5FHQA

Crystal structure of (wt) rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol (dnc)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Effects of Active-Site Modification and Quaternary Structure on the Regioselectivity of Catechol-O-Methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 65
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fhqA01
3HP7A 3EGVA 5LSAA 4PGHA 1R18A 3SMQA 1I4WA 1JG3A 1XCLA 1OR8A 1IXKA 2O05A 3P9IA 4MHTA 3GJYA 2YXDA 1QAQA 3FPFA 2VDVE 1NW6A 4HG2A 5K03A 2PT6A 5DM0A 5DTQA 3G2QA 3A27A 3BKWA 3KR2A 4OQEA 5CVDA 3TM4A 4DM3A 2ZTHA 5DT2A 4QVKA 3C3YA 2PT9A 3EMBA 2V7EA 4YMGA 3KPUA 2C7RA 4QQNA 2F8LA 1M6YA 2YTZA 3LSTA 3OPNA 3G8AA 2P3OA 5H02A 3UJAA 2FK8A 5K0GA 3SVZA 2PVCA 3K0BA 5DX0A 2JJQA 1NW3A 2JHPA 2IIPA 2YXEA 3B89A 1RJDA 3PS9A 3FPEA 2C7PA 2JG3A 5D1NA 2ERCA 3THRA 1N2XA 4IV0A 3CJTA 2ZZKA 1KYZA 2NP7A 3MAGA 4U7PB 4ZTBA 3FPJA 1R00A 5LQKA 2YXLA 3T7RA 1XXLA 5F2KA 4RTPA 3EVBA 4HRAA 1RJGA 3UA4A 2BM8A 1M0EA 3FUVA 4BP3A 4PGGA 1FPQA 2WA2A 5HOQA 4DF3A 3DLCA 1ZKDA 1SUSA 1Q0SA 1RJEA 1T43A 3TPZA 4OA5A 3CJQA 2NXNA 3FTFA 3HVKA 3DXYA 1FP1D 1RI3A 4LECA 3L8DA 3VC2A 4IKPA 2G70A 5C9ZA 4KIGA 1UFKA 2AOUB 3HTXA 3PB3A 4P7GA 5E1OA 1EQAA 3UJDA 3AY0A 2P1DA 4YV0A 4PYOA 4E33A 5EQJB 1RI1A 4FS8A 2OB2A 4AZWA 3PTAA 5D1HA 5DRYA 1ZHFA 2IDJA 1VLMA 5CM2Z 3NJRA 1V39A 4CTJA 3QOXA 5EZQA 10MHA 1QZZA 3NWEA 5DPMA 1RI2A 5G02A 5ICFA 5CCBA 3AXTA 1ORHA 1NW5A 4QPNA 3SGLA 3LDGA 4OX9Y 3LDFA 2AS0A 3EPPA 3EGEA 2AN3A 1ORIA 3EEOA 3OU2A 4E2XA 4QDJA 4PYMA 2KW5A 1G60A 3BWYA 1NBHA 4A6EA 1G8AA 2ZWVA 1JTEA 3KQSA 3CC8A 4YUZA 1D2HA 4EKIA 1P1CA 4HTFB 2FYTA 4GOND 3NTVA 3P9CA 1M6EX 3M6VA 3IEIA 1SVUA 1KIAA 5DTMA 1ZGAA 1WZNA 3MQ2A 4CWAA 5LQUA 3G5TA 2PV0A 2PJDA 3PX3A 5DTRA 4RV9A 4C08A 2PWYA 5DX8A 9MHTA 1WXWA 4R8SA 4YV1A 4JXJA 2AOTB 4EQZA 1UIRA 2JH9A 2FRXA 3ME5A 3EGIA 2BH2A 1R6AA 3LCCA 2IH4A 3KQQA 1O9GA 3GRZA 4FP9A 2HTEA 5EMJA 3E7PA 4PIPA 3TFWA 2XYVA 5EG5A 2WK1A 5E1BA 3UJ8A 1JG2A 2FCAA 1PRYA 2Z6QA 1AQIA 5DLYA 3D2LA 3FPGA 3GO4A 3VYWA 3WSTA 1X1DA 5K05A 5CUQA 3G88A 1I9GA 2OKCA 5HILA 1H1DA 5K01A 1L1EA 2ONYA 4POOA 1VE3A 1YF3A 1NKVA 4QTTB 5EIWA 1QAOA 1D2GA 1SUIA 2B9EA 3LGAA 3Q7EA 2YUIA 4P7KA 4V0QA 5FHRA 1WS6A 4GOOD 3ORHA 1FJXA 3EVDA 3FUXA 2YX1A 4WVLA 3TRKA 2UYCA 1XDUA 1YZHA 2I7CA 3T7SA 4OQDA 5K09A 2CL5A 3C3PA 3G5LA 5CCXA 4RTKA 2ZBQA 3CKKA 3ANXA 2EJUA 4OBXA 3IHTA 4PYJA 4GUAA 2NXCA 3FUUA 5F2NA 7MHTA 4EK9A 4DZRA 2FPOA 2HV9A 1IM8A 4M38A 4ISCA 5LQJA 1L3CA 4NECA 4CKCA 2AOWA 4M37A 3RIEA 2ZCJA 3MGGA 3B5IA 2UYOA 4P7JA 3H2BA 3HM2A 1YFLA 3LECA 1JSZA 2QM3A 3NDJA 3SSMA 4RVFA 3AWIA 3DUWA 3R0QA 3AXSA 4PYIA 2P41A 5FADA 3BKXA 1FBNA 1X1CA 3AJDA 3P2KA 4HSGA 4PINA 4C03A 5LQRA 3MERA 5GIOE 3U81A 3M4XA 1X19A 3GDHA 1IY9A 1R74A 3JWJA 5CVUA 2ZBRA 4GC5A 4DQ0A 3KQTA 3DLIA 4E2ZA 3C6MA 3LKDA 5DM1A 3PLAE 1EIZA 3O31A 5FA8A 2BR3A 2HWKA 2BZGA 5GOZA 3GGDA 4BLWA 3KPVA 1Z3CA 1XTPA 3DXXA 4IV8A 3OZRA 3THSA 2XBMA 3QOWA 1JR4A 4LWOA 3PT9A 4C4AA 5EOVA 2ORED 1TPYA 1DUSA 1YFJA 4F85A 3FZGA 2CMHA 3P9NA 5HIJA 1AF7A 3OE5A 5CVJA 2GH1A 3DMGA 2R3SA 3HA7A 3HVIA 4RTJA 2OBFA 4QQKA 4O29A 1F3LA 3UBTA 5K0FA 3HVHA 4BY9E 2PXCA 3MTIA 3R24A 1XVAA 1G38A 2QRVA 3GCZA 3TLJA 3HCFA 1VP3A 4F84A 5EIFA 4KVZA 2Q41A 1BKYA 3HNRA 3EMDA 3HEMA 3B7PA 3GWZA 4YUVA 5M5BA 5HIKA 1X1AA 4ER7A 4PCAA 5FWDA 5FQNA 3UFBA 3DP7A 2B25A 2OXTA 4UOEA 1R8XA 2ZVJA 4RTQA 3NW9A 1L3BA 3EVEA 4RX1A 1D2CA 4U7TB 4BLVA 4QVGA 1VBFA 2O06A 3G2OA 2ZWAA 2CWWA 3PX2A 4XUDA 5EVJA 3LPMA 2H00A 3Q87B 5E9QA 3KU1A 3OU7A 2Z6AA 4KRGA 2B2CA 4CXMA 4ATNA 2R6ZA 4C04A 4YV2A 3EVZA 2AZTA 4MQ4A 4P58A 4QPPA 1VL5A 3ER8A 1YUBA 5HIIA 1VIDA 1KPHA 1DCTA 1RI5A 1NW7A 2ONZA 1U2ZA 1FP2A 3FUTA 4GF5A 3CVOA 3E05A 3F4KA 1EAMA 3BGVA 3GNLA 3KQVA 4IWNA 5P8WA 2I9KA 2AN4A 1P1BA 4AX8A 3MB5A 3FTCA 4KWCA 5FCDA 2OZVA 3P9KA 3ERCA 3HCDA 3A25A 2LD4A 4PYQA 4HC4A 3DMHA 4XCXA 5EKUA 2P7HA 5U4XA 1DL5A 2AOXA 3FYCA 5FA5A 5GIPE 3LDUA 2GA9A 2AOTA 2ZBPA 4C06A 2BR5A 2ZW9A 4DA4A 4FT2A 5E8JA 2PX4A 3LHDA 3PFHA 5ICCA 3KHKA 1BHJA 2ZIFA 3M6WA 2BM9A 2AOVA 5EMLA 3S68A 3NVKI 4DMGA 4EKGA 4F86A 2OYRA 3RW9A 2IP2A 1RJFA 3C0KA 1P91A 1L9KA 4E2WA 3KPJA 2AVDA 5LQCA 4E2YA 5HZMA 3SR4A 3ELUA 2PXXA 3GRUA 4CKEA 2VZ9A 4R6XA 1KP9A 2OPBA 1G55A 3T0IA 1KPGA 2UYQA 5EC8A 1SKMA 3FRHA 4BP1A 2P8JA 4XUEA 2ESRA 4X1OA 4PYLA 2UZ4A 2P40A 4Y30A 3K6RA 5E9JA 5BW5A 5JUWA 3SSOA 5CVVA 4OA8A 2PSSA 2HMYB 3DR5A 4FGZA 2Y1WA 5E1DA 2BR4A 1EG2A 3FYDA 4H0NA 2FK7A 2QE6A 1QANA 5DRTA 4RTRA 5EMMA 5EEGA 1SQFA 1WY7A 4KW7A 4RSRA 5ICEA 3ER9A 2EG5A 3NWBA 3A7DA 2I6GA 5EEHA 2UYHA 2AN5A 3FUWA 3I58A 5E2BA 5E8RA 4DKJA 4GOMD 4QTUB 4AZTA 2OY0A 3B3FA 3KR0A 2A14A 2N47A 5E2AA 5BP7A 2G8NA 3SXJA 1VQ1A 2P7IA 1SQGA 1G8SA 2ZFUA 5B1SA 5GM1A 2G1PA 3M70A 4E31A 2YQZA 4X60A 5KS2A 5KVAA 1Q0TA 2IGTA 1KR5A 4EMSA 4C07A 2IH2A 3FPHA 3BWMA 2ZIEA 5FHQA 5DSXA 3E8SA 3OE4A 4LWPA 3GRVA 1AQJA 1SG9A 5EHGA 5BXYA 2B78A 3KQYA 3OZSA 2O07A 2NP6A 5JR3A 5GINE 4Z2YA 3R6TA 4GBED 1XJ5A 2G72A 3BT7A 3DXZA 3OZTA 3UWPA 5K0NA 4CKBA 3I53A 2GPYA 3JWGA 4DCGA 3OCJA 5DX1A 4KIFA 4FSXA 5EZSA 2GB4A 3BXOA 4B17A 4YUYA 3DOUA 4OBWA 2XYRA 5LR6A 1WXXA 4RTMA 2IPXA 5DM4A 5T64A 1YB2A 2PBFA 1MJFA 1KXZA 3GU3A 4G56A 3CJRA 2FHPA 3OFJA 3M6UA 5LQNA 2GAFA 3LCUA 3MCZA 4HGYA 5IH3A 3P2EA 3KKZA 4E30A 3KPYA 4FT4A 1JQEA 5FTWA 3UZUA 1AV6A 3EVAA 2JH8A 3HA3A 1JQ3A 4QDKA 3PFGA 1TW2A 1QYRA 3CGGA 2AOUA 2EX4A 4WXHA 5FULA 4YUWA 1N7JA 4GQBA 4PIMA 2P3QA 3MHTA 3LKZA 3QV2A 4ER6A 4BLUA 3C6KA 3BGIA 3BZBA 4PNEA 5C1IA 2PY6A 4R6WA 1X1BA 2P3LA 1NBIA 1L3IA 3O4FA 2DPMA 1I1NA 3NDIA 3JWIA 3JWHA 4RTLA 2ZLBA 1N7IA 2CKDA 3FTEA 2PGXA 2VS1A 3CCFA 5IKMA 1QAMA 4MTLA 1EJ6A 4K6MA 3BGDA 4X61A 4RVHA 3FRIA 2E5WA 2Y1XA 3UJ9A 2ZIGA 3A26A 3ID6C 3IV6A 1VP9A 4MIKA 1NE2A 2XVAA 3SX0A 4ER3A 2PX2A 1KHHA 4CTKA 2QYOA 4AUKA 2NXJA 1UWVA 4RTSA 2H11A 3REOA 3NMUF 4L7VA 2I62A 5ERGB 3DMFA 4YMHA 2ZZMA 3EEYA 2K4MA 5T6BA 4HTFA 2PXAA 5F2OA 1YZ3A 3X0DA 1VPTA 1R8YA 3ELDA 3KPWA 3GRRA 4EVIA 1NW8A 3I64A 1HNNA 3ELYA 5CIYA 2ZZNA 2NNWB 4GOLD 1BC5A 3UA3A 1INLA 4KDRA 5CD1A 2OO3A 4RTOA 3M33A 2XVMA 3E23A 3LBYA 3A4TA 2C7OA 3P8ZA 5DSTA 1KYWA 3GRYA 3HCCA 3UJ7A 4M7RA 5BW4A 3KQPA 2QRVB 4FR0A 3UJBA 3OU6A 5K0LA 3SSNA 4KDCA 5GM2A 5EKXA 3KR1A 5HFJA 1JQDA 5K8VA 3TOSA 1ZGJA 5T67A 3GXOA 2HR1A 3TKAA 2AVNA 4R8RA 5EHIA 3CBGA 5GP1A 1XDZA 3DTNA 5HIMA 5HEKA 3DH0A 2OB1A 3PVCA 2PLWA 2YR0A 1WG8A 1Y8CA 4LG1A 5K0EA 4HGZA 4RYLA 3I5UA 5DWQA 2V74B 3T7TA 2VDUE 4C05A 2NYUA 1F38A 3HCBA 5K0CA 1O9HA 2EFJA 2YVLA 5KQSA 5LQAA 3SM3A 1EJ0A 2ADMA 2B3TA 3M6XA 3GIWA 4AZSA 3EVGA 2CMGA 5EGSA 2O57A 1ZQ9A 3MTEA 2DULA 2H1RA 3IYLW 2ZSUA 5E9WA 5ICGA 1KPIA 2JHCA 1JSXA 3I9FA 4XUCA 5DXAA 1BOOA 3LL7A 3B3JA 2G71A 1NT2A 1P39A 3KR9A 3A7EA 3O7WA 4R05A 2PX8A 1XDSA 2EJTA 2VDWA 3G8BA 3LCVB 5FUBA 5GWXA 5K0BA 3R9XB 2IH5A 1JG4A 1O54A 3HVJA 4ER0A 3BWCA 4GEKA 2PKWA 3G7UA 3KQMA 2AR0A 3ELWA 3TQSA 5C0OE 3BUSA 2IFTA 3G2MA 1XCJA 4ER5A 3TR6A 3HCEA 1NV9A 3P71T 2IDKA 1JTFA 4E32A 2PX5A 3LX6A 5EPEA 1G6Q1 2HNKA 3NVMB 4Y2HA 1ZG3A 4PCLA 4PYNA 2C7QA 2Z6UA 3OFKA 2WA1A 3P97A 2O0LA 5DM2A 1MHTA 2P35A 3R3HA 4PWYA 2NXEA 2GLUA 3KQOA 4RVDA 3KQWA 5EMKA 5FQOA 2VP3A 4M36A 1NV8A 4FZVA 3G89A 4X63A 5DXJA 3EVCA 4MWZA 3EVFA 3VSEA 4AZVA 4PYKA 3UJCA 3V97A 3MCTA 8MHTA 3UJ6A 5KQRA 3VC1A 3HCAA 3P2IA 1TW3A 5MHTA 4RTNA 4YUXA 3RODA 4RVGA 4X41A 1JG1A 1HMYA 2IBTA 3V8VA 1PJZA 4GC9A 2QY6A 4PONA 5K0JA 3LBFA 3TM5A 2ZULA 4DCMA 2IBSA 1RI4A 4P7FA 3BWBA 5KYGA 3FTDA 5CVEA 3TKYA 4HH4A 2JHAA 2XYQA 3HA5A 2PWPA 3TMAA 3B3GA 4V0RA 4A6DA 3G2PA 4FSDA 1B42A 3DULA 5FWAA 4E70A 4RWZA 2GS9A 5E1MA
chains in the Genus database with same CATH superfamily
4D46A 1LVGA 4QFCA 4KMMA 2NSYA 3VAZA 4XCVA 1UZUA 1VB3A 4QUGA 4HWGA 3O8BA 1ZH2A 4ZFNA 3T5DA 3NOXA 2H65A 4B75A 1R8QA 3DSRA 4I1YA 4TLLB 1E1RA 4COOA 2GLXA 5DM0A 4EI8A 1II8A 1IN4A 1KEZA 2O1SA 4R4JA 4HXYA 5CVDA 1Y1PA 3OZWA 4B6RA 3U3OA 3N2EA 5HKOA 4OXYA 2E5LB 2ZUUA 4OMFG 3OQJA 4DBLC 2QTFA 3G8AA 3PWZA 4KPGA 1OROA 4O2BF 1SZJG 3UJAA 4ZGGA 4F4IA 2Z2KA 5IYZF 1YZVA 4BCBA 3MBKA 4KR3A 4NJMA 3PS9A 1AGNA 3TKLA 4P3PA 4IZHA 1CY7A 1BYIA 1JFFA 2ERXA 3QGMA 4Q6BA 3L7YA 1QGUB 3CRNA 1L1RA 1USKA 3LQYA 3JD4A 4PICA 2QN7A 2NWQA 1T9KA 2N9UA 2EEZA 1G9XA 4CMGA 4PU0A 2ZJ3A 4TWZA 2CYCA 2PM8A 1FPQA 3HNPA 3T12A 3IVMA 1RRMA 4BZQA 1H93A 4CYMA 3SHVA 1ZKDA 4RV4A 1IJKA 2YHUA 1F2UA 5CR9A 4UPEA 3SDSA 1XKLA 1WDWB 2A0UA 5CB8A 1JE1A 1PL0A 1RI3A 1UBGA 2WTEA 3C98A 3QITA 4J1TC 3ZS8A 1XLTC 2V7XA 4KIGA 1KMHA 1LQTA 3FLAA 3WL3A 2GAIA 3P9QA 5A4DA 1XTIA 1QHSA 1ULAA 1ZLXA 2LIVA 3TDMA 4HY3A 4MVJF 3MK31 1QOQB 1YZYA 5D1HA 4PC2A 1GLNA 3GJ4A 4HQ6A 3EAGA 3VR4D 3B7WA 4B46A 2C04A 4DLWA 4YCMA 5FUMA 1QRAA 4FBGA 3LY8A 3HKDA 1UP7A 2YNMD 2FDRA 2VYNA 1WHSA 4G07A 1SOMA 2P4EA 4G26A 4OI0A 1YRAA 1GWNA 4TM7A 3IH5A 1OGIA 4P98A 6NULA 1DLIA 4FFNA 4DJ5X 4YCLA 1L4KA 3K96A 4PHGA 3PPWA 4L2IB 1TJYA 1DQRA 1FS5A 1LDGA 1C9KA 3EE6A 3DM5A 4NL4H 3AEZA 2WTXA 1JVBA 4CEHB 3O9ZA 4YDQA 1YB7A 1DBIA 1VCHA 5JBNA 4BZPA 1RHRA 3UWSA 3IR6A 3IAXA 4GSLA 3FH0A 3IVGA 4B6OA 4D8YA 3HXMA 2YY6A 3C74A 1YIOA 1BH6A 1JI3A 3IEIA 4J4TA 4JLSA 4BFZA 3GLIB 4FDTA 4A2QA 2ZB4A 4JYZA 5LUBA 1FSFA 3C1UA 4ND8B 4CL2A 3VKGA 1IJFA 1IPHA 3BD6A 3CZMA 3NC4A 4J6FA 3QYFA 2DT8A 1GQYA 3KTFA 4QQ8A 1R6VA 2JH9A 1DAMA 4IG4A 1PIWA 3GGSA 2C9YA 4REQB 1L4LA 2VDQB 3BMNA 3E7PA 2ZGVA 1H2RS 2GAAA 2BRUA 3OIWA 1DFHA 3VYVA 5C18A 2FCAA 3CMMA 2WILA 5IAAA 4JLJA 4HPXB 3RABA 1BJKA 5CFOA 1FFBA 1CJTC 1CNEA 1MU0A 1WDLA 2NV0A 2I78A 2Y9MB 3K8ZA 4HDAA 4PLGA 4QOEA 4UPVA 2VRCA 3H5RA 4BO4A 1KDVA 2BMEA 4RF4A 6CHYA 3ICQB 3DJYA 5TGTA 5CYOA 1R8JA 1PR5A 4MW5A 2UDPA 3OM1A 1ULBA 2NU8B 5HZGA 4F60A 3STTA 4BQRA 5LDGA 2Q1XA 1NN3A 3L6BA 3RRJA 3SS7X 2PANA 2BGWA 1RPJA 4XRGA 1NAHA 5CEFA 3I2YX 4NZMA 4Q37A 4PYJA 4P81A 3MIIA 1E2MA 3FZNA 3CRVA 4RVSA 5E0KB 4JZYA 4CKCA 4FB5A 1R0XA 2CLKB 4G4GA 4HFNA 4MH0R 1IH8A 1LS1A 2GYUA 4LBVA 1S8FA 5LMCA 3WMGA 2YCBA 3NYQA 4DARA 1Z0IA 1XEWX 1COZA 2VN8A 2IIVA 3O0DA 4ZAFA 1X7DA 5BV1A 2IGBA 4ZOEA 1YJCA 5TS2A 5CT8A 3IEVA 4ZN6A 5DM1A 2QQ0A 3KV3O 1L4NA 3EB9A 4IKEA 5GOZA 2BZGA 4BP9A 5B55A 2Q8NA 1PEDA 1RKXA 2NM0A 3F71A 3OUZA 2BFOA 4LVNA 4B82A 1R3DA 5BQXA 4FN5A 1KK0A 3R7BA 1XFAA 4TL9A 5EJ8A 1N6IA 2F3PA 1T5TA 3O03A 4H6PA 4KKXB 2PGDA 4K1LA 4MICA 5COQA 4YRZA 4IDFA 4A16A 4XCQA 2A78A 4N54A 2WWGA 3K72B 5KTYA 2YIMA 3WMXA 1Q1EA 2G88A 5SY6A 3IEPA 3KALA 4DM7A 2DRIA 1GGMA 3C3BA 4BGEA 5K8IA 3CVJA 4BE9A 2OP0A 4HGOA 4IOJA 1W5TA 4NMWA 4ENSA 2P6PA 4NV1A 2G7MC 8AT1A 3H13A 4L0DA 3D3KA 1T2DA 2IU4A 2QR5A 4HQ0A 3TLYA 1E92A 5EIBD 1XXHA 5JAPA 1BG6A 3HV0A 3NV7A 3OMWA 4EVQA 3QVJA 3X1JA 5CXUA 1OH8A 4AL4A 5ILGA 1G6OA 4BLVA 1OX6A 1XQ1A 4QFMA 3T34A 2O06A 4BP8A 4XWWA 3VR4H 4HAWA 2CWWA 3A0UA 2H4WA 4MR7B 2ODBA 2VP4A 1T8YA 1GNTA 3CLVA 2CLLB 4BX2A 3FNFA 3QKUA 2BFCA 4HEA6 2PSDA 3L05A 3MJEA 4MEAA 1LBSA 4MIOA 1GZUA 1XVLA 4GLBA 4OYLA 3KV1A 1QQAA 1W4ZA 5I9NA 2FQ1A 3PXXA 2JVJA 3KSRA 3SXUB 1Q57A 2FR8A 3N3BC 1C9EA 2GXUA 2WWHA 4JS0A 3PNSA 1HNXB 2AN9A 5FO1A 3P5BA 1F5NA 1N5KA 1QNLA 2YWGA 3FRJA 1C1YA 1MC5A 2EZTA 1J0BA 2BLNA 2QAIA 1G2PA 1L7AA 3DB1A 2Z2IA 4DLYA 3S5UA 1FRQA 3PDIB 4HNVA 1V16A 4D8UA 5DHSA 3W4IA 3E9EA 2YHIB 4EFMA 2GJSA 1IN7A 4HC4A 4GP6A 3TS1A 2H07A 2P30A 1UXGA 3G0CA 1IB6A 1M83A 2WTAA 5EWJB 2ZTUA 5BSEA 4WK0B 2XQKA 1HG0A 3ZGLA 1NJ5A 3ZLUA 3DMTC 1S2LA 2ZW9A 1ZW1A 4FT2A 4MYCA 5E8JA 4C7OA 2FUNB 4HAIA 3CLSC 3TTWA 1V71A 4DJEC 1C9DB 2I4OA 1WMEA 1E77A 1QO9A 2XWJI 3LW8A 3AF6A 5JHGB 1KO8A 4UUMA 3Q3HA 1GL6A 3C0KA 4I2NA 4LRQA 3RH0A 3KPJA 4MYRA 1E2PA 1N57A 4E2YA 1NN5A 4JU8A 1R4NB 3SR4A 5EMHA 3G3EA 2D1RA 2O7RA 3DNFA 3BTVA 1P0CA 2V8OA 1GXSB 1ST2A 5H0IA 1XNJA 1KPGA 1E2LA 4RPKA 2FN7A 3OCVA 1K1EA 3TJRA 4XUEA 3VVCA 1VSQA 1YASA 3H2JA 4YK7A 2VTBB 4OA8A 2FF5A 4XE5A 3VKHA 3QU7A 3IDZA 4UPDA 3VNRA 4CFZA 3IHLA 3JR7A 4H0NA 1T36B 3SYNA 5JD4A 2FK7A 4MV8A 2MYUA 1I7LA 1THMA 3DVAB 4UJ3A 4DCJA 5G4KA 5EEGA 5JAHA 4DV2B 3AVXA 2WUFA 3ABOB 4AY3A 1KTIA 1D4ZA 1VJGA 2GASA 5KVCA 4PZEA 2W4QA 1XZLA 5I45A 2NX2A 3C3AA 2O2XA 4YO7A 5FPSA 3FMOB 3KKKA 4FR5A 4E51A 2FPXA 1Y6FA 4JUCA 4NCJA 4A8JA 1MO2A 2QLLA 2E18A 3PQ4A 3DEIA 3UWDA 1A0OA 3FCAA 5LBTA 1I01A 3QVWA 1P7YA 4N48A 1NR7A 1ZIOA 1BDBA 3O6VA 4HDKB 4MQEB 1SC4A 1FDSA 3MTJA 1PKXA 3FNBA 5EHGA 3FVVA 2VF2A 5GADl 2GR9A 3VX3A 3VJMA 3SPXA 2CNDA 3N6RA 3QTBA 2Q3DA 4U1RA 1KH3A 4HSEA 5EE9A 1XJ5A 4C6HA 2QBYA 3AEQB 4G0OA 2J87A 4AG6A 4F06A 3UMYA 2WOJA 2G9UA 3I53A 1O95C 2YFHA 5JVDA 3OCJA 2F90A 3A4VA 4KIFA 3TCXB 2QUKA 3U13A 4YP7A 3CWQA 2VJNA 3WWYA 4YACA 1OZHA 4I81A 3L82B 5FTMA 4FHGA 4PQGA 1Y1RA 3C39A 1WCXA 3D02A 3QEOA 5HS6A 4GP7A 3VDRA 2HJSA 1WF6A 4GECA 4ZV9A 1U8CB 4JASB 5KHOC 4BB5A 2XGOA 4L8YA 4QHTA 4XWTA 1NVUQ 1QLHA 3SBEA 3JAMA 1F8GA 1VG0B 3NDRA 4MV0A 4ZAWA 3UZUA 1CDOA 3CG0A 2AFHE 3PFGA 4KR7A 1QYRA 1BJTA 1FLNA 2EKZA 4WXHA 2X7JA 1K98A 4ZT3A 1G7SA 4M3NA 2ZRNA 1GG8A 3CNNA 1SBZA 2NPOA 3O21A 4EJFA 5A7FA 4JI3B 1JLKA 1PWZA 3KEOA 4Q24A 1E9VA 5IJ9A 5L95A 4BZZA 2H7YA 3R3VA 3L9WA 1T6XA 4RVHA 4FQ8A 1QYIA 2WV7A 2JA1A 2P27A 3N87A 3QXJA 5FFNA 5IZCC 4J0JA 5B3JC 3OT5A 4G1VA 4MIKA 1PNRA 2XVAA 3RJ9A 4N3NA 3VR3D 2RGUA 4G5XA 2IWHA 1FFXB 1WR8A 4AUKA 1Y34E 2EDAA 4O4HF 3AI3A 2H48A 5CH8A 3BD8A 1ZJJA 2H11A 3A3YA 4EA6A 1KQPA 1XTSA 3SKXA 4EA8A 1ICEA 5J2UB 3Q6NA 3RS2A 4DDHA 3UVEA 1ZMBA 1ZUNB 2R7MA 2R86A 4HDSB 4LGVA 2FFRA 4LE1A 1EXVA 4M49A 3N1UA 1R8YA 2VAWA 3ROPA 4DM4A 5IFKA 3AM4A 2IHYA 3HP1A 4HL6A 5CIYA 4DY4A 3HUDA 3RSQA 4KXMA 3CF6R 1ZNYA 3T7CA 1GUBA 3UY4A 3H0KA 4YDSA 3T7AA 2C7OA 5DSTA 2OM6A 3NNNA 3RWMB 3TG8A 2XBLA 2B1QA 5TR9A 3AFHA 3HB1A 4YWJA 3NKVA 4I5IA 3U3ZA 4HR7A 4BIMA 5INTA 5LM3A 3ZKWA 3FHOA 2WU8A 5LXTA 3TYXA 1YHNA 3BB4A 4FZ3A 4OTZA 4YXWD 1UK8A 2XSZD 3QKIA 1C30B 4WLVA 1L4GA 1M5UA 4AWXA 4F4CA 3PXUA 2O8EB 4I99A 3RSOA 2XQFA 3W2GA 4ZO8A 4NRDA 1XTJA 3BG5A 2QI9C 5HCIA 1K08A 4TKUA 2CHFA 2YR0A 5K0EA 2FX5A 1KZ1A 4RYLA 3UICA 3HCRA 2CHVA 3PGLA 3WDSA 2NYUA 1E3MA 5J63A 2EFJA 3PNMA 3HA2A 1KOLA 3OI7A 3BBLA 4U2FA 3PYLA 4WFIA 1Y8QB 3LC2O 2YFYA 3UV3A 3WKAA 4OBEA 4RHTA 4DLKA 4K6CA 1UAAA 1JJIA 4ITVA 3DOIA 1Q83A 1XNHA 3I9FA 1JSXA 4N5HX 5GY7A 2ERYA 4EGCB 3G2KA 1WMFA 3V1NA 3O7WA 3J81k 2LDXA 4CM9A 1E1NA 4NZ9A 2Y76A 3JYNA 5JMPA 5EY5B 1HE2A 4IQ4A 3GVIA 5TC4A 4PTLA 4IDPA 2AFVA 4X65B 4H27A 1MAVA 3CINA 1GZVA 2WF6A 3MWEA 2VZEA 1K3FA 4F91B 4X93A 3E3NA 4AJPA 4D0NA 1NF2A 3LX6A 1WCIA 4FZ5A 3V7YA 3B70A 4YLEA 4Y2HA 3C6QA 3USES 4JI5B 3E2MA 4HWRA 1MV5A 1P3JA 4A5SA 2P5TB 4PAQA 1PEKE 3RAJA 3R3HA 4OFWA 1T25A 1XYYA 4DYDA 1R4MA 1SELA 4I4IA 4MITA 4ZC1A 1XQWA 2XMQA 4UM9B 4ZGWA 2CLDX 3S2FA 1AQNA 5TVGA 5HF6A 1Z74A 4QPCA 3ITNA 1NVXQ 4TSRA 5U9CA 4QBGB 5I7WA 1ZVJA 1EUQA 2OAEA 3PPIA 2FWNA 3M4JA 4D7AA 2WB2A 1E9EA 4RXTA 3VC1A 1Q20A 3AF3A 2M6SA 5MHTA 1TIKA 2NQ2C 5TT1A 2RGRA 2NYVA 4KSBA 1KHTA 1J39A 1EVIA 3TW8B 3HQ4O 5JS7A 1U9CA 3MILA 3ZD7A 4AMZA 2ICAA 1E1KA 2JLRA 2OG2A 3TM5A 3U3XA 4OXNA 2FA9A 4EEXA 3HYTA 1QIJA 5A3SA 3QKRA 1YI8A 1ZZGA 2E4XA 5D87A 1BYUA 4DDWA 5C7OO 1V96A 5KCZA 2J09A 1ONPA 2GN4A 2PWPA 3ZEIA 3WB1A 2JK1A 4FLEA 1WMBA 2YNMC 3SC3A 3D6UA 3QFFA 1DGQA 1ODFA 3RSLA 5E1MA 3PXDA 3MGBA 1MFPA 3MG9A 4Q3LA 4ARVA 1R18A 3SMQA 2ZRQA 5AJTA 3B5JA 1XQVA 2G9RA 2NSJA 1M6VA 5JJBA 1ZHHA 3GJYA 3JQPA 3FPFA 5EXXA 3BOSA 1KU6A 1MQAA 1L5SA 4Z53A 3HB7A 2BGMA 2WTNA 3H5LA 2HU2A 3TI9A 1VIYA 5DNYB 5H7XA 4ZHQB 1G8JA 4EIWA 5T4EA 1M6YA 3OIVA 5EIOA 1GAEO 2VYCA 2WFLA 3VPBA 4PZLA 2GRAA 4BXOB 4GX5A 4Q9LA 4L57A 1KOJA 3EMVA 2JHPA 3P20A 4NKRA 4CN9A 2B1IA 4UVEA 4BO5A 3UJ9A 2WWFA 4PLYA 2DY1A 5JNRA 1YQGA 2NQTA 3C97A 2BKXA 4R8MA 2ZZKA 1X7YA 5KVQA 2QGFA 7AT1A 1SKYE 3CUYA 5KNCA 2ZPTX 2ZPUA 4N12A 3ROMA 3GA0A 5AOAA 2HF2A 4YQFA 5CB6A 1UAGA 5FOVA 2HLDD 2ENWA 1SVIA 3VNSA 3R4CA 1N0IA 2C20A 1EBUA 4A26A 4HLUA 1CEQA 3CVXA 2REQA 4ZI7A 1LDYA 1VBNA 1XFDA 2J9XB 4YAFA 4BGDA 5KPDA 2EAUA 1P74A 1NZDA 3EN0A 1KE2A 3ZQKA 2XNKA 2XTZA 3EXHA 1TUGA 1POXA 4G85A 5CMLA 2ZQ5A 5HX7A 1BCRA 4GPBA 4IKPA 5EHZA 1SIUA 2JI6A 5IAGA 4JI8B 4FMBB 1TAUA 2DLCX 2OXEA 2P77A 1RT9A 5L7YA 3KETA 4PYOA 3EAQA 2YW2A 4MB2A 4MR9B 4Q4DA 3BSFA 3IIJA 3IQHX 4YROA 1Z36A 2H3EA 3UAXA 1PJ4A 4L9AA 4LJLA 4MYUA 2WMDA 3SE0A 3UAZA 5ICFA 3C2QA 1E3EA 4IJWA 1CV2A 2YUTA 3AXTA 4WBNF 1DG3A 3GZ4A 2Y6UA 3OHMA 4MVJD 5LNK6 1CFZA 4TV8F 2ZUCA 4AFNA 1C80A 2WJ6A 4F71A 5B2EA 1J7KA 2VAXA 4DMMA 3DF7A 2AS0A 2GF0A 4IZIA 2ZSIA 4JGIA 3EPPA 3SQMA 3LX4A 2CCJA 5TPZD 4QDJA 4FOSA 4EPVA 2BFFA 3L6OO 3IL2A 1EHCA 2CFRA 4IQ0A 5KYVA 5KIAA 3JQQA 1NF9A 3VV3A 2ZWVA 3AUKA 3KQSA 1RIIA 2WAOA 4GSYA 2OVBA 4QDTA 4UDOA 5KSPA 4XWYA 3T54A 3W6NA 1PGJA 4C20A 3TRFA 3CKMA 4F04A 5ITZB 2WYIA 2C5HA 3QUQA 1C4KA 1HTTA 1EEHA 3AINA 3PF8A 5CRIA 2POCA 1ZONA 1VE6A 2GSDA 3VBEA 5LQUA 4LZZA 5D51S 4YJKA 3D5QA 1T9CA 4V0ME 4M1EA 3T1QA 1WV0A 2I54A 2WFZA 2X42A 3O8DA 4YV1A 5JMTA 1BCSA 3H0EA 4G5HA 3DT9A 3GRFA 2D7JA 3QVUA 1T6NA 1LF5A 3CONA 5T8KA 5JADA 5AHWA 3HGTA 3PEWA 3E1GA 3ZK9A 3MJ4A 3Q5DA 3CH6A 5EIBC 4EHDA 1N6KA 1A9ZA 3IVCA 3WSTA 2XWSA 4QXPA 5KOJA 3QY9A 2HCRA 3GNSA 1WX1A 2D5AA 2IYVA 2C5AA 2J85A 2OK7A 3GJ5A 5AK4A 5B1HA 4HUTA 5LOVF 4GYWA 2WM2A 1E3JA 4GR5A 2NUPB 4TX1A 1TD9A 5EJ5A 5EIWA 4JBLA 4X64B 3ZLVA 3B1JA 1XI2A 4MVJE 2XWBF 1H9CA 4K05A 3A6KA 3DV0B 3EVDA 5KX5F 2DFPA 1EK5A 1R6XA 3A36A 1O4VA 3DMNA 2FDCA 1RHQA 2X4DA 2XA1A 3KVOA 3C3PA 4ZJPA 1DAEA 1DFIA 2A0KA 1GPWB 3F6PA 4N40A 4V39A 2OCKA 3WOVA 5B2ZA 2YV5A 5JSZB 4Y2UA 4KXXA 2QM0A 1T5HX 2E4VA 4XIIA 4I4LA 3RIEA 1L8QA 4BLPA 4P7JA 2FPPB 3TBFA 5FIUA 3NDJA 4QTZA 2D5CA 3HUFA 4N9WA 1NOJA 1Z0DA 1R88A 3ZWDA 4X9XA 5JAQA 2IUUA 1NY6A 3C6YA 3L7CA 5GAJA 4BO1A 1KI2A 4OLHA 3WJ7A 4EVSA 3I4CA 4YRKA 4ABYA 1SHTX 3RVSA 2Y71A 1UOOA 4FGSA 2QJTA 2XOEA 3HH8A 1ZNZA 2CJWB 2XA9A 4E2ZA 4YJ2F 3W90A 4DBZA 3F8WA 3K5PA 4LOLA 3L7JA 5AVTA 3EXIA 2PZGA 1MP0A 3A11A 1T9BA 4GPZA 4LC9A 1MXFA 1JR4A 1WSAA 3IP5A 3RSFA 4II7A 3T5TA 2CYAA 1JJVA 4HX5A 4AW9A 4F8JA 1OY1A 3USZA 1WMDA 3OE5A 4KXNA 3B7GA 4JLUA 3UCEA 4DSUA 2PKEA 1E8NA 4BKRA 1CUYA 1NULA 2AUMA 2JLCA 3FFBA 3GHHA 3MTIA 3R24A 2BGIA 4PZZA 4XYEA 5DB4A 3ZHVA 2VXOA 2ZITA 4DDVA 2QRVA 4O4JA 5J4YA 4Q9DA 1IDN1 1Y4DE 2OXCA 4BV2A 2Q27A 2Q2WA 3HEMA 1PX2A 5M5BA 3EQ8A 1JDPA 1IAQA 3TTTA 1DDIA 1FU4A 2EFEB 4OHYA 2NYRA 1H0HA 3EDYA 1FFEA 3EHEA 2HIHA 2VSOA 4OV6B 1KY3A 1GEGA 3G2OA 1GRNA 2JRLA 3KDAA 1P29A 5JCOA 5LZ5A 3DPSA 3Q87B 3VGPA 1KEEA 1BE6A 1MDFA 3OU7A 1ZW6A 3IDSA 4YR9A 5CXXA 4C6RA 5IKPA 4MVJH 3HDQA 4L7QA 4C04A 1YB1A 3X1WA 5CIQA 2PFSA 3IE2A 4WVFA 3HNOA 3AM5A 1VE7A 4J91A 3K2BA 1L6RA 1LZKA 1VIDA 2EX1A 3BZUA 1DCTA 2AEEA 4BGUA 2RB5A 2Q7OE 1JSRA 3PEEA 5CDYA 1JXQA 1WNTA 4F3RA 1NI4B 3VR2A 2HPVA 5H68A 3OQHA 4QAQA 5K3FA 4RSMA 3IEMA 1DKOA 3N2GA 4PSAA 3RFTA 4AXBA 4DQDA 1TM4E 4CFSA 4WXRA 4CCAA 1Z4LA 3MBIA 4HRVA 3ZGXA 2IUTA 4D9KA 4M60A 3ROXA 1HF3A 2PH1A 5IDYA 1DIGA 2AOTA 2JFQA 4YI5A 3SXPA 1HFJA 3C5HA 4FFOA 2EHDA 1K5DA 5H82A 3JQ6A 3M6WA 1UFRA 4NYJQ 5IKXA 3CSUA 3K20A 1C2TA 5HQ3B 1JWLA 3L6EA 4JJZA 4DLSA 4N49A 1NURA 2B2NA 4YCNA 1JDZA 4HGNA 4KE9A 3DG9A 3EZ9A 1L7PA 1C7ZA 2IYXA 3F5FA 4IIFA 4O1HA 5IVPA 4L8FA 5DLPA 4BZXA 3ONVA 5FUWA 1XE3A 4LAFA 1IOZA 1EESA 4LN1A 4KV9A 1FVHA 3NT2A 2BEUA 4E14A 4JP8A 1YIDA 4QGGA 2HF9A 1PD0A 5A4JA 1F6WA 1QG6A 1UM9A 2WHRA 2XB6A 3MJDA 4NC9A 5B5SA 1KOFA 3ND5A 2PSSA 4EAAA 3OZVA 1MVLA 2EW2A 4MP8A 3PQCA 5MGBA 4MI9A 3E4CA 4R98A 1LBQA 2ZRHA 3G79A 3A1FA 1KJ8A 4MQMA 5FUYA 4HCJA 1JLLB 1BXGB 5EEHA 5JD5A 3QI7A 4X8LA 1RZUA 5ED4A 3B3FA 4F5DA 1RYFA 1EHIA 3PQEA 2RHBA 2QSUA 2Y92A 4DLZA 4YJHB 4ZU6X 4Y1RA 2EIXA 3VC7A 4E31A 4CR6A 2OLJA 2WHYA 3ESCA 4KBGA 1N7HA 3W1WA 4ESHA 5CU7A 4CRWB 3TRJA 2JBAB 2X19A 3C5CA 2ZIEA 2EYQA 3GRVA 1U1FA 4EEZA 2O2YA 5BXYA 3FDJA 1JIKA 3C6XA 1ESDA 2FH5B 2IW3A 3N5CA 3RK4A 3WGKA 3KEFA 3ZCXA 4ZTUB 2VP5A 1JR3D 1T5IA 4K9OA 4QUAA 2XEXA 2Z43A 3MWKA 2RAFA 4BQIA 2EJBA 4DXDA 3I2KA 4LV8B 3I01M 1GG5A 1HDYA 1XOIA 4ADSG 4EABA 3FDZA 8GPBA 2HCJB 4E7PA 4BDSA 1CHNA 3F6RA 3E9QA 4XDZA 3BXOA 4LZJA 3V4SA 3R6WA 3SIWA 3ICEA 4UCXA 3DQQA 4QA9A 1DXQA 3U3DA 4DCSA 1UOQA 5LQNA 3BCUA 4W1PA 3ASUA 3LAWA 2HFKA 1DINA 1LFDB 1NRIA 1FU7A 2J7PA 4L9WA 2HJWA 4Y6OA 3SC2A 1GKIA 3HI4A 5ANRB 4ZANA 3R7SA 1U9YA 4Q3DA 1PV2A 1XROA 4QDKA 4LRWA 1SUFA 4YTEA 4BGVA 3QLJA 1C1DB 2PEZA 1DXOA 2A92A 1SD2A 2ZUWA 3CGGA 4UMVA 5EE0A 3SQWA 4DV4B 4AKGA 3S7ZA 3N2KA 4D9JA 2X6TA 5IF3A 3QW4B 4GR4A 5AW6A 2I80A 3C6KA 2WIGA 3BZBA 3TQQA 4R6WA 4OXQA 1I1NA 1TT5B 3GYBA 4R83A 1P2GA 1F0NA 1UANA 1Z4MA 4HO1X 2ORIA 4M0DA 5AUNB 1Y37A 1GARA 1JR3E 1P5ZB 4FKBA 1DUVG 3AKYA 5SY9A 1KO1A 2ZJ7A 1ZAYA 3I0MA 3TQRA 1NE7A 4KPYA 4CEJB 2X1MA 1K3UB 3K0EA 4C0AC 1WJGA 2VP2A 2QYOA 3N70A 4DSNA 3ZH2A 4UDYX 1UXJA 1H2HA 2O3JA 1CIJA 2WP8J 1OYYA 2V6JA 3DD5A 3QEMA 2ASEA 1OWPA 1YU9A 4KYVA 4LY9A 4Y0VA 3DE6X 3JD0A 4EO4A 5JBQA 3GVCA 3PPXA 1E94E 3ESBA 4H59A 4KO3S 4PRZA 1P72A 5C8YB 4LV5B 2DP4E 3GLVA 1UBKS 4NZZA 1LDNA 4ZEVA 2R1UA 2HT1A 1UZLA 3GRRA 4E08A 5BSUA 2O8FA 4MKIA 1UPUA 4EKEA 5JQWA 3QF4B 521PA 2K7ZA 4KDRA 3PQ5A 1AX9A 1QZ3A 1MA0A 3LBYA 1QQTA 3M33A 1CR0A 4Y0NA 5CX4A 3X1KA 3ZCQA 5LP6B 2I6TA 1A9XA 1FVFA 1R5BA 1E1MA 2VZ0A 3SSNA 3IUYA 1E5DA 4OHZA 5AM3A 3PITA 1NUSA 5KKCA 1G6KA 1WVMA 4XQ9A 1SUAA 4H1TA 4WHMA 2Q5QA 4OY3A 4GMDA 4YAWA 3ICVA 2ISSD 1RQ7A 4CV0A 5BV2P 1NJFA 2CVOA 2ZATA 5EXSA 5IJ0A 1J21A 3IO3A 2HBRA 1PJRA 1KH2A 1Y8CA 4LG1A 1JVSA 3JWEA 4RK5A 3W9BA 1XZKA 2AFRA 1A5ZA 1XALA 1NP6A 5DWQA 5I4KA 2IHTA 5CPBA 4TLBA 1Z17A 1JEOA 3T4EA 3V42A 2C83A 3U7RA 4WV3A 4ZOAA 2P2ZA 4DR1B 2EKBA 2C77A 4YPFA 5J59A 1JILA 2X76A 3M6AA 4CM4A 4EHAA 2WM3A 3SHWA 2AFIB 2YOHA 4N01A 4U63A 4UU8A 4Q82A 3DHEA 4N8EA 2AD1A 2Q45A 4RKRA 1IBKB 1OAOA 2BHTA 1IWOA 5DXAA 2GBLA 1VHWA 4BEBA 3B3JA 3BHNA 4R9RA 1IEWA 1Z0UA 3K6SB 2KQUA 4HOYA 1HI9A 4PAGA 2PX8A 4BFTA 5E3HA 1Z5ZA 2VDWA 3VPAA 2TYSB 2WC1A 2LCQA 4IHKA 1J49A 4JUAA 2BGRA 2DOKA 3MS4A 4YDHB 2R65A 1UBOS 2MSWA 3JCZA 3HCPA 1DUIA 1H8EA 2DUWA 3UATA 5CJ2A 4FILA 3JS5A 2Q2QA 1U81A 2DQ4A 3I32A 2FW8A 5L3VA 4LHEA 1ESNA 5L8VA 2VPZA 4M89A 2HNKA 3AP1A 1UL1X 1TAGA 3LLUA 5EPEA 2C7QA 1ZXXA 2Z6UA 4D74A 2I4RA 3H1GA 2B0CA 3G85A 4UUPA 5JDCA 2ZSEA 1VCOA 4BX0A 4IMPA 4PWYA 4N6NA 2WWRA 4QUHA 2QMEA 4UZFA 1U0NA 5FQOA 3WADA 1L7XA 1I4LD 2Q1SA 4AY2A 3UCFA 1O08A 2UV8A 2HQRA 2ZRMA 4PLCA 2FW7A 4WECA 1PEYA 1HXHA 1P17A 4AMGA 1YE5A 3JTEA 5JXHA 3T9AA 2CE7A 2B2XA 1V9LA 1UBHS 5YASA 1GZ3A 1W85B 3P2IA 1PNTA 1VYTA 3HBMA 1XDDA 1BMQA 5KWIA 1H2BA 1PFKA 1AHNA 1UEXC 2UUOA 3V1YA 4QZVA 5A06A 4PPNA 3BL6A 3F2VA 4B74A 2YFKA 4HN4B 2WNIA 3U0BA 1P60A 1ATZA 5KNDD 2OG1A 3LK6A 4U2KA 4F97A 1BSVA 3W2TA 1PJCA 3TIIA 3B3GA 3P0HA 3COZA 4EGFA 2G36A 1MAAA 3HS3A 4PRKA 3ZE9A 3PKJA 4NBWA 2B92A 3R0XA 3HN7A 3AM3A 4NATA 1G18A 2ODWA 2CF6A 5FYQA 1OFVA 1W4AA 4F2WA 2FXVA 4GI5A 2OBXA 4TKZA 1U0GA 4B76A 1J9ZA 1O4WA 3THOA 2BEVB 5JBIA 1YZKA 1SK9A 1ISGA 3P4XA 4F5ZA 4IEFB 4AIRA 3OQ6A 3D9QX 1JUDA 1IHYA 2AI2A 2V7EA 3P7MA 5ALUA 1K7SN 1ELOA 2C7RA 1MIHA 4L51A 2PUJA 1X9IA 2K2QB 1L4MA 4J2OA 3G9QA 4HDRB 4JBIA 4REOA 5DXFA 4BNWA 5BR1A 1OWMA 2FSGA 3Q8WA 5AW2A 3U4IA 3U39A 3ZNOA 1KS2A 3GQBB 4CKBB 1VECA 1B0PA 1WB4A 3E48A 2HU8A 2C7PA 3I04A 2HMUA 4V24A 1RJWA 1F1JA 1W6UA 1NATA 2VRBA 4QECA 1QYDA 3HP4A 3QEAZ 3H75A 2YV2A 4F9EA 2ZIWB 1KBQA 1S5PA 2J9YB 4K9SA 4QGAA 4B2PA 2GDZA 3NH9A 1T2AA 5BVGA 4MO2A 5DBGA 1TM2A 3T7RA 2VNAA 1XXLA 5F2KA 3TQHA 4ALNA 1EKXA 1TLLA 3N3AC 3RWBA 5KC8A 1FPMA 3IBYA 5DGCA 2EKLA 3A06A 3H9UA 4MW4A 2Q1WA 2XOKA 2YDYA 4HDCA 2K6GA 3L07A 4JJGA 1EG7A 2BDUA 1SD5A 2W58A 4KMOA 5JE8A 4ALKA 1QH1A 1TVKB 3HVKA 3GJ3A 4ZEWA 4GVLA 1Q74A 1N5MA 2VNIA 4HNAA 1ESMA 2YWJA 3H05A 2HLPA 1W6RA 2ZRGA 4J1QA 5EQJB 1RI1A 4FGUA 1YGPA 1HURA 2X8WA 3GUYA 4IRXA 5HE8A 4R2KA 2Z8XA 5TARA 3U16A 1SA0B 1TKAA 1Z26A 2Z98A 3FLEA 3THXA 1TKCA 2WUWE 3ONNA 1QZZA 4RGBA 1W44A 5B7GA 2ZUEA 3ZHRA 4B3RB 1ZXLA 3AH8A 2IHKA 4ILKA 2J32A 1OBVA 3QVKA 4GM1A 4NZOA 1GTMA 2Q3MA 3EDRA 1DSSG 2AFHB 2W5UA 4M1MA 1XRJA 2ANBA 3LDFA 3F1LA 2C5LA 2D74A 4QXOA 4EY5A 2BZSA 4F12A 5K8LA 1NN1A 1NYLA 2GCOB 3JARA 4ZAXA 3WK5A 4E2XA 2KW5A 5F4ZA 3ANMA 3T5GA 3CH5A 3ZCRA 1HLFA 4NI5A 4RIGA 4Z4EA 4WUVA 3GK3A 4ANFA 4HLDA 1D2HA 1VIAA 3VR0A 1Z13A 3ND6A 5KMGA 2NGRA 3NTVA 4MVJP 1B15A 4ZJZA 1G66A 1QH9A 2IHVA 1L4YA 3GPBA 3KVRA 3H2HA 5CT9A 1XZIA 3IJPA 1CUUA 2D2IA 1PLKA 3KJXA 4CWAA 3PXBA 4RPCA 1JQAA 3LMKA 2SHKA 3UYKA 2PWYA 3PZRA 3ETDA 3PR1A 4BLSA 1CKEA 2PVPA 4JGBA 4R2XA 1E98A 2ASVA 2XKJE 3ZNQA 1CIVA 4U9UA 4ZCMA 1XF9A 4I1UA 4FP9A 3R8CA 4FW8A 2YXPX 3X3HA 4ESOA 2OFFA 4UTPA 3SICE 3EPRA 1Z7YA 4Y9SA 1ZN8A 2JGLA 4DBVO 2F2TA 4KC0A 1N6NA 4EHJA 3H5IA 2X0EA 3JQBA 2AK3A 1QFZA 4CG1A 5EUQB 2Y9PB 1IK6A 4YJ3A 1IXYA 1EIWA 4S05A 5HBGA 7REQB 1N9KA 1E79A 3B9PA 5KNDH 3OM9A 3UTCA 1N2SA 1RWBA 1SUIA 1OLUA 4J3NA 4DAOA 4X3PA 1SY7A 5BR7A 4MMXB 5I48A 4XPIB 5EJEA 2NAPA 3WQRA 1XP8A 2XQVA 1JAIA 1KYYA 1UXOA 2FQWA 3DS8A 1MJHA 1H23A 3E2IA 1NVWQ 3II6X 5A7HA 2A88A 1QGOA 3G2NA 4JJKA 1XZDA 3SE7A 4TZKA 2FSSA 5CFRA 5F2NA 2PKCA 3ZPXA 5L45A 4MV7A 1I10A 3COSA 1FDVA 3QELB 1K5HA 1G5IA 5KJ6A 4M1KA 2H5IA 4DV3B 3B5IA 3FYUB 4B2LA 4UULA 4HNUA 4EP1A 1JSZA 3Q10A 5ALOA 3ORRA 4K81B 3AXSA 4KR2A 2Q6IA 2W43A 1FW6A 3GEDA 5C53B 3ESQA 2GZ1A 4HSGA 3VSDA 3GJQA 2PL9A 3JYOA 1ZD8A 3H6KA 2R5WA 3BPSA 3HKBB 3F97A 4DR3B 1A9YA 1B7GO 3SEZA 3F1KA 3LHFA 3C6MA 1JIIA 3JW8A 1F9EA 1ACMA 1QS0A 1GPUA 4V3BA 1HA3A 1RCUA 2ST1A 3SHOA 1HY3A 2BDEA 3S2GA 4KNWA 2BFNA 5ESWA 1SOAA 3PNBA 3UMSA 1MW9X 5FX2A 3EEBA 3JATB 1E6WA 5IT5A 1OV4A 1M5TA 5NLLA 3RS9A 3CVUA 1Q7CA 1T4CA 2R3SA 1Q1BA 2REOA 3AESB 3H1AA 1Q5PA 5KPJA 1ULHA 3CXRA 4B3IA 3UXMA 5SY4A 3IT2A 1E0AA 4IRUB 5ELXA 4KGZA 1ISRA 4KN6A 1ZH6A 2C9ZA 1OSNA 1UJ5A 2X9QA 3FETA 4F84A 4DR6B 4X8OA 2QLMA 1MJGA 2OHGA 2YJ4A 3DEZA 3AHFA 3D8NA 3FWYA 5AESA 3IKVA 3JQFA 3U44A 2CB0A 1YJ5A 4YP9A 4HB2A 2LGJA 1G2QA 4L8GA 4PCAA 2BUCA 4WY5A 1T3HA 4DIFA 2I7TA 1KH1A 3IS3A 5ALRA 1QTQA 3NW9A 3K4HA 2GPTA 4QT0A 3JQGB 4JBWA 1NUTA 4TTJA 1AD2A 2EL9A 3L4SO 1J0DA 4HUJA 1V7ZA 2QLBA 1QIGA 3O92A 3EGXA 4J2HA 4KRGA 2TMDA 5TPWA 2GK7A 4TTRA 5AKEA 2H1SA 1VJDA 2JGDB 1XT6A 1HDXA 2WE8A 3CA8A 3KOOA 2AZTA 3OZGA 4OJYA 3E9YA 2QLFA 8MHTA 2WYUA 3EZ7A 2E37A 3BJMA 1QV7A 1D07A 4FYYA 2XUAA 1UKCA 2FG6C 3H99A 3I1JA 1MC1A 2GZMA 4Q4AB 5IABA 2XKBA 2Q7XA 1W88A 2YBDA 5K0TA 1UBFA 4RADA 3C8UA 3UAYA 5LWQA 4KXLA 2OZVA 1T1SA 4DZZA 3IFSA 1RAEA 1IU9A 4RW0A 4AZ0A 3CEHA 3TX6A 1VLZA 3AEYA 1GFIA 4Y2XA 1JG6A 3EH2A 4PYQA 3RTBA 4DNFA 1LPPA 4CKZA 3B8HA 3CB4A 4X90A 2V8BA 4C78A 4BJHB 1WNFA 2AXPA 3PLNA 3ZCVA 3G0IA 5JSYA 5T5QA 4UNNA 4IGAA 2GPNA 4ZK2A 4DA4A 2VJAA 2WUEA 1VTKA 1EP9A 3LHDA 4QARA 4RKFA 4V03A 2LW7A 1P19A 3TSAA 4RLSA 3KZKA 4WKGA 1NONA 4CEIB 5IBCA 5IDVA 3EIWA 4GLFA 1IBLB 2XUHA 1IULA 1THZA 4HAOA 4FE3A 1WO8A 3FWHA 4IIJF 5BOSB 4ZARA 5ITSA 2B8JA 4D3DA 3V7FA 2PO5A 4CKEA 2GLTA 5HKKA 1A1VA 1ZD4A 1QZUA 1JQKA 3SF0A 5EERA 2ATVA 1NX6A 1HOXA 3TLGB 2IS1A 4YQZA 2YJ5A 3LQ2A 5E9JA 1RRGA 2NO9A 4YPOA 4IQ8A 2FE4A 1E1RD 5CX1B 2QORA 4B3BA 3DE3X 4MAAA 4AECA 4DCCA 1ODSA 4XEUA 1AUVA 2EQAA 4WXMA 5F76A 4RTRA 1Q0ZA 2XCRB 2HL6A 3ZU5A 4YEDA 4B4UA 3AHGA 1MIOB 2GK3A 3SP1A 4CVNA 2CWDA 2QL9A 2I6GA 3GLHE 3CX3A 3EIUA 2Q4DA 4WJKB 1DBVO 1M67A 1LRLA 3IQXA 1K7CA 4HVCA 3KKNA 3AR9A 1CQIB 3IQDB 3TLCA 1YJ8A 4I3FA 4Q3BA 4UTZA 2V3CC 4AJOA 1CVLA 1R6DA 1E9RA 3DHYA 2RIPA 1GNPA 2QSZA 3HC7A 1OD6A 2IHUA 2YQZA 3A1EA 4XWAA 1ZP6A 4WWHA 5JH7B 3O74A 2HV8A 3F9IA 2XUGA 1DRWA 2PD3A 1RPNA 2Q46A 4YQYA 4WEOA 2D3TA 3S55A 3TG2A 2IXGA 4DREA 4LJ6A 4A6XA 1O5IA 3E8XA 1VMEA 5FFMA 3T9CA 3UIEA 3W5SA 4KNVA 3EQ7A 4R5MA 5C80A 1YKFA 2NP6A 1N2IA 3TGLA 2W2LD 2IL1A 2W6PA 1OGJA 4QYWA 2PPLA 5CT6A 3DFFA 5C31A 1X94A 3EC2A 3SZRA 3K30A 4OQQA 1UAYA 4C1NA 4W9NC 4WN9B 5IDQA 1TTTA 1V43A 3FCCA 3P0EA 2FUG6 5KTMA 1FF9A 1QGUA 1OA1A 1SBCA 1X92A 1M2HA 1ZY2A 1C41A 2BSXA 2FZLA 5JAIA 1IM5A 4Y18A 1FSSA 4RTMA 2JLWA 3AMVA 2EATA 1YO6A 4CV3A 1R6TA 4J16C 4MV1A 1H4QA 3CLKA 3DQZA 4DIBA 4DIKA 3K70D 3IAM1 1ULZA 3LCUA 2E5FA 3NBUA 3SJUA 1E32A 4KO8A 1OASA 3KKZA 5BN4B 4KQGA 3SLGA 2IIBA 2E89A 3LXMA 4GW3A 5CK5A 1YQDA 4C0JA 1XBTA 3GG9A 4D26A 2APJA 5JV5A 1CZOA 4AICA 1N34B 3AB7A 1MTOA 3GVXA 4UE2A 1IHOA 3F5QA 1EFCA 2P3LA 2R87A 3RUEA 3AYZB 3PUHA 2VT2A 3H65A 3M2PA 1E99A 1KI8A 1V6AA 2ZLBA 1N7IA 2CKDA 4JSTA 4UTXA 1QONA 4MWCA 3R7AA 2FFHA 2OBNA 2J9FB 1CRLA 1QDLB 4D79A 4ZVUA 3DDOA 2MINB 4ZXFA 4D9EA 5I8WA 1H9AA 2DZDA 1RLIA 1OFTA 3U49A 4L4RA 4KVAA 3RUPA 1OXVA 4Z4HA 1JEEA 1KI4A 1XJCA 2EFCB 2MHCA 3H1FA 4YECA 3HJRA 3I12A 5FTKA 3VR1A 5KB3A 4GS5A 4PQEA 4E11A 3ECCA 4KO2S 4L2IA 2D5BA 1Y7IA 4M1ZA 1J2RA 1AQ6A 3GNTA 3CX4A 1H05A 4LHWA 5GJBA 4CEHA 1O6GA 3VMFA 2X5JO 4ARAA 3K16A 5F2OA 1JEAA 2AUNA 3T5CA 6ADHA 2HJHA 3RD5A 1G16A 5HA5A 3RFVA 4PO1A 3PD1A 4EGJA 3GLIA 3E27A 2VTDA 2VRCD 5TJ9A 4B8WA 4ND8A 1FUKA 4D5EA 2CHQA 1GRRA 4J4BA 2A33A 1V7QA 1XTZA 2A86A 2Y68A 3OJCA 4ZV7A 1M8GA 3EBLA 2IYFA 2QZZA 2IY7A 1U2GA 2C61A 2DC1A 2JJMA 4H17A 3QFRA 4DOMA 3RM3A 4REQA 4EHBA 1GQOA 5D5QA 2ZJ1A 3K9NA 1KZ7B 3D4PA 2HJGA 4DEYA 3WRXA 1SRRA 1IYZA 1X74A 5LVAA 2YHBA 4QGBA 5F7JA 1TA0A 1DI0A 1TTQB 4IIBA 5BOVA 3QXGA 1HQDA 1Q7TA 1TYZA 1E3TA 2R2GA 5EHIA 2H1OA 2V1UA 3KT3A 4UJ5A 1XWWA 4C0XA 4DDMA 1GQRA 4MV3A 4E0BA 4PO3X 2ETXA 4BEWA 1JJ7A 4BTVA 5ALVA 1U8EA 2GM3A 4M1TA 3RRFA 2MJLA 3EWIA 3JTMA 4UEKA 4A03A 5AHOA 2P5YA 5K0CA 4PTZA 2JZCA 1EVZA 2EWWA 2M6RA 4WJZA 4BNTA 2PR2A 3Q41A 2R1ZA 3BIWA 3ENVA 4MPDA 4Y2SA 3KZXA 2VHCA 4FPXA 5EJFA 2NU8A 3RSHA 2ODAA 2A1TS 1SZDA 4GGOA 2BVNA 5KTNA 4JIGA 1VJ5A 3FPSA 3MTEA 2DULA 2H1RA 3IYLW 3ROZA 1Z5WA 5ICGA 4Z3OA 1UXIA 4E09A 1TUEA 4E6EA 5H3CA 4OLJA 2D4AA 2ID8A 1TTPB 3HFGA 4TKVB 3ZE1B 2O7SA 3A7EA 3ER6A 3VU0A 2YVAA 4N6OA 4LRUA 4FOLA 2NSLA 4I55F 1S3IA 4RVCA 2QA5A 3ZU3A 3IPRA 1O54A 4MYSA 4QSHA 1IOVA 1UBCA 5BN5B 3DZGA 2HGZA 1MVNA 4NLLA 3MNFA 4UM8B 2F9LA 1E6MA 1ESCA 1TYAE 2G4LA 1EGQA 1FRNA 1LA2A 4L3OA 4MO9A 5EXEA 5TMBA 2DHQA 1B0UA 1E2HA 2X2OA 5K3DA 1OH6A 3ZDAA 2F1RA 5DBHX 2EU8A 2JFOA 2Y0DA 3NVMB 2QZ4A 3BL8A 5DCUA 4Z9FA 4IHAA 2CDBA 2IP1A 2P9HA 4ZAGA 4BNXA 1G6HA 4Q47A 3LQ4A 5CLIA 5K51A 2JF0A 2V7VA 1E6EA 3G5UA 4Q39A 3KOUA 1DMSA 2PKYX 1FMLA 4JP3A 3SYRA 5CYPA 2PS9A 4R9SA 5DXJA 4LGYA 4UVHA 5IW8A 3KKPA 4GZ3A 5ALWA 1RRFA 1WL8A 3C45A 3FOCA 2WWVD 3A9CA 4YR7A 4WZ6A 3VHRA 3W9SA 3OJWA 4I5FA 3ECSA 2Y0PA 5B1IA 3STVA 4AJEA 1H6DA 4EUSA 3DD1A 1V3QE 1ZU5A 4OLFA 5C8XA 3JSAA 3VR6A 2X7HA 2GMWA 3W5IA 1K3TA 3CM0A 3MJCA 1SIBE 1W36D 4CODB 2I3DA 4NMHA 5KNBA 2GBGA 1RHKA 2QTZA 2FOLA 3AEXA 3O75A 2CUTA 3AY7A 4EBFA 2PG3A 4MGKR 3BWBA 3FTDA 3S40A 4OK3A 2Q1UA 3D7NA 2FMUA 1SO8A 2A4MA 2FEPA 1SHZA 3H8VA 4X3OA 1HSZA 2YY5A 3STUA 1I3LA 3LY5A 4HLCA 5FWAA 1IUNA 2RBGA 1T9AA 4RWZA 5FPHA 3A3PA 2GS9A 2I2BA 4XJXA 3L02A 1D5WA 1GVHA 4WD3A 3RS7A 1J7JA 5LMUB 2ZI4A 1UJBA 1DNPA 4L72A 3TSOA 4TQ9A 4XIYA 1USGA 2PDAA 3CW8X 1KDZA 3SXUA 3OTIA 221PA 3PNQA 1G8MA 4RKQA 3W9UA 3BIJA 1NU6A 1WXGA 2N42A 3H2YA 1YQQA 4JVLA 1QM5A 2LUOA 1WDMA 1UMCB 2QUBA 4LYHA 2PT9A 4R3WA 1DJOA 3P19A 1GU1A 3JPWA 3PDIA 2V65A 1YTLA 3SHFA 1NASA 4KODA 2P3OA 2YHIA 3Q3EA 2D1YA 3QLEA 4ZP1A 4B3JA 4K28A 1XTBA 5K0GA 5JNLA 1T9DA 2JLAA 2Z57A 2Q3HA 1KKUA 2SKEA 3OEEA 2V9PA 3O8OB 5EWJA 2IYUA 4I8DA 4EYQA 4WA8A 4G0ZA 4PFJA 2FLKA 3Q2IA 4P3NA 3G9XA 3SJBA 1W8DA 2FV8A 1GO2A 4J43A 4JYCA 1JFVA 4LVUA 3L1IA 3WLMA 2LTAA 3ZHCA 3ZK7A 4BJ5A 4E1AA 7MDHA 1FOEB 4C21A 1TCUA 5AVRA 3LUHA 2WF9A 3QX9A 3W7VA 3NGLA 1NQWA 1XRRA 1TZJA 4URWR 1JH9A 5HOQA 4L5AA 5JI3E 1KJQA 4H15A 3R23A 1DV2A 1JPJA 2XB4A 3Q7IA 1R4NA 1Y4ZA 2PAFA 1NXSA 2A5YB 3NBMA 1BW9B 3J81A 1GXSA 4UFOA 1PR9A 1LLFA 4L0QA 5DH9A 5ULLA 2G70A 2J9RA 3CWZA 4FZRA 5AJHA 4EY3A 5FOUA 1UFKA 4GO1A 1U6JA 3TJZA 5EJ2A 3PJDA 1BS2A 5ES3A 4IDHA 3U62A 4QUBA 1UEJA 3AY0A 3T38A 4YV0A 2VTBA 4U6SA 4E33A 1FRFS 5C5DA 4I5GA 4NCNA 1L5KA 2WY2D 2ODTX 621PA 3RSSA 2B1GA 4ZZ0A 1M1NB 4LXYA 4BO9A 1T36A 3OZCA 1E2UA 3LPNA 3DVAA 1KVSA 4XDHA 3ZD6A 1PR0A 4K1XA 2H4XA 4QHYA 3EFBA 3DWFA 3ZJYA 3LOQA 5H81A 5G0VA 1F8FA 4O02B 1HDIA 3SGLA 2TMKA 4JD5A 2BAGA 4V3CA 1Y7LA 2WSBA 3LQ1A 3ZE6A 1D2AA 4MPJA 1OH5A 4IIGA 1POWA 4CQJA 1YHYA 1RWOA 3UHPA 5HP4A 1E8DA 1IN6A 1GYQA 3FMFA 3PYXA 3RG8A 5CA0F 5IP5A 2WPDD 1G8AA 3FVTA 3VR5A 1FX1A 4HDKA 5EJAA 3PGVA 4V1CB 1XZFA 3QLTA 1DE0A 3E84A 2ZDHA 4JT8A 5DDIP 3SU8A 1KIAA 2IVZA 3BA6A 4LVCA 4G4SO 4CM3A 1OMOA 5D6NA 6PFKA 2KS6A 4J3FA 1OX4B 3AEQA 1K8QA 2XE6A 4WLUA 1BDIA 4P32A 4Q1AA 3GD5A 4IFBA 1QX3A 4HEHA 2FRXA 2PRJA 3EGIA 4JP1A 3T9FA 3SKVA 5HM8A 1BMFA 3NUQA 2HQBA 1VPWA 1H2FA 1JIQA 4LJ9A 1GILA 2JI4A 1L7BA 5K2MA 4YRLA 4XYGA 1SC6A 2A57A 2XPCA 4E4RA 1UM8A 4B2YA 3QI2A 3A14A 1H3NA 3VRHA 1PL6A 5FPPA 4RFVA 3ETGA 3N76A 1XNRB 4EJ0A 3K0FB 1EZZA 3O8LA 4R0VA 1VI5A 3HI6A 3OO1A 4MQ5A 4POOA 1BIFA 3GFPA 3KL4A 4Y6QA 3RIMA 3JZFA 3LP5A 4XQEA 4WTOA 4P80A 1N0VC 3OEHA 4W9RA 3AF2A 4B7ZA 2OHIA 3QHQA 4CLDA 5I9BA 2GBPA 2I7CA 2P0YA 5CITA 4Y98A 4NHEA 5JPCA 2ZETA 2EIHA 1DRUA 1RBMA 2KSQA 4JB2A 2ZBQA 5JNUA 3ANXA 2EJUA 2XMZA 5AXAA 1KFBB 1YB6A 3Q8KA 5LA6F 1U9IC 3K53A 1MFZA 2FPOA 3HZOA 4Z86A 4M38A 5CT5A 4C7MA 1ZINA 5EQTA 2AK2A 4OU4A 3TQTA 3BGWA 2ZCJA 4X1KB 3ETNA 3GLFB 3WICA 4B43A 1O0SA 2COEA 1Z0JA 4QDOA 4HAVA 2PUFA 4S0ZA 3RRMA 1WHTB 3AJDA 2Q7DA 2ZG6A 2W71A 4M0EA 4DXHA 2VWHA 2F7SA 1FFXA 1V41E 2P1RA 4QHSA 5DK4A 1CK4A 4ENWA 2GZHA 1JHMA 3VYRB 1LK5A 3PLAE 4IDNA 4PLWA 4TRNA 3TLMA 5J2UA 3OH8A 2OZLB 2QXYA 4JB0A 5CDGA 1A4RA 1NXVA 3DXXA 3O8QB 4J76A 1JHVA 1ZUNA 3QOWA 4HXGA 5TMPA 4EG5A 4GBGA 4HDSA 2AL7A 2GM5A 2MYNA 3OF2A 5AW4A 3KOMA 1Z25A 2ZRLA 5A71A 1HKUA 2O0MA 2QUAA 4W4TA 4R2HA 1YNOA 5JO9A 4DB2A 3P5SA 5FB3A 2ZDQA 3DOCA 4PBTA 1P7CA 3ZHUA 2NXWA 1G38A 4E5UA 1SXJD 4I9UA 4NAHA 3CO5A 1VLJA 3E5RA 2BI8A 5JPDA 3SWWA 3F4BA 1JF8A 1SCQA 4Q7KA 3EODA 1TK3A 1JA9A 1PO7A 2VYVA 2V6MA 4P4SB 1C81A 3PR2B 1C30A 2DBZA 3UMMA 1XO1A 5FPQA 3CWCA 1D5CA 4PPYA 2O8EA 2YZKA 4XAQA 1YACA 3A9WA 4KQ1A 4HAXA 3D1VA 3EIEA 2EX0A 1Y7TA 4ECEA 4B2IA 4R71A 5F5LA 3VO9A 4C6TB 2W8BB 3FFWA 4WKPA 2G8LA 3CR8A 2REBA 3D7KA 4NWIA 2VCHA 2RHTA 2Z5FA 1N2EA 1RE0A 1V26A 4CV1A 1B23P 1T2FA 1W5FA 1IONA 2H00A 2CL7X 4LBWA 4J1TA 4WEQA 4LKOA 4OU5A 4QXQA 3RVKA 1F60A 4MOWA 3PR3A 1Y8QA 2ODNA 3I45A 4ERXA 3ETCA 4WBXC 5ALZA 1IY8A 1NC1A 5CM8B 4XJVA 3NU1A 4OMCA 3MCWA 3TGWA 3G1TA 3MJRA 4JK3A 2JIPA 1RYBA 3I0ZA 1RKBA 3OAAA 5ERXA 4K9QA 4B44A 4CG3A 2I1QA 3VZCA 4AX8A 2DYKA 4KE7A 3OQMA 1VRVA 4G5SA 5JAZA 4TYMA 3WFIA 3IUPA 4F2PA 4Q9KA 3U61B 1YK1A 4DMKA 1FXWF 1AZWA 2A1UB 3LXUX 3UKDA 4FYHA 2AOXA 2PRYA 3L4BA 3A6LA 3RU3A 5L51A 1YDMA 2ZBPA 4BMYA 1EBBA 1RQRA 4RL4A 1SXJE 2CYBA 1V8FA 2NO1A 5BRAA 2CL0X 3KHKA 3QU9A 1A8SA 1QCYA 3GPIA 1GTSA 1G64A 2VZ8A 3HEAA 3PRYA 1BTOA 4NCKA 1XPJA 5FR2A 2YN2A 1HYEA 3K70C 3R8XA 3RROA 3DHVA 1Z62A 3NM4A 5HPYB 4TM8A 1R5OA 3UWOA 5HE9A 2QTMA 4B6PA 5B30A 1P4AA 4AJJA 3GHYA 2IU0A 4DLVA 1WMAA 1QZTA 3A04A 4H7EA 3OT4A 5G4LA 4CJXA 5I7EA 3C16C 5EUBA 3LWDA 2P8JA 4MCAA 1LTHR 2DWPA 2YJZA 4I3HA 2PQ0A 5FF9A 1S8NA 3ROFA 3RUFA 4EFNA 2RC6A 2Z3ZA 1OWOA 2A9KA 3USCS 1QDEA 5F52A 3TW8A 4JVMA 1EEXB 1K8XB 3MOIA 2ZVPX 3PRKE 1JGTA 4ZHSA 5HRAA 1MRSA 1LF0A 3CEMA 3QXSA 1PUJA 1V9SA 2PMBA 4JCCA 1VHQA 3BVPA 2YVUA 3OPQA 3NWBA 3O1LA 4EKYA 5TEWA 4QUIA 5C4MA 5LJIA 1T2UA 3W5BA 2A14A 4M0MA 3E0QA 1KK2A 4IDGA 3H42B 1HE8B 5KTOA 2OGSA 2BUBA 3D3NA 2Z9DA 2JANA 4O63O 1FMJA 1UQTA 1M7GA 3SM9A 3U2QA 3ZU4A 4XOUA 4MAMA 1R6UA 1YQXA 4G1EB 1A5TA 5K45A 2VOEA 5KNCD 3IP6A 4EMSA 1SC1A 3R3UA 2FPGB 4IQGA 1KYQA 5IDXA 2BRUC 3OE4A 4PRLA 2PKRA 1KQGA 3L7IA 2IEZA 2CXOA 2WIDA 4ZHQA 5L4NA 3PEYA 3MMNA 4BIIA 1UXKA 1HYGA 1Y1TA 2WKQA 2Z8ZA 5A9TA 5JTTA 4MRRA 4OB7A 3F78A 3BT7A 4LE2A 3DWIA 2QUHA 3GMTA 1SIWA 4R16A 4DCGA 5I7FA 3AFIA 1GIAA 4GH5A 1Y3HA 4CMEA 3U3RA 3GFTA 4H1WA 2C54A 1F5SA 3NZEA 4TV9F 5E6UB 1WXXA 5EZYF 4EI9A 1K4KA 5K7SA 3OKFA 1CEEA 5JRJA 1PR1A 3D3JA 1LDMA 4M88A 1MW8X 3EIXA 2C1XA 3N0TA 3U19A 3OFJA 2WYVA 2DUMA 1PTKA 1PYOA 2GAFA 2ZYUX 4BV3A 4YMTA 4IBOA 1LU9A 4HGYA 1XL0A 3T7EA 1SZPA 2BTQB 3LFTA 2WD8A 2FY8A 1W73A 4HQFA 2JFVA 3SR3A 5JS8A 1OVMA 3G59A 1BD4A 2XT0A 2EZ4A 3EVAA 3HA3A 2Y1CA 3GCXA 4P93A 4Q7JB 3CEJA 5KYYB 4PZCA 2L18A 3WO0A 3E22B 1AXGA 1W87A 1R0YA 2XNCA 3A3NA 3OX1A 4MR9A 5C1IA 4OI1A 3K92A 4B4KA 2DPMA 1NFFA 3JWIA 3JWHA 4J9VA 3TZ6A 4Q48A 5DGTA 3NHKA 4C4PA 2WHPB 2GN0A 2YC4C 4RC9A 3IVAA 4JNCA 2J5QA 1M3SA 1RLTA 4I6EA 4FK8A 3SLKA 3RYFB 3ZV6A 1P45A 4L5CA 1UFQA 3PHJA 1UOEA 3MWGA 3COVA 3GJ8A 2JD0A 1UMBB 4I6JA 1Z82A 3AR7A 4TUYA 4WBNB 1AA6A 3RC8A 1DBSA 1PGQA 4F9TA 1YI0A 1E2DA 1DBWA 4X6UA 3WLEA 4D9IA 1V4NA 3BM5A 4TV8B 4YJGB 3OOJA 4E5DA 1RFLA 2OKGA 2VQSA 5D3QA 4AXXA 1TNDA 2EJVA 2P4SA 2QTVB 1YZUA 3DOHA 3H9JA 1YBMA 2CHUA 3MPOA 3D81A 3PDJA 5BMVF 5JRZA 4GQAA 4AVYA 2YRFA 4NBTA 1NW8A 3SVLA 1SOUA 1V37A 2AA3A 2E87A 2WV9A 5AXBA 1AM4D 2WJAA 4GOLD 5DI3B 3H2SA 2JASA 1H1LB 5FV7A 3IBSA 4B5KA 1S7GA 2XVMA 1MQSA 1YU6A 3OSZA 5ELLA 3VNBA 3WTBA 1YE8A 5KYWB 3NAGA 4M7RA 4BN0A 2ZE7A 1O6FA 2V9ZA 3A32A 2O7VA 1RXCA 1U5BB 3PK0A 3GLKA 4NQZA 1AXEA 4AP5A 1TYBE 4DT1B 1WZIA 3ZIAD 2Q4EA 1WP9A 2CKMA 3GGCA 4QDUA 1MEOA 1RU3A 2GWHA 4PYRA 1VPEA 4JQOA 5LCXA 4H7JA 4BMZA 2IU6A 2A9JA 1MN6A 1C8LA 2ZRJA 4TMYA 4Z3DA 1XKQA 5EWMB 2K5UA 3KZNA 4Q9AA 4R3UC 2H4YA 4JENA 4OHKA 2ZRIA 1U4NA 1GPAA 1LK7A 1YB4A 2HGSA 2NUPA 2QSYA 1CCWA 3I5UA 1B8VA 3UOGA 1Z6GA 2EHJA 4LTNA 4LSWA 1HYHA 3TSZA 2OCAA 1BGVA 3DV0A 2OCIA 3WB2A 2GX6A 1UWCA 3OWHA 1BGWA 4G01B 4RJIA 5LOVB 1NVEA 2CXUA 4E12A 4A10A 2O8BB 2WIAA 1G0OA 2PZBA 5J1SB 1AJEA 5DGHA 2ZSUA 2ADFA 3B9QA 4PBRA 1MUUA 2RI6A 4R7ZA 1VSVA 1HDRA 4Z0HO 5JSZA 5KX5B 4TN5A 4QGFA 1VIVA 5KNCH 2XYHA 4GEGA 3R5JA 1PKEA 3R9XB 4U3JB 2FPPA 1DZIA 3LSYA 1QVVA 1JG4A 1CETA 1CHDA 2IPLA 2V9CA 2QUIA 3KQMA 4OEHA 5EVCA 1ISJA 1EWYA 1OXUA 4NU5A 3TJMA 3BSYA 2VK4A 3INRA 5KSYA 1G21E 2JD2A 1KDTA 1N25A 2IFTA 4F1JA 1CY1A 3LZCA 4IIXA 4JEMA 3H5AA 3I1IA 4LZAA 3GUCA 5A5VA 3LUBA 4LXUA 5SYAA 5BQFA 1P0MA 1VI2A 2CJWA 1JLMA 5DHUA 1RSZA 2P5UA 1G6Q1 1RJ9B 2JFPA 2R6FA 3NIFB 4KIUA 2OHJA 4MLDA 3WL8A 3CE9A 1KEUA 1PUIA 4U5QA 3UAWA 5KWSA 1DAOA 1DLJA 1TFRA 4ZT5A 2P6NA 3W5AA 1V4BA 2CLSA 2IZ6A 2QZJA 1U3UA 3H16A 5CDHA 1YRWA 1HBJA 1X42A 1YQWA 2JKVA 4YJ2B 1B6SA 1E5LA 2H2FA 3RAPR 3UW1A 3QUTA 3MMPA 1SRQA 3QE0A 3S6JA 4UFNA 3DLBA 4KQMA 2XMBA 1N8SA 1QIEA 3H17A 1KL7A 3LLCA 2AR7A 1UQUA 3FG9A 4CF4A 2NPIA 2WSIA 1UDCA 4C7KA 2C99A 4M9RA 5L9AA 5SYNA 4YUXA 5BN3B 3FBTA 3LM8A 4MR8B 5EWLB 4FYIA 1XDGA 4X1IB 5TEVA 2WFAA 1WRBA 4LCJA 4MMZB 4D80A 2FN4A 1M8PA 1LW7A 4LY6A 2PWBA 1DOHA 2CZCA 3V48A 2MYPA 1HE3A 3O3MB 2UUBB 2B20A 3TE6A 4PLFA 4ZCRA 3ZVNA 2Z1NA 5E7IA 4TXLA 1NR1A 4U6NA 5CH3A 1T0BA 3NHSA 3K0KA 1NTOA 4KRXA 1ICIA 5E0OA 4V0KA 2N0SA 4CR7A 4XGNA 2QP4A 1S3GA 5FA6A 1MO4A 4L6AA 1R9GA 3LY9A 1SHKA 3OA2A 5HCUA 1WZUA 3RARA 1IXKA 3HWSA 4ZVPA 1PZHA 4NBUA 1QAQA 1P8AA 2X9LA 4NOJA 2ECFA 3D8BA 4YMIA 3ZI7A 4JT4A 3GLTA 3DC7A 1SUCA 3A27A 3V8QA 2PCLA 1SQ0A 5TQ0B 2Y66A 1NI4A 1WUIS 3RRZA 4AWBA 5FO0A 3I6IA 5FBQB 4MGZR 5IZCA 1NOKA 3OPNA 4FYVA 1O0BA 1TAHA 5B3JA 2EBUA 2QTHA 4XIGS 1D1PA 5H02A 4U00A 1X1TA 2CXSA 3N7TA 4MI1A 1R2QA 3ZYZA 3B89A 5KO2A 1MRZA 4HMQA 3KXKA 4BKUA 3RT1A 3B1XA 2ERCA 3WLTA 5C4GB 3O83A 3K1AA 2PGJA 3Q3JB 1DXHA 3QQ5A 4MQUA 2IUFA 3O47A 2YVQA 4WXEA 3B1ZA 1A5AB 1DQNA 2Q3CA 3DZHA 1LNSA 2WZQA 4ICIA 1U6KA 3FF4A 3E03A 3WK6A 5HQ3A 4AN0A 1ZH4A 2IBMA 3WLQA 4EJSC 4Q9NA 4CIDA 4DF3A 1T9GR 2QSJA 4M83A 3HDYA 2AZXA 4C88A 3A37A 4RZXA 1YDGA 3ABQB 1UPXA 4JBNA 3ZJ5A 4C3ZA 1A9PA 3MYRA 3DXYA 1WQ4A 4MP6A 4QUEA 4RNCA 4XSHA 1TQ4A 2HWUA 421PA 1Z06A 4AB1A 5E38A 2VTEA 3K9WA 1U98A 5A2GA 3HYCA 5FUQA 1YIAA 1FSGA 1J24A 3RTCA 3ZH9B 4FMCF 4YHBA 1D4AA 1HH4A 3JZIA 3NNDA 4QBIA 2GNOA 5EKDA 4KAJA 1VLMA 2WM8A 3O38A 4H7HA 1JBEA 3U4DA 4CTJA 4EF4A 3PC8C 5AVWA 2VHXA 2PIDA 2X1HA 5G02A 1JLLA 1BXGA 4G9BA 4N3AA 4BQSA 3HN2A 1APBA 4KNYA 1NGSA 4JFAA 4JUDX 1WUHS 3NO4A 2BGJA 2DFNA 2C3MA 4YJHA 4BX8A 2DFLA 2WVAA 1PQUA 2AZDA 2QG9A 2UU9B 1HFKA 2XCQA 2ZJ0A 1VSUA 3R40A 5GZ1A 3F5MA 4X44A 3C5VA 2OD7A 5I6DA 2PBRA 2CLCX 2JBAA 3NT4A 1KMQA 4N5LA 1G1MA 2FYTA 4QEKA 1KC3A 3N59A 4NMLA 5KWEA 2GJ4A 4P0PB 2D1QA 3ZGOA 4LDQA 3PTLA 4ZWNA 3MTQA 3PX3A 5F5XA 5BO5A 1QP7A 4M8NE 4DMLA 4N76A 1VJ1A 3IERA 2EZ8A 5AR1A 4IVPA 5GJWC 1CUVA 2ZB3A 2BH2A 4M0UA 1SXJC 3G82C 3TD2A 3TRIA 5AVQA 1LTQA 4EB0A 2VNJA 5T6MA 5B1EA 1L8LA 5LMNB 4LI0A 1IZ0A 3EGWA 3A9RA 3GFGA 3PLRA 4B32A 3U60B 3VNVA 2ZS8A 3REQB 3S2YA 3HUTA 4PC1A 1WB9A 1PX0A 3PDHA 3K70B 1C8VB 1RQLA 3WK7A 1ISIA 2QPAA 1GD1O 1D0IA 1BRMA 1KFEB 3PUWA 1QMPA 1QC5B 1PNQA 1VYHA 4ZU1X 5IJZA 5GV8A 1J5XA 1RYMA 4P7KA 5THKA 3W2HA 4YP6A 1V35A 3QWAA 1VRCA 4LDRA 4WVLA 1OXTA 1G20E 1L8OA 2C03A 1C1DA 3BCHA 1IY1A 2MSKA 1KZ4A 3CF4A 2BYTA 1F8UA 3LZ6A 3B1WA 5CCXA 1I7NA 4MKHA 4FUTA 5KOYA 2C92A 4IX9A 4DZRA 4I8XA 1HE4A 1L3CA 1TT5A 3VR4A 4PLZA 2P9FA 3UG7A 3YASA 1MAUA 2RARA 5L7WA 5M04A 2G0TA 4LEIA 1Z6ZA 4RVFA 2YNMA 5HG0A 1RAHA 4JEHA 1JP7A 5KU1A 3LPAA 4CEJA 2W2NA 4C03A 2BHNA 3OCYA 3UMGA 3PENA 4C6SA 3T06B 3VSAA 2QR2A 4HD8A 2O8NA 3WGOA 3NDBB 4RJTA 2DHEA 4TYPA 4UKDA 1SPXA 3C7CB 2XAAA 1M2GA 1X39A 1XTPA 2RMKA 1UBMS 2PX0A 2OBYA 1SNYA 1M2NA 5C8YA 3MOSA 3Q12A 3I76A 1C3JA 3EK2A 1DUSA 2C31A 3AW8A 3K2EA 4F85A 2Q6LA 1YFJA 3NX4A 3P9NA 1KQFA 1W581 2A67A 4QQFA 5CFPA 1XR3A 2V5UA 1VCNA 1XTUA 1V2GA 3QF4A 2WDPA 4O29A 1XZQA 5AQEA 3RKUA 4CF3A 4BY9E 2NLOA 4BN5A 3ZGZA 2NZXA 4I9FA 3M7IA 4UD6A 1QGAA 2Y1EA 1RLUA 4RDIA 4CW7A