2B6NA

The 1.8 a crystal structure of a proteinase k like enzyme from a psychrotroph serratia species
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
ADQPSPTWGIDRIDQRNLPLDNNYHTDYDGSGVTAFVIDTGVLNTHNEFGGRASSGYDFIDNDYDATDCNGHGTHVAGTIGGSTYGVAKNVNVVGVRVLNCSGSGSNSGVIAGINWVKNNASGPAVANMSLGGGASQATDDAVNAAVAAGITFVVAAGNDNSNACNYSPARAADAITVGSTTSNDSRSSFSNYGTCLDIYAPGSSITSSWYTSNSATNTISGTSMASPHVAGVAALYLDENPNLSPAQVTNLLKTRATADKVTDAKTGSPNKLLFSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords proteinase K
publication title The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species
pubmed doi rcsb
source organism Serratia sp.
molecule tags Hydrolase
total genus 100
structure length 278
sequence length 278
ec nomenclature ec 3.4.21.-:
pdb deposition date 2005-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2b6nA00
3VTAA 2Z2ZA 4H6XA 2PYZA 1AU9A 5FAXA 1ST3A 1BFUA 5FFNA 4OMDA 2ZWPA 2Z57A 1GCIA 1C9NA 1TM1E 4K8RB 2Z2YA 4C3UA 2WUWE 2DP4E 3VV2A 4HX2A 5SICE 2DUJA 3DE2X 3DE4X 4WOCA 3GT4A 4JP8A 1PTKA 5ARBA 1GNSA 3SICE 4M1ZA 1NDQA 1S2NA 1EGQA 4AKSA 1SELA 1P7WA 3PTLA 3GCWA 1TM3E 1SBTA 5AVKA 1NDUA 2V8BA 5AVJA 3Q40A 1R0RE 1BH6A 3OSZA 3EIFA 1MPTA 4KB5A 3DW3X 1CSEE 1AK9A 2ID4A 1Y1KE 3VSBA 5JXIA 3DDZX 1SUDA 1TMGE 1Y3BE 1OT5A 1DBIA 3GCXA 2IY9A 1BE6A 2XRMA 2WWTA 2SBTA 1BE8A 1V5IA 1WMEA 1Q5PA 4DZTA 3TECE 1NLUA 3P5BA 4NE9A 2SECE 3CO0S 2Z58A 3QMPA 1YJAA 1UBNA 1OYOA 3A3PA 1LW6E 1AQNA 5B1DA 1T1IA 1Y3CE 3LPAA 1TECE 3VHQA 1GA1A 1SUPA 3PRKE 3VYVA 2X8JB 3WIVA 1SCNE 1SN7A 2GKOA 1AVTA 1CNMA 4DWWA 1YJBA 3T41A 1WSDA 4NE7A 5AQEA 4BWGA 2W2OA 1IAVA 1IC6A 1Y48E 4I0WB 5ARDA 5B1EA 3CNQS 1KE1A 1YJCA 4HVLA 1TM4E 3D9QX 3DE0X 2ID8A 1ZVJA 2PWBA 2PMWB 3A3OA 3WHIA 1SBIA 2IXTA 4LVOA 3QFHA 1XF1A 3TI7A 4DJ5X 3DYBA 3L1KA 1YU6A 3LPDA 1KE2A 1SUEA 4CG0A 1SUCA 1Y9ZA 3EDYA 1R64A 3WQBA 1DUIA 1C9MA 3GT3A 1WMFA 3DE1X 1P7VA 3TI9A 2WV7A 1C3LA 3DE5X 1SUBA 3F7MA 1EA7A 1TM7E 1TM5E 2W2QA 5K7SA 4OV6B 1TK2A 3AFGA 1HT3A 3H42B 1T1EA 1KDZA 1OYVA 1PFGA 1ST2A 5AMXA 1AV7A 1SH7A 3BPSA 1Y3FE 3EE6A 1SBHA 3DE3X 2W2MA 3A3NA 1PEKE 3QTLA 5ARCA 3AJ9A 1P8JA 1SCDA 1C9JA 4LVNA 1SCJA 3LXUX 1SCBA 1TO2E 2Z30A 1SPBS 5JXJA 3DWEX 3D43A 1BJRE 4J94A 2ST1A 3WIUA 4CFZA 1SCAA 1AF4A 1A2QA 1GNVA 2DQKA 2PRKA 1TO1E 4GI3A 1Y3DE 2X8JA 1GA4A 2HD4A 4ZOQI 1AH2A 2PWAA 1KDYA 4KG7A 4RYDA 3SQOA 2PQ2A 1T1GA 3F7OA 2HPZA 3VV3A 1S02A 3HJRA 4NMXB 1Y34E 1GTG1 5JXHA 3DVRX 1Y4AE 1GTL1 1WVMA 1THMA 4ZARA 5JMOA 2SNIE 4CFYA 3BX1A 4MZDA 5JXGA 3DW1X 1Y33E 4WOBA 4YN3A 1S01A 3ZXYA 1VSBA 4H6WA 2E1PA 3F49S 3BGOS 3I37X 5FBZA 1PJ8A 2WUVA 1MEEA 1WMDA 2W2PA 4AKTA 2PKCA 2TECE 4H6VA 3DVQX 3Q5GA 1V6CA 2SICE 5I9SA 1GT91 3DVSX 2G4VA 2B6NA 2QTWB 1SVNA 1SBCA 1Y4DE 5CW1A 3AJ8A 4OMCA 1JEAA 1KDVA 2Z56A 4C3VA 1SBNE 2W2NA 1GTJ1 3ZXXA 3UNXA 3DE7X 3I30X 1SIBE 4FONA 1BFKA 3LPCA 3I34X 4KPGA 2P4EA 3DE6X 1SUAA 2ZWOA 1R6VA 1GA6A 1SIOA 4B5LA 2ZRQA 4Z2AA 1SIUA 2XTJA 1ZVKA 3I2YX 2Z2XA
chains in the Genus database with same CATH superfamily
2O8NA 5IK2D 3M6VA 1SXQA 2GTPA 2ZI6A 2W8BB 1H0RA 3IXQA 1JR6A 3QIAA 2F59A 4PCLA 4Y2SA 3EGWA 3H3XA 2JIMA 1GOTA 4RGVA 3IVRA 2OORC 3UCFA 3ZGLA 4B85A 4RTNA 1NJSA 1ZGBA 2GR9A 2NMVA 1J42A 2X5OA 3KWLA 4P2BA 5REQA 2HRZA 3ZS8A 4QDUA 3B6MA 1Z2NX 4HO1X 3A6JA 3QELA 1OFIA 3PNVA 4XRRA 3VR5H 3L92A 5HQTA 1TL7C 4BNVA 1PR3A 3Q88A 2SCUA 4ZN6A 2GD6A 5DOZA 1C8LA 1R0XA 4N3NA 4P54A 1UM9A 3V7WA 3W8NA 4RHYA 2HOQA 4GEKA 2X58A 1ZR4A 1H6CA 1ST3A 1SUWA 1TW3A 5AKZA 4Z0NA 2IBSA 4KXNA 3NASA 2HEGA 3CEAA 3I9KA 4KQGA 1ORTA 1RYMA 3LUCA 3FDXA 3WLJA 1GCIA 2OB2A 4JEHA 1W25A 4ZXPA 5K4AA 3EGOA 2E5FA 2XMSA 1UPUA 3R5SA 4GI7A 1V2GA 4HR7A 1MHTA 5HGJA 1T5IA 4YROA 1D2CA 3IOMA 2V65A 2XQIA 5CH8A 1T4CB 2IZZA 1T3SA 1VL1A 4ZHQB 3P27A 4JR0A 4EG8A 1N5LA 1Z06A 1E3IA 3IAM6 3JXEA 3D64A 3AVXA 1JLHA 1Q0UA 1F1JA 1J25A 1RM0A 3MD0A 2B6HA 1NI3A 3RYFA 1DUVG 2X4LA 3RH0A 1PJ2A 1UEXC 1QG0A 1TJYA 3LY7A 5DGHA 3J81A 2WJJA 1JFSA 4TKUB 2IPLA 4ZI7F 4AD8A 3KHKA 3Q5DA 3ZHQA 4JXJA 3ZWXA 2IZ0A 3VH3A 4B87A 2JA2A 1V4NA 2GK4A 4WRRA 3TXAA 4G65A 3KV1A 4I14A 3I92A 1F14A 3RRYA 4DNPA 3GUZA 1VJDA 1FRQA 5TARA 1NDQA 3CF0A 1KI1A 3HV0A 4Q7LA 4DQXA 4E13A 3UBTA 3FDZB 2X3YA 3ZDZB 4F71A 3PZRA 5HGXA 4UMDA 1X7ZA 1VLVA 2ZTLA 2QSUA 3QVKA 1RPTA 1U5AA 2I2AA 3E8SA 1J0DA 1BD4A 2O2JA 4IDBA 4QA9A 3FPEA 2ZI5A 3T7JA 5JRZA 4K87A 3BH6A 1MVNA 5TDHA 1YUMA 2G28A 2HQSA 3DMNA 4BUZA 4RV9A 3U3MA 3EGCA 1QKKA 3QLVC 4ZAVA 5LQDA 4MYUA 2B8WA 3IPXA 4KGVA 4JK3A 3ZNQA 1T3HA 3NC4A 5F2EA 2PT7A 2GAOA 3SEFA 4AM8A 4HV4A 3FPSA 1XEXB 2EQBA 1IE3A 2O20A 2ECOA 2VJPA 2WJAA 3OPNA 2PUHA 1HRDA 1PJRA 3QOFA 4WZBB 2VQFB 3ZI7A 1SXHA 4QWMA 2YZNA 3HRKA 2Z8YA 2Q5OA 1MPTA 2ZYGA 2J3QA 2D1FA 3MJVA 4Q4JB 1BXGA 2ATXA 4O0LA 4R54A 1ZM9A 5EIEA 4LPSA 4JQCA 4D57A 5DI9A 1CJUC 4F2WA 1L7AA 3ELUA 2Y66A 3A1SA 2DBRA 5ANRB 5A5GA 2J5KA 5T64A 1EK5A 1U8FO 1XVTA 5AWFC 3WGNA 3L0CA 1EFRA 1MO6A 4JSTA 1XZHA 2CFTA 2Y2VA 2OPBA 3I1IA 1V26A 2YJ6A 1YFKA 4OXYA 5JXIA 4UTOA 3ZHUA 4DBLE 2ISSD 1QOPB 3E8MA 1J24A 4HYEA 5CLLA 2DPYA 3HJUA 2QM0A 5DM70 2P7HA 3BQ9A 1BJKA 2ET6A 2P78A 3WKDA 3SIXA 3P9CA 2PO7A 4IWNA 3U7QB 1ULSA 3WNDA 4PNZA 5DIZA 4II2A 3OMLA 3UOAB 3CC8A 2YXLA 3DH0A 1USIA 4LNUB 3BULA 1QYXA 4HTFB 1AK1A 1PTJC 1R0YA 3IAEA 3IE1A 4JFAA 2BGGA 2A1IA 4BO5A 1P0MA 1A5SB 2O2EA 4RORA 4TZTA 3TQOA 3S8EA 1XMIA 3LX4A 4HSGA 4YNBA 2VSYA 3MQFA 3P5BA 3GHYA 4IIUA 2UXCB 1E8NA 4YRLA 2PX2A 4WQMA 1EFHA 2NVUA 4DLKA 2CV0A 1E8MA 4TRJA 3H19A 2PX0A 3C43A 3OI7A 3QMPA 2EWMA 4N7BA 4R0MA 3LK7A 5HX7A 2ONYA 1BZYA 1UBNA 4O4HF 2XWBF 4JFRA 1ZESA 2RC5A 1ZICA 3D0KA 4OHCA 4GHWA 1D09A 4PLVA 2YV5A 3CUEF 2V6MA 1HXHA 2W8BA 5FA5A 2RFLA 3MCVA 4OXIA 4UBJA 2X86A 1BWRA 2GBIA 3DXXA 1E9BA 1ZL2A 5I9MA 4E2XA 4EB3A 3OM8A 5AO9A 4US1R 5EJ4A 4CT4B 5M2QA 2DU8A 1XO1A 4NCAA 4Q37A 2H16A 4Q4AA 4HNGA 1AQNA 1RXYA 4MB2A 3ONDA 2ZIAA 4JA0A 4RZ2A 1WHSB 1NVKA 3I6BA 2R7AA 4FKZA 5I4KA 1U99A 1ZGZA 3OU6A 8LDHA 1O6GA 4FHZA 2ZJ5A 4GI2A 1SUPA 2QRPA 3UBMA 3LIPA 2P62A 2ZJ4A 3NIFB 4FX5A 2IWRA 4X62B 3KE9A 5G0SA 2P27A 2Y0DA 3WWYA 3PUVA 1RJWA 5AVOA 4AJJA 1YZFA 1U1GA 4CFSA 5I51A 3OCXA 2BLNA 3NHFA 4NFYA 5IVHA 3A3YA 2ZRFA 3T0GA 2AJDA 1X87A 4GC9A 3R7DA 3Q3HA 1ZNYA 2QMZA 2C9YA 2FZEA 1XPRA 1UIMA 2FVYA 3D4OA 3CW8X 3TAXA 5EE1A 3HWX1 2YN0A 3KOMA 4IQGA 3NG1A 4EECA 2ORYA 5TJ9A 5ARDA 2IYEA 2MSCB 4GT1A 4P08A 1PUXA 3FNFA 2IXBA 1Z83A 1I7NA 1PW5A 3EBLA 1T13A 3G2OA 4IMRA 4ZHQA 1QGUB 3FCOA 2CXNA 3U3OA 2G83A 4RHXA 2OBFA 1LC3A 1Q1AA 4MRSA 3NPAA 2F3RA 2QVCA 1DQSA 4OXKA 3JQ9A 3OETA 3CSDA 3QJ5A 4KXWA 5EG5A 1OXXK 2FU5C 3NVAA 3CX3A 3QPAA 1JAXA 4MPPA 5ICSA 4HNAB 4P4UA 3CS3A 3FSRA 2WPDD 1TEHA 4R8VA 4NZPA 1YQQA 2UVDA 3LCVB 4JXXA 1XRNA 4ON9A 4PBSA 4KUHA 3RRBA 5AKGA 1UPCA 2OTCA 3CUKA 1NTOA 3X1DA 4FYKA 1L5MA 2NNWB 4DB2A 1I24A 3I64A 4KXXA 1Z73A 4XA8A 2QLFA 3UJCA 5HJEA 3IEVA 3EMBA 3EIEA 4OGGA 1K5HA 1XEWY 1P72A 2HC9A 2OFFA 4CBVA 4EAQA 3DLBA 2J0UA 4F5WA 4OLHA 3GJ0A 3CBQA 4I99A 4IFBA 3OJOA 4TMVA 2DFDA 1IZ7A 1IY0A 1SULA 1T4MA 2VWHA 4LZNA 2EC5A 1EUCA 1G55A 1KIMA 1KTVA 1WMSA 3DT8A 4JOBA 2RHWA 5CYFA 4BMCA 4EGQA 1TA9A 4EUHA 2PBRA 1DWOA 4MMYB 4DC9A 3LDAA 4K46A 4P33A 1R9MA 2PKQP 1S96A 5A0FA 1IDN1 3X1XA 1XMSA 2YRWA 1RPNA 4LGCA 1TVMA 2Q4DA 1YACA 2YDXA 4MKHA 1NHWA 3LBHA 4AJ4A 2CNOA 3P9XA 4ECEA 2RHBA 1L7OA 1VHQA 4NYJR 2B21A 3S28A 5ESDA 2DUNA 3JRXA 3K05A 4LHSA 1IZ9A 2VT7A 3GQBA 1F51E 1G20B 2P5YA 1P7VA 3WLEA 3BG5A 4JS0A 4TLDA 3OY2A 4Q4HB 1RXIA 1EMDA 4WESB 3ILVA 4TTIA 1XEXA 2G1KA 3DMTA 2XMRA 3TRDA 3V8BA 2D59A 3I1JA 4KQ9A 4XYMA 1X9HA 3QUBA 4MWZA 1KEEB 2CFSA 2AWOA 3A6LA 2ZB2A 1Q22A 4OMUA 1SPXA 1IK4A 4OHWA 2H0RA 2CVHA 3M6MD 1ZJJA 1R1DA 4DM4A 1IM5A 3VR6A 3GFGA 4N5MA 4ARZB 1F7UA 2O8EB 1YKGA 1WY7A 5IRCD 1S89A 3MBOA 3WA6A 3HUTA 5CURA 3CGGA 5JQGF 1G5HA 3R3VA 1QE3A 2GYUA 1MAVA 1LI5A 1TQ4A 3KYCB 3TIGA 2CL6X 1T2FA 1CQZA 4IAOA 1XLVA 4J2OA 3DMRA 4WWHA 2CCJA 4S1WA 3OTOB 3DFIA 4HRAA 5L7WA 4UC0A 3O3OB 4I1VA 2P6MA 3U7QA 4Y2VA 1N5RA 1IMJA 5BYAA 3RS2A 3ABOB 4LNUA 1Y1RA 1SBHA 1D2AA 2V5VA 2O8CB 4HTFA 4MWOA 4D02A 3WZ2A 2CGEA 1RRKA 2EOAA 4IMJB 5D3MB 1QF6A 3OX4A 2R66A 4WPGA 4EBFA 3PUHA 1DEKA 4R1SA 4ZQIA 3K2EA 3A10A 4TYQA 1JVSA 1U1CA 3L9XA 4OOEA 2P3LA 1XOIA 4WJZA 2HSDA 4LJLA 3VH4A 3UHAA 1FZQA 4JVLA 1WPQA 4IQ0A 3U61B 2ZYTX 2WAOA 4N8EA 5TLSA 5ENVA 4Y6RA 1D2HA 3LXUX 3NS7A 4B4VA 1DE0A 5KVAA 1IZ0A 2DLDA 3K3PA 3B1VA 1J49A 4WZBE 3NBUA 1KKMA 2VXOA 2R5NA 3OLVA 4FC6A 3V4FA 2BI8A 4IRUB 3KVRA 4Y2RA 5BWBA 2V3CC 4RK5A 4MWBA 2X0KA 3HNPA 2C9OA 4MGIR 4NJMB 5KIAA 4XCXA 3M4NA 3B2NA 1DWPA 2BEUB 1C1DA 1EP9A 5FUBA 2Z8YM 3EGDB 2OYSA 3EZYA 4DCPA 2FR8C 4Q9HA 1PV2A 1OX5A 1T25A 2MYTA 2TSYB 3CWCA 4UM9B 1YFJA 2LV8A 1ZEMA 1WHSA 1ZW6A 3AHJA 5T57A 3ZV4A 4BLVA 1FF9A 2YIVX 2AB0A 3BC1A 2GJKA 3BL8A 3G02A 1IOLA 3ODGA 2QP3A 4X6LA 1D6SA 4YGXB 3ZWPA 4D0GA 4Y6SA 1BGWA 1VG0B 1TO1E 3OZDA 2H5EA 3EHEA 4BRSA 2DXIA 4BN5A 4F97A 1HTTA 4HS9A 5FBWB 1Z07A 1GKYA 2VWGA 4GP9A 5D86A 4B4UA 5CJ2A 1ZAYA 1DC4A 2OHIA 3GLVA 5JCOC 3L84A 5T4BA 3O8QB 4IJMA 1KZGB 2PRYA 2OKCA 4C30A 4G67A 1BHJA 4JBYA 4OLAA 3BWVA 1KVTA 3IT3A 4MKXA 5ALOA 4NC9A 3B89A 3T7KA 1RMQA 2O2GA 2PQ6A 1JBEA 4NMXB 1V16B 2QG4A 3H84A 1Y34E 1GNLA 2MMCA 4WCVA 4NFLA 5BSGA 1YONA 2QZSA 4Z0HO 1KI4A 3MILA 1M2HA 3DVRX 1IUPA 2J6BA 3V2HA 5JS7A 1MCZA 4PICA 1FNBA 2BI4A 2ZOSA 3OTHA 1QCDA 3HN2A 4C4OA 1DAPA 1PJBA 3FFWA 4BZWA 2H7VA 1GEEA 1SRRA 4ISCA 4HGNA 4HNAA 5EHZA 5JTTA 1SUFA 5HMLA 4JGIA 1HEUA 1J7JA 1P4SA 3CJRA 4YJKA 1AS3A 3VZCA 2Q3LA 3AF1A 4MUKA 2JF0A 2Y0CA 3A4TA 1NMYA 1NJ8A 3RG2A 3ZZNA 5A6VA 2ATIA 7ADHA 1EXDA 1T5DX 3V8QA 5EE5B 2BMWA 3WIEA 4BLWA 5AFSA 2ZM5A 3BIFA 3FETA 4XFKA 3MYRA 2CHGA 1SVLA 2DR2A 2E21A 3CRMA 4UOEA 4LRSB 1HEYA 1IN7A 2GSWA 4KXLA 1FRZA 2JIRA 3NDPA 3PHIA 2VRNA 5CT5A 4J0JA 5J4HA 3CISA 3IVCA 4H6WA 1B00A 1MXFA 1Y0BA 2R6GA 1T4DA 1XNHA 3QVSA 4IS3A 2VYFA 2QMUA 2OAEA 3IIKA 1YMUA 3O0DA 3PX2A 4GMGA 4URFA 4OP3A 5FO1A 4YMUA 5A05A 5CEFA 4CM1A 1WULS 4UMFA 1XAJA 3TW4A 4DRYA 2HT1A 1A4XA 1Z7YA 4KRGA 1GUAA 3KQMA 3ESXA 3ZLTA 1WM1A 5LQCA 5EPOA 2NPOA 1G20A 3ZS9A 2IHBA 3UH0A 1K63A 2PD4A 3A1CA 3E5NA 3F71A 3GP5A 4V39A 2R2GA 2VPIA 4XUDA 2B2XA 2JGRA 1U9IA 2XDAA 5CDGA 2JLWA 1KEEA 1Y6GA 3PQCA 3LCJA 1V6CA 2JVIA 4JY7A 1VYUA 3H2BA 6REQA 3MJHA 3TK1A 2A0XA 4KE6A 1CRPA 3UWDA 4LF9B 4NOKA 1P0PA 2E55A 3KQNA 2G4VA 2V6GA 2WIJA 3W77A 3RWBA 3MWDB 3VH2A 4X6XA 4QTZA 2A3RA 4R05A 5DCWA 4ARZA 2O8EA 4UEKA 5J43A 2P5TB 4D43A 1T6XA 2N1MA 2CXOA 4ESVA 3NWPA 2Z98A 3QPVA 4PWYA 2EZ9A 4TTJA 5IKOA 2NU8B 1T4BA 1USWA 4ZCPA 1JHQA 4Q05A 1IXYA 1IVYA 2FHPA 2NO4A 3T5CA 4DIDA 4FXOA 2BW0A 2E9SA 3NOOA 4QLBA 3H87A 1G9XA 3JD1A 1C9EA 1OFHA 2QXTA 3CNOA 3ZZ0A 4M0EA 3N59A 3BWDD 1Z0ZA 1UBKS 3DTYA 2O8CA 2I4MA 1RCUA 1Z0JA 4RCYA 1XAGA 4YO8A 1G42A 2EKZA 2GHRA 4YCSA 3VOTA 3PNBA 1K6IA 3CLRD 2YZKA 5FUYA 4EFKA 1KH1A 5KJ1A 3TVTA 1M76A 5GOTA 2DERA 4EF6A 1X9GA 2L18A 1WKBA 4LHYA 1G60A 1E79D 1JHPA 1XQ6A 2A3NA 5J9FA 5UKDA 4F5ZA 4TX1A 4B6OA 1WMAA 3G0OA 4DLZA 2QROA 3B1FA 3HCBA 2YC4C 1JPJA 3I6IA 3K9BA 4YFYA 5BMVF 1M6YA 2PKQO 4Z2AA 1HE2A 3BMCB 4FB5A 4G5QA 1KA9H 5C4MA 1OBVA 2V54A 4MW9A 4RKRA 4HDNB 4DA7A 3B78A 2JFOA 4Q1DA 3EA5A 2M98A 3R9XA 1II8A 2A14A 3BE4A 4A6EA 4F56A 4NJMA 5D7BA 4XVUA 5F7OA 4QUBA 1V8ZA 1VZ3A 4TKZA 3EGDA 4YCAA 2GDJA 2C1XA 2JATA 3HCPA 5K51A 2WSYB 4LSWA 1BSVA 2VDVE 4AKEA 4ZK6A 4JI8B 4F3KA 3T4PA 1K7SN 5FAXA 2WYWA 1YVRA 1L9XA 5IBQA 4CR7A 4AKIA 3PQ7A 4G5SA 2QD2A 4GGOA 1Y5NA 3T6KA 3U7FB 3CKMA 3QI2A 1QK4A 3C3BA 4I55B 1P3JA 4MYDA 1B15A 4WL0A 2ZJFA 5EKSA 5HK8A 4JI1B 2GAFA 5AOAA 4J3FA 5I9BA 3I28A 3KZ1E 3OSUA 2B25A 4GVLA 4OJMX 1NN5A 1NLFA 1FX1A 3T4XA 1KI6A 3W9UA 1VPEA 3KEFA 3LYHA 5A71A 3O8QA 1QV6A 3FTFA 1ZGCA 3VM6A 1QJ4A 2J9FA 2P65A 4EHJA 2FZ4A 4NQZA 2OXRA 1NQAO 1NE2A 5EESA 5FL7D 2WWXA 5DK6A 1E18A 4KFRA 3ZXSA 5JHHB 4B76A 5LLTA 5IBRA 4NFSA 4DDMA 1V16A 5IZCA 4D9KA 1Z75A 1L7PA 4P36A 4M0KA 3AERB 3EGEA 1WPXA 3TQFA 1DARA 1XZMA 2C03A 2FFRA 4Z0TA 2IQ5A 2R8BA 2P9YA 1TC1A 2PPVA 3HEBA 4IVNA 3DCIA 3LKZA 3VO9A 4OH1A 1ZX1A 1I2MA 1OIVA 3GD7A 4BBPA 2DP4E 3TQRA 3K9WA 4W82A 1GV1A 4CYMA 3JQPA 3TKAA 3DAFA 4FGWA 3FAZA 3VVCA 1UOQA 3SVLA 3PD1A 1VIVA 1UAYA 4POAA 1QANA 2ODEA 3IS3A 3I9V6 1TKCA 3DMFA 2VDKB 3C74A 3FJOA 2KHZA 3QMMA 1IZYA 4YMIA 3AHHA 4MVJG 4YCJA 2QU7A 5JCXA 1UJ4A 2BFCB 3A4YA 3RFUA 2FN7A 2RHGB 1P3Y1 2E5LB 2C00A 1A5AB 1MG0A 3AFOA 4PC3A 4IBOA 5JC1A 1VRVA 1BCSB 4ZO7A 1W49A 1DG3A 2ZWVA 4AG6A 1C3EA 1HE8B 1AMNA 2J0QA 1MIHA 1T24A 2FN9A 4DPKA 2YJTD 1K8XB 1Y5RA 2QTLA 1EGAA 2FSGA 2HPVA 3EAGA 4KAJA 3BWXA 2YHIB 4LISA 4QEDA 4RFSB 3SK0A 1K1EA 1UBUS 3HV2A 5G41A 4WCFA 1AGPA 4B3GA 4QOFA 4REOA 4BEJA 4EI9A 3T7SA 4X3CA 2GN2A 3H5TA 2PSFA 4KL8S 5HJ7A 1VYHA 5EPUA 2NOAA 3BMNA 2V3VA 1KJIA 1U7ZA 5KQSA 3K5HA 3BMXA 3S1LA 3PDJA 3IFSA 3QU9A 2XYQA 3WGUA 3MFYA 1YBMA 1MENA 3EIFA 2DT5A 4CN8A 3WY9A 1EESA 5JJ5A 1RM4A 1Y80A 3CM0A 5F78A 2PX6A 3B12A 3GDOA 5FTJA 3WFZA 3MWDA 1P5HA 1YR7A 1U8AA 3OX3A 5HDBB 4DDVA 2ID4A 1Z33A 4FI3C 4F6LA 2Y1DA 3C87A 3DXFA 3L41A 4M0LA 3TO5A 3PI6A 3RVQA 2WABA 2NU8A 4CIXA 4KQFA 2X1HA 3ADBA 2OFPA 3A1UA 4OJYA 4MDEA 5IMBA 4ND4A 3I05A 4GBED 3VDQA 3UHPA 4UM5A 3U1BA 1FTSA 4JGBA 3LVRE 4QPPA 1NDHA 4OXXA 5A0VA 4FI3F 2NU9A 4RK4A 4TOIA 1WP9A 3WLRA 5KCZA 3U60B 1S8FA 2IY9A 5C8YB 3J81k 5E7MA 5HEKA 1FVHA 4DIUA 3SEAA 5K2OA 3DZCA 1Y3IA 4NCIA 1WB6A 3B1WA 3RBAA 3L4EA 4IDNA 4FD3A 2M2IA 1N2GA 2XMBA 3S2UA 3WQQA 1NZDA 2V45A 1IK6A 2H8GA 4Y2UA 3S8YA 3QV2A 4G5OA 1M1NB 2KE5A 1OXVA 4GS5A 2CLIB 1W85B 3JW8A 3QOYA 5K8JB 3H3FA 1Y6RA 3W8RA 4V24A 3WGGA 2ZK7A 3ZEAA 2H7XA 3JQRA 2XB2A 4KSYA 2RI1A 1Z8HA 3EW9A 3BMCA 5FDFA 3CO0S 4TRMA 1BRMA 3BHJA 5CPFA 4NH0A 1FBTA 3I04A 5CNIA 4HDNA 1XVLA 4A0FA 3KQKA 4BEVA 1ECLA 1S2IA 4DLPA 1WQ1R 3BXXA 4O2AF 5B4TA 1CW2B 3G79A 3I76A 2VTEA 1A8IA 3NVKI 1HX7A 2AUTA 3B3QA 2WTBA 4G2NA 4M9QA 4FEEA 3GNTA 4QXRA 4BYGA 4CU2A 2AYXA 2XWQA 2YY5A 3KK0A 1BU5A 1KAQA 3CZAA 1O03A 1WD7A 3KT3A 1KFEB 4FDUA 3CV3A 3WP1B 4W5QA 1NVFA 3UWSA 2QXUA 3V1MA 4MR8B 1L5SA 1X70A 3E6AA 3V4ZA 3AKEA 3H5LA 1RWQA 4CM8B 3DL7A 2FRVA 1T8TA 3L40A 5DW3A 4I55A 2GILA 2ECQA 3AEYA 4IRXA 4MUMA 2HRQA 3VPGA 2I3ZA 3IHTA 3ITNA 5KYYA 5CIQA 1MEJA 1V6SA 4OBWA 3TLXA 2PSEA 4EZEA 3OO1A 1XL0A 2IT1A 3OLWA 2ZROA 4XX0B 1VLQA 2P2YA 3AY7A 3C85A 1RWPA 2VDNB 5CGZA 3UJAA 3U9LA 4JDUA 4MMZB 3Q7EA 5AKHA 4B79A 1QLHA 1B23P 1H93A 3HACA 2G07A 1DP4A 1VL5A 1WSDA 3PNQA 3W90A 2PKXA 3FMGA 1QCCA 1NNUA 3BORA 3CKLA 3S3TA 1N8TA 2VP5A 1X7WB 4D9FA 1VTKA 4CLOA 3AERA 2XXBA 5SV2A 2XKJE 4Q7KA 1OFUX 2IYWA 3Q0TA 4AQ7A 1L5QA 4QVKA 2CSUA 4DDUA 5MF6A 3GRFA 2HMTA 1PYDA 1CUBA 1P62B 1Z3IX 2J4CA 1XWWA 2INGX 5IJ0B 4GM0A 2FZCA 3I72A 4N82A 3EZ6A 1NI5A 2ZI7A 4X91A 4BMSA 5JXWA 3ANMA 4A5OA 1QYIA 1V37A 1V96A 3AUJB 2N9UA 4HYTA 3HA5A 1U4SA 2HREA 1MO3A 1O77A 3EVGA 4P9NA 3WHKA 4F06A 4TS1A 1VRWA 4ENVA 4MHTA 1UH5A 2QE6A 4HAOA 3OHMA 5BYBA 3LWZA 4OGKA 2AUMA 5TY0A 5LMCA 5KPDA 3HUUA 2IPXA 2BFCA 3T1QA 3NI2A 4D8YA 3CVUA 2P40A 3K09C 4Y1EA 2GNPA 2XMCA 1JGTA 1ZUNA 4J75A 1TD1A 1BCSA 2A59A 1E0DA 1CY7A 1QPZA 3VJKA 2PZBA 1XK7A 3D4BA 4CNBA 2GO1A 1TPZA 1MHPA 5K0GA 3K9HA 4X7RA 4YWHA 2VXCA 1FY2A 2FSPA 4PPYA 4C4XA 1TU3A 2CV2A 4WK0B 1JQ5A 3CWZA 4D6PA 5KAPA 4OJKA 5J4KA 1VE3A 2ACKA 2J9ZB 1WY5A 2AN1A 2J7KA 1LU9A 3M2PA 4CMHA 4DREA 1NW3A 4Z7QB 4ZMBA 2PTGA 3PI7A 4MLDA 3WL7A 3ESCA 1GPH1 3AVQA 4TN5A 4HP8A 5JDCC 2OM2A 1PZFA 5EERA 1N1GA 1R0ZA 4M46A 5G53C 1T9BA 3ZHTA 3QIVA 3LW7A 1SUBA 1OY1A 2V7WA 3MG9A 4D0NA 4YRMA 2PUWA 1M2WA 3BDIA 3DC2A 3A31A 1WA5A 5LQRA 1F2TA 2NV2B 3OBIA 5EMMA 1GL7A 1VKHA 2AE2A 2BN4A 3FCAA 1QG2A 1E2JA 1KPIA 2HA5A 3NOQA 1HNNA 2EGGA 3OIFA 4AJPA 5K7SA 2GLTA 1C8BA 3PE4A 5DN9A 3WL3A 4URUR 5K2MA 2XQFA 4KLAA 4R41A 4GAEA 3R23A 5M3BA 3QVGB 3UG7A 4MAFA 3GLIB 1JG3A 3LI2A 2VJKA 3TCNA 3RRFA 1M75A 3EG9A 4O4JF 5GADl 4JLAA 1GUZA 3GAZA 3GMTA 5LBUA 2GEUA 3RE1A 1ZNXA 1Y3FE 3A0RB 3IUYA 3JARB 3WL8A 3JAMA 4IG4A 3GLHB 2IV2X 4D4HA 3GFRA 2A5FA 1QRRA 3EE6A 4PZZA 4F2PA 2Q29A 3PQ3A 2I7TA 5F23A 3K9CA 3F5DA 4G5HA 2AEJA 2QTVB 3H8SA 1T5HX 2JFGA 3P9YA 4Q3DA 3WMGA 1U2EA 4JASB 5ALVA 1J06A 5IBCA 4ZVOA 4BMXA 1FRVA 1M1NA 1PBTA 2XV1A 3ZK7A 4LOHA 4UUOA 4NBUA 1XAHA 2P1RA 3KB1A 1B3BA 1JW9B 2PLRA 4E30A 4GE0A 2BMFA 3WQHA 2GAJA 5DM2A 4BWYA 1SCDA 2DR3A 4OLFA 2FQXA 4L3VA 4XGNA 4BDTA 1CYEA 2AH5A 1WUIS 3TIVA 3VYUB 1KO8A 4J43A 5KEIA 1TO2E 2V5AA 1QKJA 1RW4A 3G9TA 2RH8A 3RRZA 1OXMA 1YWGO 3ETNA 3HB5X 1CDZA 4LWZA 1PT7A 2C8JA 2CK3A 5DHUA 5BURA 4IICA 3AZQA 3QFFA 5ILQA 3OQBA 4D9CA 1O5OA 1RZRA 5CDHA 3RVDA 1RHMA 4UCQA 3VR4D 4L51A 4B46A 4B43A 2ADOA 5AT1A 4U7FA 1BGXT 1XZGA 2FEWB 3O7MA 4L27A 4MR8A 1R66A 1STOA 1SCAA 1E7WA 1F5SA 4CIDA 5SYMA 1USKA 1PLKA 1DRUA 4B9EA 1LCIA 1I1NA 1RTKA 3AQIA 1OFTA 3AQ4A 2VP3A 3F9RA 5AJWA 2PEZA 5M29A 3PNOA 3L7DA 4LCBA 1GQYA 3PHHA 2YHBA 1ZH2A 4XX0A 1K0FA 4URVR 1SVWA 3OZAA 3ADKA 5IAJA 2AC2A 3WV5A 5JH7F 4FYXA 4Z3OA 2J4FA 2NV6A 1PR0A 4O4HB 4AB1A 1WOMA 5B4UA 3TR6A 3JPYA 1FYFA 4HFJA 4G0WA 1N8SA 2D1YA 3IMKA 4WGFA 3GDFA 2DQ4A 5FBVB 1K88A 3S2IA 4OHVA 4QFBA 3TRJA 4QBFA 2JANA 2WAMA 3PEUA 3W6ZA 1YDHA 2X0NA 3CNBA 3O8DA 2I03A 2JASA 4ZYVA 4D4LA 3VR6D 2XR1A 2YV3A 2C0PA 2IOYA 3I3SR 4XDYA 4EDHA 1WBBA 4UBNA 1HNWB 4BKUA 2VYVA 5IAEA 4YRBA 3NUZA 2Z6QA 3E9DA 3EQ9A 1RXCA 3I04M 3P2EA 3CTMA 4ZARA 4JBLA 4UJ5A 1YULA 4FQ7A 4RZXA 2ODWA 2NZWA 1QYDA 2QRHA 1PDWA 2XMQA 4UHCA 2OO5A 2H65A 4N8DA 4RGYA 4MZDA 4BVJA 1QRTA 4X66B 4ND5A 4PG5A 1DMSA 1SHKA 1JHAA 1HL3A 1N5JA 2R68A 4LXUA 4BXOA 2RHCA 2Y77A 2AXPA 2PKWA 1ISJA 3T4EA 4YN3A 1CZOA 3T15A 4ACAA 1LS1A 3DT6A 4WA8A 2FEAA 3HXOA 2ZXUA 3ZJYA 4A36A 5HWSA 4W5HA 1BG6A 4YP0A 5GM2A 5JDIC 1LTQA 1OWOA 4KO2S 4G4IA 2Q1TA 5A04A 4GICA 2YY6A 1PK8A 5MDHA 3UXMA 4D45A 1AKYA 1T0IA 2NIPA 4PW0A 3WGLA 3G2MA 1E9FA 3Q7QA 3BGOS 1K6XA 1XCPA 3IODA 3N0VA 3DHWC 5FLKA 1Q0TA 4PCUA 3R9WA 3SHWA 4F3CA 4C7BA 3LQ2A 4RPHA 1PJ8A 1H2YA 1UBHS 1UJCA 3KFLA 3BS4A 3PGJA 2Q6KA 3BT7A 1NVMB 1E1YA 1C0KA 4TTTS 1W8IA 3M6UA 4UE2A 2HJWA 3PFFA 4MHSA 2BGTA 3T7DA 3URMA 2R8XA 3RC2A 4AROA 4LJ6A 4OA5A 5EE3A 2PUAA 4BNGA 1JG7A 1YGPA 3D1VA 3VC1A 3T0IA 4DDTA 1EQUA 1FUIA 4OOFA 5E4JA 1BMTA 3H8WA 4BB6A 5IHPA 1TYEB 2JI6A 2P3QA 4U7WA 3WLPA 1GT91 1Y98A 3EXEB 5CB4A 2WD9A 4IDCA 5EJ7A 4NDZA 3DVSX 1TVEA 4URYR 3JASB 5HE9A 3TPZA 4DIOA 5DSZA 4RVOA 7MDHA 1SXJC 3VNVA 4JJ8A 1R4NB 3QK7A 2B6NA 4HWKA 2Y9MB 2XWPA 3S99A 2XZPA 3UW1A 3GLIA 2HTEA 5DCYA 4GRDA 4HZUB 1FU7A 4HQKA 5FPQA 5JG7A 4RIFA 1XYGA 4RKWA 4ARUA 2F1JA 2PM8A 3LF1A 4G1VA 5EVJA 1V11A 5F4BA 4AUMA 2EU8A 4CCWA 1CUGA 5C3UA 3WGTA 1UDWA 1ZJ5A 3JARA 4JLNA 4B6QA 3LPNA 2BT4A 3F6RA 3VU8A 4W5OA 1FDWA 3KE8A 3QNUA 1IU9A 5HCIA 1GGHA 3UNXA 2IVZA 1ZMBA 1AGRA 2QTVA 2PBLA 1G59A 1UT6A 4BVFA 1E2KA 1EVIA 2QGNA 2Z2JA 5E7JA 2BZ1A 4GGMX 5JT1A 4EARA 3LRTA 3RROA 4B8YA 3G88A 1EEHA 1SKQA 2WWHA 3DE6X 1RQLA 3PC7A 5SZJA 1DXHA 3I8OA 1R6VA 5LA6F 4PYKA 4BO7A 1EHIA 4N54A 4YRFA 3NT5A 2ZJAA 5K0SA 1KU0A 1TZKA 3FPCA 4XYBA 4KRYA 3DDCA 3TW0A 4BP8A 5JQGB 4AVYA 3Q0IA 4AMZA 4LWOA 2OV2A 4WXMA 4R4JA 1EG2A 3UMVA 3AUSA 5CB0A 4L5YA 1GRRA 4TXMA 4FDAA 2EJVA 3SNHA 3EY4A 3W1VA 3AP2A 4OFZA 4FBLA 1H0KA 2NTYC 3FPHA 4OHFA 3LBIA 4ZP1A 1P17A 3CYFA 1GGKA 1ZHOA 3KXLA 1Z2OX 5CVEA 4Z2YA 5L6LB 1WKCA 2X1MA 4NOJA 5FR1A 3A9UA 3FR8A 1CB0A 4MLZA 3U1TA 1PS0A 2XZOA 5FXMA 4C0BA 3NXSA 1E1CB 2WK1A 1J2TA 1DKUA 2O2HA 5A6SB 4EJ6A 4ILKA 2XCRB 4R8RA 4X3PA 3WRVA 3H86A 2DX7A 4D42A 4DA6A 4YP1A 3GLHE 5AXBA 2AKEA 5E2IA 1DKNA 1L6RA 3EZGA 3H9BA 4MJLA 4DLUA 2QVBA 4NP6A 1B1AA 1ECPA 2QPOA 4KFTA 2DTEA 3MA0A 5HMMA 1U8XX 3UJ8A 1NZJA 3V3KA 4E08A 3A8TA 1AIPA 4RD2A 3UYKA 3H11B 2BKUA 3MUOA 4L4YA 5J5AA 4DSOA 1TM1E 1P5FA 3HTXA 4D8UA 2IFTA 5MN4A 3CU5A 1QX4A 2IE0A 4U2CA 5IC6A 4MYTA 2R79A 3NOXA 2WUWE 5K0CA 3W0LB 1Y6FA 4Q5IA 1Q21A 5IUJC 2CHQA 3P1JA 2IX3A 1ZOSA 1EKXA 1WW2A 3WJ2A 1OI7A 4TV9B 3QVVA 4I46A 3WLMA 4PN7A 4YXWA 4TZ6A 3PUWA 4XLZA 3WSVA 1TYDE 3KEQA 1KSGA 1JHMA 4R3NA 1HYHA 2YNMD 3W1EA 4P1ZA 3ZWBA 4F5YA 2XTAA 5FJJA 4GVPA 4MCJA 4Q3LA 4KN9S 3WNBA 3K35A 4ME6A 3A58B 3OOYA 3CLKA 5IULC 3DHYA 3FFXA 3A05A 1CVIA 1PTKA 2D2EA 2KW5A 4JP8A 3V97A 4Z4IA 1T5SA 3R41A 4YMWA 2HJ9A 3FRIA 3COZA 4UDYX 2CDAA 2V7GA 2YMQA 4S2EA 2AI3A 1S2NA 2DLNA 4Y3UA 1KKUA 3ZCXA 1KI7A 4R5HA 2YASA 1P31A 3UN1A 1TZBA 2WUEA 2ZQ5A 1WHTA 4V0QA 2Q9UA 4FDLA 1PT5A 1VI6A 2P68A 1EXVA 2FMXA 1NC1A 3WV4A 1DBWA 1KAHA 3O1JC 2Q2OA 3UB4A 3V6MA 4D4KA 4ZDKA 5TJHA 1EK6A 4EY4A 5AVJA 5FPSA 4WZAB 3U5ZB 4F3YA 5LYYA 3ETEA 4GPIB 4UM9D 4IMIB 4RJLA 4V0RA 2E4UA 3LP5A 2JLVA 1V9LA 1JLLA 1R9JA 4JT4A 4KHPB 1SM4A 1O3YA 5EP4A 1A8SA 4NNOA 5K20A 3K0FB 3QXHA 1R4NA 3KTDA 3M8KA 3L0IB 4DCVA 1SQGA 2OBLA 4QPDA 1U63A 2V0GA 3WXBA 3OURA 4QGHA 3DL4A 3WISA 4HZUA 1FK8A 2OL4A 3CT6A 3O26A 1WE2A 4D9NA 3SI7A 1NQXA 4GYJA 2ZT7A 3CW9A 5BW8A 1XJQA 3DLIA 4W9RA 3ROPA 3KKLA 2P5UA 4MV3A 4QYWA 1N1MA 3SOPA 4Q7MB 3L6BA 2FW8A 3UUFA 2E4WA 4B84A 1RQGA 2FPRA 4AY2A 5FWXB 4PQGA 3VVLA 1T0PA 4EENA 3K9GA 4J0DA 3KLOA 1WMEA 3B6JA 4MX8A 3ANXA 3KS9A 2BKEA 2B5WA 3K1JA 3HFRA 3E5HA 1SVMA 3MWEB 3P20A 3K20A 5AYVA 2B35A 3ZWWA 1E62A 4JGGA 3HM9A 4MO2A 2GJAA 2HDOA 1P6QA 2JB9A 2SECE 4YJ3F 4OBEA 2DKFA 3WNQA 4I8DA 4ECAA 5BSTA 3EZ2A 4IIVA 1ISIA 4Q34A 5A4JA 2W93A 4B3CA 3GUUA 2B83A 3HYTA 3ETHA 3F3YA 4LOKA 4QJ4A 4H3SA 1SCUB 1EAYA 1NMQA 1ICIA 1OYOA 4K7JA 4TMXA 3V48A 4HLUC 1NBAA 1M67A 1DDIA 5B5SA 3ML1A 2EKLA 5H16A 2FCRA 2VAWA 5BNZA 4IUBS 5HF6A 3TW6A 2C1EA 4FYVA 3IJEB 5LDGA 3EGXA 1IL0A 5F52A 5B1DA 1T9AA 4BLTA 1YI1A 3MERA 1PK9A 1YS7A 4U7GA 1E1CA 2H85A 2ZJZA 5CU7A 4V0MA 3ZDYB 3A3KA 4K6KA 2C83A 4KXVA 2XQKA 4IHJF 4AP6A 3PC3A 1G291 3RNLA 3MM4A 1F6DA 4YPVA 5JPDA 3HXMA 5FR2A 5H7XA 2WHYA 5HJ2A 3R7WA 4Y9SA 2ZPUA 1WAMA 1M0TA 4I5DA 1DJNA 2QD1A 3UQZA 1EVZA 3E1SA 1GVNB 2GVNA 2VJYA 3GI1A 3NTUA 3ZBQA 3N2GB 3UXHA 3WHPA 4AX8A 2WAXA 2HBZA 2P9HA 4RPIA 4YRCA 3H11A 2QG6A 2Z43A 1KH2A 3DKKA 3SX0A 2R8YA 1TCBA 5K6TA 5EZ5A 3GJ5A 3MAJA 5ERGB 4G1FA 2W2OA 1IAVA 4NAVA 2OV8A 1U2RA 1AZSC 2J3HA 2IITA 2VUSA 2XCQA 3DCJA 3QBDA 3G68A 2X9QA 1DKQA 4WE3A 5SY9A 4HLNA 2CXPA 4PHCA 3M5WA 4K05A 1F0YA 2ZKIA 4CI9A 4BN0A 3EG5A 3QLUC 2O7SA 1ZO8A 4N40A 2YIJA 2XECA 4TV9A 1FCJA 2EW8A 4H15A 1V8OA 4NL4H 4EYSA 5KTTA 1YRYE 1UOPA 1Y5IA 3IPRA 4ENSA 4P0QB 1EH5A 3HEAA 5L7YA 4BGDA 5C32A 5LD2C 4BB9A 2IPOA 3AVOA 4G1UC 1E3LA 5FWYB 1RWNA 2HAEA 4R1MA 2JKYA 2GLUA 5DP2A 1RKUA 1KEPA 4L9RA 3FUTA 2C2WA 2IUYA 4CPDA 5E0KB 2IEBA 5B7QA 1MKYA 1YC5A 4ZI3A 5IAOA 2HY7A 5GJVC 2FWIA 2GYWA 3R5FA 3ADDA 1KY3A 1I2DA 2EJCA 2JLSA 4TVOA 4AYXA 4C0AC 2L42A 2VSNA 3BQMB 1I1HA 4UW9A 1M2EA 5CHYA 3ITDA 4H4EA 1T5LA 3T61A 2PZAA 3TNJA 5ITZB 1XCOA 1MZPA 1VMDA 4CG0A 4D3DA 1E77A 2O0HA 3BWEA 3EZLA 1DV2A 2CL5A 3QXSA 1QQBA 4L76A 1R64A 2EATA 5IJZA 1YB6A 4KRFA 3DLCA 3RASA 5DXFA 2Q0HA 4Q1CA 1PX0A 3ZVRA 4XWWA 2QS9A 2BHSA 3LUFA 1X1CA 2F90A 2WUGA 3D8TA 3Q7RA 5TT1A 3F8TA 1HDCA 1KQFA 4G3XA 2PXCA 2RKOA 4O2BB 4TTAA 4WTOA 4WZAA 3BK1A 3RAGA 4BKPA 3TFOA 1JALA 1ZK0A 3U4DA 1QWOA 3C7CB 3ILHA 2L2QA 1EK2A 1HKUA 3PL1A 1WEHA 4PZ9A 3AEKB 5E9QA 3WKEA 4RSGA 4MINA 5HF9A 4QQNA 3A6ZA 1KPGA 2QRUA 2WI8A 3AIOA 3Q10A 4JB2A 3K0FA 2VSQA 4KWEA 1RR6A 1J8QA 2W9XA 1FEZA 2O0JA 2OXFA 4RV5A 4JN6B 1FS4A 2BMEA 1R5JA 2NXCA 2YJ5A 1WUHS 3GAFA 4Q19A 2PT9A 2HH9A 3DP7A 4X3OA 3GEGA 1L1FA 4CQMB 4QEZA 1N4AA 4F9FA 4ZQBA 3PDCA 3G7NA 4KN5A 2COUA 4P22A 2G25A 3SSMA 1KIAA 2LZ0A 3CURA 1SVSA 4L02A 3O73A 4W1QA 2EFDB 3HZZA 1MNAA 1GITA 3U40A 4QULA 4DTIA 2RK4A 5CXQA 3TJZA 2O8VA 4AZVA 4BNJA 1HYBA 4BQNA 1ZH4A 2BGJA 1JXMA 2NO1A 1N25A 3L7JA 3G89A 2XY4A 3CY6A 3E15A 4G41A 4XGQA 1RJ9B 4MV0A 5ECYA 4DJTA 3KXKA 4G4JA 3NETA 1YH3A 5GGXA 3VU3A 3X1JA 3V7FA 2P41A 4AURA 3K0SA 3UWOA 4KQ1A 3NMUF 1T9HA 1L4KA 4ZI5A 2EP8A 5ENZA 2JFWA 1U0LA 2DFKB 2MT9A 2HHLA 3IPLA 2XUIA 3RU9A 2RAVA 4ZAZA 1T3ZA 1E5VA 1XJWA 4W63A 5TEVA 1COWA 3FBGA 2XCOA 4NHEA 1SCUA 3DEAA 2VYCA 1SCBA 1HURA 3TX6A 2ZFUA 3RS7A 3QPCA 3B7WA 3CLSD 2QHXA 3U62A 4EGCB 3NJ8A 1GUYA 3OQ1A 5GV7A 2CY0A 2G6TA 2BKLA 1J23A 1JSRA 4NYIR 5WRFA 1O1YA 421PA 4CL8A 4Q4DA 5CM8B 4WKNA 3MC1A 5TE9A 4RTKA 1ULBA 1XCJA 4WVLA 1OMOA 5C80A 5HYVA 1YZQA 1ML4A 5A2QA 2FPGB 3KQSA 4IIEA 1Q1NA 2CXTA 1W5FA 1N5IA 2DQKA 3PC2A 4OQXA 2XXAB 1RKVA 3E5MA 2KMLA 3IB6A 1O96B 1GPJA 4GM1A 1LS6A 1NPTO 3GUVA 4KWHA 4KZKA 4L15A 4Q3CA 4Q3KA 5IU6A 1MB4A 3LDGA 4AJ1A 5KB3A 1PD1A 5BV1A 3VC2A 3N2GA 3KQLA 1E1KA 1Q74A 2B4QA 4ZVNA 2F00A 3ZXIA 2CF5A 2F48A 2OCLA 3HXKA 4OHYA 3QSYA 1W5BA 1RYYA 5DI3B 1JSCA 5E3HA 4IUDS 1I4EB 4NONA 1NV9A 1U8TA 1WU7A 5BT9A 1HY3A 4V2UA 4EG0A 5JMTA 1NQTA 1N8KA 3SZRA 4Z4QA 1QMPA 5K45A 3GFTA 3R6WA 1UCFA 3BDVA 1M8GA 4QOIA 1EFCA 1GTG1 2A92A 4NSNA 2QN7A 3SC3A 1LBEA 1QE0A 1NRJB 3LO8A 4FHDA 5JXHA 1WBDA 1U65A 2VYQA 2DPLA 4ZD6A 1FSZA 4RLQA 1I3NA 3BEOA 4IHKA 1ZK1A 3OIYA 3VA7A 5FI3A 1DKMA 1N2BA 2BGNA 2Q5CA 3T06B 5C31A 4HHEA 1TVKB 1MEOA 2Q1XA 3MIIA 4WZZA 1K86A 5ER9A 2X0FA 4L3WA 4YJHB 1B8UA 3GT0A 5HBGA 5IX8A 1RPJA 1MABB 1WXHA 2BEJA 3Q11A 3QGMA 5FWYA 3NQ41 2RG7A 2FRDA 1Z45A 3AUTA 3HO6A 4FUTA 4HB2A 4IDOA 2HXSA 4Y2HA 4YAEA 3UKDA 4EHIA 5JR3A 2XA1A 1FTNA 5BR4A 1UM8A 2YWBA 3IEPA 1FRNA 2HW8A 1PI3A 2C4TA 3GOHA 1YZTA 4Q47A 1EDBA 4B3BA 3I9NA 4ZVRA 4A92A 1IN8A 1GRQA 1CR2A 1MJ5A 4BFWA 1TD9A 3AB3A 3VUFA 2YOGA 3Q2IA 2ZSIA 2XUOA 3C6MA 4DUGA 3U16A 2JFFA 3KPWA 5DWQA 4DYDA 2WZBA 1E8DA 4KMRA 3F49S 2W6OA 2J46A 3PDIB 3FHTA 3REQA 3GNLA 3HU5A 1ZDMA 1N5MA 5FBZA 2HNBA 1NN1A 3AMVA 4Q18A 4DSNA 4EG7A 2H5LA 2V6IA 2WUVA 3O90A 4PNPA 4C2BA 2C9CA 5JPCA 4KTTE 1M8KA 2PQ0A 2W43A 1X1EA 3U3JA 4BNTA 5FUXA 3UAZA 2WKSA 4O2BA 2H9IA 1ELOA 3GPLA 3Q9LA 2N46A 4UZEA 4DWOA 4S12A 1RYZA 2QW0X 4Q7EA 5AVRA 3ORHA 2VUHB 2HI0A 5I4CA 4Q9AA 1Q17A 3AEKA 2B1RA 1G5PA 4PV7A 1KO5A 2OVBA 1P8AA 3ENKA 3MJRA 3ROQA 3X0DA 1YFLA 4UAUA 2JJ2D 3W5DA 4EHLA 2X6TA 4QM6A 4F92B 1WF3A 5JAHA 2BTQB 3V9AA 3OTQA 4QYXA 3L0OA 4CKEB 4CQMA 2QTWB 1CS0A 2QUZA 4XASA 3GL9A 2HU5A 2GKGA 1T2EA 4FP9A 1O94C 1VRCA 4UPDA 3VR5D 4HJRA 1JSLA 2QL9A 5AI8A 4JI2B 1ZN2A 4PRKA 1I6LA 4R69A 1KDVA 2A9RA 2Z56A 1GUBA 1DFIA 2PSDA 5GZ6A 3SFZA 3VHRA 4C89A 1PZNA 1CYDA 1YMQA 2XKAA 4B3SB 1CZLA 2C2OA 4EEKA 2ETXA 2HMWA 2IQIA 2OK8A 1FJHA 1NBOA 1YZKA 1W30A 3ULKA 1RJ9A 3QOXA 1HO3A 3TE7A 1ATIA 3PHLA 4QPCA 5EUQB 2Q5LA 2W2KB 2LRHA 3QYJA 2J5XA 4ER6A 2AVDA 1I6KA 1RHJA 2PVPA 3EW7A 4GOXA 4KGZA 4U2KA 3ZOKA 2G1UA 1X8KA 5J2UF 2YVUA 2VYVD 2V1UA 1TYBE 1AQLA 3NHSA 3NB0A 4HQ6A 1M0SA 2PUBA 1F0NA 1SUAA 1XI2A 2PGIA 4F11A 4XKJA 1VL0A 1GA6A 3FNEA 4ZVTA 2WM8A 4WIAA 1GL3A 3L7CA 4X7BA 1XCMA 2BUAA 4BO1A 4RTJA 3MF4A 5DMXA 4O4JB 3N5KA 4S1VA 2EX0A 4EA9A 4QPNA 2I1QA 2H9AA 4EB6B 5F4ZA 5H82A 2IRWA 2ON6A 4HLDA 4Z3KA 5K6AC 3H0EA 2G0AA 1M8FA 4ZO9A 3LY8A 3VTAA 2IU0A 3KFXA 2A5LA 2B8NA 1W48A 1LX7A 5LQNA 2ZDHA 4JJIA 3ZHXA 2NP6A 4UUBA 3ZY3A 4Q9KA 5G3YA 4L07A 3MB5A 1MAWA 5ILOA 1ZCBA 4IJWA 4JV5B 2WHPB 2FPGA 5B7GA 1RM5A 2XYHA 3FE2A 3U3ZA 2XXAA 1HZZA 5GGYA 1R8JA 3IO3A 1V7QA 3NALA 4RQBA 4YQYA 5D5QA 4PLPA 3S70A 1XD8A 3W5JA 5KMGA 1UEJA 2I6FA 2BRUA 1GUDA 3KP1A 2IL1A 2XB9A 1LH0A 5B53A 4NG5A 2J9RA 4EVSA 3KBOA 3D2AA 5C2JB 3IKTA 3TL3A 3D2CA 1R4AA 2Z5LA 3K53A 4K0RA 4G1BA 3TSYA 3ZK9A 5TMPA 3TTWA 1QYVA 2QX9A 4P4SB 3UCEA 2O4UX 3RTGA 5AVWA 3O94A 5HG0A 3M1LA 5EUBA 2W22A 3CO5A 3DTVB 4BNKA 3SFTA 2E49A 2QB5A 3VVBA 1IHOA 1PV1A 2A33A 3I73A 4MDHA 2P77A 3WDLA 1W0KA 3GJ3A 3WO0A 4C5BA 3ISTA 2WWIA 4RAOA 4CGZA 1GCGA 1QH8B 2VHZA 4B3DA 5JVDF 3PKJA 3FMVA 2Z2YA 4B73A 1RLOA 2D2VA 1XP8A 3OFSA 5EL0A 8OHMA 2CL0X 2X15A 1PWEA 3KPUA 3L1HA 4IIBA 4M8LA 5DLQC 3MWJA 4U7PB 4A03A 2P2CA 1MAUA 2VH5R 2HQOA 1UEIA 2UZ0A 1TVKA 1PQYA 2H31A 1VCIA 3HJBA 1TFUA 1X2BA 2C95A 4YJHA 3VV2A 3AINA 3LHSA 4S0XA 4DJAA 5D7NA 3AR7A 4EO7A 2VS1A 2PGLA 5ALUA 3ISVA 5THQA 2B4TO 2YIDA 2GRAA 4JJEA 4ESHA 4BS9A 1SKBA 1WPGA 3G0HA 1U6IA 1EINA 1IHYA 3DR3A 4KQEA 2O6LA 4F86A 3THYA 1N2JA 4F85A 4AJ9A 2Q07A 2EP5A 3KUXA 5AI4A 4FKMA 4UATA 2PWPA 4HH0A 5BYJA 1ETHA 4CDRA 1QVVA 2XD9A 4RKYA 2FPIB 3ZPXA 2Q5HA 3JZFA 3AGQA 1CEXA 3LG2A 4R9RA 3L79A 1I6WA 2PZMA 1ZGGA 4HEA6 4TL6A 3ZC3A 3PDIA 4IILA 3AHDA 3B48A 1ECBA 3NVDA 3IEKA 5DTQA 4MR7B 4Z0PA 3W3AH 3FVWA 1EGQA 1UODA 2Y1KA 4BO0A 4D9MA 2VG8A 4Y6QA 9GPBA 3AKCA 5E4TA 1VHTA 4EKYA 1RHRA 3HKDA 3IUBA 3FWHA 4HAIA 1SOVA 2IBTA 4IIFA 3E9YA 3H16A 2NYVA 1EU1A 5INTA 1XZLA 2J87A 1JNXX 1N2EA 2UUOA 2WG1A 1TM2A 3PJFA 4HDCA 4XSHA 1EP3B 4RY9A 4DIBA 1PQUA 1X1SA 1FQOA 2GM9A 3GAMA 3W4JA 3CEMA 1MTZA 3N0XA 3QHQA 5KYVA 1CQPA 4LHZA 1R0RE 3OSZA 1NOIA 4EI8A 4NYMQ 2XF2A 4OHKA 2C4MA 2R87A 1XJ0A 3ECCA 2WV9A 1KJ9A 4NS1A 1LVHA 3IDFA 2JDID 5I7AA 2JGDB 3KLNA 3W2HA 5KNDA 1RBYA 1BOFA 1NBEA 2ZXFA 4N0EA 2CJPA 2BTQA 2Y0EA 3QX3A 2G09A 3WO1A 2G8LA 5FNVB 1JIUA 5CM9C 4AG5A 1ECFA 4EELA 5JEDA 5IC4A 2BMVA 3RU2A 3DMDA 3VTZA 2JLXA 3L7AA 5L45A 2GESA 5CH3A 4D8XA 2OQIA 5FO0A 5GJWC 3O4GA 1I01A 2JLYA 4ZO4A 5JC8A 2OEPA 2JEZA 1Z0FA 2QN9A 3PF8A 4YRJA 4OI1A 3H2HA 1PJLA 5F76A 1JTFA 4RPGA 2SBTA 1WCWA 4RIGA 1O58A 2XZDA 2W2KA 4ABYA 2Y0PA 1CR4A 4D9HA 2DFLA 4K9LA 1UUFA 3G8YA 4DC1A 1M2NA 2YHUA 4IEIA 1O9BA 1ZNWA 3ANTA 2CYBA 1TKAA 3FROA 2PS9A 5DM1A 4XQEA 2QD4A 1IZ8A 4NE9A 3ZCSA 5IM4F 4RZHA 3HLTA 1T8RA 3KPVA 4YXWD 4FT4A 1QGOA 1FSFA 2C4UA 2IUSA 3L8FA 4NATA 2C8VA 4O4JA 1TU4A 2B36A 4BCDA 3GGOA 4MQ4A 2WSLA 3JQCA 4EB6A 3NGXA 1YU9A 3M9XA 1SXJB 4U2FA 1G5FA 3TTUA 2VPYA 1LDEA 3UJPA 2PSJA 4AF7A 2QR5A 3BWMA 1YQGA 2ZTMA 3QKWA 3RG8A 1NRXA 3DV9A 4XOIA 2B92A 3BXEA 4R9SA 3LXMA 2FXVA 3GOQA 2QAGA 3TTXA 3UF0A 2PUEA 2GHTA 5DASA 2F8SA 4RPLA 1RRGA 1URPA 4CQJA 3IR6A 4OQLA 5IEBA 1KJZA 5HE8A 4BO9A 1EWKA 3IBGA 3KL4A 2GCEA 4KE8A 3URKA 2RB4A 4K6FA 4MW0A 2VP4A 4QBHA 4Z54A 5LA6B 1RCFA 1AY0A 3VO1A 4B2LA 1KYXA 5F2NA 2B7BA 1RE1A 1DAMA 1PFWA 5D6OA 1Z56C 2X2EA 3N70A 4CLHA 3M4JA 4U6SA 2RBEA 3DZJA 4MJXA 4P4SA 1CUXA 4OSEA 2CHEA 2HWXA 5DTMA 3X2SA 4XQ0A 4XPIA 5AI0A 3DTVA 2H07A 3W06A 2CCGA 5ALIA 1TCCA 1AHIA 4FHFA 1Y48E 4GQAA 4UNNA 1NBME 4D9EA 4EITA 4DSTA 5CLFA 1QH8A 4FDVA 2ZJ2A 4E5SA 4NEHB 1TZMA 3SYLA 1ESNA 2B94A 4JBXA 5B12A 4J1TA 3PIRA 5C3MA 5TIIA 1F8FA 4BQFA 1YB5A 2YXDA 4LZJA 3ND6A 1X3SA 4M0CA 5FIUA 1PR6A 2A2ZA 3AV3A 4PIMA 1NMXA 1XDWA 4PVCA 2AOXA 3DE0X 2PFGA 5D8DA 2IA5A 5AVTA 1MOZA 1H22A 1ODSA 4I9HA 4MIOA 5AKJA 4IJQA 3SJAA 2QTMA 2VEOA 2ZIXA 3I3OA 4E2WA 2A7QA 3QVXA 3A2MA 4QRIA 1MO2A 3A2NA 4LC1A 2C3PA 2IY7A 4OXNA 2FN3A 3HJAA 1GYQA 3WHIA 3ZU2A 1NJFA 8ADHA 2PUCA 2V6JA 3C5CA 3G0IA 5AJTA 3TTSA 3IE2A 4WFJA 2OZKA 3ICOA 2PH5A 2X6QA 4EJ2A 4YMVA 3QFHA 5A3QA 2C04A 4C04A 3U48A 4BLRA 2NUAB 5ICMA 4FHGA 3W79A 4TYWA 2ZAGA 2YC2C 1LBTA 2ROQA 4QFCA 4IXDA 1QYRA 4RM2A 1D4AA 4K5QA 2WSBA 3A4LA 1KSFX 4MEJA 4BCBA 1QS0B 5CA1B 2G80A 1PVDA 1OREA 2YIMA 4UM7A 4YECA 3INTA 2ZUWA 3C3YA 1KP9A 2YINC 3RCBA 3DQPA 4A2PA 1ABFA 4PBTA 4WLOA 4BE4A 2EIHA 2GOYA 3LWNA 1YCFA 3O1IC 3K5IA 4JB0A 5SYAA 1RIIA 1QDEA 2YFHA 3B13B 3KWFA 4LY6A 2NO9A 4MHOA 5JD3A 3FA2A 4EH1A 2FAXA 1FBNA 4KWIA 1PVVA 2QRMA 1VHWA 3TCKA 4B32A 1SZCA 1H6DA 3CUSA 3JQ6A 1EYZA 1NTRA 1EWTA 2E5WA 2JCVA 4GX0A 4WNAB 2NVBA 1KQ3A 4F96A 1AZTA 3JALA 2FPXA 2P8SA 1W88A 4B31A 2QUBA 1XMVA 3G0BA 3ZGYA 5CDSA 3AT1A 5HZKA 3BTUA 3EC1A 1F60A 3JQGB 4FYIA 1HT3A 5F2KA 3D0OA 2OESA 1T1EA 1L5HB 5FNVA 2QJTA 4PZLA 2GBLA 4UUQA 3DULA 4R8SA 4AULA 3G9QA 2CZCA 2OYCA 3T1OA 3MGBA 5FOSA 3ND7A 4L4ZA 4WFQA 4KI7A 3V8NA 3ZNNA 1T9ZA 3EXG2 4UNIA 1AKQA 1TF7A 2A1TR 2GN0A 3CGWA 2DPHA 4YAIA 2HK6A 1E0AA 1HYGA 3ESAA 3RWMB 1E0SA 3SCZA 4LRQA 1O6ZA 2D5CA 1EHYA 3UAVA 4C0JA 1WR8A 4EY5A 5EXTA 1FYDA 2QPTA 1Z68A 4D6YA 3KC2A 1EX7A 1TB4A 1ODKA 1YBFA 3U7JA 3W4IA 1H8EA 3RWOA 5CNMA 3TNFA 1NXQA 4QRHA 4Z8YA 4AK9A 3U4MA 1CK4A 3OT5A 3BBLA 3HVJA 1MRZA 1V7ZA 4LYDA 2WVGA 1AGXA 1Z0AA 3OQOA 1HFEL 2O1XA 4LE1A 5HS6A 2RKWA 3NFYA 5LDDC 2WBLC 3CINA 5KTYA 1GGVA 1S2MA 4H1TA 2M1ZA 1ZOLA 4NRDA 2ZS7A 5KINB 4NQRA 5KTPA 3WGQA 3WBKA 3ABIA 3ZJ5A 4PNEA 2BSQA 2NT4A 1WXGA 3B51X 3ND9A 4MKZA 1T3LA 2F8LA 3NNDA 4KU4A 2C31A 2I7DA 2V4MA 1EB8A 3EH1A 3NVMB 1KK3A 4P98A 4RA9B 2EZUA 4L5JA 5JNSA 2WQ7A 3TZEA 2I4RA 3GGPA 1M0WA 4E6PA 4WDQA 3EODA 3EVCA 4FDTA 5C1IA 3BH0A 1X1TA 1ITZA 3FIJA 1IWBB 3SHVA 4XGRA 3BDAA 1KYWA 1KOLA 3UOGA 1FMFA 3PWSA 1SOWA 3WRXC 5L3QA 1B0PA 4EATA 4OB6A 3CJQA 1IQPA 4RELA 5FPYA 2ZQYA 2WQZA 4CV2A 2HSJA 5CDYA 4YJ3B 3Q8WA 4KUGA 3TUJC 3Q0EA 4IVQA 4RAQA 4ZOQI 1FW8A 2DCMA 1LI4A 3CE6A 1GDHA 3WYAA 3AJAA 4DM7A 1T1JA 1TMKA 1UQTA 3R6GA 3Q41A 2VF4X 2B1QA 2AC7A 2PLAA 4MRMB 4QTUB 3TCXB 4UZSA 1XFAA 4L4RA 3DOIA 3QU5A 1A96A 1FTQA 5JE8A 4PGHA 2PMBA 4LXQA 3ELWA 2O54A 3UV7A 2PH7A 5LOVA 3ENZA 4TTSA 4OYHA 3HJGA 2QTAA 1P45A 3C3PA 3TSWA 3WLNA 5DX0A 2Y92A 3A1FA 3FUCA 3GZNB 4D0LB 4IJVA 1JKFA 2WJPA 1B6SA 1TMOA 3J80A 5IVKA 1LWNA 1MU0A 2CD7A 1I4WA 4Y9RA 4HVCA 2IW3A 1GZUA 2FUKA 4IHJB 1SXJE 4O1IA 2Z09A 5LMUB 4JJFA 1R18A 4LRXA 4S1PA 4DADA 3LQ4A 2EGHA 3OPMA 5CXXA 5DNDA 1V8BA 1UBFA 1XNGA 2BIFA 2H06A 3OLYA 3ZV6A 3QNMA 3OO0A 4X85A 2D1TA 3IP6A 3EVBA 3WMFA 2YJ3A 5U4XA 4IEFB 4ZU6X 4FOSA 4Q3AA 1PD0A 3JZIA 4JEUA 2RH5A 3HKCB 4IDHA 3N5CA 3V8MA 3IHLA 2O5EA 2YS7A 4LQDA 5GPBA 1QS0A 2E1PA 5CA1A 5T8KA 3D7LA 1UFKA 4D3YA 1VLLA 4FNOA 3SX2A 4IIJB 1TJPB 3QPDA 5KWJA 1COWD 5KWEA 1KQGA 1UFOA 4O63O 2CCKA 1W0CA 4B3FX 1WMDA 4R9VA 1P9WA 1AZWA 3P5SA 4KNYA 1MQSA 1PGNA 3L6CA 1DIBA 3PENA 1OLXB 4AT1A 3HHEA 1PK7A 1F6WA 4MS3A 1A76A 1MV8A 1EVLA 2Q5JA 3ROMA 2BFBA 5EFOA 4YMGA 2GVZC 2XTZA 2TMYA 5HF8A 1NNEA 3FSJX 2QUKA 4H18A 3BILA 3VAZA 4M7RA 5EWJB 3NKVA 4WNAA 1TO6A 2GS9A 3G8AA 3NC1C 1G8FA 3DXZA 3KL2A 3LGAA 5KTRA 2MJLA 3OF5A 2AD1A 1SGWA 3JQGA 4L74A 2ZRGA 3CN7A 1PR5A 4NYMR 4C6TB 3FYUC 1WLYA 2ONCA 4DR5B 5CH5A 2WP0A 1JBQA 1N9KA 4WHMA 1KBQA 3QXJA 4XUGB 5EIBC 5TQ2A 2H2WA 1TLFA 1A8QA 1X77A 3C8DA 4G97A 2VJMB 2GUGA 2F9MA 2LDBA 1ISPA 4C3VA 1NXTA 3QTBA 4G4GA 3JVUA 4XQGA 3ZU4A 4MW1A 3WYEA 4L3OA 3HBFA 3LWBA 2GPAA 4LSGA 1Y4ZA 3PUYA 5JS2A 2DAPA 4RLHA 2P67A 2W2TA 2V1XA 3HGMA 5BRAA 2QBYA 2HCBA 2WU4A 3HBJA 4EWLA 4H1WA 2F8TA 2N0SA 2GK3A 3GFVA 4RF2A 2JD0A 5F1YA 3HL0A 5E3JA 4JB3A 4PVDA 3C24A 3NCHA 1RCTE 1HQCA 1BEUB 2OBBA 2NPFA 2ECPA 2FSIA 2ATCA 5HOQA 1ZGHA 4Q00A 121PA 3RHSA 2VNHA 3ZYZA 1CUDA 4LKOA 4DUYB 3KETA 5F98A 1GQRA 1CRZA 3GRAA 3GEIA 4ZOEA 4RZQA 1NF9A 1E3SA 2HF2A 4HQLA 1DB3A 5LXTF 4RA9A 1RFLA 2P11A 5P21A 2Z1MA 3RUHA 4A4DA 3TDMA 3ZQJA 3OTWA 3GLRA 2PZFA 4EY3A 2PAFA 3HVUA 4RGBA 2REQB 2CW5A 2GNAA 1JHOA 1QE5A 5E6UB 4KX5A 3D6AA 3KM0A 2JGKA 4HOYA 2PX4A 4XI9A 1SVUA 2QK4A 4DUGD 1E20A 2VPWA 3CX4A 3H6HA 5B36A 4QHYA 1XZFA 2XVZA 3N2KB 1YCHA 5A9SB 2WEKA 4H1HA 3CEHA 1DCTA 2CBXA 5JOQA 3AF0A 1Y6ZA 2AG8A 3U17A 4LK2A 3HC7A 1O6CA 4X61A 1PS9A 1RS0A 3U6KA 1Q0LA 1UF9A 4RLFA 3WIBA 2BAGA 2NXWA 3R7LA 1JFRA 4MRMA 4TTQA 1H23A 2VBIA 1ZD3A 1A9RA 3PIDA 5ADWA 2PFKA 2O07A 2IHZA 4QHSA 4J0FA 1VOTA 3P0JA 2BE7A 1WF6A 1W75A 4A8JC 5FNZA 2C3OA 1VG9B 3EDRA 2C96A 3RF6A 5JATA 2V7QD 2K2WA 5D51S 4DF3A 1MW9X 1NULA 3COVA 1SEPA 4A15A 2J3EA 4GKKB 4U2EA 4DVGA 1KORA 1C41A 5EIHA 4WDRA 1MOSA 3TL6A 3WMEA 4CQMD 2FSVC 5KSZA 2H1FA 1QVRA 3STXA 4JZKA 2ZBDA 4IJ6A 1JR4A 3IJ5A 3RTAA 1UOEA 4KGDA 2AGVA 4QUJA 4X8HA 1HV8A 3SF8B 3A7EA 1G7SA 1VL2A 2DTXA 3T8YA 4CEIA 3TIXB 1BWSA 2JKZA 1U2ZA 2I3AA 1XEAA 1XTUA 2IOFK 2AN4A 2IZ7A 1ODFA 1T34A 4MMXB 4R1PA 5HHTA 4ZQHA 1ESZA 1U0OC 1Z13A 4YT8A 1GXSB 2WTMA 4JL8A 4DG8A 2TRSB 3FCCA 1FFSA 1CY1A 3MAGA 3BE6A 3QFTA 1U7OA 3R0IA 3U4IA 1VKRA 2A4MA 1G2IA 2LPMA 2VRCA 3DMHA 1WXWA 4ZMRA 5FEMA 3RVRA 5KQMA 3SICE 4X90A 1W9MA 1N6RA 1QAOA 3BL6A 3UFXB 4IIHA 3GFFA 1A0OA 1ENYA 3H7AA 4NBNA 4QJIA 1JEJA 2D7JA 4IIJA 5HQ3B 2NTEA 1JR3A 5D01A 2GASA 5CYPA 4CMCA 3THWA 1P7WA 1RLMA 3SEQA 4YAWA 3D8HA 3HPQA 4XWYA 4YMHA 4Z4HA 3R4CA 5HOEA 1U7PA 3ONEA 3KQQA 5L95A 1OLXA 3AVYA 3H9UA 3LBNA 4E33A 2HX1A 4TMYA 4U7TB 1EX1A 3TINA 4P4GA 5F1KA 1M2JA 5BNFA 4E22A 3FWZA 3ZUGA 4MAAA 1D1TA 3SS7X 1JHUA 1W8DA 1V1MB 3G2LA 3MSXA 3NHJA 2NT3A 5EWJA 3QKTA 2XEDA 4WXPA 2REOA 3FMOB 1ONOA 2B9EA 4FW8A 3UJ7A 1E9RA 4JDPA 1NLMA 3NEYA 4TGLA 3UIEA 4KVZA 1KMCA 2JG3A 1G21B 4Q82A 2JFUA 4IJKA 1BGVA 5HNKA 1BX0A 3GLKA 1YTUA 2R4QA 3M6WA 4EW3A 2Q3DA 5ALMA 1WVIA 4QQ8A 4FNGA 2F1KA 4I36A 1A8HA 3EIWA 4GU5A 4L5IA 4PY2A 1I33A 1PKXA 1CS4C 3NOVA 1QIMA 4K9MA 3T3MB 3P96A 3OQ6A 1TZCA 3B36A 4Y6PA 1Z5PA 4DS3A 5MN6A 3ZD7A 4NMMA 4DV2B 1NUUA 4M1SA 1SNYA 2VTVA 5EEGA 2ZSEA 3S29A 2VJMA 1M10A 4HS4A 1A5BB 3B1KA 3E2PA 5A4AA 4Z1MD 5JO0A 4W9NC 1Y8ZA 4KJZA 1X13A 4MRPA 3WMRA 3GLSA 1R0KA 1HQDA 4RIEA 3KFVA 4J3NA 1YZUA 3RU7A 5BR1A 1HDEA 2F55A 3PPYA 2J07A 2WIFA 2AXNA 1GL6A 1RAIA 1COZA 2VDWB 3EF1A 5J4LA 5B3LA 3RC8A 2DWOA 1Z7GA 3QU2A 4QUEA 3MJSA 5IXYA 3HMQA 5F12A 3ZX5A 2C7GA 1K8QA 3TECE 1A4UA 5KNBH 2IOQA 1CQXA 1C7JA 1CQIB 1GSHA 3R40A 4R7ZA 5D5HA 2ZIGA 4G24A 5E6SB 2HFJA 4EVRA 4BNZA 1M72A 2IV7A 3D6JA 3BD6A 3CX8A 4DQ0A 2AOUB 4K28A 1M6HA 3RV3A 3BWCA 3DONA 2AFIB 4GOLD 1I5OA 3E03A 5B6JA 1T1SA 2YYYA 2IK8A 1OBOA 3D8BA 3NFRA 3QU4A 2AF4C 2MCFA 4B75A 2GZMA 4DQKA 1EVQA 3WJ1A 5LZ8A 1F8YA 1QZUA 4P7GA 4RK6A 2FKAA 2P9GA 1RQPA 2REQA 4M1WA 1QFYA 3O75A 4IXMA 4TT3D 5E6UA 5J1TB 3PRJA 5GIOE 4M86A 4D74A 4OIFA 4BQRA 3NC0C 2QORA 3ZG6A 1SEVA 1NVBA 3Q15C 4XWAA 4Z6KA 3N2KA 5A9SA 4F4DA 4RDXA 1DAGA 3LTNC 3A1VA 2YYZA 1HMYA 3EEFA 2Z6VA 4J1NA 1JDZA 1NG1A 4MZXA 5HIJA 4GD3Q 5EE9A 2F1HA 4EG1A 1LJLA 4MDYA 2EZ4A 1XLWA 2HCFA 5I6DA 5K0EA 1PFKA 2OO3A 2PPLA 1GGEA 2JIPA 4QXPA 1H2BA 4M37A 2J6CA 4UD6A 1JFVA 1KDOA 1GPDG 3W4KA 3VQTA 1CNMA 2FYTA 2VOJA 3NGMA 4F2GA 1WWKA 4H08A 1KNQA 2R7MA 2YCBA 3OIDA 1A2KC 2C9BA 3OHSX 3WJAA 2BFEB 4IY1A 1Z63A 1V71A 3NIBA 2VATA 3VBCA 4Q3OA 1L4MA 3WE7A 3IESA 3CNQS 3BFJA 5M7EA 4C4ZA 3LRXA 4LTDA 3LT5A 3GLFA 1NUPA 3KTFA 2AMLA 1YC2A 2G5PA 3D9QX 3S4YA 4E46A 4HQNA 4M38A 5JMPA 3SF8A 4F3TA 3KWJA 1P0QA 4P7KA 1XRLA 3L7KA 2QLBA 5CRIA 1CJSA 4DCCA 4DIEA 1C4OA 4I4TB 3C39A 2XLCA 4X20B 4B71A 1BS1A 1TI7A 2QX8A 4KNVA 4QFMA 3DFZA 2PUFA 1GXSA 2VLIA 1XKXA 4UHJA 4WSOA 1W96A 3UAXA 4RS3A 4QUIA 3E7FA 3KJXA 3GEDA 2VF5X 1Q14A 1TZJA 1BWPA 3G2IA 4CMIA 2ZAYA 4PIVA 3UM9A 4HAVA 2X42A 5JVDB 1E3WB 1Z6YA 2GPSA 3UFXA 1NBMD 1LUAA 1UWLA 5ALQA 3WSTA 3CHYA 5K99A 1CIPA 5KYTA 3EZNA 4MUNA 3LOUA 5T6BA 3PPIA 3ZK8A 3ZQ6A 5DNUA 1VHJA 3OCCA 4M1QA 3VSEA 2I3GA 5DIFA 5JRDS 4HXGA 3H8JA 4AC9A 3MOIA 2R6DA 2H08A 3K9QO 3RVLA 1WMFA 16PKA 1RYNA 2C2XA 3GJ4A 3RGGA 2JCBA 5HBRA 4RSHA 5BN5B 4E1AA 4NNJA 3NCTA 5T6MA 3U26A 4AUNA 4FCWA 3RBXA 3JY6A 4OHUA 1Z17A 3F7MA 3OZIA 1FSPA 1H05A 1L5FA 3V46A 1SUIA 1CB7A 1RAGA 2QD3A 3Q8MA 1E63A 3DNMA 3AM3A 4CMEC 3MWLA 1SA0A 2PLWA 4MV1A 4GE3A 1FB5A 4L85A 2HHHB 1UKVY 2I6UA 1HEIA 3OE1A 5SZHB 4M0DA 1TRHA 5TMEA 4PTYA 1Z28A 4DCMA 3OCUA 4GI5A 2HJRA 3ZUPA 3VPFA 1WXDA 4LDPA 2H1VA 3IP8A 4JH0A 2Y8EA 5T41A 1FUKA 1H85A 4HAZA 4PPNA 3C8HA 2WICA 4YPOA 2NU7B 2L69A 1QDLB 2RONA 2VPQA 3C4QA 3R3XA 4UXIA 1YRQA 2R6JA 4AIRA 3WFJA 2CFIA 1FJ2A 1OT3A 3HLKA 4HDQB 3DTVD 3M0EA 3RT7A 1AQIA 4KK3A 4LRYA 1TQ6A 3HR7A 1HE4A 4FJ0A 5HP4A 1X1AA 2VDWA 1VSQA 3MUEA 4S04A 1M8JA 1IG3A 1DXYA 4EA8A 1H3EA 3NU1A 1NKTA 3MBKA 3C6YA 2X2FA 2Z3ZA 3OX1A 3WWPA 2KPOA 2X3FA 3WSWA 1KEVA 3ZCQA 4G23A 3A6GA 1ZC3A 2NV0A 4WBNB 2HM7A 4GC5A 3QYAA 2FEXA 3EX7C 5FULA 1U1DA 1CQIA 4DGQA 1G5QA 4GZ3A 1UMCB 4JD5A 5E6SA 5BWMA 1FFXB 2O1WA 4RVNA 4S1TA 1QH0A 3VYTB 3R0XA 4IV8A 4YT4A 1E0JA 4C0WA 1QFZA 2O8FA 3VNQA 3HVHA 3UK6A 2HLHA 2FX5A 2JBHA 1PEAA 2AFIA 4JC8A 1XNJA 4OQFA 5I45A 4M54A 3FTEA 1SPBS 1G6HA 1Y89A 3H5RA 1U5CA 2C94A 2FX2A 3FVVA 1G21E 1ZR2A 2OZPA 2PZGA 1NBHA 2Q3CA 3U3RA 3VPDA 5I7OA 2EZTA 2ST1A 2FWMX 3E84A 1ILWA 2ZT8A 1T15A 3ZKAA 3K30A 3CUWA 1PGJA 2R7NA 1EFPB 1RBMA 2CYCA 2VBGA 3VO2A 4U5XA 4BNNA 1E9DA 2WFZA 1FU4A 3GCZA 1N2ZA 3P9IA 1OA0A 1X74A 2Q1SA 3AZPA 1DTSA 4GZ6A 1NQWA 4MQBA 5CJJA 1Q50A 1WTCA 2BISA 3LX8A 3HXTA 3V1TC 3EY9A 3RTCA 1XVVA 4TLAA 2K4MA 2WJ6A 4BNFA 1QLWA 1T9CA 1F4PA 1JJIA 1JSXA 4TLEA 1K2WA 3V4PB 2J3MA 3R24A 3MMPA 5JD4A 1S6YA 2JHCA 5CK4A 3PWTA 2H1LA 4GYKA 2JJ1D 4LJ7A 3WGIA 2XYRA 4NPAA 4ZOLF 3V33A 4JROA 4DE5A 3HFGA 4CM6A 1XPUA 4IX1A 2UKDA 1W4CA 1P19A 2OFWA 2H17A 3GA5A 3OQIA 4WD3A 5JS8A 1YS1X 3PGXA 5KX5F 5KYKA 2OHFA 3H1EA 1PAUA 4ASUA 1E3DA 1Z6GA 1K3FA 1Z8DA 1GTL1 1EGMB 1I32A 1QMGA 4FGLA 1NWHA 1I2ZA 5ESRA 4ZGWA 1HFJA 1T8PA 3JQBC 4QHTA 3MHPA 2EIXA 4BDSA 2I76A 2R6CA 1BAPA 3B8EA 3T38A 4H7DA 4I4TA 3S44A 2GA8A 5AHWA 5LCXA 3UPDA 2VAPA 3HWRA 3IX7A 4K9DA 3UK7A 1J8VA 1PG0A 2W6JD 3Q7IA 4YDSA 4UCXA 1VHLA 4L08A 1MJGA 3RVNA 2BP7B 1M2FA 3AG6A 4WXYB 4GXTA 3LU1A 3FW1A 4XVQA 3OKPA 1J00A 1B93A 3GEEA 1SCQA 2CLCX 4P7BA 3QWFA 1GFIA 1E3WA 1JU3A 4I9GA 4KLCA 5ALGA 2ZI3A 5E4YA 1JTEA 3MFQA 1J97A 1U3CA 4BNWA 4RPJA 3E9MA 2EW2A 3QG5A 4FQ8A 5DCLA 3V7YA 3I2FA 5F1PA 2VWPA 1I7SB 1JEOA 2C9DA 4N4AA 2R3SA 2J32A 4YRSA 5DVZA 2AK2A 2BJVA 2QRQA 4U9HS 3PF9A 1GNQA 3PGVA 4ZJPA 5C8ZA 2VO1A 5JQWA 5L4SA 1PQPA 1J6UA 2PD6A 2VBFA 1SXJD 5BRNA 4Y7DA 3W3AA 1TK9A 1B6RA 1VPTA 2VAMA 3OJLA 5ALTA 3RI3A 3TD6A 3O8BA 5BN5A 3AM1A 1K66A 4NE2A 3F5QA 3BF7A 4M9SA 1W2WB 1YZVA 2IKSA 5AK5A 3QYPA 3DYVA 3QUQA 4CEJB 2A35A 2DETA 4H6VA 2P3SA 2WSSD 1MB9A 3DVQX 1FC0A 5GQSA 1I0ZA 2BFMA 3IA7A 2P9CA 4X00A 4C14A 3EULA 1DKOA 2P2NA 3VKWA 3OAAA 4UVDA 4JYCA 1KMHB 2B3TA 2JGIA 3ADPA 1E92A 4FKBA 5ICCA 5JAZA 2XRYA 5D3KA 2DWQA 3FRHA 3N8DA 2D0DA 2XBLA 1OFUA 5TV2A 1FS5A 2ZE6A 3P2OA 3WL4A 4E07A 5IYZA 1N5DA 2R8PA 4UJ3A 5H4HA 4TQAA 2D0IA 2XGJA 1A9PA 2ZREA 1TUEA 5TPZD 3RV4A 2IW1A 5HUJA 1GFZA 1NVEA 2NU7A 3R1IA 2BZGA 4E4RA 3LX5A 4LXXA 4MW2A 3SVTA 4KBFA 2DC1A 2YWRA 3GH1A 4MDFA 1ZU4A 2FXIA 4G0YA 1SVOA 4LOJA 5FBLB 1VECA 3VKHA 1RFGE 2GD2A 4OF4A 1FDOA 1OZFA 3BUSA 3BMOB 2A9VA 3KHTA 1HG0A 1SHJA 4GX1A 2BEVB 2GBPA 4UCWA 4KPFC 5CA0B 1HDOA 1QOQB 4FONA 3K0AB 1DGQA 3LPCA 1FX0A 1E6MA 1AE1A 3QJYA 3T5GA 3AY6A 4DR6B 1DJPA 1C3JA 1XT6A 3B9RA 2G4CA 4JBNA 4I2NA 3PDWA 4WBNA 3ERCA 4BP1A 2P4EA 2Y71A 1AD2A 5AXDA 1OPRA 1V3QE 4GLLA 1UMCA 2XOXA 3TAHA 4IZHA 1LV8A 4B5LA 1Q0HA 1RZ3A 3LL7A 5I7WA 5DW0A 4DMUB 4I1SA 4EABA 4PC2A 3SWWA 2QYOA 2RCNA 2PX8A 3NKLA 5DFAA 4B3X