4IGKA

Structure of human brca1 brct in complex with atrip peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
211
Chain Sequence
VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the BRCA1 BRCT Interaction with the Proteins ATRIP and BAAT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Breast cancer type 1 susceptibility protein
total genus 63
structure length 211
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4igkA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4igkA01
2ADOA 2COUA 3FA2A 4IGKA 1GZHB 3AL2A 4U4AA 4JLUA 3PXCX 3AL3A 1IN1A 1JNXX 3PXDA 1CDZA 1T2UA 4IFIA 1T15A 2JW5A 2COEA 1Z56C 1T2VA 2DUNA 1OQAA 2R1ZA 4Y2GA 5ECGC 2XNHA 3SHVA 2LE0A 3K0HA 3II6X 4N40A 3PXBA 2EP8A 3I0MA 2VXBA 1Y98A 3COJA 2EBUA 2HTFA 3K15A 3KTFA 3HUEA 4OFBA 3OLCX 3L41A 2E2WA 3QVGB 1N5OX 3UEOA 1IMOA 2K7FA 3EF1A 3L40A 2ETXA 3HUFA 2EBWA 3PD7A 3K16A 4XQ0A 1KZYC 1T29A 4XPZA 3T1NA 1L0BA 3PXAA 4BMDA 2L42A 2VXCA 1WF6A 2NTEA 4BU1A 3I0NA 2XNKA 3PXEA 3T7IA 3K05A 3QVGA 1L7BA 4ID3A 3PC8C 3PC6A 2INGX 3T7JA 3JVEA 3PC8A 3PC7A 2D8MA 3SHTA 4BU0A 3UENA 3SQDA 4BMCA 3K0KA 3U3ZA 2WT8A 4Y18A 3L46A 3T7KA 3EF0A 2AZMA 3SZMA 2M2IA 2COKA 3PA6A 2K6GA
chains in the Genus database with same CATH superfamily
3QVMA 3M5PA 4GR4A 3KJGA 3KE8A 2BFCB 1RACA 4CU2A 2I99A 1NR1A 4G81A 1CLUA 3LX8A 3H0KA 1R0XA 4ND1A 4QAQA 1AKVA 2AA3A 4K1XA 5C2JB 1GTMA 3OQIB 4XGQA 1Q6ZA 3QVWA 1T5DX 1J8DA 2NSYA 3A4VA 5G3ZA 4OHZA 4DIUA 4MUFA 4JI8B 3NC4A 5HDQA 4ZYWA 5IWAB 4RPLA 3M4ZA 5CTJA 1GZ6A 3QKUA 2QTLA 4Z1MD 2XYGA 3GUUA 3UF0A 1XMOB 2BCJQ 4L22A 3EUEA 4RTSA 3JX9A 1JJVA 2HJGA 4JLVA 4UPDA 2Q0XA 3VBCA 1EKXA 5CCBA 3KDAA 1E20A 4FFSA 1K2WA 1KXJA 5A4IS 1QTNA 3JR7A 4F8EA 1U8YA 2HLNA 3ME5A 2X3UA 3MZ0A 3W8NA 3VDRA 5DSXA 4HUQA 1Y4SA 3ROQA 4RKYA 4P7KA 2BEUA 2XW6A 3DOFA 4CF7A 1N8SA 3EIQA 3A3NA 2LV8A 3P2JA 2WSSA 4QTTB 3KPVA 4YJ3F 4IMRA 3H16A 2DPHA 4N3NA 4H27A 4BNYA 3U3RA 1C7QA 3BXOA 5ALPA 4G3XA 1W88B 1QMGA 1A7JA 3DLCA 5CJ2A 4FD3A 2ZYTX 5IHPA 3UHAA 2A78A 2Y1LA 4XWKA 4WQMA 4YP5A 2G17A 4AJIA 1HORA 3TE7A 1KPHA 1KZGB 4KO1S 3QPUA 2ZETA 3DJFA 4RESA 5AKLA 3UGQA 4ZCRA 5FUMA 1VXRA 3SKVA 1AX9A 3KPJA 4MUAA 2WIFA 4LFCB 2A1TR 4W9NC 4Y6GB 5FA8A 2XUPA 3PDJA 3OM9A 2IUSA 2QAIA 4QU9A 3DZIA 4D8WA 5JC1A 4BMOB 2D4AA 1N3BA 1YRYE 2VT3A 5I9SA 4DLZA 2XOKD 3GRUA 3HLTA 4BFCA 4L8LA 4UU1A 3L1VA 1CF4A 2JGLA 5I7RA 3K1ZA 4ZOQI 3UWKA 1P4RA 1S5PA 3FNQA 5A4MS 2HNAA 4K8OA 4QU0A 2IUUA 3H1BA 4DV6B 1ZM9A 2L42A 3CJTA 2AEJA 2W2XA 3EBPA 3AVOA 3QOFA 4N8EA 1FFSA 1XFAA 3DTVD 2HZ7A 1G7SA 3EFOB 2VNIA 5H16A 4OQNA 4PWZA 2OCDA 1E2PA 4ZHQB 5JCJA 1IHUA 1KIMA 1XRSB 2ZWVA 2BFBA 3ZWWA 1BQ4A 4M1OA 4CLRB 1ZI9A 1FMLA 3TQTA 4X5OA 3BK7A 5JFOA 1LZKA 2PSHA 2W6NA 5J2TF 4C2AA 4EUFA 4ZEWA 5A4DA 1YZYA 2ZR8A 1VKOA 2ZVPX 2FP4A 3O91A 4ILEA 3CLVA 2FPWA 3QUCA 3TTTA 1K2VN 3K9FC 3CRW1 4YJGB 4UEQA 3T1HB 4DDTA 3LHFA 4Y1EA 1EDOA 4OBXA 3TSWA 4L9SA 4CLOA 1REQB 4LCEA 3SQDA 1GU0A 4YT8A 4OQEA 3K0KA 1SM4A 1X7DA 2BLNA 3GI1A 2OXTA 5JH7F 3QQPA 3WKBA 4LC9A 2ET6A 2DT8A 2GVDC 5JMOA 2UUAB 1JDVA 2VSOA 1C2YA 4JJZA 4JC8A 4N7BA 3FOFC 2CT8A 4OI0A 2IYVA 3QU9A 3FA2A 1X7XA 4IIYA 1QHYA 3O4GA 1U81A 1NLFA 3GWGA 1W5TA 3E3MA 2RH9B 4MKRA 5CW2A 3I61A 2Q6LA 1I2CA 4Q39A 2DF8A 3AP2A 4WA8A 5L4SA 5D01A 2M1XA 3RVDA 2JA2A 3WNVA 1V1RA 3HZZA 4A91A 2VDKB 3K2EA 5CAEB 4A2WA 4BVBA 2NLOA 4YJ2B 5A02A 4P82A 3CONA 4UTRA 1DO2A 1IEWA 1PN3A 3M89A 2HHJA 2F8LA 1R00A 4BQRA 1ZD5A 1JEEA 1EGMB 5DBFA 1YJ8A 4R6XA 1HMYA 1FTWA 4U7JA 2FYTA 1CZHA 3V2HA 5G1PA 2C77A 4ARSA 4GOOD 4JMPA 4NPHA 2WMOB 5JCOA 2P8JA 2WT4A 2I2WA 2YICA 2B1QA 2PYZA 1XHFA 2WE8A 5FJJA 2R86A 3NVDA 5B2FA 5JISA 2CV2A 2Z8YM 5K0EA 4NYJQ 1ZRNA 4ZHSA 5EUCA 2HSGA 1SK8A 1ZWLA 3GPCA 1DC3A 3ORFA 2I9KA 1OLXA 1SBYA 3HYSA 3WZMA 3MRTA 4G1FA 4JLAA 1IN4A 3B5JA 1J8VA 1E2DA 2JNWA 3DV0A 4LV8B 1ZUD1 2FSVA 3DR5A 4MJLA 3LH5A 1TAQA 1XAHA 3VJLA 4EHAA 2CNWA 1D0IA 3HLYA 5LXTF 3P2YA 5H83A 1GUYA 2QN9A 1WW3A 2WYOA 1DJOA 2GT1A 3QEAZ 1DARA 4TMVA 2V7BA 2WPDA 1LI5A 3S7ZA 5CLGA 1N8KA 2PO5A 4E5KA 1SOVA 3G88A 1ILEA 2XMQA 3PGLA 4PZCA 5TNXA 3SF0A 5IXJA 5JZMA 3UCXA 5LIPA 3GD5A 2CLCX 3BFVA 3QLJA 5AXAA 2IQIA 3RFFA 2PAAA 4A23A 2QLFA 1UZNA 1RQ7A 3WMRA 4MUGA 3PD7A 3OQOA 1I2DA 3TNDA 2H9AA 4JS0A 4DLSA 3JAMA 5G1NA 2C4NA 3LHKA 3VZCA 1MG5A 2HIHA 2HQ1A 1MVOA 2P11A 1E3LA 2ADFA 1IOWA 1G20E 2GD6A 2QUHA 3QUTA 4NBTA 1HSZA 1ATZA 2A7XA 1DDIA 2M6SA 2CNNA 2QX7A 4DJ5X 2Q3LA 2W6MA 4R1PA 1BCSB 3D02A 1T3ZA 1YZVA 1IXZA 5H4HA 2GBPA 3IOYA 4PR3A 2FMFA 4OP2A 4DY4A 3M2TA 5FBQB 1M6EX 2IUFA 2O7VA 3OIDA 2BFDA 3K0EA 4IQ8A 1E5DA 2NUTA 2UYHA 4B0OA 5BORA 4QDOA 5D86A 1JPVA 4LMBA 2PBFA 2XMRA 3TEJA 3ECAA 4INPA 1NULA 4DCMA 2RGCA 2IZ1A 2J46A 3H97A 2OCBA 1VDZA 1KC1A 4TVKA 1OLSA 4IS3A 3EULA 4JXKA 2B4KA 1M8KA 4ZDIA 1ZJ4A 4MKIA 1VE3A 3BEOA 4JR1A 2R6HA 1LSOA 2HBQA 4BJ6A 1JB9A 1W1UA 4KXXA 4BNLA 3TWOA 2ZRNA 2PBLA 3Q12A 4EKEA 1VJTA 4O6VA 1QS0B 1R3UA 5BSTA 2H1IA 4V0MA 3DEHA 2HR1A 2QEQA 2JZNA 1KEEB 1ANKA 3V1MA 3HB9A 4L02A 2IU0A 3PA6A 4CTJA 3CR8A 3GJ0A 4CU5A 1Q1GA 4HK4A 4PLCA 3R7DA 4PQGA 1V47A 3ORYA 1X6VA 3AFGA 1C3EA 4M0LA 2MMGA 1KQNA 4B85A 5LQCA 3SVTA 3UMFA 2FW0A 2DKFA 4CQMB 1IN6A 2O2XA 3KQHA 2FMXA 2WM2A 4AZ0B 3HGTA 1YQWA 2G6BA 1ZUNA 1WSDA 4AJHA 2DR3A 2VJBA 2BAGA 3LOQA 5IKOA 1MV5A 2Y76A 2A5YB 3BMCA 5IKPA 2ONYA 4H0NA 1GM5A 4LJAA 2ACKA 3IDSA 1WZNA 3OIWA 4I6EA 5JS8A 4TKLA 4WY2A 3HI6A 2Q7OE 4IFIA 3GP8A 2R97A 2JFNA 3MWJA 2Z2YA 3PHGA 3Q3IA 4V0OA 3PWKA 3WGOA 1BTOA 1XDSA 5HRUA 4QG3A 3DMFA 1A9YA 2W0SA 5ECGC 3MCAA 1XAIA 4CF4A 1BEZA 4TYQA 2XE6A 3KC2A 4KQXA 4INOA 1Z6AA 4L5IA 4PN3A 3SXUA 1FP4A 1I9CA 1L5YA 1NLZA 2PZEA 2I4OA 3FGPA 5E1DA 3VPDA 1N2CB 3FPFA 5ALZA 3CWZA 2CZGA 2FP3A 4GNKA 3T95A 2IZ5A 3IYLW 4YBZA 2PMCA 4GLLA 3TX2A 2VH5R 3R3ZA 2WICA 4AP9A 3HBAA 4LCBA 1FP2A 4GXNA 3X1KA 4X54A 1CDOA 2QNBA 4K6MA 2YWJA 5LLSA 1Z7GA 1QRUA 3OUTA 4GMFA 1LVGA 1YZFA 2RHHA 3SOZA 3WGJA 3B9BA 1ZJZA 1P81A 1FYVA 1IHDA 5IW8A 4A5OA 1E6LA 2BI4A 1KARA 2AR7A 4JX9A 4D0RA 3DXYA 4OLHA 2H8KA 3RRFA 2OBMA 4XWGA 1YJ5A 4R1UA 4DXDA 3CRZA 4EPRA 4NZPA 1Y8RB 2JGRA 3GA7A 2O1WA 1AGRA 3PXGA 3SJUA 3UMGA 1XRQA 5AH0A 2BSAA 3K1TA 3FYCA 4H17A 3V1UA 3PIDA 4YV2A 1K8ZB 3LT0A 3PSAA 4W9MC 2HV8A 4BMVA 3L92A 2XOKA 3FMVA 1PLKA 1N9GB 2Q8PA 5EKXA 3RHFA 5LDGA 1T4MA 2ZE6A 2QL7A 1KP2A 2Y1FA 1D2CA 4KRGA 4XUCA 5JD3A 3X2FA 1R6UA 2ZYSA 4MARA 1H0KA 3R9XA 4FB5A 2AZDA 5J1SB 3WBJA 3RYIA 4PIVA 3BZUA 1XD9A 5JBNA 3JQ9A 1NUAA 1RWKA 4YMHA 2P6NA 3NHPA 4LTDA 1YCHA 3OSUA 4QU8A 1UM8A 2REOA 4DLXA 1DQSA 1Y7PA 1Y5MA 2GZ2A 1IQPA 2IIBA 2PSSA 1TIBA 3K31A 4MR7A 4QBIA 1II0A 1V43A 5DTIA 5AT1A 4RTQA 1X70A 4OGWA 1JEYA 1DRUA 3ZCUA 1JFFB 2GILA 2ZT7A 1GD1O 3BJEA 3JD0A 5AM0A 5FX2A 1Z6ZA 3MD0A 3Q98A 3IC5A 1L5VA 1G2OA 3VR4A 1XJQA 2PUWA 1K4MA 5DYYA 2EP5A 5JNLA 1MPXA 1KYXA 4YRGA 3C43A 1NBAA 1RXSA 1CS0A 1P7ZA 4N54A 1T43A 2G9QA 4UUBA 4BKRA 2QP9X 5B6JA 5A6SB 1DEOA 4Q3OA 1KYQA 4JKYA 1G21A 4G4SO 4PHFA 2R6FA 1UZMA 3LUKA 4U7HA 2EKZA 3LVRE 1XL1A 2CL6X 3NYRA 3WLFA 4UVGA 1QHEA 3SMVA 5JAHA 4GMHA 1F3OA 2IHBA 1CR1A 1Z5OA 4XPIB 1MHPA 3VDXA 4LGVA 3VR0A 3MWKA 3V32A 3WADA 4ETWA 1G5QA 4KVFA 4JP8A 4ENQA 4L0MA 3I2KA 4O5AA 5A5DA 4J7CA 3F73A 3KAJA 3HCWA 1XAGA 2WV7A 1G3IA 1K08A 2I3DA 5HA5A 5EJGA 1GLNA 4Q93A 3VNUA 3W2EA 1NXTA 2HK6A 4EYSA 2D0OB 3D31A 2FW8A 5B1IA 4YRQA 4FCCA 2X5XA 2PUFA 4ZT5A 4GZ3A 5DTJA 1T4GA 4A1OA 4HDRA 5CIYA 4QE3A 2F2TA 3X44A 2JCBA 4LK2A 2AB0A 2VNAA 1JTVA 2HFKA 2WABA 3D6TB 5EIFA 1EAMA 1KI2A 1ZNQO 2WT9A 1XV5A 2I80A 2WPNA 4MTCA 4MUBA 1XHEA 2DGDA 3WICA 4AUKA 2C9ZA 3ET4A 3SDBA 4GOJA 5CBPB 3QMMA 4DDHA 5A7FA 1E79A 2OHFA 1GKLA 4IRUB 4E46A 3VA7A 2WBLC 1N7JA 4MZDA 3R0IA 1J0AA 1GR1A 4UTVA 3GEGA 3RIYA 3KWMA 1MIHA 3K35A 2B5WA 4JEUA 1U99A 4YNBA 3TUJC 3OURA 2OZKA 4ZVMA 4BGDA 5M04A 3COZA 3CH5A 2AEFA 1OFGA 1ZVMA 3AI3A 3HGQA 3OY2A 1BW9B 4MS4B 1C1DB 5E9AA 3OJEA 1M1NB 4QDKA 2ZR0A 4REQA 1XVVA 2G40A 3VOAA 1LLUA 1W94A 1ID1A 2QZ4A 4UM9D 3KVYA 3RIMA 2QROA 2J9XB 1PO7A 4B6EA 5HF6A 3U9TA 1LI4A 3D4PA 3D8SA 4INAA 4BJHB 1CRPA 3QA3E 3EY9A 1VRWA 2JGNA 3SQWA 4M7WA 4OKNA 1HGXA 2DZDA 3CVYA 3KTAA 3G5AA 1T4DA 1XNGA 2X7XA 5FUWA 1FQOA 3E35A 3O8QA 3QTLA 4Z9BA 1FRVA 3O8QB 4OKIA 1EQUA 3AF1A 2QMUA 3FNHA 2Q9BA 5ALGA 3R3WA 4EJSC 5TPZD 1LF5A 3HJNA 1EA5A 4DCJA 4DM4A 2JJ1D 1AQJA 2V0NA 4MV3A 5JARA 2CXHA 3DYIA 2R6JA 3V7YA 4P0TA 3UXEA 1SG0A 2D1SA 3PFKA 3VC1A 3ZJ5A 1WU7A 5E3IA 4QDXA 3ROKA 3C41J 3I5UA 4TXNA 4UREA 3VSEA 4A6DA 1W36C 3NMUF 1VPTA 2R8YA 4ALMA 5KNCD 2IT1A 2FUKA 3AR4A 4MS4A 2VUSA 4Q18A 1O9HA 3E8MA 1UFKA 1EDDA 5FL7D 3HV0A 4BZXA 5CMLA 3K6KA 2HA4A 2J3EA 2CVOA 3IUSA 1UIRA 4TS4A 1WB6A 1YHYA 2GAOA 3OX1A 1B8OA 4ZI7B 4NULA 4ZJUA 1H9BA 2M9MA 2CDNA 2Y71A 4GO1A 4TZKA 1BWQA 3K92A 1ZGAA 4DLPA 1F1JA 3TNYA 1ODJA 3DV9A 4GYKA 5DYWA 5CCEA 2AIRA 2TRSB 2R7NA 3V1TC 5J3JA 2HRBA 2DWUA 3NH9A 3SSAA 4Z4QA 2NM0A 3TIXB 1TQDA 2MYNA 5IC5A 2FSPA 3KZCA 1BMQA 2ETVA 4KO8A 1YOVA 3MVEA 2H4XA 4B2PA 1MEOA 2PS9A 4MZXA 4C0BA 4EYEA 4FSDA 1I6KA 3WL8A 4EHJA 1ZIOA 1AO0A 4KIGA 1M2OB 1U3CA 3AL2A 5KTTA 2ZRBA 3IIJA 1QM5A 4NTZA 3UA4A 4NV3A 5A5VA 1PV4A 2CHGA 3OTGA 5FNVA 1F5NA 2A14A 1O1YA 2Z58A 3BXGA 3ESAA 3QEMA 4N0MA 2XE7A 2IUEA 3NG1A 2K2WA 4IMIB 4BMXA 5LJIA 5KSPA 4XIYA 2DG2A 3JZAA 1A1SA 2QVBA 3QRWA 4WK6A 3T6KA 4N8DA 3W04A 1PG2A 3HJTA 5J40A 1MDBA 4YFYA 3WLNA 3S1SA 1FRQA 3NCHA 3O8OB 2I6GA 2RAVA 1NXQA 3SP1A 1G2QA 1T2DA 1KI3A 1NBMD 2P69A 2QPTA 4KMSA 3URMA 3V8MA 2L0XA 3FYHA 2C1EA 1PVVA 4ZZ2A 4NC9A 1W0JD 2C8KA 2D2VA 4BP8A 1SVOA 5KYYA 2ATVA 2V1UA 1Y7HA 3EGXA 2OO3A 2ZRGA 2V6FA 3QWIA 4OHFA 3SEAA 1V8ZA 3NAZA 4MQLA 1KFJB 1PZFA 3I2YX 4PNEA 3Q3HA 4RIGA 3TOZA 3DPUA 4ZCTA 1T5TA 2AW5A 2NYVA 3AG5A 3LKDA 3VQTA 2ZQYA 2ZR7A 2A33A 3CINA 1E2NA 3L41A 3OLCX 4PS1A 3ZZNA 2FZCA 2OQ2A 4Y2TA 3ZCTA 1EUDA 5KQGA 2V3VA 1QZUA 5KQSA 3RYFB 4ROSA 5FPKA 5IEJA 1B0AA 2V9ZA 4HYYA 2Z09A 3B8HA 1E3WA 4N9WA 1YJXA 1RU3A 1N1DA 2FN3A 3FYUA 4D80A 2C5HA 2I1WA 2JI9A 1WJGA 3NALA 4PXYA 4WESB 4P1ZA 1CUXA 1ZHOA 1NMZA 1AQUA 5SV2A 2IYSA 3CB4A 4Z51A 3HXQA 2G0AA 1V95A 4L5YA 1E2MA 5F5NA 1N6KA 1WZIA 3ZCXA 5EKSA 2NQ2C 2RHTA 1JHRA 2W2LD 3GH1A 3HMQA 3FMGA 4AJ2A 2Z2XA 1AGNA 4YAGA 4X1YB 2JKVA 2JATA 3ZBQA 4Z3KA 4FC6A 1FTYA 4KO4S 1BFUA 4JQSA 2NZVG 3EG9A 2ZRMA 4PZ9A 1GGVA 4BLRA 1RC8A 5CA1F 4AG5A 4MQUA 5CYGA 3KIPA 4K87A 4RHXA 2ZRHA 3B1JA 3CTPA 1V8FA 3HN2A 1YBMA 3IPYA 4INZA 5HIJA 5DHFA 3RLFA 4BLTA 2E6UX 1WSBA 2MSWA 3P5SA 3TXAA 4YQFA 4Q4AA 4M7RA 1FRFS 4YAJA 4QZVA 3RTGA 5DHPA 5LQAA 3FCSB 1XVTA 3ZGNA 4DGQA 2Q29A 3OVMA 5JOQA 5COBA 2EFJA 3RBAA 1PSWA 1QE3A 1DQPA 4WNYA 4ZQGA 4C2BA 1WDKA 2Y6UA 3K9QO 4DE5A 5K8CA 1QOQB 4RK7A 3DZHA 5CD9A 2F1RA 2HXGA 1XDDA 3QELB 1A69A 4HXEB 4C4ZA 1KOFA 1VHTA 1RW4A 1JZSA 3A4LA 3H9BA 1RTTA 4IW3B 1RS0A 4E32A 2M2IA 2NVUA 2AFHB 3FFWA 5F5XA 5JSZB 4EA7A 1AV7A 3EEIA 3NHSA 4GX2A 3LVBA 5ICCA 2V7WA 1QK5A 4P8RA 1VZ2A 1SC9A 1GZUA 3KXPA 4BAGA 4DILA 4EHIA 3D8NA 1M2FA 1QG0A 4TV9F 4WLNA 4EUHA 3DULA 1K9VF 5E0OA 5IDXA 5LQUA 1W49A 2B98A 3THWA 3EVAA 4O2BB 2XKKA 5JE8A 4JXJA 4QRDA 1O97C 4YCLA 3SEFA 1E89A 1QH0A 1W4CA 1G5TA 2O1XA 3TLJA 3VYVA 4YCNA 2FOXA 1BAPA 2X19A 2A67A 4MAFA 5A0FA 5IJWA 1A4IA 1Y6ZA 3P19A 1GGEA 2Q2NA 3UAWA 2X8JB 1OI2A 3PXUA 3T9AA 1NI4A 4PYNA 3ASUA 1T2AA 4UTZA 5TGZA 4JLSA 3ZHVA 5I3CA 4I1PA 3EODA 1YCDA 2ZYAA 3QE3A 4QTUB 2JFOA 4DHEA 4AKIA 2W48A 4UAGA 2FMUA 3DGFC 5I47A 1A1VA 3QBDA 2Q5CA 4JAVC 3ADCA 1YK1A 2QHXA 3BSWA 1ZN9A 1CZLA 1L7DA 2H0AA 1JAXA 4TUYA 1ODTC 2W4QA 3KR1A 1Z5GA 1RLOA 5AM4A 2ZYHA 3A2KA 1OLSB 2P5TB 3FZGA 5EYPA 1YQQA 3TGWA 5FEUA 5FFNA 3LIIA 3T0FA 2PVPA 4P84A 1N5OX 4XGKA 5HBGA 4Q66C 4ZN6A 2CXOA 4C6TB 2CY0A 1YWGO 2KI5A 3VV3A 5H1YA 4EB6A 1LPPA 1SJ9A 1U5BB 2AFHE 2R84A 3ZV6A 2FXVA 1JLHA 1C3JA 4Y2RA 5KWEA 1YK0A 5AW5A 4R2IA 3PE4A 1XQ6A 5DNUA 4N5IX 2AZTA 2XNJA 1TPZA 2XQIA 4DZRA 4L3OA 4EVQA 3W9UA 4YQEA 1LPSA 5JY6A 2WF8A 1JPNA 3IJPA 4CRWB 4ER5A 2Q8QA 1E58A 4LX8A 1VG9B 2JLSA 2ZKIA 1E2JA 4WXYB 3UKOA 3WVNA 2HF2A 1XZLA 1N2SA 2HQSA 3M4NA 5GONB 3UJHA 2C96A 2PUEA 5IF3A 2VF2A 1ZM3A 3G9TA 4V2UA 4BNKA 3ILYA 4ZYTA 5HJ5A 4AWBA 2BGJA 1GP2A 3I9V6 4Z9AA 4GYJA 5JEEA 3ELDA 2VT7A 4TRRA 2XCTB 1MRSA 1KHHA 4HNVA 1KNXA 2F67A 3H05A 4TLEA 3ZY6A 1OYYA 1QV9A 3PC6A 4E4RA 5IDVA 2Y8EA 1YB5A 3CPHA 4RD0A 4M99A 3V4OA 4PBTA 5TMPA 2CV1A 2GTPA 2WP8J 2IPOA 1QQAA 1DBRA 4TSFA 1CDEA 1UQTA 2YX1A 5EZQA 3PEYA 2UXCB 3EXAA 4C76A 2PWYA 3KKQA 3PC4A 2ZT5A 3DZGA 4UU0A 2RFLA 2FZKA 4HWTA 3BKWA 1MD9A 2FQWA 1QP0A 1ZBDA 3IVMA 5FBLB 1K8YB 4N9QA 3SX2A 1OZAA 4UVDA 3NBQA 2E7ZA 4KGVA 2IHYA 4HVLA 3ZDAA 3HR7A 3A3YA 1QB7A 1W76A 3HRHA 4UM9B 4IQFA 4YRNA 1YB2A 2Z3WA 3GVPA 4RGYA 5DN6A 3C70A 2QTMA 1CUHA 2AE1A 3BFPA 5F3RA 2RD2A 5LQSA 3TL3A 2EHJA 1D8TA 2PL9A 2VZ0A 3LU1A 2VHZA 4M9ZA 4FDUA 3FYDA 4DLKA 4B4KA 5GV7A 1G16A 1R5JA 2KM1A 1EXMA 2ZUCA 3ZCRA 1BXZA 3ZHQA 1DG3A 1DT5A 1I1HA 1R4MB 2CXNA 2RHDA 3CEAA 1WEKA 2OB2A 4KXUA 4PC2A 1SY7A 1Q1QA 3EN0A 2Y1XA 3KEQA 3MWFA 1ZG3A 4XFJA 5AJXA 4DT1B 5BNTA 2HMWA 2R4UA 4HGPA 2ANBA 2PVCA 2Q0SA 2Q21A 4RJ2A 5G53C 5I7WA 1CUCA 1ISIA 2Q5EA 3KT8A 4M37A 3TE6A 3ZWXA 2BI7A 1X7XB 2C3YA 4WGFA 4C3VA 4ZO8A 1Y5RA 1NDHA 3FFAA 1FZTA 1TUIA 4PTZA 3CE9A 5HKBA 2ISSD 2RI6A 4O2LA 5AK3A 4NCBA 2OL4A 1Q1EA 1XQ1A 1Q11A 1YB1A 3HDGA 4CF5A 4RZSA 1XD2B 1XVLA 3B1VA 1IAQA 3CW2A 4D8VA 4PN7A 4Q4JB 2WQZA 4KR2A 4XYBA 3I64A 5KSZA 1G17A 3WIDA 2B2CA 3K70D 4R9VA 1N33B 1NW4A 3QHQA 3UMVA 2C3PA 2X0JA 2J0VA 3PX3A 1EDZA 1YQXA 3RR2A 2YNMC 4D8YA 4OFBA 1J6UA 3ANLA 4BO7A 1USGA 4UUNA 3WGUA 3WLHA 5CD1A 1FMFA 4JCOA 1MBZA 1NWCA 2CWDA 3BMNA 4UASA 2C7GA 2FQXA 2BGGA 1Z4QA 1JU4A 3IERA 3IR7A 5B30A 1ZOSA 2YXLA 5L3RA 3WP0A 5HKAA 1BQEA 2GNPA 4EATA 4R40A 2J67A 3GPBA 2CHQA 4K6FA 5INTA 1A95A 2WDZA 5PNTA 1TMKA 4GDMA 5HFJA 2LIVA 1Z7EA 4NABA 2D5CA 1M0WA 2H1VA 3JVUA 4GW3A 5AVTA 3ETGA 2X0KA 5IKMA 3TPFA 1RBZA 4H4DA 5FI0B 1F0KA 3C7DB 2A2ZA 1M2WA 3N1UA 1ODLA 1R12A 4IJKA 4RTPA 3OQPA 2R6CA 1O58A 3DBHB 5JT1A 1VIDA 1JIXA 2D5LA 3IHKA 2IXFA 2NO0A 2RGXA 3EW9A 3H04A 1CJMA 3I2IA 3QE2A 3ZX4A 2JLCA 4WKNA 4CL8A 4RELA 2YV3A 1QHHB 4J1TC 4RZ3A 4B35A 5TQ0A 4WIAA 4JOCA 1NXOA 3CQ9A 3IUBA 1PL0A 1V8DA 4BBZA 4X8HA 4HCJA 2QRHA 3UKJA 9LDTA 3JATB 3IOMA 1H8ED 2PYDA 3L0BA 4KN8A 4M0UA 4Q7LA 1H6CA 4L7VA 3VO1A 1WQ4A 4O4LF 3ANYB 4V0SA 5AVWA 3SYNA 1ZSNA 3CTMA 3TQCA 3KXKA 2X3YA 3V3TA 1NG1A 4FGZA 4HAUA 1C50A 3BUSA 1M3SA 3RE1A 2IBSA 1SKMA 1R6AA 1Y8AA 4FT4A 1N6HA 3TLEA 3HU1A 4M4SA 5EIWA 3TYXA 4MV5A 5P21A 4DM3A 1F12A 4EFLA 3L84A 4IDAA 3TNJA 1UWLA 3HCPA 2Z6UA 4ZWNA 1WULS 3A9TA 1ZNXA 4OI2A 3SF8B 3TMAA 3H9QA 3CISA 3VPXA 4D0NA 5IDQA 1ZJWA 1QGUA 3I62A 4IV5A 1E2UA 2DRIA 3B7PA 3BHIA 1O94A 4YCBA 4LSGA 3DMYA 4K2HA 4TYWA 1VE7A 3NBZC 3O1HB 4XB2A 5B57C 2R65A 3U3OA 4U8GA 3LW8A 4DV5B 1ZWKA 2EW2A 2BRUC 2PBRA 2XCSB 4B3GA 4OREX 3NOVA 4I3HA 3P1JA 3W2HA 4LNUA 1DIOB 4YRPA 2XZLA 2P9HA 4O5OA 5FWYA 3OQIA 3E22A 2DWOA 3GBPA 2H29A 2IZ0A 2OCKA 3UMCA 2YRFA 2OK8A 4GLBA 2MWMA 3A4MA 3AKDA 2QK4A 1ONPA 4NYJR 4NJEA 2ROQA 5CXSA 1FXSA 4YREA 3UJCA 1PKXA 3CU5A 4HNQA 3W3AH 5F3WB 5CH3A 3N7AA 2NZUG 1HDIA 1YRQA 3T5DA 4E3ZA 2ACEA 2IHTA 2IYXA 4MB6A 3CXUA 1D7OA 1EVLA 3VNRA 1FUEA 3F7NA 1BE0A 2DU8A 3FETA 4G9EA 2Z6QA 1DMSA 3GLIE 4PXAA 1PR1A 1VB3A 2YXEA 3A2NA 3G82C 3LL4A 3S2SA 3G5MA 3E2PA 2JJYA 4AJLA 2A3RA 1ZGZA 2C3OA 4JEHA 4QUIA 5C0OE 5L6MB 1PJ4A 1WUTA 4OQZA 1PFUA 1Z62A 1LLCA 1QYVA 1JKXA 2H5LA 4Z4IA 3RF7A 3DE5X 1LA2A 3NM6B 4TXMA 3V2IA 2R7LA 2G1JA 2XADA 4WD3A 2R25B 5LCXA 4E1BA 4AT1A 1P8AA 2Q50A 4CTOA 521PA 4TKUA 3GEMA 3DFZA 3OI7A 5LYJF 4MW0A 4C4PA 1I3OA 3GIDA 1UP6A 1FRNA 1A82A 2ZG6A 3PV0A 4GMDA 3CN9A 2E4WA 4JBIA 5A7GA 1KDZA 3AONB 1OILA 4L0DA 5GM1A 3PB3A 4NENB 3WLIA 5LQRA 1FW8A 3LQKA 1SKYE 4J94A 4ER6A 1HQKA 2A7QA 1ML3A 2AE2A 1VL0A 3LCMA 4HDNA 4B2YA 3IAEA 3BIWA 2IV7A 2QRQA 3INGA 3L05A 4WTOA 1MQAA 3T15A 3LFUA 3WYGA 2VZ9A 4Y0AA 3HRKA 2A94A 3VO9A 4J49A 3OWHA 2G4CA 2WJVA 4RX1A 4WL0A 1BKYA 2FQYA 3VH2A 4LY0A 1EG7A 4X44A 3RVJA 1MVNA 4ECAA 5MFPA 2Z43A 3EVTA 1JBEA 3BE8A 3KZKA 4FQ8A 2GM9A 3G7UA 5K2MA 3ZCQA 3DLHA 1KH1A 2ECPA 1VKJA 4OHMA 3WK4A 3GC6A 3STUA 1PE0A 4IM7A 3G9UA 3FYTA 1Z4IA 2Z2ZA 1LD3A 4KQHA 4BE9A 1HDOA 1WCWA 2GD2A 5I7SA 1SOWA 1KTIA 1DLJA 2E1PA 2EW1A 3UTCA 1V9LA 2SBTA 1TYBE 3HJGA 1QF9A 3OAAA 4M1TA 3WWEA 1K7YA 1KVRA 3FPAA 4MO9A 1JQJC 1WIWA 1T9HA 3QHPA 5BR7A 3E5RA 1R3DA 2AQHA 3BJRA 4FFPA 4YN3A 5C5EA 4EX7A 3ZG6A 1AY0A 3KJQA 4G5SA 4MWZA 3D8BA 4LOLA 4NDZA 1QU3A 3DTTA 2A6PA 4IXWA 4W7SA 2UUCB 1KSGA 4BVAA 2GBFA 3NTOA 3N0WA 4JYPA 2IODA 1U7TA 1W4RA 4OAPA 3ZQKA 1M1XB 1NI4B 3ZX5A 5J23A 1SB9A 2G7ZA 2MSNA 1XDBA 2ADOA 2OBLA 1Z37A 3IBGA 4I7EA 4O33A 4GL2A 2XUIA 3DBLB 3VPCA 2MINA 1DEKA 4JLKA 4LHYA 1Q50A 3OJ0A 3MTIA 1NKTA 4NLLA 3NIFB 4MMXB 3ZWNA 1JFSA 1QIJA 5JD6A 2YWBA 4FDLA 4WNAA 4W63A 5K4HA 3N2IA 2QSJA 2Z6VA 4KH1A 4RVUA 4ZOBA 1DLIA 5DEOA 4YUYA 2C7PA 1EP9A 4LWOA 3ZU4A 4S04A 4P5PA 4LBZA 4F5YA 4F12A 2ECQA 2P91A 2D0IA 2G70A 4FMBB 5DHUA 2O3SA 4DJJA 5E7IA 1KRWA 4GM1A 3S2EA 4IHKA 4AP5A 4MCJA 2YWCA 3I6ZA 2A9QA 4LJ4A 4EFKA 5AW0A 1ZA2A 3NETA 1DU4A 2YWHA 4KW7A 4IZ6A 3G0HA 4V1CB 2ZE5A 5H8WA 1MQ9A 3HFRA 2ES4A 2Y1OA 4CG1A 2HHHB 2J08A 2WJIA 2WHRA 4HXGA 4P92A 2VZLA 5E4TA 2N47A 2IX9A 2ZJ1A 3C3AA 3QUAA 5JROA 3PXBA 2WHPB 1HQCA 4RK4A 5I7AA 1V41E 2P30A 2LDBA 3SYMA 2J3MA 4J1QA 4KLCA 3TZ6A 4G0QA 3Q0TA 4IFEA 5B58T 1ZRHA 2FA9A 2XB9A 3H75A 3IIIA 3PFHA 4U0KA 4BIMA 5CX4A 2QZSA 3CT4A 3BTOA 3MJTA 4IIJF 4MRAA 4AF6A 5LP6F 1UPUA 4CKCA 2GERA 1TQ6A 2P27A 4QULA 3BTUA 4ZV4A 1OXTA 1HDRA 1DL5A 5JPIA 1G8GA 2C5GA 3QA9A 3AUYA 4FR0A 5AI4A 5AJVB 4LC0A 5K0LA 2QV0A 1K9SA 2H00A 2AMVA 4XEHA 2BGKA 3FIUA 2ZQ5A 3JZIA 2ECKA 4BMYA 3DCNA 4P3YA 5BNWA 3OETA 1N9KA 3U7HB 1FNCA 1D4OA 3DZFA 4MR9A 3BX1A 1VQ1A 3SGLA 1MRNA 2JCVA 2OD9A 3EEFA 3KKLA 5G0TA 4AJOA 4W8HA 4AG3A 2FMKA 1GCOA 2Z04A 4H16A 4TZ6A 1LQ2A 1UQRA 2J6HA 1Z15A 3T1NA 4G9GA 1P62B 2NU8A 3DS8A 2XIQA 4TMTA 2IRWA 3DKKA 1WMFA 1ZDMA 3MGAA 3FWNA 1EVZA 2C9DA 2WSSD 1ULAA 4MVWA 3CCCA 3TBKA 1F2UA 2AOXA 1D2NA 1QOZA 4P4SA 2AFIB 4DVGA 1V5FA 4GU5A 1JHOA 2I6XA 1FYEA 3PPYA 4B3CA 1WDLA 2DPMA 3PCRB 3SVLA 5CM9C 3Q7TA 3VOTA 1LPBB 1A7UA 1K97A 2RDMA 2I1VB 3QVGA 3MD9A 3OTHA 1OBHA 3FXAA 2C99A 4QT0A 5C1BA 2ZBEA 2WJGA 1HDZA 4L4SA 3EIXA 2QBYB 1D1PA 2Q6KA 1ZGHA 4G1EB 1I3CA 4AK9A 2PN1A 3VPHA 1UMDB 4DPMA 2ZSJA 2NV6A 2Q3CA 4B6PA 2WQ7A 1CUSA 3DM5A 1GR0A 1HOXA 4MVJF 3CVJA 3V1YA 1H94A 1QZZA 1SHJA 2VHVA 2WSBA 3H6HA 4XX1A 3BWDD 5KREA 1YDEA 3GAAA 2UVQA 3P26A 4LIPD 3CEJA 4MW4A 4MW1A 3NLLA 5DK4A 4KQJA 4MH0R 3IX7A 5DGTA 1Y5IA 2ODWA 3IBYA 3WXMA 1U3WA 1RJEA 4HB2A 1ZVKA 2COUA 1BDHA 2GQ0A 4AKHA 4EYOA 5AUOB 1F2TA 1JDBC 3V46A 2G83A 1V3UA 4WOCA 3FUVA 2E4VA 2A59A 3WDMA 9MHTA 1QFJA 3AY3A 5E9JA 5BQ3A 5I7VA 4KI7A 2HMVA 4S1PA 4HMQA 4RY9A 2ERCA 4UBJA 4YRJA 5K3DA 1RNLA 1CQIB 3HWX1 5FL7A 6ADHA 1SVUA 1VFNA 1Y1RA 1T9GR 5C3UA 2XRZA 1S8NA 4L73A 2OR3A 4CGYA 2Q2QA 3VHXB 2ZT6A 2CXSA 2YDXA 3ILXA 4XDGA 1JTFA 4E70A 5FI5A 2NV0A 4FTWA 3T0GA 3BHNA 1ECPA 3H5AA 3AETA 1Q3KA 1ONSA 2VCEA 2X42A 4ETNA 3BCSA 1DP4A 1EB9A 4TTJA 1AKTA 3ESYA 2PV0A 4QBGB 1FFDA 3A26A 2FWJA 1TE2A 4ZHQF 1I7QB 3K0HA 4YB8A 1KQGA 1YVPA 2CD9A 3GWZA 3INYA 2PLRA 4L8VA 5DW0A 3P32A 1FMCA 1MOSA 1GPH1 1SUAA 4LI3X 1CB7A 2CCGA 4OHPA 3QSYA 5CLJA 2QX4A 2XJ9A 5CVTA 2PUCA 1JILA 4KBFA 4ZD6A 3PI6A 3UB2A 5CT4A 4MDHA 3RRNA 4JI0B 5D00A 1DWQA 3PEWA 1J0BA 2A30A 5FAXA 5CLIA 5I6DA 3QU7A 2WM9B 1UODA 3PHIA 1UBTS 1JXOA 4TMWA 2N75A 4WT7A 3U49A 4PX9A 1P17A 1GEEA 3C6MA 3NV7A 1OGJA 3ASZA 4KIJA 1YKFA 2JH3A 4ZQIA 4BE4A 2PT7A 4KPYA 5L51A 1XPUA 1N2BA 2ZYGA 1KMCA 2O6LA 4DA8A 1EINA 1IUNA 2PZMA 1IN7A 4D9CA 1JKFA 3SMQA 1XYGA 4L2IB 3CKKA 2VDJA 2IHUA 2Y0BA 4IJ5A 4LYDA 4WOPA 5KAPA 3PU6A 3T3DA 5A4AA 2GXAA 4KUHA 2DH5A 4QVKA 2Z9DA 2JIPA 3ZHOA 4TYMA 5B1DA 2WYVA 1L0BA 4LQLA 5IX8A 3Q4GA 4G5OA 3Q10A 2I8AA 1XTTA 3PHBE 3V1KA 4ZT7A 4WACA 2CNDA 3OQ6A 1QK3A 3NP7A 1A2BA 3AYXB 3ZWCA 4DG8A 2QUBA 3IBCA 2XTMA 3P0RA 4YALA 4DANA 4RORA 2ZVJA 4G41A 4REQB 5CCXA 1AMUA 1PYOA 4EP1A 1JLKA 2OWEA 3G1WA 3A6EA 5JRJA 5KKNB 1U2GC 2C4UA 4Q19A 3CJRA 4ZO4A 1KAEA 3ZNNA 3PLAE 4E6PA 2NQTA 2ONJA 3WAGA 3CSSA 4DJAA 3QFCA 4BY9E 4ZVQA 3EEOA 1QK4A 3OZAA 4E03A 1POWA 3PUWA 1H2WA 4R1OA 4E7PA 3IKLA 1JLMA 3RS7A 1MOZA 4TMZA 2ZAOA 4ZTUB 3KT6A 1R0LA 4EGCB 4WPGA 1FIUA 5K0TA 1C0IA 3A36A 4PGMA 4G5RA 4B3SB 5HNKA 3T61A 1RPAA 2FLWA 5F33A 3FPEA 2F3RA 4XFKA 3PHLA 1EHCA 1NQOA 1GCGA 4U5QA 4E13A 4D6PA 3EDRA 4HF7A 1JDZA 1MMFB 3H7IA 4LYFA 2OCIA 4X8MA 4CIAA 1H0SA 1SOAA 2V7UA 1VI5A 1VG1A 2ZSUA 4CM1A 5F23A 3HCCA 1J7JA 3KK0A 2HTEA 1G9TA 3N07A 4ONEA 5TR9A 5CB8A 1O6FA 4BMNA 4RDHA 1MT3A 5F52A 2VUTA 1GFWA 1IOLA 2BW0A 1TUBA 1JLSA 1GFIA 1LBSA 2RG7A 2BEWA 3RSLA 5YASA 4ARVA 5IT0A 4X71A 1AQIA 1UXGA 3RYHB 2YHAA 5T4FA 4B75A 4G2NA 4Q01A 3T4PA 2XVXA 1AZTA 1RKUA 1OV6A 3FWPA 4CWAA 2BUBA 4NVRA 4TSRA 2BHTA 4JC0A 2Z3VA 1A9ZA 4XPIA 1UFVA 2GR9A 1DPFA 1RVV1 4LYJA 1J5EB 3DNMA 4DY6A 5ADWA 1E1QA 2J5RA 3CZPA 2G71A 5E3JA 3ONNA 3TO5A 3NASA 1CU1A 1YQTA 3DBVO 4EG8A 4MYRA 1TFUA 5I9MA 4MYSA 1UMCB 2XMZA 4RJIA 1FDUA 2E55A 1EWVA 2WSMA 4N40A 4J90A 5AWFC 3R7WA 1KTVA 4MQEA 3R23A 1JWBB 3G89A 3H18A 1TVMA 2CJYA 1SOUA 2OHGA 4GT1A 3THRA 1SVSA 4IUDS 3TIIA 4UCFA 5HKLA 4WXRA 4X97A 3RANA 3CX7A 2PUGA 1JN0A 3HSYA 1JIJA 2Y9PB 3F5MA 1XZQA 2VJLA 2QGFA 1EYZA 3MCVA 2WWVD 1K86A 2V7QA 3H2HA 3R3JA 3PYLA 3AC0A 3NAGA 3P2KA 1JFFA 4UDNA 4RQBA 1AK9A 3NHWA 5FOWA 4I4IA 1SD1A 2FR8C 3TQIA 3V8VA 3WWDA 2VYQA 2AJCA 4C1BA 4D45A 3AKZA 2DLDA 4J91A 2L18A 2A35A 2G08A 2QLTA 2VUUA 1ABBA 1ZJJA 3CUUA 2X1MA 3OT1A 4D3YA 2C2HA 4DMFA 1GFZA 4PAQA 5F51A 1OT5A 3PTAA 4KN6A 3FWYA 3ES9A 2NO5A 1IFXA 2OD7A 5ALQA 2CSXA 1BX1A 1YDGA 4JC4A 3LBNA 3LYHA 5DMXA 1URPA 4UEWA 5ADUS 5T41A 3IHTA 1N9GA 4ABYA 4BJ5A 2AOVA 5CB4B 3U6BA 1O94D 1JFLA 1G42A 1OWOA 2Y1GA 1W19A 4L8YA 2XMPA 5BR8B 3FTQA 1YDMA 3Q3CA 5DN6D 3BWCA 4KIWA 2YV5A 3GJZA 4LF6B 3EGDB 4AKTA 3S5JA 1UC8A 3PQEA 2PCJA 1QHXA 1A3CA 2ZB3A 3NFRA 4KIFA 2ZJ3A 1RAGA 2ZPTX 1V6SA 4E2WA 1FDIA 2O48X 1EFDN 1E7WA 4DV4B 1HTWA 2J8ZA 2BFMA 5IAKA 1YTUA 3UK1A 5B37A 1JIUA 3SY8A 2R85A 4XLLA 5JDIA 1WQ3A 1EEHA 1VA4A 4CV0A 2VVTA 4TLLB 5A5EA 4REOA 4XOUA 5DBOA 1TM3E 2H9YA 4G0VA 1F6DA 1W8IA 4EX6A 3JALA 1X7ZB 1E6MA 4XSHA 1WPRA 1U6KA 3EDCA 1FQJA 5AHRA 2OHVA 2ZAYA 3W8RA 4UEJA 1VI6A 3NBYC 5JRZA 4BRZA 1E0AA 3QX9A 1V9SA 1G7CA 3JQBC 2DKNA 4UNIA 3RO7A 2IPMA 3SXUB 1ZQ1A 4CL2A 3LWBA 4TT3D 3WYNA 1W85B 2VRBA 2CMKA 3MRVA 4NBRA 4CKWB 3OZWA 4HY3A 1IU9A 3RK4A 2FN7A 1DJQA 3N8DA 1L1EA 3WSTA 4JYAB 2CJWA 1TTHA 2ZRCA 3V33A 3ITDA 2H4HA 3MT8A 1FUKA 2AVNA 3QI7A 2BPOA 3QEBZ 2ZYVX 3DMDA 2Q28A 3EXHC 5TQVA 4PG8A 3PXCX 2BFNA 4QDJA 2IU4A 3AL3A 1X8LA 2WY2D 3BAZA 3ZTTA 4HAWA 4ZZIA 5KWIA 1YF3A 5LB2A 4FQ5A 1UPFA 3O3OB 4QGAA 3HCFA 2HUNA 3RSGA 4C78A 4P6VF 3GJ7A 1RHRA 1R0ZA 1GIAA 2X77A 1TK3A 4HN9A 1GV1A 1V7ZA 1IUKA 3OPYA 3HKBB 3RUIA 4EEKA 1KYVA 1JF8A 3IR6A 3CS3A 3PUYA 5PGMA 3CN7A 3WKCA 5KKAA 4FB4A 3SLRA 4RPGA 4NECA 5LQKA 1IULA 5I9IA 3VPSA 1C4XA 1IXSB 1Z0JA 4KHPB 5EMJA 1Q7CA 2J4CA 2FF5A 4HC4A 3V1NA 1OPRA 1ZQ9A 1BGXT 3DBIA 4AJPA 2PT5A 4CLEA 1KI9A 2AMJA 1JA9A 1JI3A 1P2DA 1XKLA 2G9VA 4KNVA 3ZN2A 16PKA 1OH6A 1Y6JA 3GY0A 4AZ3B 3WRYA 3KPWA 2BBWA 4RMHA 3CHYA 4XYEA 2WQ6A 2O4UX 4I5EA 3KP1A 3WHKA 4NX2A 5JAZA 1NVUQ 5KYXA 3BXEA 4GC5A 1EX1A 2IUYA 3F46A 4CMKA 3DGEC 3H5OA 3QKIA 3RC7A 2GEBA 3WB2A 4KXLA 3KXDA 1FP6A 1KY5A 1NLMA 4TRJA 2F3UA 2CV0A 1YZUA 2H2IA 3CKLA 1N77A 3IMGA 3NWBA 2EFCB 3KJNA 5JWRA 4PQFA 1XCMA 2IKQA 5KC8A 2SCUB 3VTFA 1P3JA 2P6OA 3H2GA 3D7SA 2CK3A 1ZN8A 3T3OA 3O21A 4TX1A 2QGNA 3MWEA 1BCSA 3RFVA 3LTNC 4W5OA 4MYDA 1Z4KA 2FV8A 4DR2B 5HTKA 1A0OA 3L0DA 4B8YA 2EQAA 2KS6A 1L4NA 2Z2IA 1NT2A 2XQKA 4EY7A 4TLDA 1VYTA 3IAM6 5EWMA 3WYEA 4Q12A 1TYEB 3GRKA 4UTPA 3VR6H 1RJ9B 3UICA 2YOGA 2A9OA 1T3HA 1Z0SA 4U8HA 5FV4A 2YMQA 1H2HA 1R8XA 2IEIA 4BB9A 1XLVA 5TMBA 4CM6A 1N5JA 2N46A 1W30A 3HACA 5IT9A 4M60A 1RIIA 2G4LA 3ZUGA 3LSTA 1A9OA 3C48A 4EUKA 2OGZA 3E81A 1N2XA 1XD8A 1Z7BA 2NTEA 3C1AA 2XUOA 3TXYA 2A5DA 4CLHA 2JAXA 3BK1A 3PITA 5B3JC 3HGMA 3OT5A 5TQJA 1OR8A 1PL6A 1I4EB 2QNIA 2V6IA 4N82A 1RFLA 4B80A 4QNNA 1P0FA 3AR9A 3T34A 1GSIA 1DAFA 1U9IC 4BLOA 4ZYVA 2X58A 5D87A 3D6FA 3R5TA 4OI4A 1WOYA 4HL6A 3W5UA 3ZZUA 1YAJA 1J1ZA 4JHXA 4G89A 4B33A 2ZSAA 1VPWA 2GCPA 1J0CA 1UJNA 2WT8A 1H4SA 3V4SA 2J0UB 1NVFA 3PQ6A 1QDLB 1Z6YA 3LZDA 4MI9A 5DMHA 3S70A 3FBTA 3IXMA 3KT3A 4I9GA 2DBQA 1TZ2A 3FGNA 2OQVA 3ECCA 3QNMA 3TQSA 4MA5A 3GRZA 1LBTA 3U48A 3CX4A 3D64A 1GRCA 3A28A 1LDYA 3WOHA 4D42A 2BCEA 4ZICA 4ZZ0A 1Z2OX 2H2FA 3UTDA 2Q3JA 4JLUA 1BU8A 2HU8A 3I6MA 3LT1A 5MN4A 3AR2A 2PKRA 4HVAA 3E27A 3WYFA 3GXOA 2PUBA 2WZBA 1UBRS 2E4YA 3UH0A 1VHDA 5FHQA 1A9XB 2GF2A 3MF4A 1RJWA 1VGRA 4KPFC 4LY6A 3M1LA 2O5CA 4PSAA 3NBXX 4CEJA 1XIVA 1YMVA 4WASA 1R0CA 1OJLA 1C9JA 1NF8A 3CG4A 4I8IA 4EITA 1YR2A 4LCJA 2YMPA 1AXRA 1CEQA 1UEJA 4HZGA 4TN5A 1BCRA 1O2DA 1SU8A 3AF5A 2QORA 4FU0A 4WJLA 3L4SO 1O9BA 3M4YA 4EI7A 5HHTA 1ND5A 1TECE 5MGNA 4EVIA 1T8YA 2FCRA 3K53A 2DETA 3P45A 3ADDA 1TOAA 2IP4A 1Q2XA 1Z07A 3O2JA 5FFFA 4YDQA 1CRQA 1PTKA 1CUUA 4Y6OA 3WAJA 3H4TA 3AEKA 1OVMA 2QXYA 3OZFA 5A9TA 3WLLA 2FH5B 4C3OB 4Z99A 1RI1A 2FP4B 2OMKA 2FZ5A 3C8MA 1Y1TA 1LSJA 2C3MA 4JR2A 2W71A 4HAYA 4MMYB 1JGTA 1Z4LA 4HN4B 1Q5PA 1JEAA 2GX6A 1IRXA 4BO9A 3NHLA 4RTOA 1JHVA 2AMFA 2QRJA 4MWOA 4YMTA 4L07A 4JJGA 3CB2A 4TRNA 4F5WA 4UZFA 1QNLA 3OZSA 3D81A 1JDPA 1T1IA 3DBRA 1X1RA 4H1UA 5CNKA 3MERA 3AVUA 2HX1A 2VJMA 3T5BA 3MRSA 2C97A 4I9FA 4PRZA 4KQ1A 4WN9B 5CDYA 1G59A 3K16A 4NNPA 2QR2A 3R7SA 3MUEA 2GEVA 2C2KA 3EZ7A 1P1KA 2Q5OA 2QTVA 1Y3BE 2C5FA 1THZA 3T3PB 1W4ZA 4KQIA 2ODQA 2UUOA 1P4JA 4IUCS 3I3OA 1I5RA 3I5AA 3NDJA 5DLDA 3X1DA 1A88A 1O4WA 2PQ2A 3OKAA 2RK6A 4MS3B 4KPEC 1YBAA 3O90A 4YROA 4K28A 3R7NA 2JLUA 3ZQUA 3VR5A 1HMPA 1YGPA 1D0VA 4DMLA 4PAGA 1J8QA 3B9PA 3EA0A 1VCIA 4ETMA 1DOAA 4MP6A 2GPAA 1GNPA 4OJKA 4MRVA 3ENVA 5DWQA 3E5HA 4PANA 4RFSB 4ZYLA 4YY3B 3CM0A 1EXDA 3NHKA 4OOEA 1G7TA 3Q8MA 3T38A 2O5EA 3R6TA 1Y1QA 4P3OA 1NBEA 5B3KA 5JW6A 4PLGA 4ACAA 1H69A 2Z9BA 1ONBA 1A4RA 3D7MA 3TCKA 2VP3A 1SVKA 3C85A 2VYNA 4CM4A 5L3SB 1N3IA 2AMLA 1DC6A 2JC3A 3LCJA 4ZREA 1WZ2A 3Q6IA 2B2XA 4OQYA 1GN8A 3W3AD 2NZYA 1BX0A 1GADO 1CUIA 4O4HB 2GN2A 2OTCA 4X90A 1X8KA 1ZMTA 2DBVO 3SG0A 2NUPB 1WG8A 3DEFA 4C0KA 3ZBUA 4C88A 2PKWA 1BHO1 1WS6A 2G76A 2MSKA 3I0ZA 4EFNA 3MAAC 2D62A 4WK2B 2HJRA 1LLFA 1K3FA 3MM4A 3M3DA 5HTOA 3ISVA 4DIKA 2R0QC 4FYWA 5B58C 1PQPA 1Q1BA 1AGYA 2GSWA 2VP2A 4PINA 2ZUEA 1F2UB 1MB2A 1YASA 3ZU3A 1ZH6A 2ZXFA 4BGEA 2O1SA 3N8KA 1JJIA 3IDOA 3JYHA 2BH9A 3L0YA 1DI0A 1YU6A 4I6JA 3SC2B 4AMVA 4QPDA 3V8EA 1YU9A 4BPBA 4NR0A 4ER3A 2QTVB 3UV6A 2OV6A 1ZI8A 4BNMA 4KRFA 1JDTA 3QEKA 3FCAA 3WMFA 1L7NA 4O4HF 5HMLA 4B6FA 4J3JA 5FPHA 3WHIA 3TTSA 2B3TA 4RPHA 4I9HA 2BMDA 3UMBA 4Q9LA 4BCBA 1RBMA 5DHAA 1B3RA 1Q2UA 4F04A 2XSZD 5EZSA 2E6KA 4RK5A 3LF1A 4RYDA 4LSMA 4X84A 4DBLE 5GWXA 1WPQA 3CRRA 4NCAA 4CCAA 1UT8A 3L1UA 1KMHB 1V5WA 4Q21A 1NP3A 3LWZA 4DRXA 5B3AA 2A0XA 1U8UA 1P5JA 4CFSA 4L1KA 2JGKA 5CLFA 1MP0A 1E63A 1VLMA 3QUBA 1NC1A 3SJZA 2CCKA 1AUXA 2YWXA 1EBBA 2YV1A 3Q2KA 1Z8DA 1D6MA 3D8RA 3K09C 3PNOA 4IX9A 3BL8A 4YECA 3UAVA 2ZUUA 3W5CA 4YONB 3K3PA 2IH2A 1OYVA 1QGAA 1OU4A 4OFWA 4IZHA 1JHUA 1WXHA 2PLFA 4MROA 3AGQA 4K8RB 4TV8A 3EZYA 3HJBA 5K1ZA 3OU6A 1PJSA 1WKCA 3GUCA 4F5ZA 5HKKD 1TMYA 2PH3A 4MQ4A 4DCTA 5KTKA 3DVAB 3TZQA 3K6SB 1XEXB 1DKQA 4P7JA 2RBKA 3GG2A 3S2IA 4BX9A 2H7VA 1VKNA 2HEGA 5B53A 4BQOA 2BHRA 2IXBA 4RHEA 4Q02A 1QX3A 4LY9A 1GQQA 1GUZA 3OIYA 4HNAB 4F7WA 1JQAA 1KSJA 3F9IA 1GCIA 3HBFA 1KY4A 1Y8CA 3M34A 3OOWA 3GJ4A 5K0JA 4MQFA 1A9PA 1C3OB 5FP0A 2HGSA 3G8YA 1ULBA 3PWSA 5KTMA 5DXAA 1YE5A 2OO5A 1UZUA 3C4JA 2XZDA 5FIUA 1U7XA 2HKIA 5EZYF 2FUG1 2I6QA 4MGEA 4FZ5A 5C53B 1B00A 3EJ6A 2GYYA 3VZRA 1N0VC 1KI4A 4RVCA 2FW6A 3OQNA 1B0UA 5HBRA 5EJ6A 4DMMA 3HJHA 1VMEA 3GFQA 2J0UA 2UYYA 1U4NA 3SCZA 2EHDA 2OO5C 3U31A 4DNFA 3E82A 2CCJA 3OZVA 5J4HA 3R5SA 1RPJA 2VAVA 1KEZA 2N0SA 5C8YA 4EVSA 1WZUA 2DWQA 3FN4A 5HF8A 3TAXA 2J3DA 5KB3A 1MXHA 4MI6A 4FC7A 2CYAA 5FBVB 5LLDA 3R0QA 3T7JA 3S1LA 4BYMA 3MIIA 3JVEA 4XTCS 2UZ1B 2WHQA 2C94A 5DB4A 1L1FA 1IBSA 1IY2A 4RVDA 3SFVA 4QGBA 2OGWA 3IB3A 4V0ME 2IEYA 5LU8A 3VC7A 2QN7A 4C05A 4X95A 2X2FA 4AN0A 5AP9A 1KZ1A 1TT7A 1PJ8A 3HY3A 5HQ3A 1FNMA 3MUNA 3GA0A 4GM4A 3TQRA 1AHIA 5IVIA 1N8TA 2WNIA 3H42B 5IABA 3IJEB 1X39A 4PZZA 1U11A 5EWMB 4EJSA 2JZCA 3LPCA 2IEBA 4H6XA 5EQTA 3MT0A 5DYNA 4ALKA 2P9GA 1PD0A 2UDPA 3CG0A 1X7WA 4EQ6A 4BIIA 2GK6A 1XP8A 4LJKA 3Q8XB 4D4GA 4EOGA 1R88A 5GV8A 5T4BA 3T3HA 1X94A 3AU8A 4UQPA 3RU2A 2RI0A 1QQTA 4L16A 1C3OA 2SCUA 8ADHA 1PJ2A 3CYFA 1LPAB 1NYQA 3AUJB 3IT0A 3Q72A 4FMPA 4NF2A 1HLDA 2DTDA 3GYGA 2HWWA 1QLJA 1YJQA 2ZIEA 3Q7IA 4ROTA 3B1KA 2A0UA 4PYQA 5F3DA 5KYVA 5BWBA 3UXMA 3TEMA 2CVQA 5CR9A 1ICIA 1VM6A 3DVAA 4G65A 2ST1A 4RKEA 5JLAA 5FWAA 2J1LA 3QVVA 2VZ8A 3JARB 2P9ZA 1PCXA 3U13A 1NDUA 3DOHA 1I1NA 1L4UA 1E3JA 1SZCA 3GLGE 1P4AA 3S29A 4DWVA 3D5TA 2GD1O 4LHSA 3CVOA 1JEQB 4NS1A 3SNHA 4B8WA 5KOYA 3L0PA 3EQZA 2XEXA 5AVKA 3H99A 2H18A 1FB5A 1KBQA 2XKAA 1ZUHA 2WV9A 3KSDO 1KMIY 5KYWB 1YS1X 2OUIA 5DBHX 3DKIA 4JUDX 1PTJA 4MK4A 1XVAA 4NYMQ 1N7HA 2ETXA 4HPJB 5BPHA 3UHOA 1TKAA 1H5QA 1JDNA 4DUGD 5I7FA 4XM0A 4Q7MB 2XT0A 3N7TA 5ALKA 5DNWA 3VO8A 3QF4B 1Y42X 2HO5A 2O0HA 3NCTA 4KFSA 5KO2A 1TPYA 2XYVA 3ITKA 3ADBA 4Q37A 1W9MA 3KPYA 4ZQFA 4CW7A 4JH0A 5I7HA 1Z38A 3WLPA 4B48A 1Y1KE 4CHGA 2QM3A 3G0GA 3I9LA 4M83A 2GHRA 4Q7QA 1L5HB 1E92A 1Q7RA 3GFGA 4GX1A 2X13A 1OI7A 1X9HA 2QI9F 1A8HA 4H3HB 2AUTA 4P54A 1MFZA 3D0KA 4UPEA 2CLEB 2Q9UA 3DVRX 3GN2A 3P97A 5DGXA 1JG1A 1NRXA 1LRKA 1SMKA 3U0VA 3CSDA 2WRZA 3GJ5A 3VZPA 3D2BA 3I9JA 5C8VA 3T9DA 1ZS9A 3JZMA 1HDEA 1I2AA 4DXAA 5HGJA 2P5YA 2P1DA 1XYVA 3DD5A 1G8PA 4R5MA 3JYPA 1FE8A 3PUXA 3PQ2A 4JK3A 3UFXA 5IPFA 1Z4PX 1SD2A 1TD1A 2Q1SA 3R3SA 4OUDB 3AIKA 2I8LA 1SC1A 1RKBA 3N0TA 1E96A 3O3MB 3KYJB 3PJGA 1FNNA 2JFPA 4IINA 2FMHA 2PZJA 2QU8A 1NOKA 4KJXA 4Q3AA 5E8JA 3SAJA 2V3WA 2R7KA 1Q0LA 3L02A 1P6UA 4MLPA 2HCFA 3HDYA 4YA6A 3R0JA 4ZZ1A 3QU5A 3Q11A 1CNMA 1AZLA 1M0EA 2WWHA 3I58A 3PLRA 4M36A 3L1JA 4IO0A 5FWDA 3DP7A 5DYGA 4LV6A 3LDUA 5F78A 4D9FA 3FJ1A 4QHSA 4LQ4A 3QE0A 4KPGA 2ZUTA 4BBJA 2JGFA 3IAAA 2IYEA 1Z6TA 2W6QA 5KYKA 4OOFA 1V5IA 1RJGA 1RQLA 5AESA 4B87A 3QTTA 1VKRA 2ENWA 1S2IA 4LOKA 3CH7A 4AIRA 4YMVA 2IX3A 3WIUA 2QJOA 4KKXB 1ULSA 1T35A 2DM6A 4B3DA 3OKPA 1CR0A 3DQQA 3T9BA 2I34A 3GGGA 1P7PA 2H0QA 5KYGA 3I1IA 3OCJA 2B6HA 5KCMA 3C5EA 3M9LA 1OB2A 1KEUA 4TTSA 1XMXA 3DD1A 1J5XA 4CT0A 4DIMA 1YJCA 4C4AA 1WUJS 4DSOA 3VPBA 2E1RA 2AF3C 4M0EA 2OLEA 3LDHA 5LZ9A 4FYKA 3OEHD 4DHWA 1XNHA 3HB1A 3NEYA 2BZGA 3ZUPA 2ZANA 4E5DA 2D7CA 4XJSA 4EQZA 3V00A 5H0IA 3L7YA 4WCFC 1GTSA 4KACA 2AQKA 4BN5A 2BMFA 3KU1A 3UUEA 4WLUA 1GILA 2UV8A 4HFMA 4ZVOA 3AP3A 2CC2A 3T1TA 5H3LA 6PFKA 3NO4A 4YK7A 4J1NA 2PD6A 1BGVA 3LM8A 2PIAA 3BIXA 3UMYA 3FLBA 1K7SN 1JSZA 4FYHA 1YI8A 1NSTA 1OZGA 3N74A 2WTNA 2OFWA 4WCFA 4UCQA 3W2TA 2J4DA 3CY6A 2R8RA 1C14A 3G8DA 1PYDA 1Y9EA 1ZC4A 2BMWA 2QXUA 1E8DA 2XNDD 2R1TA 3FCYA 4LRWA 4RM3A 4EA8A 4Y7DA 1JDJA 2GEDA 1KAHA 1LVHA 1OCEA 4IOLA 2YIJA 3C1TA 3F7TA 1BCRB 3PJRA 1FFHA 1EWQA 1YB7A 5F5LA 2I2CA 4CKZA 1HDGO 3CVWA 3ZD6A 4CEJB 3DT9A 2ZIAA 3LGXA 3O8DA 4QO8A 4KZPA 5F1YA 5IVHA 5IMBA 1Y63A 3KAPA 1OBFO 2H07A 3A2LA 4W5NA 3LP6A 2NO9A 1IE3A 4BFVA 5AVRA 4J3FA 1Y1LA 2D2IA 4EM6A 4KGXA 3DEAA 1PGJA 3QVSA 5BNIA 1TO2E 4CF3A 1H9AA 2IDMA 4QUEA 5AICA 3F8WA 5TEVA 3T8YA 3F4BA 4BNWA 2VKTA 4Y9UA 5DTEA 3GNLA 1ONOA 3IUPA 4POAA 3EWNA 3HJCA 2IYYA 3C3JA 4LXQA 4MRNA 4O0MA 2I4NA 3TAUA 2YASA 4KEAA 4M0DA 4C20A 5CAEA 3RUHA 1SR8A 2N9UA 3R9IA 2JFWA 2XB6A 4HX2A 1QUFA 3T3MB 3BQNB 3PE6A 1ZISA 3HFSA 2CHVA 2PUTA 3I8XA 3JAWA 2WMNB 4QSMA 3ZY5A 4CMEC 3GD7A 3LPMA 3V4VB 1RRPA 4PZLA 5ALTA 3TRJA 3IP8A 2XWJI 3GLGA 4YCDA 3H5VA 3UBMA 2OV4A 3IPCA 5AHOA 1S96A 1G4AE 3P0JA 1N25A 1T5BA 1G1MA 4Z4FA 2PX5A 2X9VA 2PAFA 1DAOA 3VZQA 2ILTA 1GPWB 1BWSA 3W2FA 2JHGA 3RVRA 2W5UA 2WUFA 4HVTA 5AKYA 4ZI3A 2VLIA 1KI1A 1E5VA 3WOVA 4KV7A 1M7HA 4Q0MA 4WY5A 2X5NA 4B79A 1B2RA 4BLSA 2HHCA 4URVR 1CZRA 2CXQA 5CDFE 2WM3A 3NEPX 2VDWA 5G2OA 5F77A 4H3VA 3OM8A 4H77A 2HWKA 3FVWA 3JSAA 1F17A 1YQEA 1GAJA 5ETJA 3OQBA 3NBKA 4PC7A 4QBFA 1MJGA 2WKWA 3D4IA 3WDSA 2XCUA 4EJ6A 4S2UA 2PV7A 1CRWG 3MWEB 1VG0B 2JDID 2XEDA 4H7DA 3CLTD 2RGBA 4QEKA 1SA0B 1FFCA 2MT9A 1I6LA 1PT7A 2ZVQX 4L9AA 4J4HA 1U5BA 3PLNA 4R81A 2JVKA 3CF4A 3G9XA 3UAZA 3W9YA 5JJCA 4HWSA 4FFBB 1C1XB 2CDAA 3HB0A 1QLWA 1A9RA 5EIEA 1MJNA 4NPAA 3THYA 4CMGA 2BR4A 5DM1A 3CNOA 2HOQA 5KWSA 1TYAE 1XVUA 3F71A 3GR6A 2UVPA 2GPJA 3MJRA 4E5SA 4Q48A 2LZ0A 4CMIA 3NTQA 1JR3A 4QKQA 1RI3A 2ZJ6A 3WWZA 4NQZA 4CMAA 2HIMA 5CEJA 1VSQA 1U5AA 1E6WA 4HBGA 1I30A 1DJLA 2EKQA 2YMLA 1U8FO 3LE8A 3CW8X 4PNHA 2E2WA 4XGIA 4KLZA 3RUEA 2Y0PA 5JSHA 2Y9MB 2PXHA 4IIDA 4TTPA 5J4KA 1MX1A 1VRCA 4B74A 3AXSA 3DXXA 4QYXA 2NZJA 1R8YA 2WJHA 1MHTA 2QWXA 4EGQA 4Y1RB 3U3KA 3UXYA 4V0RA 4GEGA 3URKA 1PEDA 1KY3A 3PKIA 1JEDA 1M0SA 4N1AA 3C7TA 3CO5A 3EMKA 3HKCB 3OPYB 1QIEA 1EPUA 4RH3A 5EGNA 1KO5A 2QZPA 3SZOA 1Z2CA 4XQ0A 4H1WA 2HQRA 1A9SA 3ZD8A 5AKGA 2L69A 1UXJA 3KHSA 4ZV7A 4KN9S 3O2NA 1J2YA 5D5QA 1MO5A 1CFJA 3KQYA 3N8NA 2WB4A 4R9RA 3SR4A 1M83A 1SGWA 1XUOA 1BO6A 4XDYA 5ERYA 3FDXA 3ZR4B 5CFPA 2FOLA 3I4LA 4MW5A 2Q4TA 3A1SA 4K81B 3SHWA 5JSZA 4CKWA 1P4GA 1CTQA 2HWUA 2CLDX 2C29D 3BA6A 4FEGA 4FR2A 1HM5A 2AC4A 4OKSA 2AN5A 5ILGA 1L7XA 4W5TA 4FMDF 3DH0A 4E11A 4EMBA 4HRVA 1F3LA 3BB3A 4URZR 4H15A 3W6OA 2ZJ8A 4BMPB 2N1BA 4XCVA 3RAJA 1KYTA 3BJMA 4D98A 1UFQA 1YJAA 3TLXA 2QBYA 2EGUA 2EJWA 3R1IA 4EG3A 3B3JA 2JIZA 1GGHA 4NU0A 4AECA 1UJ5A 4FMCF 5T4EA 2BKXA 5EIOA 3JQFC 1P1IA 1ACJA 4ZU3A 3UFXB 1EP3B 1ZKMA 1L1RA 1SD5A 1SQ5A 2V5AA 2V58A 4GL4A 4Q4AB 5NULA 3VYTB 3SS8A 4C0XA 1R10A 1A8IA 1YZQA 3CEPB 1SQ0A 4DTIA 3KL4A 3FWHA 3RSCA 4PTLA 3VR1A 3M2PA 1Z9BA 3L4BA 4RPIA 1MZVA 2W2LA 4LAFA 1L1QA 1NBOA 3KSAC 2AZXA 1G18A 4DQLA 3EG9B 3ETEA 3A2MA 4ND3A 1LPOA 3WJAA 2ZUBA 1X1TA 1B74A 1TD9A 3B5IA 1H1DA 3IA2A 4LZPA 3U7JA 1PW5A 2QPOA 1NMEA 1NMYA 1W96A 2H4YA 3HVKA 3BD9A 4NESA 3GVHA 3HKEB 3KKKA 4RD2A 5ERXA 3RUAA 1UDWA 2B4RO 3ABZA 3BD8A 4I2VA 3TN7A 4TWAA 2E5WA 4UNNA 1OGIA 4PIMA 1VI2A 1O0SA 3I3SR 1T91A 1P2BA 3AILA 3L1HA 3OZDA 3K9CA 3P9CA 4HAVA 2NSHA 3IMEA 2RH4A 1OFVA 1KETA 2GYVA 4ND7A 1Z29A 1MZPA 5IM5A 3E6AA 3FYUB 1MPTA 3FPBA 3EFHA 2O2DA 1YZKA 3G23A 3K9GA 4MQ5A 1KAQA 1QGDA 5AOVA 3TPZA 3FUUA 2CVFA 4JJ6A 2PTHA 3FOBA 3UUFA 3LA6A 2CUKA 2C5AA 2EG5A 3V6LA 4JCCA 2E49A 2JH8A 2H59A 3G17A 3CA8A 4NE2A 2JCYA 5T64A 4AMZA 3IEMA 1Z2NX 2GYUA 3NM5A 1ZN7A 4Z86A 4DG5A 4F4FA 3Q7PA 1WPXA 5JBQA 3KOYA 3VKFA 1M73E 2QVLA 5BN1A 4F0JA 2AUNA 3TW0A 1HL7A 1E9EA 2POQX 5KJEA 2F9LA 5KHAA 1DRKA 3EGXB 7GPBA 3EUAA 3VRHA 3E1GA 1CUVA 4JBLA 1XKQA 1E3QA 1UMCA 3AR5A 3GT0A 3GGDA 4DLNA 1E1NA 5JU6A 4KVAA 1HLFA 2RHCA 1B42A 3L1IA 4J16A 5EE9A 4KFCA 4YX9A 4KH0A 1RHMA 1P3DA 4KK4A 4MULA 4NZNA 4X63A 3N6RA 2EGHA 4FJ0A 3ZLJA 2F64A 4IMJB 3K71B 1QO0D 4X9XA 1D0SA 4G0MA 2Q99A 2XVZA 3BJZA 5FBZA 1P7YA 2F9MA 3RTEA 3U7IA 3KBOA 3VBEA 1M33A 4DUPA 4JN6B 5HZHA 4ARAA 3F1KA 1NQ5A 2YH2A 1J9EA 3TD6A 3QEMB 4NOLA 4EQ6B 5FNVB 3RYHA 4EZBA 1DKUA 6Q21A 2Z5LA 1Y5NA 5DH9A 1HYBA 2F3TA 4P3KA 2JLXA 5T7BA 3VDMA 5C4IA 4N0QA 3OCUA 1YR8A 1T25A 5LYYA 3UAXA 3NKLA 1C0LA 3GB9A 3IRVA 4IWXA 4WECA 3WL3A 5ABPA 2EYUA 3IE1A 4FE7A 3E2MA 1PS9A 3AZPA 3ENWA 1JB1A 3L7MA 2GHIA 1E66A 4OLJA 5BRAA 2Y99A 3PXEA 2FPMA 1R0SA 3RBZA 5LDHA 4Q4HA 2QJRA 1AMNA 4JGBA 3MPOA 2KHZA 2QD2A 3VV2A 1P1JA 5K8TA 4JYCA 3GJ8A 3ZCSA 1NYLA 4FILA 2EQBA 2FJPA 1SCKA 3WZLA 2Q5QA 2PZGA 3C3KA 1L4LA 2G6TA 5IC6A 5C1DA 1DV2A 1ADGA 1N4DA 2PM8A 4I99A 3R9KA 3W8EA 2GH1A 4RL4A 2VHUA 4BNHA 1QH1A 4HQLA 5JEDA 4UNPA 4R1TA 3EF0A 2FPIA 3DHYA 1XE3A 4XD7D 1K0UA 3TMYA 3ND5A 3JVDA 2O2HA 3HPRA 3IB6A 4HR7A 4PYLA 3UB3A 3ZK7A 4BOYA 3WA6A 4YI3A 3FPCA 1TLFA 2KX7A 3CPJB 4A27A 4MR8A 4CM5A 1I0ZA 1NA5A 1Y9DA 3VUFA 2GZSA 4B6GA 3BF8A 3K2QA 2PX6A 4MYHA 3ICVA 4FHFA 4RHCA 3VPFA 4ZDJA 1ZUIA 2ZIWB 3TTWA 3TJMA 4B83A 1OWNA 3A7DA 1SEPA 3FDZB 4K9QA 4WJKB 4C07A 1T9BA 4OPMA 3EWSA 4KZKA 4PZUA 1IZZA 2KB0A 4EO7A 1N7IA 1D04A 3I9MA 3PQ3A 4R7ZA 5BO5A 2OAP1 3HA2A 1EZZA 5I51A 2EJUA 4DV3B 1GCAA 2ZSIA 3ROXA 3ZZ0A 4BO6A 1WMBA 1BVUA 2MU1A 3A9UA 3COSA 3H17A 4KRXA 4B3FX 4HADA 3K6SA 2W0MA 2WW8A 2SKCA 4UQOA 1C7JA 2ZSEA 2OOSA 1DGQA 1JSXA 4OSOA 2I66A 5TPWB 2X8LA 1A8SA 5GGXA 1NJ5A 3UFBA 4HYQA 4M49A 3N05A 1U8AA 3QV1A 2A5JA 2I22A 3GCXA 2W8BB 1BGWA 4OATA 1Y6RA 4PGAA 1T1EA 4NONA 2XCIA 1NUTA 1TZKA 4BLWA 1RYZA 5EERA 1FYXA 5BMVA 3O5AA 5EUMA 2EG9A 1BHQ1 1E1MA 4XARA 4K3UA 3H2IA 1NSYA 3ESRA 5GP1A 1Z0DA 2B69A 4YYZA 1NZDA 4A2PA 2DERA 2NU6B 2KW5A 3KUDA 3V2GA 1LX6A 2EW8A 4F11A 2VDOB 3SBEA 5A04A 3G8BA 2WFAA 1ACLA 2C2MA 4R98A 3UJ9A 4B84A 1KFCB 2R48A 3WRVA 3M0EA 1YFJA 3P0FA 4HDRB 3W8FA 3E22B 3DJYA 1CIPA 2ZI4A 3E9CA 2RB4A 1TJ4A 3QMPA 4AS1A 3OP4A 3T7EA 3AEUA 4QQRA 2ZJZA 3ZW7A 3KYDB 3F6YA 2QTGA 4JA2A 1EK2A 4IR7A 4KOAA 2EBFX 2CEKA 4DPLA 3HBNA 4IDHA 1J39A 4AY2A 1KOJA 2GARA 1ECGA 5LQMA 4RSRA 4HQ6A 1ENYA 3LLSA 1HI9A 2BZ0A 2XVAA 5KUTA 4EB8A 1L5NA 3RKRA 3LTEA 3NZEA 4BZWA 4WAUA 1BDMA 2DSTA 2HSZA 4OAOA 3REQA 3MWLA 1RRFA 5EJ8A 4TOIA 5A2QA 1UK9A 2GZ1A 4X3OA 4IIGA 5AHKA 1WZEA 4KODA 4B73A 3LVQE 3TKLA 1PWZA 2CGEA 4MUNA 1VKHA 2BFAA 2GGSA 3R6GA 2YV2A 3W2IA 1JA1A 4NBWA 4DA6A 5AFSA 5KIAA 4CDNA 1QNFA 3GRFA 1EFKA 2O8EA 3NB0A 4XGRA 2FPGB 2G9RA 1CS0B 1YRLA 4CM4B 1P0PA 2FJUA 1QIGA 4Q9KA 4CEHA 1T13A 2JIZD 5COAA 3X0DA 5KNDD 2HU2A 1DIAA 1G20B 2KJQA 4DKXA 5ICMA 3WKAA 5KBYA 2MJLA 3ZHUA 1ZXBA 1E9VA 3EK2A 3QOXA 4FNMA 4ABTA 4LXIA 2P6MA 5JHGB 3S2GA 5SZIA 2B1IA 5CM2Z 4E5PA 2H0RA 2NACA 3CKYA 1KK3A 1MJ5A 3VDNB 4P4SB 4EKIA 5KCZA 2GN4A 4F21A 1H6BA 3HU2A 1ZN2A 4MS3A 4FNAA 2BKEA 4R1NA 4JIMA 5IM4A 3C7CB 3RYIB 3L04A 3LVFO 3JWJA 3R9XB 3HVHA 1H1TA 2XTAA 4IG9A 1KFKB 1TF2A 1NRIA 1WTAA 2NZ8A 3PXDA 4FEEA 4KQKA 3VR5H 2J9YB 3B70A 1WSWA 2V0CA 2FKNA 2UZ0A 4BPRA 1JWAB 5DK6A 4UEOA 3H8JA 3TR6A 4Q9AA 4E2ZA 1PEKE 4PLVA 4ZGGA 1PR4A 1C80A 2ZFUA 4G1UC 1FDWA 1KDVA 4C4YA 2XCOA 5CG1A 4C0HA 2IPXA 4I08A 3ZIAA 1HZZA 4A10A 4BJ1A 1OI3A 4D2IA 2O8FB 3BMNB 2C2ZA 1GPUA 5AVOA 1F8FA 2F43B 3OBIA 3IT1A 4AL4A 3HDTA 5AD1A 3CV3A 4PSVA 1Y7TA 3JW8A 4PFSA 4F06A 1EMDA 2WE7A 3GCDA 5KVSA 2JJQA 4YDRA 4LXXA 3WBBA 3WGZA 3KKEA 2B8NA 4IH4A 4G1MB 1ZRMA 2HRRA 5F73A 1E8NA 3H3XA 1OBOA 6CHYA 3BRWA 2J5BA 3NU1A 4E94A 1VYVA 1P2FA 2GZRA 4IZIA 1MLDA 1PNVA 4JV5B 1QIIA 3ULKA 4P93A 1ZAKA 3LCRA 2WHPA 1U9JA 1L7EA 3EFEA 1YHZA 2GN8A 1D2MA 1HLPA 1OHHA 5E2BA 3O9MA 4QM6A 5HZKA 4XM2A 5F9FA 2QW1A 2JJMA 3D59A 4QUDA 2CUZA 3B53X 3K0SA 5LP6B 1U1DA 2RGGA 1SCJA 1XMSA 5HFAA 2PD3A 2G5TA 4UDYX 4L5AA 5NLLA 4P0QB 4LX0A 4DT1A 1Z63A 3QJ5A 4B6JA 3GJTA 3ZCVA 1SHTX 2CEAA 3E0XA 3HYTA 3L0OA 4EW2A 3THXB 1QTIA 1OLUA 1N6OA 2WD8A 4M9QA 1EP2B 2REBA 4FP9A 2OFFA 2FSHA 4F96A 5IARA 1OGYA 3P4XA 3IULA 1I33A 1S2GA 4B2LA 1COWD 1TZCA 2AJDA 4FR5A 1F6BA 4FCWA 5K4GA 1TU0A 2XUFA 1KKMA 2JS7A 4R2WA 4NS4A 1Z5NA 4GI7A 4KE8A 3M4XA 3DBLA 3N75A 4N39A 2WWXA 4P53A 2JHCA 4OGKA 4YJFA 5DRTA 1YVUA 3T5GA 3QLEA 1SKUA 1D2RA 2HQOA 3IUEA 3ZI4A 5HIAA 1XTVA 1QS0A 3TTXA 5BUSA 1X77A 3HDVA 3HN7A 2D59A 4R9SA 5FPPA 5CNMA 1I7PA 2OHJA 2RONA 3M3HA 1G6HA 3QWAA 1I3KA 3ZH9B 3F5FA 1OASA 3ZVMA 3HB7A 1E1CA 3LBAA 4N3CA 1G7RA 4OMDA 5ALXA 3TSYA 1PFWA 3NHYA 2QRMA 4Q1EA 4K2AA 1U5CA 3U62A 4YPFA 5CXXA 1ZMRA 3B89A 2YZ7A 1UAAA 2ZYIA 5EVCA 2W37A 1WLSA 1P2SA 2PMDA 4C2UA 1S6YA 1O5OA 1MX9A 2PMBA 4P4GA 5SICE 3K2IA 4OYHA 5LDDC 3HN6A 1K3UB 1DPGA 1TM2A 2FK8A 4KR3A 3EA5A 3W1WA 2AZ4A 1U3GA 2FHSA 3JTEA 3ZEAA 3S8EA 3OO0A 3J81k 1XDGA 1IYZA 4FDVA 5B2ZA 4C7OA 4GZ6A 2VO1A 4CI0B 2Y68A 4CN8A 4V0QA 3KJIA 2WMDA 1UBHS 3V8BA 1WUHS 1U3FA 3CNLA 1E1RA 2GZDA 4C4SA 1AJEA 1ULUA 2JAUA 4FZVA 1SAYA 1Z0UA 1KSHA 2ON6A 1U8TA 4LC1A 3QUQA 2R7AA 3GA5A 1K6MA 3PPIA 4EKDA 3HCEA 1BU5A 4C6TA 1LTQA 3QLUA 1OFTA 1JR2A 1YB6A 1TK9A 4G4SP 1NXSA 3HO8A 4RK6A 1TEXA 3QU2A 4WBNB 1F48A 4ZCLA 5BYAA 1Z06A 1BVHA 1XXLA 3DZCA 4DR3B 1TM4E 3HVIA 3GFOA 5J5AA 3ETLA 3OFVA 5KINB 3C87A 4BEVA 1AS0A 4OQDA 2EJCA 4DREA 5BSWA 1Z4MA 1V4BA 1D6JA 3IO5A 1E1CB 1KZ6A 1SHZA 2WF9A 3K6RA 3UMJA 3W5BA 1WKBA 3T12A 1BMTA 3MMXA 3VZDA 1OB5A 1M8FA 2XXJA 1EGVB 5KJ1A 1R74A 1ZR4A 3K0CA 1UPXA 5CGZA 4ZRMA 5TF4A 5EFOA 3C6XA 4P9NA 1QFMA 4FIZA 5EVJA 1AE1A 1EH5A 1Q92A 2QUIA 3RFCA 3I45A 2CXUA 1JW9B 4CL0A 4G07A 4YCJA 1P31A 2R6DA 3BGWA 2BLLA 3C3YA 1L7MA 5ELLA 4D4JA 2NZXA 3AUAA 3IFSA 1EDBA 3HP4A 1B2LA 1FQWA 1UK7A 4IH1A 2AJ8A 2EBWA 3E7PA 5DPMA 4NJEB 2I4LA 4Q1CA 2C0PA 4OP3A 1Z68A 4XIFA 2I7VA 1LEHA 1N6PA 1PJLA 1WCV1 1LS1A 1LQTA 4FFVA 1WBJB 4MRMA 5DTMA 2ECOA 5IBPA 4D5EA 4W5RA 4YASA 4UU8A 2GCEA 3KG2A 3FLAA 4W6QA 4LNUB 1OLUB 2WA1A 1JH8A 3I2FA 1R7RA 3O74A 3CNQS 2NSJA 3KT0A 3U7RA 3DE1X 4WFJA 5FAKA 4X45A 4B40A 1I7DA 4YFVA 3RRZA 2WYHA 4QUBA 3F98A 3BDIA 5T4HA 3ZDEA 1FS4A 3B48A 3WGTA 2CLMB 3WGNA 1JPJA 2I87A 4GRAA 3PP8A 2NVUB 5LP6A 1D2AA 2ATIA 1V8PA 1EXVA 3FHLA 1DAGA 3GMSA 3KX2A 1HKHA 1OAOA 3IOEA 3O9VA 5B4TA 7REQA 3IDZA 1YHNA 2FRXA 3NTUA 3BXZA 4HRYA 4P83A 4JUBA 3WK5A 2B34A 5AM2A 4P5EA 3WQQA 3OD1A 2IOFK 3IQXA 2VHQA 1M8JA 2PX4A 2WJPA 2I29A 2BBSA 1Q22A 1P77A 3AF4A 1W1WA 3H87A 3I2HA 4I50F 4GH5A 1IEQA 1U3DA 2B20A 1AUPA 2FCAA 4EKGA 1J2EA 3K1YA 2HF7A 4EY3A 2WZDA 3KLMX 1JXAA 4MV8A 4E31A 4EPXA 4LWZA 1M6YA 2PK3A 4LMRA 4C6HA 1OT3A 1G41A 1WXXA 1S2MA 1K63A 4TTRA 4P36A 5DIZA 3AHCA 4OQFA 2G1PA 2O8FA 4N01A 5JCZA 2HD4A 1SB8A 1IZ9A 1T9ZA 1JVNA