2B6NA

The 1.8 a crystal structure of a proteinase k like enzyme from a psychrotroph serratia species
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
b'ADQPSPTWGIDRIDQRNLPLDNNYHTDYDGSGVTAFVIDTGVLNTHNEFGGRASSGYDFIDNDYDATDCNGHGTHVAGTIGGSTYGVAKNVNVVGVRVLNCSGSGSNSGVIAGINWVKNNASGPAVANMSLGGGASQATDDAVNAAVAAGITFVVAAGNDNSNACNYSPARAADAITVGSTTSNDSRSSFSNYGTCLDIYAPGSSITSSWYTSNSATNTISGTSMASPHVAGVAALYLDENPNLSPAQVTNLLKTRATADKVTDAKTGSPNKLLFSLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords proteinase K
publication title The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species
pubmed doi rcsb
source organism Serratia sp.
molecule tags Hydrolase
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.4.21.-:
pdb deposition date 2005-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2b6nA00
2ST1A 1CNMA 1JEAA 1WMDA 3PTLA 4H6VA 4KB5A 1SBHA 1GCIA 3DVRX 3DE1X 1Y33E 1TM3E 1SN7A 1XF1A 2GKOA 2HD4A 5FBZA 2SECE 3D43A 3WIUA 4B5LA 1OYOA 4AKSA 1BE6A 1AU9A 3I2YX 3QFHA 1SBNE 1WMEA 3A3PA 1PEKE 3CNQS 3DDZX 4K8RB 2TECE 3F7MA 5AVKA 4CFZA 2IY9A 2Z2ZA 1BH6A 4LVNA 1AVTA 1TK2A 3DVSX 1C3LA 1ST2A 3DVQX 5SICE 1TMGE 1WMFA 3SQOA 1GTL1 1SUBA 4MZDA 3Q5GA 1AF4A 2G4VA 3BPSA 2PKCA 3HJRA 2W2QA 1MEEA 4AKTA 1C9JA 2W2NA 1GA1A 1P7WA 1C9NA 3CO0S 2X8JA 3DE2X 4OV6B 1SELA 1SBIA 4ZARA 1Y3CE 1GA4A 3I30X 1SIBE 2IXTA 2DUJA 1KE1A 3LPDA 1Y3DE 4RYDA 3VYVA 1R6VA 1R64A 1Y1KE 3TECE 1DUIA 4I0WB 1WSDA 1BFKA 4JP8A 3SICE 1KDYA 1Y34E 5I9SA 4J94A 2ZRQA 3GT4A 4H6XA 1TM7E 2Z57A 3UNXA 2W2MA 4OMDA 2DP4E 1VSBA 3A3OA 3T41A 1Y3BE 5JXGA 3LXUX 1KDVA 5AVJA 3VSBA 1GA6A 2X8JB 3BX1A 3DE7X 1SPBS 5FFNA 4DJ5X 1SBCA 5B1DA 3WHIA 1YJCA 3TI7A 1T1GA 3VV3A 1SIUA 1GTG1 3VHQA 3VTAA 2PYZA 3DE6X 1PJ8A 1T1EA 3DYBA 3EIFA 4GI3A 5K7SA 4NE7A 3AFGA 3OSZA 2ID4A 4CG0A 3DW3X 2SICE 3VV2A 1A2QA 3AJ9A 1MPTA 2Z30A 4NE9A 1DBIA 1Q5PA 1GNSA 3QTLA 1S02A 4H6WA 2DQKA 1EA7A 1T1IA 4KG7A 1TM5E 2XRMA 1GT91 3AJ8A 1SBTA 3DE4X 3QMPA 4Z2AA 1SUCA 1THMA 2WV7A 5ARCA 5FAXA 3DWEX 3PRKE 3GCWA 4OMCA 2XTJA 3LPAA 3I34X 1AH2A 1PTKA 1SCJA 2QTWB 5JMOA 3EDYA 3L1KA 1KDZA 3GCXA 1AQNA 2W2PA 3D9QX 2ZWOA 2B6NA 5B1EA 1AK9A 1V5IA 2SBTA 3DE3X 1GNVA 1SUAA 1IAVA 1GTJ1 4LVOA 1OT5A 5JXHA 1SUDA 5ARBA 2PQ2A 1S2NA 2Z2XA 3TI9A 2Z56A 3DW1X 3DE0X 3P5BA 4WOCA 1AV7A 2V8BA 2PRKA 1ZVJA 3WIVA 2W2OA 2P4EA 3ZXXA 1S01A 3H42B 1LW6E 3LPCA 3DE5X 2PWBA 4NMXB 2WUWE 4C3VA 1BFUA 5AQEA 4M1ZA 1CSEE 1SCDA 2PMWB 1SVNA 2WUVA 3ZXYA 1UBNA 1TM4E 2Z58A 1R0RE 4KPGA 5JXIA 2E1PA 4YN3A 3Q40A 1BE8A 1P7VA 1SCAA 1SIOA 1IC6A 3WQBA 1YJAA 4DZTA 1WVMA 1ST3A 4WOBA 4DWWA 3GT3A 1NLUA 1BJRE 1NDUA 2PWAA 1SH7A 1TECE 1OYVA 5AMXA 1SUEA 4HVLA 1SCNE 1SUPA 4HX2A 1V6CA 2WWTA 1Y4AE 1NDQA 1SCBA 1TO2E 1TO1E 2SNIE 3A3NA 4BWGA 1KE2A 1Y9ZA 5ARDA 4ZOQI 1Y3FE 1YJBA 1HT3A 1ZVKA 3EE6A 1PFGA 4C3UA 1YU6A 2HPZA 5CW1A 2ID8A 2Z2YA 2ZWPA 1P8JA 3I37X 1Y4DE 1TM1E 1Y48E 1C9MA 4FONA 3F7OA 1EGQA 3BGOS 3F49S 4CFYA 5JXJA
chains in the Genus database with same CATH superfamily
1OC2A 2BN4A 1W8DA 1Z74A 5G4KA 4E5VA 4D8XA 1LNSA 2E6UX 1XZIA 3DOCA 4UUNA 3EFOB 4Q3LA 4QO7A 3BWVA 3RV4A 5K5EA 5ICMA 2QX6A 1ZJWA 3K9BA 1KRHA 2ODPA 2V7BA 4JQCA 1KY4A 5J40A 3ZGXA 4YRBA 4M9ZA 3HE3A 3HVRA 3L7NA 1U2PA 5HKKA 1H1LA 1YF3A 1SXJE 1VIYA 1K89A 4KK3A 2BZSA 4YJFB 3WB1A 1BRTA 2JAPA 2SECE 1U3TA 4KX3A 4KLCA 3OZ7A 4IIJB 1RZ3A 1SZCA 2DOKA 5KB3A 4V39A 4J3FA 3SZ3A 2EZTA 2BYTA 2RGRA 2O54A 3EDQA 3KSBC 4BP3A 3I9V1 1TU0A 3H99A 2AX3A 5E9JA 5BMVA 4BEBA 1LGYA 4YT8A 2M32A 5JCZA 1AQUA 4WV3A 5JRDS 1DKOA 1GPLA 3CZ4A 4HBZA 2HQBA 5DNWA 1NWCA 3CJQA 1MB2A 2I4OA 2B4YA 2VJCA 3NBZC 1RQGA 4UEJA 3AX6A 2P9EA 1AKMA 4JR2A 4CV3A 3HJHA 1XKTA 3NHPA 4D92A 3H3FA 4PYKA 1MVOA 4H27A 4CF4A 3IHWA 3KCNA 3ANYB 4PO3X 1DC5A 1I32A 2Y1GA 1UXKA 3ECCA 1NXPA 3NDPA 3SZRA 2WQ6A 1K63A 2C4VA 4CLOA 4HAYA 4PS0A 1OU0A 3OE4A 1Z3CA 1QAOA 2AJDA 1V25A 2F4NA 3EWNA 4HH4A 5A4MS 2I6TA 3K0KA 4GXTA 1XTVA 5CK5A 3H6GA 1L1FA 3UYKA 4UHBA 3WHKA 5DI3A 5P21A 3GP5A 1L4NA 3ZCXA 5NULA 5EUCA 1F2DA 1HURA 4RTQA 5J43A 3RS2A 3PQEA 4D8VA 1EWQA 2ZCVA 4UMEA 3LQKA 4CQLB 4BRZA 3A1DA 4YIKA 5EP1A 1JU3A 2M98A 1A96A 3SJCA 3V4LA 3LFTA 5JASA 5F7JA 2XUQA 2VJOA 1MGPA 3L0DA 2QORA 1AF4A 1Z5GA 1VPWA 2LV8A 2WV9A 1J2RA 5DLDA 1OPRA 3MLEA 5G4KB 3EPJA 2ZI4A 3KEOA 2BGNA 4DR6B 1Q20A 2R6HA 1M1UA 2IYSA 2WSMA 2ZYUX 3QVGA 5BWLA 2I4NA 4L50A 1VJDA 5BSMA 3LW7A 1C5KA 2BFBA 4KYVA 1J2YA 2B4RO 1GAEO 3AEUB 4RABA 2GYWA 1C4KA 2QU7A 1H1LB 3GUVA 2VHCA 1TF2A 5ESXA 1I4TD 5ERGB 5K8CA 1H8EA 3NUQA 2C7PA 2FMUA 1EHCA 2BEWA 1E2KA 2Y1KA 1UADA 3NUGA 4CCAA 2I2BA 2QOEA 1EVEA 1YDFA 3Q6IA 5C4IA 1BTOA 3O9VA 1XA4A 1KO5A 3K15A 1L5GB 3S29A 3WO1A 5JAIA 4NNJA 2NQTA 3HSSA 1UOEA 4ZKDA 2AMJA 1CS4C 4PAOA 5BMVB 4TXHA 3QG5A 1MA0A 1Z2PX 1P4RA 1NUPA 2MTBA 4JN6B 1W6RA 2ZUVA 3LPDA 1Y3DE 1YMQA 2PZAA 1KO4A 3H9BA 3MQ4A 4W5OA 2VF4X 1T0IA 1IJBA 2PL3A 3NW9A 4MUFA 3MBOA 4RCVA 1R15A 2DBVO 4RYDA 3GF4A 3PHLA 2IU3A 3RUDA 3TE6A 4BWYA 5AKXA 4AB1A 3GV0A 4ACBA 3HEBA 2PU7A 4YV2A 1A1VA 4R69A 3HGTA 4KU4A 4WVFA 2EFJA 4IDOA 2CHQA 3PEVA 2PVSA 2Q8NA 4CL0A 3GX1A 3WHPA 3GJXC 1FC0A 5AXCA 3WLSA 1M75A 4QSHA 2ACWA 3LE8A 4DRZA 3QLTA 4MUXA 5EIWA 1RLTA 2EU8A 2DBRA 1E9RA 2B9VA 3FR8A 4ZAYA 4E2YA 4YRLA 3MOIA 1BJKA 4P84A 5E1BA 2OFFA 4RANA 4HN2A 3IA2A 1HRKA 5J3JA 2B5WA 2FMKA 4EG0A 2E5LB 4UVIA 1VP9A 2JAWA 3CUWA 5THKA 1Q0QA 1YI0A 1J07A 3Q7EA 4IH4A 4KJXA 4NJEB 1E6CA 4YGXB 4HSEA 3SJAA 1YC2A 3SEAA 5FBHA 2G7MC 4R8VA 3FZYA 2PJZA 4QGHA 4OGKA 5DBHX 3GRZA 2IWRA 3UKOA 3Q9SA 4FGSA 3W05A 1NBWB 3QYPA 5FI1B 1M2VA 1ZONA 2YV2A 3F71A 4FR5A 4R2MA 3UPUA 1XQ1A 2J5KA 5ALYA 1Q0LA 2HCJB 1Y1RA 4U6QA 4DIBA 1Z73A 4HFJA 3QVGB 1PUJA 4CDNA 3D3JA 3QPBA 5CJJA 3GPIA 1HFWA 3H4VA 3P1JA 3BJZA 4Y9RA 3SEZA 2BHLA 2D59A 2BFBB 3GCZA 4H3SA 4ZK2A 2B7CA 4IDQA 3SYLA 4IDDA 1K1EA 2QE7A 3O3CA 3JYLA 3PRHA 1B0PA 1XTSA 4YJ3F 5H3LA 2QJTA 4AZVA 3ZKWA 3MCAA 1J0DA 2NVOA 1BKYA 1ZINA 2E4AA 2X8AA 3Q3VA 1EXDA 2RH4A 5EE1A 2BEWB 4B6GA 2CMDA 4TXMA 1PSZA 2VTBA 3IOBA 3N87A 5BWCA 1FA9A 4DR1B 3FYCA 4JL8A 3KXIA 1JJ7A 2CFOA 4G23A 4LNHA 3OZBA 1N2CE 1Y3IA 3ZY6A 5EXTA 2X2FA 2OL4A 2VHYA 4L9AA 3FCSB 4AWAA 2H2HA 4GI1A 3CYFA 1KEPA 3DMTC 2ZUCA 2XUHA 4KOEC 3GEHA 1KETA 3GUZA 1ZAKA 5FV7A 3O8DA 4Z4FA 3N1UA 1X7XB 3BK2A 4Q00A 3SD7A 3W8DA 4BV8A 1NRWA 3HHPA 5ELMA 2FKNA 2YXBA 3K53A 5L3ZA 3EWSA 2D5LA 1BS9A 3IQZA 3W3AH 4CU5A 3TK1A 2H29A 5DK6A 5KOHA 2XCRB 1BDIA 5AKEA 1DCTA 4G3XA 1M7HA 1D5WA 4RMHA 3HYLA 6AT1A 3OUTA 4EUSA 4ZV7A 5HIAA 4DMKA 3LTNC 3U1TA 2GVZC 4E0BA 4IJUA 2GR9A 1G4AE 4L8LA 2RK6A 3IUNA 4RZXA 2YV5A 4U5QA 3DOJA 3WSWA 4C7MA 1DXHA 1FRVA 1CK4A 4NFHA 3MT0A 3U37A 4HB0A 4QECA 1IJFA 5KINB 2WU8A 4INJA 2B8WA 3B3GA 3AZQA 2VUUA 2FFQA 2FSVA 4W5HA 2YHBA 3ZX4A 2VDWB 1WMSA 3GU3A 4PTYA 1PLJA 5JAPA 1QP8A 3NONA 3PIDA 2CSUA 4TLBA 1IQUA 1W9HA 3T9BA 4NS4A 5EMJA 4BCBA 5C81A 3RS5A 3SLGA 4FYXA 1A2QA 1HYHA 3GHHA 3AI1A 1ZOPA 3FFTA 4MV3A 2W4QA 5GAJA 4X66B 4TOIA 1D2GA 3CTMA 3BBPA 3P4XA 1J8FA 1JTVA 2BDUA 2CL0X 2W2VA 3CRMA 3ZWAA 5FEUA 4C87A 3MM4A 1BH2A 3GJYA 1T6NA 2VPIA 1RHUA 5KPJA 1U80A 4JDUA 3TQIA 3NGLA 3TYXA 2XZPA 2IYVA 1MAHA 1L5MA 2Y1OA 2ZKIA 1HE4A 3EUEA 4KR0A 3VPXA 4TWZA 3VVMA 3DP7A 4AZ0A 5JJLA 2PT6A 3WWDA 4ABTA 1OAOA 1TTHA 4A9AA 3MQ2A 1VM6A 2CYCA 2HUNA 3A11A 1KJNA 2CLOB 4KC0A 5EP3A 4AF6A 3EGDB 5B12A 2MSKA 2PZJA 1JMKC 3F9CA 3TQSA 3OJWA 1U7OA 5EHQA 2PKEA 4BQFA 3RJTA 2GF9A 2G40A 3H3XA 1WB6A 3SOPA 1OAKA 4ZOCA 3CX3A 1YNSA 4XGQA 4BV9A 5CHEA 1LY1A 4Z2AA 3EIWA 1SKAA 2G1PA 2O5VA 1L5NA 4CG3A 5AWFC 4MIKA 5C1IA 4PLGA 1EZ1A 3T7KA 4PQYA 5CA1A 3NPAA 2L42A 4GPEA 5KOHB 1OGYA 3M0EA 3MYRA 1XZNA 4D4IA 2ANCA 3PRKE 2I67A 3WDKA 2JCYA 5J2UF 3GEGA 3R7BA 4NYJQ 2JC3A 3L1VA 4LK2A 5AKZA 2PMBA 5L3SA 1BROA 2C2GA 4EI2A 2E49A 2Z6UA 5FOXA 2RGYA 3JVEA 1L1RA 5HCNA 4BLWA 5JCPA 2WI8A 3A4YA 5AJUA 3RIYA 2WLTA 2ZE8A 1LPOA 2QLMA 4JYAB 4YCBA 1U5CA 1OASA 4TT8A 5H8WA 5CK4A 2JIBA 3H2HA 4M8SA 5C1DA 3E7WA 4M1WA 5LJLA 3AESA 1RM4A 2FF7A 2ZAOA 2AE2A 3M7IA 3ANMA 4WACA 2BKUA 1FQJA 2H9IA 4I99A 3AXTA 2CNBA 4PZ9A 3OQIA 1Z0IA 3F2VA 4Y30A 5M3BA 3TXXA 1K8QA 2ISQA 4QOHA 4AN4A 3ZLJA 1P2BA 4ZRNA 1SVSA 2QT9A 3BL8A 1D8TA 5H7XA 4LRYA 3H18A 3K20A 4LGMA 4WUVA 4M8IA 3AYZB 4CLDA 5A7FA 1RWBA 2Z3VA 3T94A 2WEKA 1RWNA 5MF6A 1KI7A 5AUQA 5A5DA 5KSWB 5AHWA 1VIMA 2YYSA 2BFNA 2IXBA 1IK6A 2PT5A 2Q3HA 3HBJA 3LUDA 4X6YA 3QLVA 4AMBA 4RMIA 1R9NA 2FZ5A 4RS4A 3FNEA 4L9WA 3TBHA 3UAZA 4BGIA 3DMDA 4PRKA 5J1TB 5I4BA 5CP8A 3HYSA 4MITA 1XDDA 4L4RA 5FIUA 3ASYA 2VWPA 1Q1ZA 5CNKA 3AHJA 2JFOA 1LQTA 2EL9A 4BGDA 1DDGA 1WXWA 1WZUA 2DR0A 1V95A 3N8GA 3RC8A 3RCBA 4N82A 2W22A 3GW8A 5IANA 2CK3A 2H08A 3L7DA 2O7QA 3LCCA 5CDUA 2FAXA 3IAUA 5BP7A 5IXJA 4OIFA 5J4YA 3ABSB 5FKJA 1Z7WA 4Z7OB 2EZ9A 4RWEA 2ODEA 1JEYB 1Z3IX 3GRUA 3VXKA 2P5SA 4D9IA 1E3EA 1RYYA 2QNRA 3FZNA 2Q5LA 4DBLE 3CUSA 4DABA 3HTXA 4IAOA 4BEVA 2XUDA 2YWHA 2IXEA 2JCVA 4FFLA 3H5IA 4ZWNA 4F6CA 4BFXA 5JRJA 1T4CA 1D1QA 1P74A 3ZD9A 3FTCA 5CA1B 3AU9A 2RFLA 2Y1XA 4RMNA 4LYGA 1EJ0A 1QYWA 2JBHA 1Z6QA 3W9SA 4EHBA 5AJTA 3ZDQA 3UCFA 5JNSA 4QGGA 1BXZA 4OHYA 1SVNA 2ZG6A 3AVVA 4R8RA 3U60B 1AUOA 1Y8QA 1VKOA 5EIOA 1U04A 1ZC4A 2RH9B 3PGVA 1AZWA 4QPZA 5IWCA 1BN7A 3G9ZA 1PR2A 2VNKA 1PQWA 3SR4A 1AZLA 2Q5IA 1JHMA 1ZKMA 4KI0A 4B3BA 3IE2A 2WT8A 3OM1A 1N32B 4YCDA 3SSOA 3T0IA 4UCQA 4GLBA 5JXIA 1FUYB 1OX4A 2WVAA 3GT0A 3ABIA 4LY3A 3PYLA 3SE0A 4Q1VA 3E3LA 3R8XA 4X8OA 1M7BA 2PX6A 1CF9A 5DBFA 1XZLA 2RGUA 3E03A 3M6FA 4PG5A 3AV3A 5MFPA 2OUIA 2C5AA 1OV4A 2VLIA 4G5YA 4EG3A 2JGIA 3EVZA 3QRWA 2R9VA 3UJ7A 5IN5A 5T8KA 4ISBA 3ZIUA 2RHOA 3OFJA 3C6YA 4GMDA 1V4NA 3IAFA 4CCYB 4FJ0A 3ZE1B 1DC6A 2EX1A 2VT2A 4K81B 3BQ9A 2HQRA 3P9ZA 2XMBA 3ESDA 3R23A 2HA4A 1RPTA 2H1FA 2E3JA 2XNKA 3L9XA 5EKUA 1FP7A 3RANA 5B64A 3PEWA 3LXMA 4PZPA 5F76A 4CQMD 1A97A 3U9SA 5D5PA 1U90A 3NC0C 4QELA 2IZ7A 2CDBA 2I7XA 1IAQA 3VR1A 3ADDA 4FINA 2P75A 3UGJA 3K1YA 1A82A 2WAXA 2X1LA 1O9HA 3BRSA 3REGA 3BVPA 4TYWA 3GNSA 2ONJA 3LBIA 7ABPA 2H3EA 4EMBA 1I5RA 3VC3A 1E7QA 1M7GA 2DSNA 4BNGA 4CM8A 3TNDA 1R5JA 2ZIEA 4UMDA 2NV0A 3BIXA 3LSTA 3T3EA 4C05A 3MXTA 1ETUA 1YE8A 4DMMA 4R1TA 4DMFA 3JZFA 2O1XA 5J5CA 3Q1LA 1HUQA 4FWBA 4HYYA 1B1CA 4TMKA 4DV4B 4MUKA 3OKPA 3QE9Y 1N3BA 1WTAA 1YJBA 3DM9B 3D4PA 3MGGA 4I4LA 2W6QA 2XNDA 4FFRA 4KFRA 3AP3A 1PFGA 1GILA 1JKJA 2RB5A 4U0JA 3HNPA 4RK7A 4E12A 5JMWA 2QJWA 2ZVJA 1KO8A 1LW7A 4N48A 3EDMA 2ID8A 3AERA 4QAQA 1DC8A 3PL1A 1EX9A 3DBLB 4FFSA 3QKUA 1C50A 2IJGX 5EP4A 1CJSA 5IDVA 3WL4A 3U5TA 1WEKA 3U7GA 2I2WA 2JASA 4FEAA 4Q3KA 5C1BA 4IQFA 1Q7TA 1XLVA 3TW6A 4Z7QB 1RHMA 5U4QA 4QLOA 2FZKA 5EHGA 2HJWA 3LIPA 3GLFE 1WXQA 1A9XB 4KE8A 4AJNA 3KIPA 3ORSA 4JP5A 1FX0A 3IUQA 3ML1A 1QTIA 5F1PA 4XWWA 5AM0A 2CEKA 3F7OA 4UOEA 5IF3A 2FDXA 1SY7A 4QDZA 2XX3A 4NZMA 5D3MA 4V3CA 5F3DA 4BX8A 2LXNA 4FQ8A 2QM3A 3OSUA 1QQ7A 5ENVA 1UKYA 2IPNA 2N0SA 4OFZA 1Q0PA 1PBNA 1USUA 1WXHA 1HDGO 1Z0AA 2XCOA 3DEYX 3VOSA 5BW5A 1JNXX 4LFCB 3TEMA 3IPAA 1XTUA 2TS1A 3EVFA 4FMDB 4AY5A 1TEHA 4DLXA 4BVJA 3OT4A 4Q9HA 4X62B 1VE7A 3DBOB 3KR9A 4DXHA 2GTIA 2YQZA 2JLYA 4F3NA 3Q7TA 3QWFA 2QRMA 3AEXA 3DE1X 3E3MA 3KWFA 2CNKA 5BOVA 2H7VA 5IBRA 5JI3E 4LBYA 4OOFA 5LMCA 4F1KA 3MBIA 3PGKA 5GOTA 1AUPA 4HXFB 1XDWA 3GZTB 4TKMA 4DCCA 1YB2A 3SXPA 2O52A 4HLDA 3T7IA 1A8SA 3L2OB 3SHVA 5HWSA 2IHVA 1GPAA 4WCVA 3F3KA 2FFJA 2GAFA 2QSJA 1PR4A 2P40A 2SHKA 4P35A 4OGWA 2PL9A 4B5LA 2X23A 1WVGA 5FUQA 4HPXB 3NNDA 2QVGA 5J4LA 1EHIA 1E89A 1L4KA 2VAWA 4GUDA 3SLKA 4JGGA 1UM8A 3LKDA 3VU9B 5KTSA 1OTHA 1G7TA 2QIOA 3I6QA 4QL3A 4F8EA 1IN7A 3QFHA 1W4BA 2R6JA 4G5OA 4WMLA 5AICA 4URXR 2IYUA 1Q6YA 5I7RA 1PNOA 4L08A 4Q01A 1PTJC 3ZLTA 4EY8A 5BN3A 4NY1A 4F45A 2DQ4A 2AT1A 1E2IA 1JEQA 2B2XA 2EV9A 2KQUA 3NBAA 1OBVA 1ESEA 3OLXA 4CKXA 1XQ6A 1JLMA 4RNDB 2X7HA 1XRLA 1DMRA 1T5BA 2GBLC 2JH3A 4XCVA 4YVFA 1BYIA 4DPMA 4RO0A 3FOFC 1RCUA 2AC2A 4IIJF 4REQA 3NHWA 4WN3A 3HFGA 2WPNA 2YJZA 1JKFA 3HCRA 2Z3WA 3UB4A 3C6XA 4MLDA 5M04A 2I9KA 3EXG2 4RL4A 3LOPA 4JCCA 1HA3A 1SC9A 3OTIA 1NBOA 2DC1A 2X9GA 4FYMA 1AGXA 3MTJA 3PIRA 1QK4A 4OH7A 3U17A 3BFPA 3VNAA 3ZC3A 1WMFA 4A8PA 4US2R 1FX0B 3ICWA 4HP8A 5KKNB 1U3GA 5ED0A 1GTL1 3UH0A 2I2DA 2WA1A 3IT2A 10MHA 1M76A 3PRYA 1IH8A 4A27A 2VNJA 3NGXA 5AKYA 3WTBA 5D3MB 2H00A 3KPYA 5CH8A 1T5IA 1D1PA 1RZUA 5LZ5A 3RU2A 2V6FA 3TDNA 4AKHA 4DR3B 3TLGA 1I0LA 4XIIA 3ZS9A 2DHDA 3WNCA 1OLXB 1UJ4A 1V3TA 4BVBA 4MS3A 2VP4A 5I8PA 2BFPA 3PDCA 1ZYUA 2XR1A 1N78A 5JROA 3D1JA 5KHAA 3QUSA 4EY6A 2IUEA 2G3YA 1PL0A 2Z1NA 2H7XA 4INAA 3JWHA 1OI4A 2A5LA 1XZQA 1NYLA 3G1WA 4PM4A 5HGJA 5M34A 4IJQA 3SJUA 4YP7A 5ITZB 4JYMA 3CUYA 1NL3A 1Z56C 1DX4A 3AY3A 1VYHA 3OU2A 4I5DA 5LKRA 1NNUA 4OV6B 5JVDA 1QFXA 1JLLA 3ZXIA 2OC9A 2HCBA 3I9FA 4ZARA 1FMTA 5CDFE 4CW7A 3H17A 4BRUA 2ZRKA 3EISA 1N2HA 1J9ZA 2ZETA 4HQOA 221PA 5FO1A 1A9OA 3ANLA 1KF0A 1CUYA 1T6ZA 4F86A 4JUCA 1Q0ZA 2K7ZA 3AVOA 1ZVQA 4N5IX 3IKMB 3CX4A 3Q9UA 4UJ5A 2J4FA 4JDPA 4R98A 4U7TB 4RTLA 1WS6A 5DMHA 3L01A 3I72A 1CX9B 2CXTA 1DTSA 3RFXA 5E3HA 2REBA 2QRKA 2HNKA 1P7YA 1S8AA 2CHUA 2ORVA 2JGNA 3IBFA 4WESA 4Y1EA 2JAHA 1RPJA 5SYNA 4D43A 3D5TA 3U4GA 3GUCA 3AOEC 3X1MA 1JEQB 2FEAA 2QW8A 4X00A 1CUZA 2UYCA 3BK1A 4W7IA 1ACJA 4KNVA 3QU9A 2O8EB 2O3TA 1YIAA 3H5WA 2JFZA 5DYGA 4N0QA 4TTSA 3RTAA 1DB3A 3IBSA 1W29A 4LTNA 2WWGA 1KDYA 3WADA 1GRCA 1I9CA 2H0RA 2Q3FA 4CETA 2IZ0A 1MW9X 1V5WA 3ZU4A 3FF1A 3OO1A 2EOAA 3RIXA 4I46A 4KR9A 3WLNA 4DJEC 5LQNA 4W63A 4O4HA 2YOFA 5I9LA 5BMVF 4H59A 5HE9A 2R25B 1A8QA 1VI6A 2ZUWA 3M1IA 1C3XA 2VYQA 4RA9A 4YEDA 5I9SA 2CT8A 2W6OA 2RG7A 3EG9A 3F98A 1XQWA 4AXBA 3UNXA 3G2MA 3CRRA 4BBZA 3HVKA 1TYEB 5KQMA 3OICA 3S2FA 1U8TA 4KAAA 1XLTA 3LRPA 1BXKA 5IJWA 5JPCA 3P9PA 2EYQA 2P3OA 4FS3A 4GHWA 2W8ZA 2O2SA 4MVJA 3G79A 4QOGA 5CT4A 4OA8A 3SYMA 4LFBB 2H8GA 3C3WA 3LA6A 4QDUA 3UM9A 3ZHQA 4D8WA 4JA0A 2XUPA 3E15A 5K3CA 3DMNA 1ORRA 1IRIA 4BGEA 4B2IA 1VL5A 2K5UA 2JLBA 2P67A 5DTEA 1QRTA 1G5PA 4C5BA 3BHNA 3K4QA 3H1FA 1W59A 4DM3A 4I8DA 1RAAA 4MPRA 3TIXB 3CO5A 2V5VA 4G2NA 1DC4A 4LXYA 5FWNA 2BISA 4TRMA 3S5JA 3TRHA 4B35A 1LXCA 1ADJA 5JVDB 1L5HA 3IQGX 3BD8A 3RVBA 2V59A 4LRTB 5CVTA 2CV2A 4D26A 1NQVA 1TCVA 3OIYA 1XSEA 1E69A 1P62B 1SXHA 4DJ5X 1DOHA 1DXQA 4UQPA 4X54A 3GFGA 2QR3A 3AF2A 3P19A 3KE9A 3PFNA 2FUNB 4Z0NA 4F1JA 3S4YA 3EEOA 2BKLA 1PFVA 4HRYA 4ALLA 2JL1A 5DTIA 3H5LA 4QUKA 4H15A 3VR4D 3BMCA 3N86A 1T3TA 3ESCA 4FW9A 2O06A 2Q2QA 4LCJA 3HUUA 1W2HA 3QKRB 3ZCPA 3RIMA 4G4SO 3CR3C 1BMFD 2V03A 3B6EA 5I45A 2V0GA 3N8NA 3TM4A 1IWPB 4L95C 4EVIA 2QBYA 1C7FA 3DYBA 4FP9A 1CUHA 3ANTA 2B37A 3H9QA 2CXPA 2C84A 1Z08A 1XWWA 1H2ZA 4ZT3A 1V5GA 4HR7A 4PHFA 4Z8YA 2B1RA 1W5SA 2JHCA 3G2KA 4UBKA 3TX6A 4GI3A 2PM8A 5LP6F 3FYUB 4UQLA 5TMBA 4KQHA 4CWAA 3CWCA 4KCGA 5C2JB 1NN3A 1DIGA 5JG7A 2R6DA 4MVJI 1YQ9A 2P79A 1TLFA 1U4NA 5COAA 4C6TB 2RDMA 2BAGA 2I5PO 4BNYA 1M2GA 1MUUA 2B9EA 3TGPA 1M2OA 4NG5A 5CB6A 4GNKA 3MJTA 2QA5A 3OX3A 3VKHA 1Q77A 1K66A 3HB4X 3OEED 4NE9A 4Q7MB 3F0TA 1L8AA 1X1TA 1V9CA 2KYRA 3QSGA 3ESBA 1R4AA 2V45A 4B3JA 5HQTA 1EVYA 3IUSA 3D2BA 4RYLA 5KMGB 1Y5LA 3TSAA 3HBLA 2C57A 1K7XB 1R12A 3D0RA 4RVGA 5TJHA 2Q3LA 3H2JA 1LBQA 1WNFA 2VA8A 4DDWA 4KG7A 1MX1A 1TM5E 2JFYA 1AKWA 3MCTA 1XO1A 4M3NA 2PFSA 3FE2A 1Y4ZA 1T1JA 1EJ6A 4TV9B 1NJ5A 1CVIA 3AJ8A 2XYGA 4N40A 4DUZB 2QQ5A 3QVSA 3R09A 1DO2A 1TX4B 1KPIA 1RBMA 1ZW6A 2PGOA 2R62A 4FZRA 2VDVE 2E48A 3BIFA 1JPNA 3I9NA 1V9LA 1AQJA 3QMPA 4QDXA 2GN2A 1YCFA 3A9CA 5KUTA 1HQCA 4YBRA 1L7DA 1JSCA 5DW3A 2EWMA 5MGNA 1PFKA 2UYOA 5AJHA 3TNFA 4BXOA 3ZZMA 1BA2A 1SKQA 4I1RA 4LRSB 2FP4A 2GQ0A 1SXJA 3HVUA 2WTEA 5JSKA 2EKZA 4NMMA 1PTKA 3M6VA 4D5GA 3GGSA 3SK0A 2GLUA 2JEYA 1CKEA 2OM6A 1FRNA 1GD1O 3UCEA 3EDYA 4NG4A 1IHYA 4B81A 1JE0A 4UASA 4EKNB 2QBYB 2VPYA 2XA9A 4GMXA 2G83A 1DRKA 4IDFA 4TROA 3OQ6A 3D5EA 2C2ZA 2AHOA 3PT5A 4OK6A 1T8WA 1XKLA 1A0OA 2JVIA 3SC4A 3ZDZB 3ROZA 4RADA 2IY7A 1OBFO 2VYFA 4B44A 3NWOA 1V1JA 4PWZA 2JIZA 1YE5A 3H87A 3LPNA 1T4MA 1RWVA 3ZG6A 5KYUB 1TQ4A 4UBIA 4EA6A 2B5OA 1JDBC 3TW8B 3O4VA 1CPYA 1ZW1A 3L6BA 1B6TA 4YDSA 1MC5A 5JCOA 4DCTA 3W6ZA 2D5AA 2NTEA 1W1IA 4GYJA 5DBIA 3X1KA 1WKCA 5I9IA 3HA2A 4NOJA 1SUAA 3OD5A 2Y76A 3ROPA 1IAVA 1E9CA 1DAPA 2NO1A 4HAXA 1HOTA 1FVHA 2HI0A 1OT5A 2ZP1A 3H8JA 1FJXA 1WG8A 4Y67A 1S2NA 4HQLA 3EDCA 1RZRA 5FUBA 1T2FA 3ZVLA 2QNIA 2GK3A 3RRYA 1CZRA 1F8FA 1UKBA 2PA0A 4R3UC 1MJ5A 1H1TA 3D8UA 2WY2D 3FKSA 3GRCA 2Z56A 3T06B 1A71A 1YU9A 3TWOA 4D02A 5FHQA 3ZCSA 1ORHA 1U7PA 3BDVA 4GSLA 1GAWA 2ZJ8A 2W70A 3RSLA 5JAQA 5AJVB 4EJSB 5AKHA 5TEWA 3V1UA 2Y05A 1V47A 1UL1X 5AVRA 3BMXA 3L46A 4R51A 1TVKA 1XN4A 2RHHA 4JWTA 1Z28A 4F3CA 4KW7A 2OZLA 4HF7A 4OB7A 1R9MA 2VDOB 4ED9A 1AZTA 3DJFA 3F6BX 3H0KA 4YGYA 1XNHA 3M6AA 4KLNA 1T6BY 4A8JA 1TQ8A 1JI0A 3K35A 5EWLB 1VHWA 5FT9A 2V98A 1I5EA 5B1HA 1ZA1A 4ARUA 1KA9H 5EHZA 1QWSA 4AUKA 3VPFA 5JDCC 2P5TB 3FRIA 1KVUA 2AIRA 2A35A 2TMGA 3BIJA 1DEKA 1X1QA 5E6UA 3W5UA 4GE3A 3MWEA 2YBDA 2PS3A 1KZ7B 4UCFA 5A7HA 1KYZA 3C8HA 3GLSA 2Q2VA 3UV6A 3PFBA 2NYVA 3MGCA 4D0SA 2OSBA 2D2FA 3R0JA 1WXIA 4OMUA 3RRMA 2PNJA 2QN6A 4CG2A 2IH5A 2X5OA 1JG3A 1KJ9A 2WPDA 4LBZA 3ZDFA 2O5EA 1DJQA 3A1EA 5AVQA 1R8QA 4KL8S 1N7HA 4C22A 3QNMA 2IZOA 5DI9A 4DLTA 4IS2A 1RZVA 2O1EA 5DKFA 3RTBA 4J0GA 3E9QA 1PNRA 3NHKA 3E7FA 4X95A 1VXRA 5KVQA 4TV8B 5TC4A 3SIWA 3GIDA 3HGMA 3KQQA 1DKNA 1H0SA 1U1EA 1XXHE 3FPBA 3NXSA 1WKVA 2CBXA 2DFNA 2D54A 2WNIA 4M0KA 3T1QA 3P2OA 3H65A 4MQEA 4CMKA 3LYUA 4DKXA 4ZN6A 1ES9A 1QFYA 5CA1F 1E1QA 1XBTA 1P29A 4MR7A 4DV1B 1O8BA 2AF3C 1D2AA 4AURA 4JLPA 1P0FA 3EULA 3FF4A 3I0ZA 1BE0A 4ZP1A 4CMIA 4B7XA 5KWJA 3PQDA 1TDJA 2ROQA 1N33B 4GLFA 4ZVQA 3KLBA 3ZDAA 3VTKA 3D8SA 1CR2A 4DLKA 3V1KA 5JD6A 3GLGB 4K9MA 1GZ6A 1FYXA 1QO9A 3FSEA 5ER6A 2RHTA 1S8NA 4GOXA 1G0OA 3OUUA 3WNQA 5I9NA 3G2OA 3DEAA 1PW7A 2OSVA 2QD4A 1E9DA 5ICFA 4F4HA 1JHDA 3ELBA 1G2IA 3M4XA 2A9RA 4XM1A 3AJRA 2R751 5A5GA 1JPJA 5LLDA 4JUFA 4R3NA 1TVKB 3C4QA 2N1MA 1XJWA 3CX8A 2OZLB 4G4JA 2MINA 2Q50A 3EA4A 5B53A 3B78A 1FDOA 1XVAA 4IXDA 5C31A 4OGLA 4MVJG 1UKAA 2G80A 2P78A 1HEIA 3R1IA 3I2HA 3RS4A 3N58A 2VBGA 3OO0A 1OILA 1PJLA 1DHRA 3NTVA 4IVPA 1JVSA 1FPQA 4XFDA 3OTQA 1Q19A 5AK6A 3TO5A 3TSWA 1G8JA 4LGCA 2M1ZA 3FCUB 5D00A 3EFEA 3LLCA 2WYUA 3QPDA 3C1TA 1RQLA 4WXHA 3C3XA 1QLWA 2QMEA 2Z2YA 4JR0A 3WRVA 5C5DA 2JI6A 5KQPA 4RGYA 3OAAD 3ABQB 5F3RA 3BIWA 1G3IA 2JAXA 3D6JA 1PUIA 5JANA 3SU8A 3P9IA 2X6QA 2Z6AA 5IDQA 1PSWA 2AYZA 4NOLA 1TKBA 2VNHA 2DMRA 2PAAA 2CB9A 2IOYA 5FTJA 4A1OA 1KBQA 1A5TA 4Q3EA 5JCJD 2ODBA 3CR7A 4NMHA 4CMEA 3M49A 2GK4A 4WLEA 3QFRA 4FKZA 1Y9EA 1C30B 1CQJA 1DO0A 1LRLA 2CJWA 2DPMA 4J7AA 4RM2A 4ZOAA 3TQQA 1X7YA 2RCYA 4MV8A 1EGQA 2FOXA 3KDPA 1O5OA 2YRFA 2N3ZA 4TVKA 1ADGA 1MMFB 2QYHA 4FILA 1QDUA 2HA0A 3M82A 1D2NA 2XSZD 5JD5A 1U9JA 1J49A 1LKZA 1TADA 4G84A 4GGMX 5HOEA 7MHTA 3KT3A 3B12A 4IOJA 4G1EB 1AJEA 2VBCA 1SOUA 4ZQIA 4LZAA 2AG1A 3ORRA 2YUIA 3UANA 4XE5A 2JATA 1B2LA 3AVYA 2PG3A 3HRIA 1L5ZA 2C31A 2NZYA 4C1BA 5BUSA 4Z4EA 1N2SA 2PS0A 2ZB2A 1GAJA 3WLMA 2Q29A 3GFOA 4I6EA 1ISIA 4PX9A 5EC8A 1LDYA 1ZCBA 1A4UA 1K0UA 2I3AA 3CM0A 3U62A 3LT0A 2MSWA 2HWYA 4LF4B 2P2YA 3DDCA 3B1VA 1T8TA 5TMDA 3PTAA 2JI4A 1V0JA 3L0IB 3PCRB 3GEIA 3GZNA 3OEHA 3PITA 4HNAB 3RBXA 4EMUA 4Z7JA 1K6IA 1P9LA 3NKVA 2AOWA 3UPDA 5A62A 2IX9A 4I14A 4MVYA 4GRDA 4PYOA 2JI8A 4M1OA 4YX9A 2V9CA 2G0AA 2ZVDA 2ZE7A 3QVMA 3OQHA 3IMCA 4LV8B 5ENDA 1F4LA 2V7VA 3CNHA 1TPYA 2A0UA 4BP9A 4FMDF 2FG7C 2NVBA 4MB6A 1TOAA 1FS4A 4WNAA 1PSDA 2XCLA 1ZCZA 3QFSA 3OMXA 1OXUA 3VVLA 4KV7A 2TECE 4IHJB 4DC0A 1RHJA 4IM7A 3E35A 6CHYA 3OBBA 1ZNXA 3ZNNA 4D0RA 4LVUA 1J56A 4FEGA 4PBRA 5EIEA 3T4UA 3KXPA 1GQOA 1LEHA 1BH6A 5EKSA 1LZKA 1VGVA 3I4FA 3CEPB 1W49A 1AVTA 5DXAA 4MW1A 1H5QA 2AZMA 2IYEA 3AZOA 3UHFA 4N49A 4WLUA 3FPSA 3VH3A 1SKMA 5K8JB 2HTEA 3UJAA 4OX9Y 1RT9A 1DFHA 1BJTA 1Q1QA 1XLTC 1VBNA 1XCOA 2CLIB 2O0KA 2FWBA 3D2CA 3C6ZA 3GA0A 3GMDA 1ST2A 1NASA 1Z7GA 5CXXA 5FPHA 3PDJA 4DHEA 2ZJ1A 3G0HA 1ZIYA 4FT4A 4RDIA 4RHEA 4BBAA 4DNPA 2YN0A 3G1TA 4CL8A 3M6LA 3D54D 1OXBB 4PANA 4WINA 1CQJB 2HT1A 3AVXA 1BXRA 4LYAA 2LGJA 2UZ0A 3TRIA 3MYYA 3NAGA 4JCOA 1FRZA 1SRRA 4E5SA 4FC7A 1M8KA 3M3DA 3SXJA 4EENA 3AVTA 3CR8A 1ZH2A 4UW9A 1IQ0A 4J7XA 4B2PA 2YWCA 4IEIA 3S99A 3PQ4A 4BMOB 1HE5A 3DA8A 3L06A 4PPNA 3EXAA 4TKVA 2QG4A 1IY9A 2A67A 4CF6A 3K5HA 1XHEA 4ND8A 3LCVB 3ESRA 1ZM2A 3OFSA 3QH4A 2C7QA 3DAGA 1KEWA 1HE3A 4LI0A 3KOMA 1QVVA 1ENZA 4MV9A 4L3WA 5LA6B 3R75A 3QE3A 4KBYA 1UFVA 3B9RA 3H9CA 4JXKA 3N28A 1JDUA 4HADA 3KSAC 621PA 2NACA 3UWKA 1XEFA 4KXFB 5IBCA 3GZJA 4FOLA 4FGLA 2DTXA 5E2BA 2UZ4A 1E1NA 4RFLA 3UK1A 5ALVA 3BC1A 4ALJA 1AGYA 1KMHA 2J0EA 4WKCA 3U49A 2HYIC 1FMFA 3K96A 4BTVA 3N74A 3VC2A 1YR2A 2O2HA 5EZ5A 3ZHSA 4RCZA 1FUUA 1Z38A 2H1VA 1CZUA 4BNNA 2JZOA 5MDHA 2F90A 4BX9A 3T5CA 5LQAA 4K2HA 1R6VA 4PXSA 1NWHA 2QRUA 4KN6A 4PLTA 4PRZA 1ZM7A 3RGGA 3FTPA 2P65A 1TEVA 1UPAA 2ZJBA 3KB6A 3OQJA 5HCIA 4DNOA 4W5QA 2BY4A 2O3SA 4OKNA 4UM9D 4I81A 4DXDA 1S9HA 4ZVRA 2F43B 5IDWA 4A8TA 2WFMA 2YWFA 4OBBA 2ICAA 4WLOA 1DOAA 2V97A 2C9YA 1Z62A 1MT0A 1UPXA 1U63A 4EFMA 3B13B 3G5UA 4D80A 3P0JA 3RG2A 1VCNA 1EAMA 1L7RA 4JS0A 5HYVA 1Q91A 2DPLA 1ZMBA 2BM0A 3SP1A 4JFAA 1ZA2A 2ZU6A 3IURA 3VR6H 4EKEA 4LQLA 2J30A 2XMPA 4NAVA 4IUYA 5H1YA 3SKVA 1H3FA 3KX2A 4CCYA 3LCMA 3BYZA 3U3KA 3S6JA 4X64B 5A4JA 3E0QA 1BXRB 2CE2X 4MLPA 5KTPA 3M33A 3D4LA 3INNA 3KR1A 4I9UA 1MF7A 2H1IA 2UVPA 3EZYA 3VNRA 4RD3A 1KC1A 2V6GA 1GPMA 3DTVA 3FW1A 4IEFB 5KYYB 3AV0B 1I94B 2Y0EA 4QUAA 1CEEA 1KY2A 1ZAYA 3PJDA 3TLJA 1GRQA 1M6VB 2O1WA 3DO6A 4RLHA 4Z1OA 3NOVA 2FSHA 1XG5A 3WX0A 4B34A 1H3EA 2LE0A 3UJDA 5JY6A 2O48X 2PNFA 5BUZA 4EYEA 4HMPA 4KPEC 3CW2A 1Y63A 2JFGA 3DV9A 4EGAA 3LQ4A 4AD8A 3IJRA 2NTJA 4MK4A 2IS1A 2O57A 1MTOA 1YO6A 1YVDA 1Y8CA 2R8YA 1CQIA 2X13A 1TLTA 4V2UA 5ICGA 1NU8A 3N2YA 3SMVA 1GRVA 4MRVA 4CMAA 4RPKA 1OZHA 5EL0A 1L5KA 1L0BA 1SXJC 1SKYE 2H2FA 2GJKA 4QQRA 3OZDA 3Q6NA 1OCEA 2C9OA 5IMSA 2QZ9A 2RKOA 3WJAA 1D4AA 1KMHB 3T1NA 4Y9UA 2F8LA 3IEXA 1R3UA 4O4LB 2H48A 3GARA 3M9WA 2H1LA 2VUHB 4FMPA 4HT3B 1RI4A 4HGQA 1MVLA 2Q5FA 1YT5A 1OW3B 1V7PC 3IDZA 1EWRA 4L07A 4LC0A 4N65A 4QPJC 3WKCA 2QRHA 2FEOA 3CC8A 4AX8A 1HBJA 1EK1A 3T9AA 4KXUA 3ASVA 1T1SA 1HE8B 4NYMQ 3CLSD 2QDXA 1QO0D 1DDOA 3QX9A 3WLEA 5KSOA 1ZR4A 4G1BA 4UD2A 1Z2AA 4E6PA 4MPPA 2FSGA 3O8QB 1FNDA 1CUVA 1E92A 5JVDF 4N3BA 1W85A 5DLYA 4ZAFA 3WLHA 3ESYA 1JFFA 5BXQC 1F12A 3FUCA 2QN3A 1AKQA 1OIVA 2EP7A 2YWDA 1UM9A 2XEXA 1NBMA 3OZXA 1TYCA 1SURA 2J3DA 3W9YA 3ZNQA 4KFCA 3WAJA 3R9KA 2LTAA 2HLDD 1S2GA 3HK2A 1NOJA 5AW0A 4W5NA 3Q72A 5IG2A 1O9GA 5L4NA 3VV2A 3NAZA 3VR3D 5HRCA 5C8VA 2VS1A 3A58B 1E9AA 3IAEA 4TRNA 5IKMA 1PQUA 5H68A 3DTVB 2WP0A 3LK6A 4J75A 1DBIA 4P4NA 4ERNA 1LBSA 5T4HA 4DIOA 4G63A 2Y9MB 1SU6A 3O8NA 1MAAA 3E5HA 1UBFA 1UJBA 3BZUA 4LWQA 3WYNA 2NUBA 3KCQA 3HKEA 4DLLA 1WDMA 2C29D 3GMSA 3O03A 4EPWA 1NXTA 3HFJA 4J43A 3AY6A 1QFSA 1KGSA 1P6XA 3GLFA 4CU2A 3WIDA 3M5PA 2PQMA 4MQMA 4B2YA 3T34A 2AJ8A 1IEQA 3TPZA 4KYUA 1VGQA 4ITVA 3HBMA 1A5ZA 1CQIB 3BF8A 1W73A 5ADUS 2E0IA 4FNOA 4G85A 4PRYA 4CIYA 1QG6A 5CLLA 3KJIA 4R68A 1U3CA 2H65A 4E5DA 3CKYA 2C59A 3FMOB 5CDYA 4DV3B 4J1NA 4IOLA 4GX1A 4ARSA 4DLWA 2MYTA 3GNLA 1NXSA 4K9PA 4L7VA 4LOJA 1ZNQO 3KWMA 4ALMA 1KU0A 1RKVA 4EMTA 5HXAA 3I12A 1QRSA 3BXHA 4JU8A 3C5CA 1GKYA 2FVXA 3NIDB 4N3NA 4R40A 1Z12A 3ZGOA 2LVBA 4LJ6A 2XTJA 5AW9A 3UTDA 1QQ5A 2EQAA 4A0HA 4A0FA 1T5OA 1BWPA 2ZRLA 3G0GA 4L22A 4GO1A 5AO9A 3TOVA 2PLNA 3NOXA 1KK0A 2A92A 5DLQC 1KDZA 3NHBA 2GD2A 4TV9F 3BERA 4U7PB 4BMYA 2QG6A 1E66A 3A37A 2PTGA 4LHZA 4S1OA 4I19A 1Q16A 1Q7RA 3N53A 3HGQA 1ISPA 1Q7BA 1JFFB 1HG0A 3O7MA 1G98A 4ZEXA 2NTVA 2FPUA 3SF8B 3IIJA 4DCOA 3MJEA 2VDKB 2VSYA 4Q1DA 1ZD3A 4F5YA 1SD1A 3QENA 4M8NE 4JT8A 3CF6R 5IJZA 1XL1A 3QP9A 1XK6A 1TT5B 1XROA 3ZZ0A 4KE9A 4LY9A 1KZ9A 2V9PA 3UF0A 2L19A 5AI4A 4JBIA 4XOUA 1QYVA 4DJJA 2IYLD 1X8JA 1TZCA 1I2ZA 2BGRA 4CM3A 4M22A 3ACDA 2P2LA 2QRQA 2AUNA 5CUQA 1V8DA 4DYHA 2K87A 4E70A 1XRJA 3M1AA 3LT4A 3TM5A 5TPWB 1SK9A 2H8KA 1HYEA 2ZPAA 1PLLA 2E55A 4W1SA 4Y0AA 5FNVA 1TJ3A 4K9KA 5KCMA 1YR7A 4G0WA 5JDIC 3RUFA 3AB8A 3ZE2B 1I1HA 2A0KA 3PUZA 3KDSE 4TWJA 4YIHA 1Z5NA 1P80A 5CLFA 4QOIA 2O7RA 2RIRA 3L4EA 5LQUA 2BHRA 4TTQA 1OI2A 3G2NA 3RM3A 5T5QA 2XI4A 5A4KA 1TIBA 4OAPA 4WNCA 1ULBA 3NWJA 3RDPA 4J0CA 1Z6XA 5AQ1A 4RF3A 1I6MA 3WLPA 4D41A 2W2OA 1TYZA 4R9SA 1RI1A 1ZJJA 2TMDA 1UINA 4XX0B 1T2NA 2NUPB 1X7ZB 1EEXB 3ZXXA 4K8OA 1H6DA 1BYUA 4E5NA 1F5SA 1L7XA 1RRMA 2AOUB 2Q6VA 3BDIA 1K7EB 3N7TA 5A9RA 2AEJA 2BI8A 3AINA 1NN1A 4Y0VA 4MP6A 2CF6A 3LKBA 4G5RA 4PAMA 2W0SA 1MOQA 3LBAA 2DKOA 3LYHA 4FNGA 1JQAA 1RNLA 2YXEA 3I83A 3EOZA 4PZCA 3TKAA 2HBQA 3HRKA 4HDSA 2GVNA 2BFEB 3K70B 1G16A 3PD7A 3ZDEA 1AO3A 1FSFA 1CSEE 1TMOA 3B9PA 5KNCH 1JJVA 1WZNA 3G13A 4BCDA 1B3RA 2ZTHA 3GRYA 4D5EA 3L1IA 5F9HA 2JA2A 5CDFA 4J16C 4G26A 4LKRA 1IZ9A 2DQSA 4DV7B 1M2NA 1Q3TA 1U02A 4M9CA 1A9TA 1VGRA 2AQ8A 3NNSA 2PMEA 3OIGA 13PKA 4UKDA 2G08A 1R0RE 2R6FA 2YWEA 3G0OA 2WB2A 4CIBA 2EG9A 1T2DA 2WYWA 4YA6A 3TB4A 4YRNA 5A6SA 1ZSVA 1QYCA 3UUEA 3BB3A 2AKEA 2GZHA 3IP5A 3UJNA 1JKIA 1GCOA 1IC6A 2NLOA 2P2DA 5B4UA 1RPZA 3A6ZA 3CKKA 4P83A 3AXSA 4XDHA 1RM3A 3ETGA 3F8SA 4EO9A 1RYHA 3X1XA 1JJAA 1YS1X 2IELA 3T1VA 2CNDA 3VYRB 2ORED 5B57C 2M6LA 3DBHA 3FDZB 1AF7A 4X41A 4MVCA 4KNYA 2YVAA 5IVPA 2VUSA 2VZLA 3ZQ6A 3OE1A 1H65A 3DFMA 5KBYA 3ZWMA 1N57A 5EWMA 3NUZA 1WB5A 1G7SA 1S1MA 2QTFA 3FMGA 2IHBA 3IX7A 1TAQA 4KQ6A 2YCLA 4Z9YA 3URMA 3KYCA 4DEXA 2IYQA 3HJCA 2C5GA 2RGAA 3R5JA 3R9WA 2VCYA 4LE0A 4UU8A 5IDXA 1E0SA 2HZBA 5BRNA 1E1MA 1CUUA 1TTPB 3KTAB 3DULA 1ORIA 2P6UA 3KD2A 1QU3A 4TV8F 1RHKA 1WQ4A 3VH2A 3WIBA 2O0LA 3SHQA 3QLJA 3IQHX 1V96A 1M2FA 2ZI7A 1MB3A 3CNBA 3GFQA 2YH2A 3K09C 4JIMA 4LHYA 4QARA 1PQYA 1T3ZA 3L92A 3LY8A 3HUDA 2I7VA 3HQ4O 2H4YA 3NPMA 4FFPA 1D2HA 3K0CA 1FOEB 4M83A 3LWZA 3MOSA 4MWGA 1AA6A 2XKBA 3OKAA 1V4VA 1PLKA 3NAMA 1AT1A 5D6NA 3NR2A 3WDSA 1OKKD 3CSDA 4MR8A 2WQ7A 1UBEA 4Q7LA 4COKA 4ZVUA 1J97A 1WB9A 2FLWA 3JRWA 3R24A 4A03A 5J1SB 1PZHA 3FYTA 3Q4GA 3WK8A 4KFSA 4GLLA 5F9MA 4OK5A 1J23A 1GZ3A 2WVJA 4GLOA 4XLLA 2IZ6A 3ZGVA 5JALA 3D3QA 4A26A 1Z0JA 3L77A 2XUGA 3NTQA 3VGJA 1U5AA 2WYOA 3MC1A 5AW3A 1LTHR 2VWQA 3SC6A 2IOQA 4OQNA 2UXCB 4MS1B 1NSTA 4R7TA 1N9GB 2WWXA 3EMVA 1X94A 4KQKA 1QB8A 1FP6A 4FONA 2RBEA 2Y3IA 3HG7A 1N5MA 5FJIA 1WW2A 3W9BA 4HZUB 5K2MA 3BREA 3UZUA 2XY4A 3PQ2A 1IHPA 3F49S 5CNJA 4S1PA 2YNMD 1ZMRA 5IWAB 3K2EA 1L4LA 1QJ4A 1YRWA 3PFGA 1IXKA 3I28A 1N36B 2ZDGA 1M6NA 5C0OE 3ICOA 3WWOA 4IHQA 4MSUA 3FY4A 4LG1A 5GONB 4ZAGA 4WERA 1VL8A 4W9RA 2NUTA 2QPTA 4ZDKA 1O94D 1QOPB 2XDQB 3ENWA 3IALA 4HFNA 2WSYB 4CTOA 2J09A 1BDBA 1YJQA 1SBHA 3F8TA 3PWKA 3R5SA 2BCEA 4B32A 2B92A 1LNZA 4O1HA 1ZGCA 3N07A 4V38A 1HDCA 4AN0A 2OHVA 1TM3E 1KMIY 1SN7A 1SVUA 1Y82A 3V1NA 3WYDA 1QPZA 2DRIA 4PGAA 3DZKA 1W30A 3KYCB 1MCZA 2FSPA 4JKOA 2RJOA 3KKMA 4FHEA 5KEIA 1R0BA 3O4RA 2GAOA 1TK3A 2VCEA 4B83A 4ZVTA 1KKMA 1G59A 4ZI7A 1R0XA 2OD9A 3VDNB 4RVDA 3BKWA 2Y0DA 5J58A 2I6FA 2FRXA 2KMLA 4WADA 5IHPA 4J91A 1RYZA 1FTQA 2G9UA 3E81A 3F90A 4IZIA 1R74A 2YJ4A 3RYHA 3KAQA 2FPPB 2JHAA 2PLRA 4YJGB 4F4FA 2WWVD 3D81A 4ETMA 3A3PA 1O95D 2HMYB 4P53A 2ZSBA 2V8OA 4GC9A 2A0YA 3TXYA 4BUCA 4EAAA 4CKZA 4MR8B 2DQYA 2V7UA 4JEUA 2C92A 4UNSA 4DG5A 4JP3A 4CFZA 3D4BA 4KITB 1PK7A 4F6RB 4Z49A 3Q8LA 1E7WA 4OKSA 3E9NA 3T52A 4NPHA 4KAFA 3TL3A 3ZV4A 3AM1A 1MC1A 1ZHFA 2HDHA 4HTFB 1P0QA 2RHGB 4Q6WA 1JS1X 3MLAA 4KOAA 1MJFA 1XTQA 4M1YA 4KPYA 3BMNA 4XJTA 4Y1GA 4GPIB 2BM1A 3AFHA 4FMBB 3DVSX 2XWSA 1NLMA 5COQA 2TMYA 2VRCA 5D6OA 3K3PA 1MR3F 3W8EA 3O74A 4A8HA 3DF9A 1QTRA 3VHXB 3FHTA 1SCQA 3V1LA 1CJCA 5EAIA 5FCDA 4D0NA 3GUUA 2J7PD 2LRHA 4G86A 2GJSA 4MWDA 4FZ3A 3WL5A 1RFLA 1VLVA 3D6TB 1EWTA 2B2NA 3PDIA 1XD2A 5BNWA 4PRLA 1DPGA 2P2NA 3H1GA 1E8DA 1BCRA 4NP6A 5I51A 2YJ6A 3KVVA 1P1BA 2YV1A 3HYTA 3MJ4A 4IHJF 4MKFA 4P7BA 4BKPA 4EPYA 1KZHA 1KQFA 4TYNA 3DV0A 3H8WA 2HCFA 3GEMA 3NI2A 2IK8A 5DIFA 5BO5A 4JC8A 3UH1A 5KCZA 3Q11A 2W2LA 4M46A 3CZPA 4MAAA 5DTQA 1H69A 2PUVA 4AMVA 1OLSA 3HB0A 4A2WA 4ISCA 1E2UA 4KDCA 4MPJA 4L4SA 1NMXA 2JZCA 4WZAE 4PGFA 1M0TA 1HL3A 4ZVSA 1E6MA 5KTMA 4JASB 4D46A 3B9BA 3HXQA 2B8TA 2JDID 1GGJA 2JFNA 1SBIA 2RIPA 4OLHA 2ZRIA 1LRKA 3P2MA 1GKUB 1WPXA 2X9QA 4NCNA 3AHCA 3PJFA 2H4XA 5AJYA 1RTKA 3DYIA 4FLEA 2J1LA 2AQHA 4ZVNA 4V3BA 5BN5B 4AF8A 1W8IA 5EEGA 1US8A 1T36A 4RZ3A 5K0GA 3ASZA 4WY2A 4XASA 2GTPA 3ICCA 4PYRA 3OMWA 1E64A 2R97A 3ZW9A 1M1ZA 2X3UA 4I8XA 4RHFA 4CT0A 4YR7A 8OHMA 4QTZA 2IX3A 2QI9F 3NBUA 5HIIA 4BUZA 4EPRA 5A6VA 1DTEA 2GSDA 1U2RA 3L4BA 5I8WA 5FBQB 5LA6F 3ZWOA 4HDRA 2PPLA 5CEJA 4F3KA 2BFDB 3W5BA 1C1DB 1V1RB 1OI3A 5EJIA 4PSAA 2VHQA 3S7ZA 3DMHA 3E82A 4J6EA 3RK4A 5I3CA 5FBRB 4GWGA 5CT9A 2VJAA 3R0IA 5ELLA 1K3UB 3DGFC 5E9QA 3PPXA 5BYJA 3CONA 4YK7A 3GJTA 2J4CA 5KKAA 4J0JA 2JLCA 4LE1A 2O8FA 3AH8A 4J94A 4RETA 1ZISA 4MKRA 4TUYA 5EJAA 1I4LD 1XZ8A 4F38A 4ND2A 2GD1O 2DYKA 2AYYA 2CFRA 4XQGA 4PYQA 5HF8A 1B4DA 5GVRA 3U7QB 1IBCA 5TDHA 3RU7A 4DY6A 1XRMA 2PD3A 3NIGB 5BN4A 4L16A 1VSVA 2R1ZA 2OHIA 5FJJA 2IHJA 4FJ1A 4C7KA 4J9VA 5HK9A 5C1OA 3LIIA 1XCMA 1EUCA 1BX0A 2RAPA 3PUKA 4MKGA 3ZV6A 1RVDA 2GFHA 3DJYA 4PE5B 4YRKA 3K8ZA 2REQA 4QYMA 1ISGA 5K1ZA 2QRJA 3ZIAD 2XDYA 3TAUA 2GZAA 3A6DA 5ICCA 1E2DA 1BVHA 1OLSB 2A3RA 4X7MA 3LA8A 2VQSA 1I1QB 5I4IA 3F1KA 3FDJA 3H7IA 2H17A 5AT1A 1CBUA 3TTWA 5C4MA 1BSVA 1GA6A 1SMKA 4P3NA 2QYOA 5KQSA 2R65A 4UXIA 2A2ZA 1XXHA 5TNXA 4G09A 2YNMC 1N9ZA 3QYAA 1W1UA 1SOVA 5FFNA 1TI7A 3RC9A 2QE7D 2VPWA 3RE1A 4B4UA 2QSYA 3G8DA 1ZG3A 3C2QA 3D6UA 3WHIA 2Q1WA 1UP6A 3L0PA 2YWBA 4ND5A 4RQTA 3MLBA 2EATA 2ODQA 3V4PB 3GG2A 3H11B 1GPDG 2IA5A 1EFDN 1TGYA 1CD5A 3QPUA 4UBMA 1SIUA 1R5OA 3AU8A 5LD2B 1UBKS 2OPBA 4L8WB 2PYZA 4KH0A 4OATA 1ULZA 2XWPA 1UBJS 3EBOA 4MV7A 5TS3A 3T9DA 2GX6A 3KEFA 3IS3A 3WHLA 1DCMA 3D4OA 1BFDA 4F8JA 4ASUD 4HDRB 1CUIA 1RRGA 4FTWA 2XZLA 2R87A 3A1WA 3WGJA 4AIRA 1Q3HA 4QDOA 3VH1A 2VO1A 4BJ3A 4O0LA 4BFLA 2JPDA 3OWXA 3HFSA 4YT5A 1RU3A 4TQAA 3IP9A 4RZHA 4QEDA 1D0IA 2ZYRA 3ZS8A 1YNOA 4O4LF 1GT6A 2XD4A 4OXQA 1Z39A 2NZUG 3QOXA 1UQRA 4QXAA 5AI6A 5KS2A 2MMCA 3DDWA 1NY6A 4G1MB 1LF0A 1MPTA 3KS9A 3U26A 1HEUA 3PRJA 4E5YA 3BE4A 5BQOA 3A2NA 1ABFA 2XXAA 1QQAA 3T8YA 4JHLA 1U0TA 1G64A 2ZJ5A 2I54A 3A4VA 3GJSA 2VZ8A 5I9BA 2UUBB 2PD4A 1Z6TA 2WW8A 2ZYIA 3DPUA 4B6SA 4E2FA 1NQUA 2D1FA 2DQKA 2REQB 3BJRA 4UUPA 1WPRA 4OUDB 4F85A 4IIFA 2C0QA 1LLDA 5AVXA 3EMDA 3B6IA 3OZRA 1T1IA 3H9EO 4GH5A 4MRMA 4LXQA 5IK2A 1RXCA 3GJ0A 3UFBA 1DXYA 3FAZA 3WWYA 3K0SA 1C41A 1TTQB 4OHKA 4DDTA 1DLIA 1UPTA 3VKGA 4MP8A 3QVWA 4XLZA 2YICA 1UJCA 3DEJA 1USGA 2AFIE 1I30A 3NGMA 1EQUA 4KODA 4M9SA 1ZS9A 3V8RA 1NVAA 3ESZA 3I4LA 4QPCA 3HR7A 2HXGA 5IBQA 4JUBA 4PX3A 4RZSA 5L45A 1R0CA 4JLMA 3W5VA 2YS7A 5M7EA 1CU1A 2OV2A 2C4MA 2FE1A 3PICA 4BNIA 4PN3A 2ZUUA 4CYMA 1TNDA 3P45A 4KXYA 2O2DA 1ISJA 4D1YA 1YB5A 4WK4B 5BY2A 4CL2A 4EJ0A 4NHEA 2GK6A 1QE0A 2WWHA 4LK3A 4AS3A 4YYZA 2A9QA 4OMCA 3BWCA 1N1GA 4RD0A 4W6ZA 1NOKA 3N05A 5G0VA 1DELA 2A7XA 2OHFA 3ONNA 4F92B 2V55B 2X2PA 2FB9A 3TRDA 3U44A 3BQNB 2DBZA 3W8RA 2GKSA 1I3KA 3RHFA 5DYIA 3CMMA 1J0EA 1P2DA 5JJIA 3F7TA 3V2IA 3HS3A 3ZBQA 3IP3A 5FTWA 1OYWA 4J0HA 1MOZA 3IHKA 4L02A 1UT5A 2J5BA 3CT4A 2G9QA 1KKUA 1GGHA 3DZGA 4FMCB 1TC2A 4ZI2A 1G7RA 3N7UA 3KOUA 1O0BA 1EFVB 3COSA 3KZNA 4M60A 2RGNC 5LP6C 1V35A 4D96A 4YRZA 1JG6A 3L5KA 3L3BA 4HUQB 4LHEA 1H2YA 2VTDA 3DE3X 4PCLA 4AMYA 3QEAZ 3LX6A 2O0HA 2F4VB 3R6WA 1QH8A 3LT2A 4GGPA 3HR4A 1Y5MA 4L0CA 3K8OE 4CEJA 3FPKA 4XVCA 2Q07A 2LBPA 3L8FA 2IBMA 3Q3EA 1BOFA 1HC7A 1OIXA 2ZRJA 3DO8A 2VJLA 4WL0A 1HQDA 1QS0A 2Y92A 4YRRA 5TPZA 2ZI3A 1S3IA 1JJIA 3IAAA 4WLVA 2C5EA 2PVPA 3FBWA 3IPLA 4EUEA 1F5NA 4O4JA 4R16A 3D3KA 1LK5A 3TMYA 4CLEA 3AF4A 1QKKA 1VPVA 4UNPA 4YQEA 3DMYA 3SVTA 1CLUA 3PQ5A 4LKOA 1YE3A 2ZUDA 2R8PA 3HU3A 2QT0A 4MUBA 1U3WA 3H86A 3HLYA 3TQOA 2Z6QA 1FS5A 4ZAWA 4B85A 5ALDA 2C96A 2YZ2A 2VXOA 2AYXA 2FWRA 3MWLA 4MUGA 2YL2A 4AU1A 3WV5A 4D0LB 2G07A 1ORWA 1ZM3A 3MAAC 4B9AA 4QXMA 4BFTA 2P4EA 3VUFA 3BD6A 1WTCA 3VOAA 1SO8A 1YZKA 1DKLA 1S01A 1DRWA 1MENA 4P7KA 2VCHA 4AJEA 4L28A 2PRIA 2CK3D 1QIHA 2IYFA 3EZ9A 3GCGA 5EPUA 3WLTA 4ENPA 1Z88A 1MABA 2SCUA 3B7PA 1ZOIA 4S1NA 2OESA 5D01A 5HMMA 1E3TA 1JFSA 4DMLA 4X71A 5L6LB 1YZGA 2DU8A 2P3SA 4RZIA 3ZHOA 4H31A 3A1FA 4G0YA 4Y6SA 4OREX 5A5EA 1B6GA 1OTYA 3CZ5A 3UT6A 3AETA 3VPSA 5FOTA 1TJYA 1O6ZA 2N42A 2F6RA 2PR2A 1KPGA 5KNBH 2P9YA 3C6MA 4L15A 4LVCA 3TD2A 2HHAA 3K1JA 3WB9A 4A5SA 3A9VA 3BZBA 4F4IA 2I6UA 1U0GA 3ZJ5A 3VC7A 3D3EA 1W96A 3LU1A 2IS2A 2HSGA 4TYYA 4TZTA 5EOVA 4ZDJA 1RRFA 3UFXB 1TPZA 1YC5A 4C43A 1DGQA 3GI1A 3ILVA 3TE7A 1ZUNA 2IYZA 4MW5A 5DWDA 2WSLA 4HDKA 1TYDE 3R6LA 4FD2A 2WMOB 2HWXA 3THOA 4RY9A 1W4ZA 5FLXA 1DBRA 3WIEA 5DJ5A 1PFWA 5AXAA 4EEKA 3D6NB 2GHQA 1XFAA 4Q1CA 4OXYA 1CT9A 1Y81A 2OM2A 1OUMA 3GT3A 3UG6A 4CEJB 4NZPA 4G24A 2DCUA 2IIVA 2J3HA 4GYWA 2WG2A 2PCLA 1U2DC 2JRLA 4OG2A 3I1YA 1R66A 1QZTA 1ODIA 2UVDA 3AFIA 3D4NA 3H4IA 2JVKA 2O23A 3JSAA 1H3NA 5CYGA 1TU3A 1BMTA 3PFKA 2QAGB 4E46A 4R2HA 1KSHA 4JMLA 4JSRA 2P0YA 2KS6A 4QHSA 5GOZA 2W2TA 3ZI0A 2EHJA 4MJ7A 4OVKA 3E48A 4ZQEA 2WSIA 1LSUA 1EEHA 4F4CA 2HO5A 3GLHB 3IE0A 3LZDA 2VYNA 2WWTA 4MQBA 4URZR 2C4HA 3FPAA 4ZVOA 2WIJA 1Y4AE 2HWWA 3IQIX 5CNIA 5C8YA 3WZ2A 5FUWA 1E6EA 3X1YA 5HFNA 3TINA 2OFPA 4XLTA 3ND9A 4LJ8A 4EFKA 1V41E 1IBMB 1K97A 2QP4A 4I55A 4BVFA 1WUYA 4LOIA 1WIWA 4LWZA 1QORA 1YOBA 3MUNA 3PI7A 1IN5A 2SCUB 1MABB 3GO4A 1NZJA 5BSGA 5KQLA 2KLHA 1XPOA 3OQVA 3ABRB 1P17A 1ZVKA 2C88A 3ROEA 4O4IB 4D3DA 2HRCA 3C3KA 2I7DA 4HGRA 3DZJA 4EKIA 4YT4A 4QU5A 1N5RA 2ZE5A 4UXJA 4AKEA 1CUJA 2COKA 1YBAA 3UC5A 4BFYA 3AF0A 1LJ8A 1MKYA 4UVEA 3W3ZB 3A6KA 4I9FA 3QNUA 5B3KA 4QTXA 3HI6A 1AQIA 4O29A 1KYWA 3O1JC 2ZUEA 1ONOA 3N2EA 1J1IA 1HETA 3EODA 4F96A 1M5TA 4G8BA 1K8ZB 1K2VN 2AJCA 3IAHA 3RSGA 1JSRA 2ABWA 3WA6A 3WL6A 2ZR0A 3WYCA 5BPHA 1JH8A 2P3LA 4RD4A 1ZUNB 4QYXA 3F47A 4ADSG 3I62A 4F12A 1F1BA 5IZ4A 1F8XA 2BFAA 1CRZA 2FPRA 4FFNA 1SUSA 2IEGA 4RHUA 2Q9AA 2NGRA 3MZ0A 3PNLA 4CFYA 3W5DA 1RRVA 4HEHA 4M1EA 4LRWA 1CG6A 5ALUA 2QKYA 4OHCA 3CJTA 5TEVA 1JR2A 3GD7A 3FH0A 4GBED 1U0OC 2C4NA 1P33A 2IRWA 3RBAA 3OIFA 3I05A 3WAKA 4MDEA 1R6TA 5HILA 1YZNA 1PHPA 2HXYA 1KTIA 2ZYTX 3HADA 1E0AA 3URKA 3D8RA 3HXLA 2R84A 1E4OA 1IG3A 4RPIA 1Z5PA 5COBA 3IBYA 1VCIA 1AKTA 1S0UA 2HD4A 3MUEA 3LJKA 3P0EA 3W7VA 1UJMA 3A0UA 4WY8A 3IDAA 3R40A 4ABYA 1NBEA 1P0PA 1RBZA 1B0AA 4HN9A 1E5TA 2JFXA 1YBVA 4PX2A 4B8YA 2BZ0A 4TTVA 5KJFA 1ZR2A 3V4OA 3OFNA 1DKUA 3RF7A 1LVGA 2FPKA 2TYSB 1AV6A 3WV4A 2PGLA 4M1SA 1CULC 2PAFA 4C4AA 3K2BA 5E4TA 3UK6A 3L4BC 1E4YA 5C8YB 1AU9A 3JVIA 4V1CI 2GPTA 4UHDA 1IM8A 1VCMA 5GONF 1XWFA 4I55B 2FQXA 3HWX1 4JYZA 3CEMA 2RJ3A 2GPBA 4X24A 4JB0A 4DIFA 1U0EA 1C80A 3BWXA 3DDZX 1XMOB 4XM2A 1WSAA 4QOSA 3BH0A 4X90A 2EFCB 2C1EA 3G2QA 3UUGA 2I6QA 1AS0A 3OF5A 3AYXB 4ZYYA 5BYKA 4U1RA 2N1BA 3S40A 1VPDA 4KPFC 4MQFA 2F3TA 3PHIA 1N5KA 1E3WA 1UMBB 5EIHA 4QM6A 4QBTA 4MGHA 3F6YA 3K92A 1EGMB 1MAVA 3R77A 4B3RB 3QMVA 1C3LA 3E18A 4G36A 4M0PA 2X0RA 2BWJA 3MFQA 3N6VA 1MIOA 1MPXA 3AZPA 3VJRA 1P2FA 2NZ2A 3INTA 1WA5A 5EJ9A 1DC3A 2EFHB 2OAEA 3C48A 1R37A 1SUBA 1LFAA 1LRJA 1VLMA 2FWPA 1NXVA 3O8OA 1QLHA 4MZDA 4BEJA 4YS6A 5JYCA 4EW6A 1NVTA 3ISJA 1SQGA 1UXOA 4MQ5A 4NYIQ 3W06A 4UDNA 4Z5XA 1XD9A 3KQSA 3I45A 3OM8A 1E2PA 2JI9A 1HRDA 3L8ZA 2I80A 3WO0A 4QULA 4KLRA 2HTFA 4GVLA 1XRQA 3BFVA 4PYJA 4TLCA 4TWAA 1M2EA 1EK2A 3KZVA 4OM8A 4U6NA 4W99A 1CY0A 2ETVA 5CYFA 5L95A 1MU0A 1PCXA 3C8DA 4AKTA 3FZQA 3AUKA 1PV2A 2IEBA 1QYRA 4BQPA 16PKA 4CEIB 2BGKA 1I3CA 2VJKA 3JD1A 3OH8A 3RSZA 1M34E 1ZK0A 5DVZA 3DT8A 1RLMA 4A92A 2QQEA 2GCIA 4IJWA 1Q22A 4RY0A 1DJOA 2XJ9A 3C3DA 1Q6ZA 2Z8YA 5D1NA 3G8AA 1Y9DA 2OLKA 4KXNA 3ZD6A 4BO9A 1UOOA 2PFKA 1HYGA 3C3CA 5K3OA 4BNKA 3LVFO 1J8VA 3I30X 3K94A 4AJKA 2BKXA 4FUTA 5DOVA 3GVHA 1KPHA 4FE7A 4D2IA 4POOA 2PXCA 5DXFA 1ONBA 4HEJA 3ZHZA 4G89A 4EWLA 5JADA 2BW0A 2PA3A 5CVJA 1FFSA 4Q7KA 2GZDA 3NH9A 5F35A 5I5GA 4YP6A 4LIPD 1FBNA 5L3RA 1EBBA 2WAAA 2BGWA 4YR9A 5IRCD 4W8OA 5LUBA 1CF4A 2PGJA 2QXYA 5U1PA 5BN1A 3KQOA 3OECA 2J5QA 2VXBA 1IXZA 1K75A 3DT6A 3I01M 3U5ZB 4PIPA 4L8YA 1XNRB 3CH7A 1JEJA 3ZQ4A 4EVQA 1CUXA 4MQFB 1YUBA 2GLXA 2AG5A 1CR4A 2AOVA 1JN0A 2D3TA 4M8LA 1GKKA 2CC2A 3FWNA 5CVCA 4ZOLA 3SNKA 3VR5D 3Q6MA 1BVYF 4AP9A 3B82A 1Y34E 3QBEA 5JNLA 4NH4A 3NMUF 2J0SA 2C8LA 1KOJA 3WBKA 5LIRA 4HNGA 5F3WB 3R5KA 1BKSB 3QI2A 3GRRA 5DSZA 1GARA 3LL4A 5HJEA 2P6RA 2AUTA 2ZRQA 1EIWA 1MIOB 4DT1B 2QMHA 3LP5A 1C3OB 3VI4B 1A76A 5FTMA 3O3OB 5CX4A 1VIVA 3HLTA 4ZEWA 1Y4UA 5CFOA 5KWVA 5L4LA 4L8FA 1GLVA 1ZHOA 3O8OB 2KX7A 3G68A 4EJMA 4ND7A 2C98A 2ZSAA 1FNMA 2HRQA 4S24A 2HK8A 4B75A 4GOJA 1X0XA 3CLTC 3WFJA 4TM7A 5AVVA 5CD9A 2WIFA 1Z0KA 1JAZA 1JPVA 2YIMA 1C2TA 1FFXA 3M3HA 1K6JA 4QUHA 2XAUA 2YWJA 3AB3A 3ZBTA 3M6UA 4F72A 3RRXA 3NEYA 3TLMA 2J9RA 3AEYA 3LFHA 4PSUA 3CNLA 3DTTA 5A71A 1S2DA 1ZKDA 4CM4A 5GADl 2EBWA 4ZHQA 1A72A 1MFPA 1YQQA 1XEWX 4H0NA 2P30A 3E2MA 4NZZA 3RSHA 5BVGA 1SEVA 1P4GA 2GKGA 2NSLA 2ZBDA 4MR9B 2IV2X 3W77A 2Q1SA 1ZVVA 3LV8A 1H4TA 1VHQA 5DGHA 2WTNA 1O8CA 1SHLA 2QJFA 2XB9A 1E1LA 3M6WA 2BCJQ 2BGUA 3EVNA 4DTIA 1XU9A 3CUTA 3IKJA 3PU6A 3WTCA 4AG6A 1UBLS 5FYDA 1YBHA 2Y99A 2QQ0A 4X65B 1VDZA 3A27A 1D2RA 4QRDA 5DCWA 3C15C 2WJHA 1I8TA 1IZ0A 4EO7A 1VKJA 3FJYA 5AW2A 3OJ0A 3DKVA 3MB8A 3A9WA 1RYEA 1TIKA 4BE9A 3TUZC 3B5EA 3WRXA 3JQBC 3NYQA 2R96A 3O92A 3OT1B 2G36A 3N8IA 4ER7A 2XB2A 5CGQB 3KSDO 4BHTA 2FPGA 2OYCA 5IHXA 5KYGA 1XXLA 2CCJA 2WJGA 4MWCA 4ARIA 1UDCA 3QFTA 3N5KA 4GBMA 4J1SA 3AJAA 1ILWA 3LRXA 4DBZA 3BUSA 2NU8A 3W1WA 1YTUA 3DUFA 2R2GA 1V9SA 4FCWA 2KE5A 3B48A 3WK4A 4CMHA 1CIJA 1YACA 4C08A 3R0VA 1XYYA 3L7LA 3CB4A 3T3PB 5K7SA 1JWLA 2HSWA 4TT3A 3F5DA 2HEIA 5H9WA 2H59A 4JUIA 5KNDA 2ZGVA 1RM5A 4AZTA 1UF9A 3SX2A 1LH0A 3ZNOA 1TF5A 3TOSA 4YMVA 1AUVA 4PIVA 3UXYA 1P1JA 2Q6KA 1LDBA 3I1FA 1ZNZA 2VRBA 4CIXA 1TL7C 4FQ7A 2OV4A 5F23A 1OX5A 1IUKA 4NJMB 4C4PA 2GERA 3O26A 2BUAA 3CIOA 3E9ZA 1K4MA 3QPWA 4M7OA 1JL3A 3C39A 3P2JA 1E7MA 4OHPA 4Y2JA 4NZOA 1QFZA 2AMFA 1NI4A 4MGIR 4RBNA 1ND6A 1MB0A 3PPIA 3PC4A 1FFXB 4AJOA 3MHTA 3JCZA 1E20A 4LOHA 4PLZA 4DAEA 2GYYA 5DH9A 3MEQA 3ROTA 5HF5A 3ODPA 4UE3S 2J85A 3NWBA 2H0AA 1T4GA 4A4DA 2X5JO 1W7AA 2WU3A 4A82A 4ZHQB 2B7LA 3CF2A 1GT91 3IEPA 3QI7A 5BVGB 4ARZA 421PA 4B33A 2WKPA 5KU1A 4JROA 3DE4X 4IHKA 4X97A 4XYEA 3JAKA 2Z6VA 1IOLA 1GG8A 1TZ2A 2OORC 1DBPA 2Q45A 2Q27A 1ZBQA 5IAKA 1IRXA 1P1RA 1ZGHA 1DRUA 1MRZA 3JQAB 4BATA 5B58C 3D59A 1RADA 2GNOA 1TKRA 3K1TA 5D87A 4QM7A 3FHLA 5K0NA 1VRVA 1XIVA 4OEHA 3WSTA 2GXAA 1U0SY 2VBIA 5DRYA 1G3RA 4N8SA 4EEZA 1FXWA 1HE2A 4WJLA 5C8DA 4D4HA 5F7OA 3IPRA 4ZYLA 5T6MA 1UJ2A 3KJNA 4EVSA 2Y9PB 5HUQA 1K8YB 1UAGA 2MSEB 1WSWA 2ZBEA 3MRSA 4P82A 5KQGA 2J0QA 1CR6A 2VH5R 4MQLA 3CNEA 3EFBA 1UPFA 3LPAA 3A9TA 4Q4AB 4BP8A 4AECA 3DKIA 3W3AD 1CNEA 2AZDA 3CPEA 3NTLA 4UHJA 4XW2A 1QHHA 3BL5A 4IWYA 3AKDA 4M9QA 1O6FA 4WCFA 3WFIA 4YRAA 3U4DA 1F7UA 2WHXA 3BICA 5B2ZA 4OI1A 2PRYA 3CB2A 3LNTA 4TLMB 1EQ2A 2D0DA 3VAAA 2XVMA 2HFJA 3ET5A 1ZWLA 5GV7A 1KNXA 4ZI5A 3IH5A 1EFPB 1PYDA 2FSIA 3Q12A 3D9QX 3N6RA 1NYRA 1SQFA 2M2IA 1EXWA 2Y6UA 3IV6A 3NT2A 4GMFA 4BNHA 1WB4A 2ODAA 2ACVA 5K09A 1CW2B 1UEIA 1YKFA 4IL5A 4EUHA 1DWUA 3DAFA 2W6ZA 4Y2RA 4H7EA 1UMKA 1LBHA 1U0RA 2IPAB 2C4KA 3GUYA 2WU1A 4LX8A 4Q21A 3UEOA 4JBLA 2XITA 2QVBA 4MGZR 1IATA 4B74A 2YXDA 5CCXA 1D4FA 1QHIA 2YQ5A 1TVCA 5B6JA 4Y18A 2P4SA 5FOSA 2FPXA 1JIIA 3IYLW 1H8HA 4MQUA 3HCWA 3LLSA 4NESA 2FPWA 4B6RA 2O5RA 3OQOA 1NJ1A 4JXZA 1PRYA 3F6CA 1EFRA 4P22A 3UA3A 5HOQA 4RTKA 2I87A 2JKVA 2N46A 4HXYA 1NI4B 3RYFA 4WFKA 2D1QA 3L9WA 2BDEA 3Q8WA 3V2UA 4D7AA 2C9CA 3EYAA 4DWJA 2PH7A 2E7ZA 2VJMA 4R5MA 5ERYA 1AQLA 3W34A 4CGYA 3KPVA 4POAA 4D42A 2QX8A 1OMOA 1XN1A 2PO7A 5EMMA 2WD9A 1I2CA 3KFVA 4FOPA 2C2WA 4XPZA 1SVOA 4DV2B 2F8TA 3A05A 3U3RA 4NF2A 1U2GC 4TVBA 4W82A 4HAZA 1XZJA 2HRRA 2OV3A 1MBZA 3IOEA 1OE0A 5DTJA 2VYVA 2ZAMA 3UMFA 2IHKA 3ORYA 4WWHA 2QQGA 5CB0A 2AJTA 4OQ4A 4D98A 4GPBA 1J8DA 4JGIA 3CXUA 5JEDA 2NUAA 5ALMA 4D45A 2XA2A 1T6YA 1LW6E 2NSYA 3H6HA 2P62A 1F0PA 2Z0MA 3L6UA 2QSUA 1VL0A 3U4AA 5FDFA 2VKQA 1Y1SA 4M0UA 2R5WA 1JQ5A 4DLVA 5LZ9A 2ZWIA 4QEKA 1IWOA 1ISSA 2W6MA 1KJJA 1QWOA 1U9IC 5DT9A 3B1XA 3PF9A 4PHCA 3EF1A 2V1UA 2PKQP 4G0QA 1U7WA 1SNYA 1E3IA 4W8GA 4Y2QA 4QUEA 3SR3A 3JQ7B 4E2XA 1UJNA 4KWIA 3WLLA 4XUGB 2YFQA 3CH6A 3F5FA 3MINA 3R5FA 5DN6A 1K5HA 3KBOA 3FTNA 2CHEA 1LV8A 2J0VA 1HGXA 3RTGA 1DHTA 3LGAA 4FIDA 1E7SA 2EFYA 4FJ2A 4YONB 3WMXA 3M2TA 3A36A 2RAVA 4B43A 1A04A 1REQB 4I4TA 4CT5A 3CRVA 3CWQA 4X94A 1QF6A 2GS9A 3EK2A 3G23A 1I36A 3GFBA 1GEGA 2WPDD 4LDRA 3F46A 5B7GA 4DZTA 4YV7A 4GGOA 4L3VA 2FYTA 4M98A 5HUHA 1OFGA 1VBFA 1GL9B 3GH3A 1FQWA 4AUMA 4DWWA 2BZGA 4E21A 2NO6A 2DVMA 3TFWA 1VFPA 2W9XA 2XNHA 3MMNA 3PSAA 4EFDA 3F97A 4RTRA 4XWKA 5IVHA 5F33A 1VMEA 5JZSA 1J7KA 3FBGA 3JARA 5FUVA 1ZIXA 2VAPA 4QU0A 5BNTA 3RROA 2WZCA 3QJ5A 4MUEA 3ZWQA 3RYFB 1TZJA 5KOIA 4GM1A 2IEZA 3OOSA 3WJ7A 3ILYA 1VRWA 1SB9A 2VJMB 4GKKB 3QEMB 3NM4A 2W71A 3UVEA 1DAKA 3DB1A 2OFOA 1E3SA 5JECA 1KWKA 1ZN9A 4PZZA 1ZL0A 2VJBA 4V0ME 4P80A 4UOZA 3EPHA 1IE3A 1JFRA 2GESA 4RQAA 5K4AA 5FX2A 4FSDA 4EGSA 3MJSA 3OPYA 3M4NA 1P7PA 2ZBUA 4LAFA 2IV7A 3KEGA 3NLLA 2J33A 1Q11A 3IVXA 2X0FA 2ZT8A 3LOQA 2NPFA 4GICA 3C1AA 4MB2A 4UUQA 3R7FA 1G55A 4B3IA 5EWJA 4HAUA 1L1QA 1N92A 1YASA 3C85A 3TBKA 4FHFA 1X70A 3VX3A 4Q0MA 2PSHA 2QUZA 1YQUA 4EF5A 2E85A 3DOOA 3PLNA 3TL6A 4G0ZA 4LF7B 1M83A 1V16A 1YRHA 2HDNB 2ES4A 3CMCO 3GVPA 1Q74A 1XQXA 5ALJA 4EHHA 3EE6A 2CLLB 3I3SR 5HR5A 2JCSA 2QX4A 3ZBPA 1RJ9A 4OXXA 2AF4C 3DKKA 4D4KA 5I7FA 4ZO8A 1VG9B 3FDIA 4XI9A 4ENQA 4BBPA 1LV7A 1BEUB 1HYQA 3GAFA 2JJ1D 5GM1A 1VLZA 1NMSA 1PL6A 3I64A 4FDTA 3MINB 4HCJA 5AHXA 3D6FA 4UUOA 1Y48E 3PNKA 4NEHB 4EJSC