5FHQA

Crystal structure of (wt) rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol (dnc)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of Active-Site Modification and Quaternary Structure on the Regioselectivity of Catechol-O-Methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 65
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fhqA01
3BGIA 2LD4A 1N7JA 4DM3A 2CMGA 3FTDA 1NW5A 1TW2A 3P9IA 2CKDA 4KDCA 4HH4A 4KW7A 1X1BA 1Z3CA 5F2NA 3UJAA 5CVVA 5FADA 2UYCA 4U7TB 3BWCA 5EZQA 2QM3A 4RVDA 5DXJA 4PIMA 3HVHA 5DTMA 4YMHA 3UBTA 5DLYA 2HMYB 4AZTA 3Q7EA 5EMLA 3EVAA 4QDJA 3MHTA 1KYWA 2V7EA 5K05A 4KIFA 4LWPA 3SSNA 4IWNA 2ZW9A 4F84A 2OY0A 3E05A 1D2GA 4AX8A 3ER9A 3G5LA 5DM2A 2QRVA 3I5UA 1IXKA 1UWVA 2V74B 3NVMB 3DMGA 2IDJA 1XJ5A 4P7KA 5DPMA 5FTWA 2WA2A 1DUSA 3ID6C 5F2KA 3GGDA 3GRYA 3UJDA 4ZTBA 5LQUA 1R18A 3PFHA 2P3QA 5DRTA 5LQKA 1PRYA 1T43A 3LDFA 3EGEA 3HM2A 5ICEA 3UWPA 2NP6A 1BC5A 1KP9A 4PYNA 1ZHFA 5GM2A 1F3LA 2ZIEA 5FCDA 5BW4A 3G8AA 5FHRA 3BWMA 3P9KA 5ICFA 2NXJA 4RVFA 1BOOA 2FPOA 2IFTA 3G5TA 4DKJA 3O4FA 5T67A 2PXXA 5EIFA 1G6Q1 5GWXA 2ZTHA 3B5IA 2OBFA 2FHPA 4CWAA 5LQJA 5HZMA 4BLUA 1KPIA 1VE3A 2P35A 5KQRA 4X41A 2B9EA 1M6EX 1SG9A 3BGDA 2OO3A 3GRRA 4WXHA 2PT9A 3E7PA 1KPGA 1WS6A 4GF5A 4Y30A 3IEIA 2EJUA 2XVMA 2NXCA 1QYRA 5KS2A 3EVCA 1NW7A 2GS9A 4RTQA 2YXLA 2FCAA 3B7PA 2PX2A 3THSA 3ORHA 4HSGA 4E2WA 1VQ1A 5CCBA 1P1CA 4X63A 1XDSA 4LG1A 4QQNA 3F4KA 3OE5A 4XUDA 3I64A 3SXJA 2B2CA 2YUIA 3CVOA 3OZRA 3NJRA 5EMMA 3TLJA 2NP7A 2UYQA 5EZSA 1P91A 2O06A 1D2CA 5K03A 1EJ6A 3PS9A 3P2KA 3BKWA 5K0JA 2ORED 4PYQA 3THRA 4M7RA 1L3BA 5EEGA 4RTJA 1JG4A 2AOUA 4FSXA 5F2OA 1L1EA 4YV0A 4R05A 4OQDA 3VYWA 4HGZA 4HRAA 3M6UA 2ZIGA 3TFWA 2I62A 4QDKA 3M33A 3C3YA 3P8ZA 3CKKA 3SGLA 4ER0A 2Z6QA 3KQSA 3K6RA 5DSTA 2JHAA 3OE4A 3OCJA 5CM2Z 3ELYA 3GRVA 3A25A 3C6MA 5DWQA 5KQSA 1DCTA 1NKVA 1QAOA 2PY6A 3CJRA 1KPHA 3EGIA 5CVUA 2OB1A 4MTLA 4E70A 4RVGA 1O54A 3MCZA 1VIDA 3G7UA 4RV9A 1L3CA 1NW8A 3NDIA 5EEHA 1AF7A 1NV9A 5DM0A 3UJ9A 2O0LA 1D2HA 3KPVA 4XUEA 3ERCA 3LGAA 1SQFA 4QPNA 1F38A 3RODA 4C04A 2IH5A 3HCAA 3KQYA 4WVLA 2P7IA 4GOLD 1EG2A 4F86A 4PCAA 5DX1A 3NVKI 5LQRA 3C6KA 1RI3A 5C0OE 4EQZA 5GINE 3SM3A 2QRVB 5HEKA 4MIKA 4CTJA 3FTEA 1R6AA 2G72A 3KR0A 4JXJA 4BP3A 3JWJA 4YUWA 4M36A 3C3PA 4KRGA 5K8VA 3R6TA 4CKBA 2P40A 3KPJA 3IYLW 1RI5A 5EOVA 2XYVA 1I4WA 4YUZA 2C7QA 5DT2A 3RIEA 4ER6A 2OYRA 4MHTA 2BH2A 1RJDA 1PJZA 5HIMA 4QTTB 5P8WA 3TKAA 4E2XA 5ICGA 5DXAA 1MHTA 3HP7A 4L7VA 4YUVA 1KHHA 3LDUA 4FR0A 4PNEA 3M6XA 3EEOA 5CVDA 5E9QA 2ZBRA 3MGGA 4DZRA 3NDJA 1XCJA 3H2BA 3HCEA 3VSEA 2R3SA 4YUXA 5LQAA 4POOA 5M5BA 3EVFA 5FA8A 3G2MA 2ERCA 3EVBA 2VZ9A 3SSMA 1X1DA 5JUWA 2C7PA 3SSOA 3R3HA 2Q41A 2PXAA 2AOTA 4ER3A 1IY9A 4QVKA 2E5WA 2XVAA 5EC8A 2FK8A 3REOA 5FULA 5BW5A 4QVGA 1YFLA 2ZFUA 3DULA 3T7SA 4PGGA 3HCCA 4E32A 4HTFA 2Y1XA 3M6VA 3PT9A 1I1NA 3FUUA 1UFKA 3DMHA 3KHKA 3DXZA 3X0DA 1JSZA 2ZCJA 3DMFA 4YV2A 2O05A 2HTEA 3OU7A 1HNNA 1VBFA 3GDHA 4EVIA 3MTEA 4OA5A 3O31A 1QZZA 2ZLBA 4V0QA 2GLUA 4AZVA 2FYTA 2QYOA 3QOWA 5E2BA 1ZKDA 5EMJA 1ZGAA 2I6GA 2P8JA 1RI4A 2AVNA 5FQNA 5FA5A 3K0BA 4E2YA 1R8YA 4KWCA 5K0NA 3LECA 4IV8A 5K01A 3UFBA 1U2ZA 1VP3A 1EAMA 1JG2A 4KVZA 3PVCA 3B3FA 2WK1A 2JHPA 4PCLA 4PYMA 4R8RA 2KW5A 3A26A 4C03A 5EVJA 1QAQA 3AXTA 3BKXA 2IDKA 4RSRA 4EK9A 4RTPA 2OKCA 2ZBPA 5K0EA 3FZGA 3G2OA 2B25A 3TR6A 3VC2A 3LL7A 4EMSA 2AOUB 2C7RA 1VPTA 3NMUF 3UJ6A 3DLCA 3MCTA 2PBFA 3GXOA 3KPWA 4B17A 3GWZA 1L9KA 5DM4A 2JHCA 3V97A 2G70A 3GCZA 3G2PA 1BHJA 4NECA 2VDVE 5K0CA 3EMDA 4FT4A 1EIZA 2WA1A 4M37A 5EKXA 2ZSUA 2ONYA 2ZZNA 3VC1A 4RTOA 1NBHA 2XYQA 2O57A 4LECA 3E23A 1Q0TA 3CJTA 2ZWVA 4PYKA 3FRHA 3AJDA 1G8AA 1YZHA 2YVLA 1ZQ9A 5LR6A 3V8VA 4KDRA 4BY9E 3CC8A 3IHTA 4RX1A 2G1PA 4ER7A 3LCUA 4UOEA 4FS8A 4E2ZA 2ONZA 1FJXA 3S68A 3HNRA 5HOQA 9MHTA 2ADMA 2YR0A 1SUIA 2ZBQA 1Q0SA 3M70A 3CCFA 1DL5A 2QY6A 3HA7A 5CCXA 4FSDA 3FYCA 5EG5A 3LDGA 4PGHA 1RI2A 4PINA 5HIJA 5C9ZA 4YUYA 3OZTA 2ZVJA 5EHGA 4YV1A 1UIRA 3UA4A 3HVIA 4E33A 1JG1A 1ORIA 1QANA 3DH0A 4IKPA 4R6WA 3DR5A 2VDWA 5KVAA 4OX9Y 1P39A 5FWAA 2AVDA 4QQKA 2GPYA 2IH4A 2AS0A 2BM8A 2IP2A 3MERA 2PSSA 2OB2A 2P1DA 2O07A 4PONA 4X61A 3P71T 5DRYA 2PV0A 2G71A 3LBYA 2OPBA 5FQOA 4G56A 2PVCA 1L3IA 3P9NA 1B42A 4O29A 1N2XA 2ZWAA 2C7OA 1O9GA 1XDUA 2EG5A 2Y1WA 4MQ4A 1G38A 2PX8A 3HCDA 3TQSA 1X1CA 2HR1A 4X1OA 2DPMA 4YMGA 3MAGA 4FGZA 2AN4A 5K0LA 3O7WA 2YXEA 5LQNA 1MJFA 2AOVA 4PIPA 1WXXA 2ESRA 5E8JA 4GC5A 1SQGA 3KQVA 3KR9A 1ZG3A 3GRUA 4OBXA 5H02A 4C05A 3TM4A 3HCBA 3KKZA 1ZGJA 5E2AA 5HIIA 4C06A 5EPEA 2H00A 4C4AA 4DCMA 2BZGA 5ERGB 2IBTA 5IH3A 1FPQA 1HMYA 5EHIA 3AY0A 2CL5A 3HEMA 1SKMA 1N7IA 1XTPA 2VDUE 1G60A 3EVDA 2FRXA 3EVZA 2PX5A 5FHQA 1IM8A 4RTMA 4P58A 2OZVA 3FPJA 3FPFA 2JG3A 3LKDA 3G89A 4QPPA 5GIOE 3R24A 3FUVA 1BKYA 4A6DA 3BXOA 5T6BA 5DX8A 3L8DA 5CVJA 2FK7A 1QAMA 3OFJA 2IPXA 4Y2HA 1RJFA 3WSTA 1AQJA 5D1NA 1VL5A 1JTEA 3EMBA 3GO4A 3G8BA 5GM1A 5T64A 5BXYA 2XBMA 2NXNA 3UA3A 2JH9A 2YTZA 3EGVA 2YX1A 3A4TA 3ELDA 3GIWA 3OU6A 5DX0A 5K0GA 1R00A 2VS1A 3PFGA 4AZSA 3KQPA 5G02A 2DULA 3I53A 1WXWA 3A27A 2PKWA 3GNLA 3PLAE 2EJTA 1RJEA 4OQEA 4RTLA 3GJYA 3TPZA 1O9HA 1TW3A 1NE2A 1SUSA 1YZ3A 3B3JA 3BGVA 2JJQA 1VLMA 3NTVA 4GC9A 1XVAA 5EGSA 2UZ4A 4OBWA 3BZBA 4DCGA 3AWIA 3ME5A 1YFJA 1WZNA 2I7CA 1FBNA 4DA4A 8MHTA 4DQ0A 4H0NA 5DTQA 3HA5A 3RW9A 5K0FA 3LCCA 2IBSA 4A6EA 1KYZA 3LBFA 1AQIA 3BWBA 4EKIA 3NW9A 3KU1A 3LX6A 5DM1A 3OPNA 3ER8A 1H1DA 3BUSA 3ELUA 3LSTA 3DP7A 3FPEA 1NV8A 3GU3A 4P7JA 5HILA 3DXXA 3EVEA 3P9CA 3KR1A 3KQMA 3UJBA 5JR3A 1NW3A 2XYRA 4GBED 5B1SA 5K0BA 3FTFA 3SVZA 3P2EA 2PWYA 3KQTA 4C07A 3JWIA 3T0IA 3KQWA 2G8NA 5E1BA 4AZWA 3GRZA 3NWEA 2BM9A 3U81A 2P7HA 2ZULA 1RI1A 2HWKA 4X60A 4U7PB 3ELWA 3KR2A 4FT2A 3E8SA 5EQJB 4BLVA 1NW6A 3TMAA 3FRIA 4FP9A 5E1OA 5DTRA 5E8RA 1RJGA 3MB5A 3CJQA 5LQCA 4XUCA 3Q87B 1FP1D 1OR8A 2P3OA 3A7EA 4HTFB 2F8LA 5GP1A 5GIPE 2K4MA 3P2IA 4RYLA 5E9WA 4OA8A 4AUKA 3EVGA 4ER5A 5CD1A 3OFKA 5FUBA 3KQOA 3TKYA 5K09A 1G55A 3CBGA 3UJCA 1EQAA 3HVKA 3CGGA 4F85A 2QE6A 4GOMD 3JWGA 3R0QA 3DUWA 2IH2A 4RTKA 4PYLA 1P1BA 2ZZKA 2B3TA 3C0KA 4RVHA 2PWPA 3UJ7A 3LKZA 3I9FA 4BLWA 1INLA 4CKEA 1M0EA 5D1HA 2JH8A 4C08A 2PLWA 4E31A 5EKUA 2OXTA 2Z6AA 4CTKA 3FPHA 3MQ2A 3PTAA 3P97A 4RTRA 2UYHA 3BT7A 4QTUB 2GH1A 3DXYA 3LCVB 1WY7A 5KYGA 4GQBA 1YF3A 2IIPA 3FYDA 5GOZA 5E9JA 3KPUA 3UJ8A 3JWHA 3PX2A 2CWWA 2GB4A 3KQQA 5FWDA 4P7FA 3KPYA 1KXZA 1X1AA 4R8SA 5EMKA 4V0RA 1JQ3A 3PB3A 4PYIA 2BR5A 4DMGA 1NBIA 2P3LA 2B78A 4RTNA 3DOUA 3OZSA 3HCFA 4FZVA 2PJDA 3TOSA 3D2LA 10MHA 2IGTA 3NWBA 1JQEA 3OU2A 4KIGA 2AN5A 4RWZA 3HTXA 3FPGA 4IV0A 3QOXA 5MHTA 1G8SA 1VP9A 4GUAA 5C1IA 1FP2A 1TPYA 2GAFA 3SMQA 4DF3A 3LHDA 3MTIA 3LPMA 1XCLA 3FUWA 1M6YA 4XCXA 3AXSA 4Z2YA 5BP7A 5CIYA 3I58A 4ISCA 1YUBA 3T7RA 1AV6A 3EEYA 1X19A 4GOOD 2PXCA 1I9GA 1JSXA 3R9XB 2ZZMA 2AOWA 3PX3A 1Y8CA 4K6MA 1NT2A 5E1MA 3HVJA 4PYJA 5CVEA 1KR5A 5DSXA 7MHTA 2GA9A 3ANXA 3FTCA 5LSAA 3EPPA 2AOXA 4HGYA 2YXDA 3HA3A 4EKGA 3T7TA 2VP3A 3G2QA 3G88A 4M38A 2AZTA 2NYUA 2ZIFA 3TRKA 4CKCA 4E30A 4RTSA 1V39A 2UYOA 1JQDA 2N47A 3DTNA 3FUTA 3SR4A 2CMHA 3SX0A 4LWOA 4MWZA 2PX4A 3IV6A 1YB2A 1JR4A 1EJ0A 1KIAA 1R74A 5E1DA 1XDZA 5ICCA 2HNKA 3B3GA 4ATNA 2I9KA 3TM5A 1WG8A 3B89A 4GEKA 4GOND 1XXLA 4R6XA 2H11A 2AR0A 4HC4A 2NXEA 2AN3A 5U4XA 2EX4A 1ORHA 2H1RA 2AOTB 3QV2A 5CUQA 4CXMA 2P41A 2HV9A 3M6WA 2A14A 2PT6A 2BR4A 4HG2A 2Z6UA 1R8XA 5EIWA 3A7DA 2EFJA 1SVUA 1JTFA 2BR3A 3M4XA 3UZUA 3FUXA 4PWYA 3BWYA 4BP1A 3DLIA 5HFJA 2NNWB 1JG3A 2PGXA 2YQZA 2R6ZA 4P7GA 4PYOA 5HIKA 5IKMA
chains in the Genus database with same CATH superfamily
2FMIA 1XEXA 4J7XA 4L0CA 1IJEA 3BGIA 1VLHA 4RKRA 3IQGX 4BO1A 1E0AA 1NUTA 3LOUA 1H8HA 2GF0A 2MCFA 1PFWA 5KX5F 1M76A 2YY7A 4KDCA 4X45A 1V43A 5JLAA 4MV6A 3U7QA 3VSBA 4PY2A 1WUJS 1RPTA 3AF5A 4LF7B 1FUIA 4IJUA 1SBYA 1YS9A 2GSDA 3AKYA 4O4JB 4RVDA 4TTSA 5ALDA 4A4DA 1Q0PA 3UBTA 2NVUB 5EPOA 1ESZA 2OGZA 1I4EB 3IR5A 3ZZNA 5JNSA 3O3MB 1L5FA 1NX6A 3Q3EA 4XJVA 5CLLA 1OVMA 2Q3DA 4WKNA 4M7PA 2IZOA 3OAAA 3HY4A 1W9HA 3E05A 4GQIA 3UK1A 1QH8B 3DDZX 1SU6A 4G5RA 1CEXA 2X13A 2V7WA 3GJRA 3OLQA 4FYMA 1JW9B 4LJ5A 3IVXA 5K99A 3FROA 2IYSA 1X7GA 2IUFA 5BNTA 1T3HA 3UHOA 5CTAA 2VHUA 3FYUA 5EYPB 1E4OA 5G0SA 3QMMA 2P68A 4ES6A 2OZKA 2FCRA 4DWWA 2R8PA 3MD9A 3L7OA 4E5PA 1JMYA 4MWDA 1XJ0A 4BMVA 3OPQA 1FNDA 4FYPA 1Y5NA 2GZRA 4JU9A 2KI5A 2ODNA 3HJTA 4N39A 3EZ2A 2V3VA 1TM3E 2NZJA 3H99A 4P4NA 2BGWA 1NQXA 3BGWA 1GGMA 3W3AH 4N5LA 4AP9A 1X70A 4CM3A 2P9YA 2WUWE 1UBMS 5GWXA 2AUMA 2IYVA 3AEYA 1B76A 3JR7A 2BD0A 3MQFA 3DHVA 2XTNA 4GH5A 3CISA 4DYDA 2NYRA 4REOA 1QRRA 1TYEB 4YN3A 1II0A 1OILA 1WU7A 4Q4CA 3PXGA 1F6WA 3QA3E 2B9EA 4YPVA 4B4WA 2ZOSA 1IZYA 1VG8A 3E7PA 3G2JA 4KTTE 2FWJA 4LOIA 1Z2CA 4JLVA 2PGIA 1I10A 1U90A 3E15A 3EVCA 1NW7A 1HYQA 2ACKA 1R10A 3B6MA 3IQDB 4FGJA 1J0AA 4R40A 4BQNA 1Q21A 2MIIA 2YW9A 4UW9A 4ESHA 4BXOA 1YJ8A 2OXRA 3IDAA 1VQ1A 2H48A 2Q45A 2RG1A 2X9QA 3BFPA 1OGJA 3BSWA 3CX8A 4LZAA 4DB2A 4E88A 3WC4A 4BVKA 1AUOA 1QHFA 1E69A 5KNBH 2D5LA 4RSHA 4UTRA 1BVRA 3A8TA 2FSSA 5FBZA 1VJTA 3OJWA 4ERXA 2I80A 3P2KA 7REQB 4YAUA 2O59A 2F48A 1TKRA 4M7RA 4RTJA 4K9NA 3AF6A 3WK6A 4FCVA 4XPZA 1ZCZA 4YMIA 1RZRD 3WNZA 3FZNA 1GQRA 3NBQA 3LUCA 5F5NA 1IIBA 5JD4A 3ONNA 1SA0B 3BH6A 4PQFA 5CXQA 3H1PA 4ER0A 5I8WA 3VBCA 5DSTA 5I51A 1KJ8A 4XWTA 4JNKA 3RRFA 2F64A 4KX5A 3OM9A 3EHEA 3SYTA 2ZJ1A 2B4TO 3GRVA 3A25A 5KQSA 1W47A 1PJLA 2YV1A 4Q1CA 4B4UA 4B31A 3WV4A 1N2OA 3H8JA 4QUJA 2PY6A 2R6GA 5IZCA 3LE8A 2FPKA 3RUPA 2H57A 5CNIA 1SCDA 1EEXB 2V03A 2P69A 1Z0IA 2O3UA 1LWNA 4UNNA 4WKCA 4KI0A 3UB2A 1CY1A 1QRAA 3R6DA 3ERCA 1AX9A 4QC2A 2CUTA 3P27A 1AB6A 4FWIB 1RZVA 5HCNA 3U2QA 1EG2A 4KVAA 3WK5A 4O2BF 3NVKI 3WP0A 2HU5A 1GU1A 3C6KA 4L27A 1ECBA 2P6UA 4BZXA 5JS8A 2SNIE 4HGQA 3BMQB 3Q7TA 1Y6GA 2G72A 3JPYA 2GBGA 4YUWA 1M3SA 1Q1ZA 3JWJA 3KXKA 3N2KB 4XD2A 3GARA 5AI6A 3C3PA 3OMWA 3WGYA 4DLVA 5KINB 3D6MA 1P2FA 5KOYA 4LKRA 1RXWA 2X6TA 1J5XA 2D7JA 3OQJA 3DWGA 1C3EA 1GO2A 4JN6B 1FDSA 3JAWB 1BQEA 3AL3A 4FIDA 1MRZA 3L8CA 1ZC3A 3TSAA 4UOZA 2VWHA 1U5CA 3JTMA 4PIVA 2ZE7A 4YUVA 4K0RA 3THXA 5K4GA 1Q74A 1DKPA 1YMVA 3CNQS 5I4BA 5ANRB 2M98A 3R6LA 1MPTA 2X7XA 3BFJA 1DX4A 1Z4KA 3D6AA 3HCEA 4K6CA 1AVTA 4FI3C 2UXCB 2P9EA 3PPYA 2D62A 2Q99A 3CZPA 3PV0A 4HDKA 3NHFA 3QVKA 1KY4A 4POOA 1Z0JA 3KEGA 3L04A 2CHQA 2YJ6A 1OX5A 2VH2A 4FEEA 4QWWA 3MRSA 4R2IA 4WXMA 4DM4A 5A04A 5CCEA 4RPKA 4Y2QA 1FRQA 3L7IA 2O5CA 2V7VA 1ZJYA 1CZLA 2C1EA 4QBFA 3W7AA 4JBWA 1U2PA 1QYIA 2PCLA 2QSYA 4O63O 2EBFX 3JAKB 1ZH0A 1V5FA 5DDIP 1YULA 4KNVA 5TPWB 2JASA 1HX7A 2JFUA 3I05A 1NR7A 1FLVA 1I1NA 5ALRA 5LZ5A 5ALKA 1MQSA 3DMHA 4RD4A 4DY6A 3C6ZA 2O8DB 4FINA 1SG0A 4XDZA 2QRQA 3SR3A 2Y9PB 1W0KA 4C4RA 4EGSA 1HNNA 1QC5B 1VBFA 3K9BA 4WXYB 3TSCA 1U9IC 2YHUA 4NAHA 4OKIA 3VPSA 4B32A 4LQLA 1AGPA 3ODGA 5EMJA 4TPKA 2YZ2A 2QENA 3SOZA 4BNGA 2P8JA 4AJOA 4DXHA 2D3TA 4HH1A 1XNRB 3TZBA 1XJCA 1P7VA 1SUEA 3F9IA 2COUA 4E5MA 2E21A 4JVLA 4BO7A 4IV8A 3EPRA 5IBCA 3UFBA 1N0WA 3DC2A 4PAGA 2ODAA 3D6NB 1JRLA 2H31A 1RLTA 4Q4HA 2W2XA 3R5XA 3TPCA 3MC1A 3ZHCA 4C03A 4IJQA 3U19A 5DTEA 3H9EO 1F9AA 4ITRC 4QREA 3MJRA 1XFAA 4DV2B 1K8XB 5B53A 1E7QA 4DE5A 8LDHA 3F5SA 2QGNA 3JYNA 1D5WA 1CF2O 3RI3A 1KK3A 3VC2A 4JYBA 1RYDA 3MIIA 1NYQA 2POCA 1GKLA 4KXLA 3BMNA 4OOEA 3UJ6A 3U60B 5A0TA 1NDUA 1UBFA 3NKLA 3O8QA 3OZIA 4PTYA 4KMMA 1E2LA 1XZKA 1E1DA 3MS7A 4LQCA 2Z3ZA 4RIGA 1DV2A 2QAIA 1TIBA 2AGVA 4M37A 4X92A 1P1HA 4XPIA 3FKSA 4TMTA 3KT0A 1CUGA 2C8JA 1IHUA 1BWSA 3I01M 4Z2AA 5BSFA 4JJ7A 4NBRA 1NOJA 3IB3A 1Q0TA 3E82A 1OXKB 4ITUA 4PLPA 1P1JA 3Q15C 13PKA 2QMYA 3AVUA 3F1KA 4D26A 3FHCB 1MV8A 3CHYA 3PDWA 4C76A 5LDDC 1T0PA 3AJEA 1S2IA 1KOLA 3EN0A 1UKAA 3F7TA 1DPFA 2W48A 3KLOA 3K1AA 3UT5A 1DJOA 4GVXA 2R44A 4XOIA 1WCYA 4BFYA 1XQXA 1OBOA 1QP8A 3H2SA 3NHLA 1RYNA 4ZO9A 1QPGA 5EG5A 3EOAI 3KXLA 5EZYB 4FFNA 2WJPA 2C9ZA 2OYSA 3DAOA 1Z7YA 1NUHA 2CLEB 4PCUA 4NULA 4EF6A 1KMCA 4JC5A 4KK4A 4TUYF 4XIYA 3S1AB 3GA7A 5IWCA 4N5HX 2BC9A 4AO8A 4P22A 5AM3A 2G9QA 2YV4A 3BAFA 1B8NA 3QI2A 1ZY2A 4QQKA 4ZI7B 1KMHB 2WTEA 5TSDA 3ZWYA 5A4FS 1WB6A 4R83A 2PRYA 4RE6A 3LBYA 4UE6A 4PSCA 1OW3B 3LV8A 1ZD4A 1OZGA 3LXRA 4L4UA 4INJA 2PG3A 4X6XA 2C7OA 3VKHA 1N5JA 4ETMA 5B3KA 3JXEA 2HB6A 3FXAA 3RIGA 2YXEA 4PLHA 4XRRA 3NR2A 1OZFA 3C43A 5DB4A 3LD9A 4NX2A 1T8UA 3QA9A 4LMPA 2DT8A 1ZN7A 1S3SA 4UBMA 1ZIOA 4L8FA 2X7JA 2B61A 4E4RA 1H3EA 3CVXA 4A3SA 1ZH6A 2BEUB 2HT6A 3LUJA 1BZYA 3MINB 1XNJA 4JP3A 4NENA 3BQNB 3EQZA 2FLKA 3HDQA 3RSGA 3KWLA 1XTPA 1G60A 3HC7A 3KZVA 3RYCA 2PX5A 3NYWA 3BHMA 5B2EA 2J1LA 3HWSA 4L6AA 5FL7D 1W4CA 1TJ3A 1YA8A 5ECWA 2N42A 4XLLA 3AJ9A 4M1YA 5BORA 4JLUA 1R0BA 5CG1A 2FX2A 1ZX1A 3D2CA 4L74A 3BK2A 4U3JB 2QPTA 3ORYA 2NXNA 5A05A 3RFCA 5JNLA 1X80A 3VU9B 2C3MA 5TB5A 1JFFA 3GIWA 4JKIA 3S81A 2HYDA 4RIIA 1GD1O 1CSEE 2F4NA 3TNFA 5BMVF 3I53A 1VECA 2FLVA 5ALEA 4URZR 2NUAB 1IQ0A 2ASEA 2UVPB 4ZQGA 3JZDA 4M0DA 2EKDA 4GZLA 1Q50A 2XT0A 4LY0A 5KNDA 5FA5A 2PMFA 3TRJA 1OJLA 4P5DA 4BZQA 2BL4A 1QCDA 1ZRSA 3WGVA 4V0SA 4HZUB 4RZ3A 2F8SA 4DN6A 1YOVB 2I7CA 3MWLA 3RK4A 4NOLA 1HC7A 3HBFA 2XZLA 5A0VA 2VQEB 1X1TA 1V16A 2G1AA 3DEJA 1KI6A 4DTCA 3PUHA 3AUJB 3ESCA 4HDNA 3V42A 4EKIA 1XK7A 1C3JA 4QOEA 5DM1A 1T5DX 2I66A 3MD0A 4LJYA 3EXHA 3T6KA 3GLFB 1DMSA 1WDMA 3DP7A 4PO9A 4MGIR 2PGDA 2P5TB 2W6OA 2R5NA 3CH4B 3CMMA 3NPAA 5CDFA 4ANFA 2XGSA 1OLUA 2VQFB 3W2HA 2PWYA 3I6MA 3L0CA 2ZBGA 4FCTA 4FNMA 2DTXA 4M0CA 3X44A 1MZVA 2HDHA 1MEJA 2I4IA 2V58A 3AHHA 3D5TA 4PX5A 4N0DA 3UUEA 1UOOA 1DQRA 3GD5A 4YP6A 3UV6A 3FG9A 4J0FA 4U0JA 3AHJA 4GP7A 1NJ5A 4U7PB 1PEDA 4XWWA 1NF3A 1T1IA 3Q3CA 4ZRNA 2XAAA 2H17A 3GJZA 4D4IA 5TMDA 4NESA 4UM9D 3T1HB 5E8RA 1Z0FA 2XRYA 4LV6A 4YV7A 5JCXA 1JJBA 4D98A 3FNRA 1SXPA 1OR8A 3CNNA 2JKYA 4HTFB 3O73A 3K53A 1EGHA 4CMIA 1W5SA 3X2EA 2IJGX 1GGHA 2AEFA 2EBWA 2O7NA 5AICA 2NU9B 3M2PA 4DQDA 5J2TF 1S3GA 3CGGA 2A4KA 3JYPA 5DBEX 2ZJYA 4WLFA 2XCQA 1JEQB 3VZQA 4W7HA 3VMMA 2FQXA 4JJFA 1WVMA 1M2WA 2YIDA 1CIPA 4FK8A 5A4DA 5AI4A 3LQKA 3K3PA 1YBHA 3H9UA 5AJXA 1KQFA 3DKKA 4B2PA 1EZ4A 1SUAA 1ULZA 5D1HA 1EVIA 1HDCA 1OLSB 2ZVDA 2PLWA 2ZRHA 3GL9A 4Y1FA 1ZI6A 4Q4JA 4TTTS 3K8YA 3IHLA 2G4CA 3T38A 3T3DA 4EF5A 5EJ6A 4QTUB 4BNWA 1T0UA 3ZLUA 3AZQA 3D81A 1JN0A 2A5DA 1BA2A 3AR7A 1QHEA 1ODJA 2CXRA 1V3VA 3KE8A 2IYNA 1P8JA 4EB0A 3ESZA 3KQQA 5BY2A 2XVZA 3F3KA 3O6VA 1N5OX 4X95A 5IN4A 3W06A 3OEHD 4M6WB 2G7ZA 9ABPA 3WI7A 3M5WA 3HCFA 2BW0A 4JL5A 5KSWB 2O52A 3STXA 4MOWA 3SDZA 2CNBA 3PQEA 1E4VA 1T0HB 2GZHA 5MHTA 4GUAA 3SEFA 1KVSA 1Y4UA 4AULA 5DT9A 1Z2OX 1JEDA 2EG9A 5CR9A 2B3DA 3A3NA 2IOFA 5F2EA 3D3WA 5J1TB 1Q7RA 3OEED 4BX3A 4UHEA 2I4LA 4TTIA 4O2RA 5CIYA 3M5DA 4P0TA 1TPZA 5D85A 1BCRA 1L5KA 5LMCA 1AV6A 2VP6A 2QLBA 1RYMA 2Q62A 3MF4A 2SECE 4I2NA 1I9GA 2BBTA 3WMRA 3MMZA 3QBVA 1JJFA 1VLLA 2J4CA 1F2DA 1SAYA 2A9QA 2LDBA 5AJZA 3T35A 3C48A 1LKZA 5CJ2A 1X1EA 2I1QA 4R1QA 3H86A 5IAJA 3VNAA 3VR6A 5IBPA 4HDQB 4FE4A 5GVRA 3FTCA 3GCGA 2J0UA 3L0PA 1JA1A 2AOXA 2IQIA 4BB6A 4DUPA 4KN8A 1IN4A 1K0FA 4ETWA 4E5YA 3TEMA 4F97A 1S1CA 1DARA 1SC6A 1MIHA 2KX7A 1MW9X 3BB1A 4JB0A 4K6OA 5F7XA 4KXXA 2WWXA 4O4IA 4BUCA 5HJEA 3H83A 4WBNA 1R5BA 4LDAA 3GMIA 4UHCA 1JIKA 1DMRA 1VYHA 1Y4AE 5JPDA 1CYEA 2I1VB 1CJUC 3OPVA 5TPWA 2W42A 2G09A 4R54A 2RARA 2OKGA 4ZU1X 2AN3A 1MEEA 2QL7A 2VHWA 1E9AA 3HYSA 1R8QA 3IOYA 4XFJA 4ALNA 4EPYA 2IF2A 3A31A 3DO8A 4PRZA 3RS2A 1WCV1 1J25A 5EIAA 3ESAA 5HSGA 1MENA 3HKDA 4HX5A 5DJ5A 4D8TA 4FBLA 4OXIA 4JP8A 3N2NA 3P7MA 2RHMA 1SO8A 2ZJOA 5AK0A 2B0JA 3TZEA 5DNUA 4UKDA 3IPRA 1HL3A 2GMWA 3N0XA 3S2EA 5LIPA 1MKYA 2E4UA 3DUFB 1UBNA 5ER9A 4RDHA 4X64B 4D46A 3UMMA 4EJMA 2D1SA 1JBKA 1OH8A 5FLYA 1E98A 1BHSA 4Y2TA 3WQQA 4I3HA 3W2IA 2ZSEA 3GZ4A 3OP1A 5IAAA 4Q5IA 2BLNA 3IUMA 4HJXA 4OJKA 3DEHA 4RA6B 3VAZA 1SBTA 2DXIA 2QBYA 5K05A 3WKBA 1EGVB 1CUJA 1PQPA 2X8LA 3OZ7A 4BMNA 3DWFA 5IYZA 2PL3A 4S2UA 2CJPA 3C3CA 3AKZA 4JXZA 1TQ4A 1QVAA 1BHO1 4QUDA 2IIVA 5FTKA 3TLEA 2P6PA 2BFCB 4PAQA 4XM1A 4WHMA 4GNKA 1A8SA 2WFZA 3O7MA 1SCIA 4JLWA 3TPFA 4Z1MA 2HA7A 3O8BA 5CGQB 1G0OA 3HJFA 1PJCA 4OX9B 3OIYA 1NBWB 1JDJA 4RZSA 2WSMA 4YCDA 2GHRA 3UAVA 5DI3A 5NULA 4O4IB 3PFNA 1IN7A 4HDMB 4LW8A 4DEYA 5C8YF 2OXCA 2GPTA 4XR4A 4WL0A 4DDHA 1NC3A 2GD0A 2WIBA 3LQ4A 1QNLA 2P2CA 4LXTA 3TW6A 1KJZA 3NO4A 2GZSA 4TKLA 4YAFA 4YECA 4DLKA 2RH9B 3BS4A 4Q9IA 1CRWG 2V7BA 3BBPA 4ZT7A 5ARBA 4A1FA 1Q19A 4H7EA 4QOIA 3LDAA 4NP6A 3SZOA 1YR6A 3SZLA 1KHTA 2WUGA 1O6CA 5G0UA 1Z08A 3N86A 3BE4A 4FDVA 3ZJTA 1KPGA 3LDHA 3VPXA 521PA 2VBCA 1V37A 4QOFA 2QVBA 5DNVA 4E5VA 4EZBA 2DE0X 3P19A 1Q3KA 2PX2A 4HNAB 4EENA 1QS0B 2QRLA 3QENA 2BI7A 4ZYVA 1HE8B 5AK4A 4P93A 9LDTA 4HQKA 4IDOA 5TGDA 4QQNA 2C4MA 5DOVA 2WVGA 3T9AA 4UJ3A 2W4QA 1J70A 4R7GA 3SHQA 3PR2B 3GPIA 2VDOB 1SCJA 3U7EB 3TLJA 2UYQA 3LM8A 3A9CA 4G23A 1E5TA 2VLIA 3L9XA 4HNAA 4J0QA 1HLDA 2QVZX 4CV1A 5CGZA 4DR4B 4JP1A 1Y4ZA 2VHZA 4FSXA 4YV0A 1GAEO 4N18A 1NJ2A 4C6RA 4B3GA 2OWEA 2Z58A 2EHDA 3GJ6A 3M6UA 2ZIGA 1LVGA 1XTJA 2ZQZA 5EE9A 3RYHA 5JS2A 3H4TA 2FPRA 2OHHA 3FCEA 3I12A 2E49A 4U7WA 3LTNC 1Z0UA 1JAXA 3ZWKA 1PV1A 3D3EA 4UUQA 1XMXA 1PT6A 3INRA 3OKPA 3GBPA 3L7JA 1NVFA 3TCXB 1N1EA 2DYKA 1TGYA 4MI9A 5AI9A 4WKPA 1TQ2A 4PLZA 3KJIA 5F12A 3MHTA 1MOSA 4C6SA 2OB1A 5J2UB 3KB2A 3B52X 2WWGA 4FUQA 2VHYA 3Q0TA 4HZIA 4AZ0B 3K2BA 4BRSA 1H0SA 4C0LA 4CV0A 4G6ZA 3ZYCA 5B4TA 1MB3A 4RVCA 2AFHE 3IAFA 5JBIA 1A9ZA 3N70A 1FZTA 2DY0A 1YB7A 3AF2A 3CGWA 3CCCA 1WB4A 1CUFA 3EVTA 3LGAA 1KYYA 3NHPA 3PR3A 4QQRA 3RKUA 1BE6A 3DFIA 1UJMA 1Z73A 3KQYA 4TWZA 4F7WA 4DV5B 5AW1A 3ORSA 5GINE 2A7QA 1NKSA 4OK6A 2HMWA 3C87A 1ESNA 4ROTA 1QMGA 4FJ2A 4H08A 3GBVA 3TE7A 3DNMA 1MX9A 3KELA 3GXBA 1NVUQ 4YJKA 1T5OA 3NT4A 1QZUA 3WYDA 5KVCA 4X93A 3LTEA 4YUZA 4KPEC 4Q21A 1S9DA 4KREA 1ZR2A 4L8LA 3ES9A 4G25A 3V2UA 2DHDA 2PRJA 4CKWA 2WYHA 3IVAA 4X66B 2VK2A 3LDUA 4DZZA 2I4RA 4UVDA 3RO7A 1Z6YA 2ZBRA 4IFIA 5FO1A 1GZ5A 1E9RA 5JNRA 2BKLA 2ZKIA 1UKEA 3RBXA 4BKUA 2HYIC 3BWXA 1QYXA 4D6PA 5JY6A 2NU6B 3COVA 1IQPA 5D8DA 5TQJA 4R1SA 4DWOA 1JIIA 4A8JC 1WQ1R 2HUPA 1GTJ1 2PGNA 1X1DA 3FWHA 3W6PA 3I73A 3MTQA 1GRCA 1F0NA 1JTVA 2RHDA 3AF0A 2ZCVA 3ZKAA 4FUTA 2V0CA 1WKCA 2JZOA 1JQBA 4TV9B 5I5GA 1W96A 3W5DA 5H3CA 5KX5B 5DK6A 2RH8A 3WGUA 4CEHA 4KOEC 5IANA 1O96A 1AURA 1EMDA 4MKIA 5JQGF 3QVMA 2HNAA 1FLAA 3UXEA 2AQHA 2X42A 2QIPA 3F8SA 1CPYA 4TRRA 6PFKA 4AB1A 1RT9A 4INPA 4KC0A 2HK6A 5JC1A 2I2FA 3U9LA 3JU3A 3GDHA 2Q07A 3CONA 4GVPA 3PHCA 3FPAA 4Z4QA 3QVTA 2KM1A 3O31A 1QZZA 1G5IA 4QD3A 3SBXA 4EQ6A 5IKEA 5AJYA 4DV4B 4I99A 3HUTA 2XJ4A 1B2LA 4FFDA 2JBAA 4WY2A 5KYWA 1LSUA 3DVQX 3I5MA 3Q12A 3UAZA 2PDAA 1XF9A 4F4HA 1TYAE 2PQ2A 2CBZA 1QDEA 4GBJA 1CS0B 2PZLA 5CDFE 4LBWA 3U09A 2I4OA 2AJCA 2O50A 1VKZA 2O48X 2YZKA 1M6VA 4BO8A 2JHPA 2OQRA 2GM4A 5I48A 2GHTA 1VJ1A 1O97D 1WR8A 1SULA 3LT1A 4FOLA 3PPWA 4O4HB 2IDKA 1K5GA 2CW5A 4IMJB 5KYWB 1NXTA 1H3NA 5ENDA 3DPIA 4LVNA 1U0TA 2QZSA 2QLLA 4J90A 3W78A 3K9NA 4NOMA 2FMFA 3EUWA 3L7AA 2QYHA 2GNOA 1XZQA 1FMCA 3LZCA 4I4TF 1L5HB 3KRTA 5FOUA 4YRPA 3AQIA 3SAJA 3NMUF 3ROQA 4G5HA 5LLDA 3HSSA 4NCXA 4QXPA 3PFIA 2B8NA 1JR3D 2V6GA 3ECCA 3R7BA 2FX3A 4NZPA 4L5IA 5MN4A 3QMVA 1DP4A 4LXQA 4C7OA 1Y8QA 2FX5A 3FHTA 3CLTD 5KVQA 1GPKA 1SWVA 1FUYB 1K6IA 1TM4E 2ZSKA 1N2JA 1P1RA 1GT91 4LNUA 4OGGA 3TJMA 1IOWA 3CJTA 3AI7A 4M1OA 2OORA 4CGYA 3TJRA 2UVDA 1BH2A 1L8AA 1SC4A 3PDIA 1UQUA 2G9NA 5CFPA 5TMBA 3ZXUB 2GXAA 2PKYX 1R12A 4UVIA 5J2TA 3M82A 5KHLB 4LE2A 4S0XA 4BV3A 4YRAA 3I2JA 5CCXA 3ZJVA 2XPCA 2XXAA 1N3BA 3QBDA 4UMFA 5AFSA 1MH1A 1VTKA 3A1CA 2R8ZA 4X6LA 2YWGA 5HIJA 5BT8A 2QRPA 3OZTA 3DHEA 4DIMA 1BGXT 1PK8A 2IZ1A 1V8DA 3CZAA 4LOHA 3LY9A 1ORIA 1QANA 5TX7A 3QJGA 3IXLA 3WWEA 4EVRA 1JG6A 4MZXA 5KVAA 1AD2A 2G5PA 1VG9B 3K0AB 3HY3A 5AKEA 2Y3IA 4IXDA 2W2LD 2AS0A 3FN4A 2PRIA 4GT1A 3U4CA 2LZ0A 3E9NA 5JZBA 3E70C 5DRYA 3UENA 2G71A 3X1ZA 4TV9F 1NBME 4LIPD 2DPHA 3NIBA 3LFUA 2ZBFA 2X8BA 4YMUA 2HR1A 1PNQA 1YBVA 4X1OA 3S4YA 3MAGA 4R4JA 3KKLA 4R2JA 5CM9C 3O7WA 5K0LA 3DOHA 4O02B 1TUEA 3A4YA 2AOVA 4BXOB 1I4DD 3HABA 2OP0A 1A96A 3H7AA 4RGYA 2QN2A 3KQVA 5DISB 3RS7A 2MYNA 1PL0A 1UODA 2WAAA 3MWEA 4DMKA 4LA4A 3SS9X 1T5LA 2XTZA 3TM4A 5CLFA 2G5TA 3TVTA 1LSOA 4RJIA 3ASVA 1L7XA 4R0NA 3CUVA 3PXEA 1NL3A 3NM5A 4W7IA 2HOQA 2PMCA 3AY0A 4N5IX 5KTPA 3LQRA 2QTTA 2X58A 1JDPA 1GZ7A 2AQIA 4UBJA 4R16A 5CNMA 4EKEA 1JZTA 2I78A 2VPTA 3C3BA 4JX8A 3QUTA 4CT4B 1AG9A 1DBSA 5TMEA 3TSZA 2QB5A 3OCWA 3DEYX 4ZAVA 2NV0A 1UIMA 2RGNA 1C3OA 1CRZA 1NVEA 1JE1A 2BEWA 3IP6A 5C3UA 1RJFA 3A4NA 3I37X 1AQJA 2EZ9A 2POQX 3OIDA 4U2KA 4WESA 4YIHA 1NUQA 4BNTA 2BFFB 2HF7A 2JH9A 2YC2C 2YYZA 1E2GA 2YX1A 5AVKA 1WF3A 5KKAA 4JBLA 1R00A 4MVJP 1XEWX 2R66A 1HZJA 4PLGA 3ET4A 2DULA 4MEAA 4MDEA 2NTJA 1NVAA 4MZDA 1B1CA 1SD1A 3B12A 3H16A 2N1MA 4ZYLA 5CFOA 1BNCA 4TTJA 4FZRA 5DNWA 4AJHA 5JAOA 3BXPA 2G7MC 4HNGA 4NBVA 2E82A 2D2VA 2H18A 3T7EA 4XWKA 2IS1A 2A9VA 1ADYA 4RPLA 4UBKA 4MP3A 4BX2A 4JU8A 3S70A 4BYMA 1Y3BE 4DA4A 1Z2AA 2XZPA 2ZIXA 5JSHA 1K06A 1OA1A 3FWNA 4LJ6A 3ICCA 4FHZA 2ROQA 5F3RA 1ZXLA 3LBFA 1PZNA 4JLOA 4EVSA 4DAOA 3VR5A 1HT0A 1JLKA 5GGXA 3M4YA 5ALOA 2JCGA 3AUTA 1BGWA 3EVEA 1I7PA 2LVBA 2AXEA 1PT7A 1YQWA 4RKEA 5BPFA 3JQFA 2GVDC 3MVEA 1RM3A 3IQHX 2VYVA 4WQMA 3RVRA 3SZGA 1YGYA 1LBHA 4TLCA 4YEDA 1LPBB 1DBVO 4AZWA 2QE7D 4PTZA 3B38A 3U81A 4QM7A 5DYNA 1Y82A 2X22A 4EI7A 3LUDA 1CE8B 5H68A 1U2TA 1LNZA 1X3LA 4PZAA 2VJDA 1GGFA 1N6IA 5JPCA 2O3RA 4MW5A 1BX1A 4WDQA 3PYMA 4B4KA 4DSNA 1GFIA 4CDGA 2QAGA 3X43A 5A1JA 2BGTA 3AW9A 2ZR9A 1E5QA 1ONNA 2A0UA 3JQ6A 2HH9A 3QKSA 2CFSA 4QECA 1JS1X 3CLRC 3KQOA 1ZD9A 3CUSA 2L82A 5BUQA 3EA5A 3QF7A 4YJGA 1WEKA 3E5NA 2QE6A 5DKFA 3UYKA 3WHLA 4AG6A 2J5QA 4GSLA 3KWMA 4IOLA 4KSBA 2YN4A 5GGYA 5IC5A 1WCXA 2ZZKA 4JENA 4OH7A 2H08A 1ZVKA 1DB3A 1CDZA 2Q1XA 1EBFA 3HJAA 4INAA 5HJ2A 3WICA 2JHGA 3UUWA 4PXSA 5AK5A 4CLEA 4Q1VA 2XCUA 1QQAA 2CB9A 4ZYXA 1CYDA 2OILA 4MRNA 3WKAA 4BWYA 1UP6A 1W4BA 1ZK4A 5FNZA 3PTAA 4Z53A 1OB2A 5AVZA 3DMTC 1U9ZA 4R41A 2JI6A 4I50A 3CZ5A 5GOZA 4BLSA 4B33A 2JK1A 4JXKA 4X0EA 2HO4A 4L8WB 2HA3A 4C6TA 3S44A 4YA6A 1BMDA 2AFIB 3DCNA 4FBMA 4RZHA 3IP1A 1EP2B 3OZSA 3RK0A 2QN3A 2RHOA 4AYWA 3LWNA 3FDXA 3WL6A 1WL8A 4NY1A 5KYKA 3QH4A 3K9HA 4ZREA 4ZI3A 5A5DA 3UAXA 4F3CA 1TRHA 3HPQA 4LCBA 2G1JA 1O5TA 4GZ6A 5HGXA 3STUA 1GFSA 1P2TA 1P4GA 3HY6A 1NP7A 3LPMA 1J1UA 1KVUA 4JJIA 3LX4A 2EZ4A 1VKNA 3R7DA 1WO8A 2JLYA 1BA3A 4LISA 1YUBA 3DF7A 4JQYA 1FP6A 3LLMA 3IEXA 1SWWA 1ZA1A 5AVJA 3ABZA 1ISSA 1T5IA 2H2WA 3L8EA 3NTXA 3RREA 2NTVA 3FOAA 4QYIA 4ZT2A 3AI1A 2GLTA 3WHKA 1KARA 3RVOA 2TMYA 4M0PA 1KK0A 4LYYA 5CT8A 2EKZA 4O5OA 1DIOB 2FSGA 3E9DA 1Q1BA 3MWJA 3EPPA 1T35A 5HGJA 5GZ1A 3L1IA 3G0BA 4JOCA 3G2QA 1A5SB 4RHUA 2WOOA 3QBTA 4LDNA 5JIBA 3UATA 5CVCA 1T2UA 1VRVA 4OBEA 4XB1A 4HDMA 4N49A 4CMCA 2EW2A 3SX0A 2I8LA 4ICIA 4IZIA 2CLCX 1A8PA 4A6PA 4KRFA 1GADO 1EJ0A 1SKQA 3IQIX 3VZRA 1TT5B 1QHYA 1Y89A 2YVQA 4ZZ0A 1RWKA 4E11A 1QFZA 2FRVA 4MQMA 2V3CC 3MELA 2H11A 5U4XA 2QSUA 3AV0B 2WTXA 1ORHA 1TAHA 3MNFA 1QE0A 3F67A 1Z6QA 1G5FA 3MT9A 3M6WA 4HG2A 1OFTA 3BRWA 3S29A 2VYQA 4R1TA 3UWMA 3R5JA 3G8CA 1ODFA 2NO7A 3ZZTA 3L0OA 1JTFA 3K0AA 4RIFA 4BASA 3VYSB 3TVDA 4FD3A 4AW9A 2H54A 3GQVA 5CFZA 1Z63A 5K3SA 3KTOA 3OAAD 3RVJA 2YHIB 4BP1A 1FYWA 4F9TA 1YJQA 4TMKA 1ZCAA 2CLLB 3KVOA 1K27A 2A7XA 3JVDA 4HNVA 3WHIA 4OGWA 3THXB 5K0TA 3NP9A 4ND4A 4REMA 2ZETA 1U8ZA 4Q4DA 3PFFA 3BA6A 4U7TB 2HX1A 3BWCA 5LXTA 4URFA 3QI7A 4Q12A 1CZOA 1FX0A 2QRMA 3FKJA 1AA9A 4JS0A 2D5IA 3QU2A 4QXRA 4RACA 1K2WA 4AG5A 5DN9A 4LWPA 4LMRA 4OK5A 4FFPA 4D92A 2F1JA 1CUWA 2ON6A 5JRDS 1KJJA 1KDTA 2ZRDA 4HEJA 4HX2A 2OESA 4RNDB 3NVMB 2V74B 4XX1A 5DPMA 4G4GA 4GAEA 5HX7A 1CZRA 5HP4A 2VI5A 1AGRA 1JU3A 1P9LA 1PN3A 2E4WA 4AJLA 4D02A 4Y1RA 2Z9CA 3EZFA 3RFFA 3MGKA 5LKAA 1S9HA 1L7DA 1QH8A 1K6MA 2JL1A 2ZB2A 1NPTO 3EG5A 3C85A 4EFNA 4OMUA 3HM2A 1ESDA 3GLHA 4D43A 1VL6A 1NQWA 3ED1A 1J0XO 1Z5GA 5DIZA 3TTVA 2J9FB 3EZYA 3IQXA 2R48A 2YOGA 4LMBA 2F7SA 4IZOA 1UC9A 3V3KA 5KJCA 2Q2VA 1E7RA 1AOXA 4X8OA 4ZTZB 4J49A 3B5IA 4L28A 3D7MA 2ANBA 3EIOA 4B75A 3QSYA 2HQRA 4G3XA 4A15A 2IPOA 3AIIA 1P5FA 2J3KA 2VC2B 3JZFA 1QV9A 1T8TA 8ATCA 5J2TB 1S96A 3SEQA 5CDUA 4QVIA 2C2MA 3IPLA 5G0VA 2G83A 2BF7A 3NFYA 4WXHA 4Y2PA 3ZE9A 4TS9A 5CDHA 4D25A 3GGJA 2VSOA 5HBGA 3CSDA 1EFTA 2WFAA 4GE0A 1RMTA 3T94A 1XTRA 3UPDA 1DJPA 1RWPA 4C6HA 2WD7A 3RGGA 3H1FA 3MMPA 4HDRB 1M1UA 1M54A 1USIA 1FY2A 1E1QA 3NV9A 3SXJA 1JPJA 3C4QA 2C8KA 4L85A 4EOGA 2DJIA 1PHRA 3P0EA 1GR0A 1ZLXA 4FGWA 5K8UA 3B8HA 1XNQB 3KXPA 2ZUEA 3F5DA 3O9VA 1UPUA 3J7AC 2YMPA 4KO8A 3WK7A 2AMJA 1JG4A 4FC7A 4A10A 1KYTA 1J6UA 1U2EA 1VMKA 2ZWIA 1BEUB 5E4TA 3W1EA 3AEQA 2J7PD 3KAJA 2CNWA 1Y6JA 1A95A 1Y1KE 4MVJA 3WWCA 3CKKA 3GEPA 3Q85A 3SZUA 4DG8A 1RJWA 2ECQA 4DCNA 2I54A 4DR7B 5B7QA 1A9OA 3AG6A 1IFXA 1SD2A 1J07A 1NXVA 2CVFA 4GRIA 2NZUG 5LP1A 3BCSA 5CVUA 5K4AA 3C1TA 3H0EA 3Q5EA 3LPNA 2R1VB 4LV8B 3D54D 4NZZA 4QU0A 4YLGA 1NKTA 4EYEA 4BPBA 1NJ8A 3O8LA 2QVCA 3ZGOA 2IY9A 3HBAA 2J85A 4LHYA 5DM0A 4TZ6A 2OV4A 2QL5A 3Q7IA 4ZOQI 3P45A 3OLVA 1TVEA 2WHYA 3ABQB 4LYGA 4AKSA 4B35A 1ZXXA 5C4GB 1UBKS 3H5VA 2J09A 1R6VA 4NYIR 4OYLA 4M0EA 1Z12A 4FEAA 4Q1DA 4RK5A 4JLJA 2BKAA 1R1DA 1R4NB 2AK2A 1UFOA 2VXBA 3GT4A 4I1OA 3QSGA 5H5JA 4ZXFA 4G0ZA 3D3JA 5CXXA 3WLFA 1T6BY 1K5HA 1UKCA 2QSZA 4KRGA 3R5HA 4BMYA 4D79A 1POXA 3GLGE 2UYCA 1U6JA 1IDN1 1RI5A 3KG2A 3ICWA 2XNHA 4WCFB 3AINA 2I2CA 2D06A 2EV9A 2JGMA 1PJZA 4F60A 2GD6A 3TYXA 2DFKB 5IAOA 1RHMA 1K7YA 5C7OO 5CVDA 4R81A 1V1JA 2IUYA 5JRZA 2X6QA 2JGNA 4QNRA 3X1MA 1MT0A 1QYCA 2B4YA 2KBEA 1N4AA 2O8VA 1PFUA 3JRWA 3KUUA 4IXMA 4X9XA 3A6PC 2IXTA 1EE9A 1GFWA 4UNPA 4I9FA 5KVVA 1CRPA 2YMQA 3UWSA 2WG1A 2Y68A 2Q41A 1P29A 2PXAA 3TLGB 4W1PA 4JAVC 3W6UA 1GQYA 3U40A 4OQNA 2QSJA 3SIPA 1XTQA 4E32A 1GQQA 2PKRA 2QDXA 2IYQA 4V1CB 1IK4A 1E3QA 4B3HA 1BROA 1GZUA 3CM0A 6GPBA 4J7CA 4K0KB 1XWFA 1NVVR 1M2FA 5MDHA 4D8VA 5F3DA 4ISBA 3EBLA 5HS6A 4DMLA 1B3RA 4PQRA 6ADHA 5JHHB 4HDCA 2PGJA 4M9QA 2QX6A 4P5PA 1MV5A 1PQUA 1Y1PA 4PPFA 2VLBA 1U6KA 2FEOA 3UJHA 3WL7A 2JIZD 3OECA 1T4GA 2O5EA 1HGXA 4HV4A 3ZW8A 3RU9A 2G4VA 4LFAB 3FPBA 2YYAA 3S2IA 5B36A 1E1LA 3DB1A 4TLEA 3ZWMA 1A1VA 3NDBB 4AJ2A 1L7PA 1V16B 4H17A 4JLMA 4QPDA 4DS3A 3OQPA 2OTCA 4N7BA 3WRYC 2NSDA 3AKCA 4KLCA 4Q1EA 2NWQA 5EERA 3DWEX 4IIXA 3TEFA 4NK5A 1U1DA 2OAEA 3D3WB 3TIGA 4F4DA 5FOXA 2WJYA 3NIWA 3N2GB 5TEVA 4NU6A 1LF5A 1LTHR 1U2GC 4A8PA 4MWEA 3SZRA 3TD6A 4KH0A 4N40A 4J29A 1EFCA 1ECJA 1W8IA 3PXUA 6Q21A 1ZAKA 1AJEA 4AI6A 3K72B 3TD2A 4KGVA 5EXXA 4CIBA 3VUEA 4W8HA 3V97A 3R2JA 1KI3A 2JFXA 2PX6A 5EHNA 1HFEL 4MUFA 3EMDA 4AJIA 2EQAA 1GZHB 3BXHA 3ND8A 3QPDA 4MS1B 1HV8A 3L6OO 4XEUA 1ODLA 1THGA 3N6VA 3SICE 4KJXA 2EERA 4RTOA 3I5XA 4HFNA 3IP8A 3TLGA 4JUFA 4BMPB 5EINA 1OIXA 2PV7A 1ULSA 4EHJA 2P9QA 3ZCRA 4KIJA 1LGYA 1FZQA 1G9XA 1T1SA 3GGCA 2OCDA 3VR0A 3T5TA 1R3DA 1OH7A 3SYNA 1QH0A 3SDBA 1PSDA 2OO7A 3ZY4A 2UUAB 1AF4A 1SIBE 2V9CA 3QFSA 4MCIA 3K1TA 4V02A 2ADMA 3NBAA 2PTGA 2ZBQA 3H5AA 5JD6A 1PWYE 4QGFA 4MITA 2WKPA 2P6OA 2YS6A 4FDTA 1YRBA 1NVGA 1S2MA 2GWHA 3FCAA 3VDRA 2Z09A 4US2R 5B55A 4ESEA 1A2OA 1CBUA 2HMSA 1BYIA 3I5AA 4YV1A 3FTPA 5CDGA 5L4NA 3UA4A 1TQDA 2EF1A 5B37A 3CWQA 1SPXA 1P0QA 2RBKA 1DQNA 3K09A 3M1AA 3IHWA 2W2MA 2J31A 4FLEA 4OKSA 1L7VC 2OBMA 5EJGA 2GBLC 1NQ5A 1K89A 3DB2A 1IJBA 1W85B 4P35A 3TZ6A 3C3JA 1B42A 2DPYA 2EG5A 3CLUD 1NMSA 1W8DA 2XMDA 4BO9A 1PZFA 1A5ZA 1L5OA 4BQSA 1ISJA 4Q3CA 3B1ZA 4RKFA 3IH5A 2PSFA 1ZITA 1KFCB 1JECA 2XXBA 3FFWA 1F5NA 4MVCA 4M22A 1I7NA 2H7VA 3RJ5A 3WAKA 3A2LA 2Q6VA 3PTZA 3HCBA 4YPFA 5HIIA 5A3VA 5AW6A 4C06A 4B83A 4AY6A 1NRWA 1X94A 1V48A 3NUZA 4TZ0A 4JITA 3H4VA 5JMWA 4P4GA 4HGPA 3P0RA 1HMYA 4M9XA 2X5NA 3A6EA 4WZAA 4ZU6X 2VDUE 4NFYA 3EVDA 2FRXA 3OEEA 4P98A 4YRRA 5B6JA 5L45A 3QE3A 1DGQA 1V9CA 3KZOA 1IH8A 2H1CA 4D3YA 5DHUA 3TAHA 3B60A 5T41A 4ZOLB 4IY1A 1FRVA 3KHTA 2GAAA 5KDLA 2O1SA 3TO5A 1BKSB 1UT8A 1C4XA 1XR3A 1ZH2A 3I9V6 1S02A 5C8ZA 4MVYA 1XPUA 1EK2A 3KALA 3KYDA 3CG4A 4Q3NA 2Q5QA 1P7PA 2FOXA 3DONA 5K8LA 4N8SA 1QFSA 3MSCA 3IDZA 4GHWA 1Q7TA 4CFYA 1NQUA 1WM1A 4X7RA 4CLXA 2IOHA 3E2PA 1ILWA 3KOXA 1DG1G 2PZ8A 3K6SA 3NXSA 2RHHA 2LKDA 4JZYA 4F93B 3UG6A 2BEWB 3UANA 4TSKA 1ZVVA 1YZ3A 1QOPB 2B9VA 2JJQA 3NT5A 1UWCA 1GZ4A 3MS4A 4BUZA 3EPKA 4IH1A 4ZCMA 1OY1A 3GGGA 2JFGA 2RGNC 2XA9A 2R1TA 3L0BA 5IULC 3GLKA 4RBNA 3WMWA 3MFYA 1PCXA 2B82A 3GG9A 3L4KA 2ZK7A 2R25B 1TYCA 1YZGA 1KH1A 1GTMA 1V6AA 1JP7A 2OBNA 4AP6A 4I8IA 2WYWA 3VTAA 1JQAA 3FI0A 2BTEA 1VMAA 4LXXA 4XFKA 5DGIA 3OPNA 3KM0A 3SJUA 1Y8ZA 4JI4B 4R2MA 2XT6A 3E03A 1EK5A 3F6CA 3MFQA 2Y0EA 4OVKA 3FWZA 4PO1A 4BZZA 4V0NA 3MCAA 4NCAA 1QCYA 2AF4C 1E1KA 1T91A 4BBAA 2J07A 3BE6A 1KYXA 1UBSB 1NBMD 1U2RA 1E8MA 3NHMA 5CDYA 5K8CA 1E0KA 2C9OA 3Q2KA 1BJTA 3W2FA 5LP6A 1JXQA 4X60A 2E9SA 5JXJA 1CQPA 2NW6A 3AI2A 5JXGA 1G1MA 1RAGA 3BFKA 4FP9A 1VL8A 4WFIA 1AN9A 4AKTA 2QEQA 3KZCA 4QGHA 2YQ4A 4NNPA 3GJSA 2F8LA 4H6PA 5HRUA 1Z4MA 5F51A 2I7TA 2ZT6A 1KF0A 3DG9A 4ER5A 2WUVA 1Y1TA 1ZFNA 4PAOA 4ZDJA 5FBVB 5KMGB 2H2DA 4UEQA 1OYWA 2AIRA 3ZDAA 1PJ4A 3AKEA 1JGTA 1PFVA 3JWGA 2JFHA 3AHGA 1XAIA 3OOWA 3WMFA 4A5OA 2H5EA 3E53A 3MAAC 3REFA 1SMKA 1E2IA 1EFHA 4NXNB 4JHXA 4MWGA 4ZVVA 4D0SA 4DLPA 1HDYA 3UJ7A 1ODCA 4MR9B 4Z4IA 4JWKA 4FTWA 2C95A 5FTLA 1V8ZA 2QN8A 1ID8A 1BMTA 5DGCA 1J4AA 5JMTA 1KR2A 2WM9B 2HA6A 3O8OB 5LLSA 5DNCA 1XLVA 2PUEA 5LZ4A 1X13A 4BQPA 1TZ2A 5IEBA 3AVOA 2QT0A 5FYDA 2X1LA 3HSYA 5F98A 3OT1A 1RIFA 3CLUC 3W5BA 1NJ1A 1B15A 4JT9A 1BMQA 2GB4A 3EDMA 4XX0A 2M6KA 3VR4D 1EDEA 1E89A 1JUDA 3BHJA 3PE3A 2P3LA 1UOQA 2ODBA 3DOUA 4KE6A 4FILA 4X24A 5TT1A 3G5MA 1YCDA 1KAGA 2XRMA 3HXPA 3TOSA 1X0XA 1R5OA 3ANLA 4L0QA 2NQ2C 1GAQA 3QPBA 5HQJA 3RAGA 2MMCA 3OPYI 1GAJA 1G8SA 1VP9A 5FOQA 4Q4AA 2ES4A 3F46A 5FF9A 4OMFG 2C2WA 3FA2A 3AXSA 1JYEA 3OX3A 3IUEA 1QHHA 5BSUA 2C7VA 1H2BA 2Y1LA 3I72A 4OGLA 4ZJUA 2AJDA 2HXSA 3U80A 1Q44A 4ZVTA 3RC7A 2PIDA 4MKXA 2MMGA 5DWVA 4ZP1A 4KWHA 1RMYA 5G3YA 2C98A 3K5PA 4G07A 3UCEA 4MQ5A 4P34A 2HQOA 2QLFA 1S01A 2R00A 5LSAA 3H87A 1P2UA 2DF8A 1EDOA 2WJIA 5I4KA 3HM9A 3HA3A 2WM8A 4O08A 4Y2GA 3LUPA 1GZ6A 3LCRA 4JEHA 5CLHA 3WFZA 5DBFA 2VOEA 3ETGA 4HO1X 1B4DA 4IF6A 3E4CA 5LIRA 1GRVA 1FFHA 3FUTA 3ITDA 3PG5A 1YDWA 1YL6A 1TIPA 7REQA 3NHWA 4DY4A 3PR1A 4J1SA 1EFVA 1M6WA 3H4MA 1KIAA 3SC2B 4D3SA 5HQTA 5REQB 2JZCA 3GFBA 2VAMA 3PQ7A 4A6XA 2ZU6A 2DERA 2QXYA 2RMKA 5ELXA 3E3AA 2I9KA 5DF1A 3UUFA 5HKOA 1IC6A 1XXLA 4MUNA 1EM8A 4MVJM 2YFQA 3NASA 2NXEA 4URUR 5FTJA 2BDUA 1S8FA 2HA2A 2IITA 4U5XA 2XD4A 4Y9SA 4CXMA 3GPLA 1IUKA 3CXRA 3AY7A 2D0OB 4O2LA 2ADFA 5K7SA 1K97A 3CZCA 4PZPA 1J22A 1I32A 1SU8A 2I1WA 4PWYA 3ISVA 2ZRIA 2GZMA 2YDXA 1Q22A 2R5WA 4EEKA 3ZQKA 1ADCA 4RFLA 1GGJA 3HP1A 2UAGA 2A94A 3SHTA 1MOQA 4CM4A 2BCGY 3IOMA 3P9IA 2IEAA 2CXTA 1HH4A 3M6FA 4DNFA 4CM7A 1EVZA 4V24A 2PT5A 4R7TA 1GM5A 3OOEA 4HLUA 4UCWA 4DDVA 1HL7A 5EJ9A 3E9YA 2YHIA 3P94A 3TB4A 1B6SA 2D74A 2WVAA 5CB0A 1SCQA 1C9NA 1JIVA 1EIWA 2JC3A 5FWYB 3I2IA 3JVIA 5EE3A 3RAJA 4F84A 4YP1A 5KJ1A 3DWIA 3KAQA 3F97A 3MRTA 4LXUA 4UDXX 4ZQFA 2OAP1 3PX7A 2WD8A 2ILVA 3WLPA 2IDJA 3NXKA 1UPAA 4CTOA 1A9QA 1WV1A 2WA2A 3QE4A 4XASA 1WBJB 4JL6A 2GBFA 3LVQE 1JYFA 1U1IA 1HYBA 1K7FB 4RKYA 1W4ZA 2F17A 2I22A 1MFZA 2PNFA 4BGIA 5LQMA 1EJ2A 1I9CA 3A1SA 3FF1A 3MN1A 5DBHX 4XVCA 4MW0A 4J1NA 2FLWA 3KEQA 5ICEA 2NP6A 2QLMA 3EC1A 4J0IA 3T12A 1ZHFA 3U62A 1UFVA 2ZIEA 2OFOA 4E21A 5ALUA 4AU1A 4IGKA 1U6IA 3C3XA 1VZ2A 2VDKB 4M87A 2IFTA 2NZYA 4R2XA 1YC5A 3TKLA 3OTQA 5C7YA 3GDOA 4YCSA 1JEAA 2EP8A 3P1JA 3PQCA 3DQZA 4DJJA 5J1SB 1KI8A 2GN4A 4P84A 4AIRA 1NYLA 1REQA 2W6IA 1C2YA 3FOWA 2CJWA 2WYIA 1RHJA 2YS7A 3I52A 3TUJC 3S8YA 1MTOA 4Q6BA 2QN1A 2VVTA 3WSWA 3WWOA 4EO9A 3COPA 1BCSB 1MDBA 1HM5A 3L4BC 3GLHE 3X3HA 1PJ2A 1PR4A 2EW8A 5FH9A 1XRQA 2JIPA 1U1FA 2ZYUX 1VL0A 5BN5A 3L84A 1S5PA 4M98A 4WTOA 1T9BA 2O0MA 3R5KA 1W6RA 5I4IA 2BUAA 1Y7LA 2I3ZA 3PEWA 2IYEA 1PT5A 3FCCA 1I24A 5EJIA 2IYRA 4F3NA 3LLUA 2MINA 1KDYA 5K0SA 2NP7A 2XOXA 4XQ0A 4OU5A 1TTHA 2BV3A 2R62A 1WUIS 2AYXA 3W2GA 4F4IA 5IJ0B 1M34E 3VTKA 5FWYA 2GCOA 5FBQB 4Y0NA 2A3NA 2ACVA 3TZQA 3ZDFA 4ENRA 4NZOA 4CEJB 3HBMA 2WZDA 2ZROA 1JB1A 1A8QA 1GQFA 2CHFA 4EPVA 4FDAA 4PRYA 3GN1A 4LC1A 5FBKA 3VUFA 3ZK9A 3MG9A 4CMKA 1P2SA 2AI2A 2DBVO 4B6EA 2I7VA 3KVRA 4DKXA 4ECAA 2PBZA 5I7WA 1CY6A 3TXAA 2UZIR 4MVWA 3TR0A 3PXXA 4R9SA 1ZNYA 5EKTA 1LNSA 5CLGA 5NLLA 4CQMA 4EUKA 2SBTA 3ORRA 3ICVA 2QAGC 3K1ZA 1KPHA 3EGIA 4KXYA 4BUJA 1NXSA 1BJKA 2O6HA 1EVYA 4NPAA 2GOYA 2FSVA 2JAXA 3KTFA 2OGWA 3KPVA 4LJ4A 1XCGB 3V2IA 1TZMA 2Z9BA 3HCAA 4EKNB 1YONA 3B78A 1R0ZA 2HCTA 2G40A 1XZ8A 2HAEA 4FDLA 3G23A 4RCZA 3SM3A 2Z3VA 3WWYA 16PKA 1NMQA 1W1WA 3LP6A 3OZGA 1X39A 4WA7A 4BP3A 4GWKA 3G2NA 4YT5A 5E7IA 1PFKA 5BYBA 4QJIA 3KETA 4H6VA 4U8HA 4GLJA 4B3JA 4QPZA 1DTWA 2A8YA 4C6TB 3N6XA 4EW2A 5JS6A 3W8EA 4G26A 3F74A 1F8GA 1X7DA 3HHEA 3SJ7A 1C9EA 4NZ9A 1MB0A 1BEEA 3D1VA 1T9ZA 3NONA 1DCFA 4GMKA 4K9OA 4DV7B 4MHTA 3ADDA 2W8ZA 2OBYA 3KHSA 3IB6A 5TF0A 4L7VA 2I91A 1T36A 2YOHA 2GZ1A 4QG7A 3MGGA 2WMDA 3ILXA 6CHYA 4QWMA 4ZN6A 3I45A 2R3SA 1QGED 1T1RA 2PA0A 5WRFA 4EO4A 2ORWA 2BSQA 3FZEA 4HDNB 5BRNA 3ZYZA 4MAMA 1HDIA 2HJWA 1SZCA 5LWHA 2ALJA 3FOZA 3EVBA 3K94A 3VNQA 2IGBA 2VFAA 1DG9A 2KJQA 3GZTB 3C70A 4N03A 4F3TA 2AOTA 3M1IA 1NU6A 1P19A 2ZYTX 5EC8A 1JV2B 3R23A 2A5YB 5FULA 5CVTA 2AXPA 1DQSA 2V6JA 2ZFUA 4AKGA 4QL3A 1YV9A 3FCYA 1U11A 1X1SA 3W3AD 4QOSA 3RSCA 2H1WA 1A3CA 1GXSA 2WSLA 4HFMA 3VJRA 2WT8A 3FSEA 3GP8A 2RHRA 1DEOA 3L5KA 1MQ9A 2RKBA 3EC7A 2PNJA 2XODA 4JLSA 1CERA 1XCBA 5JSKA 5I7VA 3LGSA 5G4LA 1RXEA 4ZCSA 4LHXA 2QYOA 2RKWA 2IPAB 3TRFA 2QDKA 3EUAA 1FNNA 1WB5A 2VJPA 3OHSX 2JFWA 2OD7A 2JLZA 1YK1A 5K0NA 3EYAA 4MQFB 1RC0A 5FLXA 3A9VA 4BNZA 4QAJA 4P54A 1OT5A 2VXYA 4N6NA 3UAGA 1ZK1A 2CLIB 3RRBA 1X2EA 4W5JA 2VAXA 4RJKA 5BURA 2DBZA 1T26A 2IEZA 1AKWA 3EIUA 1U9JA 3EK2A 3JWEA 4OMDA 4BVLA 3SU8A 5LQDA 5IM4A 2JATA 4K03A 3PJEA 2PUGA 1P5ZB 4MSUA 5B3LA 3TUIC 4XWOA 4E5SA 2H4JA 1C9KA 1VPTA 4ZARA 2X23A 4AN1A 2XIQA 1F48A 4OQFA 2PBFA 2GBCA 5LP6C 4LEIA 1TYZA 1ZUHA 4W99A 5E95A 4H18A 1WUKS 1YCGA 4HQ0A 4DQLA 1A4IA 5K3OA 3UJ3X 4Q3OA 4XVRA 1QIHA 4JGGA 5EKXA 1L4FA 1G8MA 1GDDA 1ISFA 1VLJA 4DGQA 1VKOA 4UU1A 4DILA 4JZKA 3RRZA 1CDOA 2C2KA 2ZWVA 2IYTA 1RQGA 4DOMA 1HYHA 1Y6QA 1YBAA 1YZHA 1BXZA 5LR6A 5FNVA 2WJ3A 1TKBA 5EE5B 2FDXA 1BTOA 2QG4A 3NKVA 4HDKB 5HF8A 1KQ3A 3DLBA 1K6XA 3G85A 3AP1A 5COAA 1P17A 3ABIA 2XWBF 1VHDA 4WJLA 1RKQA 2QORA 1SN7A 1KGDA 2FPPB 4X6YA 5ALNA 4YMVA 1ISPA 2WG0A 1PGPA 1YI0A 2M9MA 3MBOA 2DU8A 2OQ2A 3N7AA 1RI2A 3QEOA 4MUXA 4EYOA 3U6KA 1O89A 2IS2A 3GK3A 4YONB 3SJZA 4BBJA 2CT8A 4UU0A 2AK3A 3QITA 1Z5VA 2WOJA 5CYOA 4MMZB 4IKPA 3KJNA 3O8NA 1DINA 1FMJA 1MC1A 1RLMA 3ANSA 1Y9JA 2SKEA 4A0HA 5JQGA 1WMEA 2VTDA 4K7JA 3D31A 1YS7A 4BRWA 2NZVG 5AUPB 4NOJA 4MI3A 4TVSA 3IBFA 3EE6A 2ZR0A 1B6GA 2GEBA 1P3DA 4KMOA 1UJNA 3K0EA 1LBEA 3D0QA 4PLCA 3S7ZA 2RI6A 5M29A 2PE5A 1UC5B 2EL9A 1VE1A 3R3VA 2R79A 5FBHA 4DJAA 1GUAA 1DJQA 3EEFA 3KV3O 1N6HA 2Z5GA 3SYMA 1MAHA 2XOKA 2FKAA 4PIPA 1Z07A 3GRKA 5ALVA 3S8EA 1QV7A 3LA8A 5EQFA 2WF6A 4XXHA 2XGJA 1LW7A 2E18A 4ZVMA 1M83A 1VM6A 1WTAA 3ZJ5A 3THWA 4B2IA 4NOKA 1SOWA 4DMMA 3WJ7A 3I32A 3I6BA 4O4HA 4WOCA 3DNPA 3PTLA 5JH7F 4B82A 3DKPA 2CY0A 2TYSB 3T15A 2DGDA 3MINA 2CV1A 3FNIA 4JMPA 3KKQA 4KR2A 4ILKA 1QKJA 2X6RA 4NPHA 1H1LA 2P9CA 3BHIA 1JDUA 3R0VA 1NT4A 1LDYA 1MC4A 3NS7A 4ZOBA 4QLOA 3RSHA 4W5OA 1SVKA 3KE9A 1T25A 5E6SA 5K4HA 5LMZA 1IHXA 3FR7A 4W63A 1G7SA 5HUQA 3LUBA 1RS0A 4ASUD 4PHFA 3QYFA 3VJKA 2VS1A 1DIAA 3PNVA 2XMZA 5LYJA 1IOZA 2MHCA 1TT5A 1I0LA 3A27A 2PKWA 3KSBC 3HXOA 4FIZA 5A02A 1P4RA 4ZRDA 4LF8B 2IYAA 3GJYA 4TSFD 4MRAA 2B6NA 3DW1X 5JNVA 1NVDA 1EK1A 1M1YB 2B7BA 4GX2A 4MUJA 4XGNA 5CIWA 3UM9A 4CNQA 4E15A 5J2UF 5GOTA 1BWQA 3BF8A 1WY5A 1QRTA 2JLUA 2Q7OE 3VOSA 3MOIA 3ZQ4A 5IKXA 4AF6A 3H5LA 3KL4A 4M0MA 1LFAA 5HS4A 2XEDA 4D4MA 1YZYA 2DECA 4UQPA 2OV1A 3U7IA 1J2TA 3T9BA 3UMRA 2Q2OA 4UNSA 3IIEA 1VCOA 3QTBA 3C7TA 4B8WA 2PZJA 4YHBA 4C2AA 5IYZF 3D4OA 4OXKA 2HV8A 4AUMA 1Z6GA 3NH9A 1WCIB 4DRYA 2EGHA 4F5EA 2PZEA 1KEWA 4EMBA 1E64A 4C5CA 4IDHA 5HZHA 3A6JA 2X0KA 3CUTA 3EFOA 3PHJA 1G59A 4X3PA 4XGIA 1X77A 4GI3A 1O08A 2EBHX 2PUTA 3LU1A 5DASA 3OI7A 3T7AA 1MT3A 2WHXA 1XGKA 3ABRB 1H9BA 2Y1CA 4D9EA 1NI5A 1NXXA 1GSOA 4C3UA 4RETA 1XSEA 3IAM1 1P7WA 4OREX 4RY8A 4MB2A 3MUNA 2GFHA 4GUDA 3IR7A 2Y0BA 1POWA 1RI1A 5EIHA 4HYYA 5JBNA 5A4JA 1YI1A 3QBJA 4QOHA 1TC1A 5JJ5A 1TEXA 4U2EA 3B20A 3E9MA 4J9VA 3EF0A 3FDFA 4RM2A 2D54A 2C31A 4FFLA 3HYLA 3SHWA 3EB9A 3LXMA 5KAPA 2FMXA 4XDGA 4HR7A 5E7QA 5CD1A 2ZI7A 5KX5A 4CEHB 5LA6B 5DBIA 3F78A 3ZCUA 3CBGA 4HFRA 4BFVA 2QL6A 4C9BA 2CBGA 5GAJA 4F21A 1XPOA 3N58A 1D07A 4OHRA 1MJ5A 1E1RD 2IH2A 1FE8A 3PFWO 1KP2A 1W87A 5EWJA 5TGZA 4EFLA 3Q8MA 1IY8A 2YCBA 2GEVA 3SXPA 4RPIA 1GLNA 2QW0X 3QVGA 5JAIA 3PGVA 4IDDA 3DYBA 2HPHA 5AKHA 3GT0A 1AHIA 3EA4A 2J3IA 2ATXA 3VVMA 4E31A 4N54A 3FPHA 3MQ2A 4HPXB 4MJ3A 1KJWA 4V0MA 1NUSA 3V1UA 1FYEA 3OJ0A 5SYNA 3WB1A 1N0VC 4HWSA 2IHBA 4NCIA 1IB0A 4LOAA 3Q7PA 5CM8B 4NFSA 4LYAA 4ZKEA 3C5WP 4XJXA 4RXMA 5EMKA 3RE1A 2W6ID 1E2EA 4MAAA 4C4SA 1U0RA 1T29A 3HJCA 5FV4A 4LXYA 1SVWA 3BZWA 3ZWOA 2C7GA 1RXIA 1BX0A 2CYAA 4RTNA 4EUFA 1KJNA 2Z5FA 4JVMA 4UFOA 1WZ2A 1HSZA 1E3WA 3W0LB 1IVYA 4IFEA 3HB4X 4EPXA 2IT1A 1YVUA 3N7UA 2D2FA 2YUTA 3OU2A 3UAOA 4F5ZA 3K9FC 1LQTA 2O8EB 3P5SA 3L8FA 4IFTA 2V7UA 1YS6A 4RS3A 1D7AA 1TPYA 3UY4A 1YJAA 1QYVA 4J0HA 2JLRA 4REQA 3A4IA 1ZOLA 1ZZEA 3QEMB 3WE7A 4ISCA 4K05A 3NTUA 4TWRA 2WB4A 1C1HA 3AM5A 4D9HA 1ORTA 1SQSA 1TNDA 4YAIA 3ITKA 1QIIA 3RH0A 4MVXA 1GLGA 4O8ZA 1F7UA 2HMUA 3MCWA 2CB0A 2IXAA 1CHDA 3VZCA 4CGZA 3EFBA 3WOVA 3J81A 4Q19A 1GUZA 1T36B 4KDFA 4FE7A 4WH0A 4XVUA 1NDQA 2XB9A 3IO3A 3QVJA 1CFJA 4JJEA 4RZ2A 1H85A 3EWIA 4V39A 4DCUA 4EKGA 2J0EA 3FLEA 3L01A 1EKXA 4LHWA 4WKOA 3BCHA 3QLTA 4HQNA 2HSDA 2YXNA 5SY6A 3TX6A 3IA2A 1P60A 4NPCA 3LRPA 2JJ1D 2PX4A 2Q0XA 2YASA 2YRFA 1DE0A 1E2QA 2J5XA 4I6GA 1LRJA 2IEYA 2X5OA 4F0JA 5U9CA 3O92A 2XRZA 1EE2A 3OTHA 4MPPA 4DSAA 4ABTA 1Y4SA 2H52A 3NRBA 2FW7A 5HW0A 1YZFA 4FDMA 4PRLA 3A11A 4QLAA 3KT3A 1WPRA 1IBSA 2PYZA 4C4OA 1YT5A 2A14A 2PT6A 3EMKA 4HNHA 4IQFA 3R41A 2Q9UA 1O57A 3LUHA 4KV9A 4COOA 2BF4A 2HQBA 1PS8A 2QTWB 3JQ7A 5IC4A 5KTTA 4Y2YA 1YA6A 1QJCA 3HFRA 3DLIA 1PJQA 4FGSA 1XU7A 1LX7A 1BN7A 3V4VB 5MFPA 5AI5A 5AVVA 3N76A 1G18A 4BNYA 5L7TA 2HRZA 3ENNA 2CKDA 3U17A 5HTOA 1LU9A 1II8B 5CT4A 1J42A 4AJEA 4H31A 4DLYA 1XJWA 3WISA 1C7JA 3VNVA 3IELA 1I3CA 4PIMA 3HVHA 4BB0A 1FFXB 1TM2A 3IALA 1MGPA 3LC7O 4HL6A 2YW2A 1T6ZA 4IQ8A 5EMLA 2JEYA 4AICA 1U65A 2W22A 1GPBA 2QRHA 1K7CA 1E8DA 3O83A 4KQXA 1XZGA 4OIFA 5AM5A 2PH5A 3PVZA 5IARA 3MWKA 4K9MA 2FFAA 3RF7A 1PKEA 3DR3A 3I5UA 4H27A 4LJ9A 3TLZA 5JFOA 1W6UA 2V7GA 2WJAA 2G63A 1YE3A 4OLFA 3ZQ6A 3AJRA 2Q2NA 4TWJA 5FUQA 4XPIB 3TQHA 2GDZA 1Q7GA 5JEEA 1TU0A 3PFHA 1MNQA 1AKVA 4MHSA 4PC3A 2VT6A 1M5TA 1M9NA 3K0FA 4HWKA 3C8ZA 4KXWA 3CMCO 1F3LA 1P4JA 3MLEA 3OZBA 2Q7XA 1OTHA 1J97A 2H65A 2JI9A 3G9QA 4OFXA 3W3ZB 3H5NA 3GBSA 3G5TA 4AF7A 4FWBA 2FP3A 3NIGB 4MUEA 3Q9NA 4UDNA 1XKQA 5BSRA 4HCJA 3WADA 3K0SA 1PNOA 4G1UC 5KYXB 3QNWA 2CV0A 3BEDA 4RMHA 2XUQA 4YAKA 4BLUA 4DUGA 2OM6A 4UE2A 2PRSA 1QMPA 1N4DA 2NU7B 2FPGB 3E9QA 3GMTA 2ZIXB 1VYTA 4EG1A 1AXRA 4X41A 5ICSA 4Q9DA 1E9EA 3CTPA 3LT4A 1GVNB 4LN1A 3WYCA 3GA0A 2E4XA 1R0YA 4Z51A 3DYIA 4WLEA 3OC6A 1C1YA 2DUNA 1T4BA 3KBBA 1ST3A 5KS2A 2QTVA 3LWZA 4RK4A 1PGJA 2EU8A 2OGTA 4IDQA 4E2WA 4GDFA 5KB3A 3MLBA 4CFZA 3SP1A 1JF8A 1XWWA 4MEJA 3U7JA 2GYWA 2KLHA 2RFLA 4KMSA 1GYRA 2JFQA 5KDDA 1AQYA 1AB5A 4FHGA 4AKEA 2IEGA 2X2FA 1IVNA 1GL6A 3BOSA 3OY2A 3NX4A 1H8EA 2VHXA 3H2YA 3DJFA 1DKNA 4G85A 1X7WB 3Q2IA 3UMVA 3VU8A 5IX8A 1VPDA 2OZLA 4NQZA 1AO0A 3W1WA 3K1YA 1TZKA 1ECFA 1VHTA 5BV8A 3E22A 3ZU4A 3D7KA 5T7BA 3KJQA 1CQZA 2PMBA 2Z8YA 3CLSC 5AI8A 3RJ9A 4C7JA 4B7XA 3MOGA 3EPLA 5L3QA 1KL7A 5THXA 5BXQC 4JX9A 3OCJA 4F72A 2ZTSA 1ZGZA 2G5GX 2E6KA 4PPNA 3D5QA 3KXDA 5IDXA 1N36B 4DUYB 4LYEA 1VKJA 1B8VA 1VG0B 2EYQA 3IDFA 2VF2A 3VI4B 4JELA 1YQUA 4MTLA 1KAEA 1MAUA 2VDRB 2PL9A 3GC6A 3KOWA 3QFRA 2J0QA 1XROA 3GQBB 4MNTA 3I2KA 4LDRA 3AIMA 3BL6A 2ZP1A 3DF9A 3GJQA 5EVCA 3AFIA 4ECEA 4EFMA 1N2CB 3RS5A 2OVBA 3LXUX 2CD9A 4C04A 2IYFA 2Z8ZA 4ZGGA 5KNCD 2EFHB 4Y1RB 4O25A 5DX1A 3JYHA 3KFVA 3T9CA 3GV0A 3OCVA 2JZNA 2ZQYA 5LZ9A 1CEYA 3JQEA 2QRVB 3BMQA 3QY9A 4MIKA 4A0QA 5BUZA 1CUSA 1KNQA 1R4NA 3NI2A 4NC9A 4N76A 4WJKB 1QBKC 2DM6A 4Z0PA 5IMBA 4Y67A 5ITWA 2AFIA 2D59A 3TSYA 3RSZA 4GS5A 3PQ4A 4HPJB 3AY6A 2JGDA 3ISTA 4JROA 4G97A 2A5FA 4QT0A 2Z1NA 4G0QA 2XYVA 3L7LA 5LBIA 5IM5A 1R5JA 3Q88A 4P4SB 3RYIB 1RJDA 1LBTA 1XXHA 3HRKA 4IMIB 2XUDA 4BVFA 4QDTA 1R16A 1NP6A 2Z43A 2LXNA 5A3JA 1WKVA 4RJLA 2XUFA 4ZAFA 1GTRA 3W8DA 5LVAA 2OUIA 4RZXA 1N0IA 5I9BA 1UUFA 3IEPA 4QA9A 4A23A 4X7MA 2VT2A 5KNDD 1CRLA 4AD8A 5A03A 2CXPA 4DAEA 4EHDA 5C37A 4FQ8A 4B3RB 2W4MA 2ZAGA 5JUWA 4PHCA 1KBOA 4M1MA 3TH5A 2Z8YM 3E7XA 4QVKA 1PL6A 2OECA 4IKEA 4QVGA 2GWRA 1GPMA 2QMQA 2DQYA 3ASYA 2VNKA 1OBFO 5FDFA 4AJ1A 2HHAA 1THZA 1QQTA 1WJGA 1XHFA 5EL0A 5BWMA 3KHKA 3DXZA 3QQ5A 1DTEA 4BKPA 2OC9A 3ZK7A 2FE1A 1V4VA 3DP9A 1WXFA 2ZUFA 4RKWA