3NRBA 3PQEA 4P4SB 4CM8B 5KQPA 4K8OA 4WFQA 5AOVA 4Q21A 3TNYA 4BZWA 4V39A 1CEEA 1P33A 5ICMA 2WKSA 1VOTA 1R7RA 5IUNC 3IALA 4EX6A 4ASUD 4JB0A 5FF9A 4B45A 3EMBA 1G7RA 1LBTA 1YGYA 4QX6A 4MWSA 5FPPA 1YVDA 1H8HD 1K8XB 3KYCA 1R27A 3K2EA 5IX8A 4R51A 4A26A 3DLPX 4LDPA 1MC1A 1VECA 3LGSA 1VI6A 1KOLA 1BD3A 4N39A 1XZIA 4GFDA 1AKWA 2CHGA 2XNJA 3EGDA 3M9XA 3MLEA 3OT5A 4GP7A 5C80A 5IDQA 1KO5A 4WN9A 3BK1A 3FUXA 4Q03A 4F4JA 2R6CA 2VG8A 3HGTA 4ND2A 5JH7B 2CFIA 1PWYE 4R3WA 4UHBA 5K1ZA 1PWXA 5LLSA 4DGQA 5D8DA 1YTUA 3R0VA 4YX9A 5C7OO 4FOOA 1E6CA 3MBIA 3RK1A 2QG9A 4CKCB 1QVWA 5HKKD 3SJAA 1JWBB 3BL5A 2WILA 3EIHA 4LUCA 5CITA 2BPOA 1RPZA 1Q0TA 1BGXT 3DDNA 5BOVA 1EFHA 1ZWLA 2RSLA 2WJWA 2PSEA 2J32A 5FPSA 1NBWB 4O2BA 3ZWVA 4YMWA 3AFGA 1E9DA 4TS9A 1XZGA 3FZNA 2AN5A 1MVLA 5G0UA 2QMYA 1T1EA 4KHPB 3QRWA 3RW9A 1YFKA 1YDMA 4XWYA 3W3AD 3W0LB 3WGZA 1YRYE 4Y1EA 5BT8A 5JEDA 1FDVA 3JATA 4HFRA 5D5PA 3BJMA 3OMWA 4KLCA 5FNVB 1VHDA 4HBGA 2CL6X 1T10A 2P6UA 3HVRA 3ZHSA 1XDSA 1WCIA 3G2JA 1NT4A 1P4HA 2FQYA 3V1UA 1RYEA 4X94A 3B9PA 1PG5A 1PI3A 2JJQA 4GP9A 3ZZMA 3MRSA 5C51B 4CTMA 1HLGA 2GVNA 1Y1QA 3HFGA 4NL4H 4GXTA 4MWZA 1C7JA 2BSXA 2W8BB 3KJGA 5KC8A 5ESRA 1WMBA 4K9MA 2PPVA 5TJ9A 4F04A 1DTSA 5A4JA 5GJCA 4IOKA 3OOJA 2HGZA 4AZTA 1Y5RA 2I2FA 1DIRA 3OJWA 4GP6A 3TD2A 4N48A 1H0SA 4QJBA 1T9DA 2QPAA 4BNTA 3SFTA 4R1UA 3NP9A 1CZHA 2A57A 5JAPA 1Z6GA 1KY2A 2QTCA 2ZRFA 5A5DA 5L9AA 1RXEA 4IFBA 5D3KA 4M9SA 2D7DA 1GT91 1EK6A 4W1PA 3A58B 4CL8A 4UD2A 4RAOA 4YV7A 1CQJB 3V00A 2XYQA 3JALA 3JS5A 1A4IA 1HFEL 2YR0A 1ONBA 2NU8A 4DLYA 1QOQB 3IUEA 4EI9A 1AO0A 2NV6A 3T5CA 5CG1A 1KOJA 1DU4A 4PPFA 1BN6A 4JJFA 2FXIA 1L7OA 3F9IA 4CIDA 3H5WA 4L0MA 2POQX 2OBYA 3KWLA 3DQZA 4HB2A 4DKJA 5KBYA 3IDZA 4GGMX 1FSFA 3K0SA 2CSXA 5JZVA 2QTLA 2QLMA 2XCQA 3BB4A 3G89A 4BNDB 5ALUA 3F6YA 2Q21A 3TSCA 1P0FA 2O8CA 1R0CA 2ZU6A 1R5BA 5B37A 1T1SA 3EBLA 3GARA 3ZD9A 4XWOA 5I3CA 2LDBA 1R6XA 3L5KA 4GOJA 2PH7A 2YVAA 2HXGA 3KOMA 4GZLA 4UBLA 5COAA 5DGHA 4DR5B 1ODJA 1ZJZA 2MYPA 3BOSA 4ZVPA 1KBOA 3K7EA 4PZ9A 1G8KA 2WJPA 3BWEA 1SB8A 4RAQA 4G9EA 1UMDA 3Q87B 4X44A 5J4LA 2Z58A 4H27A 4A0SA 5L3SA 1DARA 4TTRA 1XNGA 1G4HA 4FYHA 1LJLA 5EJ4A 4PIVA 1RC0A 1JUDA 3GXOA 3EY4A 1T29A 1CJUC 3STUA 2YKGA 1EJ2A 4IIUA 2PMFA 1Z08A 2PQ2A 1IXKA 2PSDA 3O83A 4PLZA 5T64A 2G1UA 3F2VA 1IN7A 1V16B 3D3QA 4UE6A 2SKCA 4CDNA 1CEYA 2REXB 4OA5A 3NR2A 2VUIB 3B9RA 4H7IA 2CE7A 1ZKMA 1Y5MA 2C8LA 2O2CA 2XV1A 4Q9IA 4J29A 2DMRA 2A86A 2EHDA 5A5VA 1TEHA 3PQCA 2GLUA 4OGKA 3IP6A 2X0IA 1E59A 2PG3A 2XOKD 4G65A 4G5RA 5AUPB 3S8EA 3MRVA 3PWSA 3FOWA 1GFSA 1MIHA 3QK7A 4MR8A 2HQBA 1R8JA 2UZ0A 4F1KA 1DIHA 1OH6A 2Q3FA 4AYWA 3RT1A 3VSDA 5BT9A 1SXJB 4L51A 1SC4A 2C3YA 2G9NA 4PHCA 3DHVA 5HKLA 1JJFA 2XMBA 4X8LA 3K5WA 4FFLA 4X8HA 3QVKA 5E6SB 3D6FA 1VRCA 2O5VA 2RHOA 4Q5IA 3T3MB 3CUTA 4Z7OB 2Z0MA 2D2IA 1I4DD 2QUBA 3C6ZA 3HUEA 2AD1A 4JJIA 1Z4NA 3K4PA 2D3TA 3EULA 4FEAA 5FOWA 4MYRA 2Q6OA 2IS1A 2LNDA 5LB2A 1VKZA 4L07A 3TLGB 5B4TA 4JUDX 4D2IA 4H3HB 1FIUA 3ESRA 1UP6A 4U7WA 5CGZA 3FFBA 1R12A 3OOWA 1IM5A 1OTHA 3P5BA 4L75A 2JCYA 1Z38A 1AQ6A 2W58A 1U7HA 1O5IA 3NOXA 3WK6A 2EX1A 4A0RA 1YDHA 4ND8A 4RQUA 1M1UA 2QLFA 3GZTB 3FCSB 1EVEA 1GV1A 3C6YA 1B42A 3WSWA 5AJYA 1BEZA 2R6AA 1XVAA 4JBGA 2JJMA 1V9SA 3CHYA 3L02A 4BY9E 2BTEA 1XPOA 1QFSA 3AJ9A 3EXHC 4W5JA 4CF7A 2AZ4A 3MK31 3ZHVA 1Y8RB 4LOAA 1T4CB 2HXSA 1TD1A 2D3WA 1P44A 2AOTB 1MOQA 1P7ZA 1NP3A 3H6KA 3R0XA 4FKZA 2FSIA 5A02A 3TVTA 5BVGA 1VHLA 1QRTA 2ZZNA 4HQ0A 3DOIA 3ZGZA 1MRNA 2PJZA 4HZUB 4B75A 4QDKA 2P11A 4A5OA 4EUNA 2HNAA 3ML1A 1YK0A 1OTXA 4XZ3A 2HDWA 4BZXA 1T43A 1OBCA 1Z2NX 3HJGA 3EZLA 1CRQA 1GPBA 2P2LA 2RHGB 4O4LF 3TGLA 2BGLA 3B6MA 3L84A 3ZW8A 2DETA 4BB0A 4K6OA 4PZ0A 2V97A 2I1VB 3EXHA 2IGTA 3BXPA 3MGGA 1NRWA 2YXNA 2ZWVA 2PKRA 4HN9A 1O08A 4WLNA 5EY5B 2ACWA 4DNPA 1R3DA 5K99A 5CNMA 2YJ4A 3Q7TA 3VOTA 1JBQA 1KYQA 5FYQA 3K0BA 5IAEA 2ZJ2A 4E3ZA 3BF7A 3NYIA 3QY0A 4QUJA 5CJJA 2WJGA 3FBGA 2HWUA 4LYJA 1SBNE 5TPZD 3VHXB 3RSCA 3FHTA 1INLA 4N0MA 3LX5A 3DEKA 4RY2A 5EIFA 1O87A 2Z56A 4MS3B 2WNHA 4AN1A 1VGVA 4NATA 1CHDA 2VQFB 1ZNXA 2NUTB 2RC5A 1A8IA 2WFMA 3KWMA 4G3XA 4QQNA 3PX3A 1IU9A 3MSCA 3T0FA 3A9TA 4UE3S 4D8VA 2ZRCA 3QEAZ 4FYKA 1GZ3A 3Q8WA 3T7EA 3JAWB 3T0GA 3UV6A 1LWNA 4WXHA 3UQYS 3VU0A 5KREA 1HH4A 1NIPA 3L7KA 4FEYA 4LIPD 5LOVB 1BKYA 1LFDB 4M7RA 1H2EA 4L28A 3A3PA 2PXHA 3QI2A 2O2GA 4KN5A 2B2NA 3INRA 2VDPB 2IXGA 5DXAA 3UWKA 5GZ6A 4LYHA 1X0VA 4BNHA 1OB5A 2VPTA 2NN3C 1SEPA 4RU1A 4Z8YA 4DBLE 1QYIA 1F2TB 2ZBQA 3UKOA 3FCXA 4LF5B 2IKSA 2LRHA 3MMNA 2ZVQX 4GXQA 4KDRA 2BP7B 2HB6A 2EZTA 2IODA 1PX2A 2D4HA 2IU4A 3LLCA 4XYBA 2VI5A 4XXHA 5H5JA 3KIPA 2HPAA 3D5EA 3U3MA 1SIOA 2XRFA 1J06A 2FJ0A 1E18A 3DXZA 4OMDA 2O50A 1VYVA 2Y1GA 3A4VA 1Z0ZA 5KQMA 1DAHA 2BM1A 3DC2A 5ADUS 1OLUA 5GZ1A 1N75A 3NHRA 4LDRA 4A7PA 5LR6A 3LBHA 2DG2A 3DFFA 4QELA 4OHMA 2WWVD 3WQSB 3WGYA 1GTZA 3DOEA 4K6HA 5EE1A 4M9CA 3VGPA 3WNDA 2A92A 3VR5A 1GU0A 2JJ8A 1TKAA 1Z29A 2CLFB 5AXDA 1BDMA 4F7WA 4NCNA 5ER6A 5TVKA 4OMCA 5BNTA 2AFRA 2OWEA 3A9RA 4AKHA 3MILA 3KOWA 1TEZA 2CUTA 1ZGGA 3LW7A 3FGOA 3WNQA 1UANA 4C6RA 4E5MA 1UT8A 1ULZA 1OX6A 2WF7A 5JFOA 1ECFA 3SI7A 3TOCA 4HEHA 3I4CA 2W2OA 2NUAB 4MWDA 2WD8A 2ARKA 3SF0A 3HUUA 3WOVA 2WZDA 1H2BA 3R5TA 3ZIUA 4OX9Y 3ID6C 2XB8A 1G3QA 2ZI9A 2PHZA 4KSBA 1NMZA 4FMDB 4ZCSA 2YCBA 4BUZA 5TQ0B 4DCGA 4C30A 5E1MA 4MUGA 1SUWA 2JH8A 3TZLA 3PYXA 3WAJA 4JSRA 3TTVA 1PL0A 1Y7LA 3PA8A 2JHAA 1OPXA 3LUGA 4D25A 1E9AA 2BWJA 1X39A 3NHMA 1RPAA 4NZ9A 3I9MA 4LKRA 4UULA 4ZVSA 4TKVB 1PL7A 2QWXA 2ZVDA 5HW0A 5CXSA 2ACEA 4X3CA 1XPRA 2KWIA 2X9NA 2WJ4A 2DKFA 4U0KA 4BIMA 4LMPA 2X8JB 4R7TA 5FHQA 4B8WA 4OJQA 1D2GA 4D8YA 4IXWA 2WQ7A 4L76A 1LQ2A 1V8FA 3ENQA 4IGKA 2NAPA 3W6NA 1LC0A 1KZ9A 1XDBA 2CEKA 2OY0A 4CKWB 3FM9A 4TMKA 4JLAA 1F06A 1BO6A 3AT1A 3BQ9A 5KQSA 3MLBA 3RQIA 1VSTA 1X2EA 3ZJYA 2GESA 1Z5PA 3DLHA 3GMDA 3B3JA 3OP1A 4EJSC 2R8EA 2Z5VA 1II8A 4MO2A 3NRJA 4N8EA 5FA8A 4UEWA 3ZY6A 4PYRA 3B51X 4IHKA 1SUIA 3GRFA 1KYVA 3OZXA 2C2GA 2DPLA 4KAAA 4KQJA 4BZZA 1E77A 1LQUA 3CX3A 2PVCA 2RHTA 4NE7A 5AJHA 5GVRA 2EZ9A 1NJ8A 4IAOA 2B92A 3WJAA 1H69A 3GRRA 4PAGA 1JBEA 3L8MA 4RTKA 3ODGA 4AKGA 4AY5A 1UXHA 1PHPA 4KB5A 3NVAA 3FVQA 5FH9A 2WD7B 2GEJA 4LZOA 1T8PA 4OIFA 5EC8A 4CFZA 1GCOA 1VG1A 3VVCA 4E51A 3TG2A 4JMLA 2YFHA 1ORIA 3FPFA 3A4MA 3BRCA 3GGJA 3NNSA 2IZ1A 1MO5A 5NULA 1SD2A 4RZHA 1YNSA 5JD6A 2VNKA 3T6KA 2B7BA 1VMAA 1C7RA 3D4LA 2NTVA 4RZQA 5BWNA 5AKIA 1I7NA 1GN8A 4OEHA 3K6JA 1F8GA 4PN7A 4CLOA 3E2IA 4GR4A 3ZHCA 5AJZA 1U0NA 4ERXA 1ZMBA 3D7SA 3ESAA 2ZJBA 1P3Y1 2LBPA 1GP2A 3A05A 5KWEA 4XLLA 4J49A 1SA0B 1KSJA 1WMAA 4L0DA 3ABSB 5CFNA 1LDMA 3R7LA 4R1LA 1XRLA 2Z3WA 1WXDA 1C3XA 4DCCA 2E6KA 1BS1A 2CVFA 3K9HA 3RTCA 5ITVA 4R98A 4UZFA 3RC9A 2D7CA 1EVYA 2D7JA 4P7GA 2ZITA 4A0HA 1ENPA 2QN8A 4WZZA 3EIUA 1P2BA 4XE5A 1H8EA 3RYCB 1ZGBA 1I6KA 2UVQA 2ABWA 1BE6A 1XZEA 2I3BA 4M8NE 5KNBD 1U3FA 1RT9A 2UVPA 2A7QA 3ONNA 3QG1A 4YEDA 1VIVA 3D8HA 3G1WA 3GQVA 3NM4A 5EE9A 3TF5A 5EIXA 1Y1KE 4JT8A 2HQ1A 1SH7A 4MA4A 4XWTA 4F6RA 2VP9A 3WOHA 1L7AA 1KH3A 2PUAA 1UBMS 3I92A 5EPOA 3V1YA 3ZXSA 4I1SA 2D2VA 4G89A 2BGNA 1LPBB 3RVKA 1FQJA 4A6EA 1A2OA 1N5OX 1Z4PX 2PYDA 5CLFA 1VRVA 2WIGA 4R2LA 1MAWA 5F33A 3U81A 4LJ9A 4I2NA 4NMHA 2X8LA 5KCMA 5FV4A 3ZWQA 1WV1A 1RAGA 2J5XA 4Z0PA 1YA6A 1OOEA 2Y6VA 1J99A 4M8LA 5DX0A 3I9LA 4YRFA 3HDJA 3M6VA 4QOGA 1QYDA 1E3LA 2L69A 4UNSA 3TD6A 3PYMA 3GCWA 4E15A 4HGQA 1FDUA 4ZZIA 5BW5A 2WTAA 1P2VA 1ZOIA 2VCHA 4P4SA 4CM8A 1EK5A 1JLHA 4RCVA 1XRJA 4X1YB 2UKDA 3P2KA 4G5OA 4B6QA 1V39A 2NU9B 4XCVA 1I13A 4R9RA 1CNFA 4EGJA 4RTNA 5FA5A 1CQXA 1E1NA 1NRXA 2PX0A 3UB4A 4EA8A 3HJUA 4NVRA 3OZIA 1QO9A 1KQNA 1V4BA 1VJRA 3LX6A 2BZ0A 3LCJA 4YGYA 3BAFA 2WE8A 4PAQA 1LTHR 1SXIA 3CSSA 1WKVA 1AU9A 4EGSA 5AJWA 4B3MB 4EUFA 2ZE7A 1F17A 1AZLA 1JP7A 1R0XA 4QVIA 4TL9A 2G09A 2OQIA 2YJZA 2QT0A 5B58T 2HWYA 2QPOA 1AUXA 4JROA 2JAOA 4DG5A 1NJSA 1XLTA 4NOMA 5JH7A 4PSUA 4B4VA 4JI2B 1JQKA 1ZMXA 1OYVA 4BO7A 1SXGA 4CKCA 4FFMA 4OU5A 4YRQA 3VKFA 1MG0A 1PJCA 2FSHA 2WFLB 3DWGA 2Q6IA 4ZOCA 5K3FB 1IJEA 3JD3A 1K7CA 1JG6A 3O82A 4LOJA 4V1CI 4E07A 4WTOA 1W5FA 3NEAA 3Q72A 1FYVA 1CUAA 1CJKC 1S3GA 2A3RA 3BGIA 3FGPA 1XMXA 3H5NA 2XUDA 3IMCA 5HGJA 4DREA 4YXWD 1AA6A 1T6NA 3QPWA 1P77A 2ZBFA 5CNIA 4EW3A 2UZ1B 4LSZA 4O4IF 4YRPA 1R9NA 1XXLA 4LXUA 5GPBA 5FNVA 1GGHA 1D2AA 3UPTA 1K1EA 1WTCA 3ILHA 3OE7A 4ZAZA 1YASA 5EIHA 1YB1A 1U8AA 2IHVA 2R97A 4TMXA 3N2IA 1TADA 2R68A 4G26A 4L5YA 1DFHA 4P92A 2NP6A 1HE8B 3IUSA 4EFNA 4YUZA 5KYVA 2OBXA 5AHXA 2Q1UA 1NNI1 2JFYA 4OP2A 4YNBA 5HM8A 1QV7A 1QUFA 4F2WA 1ND6A 4INJA 4K9NA 1GYPA 3CA8A 4GBMA 2NSYA 1CERA 4DABA 1ZJWA 2CFOA 4CN9A 1ILEA 4TSRA 2B6HA 4L73A 2HU8A 3RK0A 1RM3A 2A8YA 3S5JA 1YK1A 3E7PA 4ZJPA 1J0CA 1VGQA 1XT6A 6NULA 3IMGA 3G8BA 1JILA 1KDPA 2QN2A 4C9BA 5KYGA 1K4YA 1CVIA 4PIMA 1LX6A 1CQJA 1L5FA 2V3VA 5C8VA 3KHSA 3IE0A 3OQVA 4NDNE 5EZ6B 3V2UA 3T3GA 3KKOA 3L0CA 2V7VA 3EAGA 5KCZA 4U4AA 5CW2A 2AZDA 2AFIB 4EO4A 1KXZA 1IZ9A 1BAPA 3ABQB 3Q12A 4X24A 1D8AA 1DJPA 3H4TA 4Y6QA 3ZBPA 2FPPA 4YXFA 1XD2B 1K63A 1AX9A 3D6AA 1CR6A 1FFCA 2P2DA 5HG0A 3ZLUA 4Y2SA 1JNYA 3MMZA 2BSQA 2J0SA 3U9SA 4DQLA 1SPBS 2B5VA 1RBZA 3AUUA 3FPCA 1JI0A 5F78A 4GI7A 3TM5A 3VJKA 2BKXA 4RSGA 5DYWA 3OAAA 1KFEB 3DBIA 2F62A 3CNQS 4BV2A 3P2IA 2O8BB 1JG1A 2D5IA 2QW1A 2WP0A 1DEAA 5D2CA 3RYIB 4CT4B 4LF6B 4PXYA 4XD7A 1DQNA 2ATIA 5K0FA 2BM9A 1LLCA 4MGKR 2XMRA 3ESQA 4EITA 1CQIB 1IEXA 2IHBA 1N9KA 2ZI4A 2WPDD 3D8NA 1IHOA 5IVIA 4IIBA 5LQDA 5C8YB 4LE2A 4X91A 1O3YA 4N12A 4FSHA 3JU3A 4ETWA 4LF4B 2ZQYA 2NOAA 1L5LA 1OWLA 2ZSJA 2XUAA 3PWTA 5KINB 1HTTA 3Q9LA 1FMLA 2ZVJA 3JTMA 3CLUC 3ZHUA 1U4SA 1MX5A 1NXXA 2XJ4A 4GYYA 4EB6A 3OX1A 3BRSA 3NBUA 4ODIA 1V16A 3VZBA 4BKUA 3D43A 3IB3A 5CYOA 1TEVA 4GC9A 1AKEA 2VHUA 3CNEA 4M88A 4R1OA 1VZ2A 5D01A 3UGTA 1BEUB 1QG2A 2ZYIA 2XX3A 2E7ZA 2Q1WA 3OZSA 1M8KA 4L72A 2CV1A 5FOTA 4D99A 4RHCA 4ECAA 3VNSA 2XUPA 3OIFA 2C2WA 1M73E 4YIHA 3ZY3A 3G85A 1LPAB 1ESMA 1X8XA 3ZCPA 3WHLA 1H2WA 3FCYA 3VNUA 3S2ZA 3I0NA 1L4BA 3O3OB 4HOYA 4U1RA 1YZ3A 5ALQA 4K7JA 2W70A 4TLLB 3GWZA 1SXJA 1XMIA 4LHSA 1QRAA 3AF1A 5LZ2A 2W2XA 1UJ6A 3LYLA 1TYDE 3W7VA 5E6SA 3RG8A 1T0JB 1UFKA 1BE1A 4F91B 3DUWA 3LQQA 4FKBA 4PHHA 2LD4A 1UDRA 3E8MA 4WV3A 5C0OE 2Q2NA 1XB2A 2VDRB 3IJRA 3ZV3A 4CKBB 3GNLA 1Y9ZA 4G09A 4RF2A 1OJLA 3E3OA 4OQ4A 5K0LA 4DNXA 1OKKA 2VJCA 1ISPA 2G4CA 4QRIA 3T99A 1TQ8A 4FHFA 3TLGA 3EEYA 4ENWA 5FLEX 4H6XA 3ZZ0A 1RR6A 2FY8A 4CR7A 4RTQA 3GT4A 5I3ZA 2WA2A 1UM9B 2WHEA 5EJ9A 3IO5A 2C2MA 4PHFA 2GO1A 3RSLA 3D3NA 1QHHA 4RKQA 4U8GA 2OXCA 2ST1A 4CCSA 3PPWA 1ICIA 5CCEA 1Y8ZA 4YT4A 1CETA 1JNXX 4MCIA 2FFRA 2P40A 4B7UA 2E21A 3W5SA 5K0JA 2E9SA 5IKOA 3JCZA 4NC9A 1Q2UA 3JASB 3PHHA 3BWYA 5B12A 1Y8RA 2H4XA 1T4CA 3A1NA 3A31A 2FOLA 3P9PA 3ANNA 3QM1A 2LIPA 2AOTA 4ZAYA 2JLVA 1XAHA 4MRVA 3IGFA 4HS4A 1TVKB 2C96A 4UVEA 1OY1A 5EJ6A 3MHTA 1WB5A 3P27A 4HZUA 5ALMA 1Y8CA 3QVOA 1PQPA 4L7QA 4DXAA 3HYSA 4BWYA 3WK8A 3IP7A 2BFNA 2IC5A 1X9HA 3CE6A 3NONA 5F9FA 3TIVA 3P20A 5JDCC 1IM2A 2ZYRA 3B9BA 4FGSA 4HD8A 4MQ4A 3TTXA 2CBZA 4D96A 4BL5A 1J56A 2GR9A 3ZYZA 2C7PA 3DZFA 2PWPA 2EKBA 2W6OA 4G85A 4DEYA 3ODPA 1NVKA 4O4JF 1BQ4A 2MT9A 3O2QB 1SG6A 3IBFA 1UEXC 1RRPA 1PV4A 3NIDB 5DCYA 4Z7QB 4F45A 2BMAA 3KJQA 1YHYA 1U0SY 2XMCA 5U1PA 4BLWA 4FFWA 1WSAA 4QARA 5JQGB 2AEJA 5FUXA 3B38A 1XN4A 2JLRA 3C3WA 2NZ2A 3A4TA 5BSUA 3WLFA 4KAFA 2A14A 1IL0A 1TD9A 1W0KA 4R31A 4RD4A 5EZYA 1I2CA 3VHXA 1ISHA 4I50F 4JLDA 4UAGA 2G76A 4BN5A 2WV7A 3BFKA 5JECA 5JDCA 3RAEC 3U4QB 1U28A 4OQDA 1E5QA 4MS3A 5B5SA 1V8DA 2P1DA 4FMBB 3CZRA 2CKMA 2F43B 2WAAA 4H4CA 4WCFB 2NUTA 1W75A 3HVHA 3UN1A 5JT1A 1AH2A 1TM5E 2K4MA 1IY2A 4WA8A 3DMHA 3L6DA 2CF5A 2A0YA 3UAOA 1X7YA 4YREA 3E0QA 1IRIA 2F1IA 3JAWA 4Q0MA 2HSDA 3JD0A 5J2TA 2MSWA 1R10A 2B8JA 3BM5A 4MPJA 4Q3CA 5TS2A 1IN4A 3IEKA 2EV9A 2P9GA 1MJ5A 1ZXXA 1OH7A 2P6NA 5CFZA 1WXXA 1PJ4A 2P68A 2P4EA 4GMHA 1BJKA 3VPHA 3B70A 4KRGA 1ZHOA 3RSQA 4DRYA 1GKYA 4I46A 4A2PA 5CFMA 5KYWB 2Y4NA 4D79A 1K27A 1CLEA 4K6FA 4J8PA 4YLGA 1KP9A 1U3TA 2AF3C 2ORYA 1B73A 3GLSA 3AXSA 3K2QA 4P8RA 4S1TA 5AXAA 1F2TA 3K6RA 5EQDA 1T8SA 5GY7A 5K9ZA 2YX1A 3HY6A 3FR8A 4D56A 4J0EA 4ZODA 4CM1A 1THMA 2SKDA 1O57A 4NK4A 1PEDA 4TTPA 4BCBA 4KXMA 3W7AA 2X14A 4LHZA 2BP7A 2JS7A 4FNOA 4NOKA 2MSDB 4PO8A 4YJHA 1JDVA 3U7HB 3D8BA 1JDBB 2Y6UA 3T5GA 1PTKA 3C14C 4AU1A 3HMQA 4R9NA 1BROA 1XMOB 3GP3A 3O95A 1R64A 2GSWA 4IICA 2R60A 4ARBA 1QF7A 4QU8A 1SXPA 1AV7A 2CY0A 3TRIA 2CLLB 2KYRA 4QTYA 5LQSA 3ZDAA 2OO5C 2HPZA 1NG1A 3HBLA 2GKOA 3OZTA 5E9WA 2FPUA 2ZUFA 1Z74A 3NLLA 2VT7A 4UM5A 3RJ9A 3I1FA 3SYLA 2IH5A 4K9LA 2EARA 3NU1A 4NCIA 3K4HA 5J4YA 1ECPA 4FCTA 3K70B 1X15A 2NYAA 3P9SA 4YT2A 1ADBA 4S2UA 4V0QA 5DBIA 1FP4A 4UREA 3T9AA 4AJJA 1QH9A 2FMFA 5CLHA 3C8DA 4WOBA 3IB6A 4MUIA 2ANBA 4FI3F 4IINA 4CMGA 2AOVA 2JG3A 2YY6A 1OV4A 1DC7A 5HQJA 2X1HA 4QBGB 1WUJS 3IEUA 4A8PA 5LLDA 1DRJA 4DIBA 4IEEA 3W4JA 3NCHA 2OO5A 2GJAA 1G1MA 3EYAA 3FE2A 2NUAA 4FCCA 1O58A 2P6RA 2V55B 1AKUA 4UTXA 3N0WA 3OE1A 4BP1A 4EAQA 3OF2A 1Y3AA 4OSEA 1TUEA 5D00A 3E4DA 5DWDA 3RS4A 4KN8A 3TPZA 3OFJA 2DQYA 2D0DA 4B5LA 3P2MA 2LKCA 3KLBA 3C6MA 2ZI3A 4ED9A 1PAUA 3A1SA 4YECA 5TQ0A 4HWPA 3FFWA 5BN3B 2C00A 2POCA 3OOEA 4H3VA 2LGJA 1F2VA 4U5XA 4WY2A 4ZEXA 2WU4A 4DA8A 2YWFA 5IJ9B 2Q6TA 1LDYA 1R0BA 3Q98A 1FTSA 2CZGA 3C87A 4TKVA 3N07A 1LVUA 1JFLA 4AIIA 1X70A 5B53A 4MWCA 5CU7A 3OT4A 4TVOA 2PA0A 4RJJA 2X8JA 1ZM2A 2FZ5A 1XC7A 2P75A 5TC4A 2FGJA 3QTLA 4CUJA 3N6RA 1Z5OA 2JNWA 2ZUDA 3GFPA 3TPCA 4KWEA 1R0SA 2HTEA 3BKXA 3EX7C 3CO0S 5FQNA 4BVJA 6AT1A 1MFPA 4OQFA 1KGDA 4CKWA 1Z15A 3WJ1A 3QX3A 1G17A 2D13A 3ISTA 4RVGA 2XDWA 1DG1G 1JIKA 3GGPA 2QGFA 3KZCA 4WOJA 4H7HA 4L6IA 1XGKA 3H7AA 5EYPB 1E7RA 3I5UA 2JA1A 5JO9A 4BNZA 5HYVA 3NHAA 3QSYA 2XCRB 3CG0A 2DFKB 1QZXA 3BGSA 1NVFA 4WZAB 4UU0A 1GKUB 1L5QA 1E8DA 3MTBA 2HKIA 4Y30A 1P0MA 3K5IA 3HXKA 3SSAA 4C03A 2QXTA 3O8OB 2GKGA 3H9CA 4MEAA 3MGAA 4N6NA 3D3EA 4JFAA 2ZIUB 4CUKA 4XGKA 4KQ1A 4DCVA 3LECA 4D4JA 2W4IA 4FWIB 3M3HA 1GAEO 2YUIA 3EFBA 3DQQA 1JAYA 5KYNA 5A3SA 3AR9A 3SPXA 1N2EA 2QRZA 1XEFA 4AJLA 5DTIA 3G88A 1L5RA 1ZG3A 3QFHA 3NO4A 4RIGA 2GBPA 2MR5A 1RWQA 4J0GA 3DL2A 4YDSA 2XMGA 1YQEA 3I3SR 3QNWA 4X7RA 4Y9RA 5FFNA 2C3UA 5JAIA 1AQUA 1GIAA 4DR2B 1Q5PA 5EXSA 2OZEA 5H68A 2QE7A 4II7A 5C5DA 1R9JA 1Z8NA 3L1HA 3Q6MA 2C2HA 4H7JA 1W1IA 2O8FB 1OXVA 2R4UA 2GCPA 4O1HA 2EJUA 2QTHA 5AKGA 3O75A 4XJXA 3TR0A 3FWNA 5KX5F 3UT5A 3A6GA 4LC1A 1SIWA 2FQ1A 2JHFA 3OQOA 2BMJA 1LRLA 3HCFA 4PG8A 5JSQA 3JZMA 3QF4B 2DCMA 3ER9A 1ND5A 1QQ5A 4E21A 1RVDA 5DDIP 4UFPA 5CG2A 3B6EA 1FUYB 2IT1A 3LLVA 4KSCA 2NTEA 5AKEA 5AFSA 3FZEA 4K2HA 4H1HA 4MCHA 4RCZA 3RYCA 3PXEA 4MKXA 1PZHA 2PT9A 5HKBA 2ZJYA 1A27A 5DCUA 3KQKA 4GMGA 1WMFA 3HM2A 1NXOA 1OJ7A 3TLAA 5KNBH 2QVXX 2W6JA 5J58A 3EIOA 3TLEA 5ALLA 2IOFA 4CM9A 1JQ5A 4DSNA 1Z75A 2B8WA 2W93A 4IG4A 3RVDA 5AP9A 4BLOA 2WTUA 2FMKA 1EFDN 1Q84A 1QWSA 2GPAA 4JZKA 1QPGA 3NHJA 4RQTA 3VTFA 2VJQA 3H19A 3AY0A 4NU5A 4I4TF 1QE5A 4YUAA 2QD4A 5T6BA 4EUHA 4Q3BA 2FZCA 3IOCA 3GEBA 4RHXA 3Q8KA 2DM6A 3DBHB 3RSOA 4ZV9A 3RBAA 5CDYA 1L1FA 1CJMA 1QP4A 4C20A 1JIUA 2I67A 3W8RA 3ILVA 1H4SA 2RAVA 3BCHA 5JSZB 2Z57A 2VUUA 2Z9CA 2ZTLA 5E3HA 4HO1X 1JHPA 4ZQFA 1NN5A 1YR8A 3OH8A 4MQUA 1Z34A 1D4OA 2K2QB 4X1YA 4F4UA 1MO2A 2XA9A 1B26A 2H4YA 3LXMA 4FYYA 4OM7A 3MSXA 1ZUWA 2NU9A 3CFYA 3EQ8A 2Z2ZA 3FYCA 4XEUA 1H6DA 5AHKA 1H4VB 2BTOA 3R0JA 5B3LA 2XXJA 1BNCA 2R7KA 4YMGA 1L7EA 4F1JA 1AS3A 5LJIA 4OKIA 2VSYA 2P3QA 2Y1LA 2ZUUA 2AJDA 2QMZA 4M7OA 3AUXA 4YQZA 5A7GA 2MDTA 3N53A 3PC8A 3A2NA 2R48A 1DIOB 1E9EA 1J2UA 1MMFB 3MMXA 2R3SA 1VI2A 3IBYA 4FWBA 4H1VA 4ZREA 1OE0A 2R84A 4B4OA 1JH9A 3F4KA 1WLSA 3V4PB 3BCUA 3OG9A 2QRQA 4OK3A 3ULKA 4B3BA 2KM1A 1WVIA 1E8MA 3MWEB 1SUAA 5ERXA 3LDGA 2CLKB 4Y1RB 3CISA 1UAGA 4ZFNA 2AFHB 4LZAA 1NJ1A 3N2GB 4J7CA 3TSZA 3KPUA 2WFLA 3FWPA 1ZUD1 4K87A 4NPCA 5K3FA 4HQLA 2R6GA 3A37A 4DF3A 4FYPA 2C57A 4AULA 4PZZA 1XQWA 2J7PA 2CBXA 4JHLA 3GYBA 3IFSA 3G82C 3C7CB 3NORA 4O2AB 5JISA 1LXCA 3F4BA 2VC2B 3LL4A 3PC4A 3G68A 4AP5A 3WNCA 2UZ1A 1S7GA 1VMEA 4ZV4A 4AUKA 4W6ZA 4BNLA 2XB2A 1HZZC 4P22A 1E2LA 2A9FA 3GA7A 4YCMA 3LA6A 1D1TA 1XIVA 2FJUA 4MDHA 4UQPA 3AGQA 4LA4A 1HV8A 1A72A 2G1JA 1TGVA 3BXZA 5IFKA 1L5VA 1Q19A 3IHWA 2AV6A 5CA1F 1EEHA 4YI5A 1S1CA 3O5AA 4GGPA 1VBMA 1P6UA 3HMKA 3CRVA 2ZT5A 3CM0A 3H9QA 1BXZA 1TB4A 3LUPA 5HZMA 1RHUA 1ZN8A 3WLKX 1I4EB 2CNWA 4GYJA 1YDEA 3G9TA 3KALA 2PFGA 3DDHA 4JQCA 2DLNA 4YFYA 1PO7A 2AW5A 1ZA1A 2PY6A 4TXHA 5ALEA 5E6RB 2UZ3A 1ABBA 4B6EA 2C61A 3ORYA 4GPAA 2A84A 1XSEA 2Z1NA 3QU5A 3WBKA 4R2MA 1O94D 2RK4A 4MGZR 3G0DA 4D44A 3DE5X 3Q2KA 3QHAA 3FDFA 4RW0A 5IARA 2BBTA 1NOKA 4AKSA 1P61B 1H0RA 4KGVA 1MJNA 2IEIA 1EFRD 4HLUA 4EHHA 2AFIA 3D4IA 2IWRA 4RL4A 3ESDA 3CO5A 1OXXK 1XD2A 3OCZA 3UZUA 4LFCB 2OO3A 4IKPA 1L7PA 3TAHA 4AJIA 4PE5B 1DINA 4NHEA 2W2LD 5KEIA 1ZW1A 1OCEA 1VKHA 3O8BA 1D0VA 4B79A 1GU7A 2R79A 3MTQA 4B48A 4ZCMA 3RYIA 1EWQA 1Z8HA 3KR2A 4ZTUB 1AURA 3UNXA 3HYRA 4QKQA 2GJ4A 2NZ8A 5CLLA 2G67A 4L9WA 2CVZA 4LVCA 1CQIA 3MMSA 1A96A 4MRAA 3WFIA 5JLAA 1SZCA 5C8YA 5CBKA 4BVBA 3DE4X 1ZONA 4TL8A 2P90A 1A50B 3BXOA 5AO9A 1OZHA 2I2CA 1ZR2A 2O05A 3WFZA 5JALA 4FEEA 1D6MA 4KG7A 4HGYA 2ZCUA 4ENSA 4Z4HA 2C5SA 1D1PA 3UHOA 1GCIA 3J80A 4ARVA 4KYVA 3Q8LA 1ZRMA 2BGUA 3FUTA 1I9CA 3NTLA 3U56A 2Z95A 3WMGA 2J9GA 4QWMA 3PBKA 5J4KA 1JTFA 2EG9A 3FCUB 3LBNA 1QX3A 1U0RA 4HMOA 3I9OA 1KZHA 3PNVA 2NU7B 3H8VA 4DRZA 2CLCX 4Q15A 2QTNA 1A71A 4HZIA 3TJMA 4N49A 2JHGA 2OBBA 4F6CA 4OB7A 1VJDA 4HSGA 3RG2A 3HBAA 5TQJA 2PUTA 1GXSB 4IILA 1DC3A 5HGXA 3IL2A 4RM2A 1U2GC 1M6VB 1Q0SA 4LYDA 4N3CA 3Q5DA 4JU9A 1T3LA 4X8OA 1NJ6A 2JFWA 5FIUA 1LBQA 821PA 2BMEA 1ODKA 3PGVA 3O8DA 3WLOA 2XA1A 1QRUA 3L7MA 4PONA 2QQFA 3KJIA 4I14A 5CYFA 5LQCA 2FFHA 4UUOA 5E2AA 3GLGE 1VJ5A 1NNLA 4BV9A 2AKYA 2H9IA 1EM6A 5F1OA 4XI9A 3B52X 4RTRA 1A2BA 2ZWOA 4RE5A 3KPJA 3THXB 4QOJA 1B16A 4M36A 7MDHA 1CD5A 2ZRKA 1QP7A 3BFPA 4JYAB 1MD9A 3TXXA 2W7TA 3IHTA 1KA9H 2H2IA 1UM9A 1S2OA 2H1WA 1E2UA 3IAEA 3MOSA 4GM1A 4QNNA 5IJXA 4BLTA 4B3JA 4L3OA 4DQUA 1AS0A 2C58A 3ZHRA 4XGRA 3QJGA 3L8YA 3NMUF 1W6RA 1FL9A 4E3WA 4YY3B 1I30A 4HPXB 3OEEA 4F12A 1KC3A 1GQ2A 3Q8MA 2Y93A 3IT2A 3RHTA 1T5OA 3IQGX 3GVIA 2ZUBA 4M9UA 5FJIA 1M7BA 2UXBB 1KAEA 1WD7A 3JASA 3KD3A 1JHZA 4KMSA 5A7HA 3VC3A 4GVPA 4C4TA 2PO5A 5L95A 2ODEA 1M5TA 5JIBA 1MP0A 5K8TA 1TVKA 1XHLA 2VTEA 3B6ZA 4GMKA 4OOEA 2IU0A 3EDCA 4ALNA 5IABA 4GE3A 4Y9DA 4CCAA 4M1YA 1Q44A 2YRXA 1FTNA 2VK4A 1IHDA 3HDVA 4J0CA 4R3UC 2A5LA 2W6QA 3PQDA 4TL7A 4Z2YA 3SN6A 3VJRA 1RXVA 1M34B 3LVQE 4JC4A 4P3YA 1DPGA 3IUBA 4BKQA 3SOZA 5KOJB 4ER0A 1NXQA 1H2RS 3OKFA 3OX4A 4LJ6A 1TM3E 1DOAA 3VM6A 2Y76A 2Y68A 3IDFA 5IDWA 2VQDA 4ZEVA 2WUVA 3LUHA 4K6CA 4X92A 4BP9A 5K01A 1ZC3A 3PRJA 2IY9A 5JQGA 3HB0A 2E4AA 4D4IA 4F4IA 4RMJA 4P82A 2IW3A 5JC1A 4O3MA 2TMDA 2VYND 3BMCB 2ZE5A 1GL3A 1HLFA 2DU8A 3QQ5A 4NS4A 4A2CA 3S2UA 3U4QA 3AUKA 1C7FA 1UP7A 1ZD2P 2DY1A 3NUGA 4E4YA 2W83A 2YZKA 2ZW9A 2OHOA 1ZM7A 3O74A 5K6RA 4CGZA 221PA 1D09A 4J7AA 2F43A 3ZV4A 2OECA 3K2BA 4WCFA 2IBTA 2FYTA 3WGQA 5F23A 4S04A 1WUKS 3GB9A 2B36A 2AQIA 1H0HA 4MV1A 2QTFA 4NQZA 2VTBB 4RANA 3BWBA 3OLQA 4PYKA 1EG2A 1NN1A 3MIZA 1E1LA 4IH9A 4LOHA 2GBLC 2GJ8A 2IYOA 1ZCAA 2F3QA 2J67A 2JLSA 2IH2A 1W0CA 2YV4A 4ADSG 1GPYA 4JSYA 1LPSA 2AYZA 3FWZA 4EF4A 1SG9A 2IK8A 4KQXA 3EFEA 4B44A 2WIKA 3Q2OA 4UATA 3SU8A 1ZISA 2AI1A 2BV3A 2FRVA 3NC4A 3ZHXA 1ULAA 4YJ3B 3HLTA 1YVUA 1UEIA 4BEJA 3LHIA 4QPDA 5KYWA 2X5NA 5FQOA 2DC1A 4G23A 1J9GA 3BXEA 3P0RA 3TLMA 1P9NA 3PPVA 4YONB 3D2CA 3W77A 3D0RA 1Q6YA 4G41A 4L74A 4ONEA 1ZRHA 2EATA 2W6CX 5JAOA 3B8EA 3AP1A 4RDHA 2DF8A 2WLSA 4J9VA 3TB4A 1POXA 2NNLD 2B3TA 4RIHA 3BMQB 4X7MA 3RS7A 3G5AA 3UMGA 3K70C 1PT8A 1EXWA 2ZAYA 1SO8A 3LBIA 4HPWA 4QYSA 1Z3CA 4DCJA 2ZJ0A 4K6GA 3H2BA 3UAWA 3KFXA 1HYHA 4LRWA 3GCXA 5DNCA 2GS9A 3E7XA 4RKYA 3NX4A 4M9RA 1RWOA 1YHNA 2JHCA 4FYIA 1FFYA 2V7QA 3PEVA 1TZKA 2LTAA 2QMQA 1NXVA 1X1QA 4KU4A 1R5JA 1Y1RA 2YFYA 5C9ZA 1EIZA 3Q7QA 4U39A 2PX3A 2YFQA 3FSGA 3PG5A 4I81A 4LHYA 3R7DA 1BGVA 1YR7A 1EFTA 4Q1BA 2C2YA 3CH6A 2B4KA 1CPYA 4IJ6A 2VP6A 5CM2Z 3MINB 4MX8A 4I1UA 4KUHA 3G7UA 2GASA 3R5XA 4HLQB 3QKRB 4BYGA 3VI4B 1ZH4A 3BX1A 1S5PA 2IIQA 2QNRA 2IEYA 4DR1B 1GNVA 3CUUA 2HLNA 3I5XA 3BUSA 4RFLA 1IVSA 4KPEC 4ZTZB 2ZWPA 3DKPA 4EPYA 3WC4A 2JC3A 5A0TA 3SG0A 1FU8A 1AHIA 1N2ZA 2VNSA 3ORSA 4N1AA 1IY1A 1OZGA 2BGJA 3F6RA 5FBQB 3WLNA 5ILGA 2PUEA 1I10A 1U2DC 5E3JA 3JWGA 2DPGA 5C31A 3W78A 1W29A 2IOQA 2XCUA 2HA2A 3FPEA 1I33A 5J2UB 5ES3A 3ADDA 3B1ZA 3LYAA 1YBFA 5LQJA 5IJ9A 3F73A 4X63A 3EHEA 2C8KA 1W4RA 2OZPA 1O9GA 1QG0A 3MQFA 1PR4A 1TU3A 2MTBA 4HYTA 1WXGA 3ZV7A 3WL6A 4ZYUA 5I7EA 3DM5A 4M0UA 3J7AC 3OEWA 3WRXA 5JCZA 1VLVA 4L1KA 2D06A 4OHKA 3DB1A 4Q1EA 3FY4A 4Q1FA 1N6OA 3AVQA 3ZPXA 1RXSA 5IUKC 2J0QA 4I4IA 2OT3B 4E88A 5IC6A 1U2DA 1V9CA 1K89A 1V47A 4FOLA 1O9BA 1FQWA 3TE7A 1P0IA 5EQTA 3OPXA 1NUPA 2BFDB 2YOFA 5EYPA 3SHQA 3V48A 4DFDA 2VHWA 4R8SA 3IOBA 1N0WA 1U2SA 4PQFA 2VQ6A 4DLXA 4D02A 1XDDA 2ZREA 1VFPA 3M6AA 3RCBA 4UCWA 4L78A 3V1LA 5K8LA 5LXTB 1AKRA 4WZAA 3TLCA 4UNQA 5KYYB 1VC2A 4YDHB 3ZK8A 5IXJA 2ZB4A 1DEKA 1SKQA 1V7ZA 3DKKA 3EJ6A 3OKCA 1CZKA 2ZBEA 4W9NC 5LKAA 4CEIA 1KMMA 2QJRA 1Z4QA 4RPGA 1BDHA 2FOXA 5DHFA 4EATA 3IUJA 5DZSA 3NXKA 2ZIXB 1SVLA 1N8TA 4QYMA 1E4VA 5J5AA 3TUIC 1XCGB 1Z0AA 1XPJA 4JC5A 1XTVA 4OD0A 3E3MA 3PRYA 4OQEA 3WLAA 4CM6A 1QFXA 4FN5A 3RKRA 5KNDA 3ZE6A 3COJA 1EM8B 4YCBA 1A8UA 1F0PA 3PUZA 1HG1A 3AF2A 4G5SA 3O3CA 4EVRA 2O8FA 3NQ41 1N2BA 3F8WA 3OLZA 2YMLA 1TAQA 1R0KA 4ISCA 2PZBA 4NPAA 2WTBA 1LDBA 4ZHQB 3O9MA 4I1PA 3NNDA 4ZKEA 3ROQA 1T0HB 1L0BA 3SSOA 2BBSA 4Q01A 1DKQA 2X7HA 2ISCA 2QK4A 1IB0A 1KI7A 1RLUA 3LK6A 3QF4A 1DQZA 1X7ZB 2WOJA 5G41A 5L40A 4CLRA 1SK9A 2RGEA 1EU1A 3ADKA 4L57A 1XQ9A 4IV8A 4EHBA 2XXBA 4F46A 1CEXA 3WZMA 2O3UA 2W00A 4TYWA 4TT3D 4FZVA 2QSJA 2IHTA 4AKEA 4YTEA 4GSKA 4RVUA 4HRYA 2XVAA 3L8CA 2P6PA 2QKYA 3SKXA 3CXRA 3GEGA 3NTRA 4AO7A 3UOWA 1MW9X 2ZAOA 4C05A 4BWGA 3RREA 1UKAA 1TIKA 3RVQA 4WERA 1CEQA 3C41J 3NVKI 1E1YA 2Q3EA 4M1TA 4BYMA 4IGEA 3FH0A 2ZYDA 5HQTA 3QKIA 2CEAA 3JQ7B 4NBVA 4Q3LA 2P69A 3MT0A 4UNNA 3RU3A 3PHBE 1L8AA 3I61A 4GRDA 3ZIAD 2WWXA 4DDUA 3PUHA 3A9VA 1L3CA 2X0RA 1AOXA 1PJAA 1DL5A 3GFVA 1QWOA 3IR6A 5M3BA 5BSWA 1U0OC 1V5GA 2X77A 4MOWA 4I8IA 2BFPA 2OZLB 4NU8X 2NW6A 3LPDA 2OL4A 5JRJA 1EX6A 4OXKA 3KFVA 1VL0A 3FVRA 1OASA 5JSZA 4UASA 3FLBA 5ALXA 2GGSA 4O1IA 4MYUA 1XZDA 1VCIA 2XGGA 4ZCRA 1SCAA 2V98A 3T52A 1F4PA 1YR9A 3T5AA 4S1PA 3AVXA 4H3KB 4BPRA 2M1ZA 4RK5A 2G17A 1KMQA 2ZDGA 1WV0A 3GJ3A 4PAWA 3K30A 4MCAA 3SY8A 4EMSA 1A9QA 2G8LA 3B12A 3N2YA 1MOZA 3F5FA 5AVZA 1G38A 2E49A 1DP4A 2GDZA 3V2IA 3SXJA 3Q15C 4MRNA 1QIHA 3R8FA 4HNRA 3D7MA 1G2QA 1DSSG 2QX6A 2P67A 2OGZA 3CIOA 4Q3EA 4G5YA 4HVTA 4D0SA 3OTQA 4QICA 3EQ7A 5F2EA 1YXMA 3STWA 5BO5A 2MMGA 1HDIA 2YHIA 4QXOA 5I47A 3T0IA 4WVFA 5KOIA 4U0JA 1UPUA 3SKYA 1VLZA 5LP6C 4HH4A 4M22A 1RFLA 1XTTA 2OLEA 2VP4A 3F5MA 3JWIA 1X13A 3MWEA 2Q3MA 3EW9A 1BE8A 2NUPB 3KJFA 2RI0A 3PQ8A 4HVLA 1V0JA 3R1IA 1FQKA 2ZYHA 3Q9NA 2AFHA 2X1VA 3GC6A 3IBGA 1R8XA 3N2GA 4ICIA 3DTVB 4XYGA 1GU1A 5C7LO 1JR6A 4RJTA 2YRWA 5IDVA 3ROTA 1NLYA 1PGJA 5JY1A 4QFBA 1MHPA 2HA5A 3HRKA 4NTZA 2IYVA 1RXYA 4O2AA 4P32A 4RLFA 4ZZ2A 3TLYA 3W6ZA 4Q4CA 3NZEA 3E4CA 1V5EA 3P71T 1CR1A 1JIVA 2AZMA 5HFNA 1RYZA 4E1AA 4HMQA 1V8OA 4Q7JB 2CUNA 3R4VA 4UD6A 5JXJA 1JXMA 4YP6A 2VJYA 4OOFA 1HQCA 1KXJA 1EHIA 1ZVMA 2XCLA 1CUUA 1IEQA 2X9QA 4PLYA 4TV9F 4X54A 2B7LA 3V8EA 2VZ0A 1ZP6A 4RF4A 4EYSA 5CXUA 2G25A 4F9GA 1C29B 2C5BA 1QLHA 1QSGA 3Q7PA 3QIVA 5KSOA 5JH7F 1EDOA 2I91A 1D5WA 2J4CA 3HB1A 1GNTA 1JSRA 3SHWA 6CHYA 2YN2A 4M0LA 2VF4X 3M8KA 1KTVA 3UHAA 1UKZA 4RV5A 3I42A 4K9PA 1WLYA 3ZE8A 1IWOA 3QMWA 5EHIA 1SKAA 2R5WA 2X9GA 3W2FA 5A6SA 3O7MA 5E6RA 4AMYA 3KKKA 5CAEB 1B6SA 3JYLA 1FDOA 3N2ZB 3TBKA 2VR1A 3M2PA 4RTMA 3H8WA 1ENYA 1C5KA 2BKEA 2PR2A 4G4IA 2F90A 2RB4A 1A88A 2F67A 4ZU3A 4WPGA 2UYGA 2H3EA 2P35A 2WWHA 3G0CA 3OHPA 3SZ3A 5IYZB 4DR3B 1R6TA 2Q9CA 4FQ7A 1AS2A 1YS2X 2NXCA 2NYVA 2QTGA 1US8B 5FNVF 4CF6A 2CXUA 2PLRA 3USCS 1P81A 3CH7A 4DA9A 5ARCA 1S3SA 5LUBA 3TIFA 2HGSA 1MX3A 2VHTA 2I0FA 5HM6A 2VAPA 3GJ5A 4KX5A 2AZXA 2WQ6A 2J5RA 2F9MA 2LPMA 3EG5A 5CJ2A 1WMDA 2YC4C 4ZOEA 5SY4A 4OI1A 1F2UB 1KPGA 1TF7A 3EIFA 1XHFA 3G9ZA 3O1LA 5CJPA 4GLLA 5IZ4A 1CT9A 5DN6D 3OF3A 3NALA 2ONCA 1XJCA 3ORRA 4WCDA 4LF9B 1K92A 1K8ZB 2YZNA 4WNAB 2NP7A 5JQWA 3WLLA 3PXGA 1USWA 1SU8A 4W9RA 4UDYX 4N8DA 1Y3BE 4M1QA 3OFND 2VAMA 2I8LA 4JI0B 3O3NB 4RKEA 2GERA 5E4JA 4J1TA 1UMKA 2I3AA 4PSVA 2HJSA 4Z3KA 5EA2A 4HT3B 3HWSA 1TM4E 2ZWMA 1UC5B 3OCYA 1FNBA 4D8UA 3AFOA 3WLQA 5AK6A 2NU7A 4PO9A 4K0KB 2ZJ3A 5AVQA 1M0SA 3BKWA 4PGAA 3OWOA 4RVNA 3KFLA 3H1FA 1V1MB 1CUEA 1TCUA 1EP2B 2D1YA 2ZIAA 4IGFA 2MR6A 1GXSA 1O95D 4V03A 1M6VA 1ZKDA 1R50A 2G9ZA 2QUJA 3PGLA 4I9FA 1FNNA 1I2AA 2QZPA 4TTAA 4ARSA 1M75A 1MV8A 2C77A 1KZ7B 5IAOA 2IX3A 4KRFA 5B1YA 4FB4A 2HLPA 3H5LA 1X38A 4BNJA 2DUWA 5T57A 3IAS1 1J7JA 4HNVA 4I08A 2EQ5A 1NGSA 5CXQA 3ICQB 3UB2A 2IPNA 3A6JA 5DEIA 4D80A 4ABTA 3NGLA 4BQOA 2H2AA 5KTOA 3ZJUA 1P4SA 3NCTA 1CYEA 4JBIA 2VDWB 3EZGA 4NXNB 4FFRA 3AV3A 3HXLA 4UTNA 2GN4A 3MXTA 5C8DA 4ZZ1A 1RRVA 2EW2A 3U7GA 1PJZA 2O1EA 4INAA 3IRVA 3L7CA 5BXQC 5BWCA 4I3GA 1P19A 5JMWA 3G79A 3DE3X 4QBTA 4QYWA 5AI9A 1E0KA 3NHSA 1CUIA 4V0MA 1EE2A 2K87A 3C3DA 4WQMA 4EHKA 5F21A 4C7OB 2RAFA 1XL0A 3B2EA 4RHTA 2ZM6B 2ZRAA 1EFLA 4FT2A 3DE1X 1H23A 1KQPA 2YVQA 3VPFA 1HBJA 3S7ZA 4HEA1 5A4AA 4EZIA 5LMCA 5AK5A 4M83A 4GR9A 4UUNA 4D5GA 2ZZKA 3CUSA 2DT5A 1GGVA 2GD2A 1ZOOA 1XZHA 4KFSA 5FTJA 4KPYA 1SM4A 1R66A 1BX0A 3II6X 3VAAA 1XROA 3PENA 4OJNA 3P2OA 4OQPA 1RPTA 3CR7A 3FKSA 3RK4A 1EUZA 5MDHA 2OC4A 1M34A 1VHTA 5CDGA 4YAWA 4EECA 2PFSA 3NH9A 2HJHA 1NBMA 2YWRA 3H1PA 3ICWA 5FUQA 1YL6A 1NDUA 2HO4A 1PEAA 4PNPA 1G63A 1GZSA 2A1UB 2NO6A 2J9ZB 1KI6A 3FWYA 4WZBB 1DE0A 1V5IA 3OUTA 5DU2A 2C04A 2JFFA 3HUTA 5K05A 3U5TA 1RYHA 3ASYA 3FN4A 5F98A 2PUCA 1SUEA 2FWMX 4H77A 2JLBA 5BPHA 1BQEA 1XWWA 4JL6A 4K1XA 2VHXA 1GDHA 1C1DB 3T7SA 4E7OA 4IS2A 3DW1X 1IBKB 4QPJC 1YR2A 5BYJA 2J8ZA 2VK2A 2VO1A 2X3UA 4AG3A 4R1PA 3T3HA 1T5IA 1YIAA 3AESB 4FYWA 2VTBA 3ZXXA 5DGXA 2BEJA 4BQRA 4WBNB 2F4NA 1Y4SA 4BNWA 5FO1A 3EVCA 4MUJA 4GPEA 3U7QB 1TL7C 1ZM3A 3RFCA 4C1BA 5HQ3B 1W94A 3EZFA 3I45A 4NRDA 2Q9UA 1Y4UA 2O20A 3GGDA 2IDKA 3KOXA 4P84A 2CMHA 3C3XA 4LQLA 3YASA 1NKVA 3VAZA 4GM0A 4D3FA 1Q77A 3G2IA 4JU8A 3HQ4O 4N7RA 3AQ4A 3K94A 1Z0SA 4A8HA 4DQXA 4BHTA 2EC5A 3CX7A 3G23A 3X1WA 4M0DA 4QEKA 1E7YA 1M72A 5EZYF 3PT9A 3ZI4A 2FF5A 3IVAA 1R4AA 3QFCA 5BSEA 1IVYA 3PNQA 4OK6A 3BMQA 3IO3A 3D6NB 1JLLA 3BPSA 4B2LA 1RQGA 4Q82A 2HUNA 4KPGA 2GPWA 4DY6A 3ED5A 1KEPA 2WMYA 4A0FA 2JB9A 1IUPA 2GA8A 3K0CC 4C88A 4GXNA 2MYTA 3T7RA 3URMA 2PTHA 3RNLA 1P0CA 3CT4A 3EXFB 3FD8A 1P7VA 3NBFA 4LFAB 3DTYA 1Q17A 4G6ZA 3A4LA 3PI7A 1D2HA 5J2TF 2XRZA 5EKDA 4Q00A 4KH0A 2BMWA 5BSFA 1FQOA 1MC4A 1JKFA 1NOIA 2BY4A 2ZSHA 3AEXA 1JL3A 2DQ4A 4KVFA 4CMBA 1NYQA 1WDWB 4MYSA 1LNZA 4ZVVA 2QRPA 4PZDA 1MH1A 5E7MA 4QREA 2MYNA 3OU6A 4HYQA 2HLDA 1DBVO 1KVRA 1H66A 1OVGA 4EJMA 4UTPA 4X85A 4P4TA 2YBEA 2H57A 1HFJA 4DLRA 1YF3A 1A8HA 1G1AA 3HEBA 3UH1A 4AO8A 4UVHA 3GY0A 2RHRA 3MINA 1M2JA 4B83A 5FRDA 3W2HA 1CUYA 3QKRA 4GLJA 1JXQA 2OBLA 4HHEA 4FYJA 4XFDA 4XX0B 3F4LA 4TKLA 2BI8A 5G53C 2VHZA 3WICA 5H9WA 4PC2A 1G5IA 1XRRA 1ZFNA 1ZK3A 1P74A 3PVSA 1QHXA 4YHHB 4NNOA 2Q1SA 2WSMA 1NMXA 1Z2PX 3Q7SA 3JZIA 3GEHA 3C3CA 3H5OA 4O3FA 3T61A 1JYSA 2E4XA 3WRWA 2H4HA 2IYWA 3H4VA 2RHDA 1ZMOA 1VJ1A 3HP1A 4HAVA 4RVHA 5CVDA 4LZPA 3RHSA 5I4KA 2J1LA 2AGVA 1W48A 2ISSD 4K3VA 3EAQA 4D97A 1ESDA 1I2ZA 3NHBA 2Q4EA 3F8TA 1J8QA 1Y4DE 4I3FA 3CTPA 4M8KA 4CF3A 1U8CB 4EJFA 3H65A 5CHYA 1FYWA 3DL4A 4KYIB 5IMBA 2R7NA 3EPLA 3HGMA 4F60A 1CR0A 4W82A 1ETHA 4DHWA 3FRHA 4EEZA 1GL7A 1IOVA 1U9IA 5I4CA 3L92A 3CG4A 3QG5A 2J3IA 2KSQA 4UM9B 3C4JA 1A5AB 4B4UA 4L95C 4OAOA 4U6SA 2VSNA 3FYDA 5FWNA 1XAIA 2D8AA 4O2LA 1THZA 3ZG6A 4E4TA 5LXTA 1A69A 4BU0A 3T4XA 5C34B 4C7XA 2PRKA 4IO1A 5KYYA 5K09A 5GV8A 4FMPA 4C89A 1E3EA 3RVMA 3PQ5A 5DWVA 5FBHA 4N5IX 2RGUA 4Q6WA 1C81A 1MNQA 5DI9A 1V1RB 3EN0A 1T9HA 4FDMA 3IKLA 3LXUX 3RVSA 2JEOA 2EJTA 2ZIXA 1U99A 4RHEA 2QN1A 3BMOB 1RQLA 3LCRA 2ENWA 1Y4ZA 3I01A 3QSGA 4CEHB 1XEWY 4YACA 3SM3A 10MHA 1RXCA 1CIVA 1EM8A 3SJZA 3GCZA 1RBYA 2GAJA 4XDHA 2GM5A 2H1IA 3H99A 3PJGA 4HMPA 2MWMA 4MMXB 5ANRB 4JI7B 1Z7WA 2OGWA 1YRLA 2J3MA 3FNBA 1B4DA 2J09A 3DCNA 1U98A 2VHCA 1L4HA 1G0OA 3MM4A 4Q05A 2BGMA 5EMLA 2PEZA 4DAOA 4ZHQA 2ZTMA 2VKQA 2QP9X 4YAOA 2CVHA 3I58A 2H06A 5BWOA 1X7ZA 3C5EA 4XB2A 4PX2A 4G0WA 4LYGA 2XSZD 3ZXIA 4BO3A 1KRXA 4RLQA 4Y18A 4MWOA 3PD7A 2Q3LA 3KHTA 4N82A 5JATA 3USES 4Y2RA 4BEBA 2GPJA 3IOYA 4BVEA 4B6PA 3LY7A 4Q34A 4E4RA 1EP3B 1RZVA 1QHIA 3S2SA 3WGTA 4G0UA 4HCJA 2ZXUA 3NDBB 3THRA 3UFBA 2WSLA 3DYVA 2VH1A 2W43A 1T26A 2GJ9A 2Q0HA 1QIEA 4UE2A 5FPYA 3EEIA 3RHZA 2ACVA 4BQSA 4P08A 1HFKA 3O9ZA 5F51A 3LUBA 3L7DA 3SS9X 4HPJB 3BCSA 121PA 1N57A 4Y1FA 3I09A 3C1UA 3JQ7A 4G9BA 2CUKA 4GU5A 5K6AC 1PGQA 1ADJA 1WZEA 4X95A 2Y27A 3QE3A 5H02A 2A6PA 4KFTA 4ALKA 2V6JA 1QFYA 3H4MA 4PYQA 3CVXA 4IXDA 3HA7A 4RXTA 3OOHA 4F3NA 2PD4A 4J3NA 3MB5A 1YRWA 2OZLA 2P1RA 4X41A 1UPFA 1Y4AE 3CZ9A 2W2QA 1DJQA 3DYBA 3KNZA 4C4RA 4EMBA 5GJVC 3TI9A 1XWIA 1EBUA 1GUYA 2A9KA 3JD4A 1GVHA 5BRNA 5TSDA 2DR2A 2NQTA 3KKMA 5AJTA 1P4JA 1DMSA 1SC9A 3BE8A 1WSDA 3IYLW 2HC9A 3T1HB 3H2SA 1PR9A 4S0XA 1NN3A 1IFXA 3PXAA 1Z37A 1BS2A 4FDTA 4QQKA 1R8YA 2E1PA 4FR2A 2A67A 2G28A 1JEOA 3FPAA 2FPGB 3NV9A 3IKTA 4G2NA 2V59A 1NUQA 2VNIA 4LN1A 3V9AA 2O1SA 3CLTD 3F3SA 1XDZA 3G2PA 1QK3A 3JWJA 2YZ2A 3KJEA 3NC1C 4RPLA 5DASA 1GPLA 3D4NA 3EEFA 3DVRX 3ZI7A 2PJDA 2XD4A 1YBVA 3BAZA 3QXXA 4B82A 1CULC 1EINA 4WY5A 3KT8A 4AY6A 1MO6A 2RGBA 1DTEA 2Q4DA 5A7FA 5JWOA 3W8EA 4B35A 4M1KA 4L5BA 1I01A 3EVNA 4MUXA 3LF2A 1NATA 3N6VA 4UAVA 3SBEA 4JYMA 1HE1C 1HOXA 1UT6A 4KVZA 4QBIA 2Y1FA 4XDYA 3WIEA 4ZDKA 2XNKA 3BMNB 3GDWA 1Y9AA 2FWNA 5DBEX 2BE7A 1Y33E 2VDOB 3BICA 1MAAA 3DDZX 3FYUB 1E5DA 3DTVA 4RA9B 3R9XB 3WGVA 2OMEA 3MJHA 3S44A 4YMHA 3ND8A 1BU5A 3HRIA 2OG2A 1ZSYA 2W11A 4KZKA 4RS4A 5CR9A 4JJ8A 4AZVA 4HQKA 4F5WA 3ESYA 5LIPA 1MEEA 2ZRBA 3CH5A 1TPZA 2FFBA 3VSCA 4GEGA 4J4HA 2H11A 2QD2A 2XLBA 4QUIA 8AT1A 3QOWA 3V6LA 3HDHA 2DH5A 4HDRB 3A28A 2E5LB 5BV1A 4M46A 4OHBA 4YT8A 4PZPA 3SBXA 1FMJA 1QGAA 5CVCA 2D2FA 1GN9A 1QTRA 1SELA 2DKOA 3JRXA 2WRZA 4H6VA 4YRRA 2RD2A 2W2MA 3EDYA 4LYFA 1GPH1 2G04A 3QUBA 4DV2B 1WKCA 2XQIA 4MRRA 4K05A 4XJSA 5DP1A 4ZD6A 2OAP1 1E20A 4BGIA 4UEOA 2JBAB 3GBVA 2X0NA 3AVVA 1QZ3A 4G63A 3MC1A 2PAAA 2X7JA 3ICCA 4GZ6A 2I80A 3GJXC 4P3XA 5TS3A 4CQLB 1HMYA 2H0QA 2ZU0C 4IIEA 2MIIA 4B3DA 3UVEA 3G02A 3VO2A 1V4NA 1Y63A 4Y2TA 1F60A 5KU7A 1W1UA 5DI3B 3ETJA 3NT5A 1W0JD 5CAEA 3HJTA 1U0TA 2DE0X 2VNHA 2VZEA 3EZ2A 4TTQA 1ECJA 2D2EA 3IVGA 4BLUA 2VRCA 1D6SA 4JS0A 3LPMA 5IYZA 4Y6PA 1Z25A 3LBAA 4KODA 4NX2A 1ZOSA 2FEXA 3KXIA 3L2OB 5LZ5A 4QPZA 3K1TA 1A4UA 1RRFA 1US8A 2XDAA 3LVRE 1OREA 4H60A 3CZ4A 3GEMA 4E30A 5CDUA 3PEWA 4LHWA 3DLIA 4R0NA 3NBAA 4QAJA 3AFIA 2OCXA 1KAOA 3W90A 4INZA 4CT0A 1UOPA 2FW0A 2OHIA 1IOZA 4PSCA 5EP2A 3RANA 1C8VB 3EVZA 3KB1A 3PUIA 3SE0A 2C0QA 3EW7A 3K0AB 3K35A 2QZ9A 2QLNA 3TQRA 1MIOB 3KOYA 5DHPA 2WZBA 1F2UA 3DMRA 4A36A 1F4LA 3N2KB 3W7BA 1CHNA 1ZVQA 2OORC 4XM0A 5IH7A 2PS9A 1I5RA 2WAYA 1XR3A 5D51S 3UMMA 4LC0A 4L4SA 2A5YB 4HKTA 1IDN1 2QT1A 4C07A 1HYQA 1D1QA 1V26A 1L7MA 3ES9A 1KDVA 1TA9A 1LCIA 3QUQA 3B20A 4UU8A 4ZVQA 1SCDA 2BKAA 1I7SB 3G1UA 3DT6A 5HJ2A 2YYZA 3CUWA 1N2SA 3BD8A 3F78A 3FTQA 4HNAA 3TRDA 2YMQA 2JLXA 5H70A 1R0LA 3QYFA 4OQQA 4P2GA 2OBFA 3MQ2A 3GVHA 3HG7A 1URPA 4MA0A 4YJGB 5DGDA 1DMRA 4V1CB 4TWBA 2BGTA 1BA2A 1CIJA 1XQXA 1ZIXA 3J7TA 4BX0A 4DN6A 4CL2A 2QYOA 1FNSA 3KBOA 4GBED 4AJPA 4Z4IA 1ANKA 1Q7RA 3LO8A 1F9AA 3EASA 3IRUA 1P31A 4G0QA 4LRYA 4DANA 3ELDA 4NR0A 5BORA 4E08A 1RMQA 1L6RA 4ZALA 5I7RA 5LBUA 5EUQB 1G66A 1XBTA 1RKVA 4V3BA 4EX7A 4HF7A 3RRBA 1R0YA 2EW8A 2ZJ7A 3ROXA 4WIAA 1RWBA 1UC9A 1ZESA 2EZ8A 4L0QA 2P4UA 2P9YA 5C8YF 3P26A 3MJDA 1EUQA 1OLXB 1W36D 3I12A 1OUMA 3HU3A 1BJRE 4F86A 3LY5A 3AILA 4DDVA 3TG8A 2VIIA 5ALRA 4TXLA 3EPRA 3EGIA 5B3KA 2WVJA 4CEJB 5JXIA 1F8UA 4JUFA 3COVA 2R6DA 4J0DA 3BWVA 4ZAGA 3RSFA 2FDCA 3SLKA 3CVJA 1DDGA 4KOEC 4F8JA 3L6CA 2VDWA 4OH7A 4HNSA 3MUFA 3VNQA 3EH1A 5BSVA 1C0KA 4QFDA 3IAXA 3NATA 2OM6A 2ZSEA 3EBPA 1GKIA 3UGKA 2ATCA 2C1ZA 4DVJA 4BGEA 2ESRA 1S4QA 2O3SA 4H7EA 4XYEA 3ECAA 3MWLA 3NRCA 3C45A 3WY9A 1EXDA 4AAYA 1BOOA 3VTKA 1V6SA 2ZYUX 3JARB 2XDQB 1DRKA 3DULA 4GXRA 3WFJA 4KYTA 4C7OA 4I4LA 3M83A 5KNCA 3WL7A 5SYAA 2OM2A 1MOPA 2ZGVA 3LKBA 3NBMA 4Z99A 1OZAA 2F9FA 3Q0TA 1RWNA 1CV2A 5JJIA 4MWBA 1IPFA 3A26A 1OU0A 4KO2S 4WFKA 1U80A 5BNIA 2WI8A 3UCEA 3EFOB 4Z3OA 2GNAA 5JSFA 2C5HA 3H9BA 3QTTA 3FDJA 4OX9B 4ZRNA 4OHXA 4PLTA 5K8IA 1TM1E 1K4MA 3RRJA 3WGLA 2XYHA 3QEJA 2Y1CA 1QPBA 2JGNA 1ZGAA 1N0HA 2GYYA 2X5OA 1RWWA 2W2TA 2JIRA 4IZOA 5CNKA 1E2FA 2BHLA 3NP7A 4MYHA 2JAWA 3W5UA 1SKBA 2C31A 3UBMA 3U39A 4TYNA 3QIAA 4MV9A 3PPIA 1BW9A 4H2DA 3K5HA 1UZAA 1Z0KA 2X86A 4UZEA 4MHTA 1GR0A 1NWCA 1E6MA 2A1UA 2VL7A 3BRWA 4LJ5A 4DY4A 4JI1B 1GDTA 5ALDA 1DUIA 4AL4A 4AMVA 4TWZA 2GVZC 4CV2A 1B8VA 1BC5A 5DM2A 1NW9B 1A04A 3JQDA 3P0JA 5EJAA 5FBZA 2WJYA 1JJBA 2GAAA 1VHQA 2HDHA 3DBRB 3M6IA 1PT9A 3U31A 2ECFA 1SHKA 4H59A 2PX8A 5IT0A 1Z26A 2R8ZA 2ZWIA 1E6UA 1QQBA 4RGQA 1C1DA 3CF4A 2O1WA 4YPOA 2REQA 3X43A 1QTQA 5HTKA 2EEPA 4MV7A 2BMDA 4CV0A 2ES4A 5IVPA 1RD4A 1CVLA 3GMSA 3AESA 1VB3A 5SYMA 4Z6KA 3LLUA 3HN7A 4YVFA 2RHMA 3N86A 1P6XA 4MUMA 1XEWX 4QJ5A 5IJWA 1JPNA 4V0RA 1ZBQA 2OPHA 5FBWB 3NDIA 1KAHA 4LY0A 3HYNA 1RHMA 2CHEA 3GGCA 3RHFA 2Q5CA 3LC2O 3NPAA 4Q16A 1A95A 5G0TA 4BRZA 3CSUA 3PDHA 3SNKA 1MZPA 4EY3A 5C52B 4IUCS 1U7UA 2FRDC 1N6LA 1YAHA 2NACA 3L0YA 3UUGA 1C4WA 2RK6A 3B1JA 3DR5A 3JQCA 2H51A 3WIVA 5JQGF 1A98A 3ET5A 4KIUA 1NPYA 1QFZA 4N47A 1X1SA 5JI3E 1G21E 1LBHA 4N6GA 1XXHA 4UAJA 4BWVA 1SU4A 1R9MA 1VJGA 1XRSB 1CW2B 4A8TA 1I6MA 2PLNA 1DFGA 5KNCH 4Q1DA 1OWOA 2PSSA 1K0FA 2RCYA 1LDEA 4TZTA 1QCYA 2BEVB 2WWGA 3GUZA 5TEWA 2NMVA 1Q16A 4QJ3A 3UUEA 1RFGE 3KVRA 5FO0A 4A1OA 2EIHA 3W1VA 3ZNQA 5BN1A 4M0PA 2JEZA 4FWTA 1X1RA 3JQQA 2C4VA 4BV8A 4EP1A 2CXXA 2M6KA 3ETNA 1DELA 5KTTA 3AU9A 2V7XA 4E2ZA 1CQWA 3LTNC 3IQZA 3UJ3X 1Y1LA 4FPXA 1EA5A 5EIBD 2QXUA 2OFOA 5F1KA 3NBYC 1DCTA 2O54A 1D1SA 1WAMA 3QKWA 2DUUA 4AF8A 2IS6A 2AOXA 1O6FA 5G02A 3IMFA 2WV9A 3AINA 1ZK4A 4IIVA 2HSZA 4M99A 1ZY2A 4Q4AB 1JG7A 4GI2A 1KORA 5DN9A 2J9YB 2PZEA 2ZQ5A 3ROEA 1WW2A 3G59A 2RHWA 1JU9A 2IEZA 1T2CA 3BE4A 3H2YA 4YQFA 2WNIA 5B4UA 4MVWA 1DO8A 4CMAA 4CKYA 4POOA 4X3PA 3MGBA 3LI2A 4XX0A 1CY0A 3L0PA 3QMPA 4OYHA 1HMPA 2A0UA 2FR0A 4YAGA 1N5JA 4FHZA 3NT2A 1TLFA 2P91A 4DG9A 1QGUB 3I05A 1E6WA 1Q1EA 1TF2A 3IS3A 1X7XB 2NXNA 3HVUA 4FINA