4C76A

Crystal structure of the fmn-reductase msue from pseudomonas putida kt2440.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
182
structure length
182
Chain Sequence
ARVIRVVVVSGSLRAPSRTHGLLQALVERLPAVLPKLEVHWVRIAELSASLAGSLERDSASADLQPHLQAIEQADLLLVGSPVYRASYTGLFKHLFDLVDHQSLKGVPVVLAATGGSERHALMIDHQLRPLFAFFQAHTLPYGLYASVESFDDQRLADPAQFERIERVLDTVGAFFHIPVAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fmn-Reductase Msue from Pseudomonas Putida Kt2440.
rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords FMN REDUCTASE (NADPH)
total genus 62
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 1.5.1.38: FMN reductase (NADPH).
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c76A00
4CF6A 3KLBA 3OX3A 1WSWA 1YKGA 2Z98A 5FUQA 4LTNA 3N3BC 5JROA 3N39C 3NHYA 3QFCA 4GR9A 3HLYA 3LT5A 4N65A 3TE7A 5LMCA 4BMOB 5LJIA 2FOXA 2QX9A 3NHSA 1OBVA 2HPVA 1YCFA 3ZHOA 1FLVA 4Y9UA 2V9CA 1SG0A 1DXQA 1DXOA 2X2OA 5F51A 4FX2A 4U7FA 3P0RA 2QX4A 4YAFA 3RPEA 3FVWA 3B6KA 3U7IA 1VMEA 3FNIA 1D03A 2R96A 1GG5A 3S2YA 4YQEA 1YCHA 4ZVLA 5LJLA 2V5VA 2OYSA 2QR2A 1AKWA 5FA6A 1C7EA 1CZOA 1RLIA 3L9XA 2HNAA 1T0IA 3K1YA 3LCMA 3NHPA 3NHUA 3NHRA 1CZLA 2ARKA 4N82A 5LVAA 4LTDA 1ZWLA 4PTYA 5TGZA 3QFRA 3GFQA 3ES9A 3NHFA 3W77A 5NULA 1QRDA 1RTTA 1AKQA 4QODA 2MTBA 3NFRA 1C7FA 3NHJA 1J8QA 1JA0A 3HA2A 4CETA 4C0WA 3O2NA 4C14A 5BUCA 2BMVA 2X2PA 1FTGA 3W7AA 4C0XA 1FX1A 3JSXA 2QMZA 4FGJA 2KQUA 1NNI1 2MWMA 4PU0A 2FAXA 1QHEA 1F4PA 2AMJA 2W5UA 1YOBA 3ESYA 4QOEA 4S24A 3F6SA 2QX6A 2M6SA 4NULA 1WSBA 3R6WA 1JA1A 5F4BA 4LAFA 4ZVMA 4YAOA 4YALA 3U7RA 1KBOA 3NHLA 4N9QA 5ULLA 1CZRA 1OFVA 5EA2A 3GAMA 4QOGA 4DILA 1B1CA 4R81A 3TZBA 1QBGA 3FX2A 4YAWA 3TEMA 3F90A 2GSWA 1AKVA 2OHJA 2QMYA 3FJOA 1CZNA 4GQIA 4H2DA 1H69A 2D5IA 2OHIA 1FVXA 2Q62A 2XOEA 3OWHA 1RCFA 2BZSA 1YCGA 2BPOA 2FDXA 2A5LA 1AKUA 1FLDA 1ZX1A 4FGKA 1SQSA 1TIKA 1ZWKA 2RG1A 4LTMA 4ZVKA 1AKTA 1XT6A 4C76A 4DY4A 2QWXA 3OX1A 5A4KA 1CZHA 4U7HA 4J8PA 4QOJA 1D4AA 1T5BA 3UXHA 4FGLA 3GFRA 3KAPA 2B3DA 1OBOA 2FZVA 2Z9BA 4Y7CA 1AMOA 1KBQA 3NHKA 4OXXA 1XYVA 2M6RA 4H6PA 4M0CA 5LBTA 1FLNA 2FCRA 2Q9UA 3D7NA 3G5MA 3W79A 1AHNA 3NHWA 3O73A 4QOHA 2N1MA 4DIKA 1BU5A 4XDHA 6NULA 2QX8A 5LLDA 4BMPB 2FZ5A 3OJXA 1X77A 2OHHA 3B6JA 4GI5A 4ICIA 4Y9RA 2MT9A 1YRHA 2F1OA 3ESZA 3N3AC 3NLLA 2Z9DA 4HS4A 1J9GA 5EMNA 2WC1A 2Z9CA 3L9WA 4LA4A 4NLLA 4QOFA 1CZKA 1FLAA 2FX2A 2KLBA 1QR2A 2V5UA 5NLLA 4F8YA 2HNBA 3B6MA 3F6RA 1TLLA 3B6IA 2BN4A 3QE2A 1XI2A 2BF4A 4U7GA 1XYYA 4YAUA 4PTZA 1AKRA 2FVXA 3FW1A 4QOIA 4XDGA 3W78A 3UXEA 1H66A 1DX9A 1V4BA 5B3KA 3HR4A 3K20A 3F2VA 3GFSA 5LBUA 3SVLA 1FUEA 3EDOA 3OX2A 2FLVA 2ZKIA 4D02A 4HEQA 3OVMA 1RLJA 2MOKA 3OWXA 2R97A 1D04A 3ESXA 5F12A 1AZLA 3EYWA 4ESEA 4ZVNA 1J9ZA 3OJWA 2XODA 1BVYF 1CZUA 1YDGA 1AG9A 1J9EA 5EAIA 1I1OA 3KAQA 5FX2A 5B3LA 3KEGA 1E5DA
chains in the Genus database with same CATH superfamily
1TW2A 1X86B 1IIRA 2WK1A 4EVQA 1U04A 1PS8A 2Z6UA 3GYGA 3GEBA 4MUFA 2H7VA 3SJUA 2GEFA 1CRLA 3TE7A 1ND5A 1YC2A 4YNBA 4KK4A 2HPVA 1Z22A 4M83A 4KDFA 2DP4E 1P4RA 3SIWA 4K3VA 1FX0A 2ZJ7A 1R5JA 3BFXA 4TL6A 3ZOZA 5IJ0A 3K2EA 2Q1UA 5K20A 1RI4A 1JHDA 5DYNA 3GFFA 2Q3JA 2IEIA 3L1KA 4H77A 3LP8A 3DEKA 4KDCA 4J16C 3NHPA 1ILWA 3DZJA 2QAGB 5C3UA 3FMGA 1TUEA 3MJDA 1BGXT 2NQ2C 1HUQA 1RBYA 1HDOA 5CFRA 1W48A 4MGYR 3BIFA 2HMWA 1D2GA 2AXPA 5F1YA 4BYGA 1Z47A 3QTTA 4PIPA 3W04A 3O4JA 4C20A 4ZZ0A 1JA0A 4JC5A 4MPDA 3S81A 1YQTA 1RM4A 5K51A 4B35A 3IH5A 3DVRX 4LRUA 4S1NA 5EEHA 2ZUTA 2ERXA 2CEAA 2PL1A 3GGPA 1UJNA 4FGJA 1XZGA 1TQHA 2XCUA 3AM1A 3IKMB 1OIVA 4B3SB 4R9UC 5AKEA 1T3LA 1K7CA 1V47A 4ZVQA 1J5EB 3IBCA 4CXMA 3QU2A 2AE2A 3PG5A 4OP1A 3IBTA 1WB5A 4Z0HO 1PQ4A 3A4YA 3ZY3A 4K1LA 2IEZA 4N9QA 2DFLA 4DPLA 3A11A 4FEAA 1CR0A 2CLSA 4YAGA 4BC1A 4YJ2A 2G6BA 1F2UB 1PV1A 3AOEC 2IBMA 3BE5A 1HE2A 3HA7A 3KUXA 5C35A 1EBUA 3EPLA 3DMHA 3FJOA 2GB4A 1FTWA 2B6HA 4U7WA 2G1JA 3GLGA 4FKZA 5KKAA 2WD8A 4XUGB 1E9SA 5DBEX 4FR0A 5CVDA 1TTPB 2X6TA 1TQ2A 1JJVA 4KLAA 3W8DA 2GARA 5JS8A 3S3TA 4NHOA 5CFQA 4M0MA 3PPXA 3RSCA 1HK7A 1GVNB 4UBJA 1QH8B 5REQB 1P60A 4D79A 5L8VA 1V26A 1YU6A 2P11A 1M7HA 3IDQA 4LXIA 4MDEA 1JQLB 2QGFA 3IMFA 4G67A 2X1HA 1UMDB 4I1SA 4MNTA 4ZCPA 4AZ3B 4HFJA 5A4DA 3GWGA 2IYAA 3IIKA 4MAMA 2BSQA 1Z4PX 4JGIA 1AUQA 3ZWYA 2WD7A 3M5PA 2VZ8A 1P3Y1 3GUZA 3C1OA 5AXAA 5JZ9A 3MTQA 1VG1A 3R3WA 1JSZA 1YQDA 4L16A 2WOJA 1MCZA 4ZARA 4TT8A 4ZP1A 4K88A 5CDYA 2O54A 4PICA 1SFRA 3WS7A 4TLAA 3V1LA 1KK2A 3OP4A 3G0BA 3AR4A 3ET4A 2A57A 1E96A 1Y37A 3BHJA 1P29A 1R50A 2D2XA 5IFKA 4RXMA 4BVJA 1AA6A 3OQNA 1QUEA 1ZICA 2YC4C 4NU5A 1RRCA 2DT8A 4BBJA 2VBFA 3I5AA 3RQIA 5KKNB 2ORWA 4FTWA 1XRPA 1QVVA 3CT6A 3JVDA 3R5HA 3SR4A 1KMCA 2OPHA 4GVXA 3TIXB 1D9ZA 2BDTA 4J7AA 3E9MA 2A3NA 1FP1D 2W6JA 4DG9A 4EEZA 1UP4A 2VXYA 1NA5A 2WSMA 4R2IA 4X92A 5ELMA 3AJDA 1DQPA 3EIXA 3G0IA 3AMVA 2IYYA 1ZCAA 1ZJJA 3C4JA 4G0QA 3H11A 2J5QA 4WDQA 3H0CA 3LYLA 4NMMA 3VR4D 4AIRA 5JJLA 1DTSA 4IXWA 1SZDA 2BI8A 1ZUIA 2GCGA 4OQLA 4JROA 4MWOA 3GPLA 3ZDFA 5CT8A 3RAPR 3ZIDA 4ZEXA 1QP0A 2B94A 1PNOA 1XZ8A 4UBIA 1WOMA 1XRQA 2B0JA 1BX0A 1XIVA 3P9IA 4N6OA 5B1EA 5LCXA 5TIIA 2YXLA 1GG5A 1OLUA 1VC2A 2G07A 3OOEA 5L45A 2EFYA 1EVIA 3AKYA 5C8YA 3RNLA 3V1TC 3GLSA 3HJGA 1L1FA 4DG5A 3AESB 3LCMA 3MGGA 2AZXA 1Q0LA 4CCWA 4N82A 3PTZA 4A7PA 1IHUA 1E0KA 3KQLA 1QZZA 2WICA 1TCVA 2PWPA 4QPDA 4NU8X 4TRRA 5G4LA 3TZEA 4FLFA 5IBPA 3TLYA 2C07A 2CKMA 4CFZA 5AW9A 1TD9A 3LVRE 2DQ4A 1OE0A 1BH2A 1EZ4A 1E3TA 2INGX 4RVSA 1RHKA 4AMGA 2PYZA 2BF7A 3KQYA 2WMDA 2IYUA 4IP0A 4JK3A 5E9JA 3VTAA 1X38A 2GESA 2QT1A 5KTNA 1N4DA 1GTG1 1OXXK 1YF3A 2QLLA 2RHOA 2QENA 3PUKA 3N8DA 3ZZMA 2ZVDA 1N0HA 3TW0A 1R88A 2YJ6A 4HSGA 1LU9A 4UHJA 3V7NA 1DCTA 1QFYA 4JVMA 2FW6A 1UOQA 4MR8A 3P27A 2LR0A 5IJ9A 1DBWA 4I4IA 4EUFA 3HP4A 1FRNA 3JYNA 1U0JA 3RUCA 1AO0A 4IGFA 1JDBB 2RJNA 2X77A 1RZ3A 2TRSB 1B2LA 4B73A 2Q41A 2ZULA 1NIJA 4XEUA 4YAIA 1DIAA 4BDSA 1IRIA 1MMFB 1VIVA 4EYKA 3I53A 1IN8A 2QXYA 2BGMA 2OFPA 3B85A 1HQDA 4L3WA 4DCVA 2HY7A 4G01B 3HKCB 2V59A 4JLOA 3GAFA 4LBWA 4MEJA 1SD2A 3ZQKA 4NC9A 2JKYA 2IPLA 4WMLA 4ER7A 2C4VA 3A4TA 3DE6X 1QIKA 2ZSJA 2IW3A 2EIXA 3UHJA 1XC7A 4IEFB 3DWGA 2P9HA 3KD3A 4FYYA 5JCOA 1EFHA 1W8DA 3NMUF 3SX2A 1INLA 4KXVA 1GUDA 2N75A 4JZKA 2PQ6A 3SNHA 1CUCA 2PTHA 2IX3A 1CY6A 2E2WA 4GYYA 3FVVA 2H2AA 4PVDA 5AKLA 1VPLA 2R6GA 3AVYA 4AKHA 4KMMA 3M83A 5ERGB 5LPNA 4ILKA 1VPVA 2B1JA 2PZMA 1PJRA 3EDCA 3L9WA 4YUVA 3JTEA 2BLLA 5LWQA 2HK6A 3T15A 4LNHA 1NE7A 2AFVA 4I9UA 3H5OA 3DZIA 4ZK6A 1T8UA 3OZ7A 2Y71A 5A5FA 1OUMA 3EBLA 3K20A 1RPAA 4U00A 1J25A 4TRMA 2PUEA 4F4DA 1QONA 5HFAA 1VPEA 1GHTA 2HWKA 3R09A 3STVA 3CBGA 1KAQA 1DJMA 2I2DA 5C8YB 4IJQA 1UMCA 3PHLA 5IT4A 3L7BA 2H1IA 3DTVA 4L7QA 5H9WA 2D2FA 3QVGB 5I5EA 4O2RA 2GK7A 2YX1A 1J9EA 4MGZR 3ZTWA 1G0OA 2WG0A 4BWYA 5IX8A 5JNSA 2A1IA 3PRKE 1DQYA 4RF5A 3VC1A 3ZOKA 3JWPA 4FYVA 1V95A 3KSZO 3RADC 3CZPA 4NCNA 3LSTA 5ALVA 3N7UA 4BRSA 2O6HA 4E5SA 5M7EA 4FFNA 5JI3E 2QX9A 1PVOA 4U2EA 5IN4A 2JFPA 3GBVA 1GM5A 2CDRA 5KIAA 3HZRA 3L46A 2W6ID 1SOWA 3R3JA 1MIOA 5ENDA 2XNKA 1XNGA 4WPGA 2IZ5A 1CB7A 2IK8A 3EZFA 4I1YA 4P98A 1OLSA 2C4WA 5B4VA 5GONF 2P69A 3BB1A 5CG2A 1XRJA 3FFWA 5HZGA 4YP9A 5L6MB 2GILA 2ADMA 3K1ZA 1ZWLA 5HFNA 5AWFC 1TECE 4K6CA 3U80A 2FTKE 4MYUA 3ZWOA 2DHDA 4G41A 4DV6B 1EA7A 1M2VB 2D8MA 2J41A 1T8SA 5EIEA 2E55A 2HT6A 1C4WA 1TKRA 3IHLA 1GTRA 1YCDA 3AZOA 3MS4A 1S4QA 3IVGA 4O63O 4RH1A 2JLZA 3PB3A 1J2UA 1SHLA 2KE5A 3FH0A 3EFHA 4RCYA 1CB0A 5LL6P 4NVRA 3KBOA 4EEXA 4PAMA 1LXCA 1N3BA 1NXQA 2RGWA 5BN4B 4L4ZA 2A1TS 3B9RA 3DDSA 3IAM1 2IPOA 1K3TA 2ZB4A 4KC0A 3KAJA 2B8NA 1U3UA 2BM1A 2VHCA 3IAS6 4I9NA 2L0XA 1OWNA 3SYRA 3DL2A 3MXTA 2GZ3A 3B51X 4KMSA 4DCTA 1Q1EA 5IYZA 1NFQA 3DAPA 1OFVA 3CX3A 4JA0A 3HCFA 3U7QA 3AHEA 1ZIXA 3RNOA 1EB9A 2VYND 1OR8A 2R11A 1AQNA 1HFWA 1T9GS 1I0ZA 2DY1A 2NZUG 4ARVA 4BXOB 3OCUA 5SV2A 2E6KA 2PVPA 4Q4DA 5REQA 4KBGA 4RIFA 4Z6KA 1FVXA 4L4YA 1P0CA 3GNQA 4EY7A 5JWRA 5FPSA 3D81A 4EY4A 5C46F 2YOFA 5B4UA 1ZRNA 4N41A 1TJ4A 1I10A 1L8XA 3T5DA 4CGZA 4FHFA 4V0ME 3OBIA 1D1QA 2DG2A 2RHWA 3BMNB 4HDSB 2Z08A 4FE4A 4ZICA 1BS9A 2XLBA 1JAHA 2C57A 4H3KB 3MJEA 4PM4A 5F73A 1Q7BA 3TB4A 4BMSA 4HQLA 3QA9A 1YQXA 3FKJA 5D5PA 2WMYA 4HLCA 4CDGA 2CLOB 2FCRA 2CHFA 2DF8A 5AESA 2ASEA 2P2GA 4D3DA 2PT5A 2PKYX 5G0UA 2I5PO 1P9LA 5ALTA 3W2TA 4AZ0B 2VRWA 1K6IA 3MQ4A 4PCLA 2YIDA 1YI1A 2GAOA 1BFDA 3M6FA 4WINA 4A92A 1L4LA 4DJFC 1HOTA 1O54A 1XG5A 3A1UA 3NS7A 3OKAA 1C9JA 4TYPA 1F8XA 2UZ4A 2AYYA 1YA4A 4FJ0A 5H3CA 2IPNA 2Z56A 3MOSA 1RYDA 2B4TO 4GSLA 4OFXA 3BDAA 1GTJ1 3O75A 2YZGA 4PAWA 4Q03A 1TKAA 5KTPA 1GO2A 3EXIA 5FHRA 4U9IS 4DA0A 2D54A 4IJUA 1I24A 4O4IB 3O74A 4DAEA 1TM7E 4N18A 4Z86A 3DDOA 1VGVA 3FOBA 3DTTA 3PITA 1Z4IA 4ZU1X 1FFYA 1MTOA 2RGGA 3C6YA 3WGGA 5HJ7A 5KWEA 2B4YA 2CV1A 2ZJ5A 3DDHA 4WESB 2B8WA 3P0HA 5ABPA 3AHGA 3T7DA 1O87A 3BWVA 4PBRA 4HL6A 4BN5A 2FEAA 2MR6A 2OM2A 4JL5A 4HFRA 1FW6A 2PGAA 3IKTA 3IUNA 4JS0A 1CUIA 1E1QD 5LQUA 1EWKA 1L4MA 3B1YA 3DXFA 2ZBDA 3KB1A 2F3UA 2HM7A 2QX4A 1TA4A 1TA0A 5L40A 1SJ9A 4R01A 2WT9A 3IKJA 4CMKA 4YLYA 1JFTA 4CMCA 2DUJA 1FE8A 4BHTA 3P9ZA 3S1SA 2DKNA 2RBKA 3ZJUA 4D8YA 1IPFA 1NHGA 2RDMA 4AJ9A 4UJ5A 2J3DA 4JLJA 2P91A 3I09A 4NZPA 3AGQA 3QFFA 3OHPA 3T9CA 1THTA 3UV3A 3WKEA 5E0KB 4C4AA 4BQFA 1ZJYA 1U94A 3CPSA 5CBPB 2FP3A 4JKOA 1LPOA 4U0JA 4U02A 4DR7B 4WCVA 5A03A 2WU1A 5LSAA 2XW6A 4CIDA 2ZRLA 2PRJA 3MAGA 4EF5A 2B3TA 3KEFA 3PGA1 4HWTA 2LKCA 1XCLA 1F4LA 3TSOA 2N46A 3HY3A 3QVTA 1NQTA 4ZHQA 2V4ZA 1IHDA 1GPAA 4GE3A 1QGUA 4ND8B 1BXGA 1F9EA 2D8AA 2NXNA 4FGSA 4WLUA 5SYNA 4GM1A 3CUUA 1EFDN 2H2FA 4MQEA 4GH5A 3M6WA 1RBMA 2A59A 4G4IA 1EUDB 2JKVA 1DAGA 1NOKA 3NKVA 4JEHA 5D2CA 5IBRA 5JLAA 1W2GA 2DWQA 1D1PA 1TYCA 2QM8A 4EQZA 1M73E 1LTQA 3F5SA 4C01A 4ENQA 4L85A 4O4JF 2XWJI 4F2WA 3BGVA 4EHBA 4ZI5A 2R4QA 2N0SA 4NYIR 4PQEA 3DZBA 1NU6A 5H59A 1U2DA 1ZCFA 1VSQA 3CBQA 4AW9A 3MFYA 2Q5LA 5DNAA 3NVDA 3N05A 2C5SA 5DLPA 1ORRA 4EGJA 2H08A 2XMRA 2H8GA 4BB6A 1Q1GA 5CGZA 3BMXA 2X15A 5IC4A 5KZMB 1OYYA 2AFIA 2FEXA 1SUWA 1X1BA 2JI7A 4CEHB 3E9YA 3NP9A 4QBKA 3JW8A 3WYBA 2VJNA 1GPKA 2BI7A 1DKOA 4CDNA 2OCKA 1DOZA 1N57A 1XUOA 2HD4A 5FPPA 3AEQB 4NOJA 3OFJA 1TU4A 2GAAA 4EELA 3RBZA 3UMCA 2J8ZA 2D0PB 1II8A 3LBFA 4QFCA 3VI3B 4BBAA 4FYMA 3MWLA 3H42B 3N6RA 4KNVA 2IUYA 3DTVD 3L5KA 1JJBA 1R8XA 4BMPB 2Z6QA 4C6RA 2PVCA 4WGFA 1TK3A 2H11A 1OV4A 2DFTA 3ESZA 3IRVA 1QQBA 2NN3C 1HSZA 4AZSA 1P1KA 1X7GA 3IMGA 4MVJI 4KGZA 5C7YA 3PP8A 4PV7A 2P7IA 4NZOA 1E8DA 4TT3A 4G86A 1RI5A 1X19A 3HB4X 2VA8A 4HR7A 3DT9A 3KSRA 2Q3CA 4LQDA 5AOBA 4CM9A 4ZYWA 4TXLA 1HZZA 3BE8A 1GNTA 3KXPA 4ERXA 3IP1A 3H7AA 3D02A 4M7WA 3FPLA 2XGGA 5IHPA 2IXGA 4D9GA 4W1QA 2XZPA 5DNVA 1Q7GA 2PVSA 5IUKC 1G8SA 4R1OA 4CN9A 3CVVA 4GVPA 2PU7A 5AJYA 1Y6RA 3LY7A 5JSUA 2HX1A 3BXFA 3JS5A 4B79A 2R8OA 1ZNWA 2A9VA 4UHFA 5AOCA 2O3UA 5SICE 3SOPA 1SVMA 4F12A 1J8YF 1FF9A 3RVMA 2F2TA 5KOHA 2HDNB 3TOSA 5T41A 1KO4A 5EJ2A 2OD2A 2VBIA 4GR9A 3UG7A 5K3EA 5JJ5A 4PHFA 1FZQA 1Z75A 3BK2A 4NJMA 4DEYA 2BJWA 4K6GA 1D8TA 1ZHHA 2AJCA 4G0MA 5EJ9A 4JBIA 1MV5A 1SC3A 2ONKA 4TV9A 2IJGX 3P4UA 2A7QA 1BWRA 3DO5A 2W37A 2H4WA 3GOHA 4BDTA 5H16A 4M9SA 4DUPA 2H7YA 4LDZA 4RDCA 2AD5A 4DLAA 5B36A 1Y7TA 2O2HA 3NHRA 3E82A 1H2WA 1IY2A 4HN4B 3EEOA 4S1PA 4XQCA 2BM8A 3O9VA 2C2GA 3FNRA 4EABA 4NBRA 1WZNA 4OXYA 4WOCA 4O3MA 1Z5OA 4LNAA 1DJOA 2NLOA 2GAJA 3GMDA 4D0SA 3E2PA 2JASA 4UHBA 3Q4GA 1I4WA 2RARA 4YMHA 3NPAA 2EKZA 3PNVA 4FP9A 2UVPA 1VL2A 5JJBA 1J24A 1I3CA 4X9XA 4YPFA 4QPNA 5EOVA 2MMCA 4S2UA 4RZSA 4BO7A 5KS2A 2UXDB 2PS1A 4KO8A 3A6EA 4H7DA 1PHPA 4JUAA 5EIWA 2PKQP 3JYPA 2YICA 1NG1A 3FCSB 1O58A 1OX5A 5K3CA 1W29A 1IQRA 1CIJA 1R8QA 5FO1A 2EJCA 3A1SA 1TF2A 4CV3A 4KQFA 3TXAA 3C24A 4OHZA 4DB2A 5LA6F 2HT1A 4AVYA 3ICOA 5K8JB 4QUGA 3V8VA 3IESA 3OLCX 2XQFA 8MHTA 4MQLA 1G3RA 1NFRA 1TVMA 2A94A 3QOWA 5DGTA 3WDKA 5I7AA 3WFZA 2FK8A 4QPCA 4MW9A 2REXB 4WOKA 1OU0A 1RM0A 1YZTA 1ZL0A 5E4JA 1T9CA 1V5EA 5HF5A 2YWEA 3DE4X 1IXKA 2XA2A 4QFBA 2HQ1A 2QTBA 3GFGA 3O8LA 2W2KB 4IV8A 5IJZA 1L7RA 2OV3A 5ADUS 1LBTA 4ZWNA 1Q2XA 5KEIA 3RG8A 1E0JA 2CHGA 3GMIA 3EGVA 1YI8A 2ESRA 2W2XA 3E3AA 4I4TF 4LYHA 1UMBB 3IJRA 3OO0A 1VIYA 1P0PA 2AMVA 2IU0A 4IRXA 4HDKA 3AB7A 3B2QA 3RHZA 1KFKB 2CCKA 2WI8A 3KZCA 4B6GA 3NXKA 2A9FA 4XVQA 3CIOA 1CUEA 4WZ6A 3EX7C 1EFKA 3ONVA 2IOHA 4LCBA 2FPGB 1IATA 2FW7A 3K9NA 3SX4A 4LPSA 4Y2HA 5KOIA 1ODLA 3I5MA 5ALEA 2IT1A 2PA3A 1OXBB 4BNMA 4DZZA 2E87A 1LKZA 3CEPB 1QKIA 3DXZA 2NUPB 4OGKA 4QSMA 1G21B 1GKYA 4OGLA 4YEDA 1UFVA 2XNDD 2P5SA 4AURA 4E33A 2EJTA 4UOZA 4KR7A 2EARA 4G0UA 1C1XB 3MINA 1NNSA 2IEAA 3HACA 5AO9A 5C8VA 4DDUA 1KS2A 3WLQA 1T24A 3HH8A 4RYDA 1NOJA 1BMTA 3TPFA 3K8YA 4F92B 1ZO8A 2J07A 3KELA 1VLVA 4X85A 3T7IA 3FDXA 3L7DA 5CBPA 5K9ZA 2NZXA 3FCEA 1NBME 1OI2A 2VYNA 1ZAYA 1X14A 4W7IA 1ZMOA 1I7PA 3WGIA 3WL6A 1CETA 2IYXA 3QPVA 4EB0A 1GFZA 5HP4A 2R2GA 4BJ5A 4ND7A 5JFOA 4KSYA 5DH9A 3WJ1A 3EVBA 4TUYB 4YQFA 4B74A 2VRCA 2R4UA 4DA7A 5GIOE 3ABOB 3KVOA 1U8ZA 2JC3A 3P9QA 5AKZA 3RRZA 2ZUSA 1YGYA 1ZAKA 3G79A 4LDJA 1GEGA 2OBFA 3HYLA 1WB6A 3BZBA 3CNOA 1SR8A 4M7PA 1T4MA 5JXGA 4G8BA 4WESA 4K6FA 4GPZA 1Z4NA 5BN5A 3TQIA 3MGAA 4RFSB 3ZK8A 1IC6A 3GFQA 5JUWA 1XQ1A 2ZRIA 2EATA 1JWBB 1ENZA 2DMRA 2YIMA 2CMKA 2IW1A 3Q3IA 2BFFB 3LK6A 3MGCA 1SB9A 3I8XA 2FMHA 4EA7A 3A9SA 1Y81A 1CRZA 4FUQA 4B0OA 5F7XA 5ISMA 3ZBPA 3I8SA 2ZXUA 2HOQA 4NWIA 1ISMA 4QA9A 3EVAA 4EIWA 4G5SA 4B33A 2MYTA 3RFFA 1E61A 1FDVA 2ATVA 2J3MA 4AJIA 2I78A 3H13A 2OV8A 2HEIA 2OG2A 2GK6A 5HZKA 3QENA 4C08A 1V3UA 2IYQA 1GNLA 4U7JA 5L3SB 3OX4A 1NM5A 4RABA 5LFAA 4PLVA 5GQSA 4AJ4A 4UCWA 1LS1A 3O8QB 1WPQA 4RVNA 5LKAA 2FPPB 3SEZA 3D1VA 2HL6A 4HNRA 1P81A 1U28C 2C5EA 4NZYA 4PXSA 4QPPA 5DSXA 1C8KA 1WJGA 4EJSB 2B8EA 3JPWA 1OJLA 1XL0A 2P9YA 1IH8A 3LY5A 4LDNA 3NNNA 5G40A 4Q4CA 2J4DA 1WUKS 1VMDA 1ZJWA 3EISA 4IG4A 3HCPA 4MEBA 3QMMA 3I1YA 2AN5A 1WB4A 1Q1ZA 2IQ5A 4M76B 5GJWC 2EF0A 2WLTA 1JJIA 3BMNA 1J8VA 4MCIA 3O03A 2J3LA 3PYLA 2H85A 1E2NA 4Q3KA 2QBYA 1ECBA 3DCIA 3OHMA 4RPGA 3UXYA 2JRCA 2PKCA 4HGZA 4QNNA 1BSVA 2PZKA 4JYBA 4LXTA 3UVEA 1IUPA 4BNUA 3LL4A 4BLWA 5EN4A 1QGZA 4UKDA 1J0DA 4MVJF 4N5MA 4I55B 3DPUA 2XTZA 1HXHA 2Y4OA 4GGPA 3V8BA 4BN4A 5A7HA 5KC8A 1XEXB 1HH4A 1H9BA 4RAQA 4QOFA 1TCCA 3RSHA 3F8SA 3G59A 2KW5A 2ZR9A 3ZV5A 4MRNA 1FP2A 4Q7KA 4OP3A 3SI7A 4RCVA 3HM2A 3IULA 5THQA 1NUSA 3V5NA 3PLNA 3QXGA 1E9CA 4DR2B 2YHUA 3LRXA 1S2MA 2QOEA 2IYSA 5D5QA 1EESA 5T6MA 4B4OA 3P71T 4EUNA 5CA1A 4ZAWA 1EFLA 4JVOA 3ZK7A 5EZYF 4NBKA 4QJ5A 3OCXA 3MWDB 3I0NA 3VR6H 1XTIA 4WJZA 621PA 4NCIA 2X13A 1P1FA 2G1UA 4BQSA 1MH1A 2ODPA 1WSWA 2GS9A 2FMFA 2HUPA 2JGDA 2ZIUB 4S1TA 2IXBA 2YV1A 4HXYA 4W63A 4UW9A 5DSTA 2PJZA 4QUKA 4AYWA 1ADBA 1A8PA 1NBEA 3VYTB 3CMMA 1ZCBA 2PY6A 1FY2A 3FHJA 3WWZA 4CGYA 4KQWA 1YMVA 3JQ9C 4K9LA 4E70A 5INTA 1D07A 4EYGA 2G77B 2WUFA 3EZGA 2IHYA 4NJEA 2XA1A 4YUXA 3NJ8A 1KI6B 4MPJA 5TMDA 2R7AA 1SU6A 2XBLA 1EXWA 1FNBA 3GDFA 2CEKA 3UJCA 3BIXA 2AG6A 3JD3A 5K3BA 3WNBA 1UWVA 1GGVA 4Q4AB 4QPZA 5DM60 4HWGA 1Z6GA 1R9JA 1XQ6A 4WA8A 4TVKA 3FRHA 1GQRA 2OZLA 2W2VA 1PN3A 4LS3A 3WWOA 1GYQA 3H9QA 4J03A 5JBIA 1O95D 2AG8A 2I67A 1YRLA 2W8BA 1NQOA 4WN9B 2J5BA 3TIVA 5JO9A 1HLDA 3M49A 3V4PB 4TS9A 1G9XA 1SD1A 1E2EA 5JH7B 1CFZA 1T1RA 3AWDA 1H6CA 3HHEA 2V58A 1JDZA 4DV7B 5T3UA 1DUIA 3DOOA 4FKMA 1X1DA 2P4HX 4HH0A 3TTUA 1UR5A 1QGDA 4G8DA 4QOEA 4A5OA 4MUNA 1WSBA 1J0CA 1E2UA 4PPNA 1L5HA 5DRTA 1FYWA 2D1YA 4QQFA 3H17A 3C16C 3GP3A 1R4NB 4HWKA 3TPCA 3CLUC 1FP4A 2C42A 4G4GA 1THZA 4RFVA 1YTLA 2A78A 5KSZA 1E2LA 3EFEA 2V1UA 5EESA 4IDGA 1PR1A 2XOEA 1U81A 3NAGA 4P3OA 1USUA 3M81A 1XXLA 3NBAA 4K9OA 4PXYA 1Y4UA 4TKUA 1PDOA 1S9DA 2EQBA 4RVFA 1CY8A 5DYTA 5A62A 5K45A 5IAGA 1XMPA 3D8HA 3ONEA 5AOVA 1UKCA 3K94A 3UJ6A 3H8VA 2GDJA 3OPYB 4R1UA 3HKBB 3AKCA 1N2HA 4UD2A 2WFZA 1WCV1 1OKKA 3G2IA 3KZ1E 1JVNA 4IH1A 4KQ9A 4LXHA 4F8EA 4PYJA 5HQ3A 5BV7A 4YJFA 1UP7A 5EHQA 1P31A 4NMHA 3ZPXA 3PFIA 1Q20A 3E7PA 4E5MA 1CR4A 1P75A 5I4KA 1KP3A 1L5SA 2EZ4A 3D6MA 1KE1A 1VI6A 2ZRAA 4BO4A 4P35A 1BG6A 2DERA 3AC0A 2QX8A 3DGEC 3GD7A 3ANTA 3LH5A 4I6GA 1QVZA 4B6FA 5KWJA 3WWYA 5L3QA 4D99A 5JCJD 3V1KA 1TO2E 1RLOA 3L0ZA 3UT5A 1LEHA 4ZZ3A 1EXNA 5A3SA 2FMIA 4MR8B 2C5HA 2GPSA 5K0TA 2AIRA 2JBWA 4Q3OA 3HV2A 3L1JA 2ZJ4A 4OQXA 1AKRA 3ER9A 3B9QA 4M1OA 4IO0A 1NJ5A 3E15A 3L0OA 1GU7A 1SC6A 1QAMA 4NYMQ 1CKEA 3HB1A 1AX9A 4KSCA 2ZXFA 1O0CA 1FS5A 4O2AA 3PWSA 1N2IA 4ZHSA 2H1OA 1JQJC 1GAJA 5DCLA 4KH0A 3YASA 3S2EA 2RD2A 4HYQA 3QLTA 2PU5A 1B74A 3UA3A 4H7FA 1CZUA 2BKEA 1L4HA 1I6WA 2J7PD 1MW9X 4X6UA 1HRKA 1XF1A 3ZHUA 4F1KA 1OMOA 1TU0A 2ZUWA 1EXMA 1R8JA 3B5EA 2QLJA 5TMBA 3ZU6A 4CYMA 5ARCA 4P3XA 4GU5A 4KIWA 2PUVA 3AY3A 1SXJE 2IF2A 3O4IA 3QPUA 3R5FA 4IUBS 1ZW1A 1WLYA 2PRYA 3TN7A 3RYIB 2OQIA 4B7ZA 5DGXA 3DUFA 3IEPA 1SVKA 1BE6A 4WZZA 1LY1A 1K6JA 1J49A 2BGKA 4OIFA 1KZHA 3WC4A 1PFQA 3D64A 1L5NA 2Q0HA 2JBAB 3P2YA 3VAYA 4LOHA 4WOBA 1RFGE 1KH2A 1QJ4A 1ZGHA 2UZ1A 2GLXA 3NBMA 1IVNA 3G49A 4B7UA 4G0NA 4OA8A 4LTDA 3TVTA 3LBHA 1Q6YA 1WMAA 1XV5A 3IIIA 3U4IA 3TZQA 4BVHA 5AVWA 3E0XA 5BSHA 3WNQA 3O91A 5IUNC 3IEMA 2HQRA 4JI2B 2AUNA 2JK0A 3WGMA 1LSUA 1VKRA 4BWVA 1NU8A 1X6VA 1M2OB 2P75A 4MLDA 2HPHA 2IHTA 3LOQA 2OGZA 2WPDA 4NU0A 2Y1DA 3KL2A 2N42A 5TEWA 4MUGA 1BDJA 3E84A 2ZVQX 1RM3A 1N6RA 2YRFA 3QYJA 1H2RS 1F4PA 1MR3F 2O3SA 1BS2A 2ID4A 4M0FA 1Y4ZA 4NDNE 5CDSA 1NV9A 3R7WB 4UBKA 3WLIA 2HMTA 4LZAA 1BVRA 4ZCSA 5DSZA 1XZBA 2F3SA 1L5YA 2X5OA 5LBIA 3K70C 4RKYA 3B6ZA 3G2LA 1EVJA 3Q6NA 1UJ5A 3STXA 1P1CA 2QN1A 2YHIB 3AXTA 1G6KA 4ATNA 4MA0A 4EG8A 4OQZA 4C4TA 3WGUA 2DBRA 1Z68A 4QELA 4KGDA 1DELA 2PCLA 2BFCA 4JHLA 3KTDA 1JWLA 1JKJA 2EJWA 1P8JA 4MS3A 1DBPA 5EKDA 5KWIA 2G04A 2WYWA 2H1VA 2UYOA 3LA8A 1UADA 4BP8A 1TIKA 2RG1A 3SHQA 4UZSA 5LOVA 1EGQA 4ADSG 4D81A 1DARA 3USES 3NV9A 1ORIA 1KAOA 2I71A 3GFRA 2EGUA 1O8BA 2VRCD 5AJHA 4Z4HA 4HB3A 6GPBA 4ABYA 2OORA 1GUBA 2EZ8A 3EIQA 4UEJA 2VTBA 4Q9HA 5TEVA 2CVHA 1K5PA 3C5VA 4BO1A 1RRMA 4RADA 3UAYA 4J0JA 4JVLA 5C8XA 1XTVA 4OHCA 2VPXA 3N5CA 3KT3A 3F5DA 1YR9A 2C3OA 3BL5A 3P2OA 1P2FA 4M8LA 4U3JA 3A6PC 2JFNA 2QRZA 4JJ8A 2QZ9A 1E3WB 1LB1B 2YUIA 3TEJA 4BMXA 3FNQA 3PIRA 3G88A 1SUSA 1Z2DA 5C80A 2G4CA 5C1PA 1R4NA 2WVJA 2I9PA 3MIZA 1P5FA 1E5XA 4CT4B 4F7DA 4G2TA 1EFVA 1L5HB 4A10A 4L5IA 5DYGA 3SIPA 3EZ6A 5CHEA 2IU6A 1SCUB 4PC3A 1WZ2A 2CBGA 4AS1A 3HB7A 4ZOAA 3UV6A 4BVKA 4ZTBA 3K9CA 3QLJA 4WZBA 2GT1A 4JR0A 4QGAA 1P6QA 4GRAA 4CIBA 1Y8QB 1XFDA 2UZ1B 3IQDB 1LJ8A 3MPUA 1A88A 4FDVA 3ZE0B 2C9MA 4RGVA 1HDGO 3RHSA 2Y05A 2QVCA 4GE0A 1U2PA 3EVZA 4AN1A 5KB3A 4BFLA 4M1EA 4LV6A 3QBTA 1G18A 4XWGA 4H1VA 5EXTA 1WULS 3CLHA 1I13A 4BNXA 3DO8A 3H5LA 3F6YA 4MUEA 5JMPA 1SVIA 1KGDA 3SZMA 4JI7B 4PSDA 2X3FA 4MYHA 2DLDA 3R0QA 4CG3A 4EO7A 4K6KA 3ZWNA 1PT5A 2XMPA 4OX9B 4IVRA 4RXUA 2NT3A 3C6ZA 4KFTA 4TTJA 4U8GA 4UULA 2GM3A 3S5UA 1HE5A 2UUOA 1E7YA 1VI5A 3BJEA 3JU3A 1Z15A 2HJ9A 1A8UA 1IZYA 2DHCA 3ZWAA 2HF9A 1C0KA 4PFJA 5LYJF 2A9PA 5AI0A 4YQEA 3EBOA 2M6LA 4ER5A 1OI3A 1YJ8A 3MC1A 4GMGA 4MYDA 4UUBA 2VJKA 4XRGA 4KNYA 1X1CA 4H7JA 4RZ2A 1CK4A 1S6YA 2NUBA 3R77A 2YV4A 4MO9A 4O4LF 4DLSA 5BQXA 1N0IA 4C0HA 4WKPA 1JALA 4C5CA 1X87A 2GN9A 5MGNA 2H7XA 1US8A 3PWKA 1C1HA 5H80A 2CXSA 3A7DA 3BMCA 2AYXA 3KG2A 3HZOA 4GECA 1U1GA 2JGRA 3OTWA 3W4KA 1IOZA 5C3MA 1E6WA 3ROXA 3K8OE 1NVDA 5AVKA 3ZD6A 3G8DA 4OHUA 1KTVA 2VZ9A 5FEUA 5JZOA 3EEFA 4FFRA 5EL0A 4B75A 2MSKA 4ZI7A 3K70B 2H5LA 3E9QA 1ESCA 1LK7A 4I81A 4N5DA 1L5GB 4MUXA 1MT0A 2FSUA 1XTRA 3N2LA 5EJ7A 2QX6A 3PUWA 2RBGA 3BK7A 4ZDJA 3AR5A 4FOSA 3DBHA 3WGQA 3QP9A 4RHCA 5IPFA 5DBOA 2O5EA 3PD0A 4FEEA 4C89A 4EW3A 4RS4A 4L15A 6REQA 3KJQA 1DCMA 2QP3A 3VR4A 4CEIB 4BV3A 2GEUA 5B57C 4C2BA 2EQ5A 1ZK2A 1T5LA 2G9ZA 3C0KA 3ZIUA 4C05A 1RJDA 3C97A 2H4XA 3WP0A 3ELWA 4RK4A 1A76A 1D5CA 3FTFA 3HVUA 3ESQA 1GUAA 3A37A 1Y82A 4XWAA 1V0JA 2XR1A 1T9BA 1RJEA 2ZB8A 5TMPA 4G23A 1CUUA 1VHLA 1YRYE 2KX7A 3ESAA 3GNTA 4WWHA 1IXSB 4MV1A 5KNDA 4FM9A 1YQEA 3ROZA 4YRQA 1UKAA 1G6HA 2AZTA 3NWEA 2X4LA 2XE6A 2REBA 1B0UA 1G7RA 3RREA 3WIVA 5DHUA 1ZN9A 1C9MA 2IF0A 1AOXA 3KSDO 4RLHA 1RACA 5EJAA 5C32A 3U3RA 1L8QA 5JNLA 1AKMA 2JF0A 1OBFO 1YRBA 3GZNB 3T3PB 3L93A 4F4FA 5LLDA 4NK4A 1DWOA 3B6JA 3FBTA 4XVRA 4CMIA 5LIRA 3V48A 2X5KO 1RXYA 3AY0A 4NESA 3UAGA 3VHXA 4C22A 4EGQA 1G38A 1J5XA 4QDXA 4G5FA 4G1FA 3PPWA 3QXXA 1N6NA 3A14A 1SOVA 1KKUA 721PA 2P78A 2BE7A 3QUSA 5BXYA 2BFMA 2WHQA 4XQEA 1USGA 2OZLB 4CETA 2W2PA 2RHMA 3I83A 1QH1B 2OCAA 4NE2A 2PT6A 3EDOA 4O5AA 4WCFA 4AG5A 6YASA 1Q91A 5JAZA 1E32A 1GTSA 4D6YA 4J0CA 3GEEA 3N2YA 5FI5A 5FL7D 5DHRA 1J07A 4BQRA 4DCJA 4MRVA 3AUUA 1VRVA 1SA0A 4UXIA 5AJXA 1WUHS 2AOWA 3DYVA 4TOIA 3UHFA 2DKFA 4B6EA 1EBBA 3KKNA 1MB4A 4TL8A 3JV7A 3DMTA 5DF1A 5BNIA 1A98A 2Q5FA 4PN3A 4LTNA 5I6DA 2QY9A 3PGLA 2CY0A 2QL5A 3CVYA 2J48A 3A26A 4OA5A 3CF6R 5CYGA 2K5UA 3CHYA 5DXFA 2RH9B 2B7CA 1IBSA 1NMYA 1EFRA 1A8HA 2IIBA 3KQPA 3M9LA 2RK3A 3A1VA 5ECGC 4C0LA 4S0ZA 5KYYB 3U4MA 2DPXA 4KPUB 4S0XA 1BHQ1 3SYTA 4Z3KA 1NURA 4QZVA 2PZLA 1U0OC 4J4HA 3D4OA 4NNJA 5HJ2A 5HKKD 3W5DA 2C5AA 3C7CB 3VDQA 3VDXA 1M72A 3THXB 4P0TA 1EDEA 3K1AB 3VPXA 5MN5A 4RD3A 5AXCA 4FT2A 5IC5A 4JQSA 2WWRA 4TQUS 3NDIA 2Z0MA 3AEUB 3KKZA 4UE3S 4AG3A 4ZQGA 4ARCA 1LLDA 1TI7A 3G9UA 4PRKA 1NMXA 4V0OA 4ZHQB 3CRW1 3DEHA 4Y1RB 2IYWA 1Y6JA 3UJ9A 1Y6FA 2C7VA 1X0XA 4OJYA 5A6VA 3HO6A 3GUHA 2KS6A 4W1SA 3IR5A 4KXYA 1OC2A 2BAGA 4GKBA 4H08A 2EDCA 2O14A 4IAOA 3W9BA 4IO1A 4FB5A 2Z83A 1YO6A 1BX1A 1B8PA 1HKHA 1XF9A 2GZ2A 1KARA 1ODFA 1RVV1 3QOXA 3AV3A 3FPGA 4GSKA 3UKOA 2ZU6A 3KP1A 2I4OA 1GPBA 3ROPA 1E7RA 3MT9A 2ZPTX 2J6BA 1EVZA 1H5QA 1UWCA 2A88A 4FOLA 1KP9A 4LOLA 3ZZ1A 4WJLA 4QWWA 3OQIB 5DTIA 1B6SA 5KDLA 3TBFA 1T9DA 1SBNE 3ZD9A 4QBHA 2JIZA 3VZDA 1JKMA 3VH2A 1SHTX 1MRZA 1L4KA 5CFLA 2Z3VA 3BEDA 4XUDA 3UMVA 4NBSA 1TAUA 4E6EA 2QM3A 5FQNA 2GUWA 3VAAA 4D9MA 4LJSA 4MZXA 2W2KA 2IZ6A 5H9VA 4NHEA 5JALA 1MPTA 3JQ7A 4RJLA 4DV1B 1CV2A 1L8OA 3R4VA 5C51B 4B4VA 3HUUA 4A27A 2AFHA 1N7HA 4IIGA 1SMKA 1TTTA 3A3NA 1E64A 2BEJA 4C4ZA 1FUUA 1CQIA 2AKYA 3FWZA 3KU4A 3AFIA 4HXEB 1IG0A 2O2GA 3COWA 3N8HA 4MQ5A 4CU2A 2XD9A 2OYCA 5IEBA 2QJWA 7MHTA 2A33A 4R3UC 3SHWA 1HYBA 4B5LA 4ZFNA 4I5FA 2GA9A 1X8JA 2HBYA 4NOMA 3HCAA 1S96A 1E94E 1ZI6A 4B31A 4BTLA 1BE8A 1HF3A 3DEJA 1KTIA 4RZ3A 1FVHA 1KEUA 1RKXA 1DG9A 1WMFA 4PGHA 2O8CA 2QRUA 1CZKA 4REMA 4WOPA 1JGTA 1ODSA 1XDSA 4E2FA 3MUFA 1SAYA 3UGKA 2R1TA 3HABA 1L1EA 2FF7A 1DX9A 2MYNA 4AJLA 4Q7QA 2C83A 2FX3A 3H05A 2ZUFA 4CMHA 2ZKIA 1N5OX 2P2NA 2FR1A 3BD8A 4I19A 2QRVB 4AIIA 3N6VA 5A9SB 2GAIA 3NIGB 2PMEA 3MELA 3OFNA 4JLAA 1ODTC 2HJWA 4S2EA 1YSCA 5K3FA 4PNEA 4OXRA 5F9HA 3P9CA 1E6KA 2NXEA 4OMDA 3ZDYB 6LDHA 2I03A 3E18A 2FSIA 4FJ1A 3GDHA 2WFLB 4Q19A 3S2GA 2B69A 3A1FA 3BYZA 4DL9A 3H2GA 3P96A 4CMEA 2FN4A 4EW2A 4ZV4A 1V2HE 5I8PA 2J6HA 1WHSA 5AW2A 1GRVA 3LKZA 1U9IA 2X1VA 3DVQX 3LT2A 5D3QA 1CJMA 4URVR 3OJ0A 3DXXA 4Y6QA 3WK4A 1P7VA 2ACEA 4CHGA 4F3RA 2ZTSA 1U98A 3G6KA 4KV7A 2QM0A 2DYKA 3OETA 1D1SA 4Z8XA 5TS2A 3O83A 4LHYA 2FPWA 1RXWA 2CSXA 4CEJA 1ARZA 1LK5A 1XDGA 2ZBEA 3FVWA 3ABQB 5HE8A 3JQFA 3SG0A 1RWXA 3TOXA 3RVQA 2CLMB 4O6VA 4QJ3A 3P26A 3BCSA 2A67A 2Q6LA 1BJRE 3CZ4A 5KSOA 3JRNA 3LPCA 4G81A 1KEZA 5LA6B 3UH1A 5CTJA 2SKEA 3ES9A 3W5CA 1MORA 3FMVA 4ZOBA 4BX8A 1JQ3A 5BSMA 4QM6A 2LUOA 3CLUD 4CPDA 1HDIA 4DM3A 1OC4A 1IEXA 4D46A 1L4BA 2I6TA 1QQ7A 1N9GA 4FN5A 1Y7LA 5BSEA 5FHQA 5I7UA 2BT4A 1BE1A 2ZPAA 1ONPA 4AK9A 4D6PA 2PGXA 2NO5A 2ORVA 3U44B 2XYPA 1QDLB 2W8ZA 3KFVA 3OM9A 3K5IA 3CINA 3MK31 2AE1A 3QFTA 3X1JA 4BLQA 3NUZA 4EPYA 4JEIA 4C4XA 3Q8LA 3Q3GE 5KWSA 4M1KA 3CZAA 3DPSA 4ZANA 3IMKA 1G17A 5FORA 3T7AA 4R2HA 2PMCA 3A6GA 4WXPA 5ITZA 1ADGA 2GBLC 1GT91 3QNWA 3PL5A 2NVUB 2VAWA 2P8JA 3DB2A 3HL4A 3G2JA 1CNFA 3QE4A 4DUGD 1YQQA 1KXJA 3KDPA 3ZGXA 3OZFA 1XFAA 1JQ5A 3B7WA 3ND9A 1VYVA 5C5CA 1TEHA 4E7PA 4OLAA 2ATEA 5DHTA 3DOFA 5CYOA 5IZ4A 2Q0QA 3SBEA 1M1YB 2DAPA 3OOSA 3HP7A 5EJEA 1FPMA 3WMGA 4NK5A 2JB9A 1ZOIA 1EGVB 1K66A 4MUJA 2TSYB 4X8OA 2Q2VA 2XCIA 1YU9A 3I3OA 4OBBA 4CEHA 1N2ZA 5GOZA 3T94A 3ZCSA 4H6PA 1F48A 4NU6A 5HE9A 1T6BY 1O96B 2QKYA 5DX0A 4D80A 2GQ0A 1KEWA 1LTKA 4OXNA 5FXMA 4DWJA 3O8OA 2M1ZA 3A1EA 2FMUA 1GG8A 3BGOS 3KB6A 3QIAA 1LRKA 2HU5A 3NOOA 2YIVX 1A77A 2W98A 2GXSA 2ZI6A 3BA1A 2VR1A 4NX2A 1ZMXA 1KZ1A 5ESRA 2GK3A 4AQDA 4LZPA 2XD4A 1WQ1R 5K01A 1LC3A 4CUZA 5F2NA 2I2CA 1EE2A 3TLGA 4OXIA 1NDHA 4PHGA 3WMEA 4ZTZB 3COJA 4TM7A 3UKDA 2IKQA 1FYFA 1I9GA 1OFUA 3TFQA 2JZCA 1F3OA 2JHCA 1KHHA 2JATA 4RVGA 3SVLA 1U7UA 3QNMA 4F86A 1TU3A 3FPSA 1XCBA 3OQHA 2HU8A 3B3QA 4MV4A 3BJZA 3QW4B 5K6AA 1DB3A 5FLYA 5J40A 1E5VA 1LV7A 1SIUA 3I5UA 1HBJA 3ELUA 3RIMA 4D9CA 4G25A 2UUPA 3EIUA 3PGVA 5JY6A 1Q22A 2IIVA 4M8SA 4Y1RA 4X66B 3INNA 1BXZA 4X6XA 2Y3IA 2XJ4A 2BFEA 4CEJB 4HZUA 3LUKA 2GDZA 1DWPA 2H1CA 3AVWA 4IIEA 1XALA 5E1MA 1NLYA 2FUG1 3EXHB 2P41A 1VL1A 2IUUA 3N3BC 3D0QA 4HVTA 1N77A 1SBYA 2NWQA 4P22A 3ZXYA 3QA3E 3P2MA 4TROA 2XUFA 3TJMA 3ZEAA 4E4RA 2QLTA 5IARA 4GT1A 4EX6A 5DMXA 1JKXA 4MMYB 4XM2A 5KOHB 2FV8A 3QFSA 1PUJA 2RGAA 3UJBA 1QG0A 3GT7A 4GKVA 2JDID 3ISVA 5IFLA 3ND6A 4MS4B 3SFZA 1ZM3A 3LDAA 3WP1B 1VTKA 2NV2B 3C43A 4JYAB 3AR7A 2IWRA 2OXTA 2EIHA 1QV7A 1U65A 1WAMA 5G41A 4BFSA 2BGIA 1GAEO 2QMEA 4XR9A 1AVTA 3C48A 3O2NA 3WGVA 5K0CA 3PQ5A 4QUDA 3ASVA 1KYXA 4BLTA 3CR7A 5A9TA 3CPJB 1QTQA 5E1OA 5C52B 1RRGA 4MVJA 1OFUX 2JIZD 4YV0A 2R1TB 5A4AA 1RDFA 2B35A 1L5RA 2Q7OE 4PG8A 4LF6B 2O07A 3T6KA 1IBKB 1OWMA 4D0RA 1B0AA 5FKJA 3DHVA 1G9SA 4JJKA 5JSFA 4YN3A 3ABRB 3ZHSA 4DABA 3LHKA 4LOKA 4WN3A 1OHHD 1AA9A 2JFYA 3BTUA 5ERYA 5J3JA 1BEZA 4L50A 4LMBA 3CLVA 3W1WA 4FXOA 3WKBA 2QLBA 3HCOA 4G37A 2IEYA 4UM8B 1V2GA 3CLSD 3ZI4A 2AX3A 2HKIA 3EF1A 4D5EA 1I4LD 4EENA 4A0RA 4DANA 1XQYA 2IODA 4RGQA 2JPDA 1KIFA 3W5IA 1CBUA 4MJLA 1Q17A 3ADDA 1MC4A 3VU9A 3UMBA 4CMIB 3QPCA 4C7BA 2VF7A 3IB6A 2QZJA 5TS3A 4EJ6A 4EMTA 2WB2A 2GD1O 3RT9A 1NQUA 5AUOB 4N48A 2ZWPA 5G3ZA 1AV6A 2PGOA 1I2BA 1U9JA 3NM5A 4N7RA 2OMKA 3F0TA 3ZE7A 2ONCA 5TJHA 1U99A 3LLMA 1YR8A 3CLSC 3WY9A 3OX1A 4AKTA 2D1RA 1VXRA 1PR4A 5JAHA 2P68A 1UT6A 4XE5A 1NYQA 2FZVA 1VCNA 1B00A 3PLAE 2X8LA 2BZ1A 2K87A 1Q1AA 1HZZC 3DLTA 4INJA 5ALQA 5BNFA 1TYEB 1U90A 4CIAA 2DQZA 1SGWA 3HDJA 2R1VA 4PYLA 3SXUB 1ECFA 3AF2A 3E22B 3ORQA 4MV5A 1SU7A 2G5PA 1ZCJA 1CERA 1GSAA 4ECEA 2KSQA 4M0LA 1N34B 1AF7A 1PR9A 1E0SA 3HPQA 3RSQA 1W46A 2I1VB 4TSFD 3O21A 2DFNA 5BNZA 3K09C 1XI2A 1CULC 3CPEA 2XH8A 3EZ9A 3PNPA 3Q7RA 4J1TC 4Q7JB 3IUBA 4ZDWA 2ZRGA 1W47A 1V48A 1W4ZA 3H2KA 4FXPA 2OZEA 3FLMA 3K96A 4FN4A 4IFBA 4UNQA 3RH0A 2ZRKA 5A7FA 4D97A 3FCOA 5KPDA 4OOEA 3TLGB 2P90A 2QY6A 4OSEA 1EI9A 2WU3A 3EPPA 5BV8A 5DCUA 1BVYF 1TNDA 3QWHA 1R3DA 1USKA 2B7LA 4IJMA 3ITDA 4TXHA 3NGXA 3T06B 1YAHA 3K2IA 4HFNA 5M34A 1XAHA 4NQRA 5K4HA 1PDWA 4Q3CA 2X7HA 3KKLA 4DNXA 3E23A 4Q7EA 4WXYB 2XKAA 1KDVA 5U4XA 1O77A 4S3MA 1R0BA 2G06A 3PU6A 3RVSA 3V4OA 2BR4A 2XVMA 4UASA 5I47A 4D4IA 1LPNA 4WGGA 3AO0B 3HMKA 5EMHA 1W35A 2OGTA 3U16A 5A4MS 3PF9A 5J2TA 1CT9A 3DNPA 1KI3A 3B52X 4KNWA 1U9CA 2ZAIA 1K4YA 3W6PA 4C5BA 2OKGA 3OMWA 2PX3A 4UOEA 3LQYA 2XUGA 3CPHA 1ZJ5A 3K9GA 2C8LA 4ZVUA 2HBQA 2WAXA 2DWUA 1O94C 5BSRA 3S6JA 5EP4A 2PZBA 2ZJBA 1QMPA 4MWBA 1HY3A 2Y92A 3MIIA 3U6BA 1ZJZA 3PDUA 2DVMA 2I76A 1J20A 1D0IA 1PSZA 1QQ5A 2HZ7A 2XQVA 3A0RB 3IO5A 4CR6A 3Q15C 4J90A 2FMTA 1R6UA 3MB8A 4IJWA 5FP0A 4ZDKA 3K0CC 2JBHA 1H4VB 4O33A 1GA6A 1GPH1 3GRFA 4KI0A 4ZAZA 3SIXA 1NR5A 3H16A 3C3WA 2PBFA 5TPWB 3KSUA 4J1NA 4UTOA 5FR2A 3V9PA 3ICPA 4CV0A 3IP3A 2R48A 1VECA 2NZYA 2Z5LA 1H3FA 1SULA 3EA5A 3NX4A 1THMA 3O94A 2J5RA 1E1CB 4JDPA 2F8TA 3C6BA 4M1SA 1EFVB 4YALA 2PJRA 2R5WA 4RVDA 2JNWA 1EJ0A 2J7PA 3AKZA 1YUNA 1WVIA 4JWKA 3HQ4O 1HDXA 3U17A 2GZMA 3FX2A 4PPQA 3E2IA 3VO9A 5KX5F 2LXNA 1DO0A 2WVAA 4FONA 4RPHA 2J32A 4KR2A 4NPAA 4CL8A 3JQGA 1KEEB 1HX7A 3PHCA 1KVRA 4YRBA 3HC7A 2EWVA 4LHXA 5KAPA 5DGIA 2PJUA 1EP1B 1SCKA 3QV1A 4F85A 4A6DA 1OXUA 4M9UA 3DEFA 4P80A 1K7XB 5BWNA 1J1UA 4CR7A 1RQ2A 2V98A 4Z0TA 1ZVKA 1CHDA 5I3ZA 5HIMA 4FDMA 1PG0A 3OM0A 5AK3A 4PHTA 4FZ5A 3R44A 4FQ5A 3UICA 4XVUA 2DLNA 1JXOA 1ISGA 4BUCA 1W0CA 5HTKA 2GEVA 2R8YA 2REQA 2A86A 2DSNA 4RMGA 5LZ2A 5U9CA 1VHDA 3GT3A 1HLFA 1Q1BA 2FVYA 3MTIA 3PT5A 1HL7A 1Z06A 1PYGA 2E9SA 1MAAA 1PR2A 3RT7A 1U3GA 1KERA 4G85A 1AS2A 2NVWA 3UXEA 1V11A 1JFRA 3EWNA 5E6SA 4QTUB 4A1OA 4BVAA 5LNK1 1XEXA 3G17A 3AM3A 3OSZA 3D6HA 1IM5A 1E1KA 2AEFA 1RJGA 2ODAA 2YMLA 2ZUBA 4IDFA 4YRLA 2HN9A 3ADPA 1T3SA 5BQPA 3DFMA 4IOLA 3C39A 2PM8A 3DA8A 4GNKA 2GTPA 3HFRA 3RLFA 5EIXA 4HB2A 2VPYA 1N2XA 1Y3HA 2WJ4A 3DOIA 4U2KA 1QCYA 3F3MA 3ONWA 3SHOA 5DBFA 2YS7A 4JUDX 5B1DA 5CB4A 1XPOA 1O1YA 4Q21A 1O95A 5GPBA 4RESA 2NXWA 4UUMA 3E6AA 3U9TA 4K9KA 3UNXA 3U09A 3EJ6A 2FPLA 3FDZA 4M86A 3FOZA 3LL7A 3FYUB 2RCNA 2DECA 3HRIA 4RY8A 5E7JA 3M4YA 4B83A 3CG0A 4B2PA 2FN9A 3GD5A 3LHDA 1MV8A 3A4MA 4W1RA 5IMSA 4WNAA 2RAPA 2OO7A 4DBZA 2W2MA 3KQNA 4XYBA 7AT1A 2DPYA 3EXG1 3NJRA 4OXQA 3PQFA 4HNHA 1GIAA 1UZAA 5JHHB 1GFIA 3X43A 2WE8A 1TMKA 4BZQA 1BH6A 1B2RA 3E9ZA 1TYDE 4O4JB 1TZJA 3A9TA 1H65A 1BYIA 2DWCA 1Y9DA 3A6LA 4RW0A 3P2KA 3IP9A 4LOAA 2GZAA 1ZSYA 4JX9A 1KQOA 2YY6A 1COWD 3GEIA 3JALB 3QY9A 5BQ5A 3DZFA 5SYMA 3MRSA 2N1BA 3F98A 3IE0A 4I4LA 1JG7A 4XQ9A 4EQ6A 1VMKA 1U0SY 3M7IA 3UJHA 4B8ZA 4BC0A 1LDMA 3PC6A 4NMLA 5KVVA 3MWYW 3GLIE 1M1ZA 1UM9B 3DLAA 3OIYA 3OQIA 2ERCA 3RV3A 3JQBC 1FNDA 4W5WA 1VLJA 1PTJA 2P4QA 3LXRA 4X60A 5KSPA 3UBMA 1Y7HA 5DM0A 4F9EA 2PBRA 3WLHA 1L6RA 3JZMA 4FYPA 1GAXA 4C0JA 1PLLA 1Y9JA 2DQSA 1GKKA 3O8RA 4DPMA 2Y1WA 5JQGA 1E3QA 2J0UA 5ULLA 1E3IA 2WZQA 3IXQA 4MW4A 5BWOA 1H1DA 3WK9A 3FBWA 1O97D 2ZI7A 4R7GA 2YJ3A 1UC9A 5AKIA 4KQ2A 4IWXA 4MWZA 5FBHA 1T15A 2C4KA 3VX3A 3MZ0A 3ZHYA 3S68A 4TTAA 4UHKA 1K8RA 3TM4A 3FTDA 1TMGE 4HRYA 4NATA 3X1XA 2I54A 1ZH0A 2VKTA 1VJ1A 1XA0A 3D6VA 2FZ4A 3C8DA 3HKEB 3T3NA 3K30A 3C4QA 1PTKA 1AQ6A 1Z5NA 5E8RA 3KJXA 1YVEI 4OU5A 5IBQA 5A0TA 4AU1A 1YH3A 4TV9F 4U9UA 3U5TA 4I5DA 3QUCA 4RLSA 1JS1X 1CDEA 5IAJA 1MB3A 3T7TA 4IVQA 1X9GA 3VYUB 4EFKA 5I7FA 3VHRA 5A1TA 4EPTA 1S3IA 3E1KA 3ZLVA 2WOOA 4UE2A 4Z0PA 3R20A 1U8AA 1D7OA 3H9JA 3Q5DA 3EXFA 4Z2AA 4F11A 4ICIA 4GDFA 4AJHA 1JILA 1T10A 2DULA 2SECE 1KEKA 4JGGA 3QEKA 3KR0A 5F76A 1PR5A 3U37A 4D43A 5TSDA 5NLLA 2BM0A 2CW5A 2Y67A 4BO0A 2OTCA 1NT2A 3QBDA 1QKKA 1BCRA 2FVXA 1GZDA 2O8BA 1G60A 1TLTA 2FUG6 4WXHA 1CE8B 2Z04A 4ZKDA 2IOYA 3CF2A 5ESWA 1UJCA 2G40A 1CUYA 1GQSA 1L4FA 1U8YA 2CLLB 5KQSA 4MAFA 4NCXA 2OBYA 2VJCA 4A2PA 2AOXA 1D2AA 4F8JA 1M6YA 1TCUA 3O5AA 1ZXBA 4FCTA 4CNQA 1U8XX 4C4SA 1BFKA 3H2JA 1H8ED 1NF9A 3LLVA 4JP1A 4UBOA 2G9NA 2F8MA 1PBNA 4JNKA 4UCXA 3SSNA 2VF8A 1CS0A 1CJKC 3NQ41 1TAHA 3HB9A 3TJRA 1DAEA 1NPYA 2O2XA 4HMOA 1KI6A 1OBVA 4PWZA 3FFAA 1ZC3A 3H7IA 1KZYC 4XIGS 3B6KA 4JLUA 3V00A 4PLGA 4Q05A 4EPWA 3DLHA 1FIUA 4AJJA 4FBGA 4JBXA 1VL0A 2H31A 3PTAA 4G36A 3TG2A 4MR7A 4FMDF 1LPMA 2CHUA 1A27A 1DI0A 2PQMA 4HB4A 5C7IO 1BZYA 1QIHA 2GN0A 4JKYA 4ZQIA 5GP1A 3QKTA 4F2PA 4H1UA 1NZJA 4KRYA 1LH0A 4DHWA 2AEEA 3OPMA 4OD0A 3HCBA 3HA2A 3GJSA 4LZJA 1SQ5A 1XPUA 2WKWA 1N1MA 1JQEA 2XDYA 2FZLA 2FEWB 1J99A 2GRAA 2HUNA 2PV7A 1N2OA 4UTRA 1B8NA 5AI9A 3Q40A 2VQSA 4NZ9A 2A8YA 1LF0A 4R0VA 2JD2A 5ALKA 3NVKI 5IAKA 3ZJYA 4DQKA 1F1BA 1G55A 1RMTA 3L41A 3PQEA 3KB8A 1R6XA 4RXTA 1QORA 3AOGA 3R3SA 1ULUA 2WF5A 4KYVA 1W75A 2PMBA 3RABA 5FTMA 4MJXA 2E4XA 1KYYA 3B3FA 5KHOC 4RLQA 4XJTA 5JTTA 1KL7A 4DIMA 1GPYA 3FPCA 2OSVA 1BVUA 5D8DA 5GM2A 4XR4A 4YHHB 2GAFA 3JR7A 2ISQA 1VL5A 2J4CA 2QV0A 2ZT6A 2GVZC 4WXMA 2YZMA 4YV7A 5GINE 1UBOS 1F0KA 2HAEA 3MB5A 1HMYA 1C9YA 1HDYA 1X7XB 1XJQA 1A5AB 2QRHA 2ZDHA 1V6CA 1LX6A 4LF5B 5A0VA 3MUNA 5IDQA 1JT2A 3VR2A 3CVOA 3L0CA 4V0NA 2LD4A 1GCOA 1O6FA 4XIIA 3F4BA 1WF6A 4NTZA 5HIJA 1MVLA 5ALYA 1LW6E 5GTDA 3IDFA 3C41J 1QG6A 4MRSA 3TMAA 1DX6A 5HKOA 3KFXA 1FUYB 2XQKA 1WCXA 4QXMA 1QMGA 2J30A 5CVUA 5GOTA 1V8DA 3RJTA 2H1SA 3MUEA 4LY0A 2VT7A 1OFTA 4F6LA 5AH0A 3C7KA 1FLAA 4F56A 3KTOA 3KT8A 1HNNA 1JRLA 1T9KA 1TVKB 2OORC 2WU8A 4ONEA 4JBNA 1BJKA 3F2IA 4DGSA 3GK3A 2B5VA 3E7DA 5K1ZA 1NDUA 3WE7A 4FZRA 1RXVA 3WVNA 4S1VA 3RWMB 2R6JA 3K6RA 2AUMA 1CNEA 1RWPA 1PX0A 1SD5A 1NGSA 4N3NA 5HQJA 5HZMA 2DBQA 4MSUA 1XZQA 2K7FA 2P6UA 3ZE1B 4BKPA 4YROA 3V2HA 2R86A 1I1OA 2W5UA 3FWYA 4N12A 3OFSA 2WMOB 1FX0B 3EODA 2CBZA 1ONNA 3F9CA 3FHCB 3QXCA 4W8GA 2YHSA 4RFSA 4RJTA 1SUEA 3OM1A 2A5FA 1U5BB 1XOIA 2Y99A 2C2MA 2WAOA 1XN4A 3LT5A 3TZCA 4Z4EA 3NBKA 1ZIDA 2CV0A 1TT5B 3ZE9A 5F2EA 2FEPA 3TR6A 3EC7A 4V1CA 3BQMB 2IS6A 2IHNA 1Z88A 4L22A 4KIUA 1JN0A 1NI5A 1Z4QA 2B8TA 3RFXA 2C04A 4PX2A 1WDTA 5FWYB 1IBRA 4CIWA 3L4KA 1UBGA 2EGHA 2W43A 1NDQA 2JARA 4LRWA 1G8HA 3H4VA 4CR8A 3ZHZA 2H1WA 1WXDA 2HADA 4ISBA 1ABBA 1QFJA 3RK0A 3ZQ6A 2EZTA 1C0LA 2X41A 3MT7A 3ETLA 2FRXA 4GX2A 1ANKA 4WLNA 4B85A 1CUZA 3I39X 2AQIA 1KPGA 1PZNA 1BCSA 3HBMA 1J2TA 1ZN2A 2CL0X 2QRPA 5JAUA 3EW9A 3FCUB 1SIOA 2UYGA 1U2GA 2GYWA 3FJYA 1KFBB 3OZEA 3ZIAD 2RKBA 2J0UB 4HOYA 4RV4A 2GFHA 1QIDA 5FT9A 1K8XB 1FX1A 4LV8B 3R7WA 5BQFA 4N49A 5K6TA 1E5LA 4EHFA 2PYDA 4I2NA 4QU5A 1JE0A 3ZGOA 5SZIA 2PUAA 3S7TA 5J47A 3WKCA 3M5CA 2OPBA 4MB6A 1K7FB 5LB4A 4A0GA 2P2LA 3K2QA 2NSJA 3BN3A 3QMVA 1RTKA 2A5YB 1W0KD 4EKYA 5CU7A 1LS6A 3KE8A 5CA1F 2J9RA 2ZAYA 2MYPA 4POOA 2R8PA 1GZUA 1TE2A 3VMMA 2F7SA 3HJTA 4MHOA 2ZWOA 2OHJA 2PXAA 5DN9A 4RA6B 4D9BA 1U4SA 5JEDA 3GI1A 5B7PA 3RC8A 4ROTA 2VJAA 1DEOA 3G7SA 5JNWA 5GJBA 4QYWA 4ZEOA 1NN0A 3VV3A 3RUHA 3ILXA 5DTEA 3TLXA 4A0FA 1CEYA 4QGBA 1R10A 2ZU0C 2VCEA 2ZVPX 3UTDA 4BFCA 2CJWA 4GBED 2GYVA 3G6WA 2X0KA 2C7RA 1TO1E 2ZCVA 4WBXC 1EX7A 2X4IA 3FI9A 3I9KA 3M5WA 4U6NA 1AK2A 5CT6A 4YJ3A 3I0MA 2PWYA 1FMCA 3N0WA 4L7VA 4L0QA 2BTQB 3JZFA 3A04A 4Q3EA 3WKAA 4CKEB 3FYUA 2EJBA 3OJXA 4HGOA 5B2EA 1CG6A 5G1NA 1Z5GA 3CC8A 4IRMA 4P93A 8LDHA 10MHA 2CUZA 2YV2A 3PI6A 5TT0A 3DG9A 4UPDA 1WO8A 2AEMA 3R7FA 3KQSA 4RKFA 2VP6A 1VL6A 2DR3A 5CA0B 4G1CA 2OB2A 5TQJA 1X94A 5LZ4A 3U9LA 3KQKA 1M5UA 4BMDA 1YXMA 3A25A 3DDWA 5FOWA 3HDGA 4Y2PA 2V65A 4QT4A 5L4NA 2B1QA 3QQ5A 5DI9A 3L7MA 3O90A 3EA0A 1L7XA 1GVHA 3L4SO 1PIWA 2C5LA 4WADA 5EY5B 1AZLA 1CVRA 1D7AA 1N9GB 4PLWA 2DH6A 1FPQA 1I3MA 1JJ7A 3GEHA 4A6PA 3UT5B 4PGFA 3ESDA 1W0KA 4JEUA 2ISCA 2VNIA 5EP3A 1E2KA 3GVPA 1UXHA 3PFHA 3L02A 2ZYGA 3MTJA 3UOAB 5A5GA 4TUYA 5LQNA 4PPFA 2DRIA 5JRZA 2GX6A 1VSTA 2VHVA 1OXMA 4ZOCA 4UFPA 1MGOA 3H97A 2IGTA 4ETIA 4V3BA 4QO7A 5BR4A 3AH8A 1FYXA 4JR2A 4MWCA 3FMPB 2RGDA 2GBLA 1GZVA 2YZ2A 4OQDA 2W6ZA 4OYLA 4EUKA 3HVIA 4BNVA 5KDDA 3B8HA 4YP1A 3E5MA 3G1TA 4K2HA 1EKXA 4W5JA 1M74A 1G16A 4ESHA 4U9HS 2Y93A 3OSUA 1BRMA 2QUAA 4HJRA 3ZVKA 4KREA 4P53A 1YV9A 3U31A 4CM7A 3ASYA 4J3JA 4LFCB 2OBLA 3L1IA 2YJNA 2P9GA 3MMXA 3EGOA 1EE9A 1M1NB 2FEOA 4FILA 5EGNA 3L7LA 3V2IA 1GZ5A 3A2LA 4GVLA 5CT4A 3M34A 1SOUA 4DSUA 4V02A 3QOFA 4YAEA 1NVWQ 2ZJ1A 2I1WA 1XP8A 4IYRA 2IUSA 2VP3A 3INGA 3U62A 1TUBB 4Q3AA 3ZW7A 1OB2A 3UJ8A 2HHCA 4R1NA 2BMVA 3CRVA 4JI1B 4ZGGA 4MJ7A 3AM5A 4JR1A 4LIPD 3IP5A 3JVVA 3OBBA 1U3CA 4BB9A 4EHIA 1G8PA 1MIHA 5KYTA 3DAOA 2OZPA 1MVNA 1NUTA 1VM6A 1FQWA 3JQ9A 3BX1A 4A16A 1UMBA 2B82A 3HJUA 1UFOA 3P1JA 4BFTA 5KC9A 3IP7A 1B76A 3NYQA 4O2BB 3IMCA 3IVMA 4FBLA 4P9NA 1FCJA 3FYTA 1FNSA 5HM8A 1L5VA 3THSA 1ZK1A 1EVQA 2FSSA 1QIEA 4RNCA 1KH1A 3H04A 4UCQA 1PT7A 4FFOA 2QL7A 5BUSA 3RS7A 2H59A 3SC2A 1ZA2A 4XB6B 2HA5A 5KBYA 1KJZA 3EVCA 3O3OB 2DXIA 2VZ0A 2OFWA 2JDIA 4GHWA 4KJXA 2E49A 2AL7A 2NNWB 2DR0A 3OPQA 4WJKB 2VSFA 2Q1WA 2OGUA 2NUAB 1NJ1A 2PSHA 1OF1A 1V39A 2J5KA 1XMJA 1A95A 2DTXA 3FHLA 2R66A 3JQ7B 2PGJA 1QPGA 3M3DA 4GP6A 2NVUA 1RVDA 2O0HA 4OK6A 1PS0A 4POAA 3TZHA 3GLIB 4FFMA 1UQUA 3X1KA 4B47A 4IPTA 2EG5A 4J3NA 4QFDA 2AN9A 4GYKA 2Y4NA 5IH3A 5B2FA 5LMZA 1XZJA 2J67A 3ETHA 2NSLA 1D3AA 3GIWA 4OGGA 1P7CA 1M34E 2QD2A 2X1MA 2ETXA 3AY6A 2HF7A 5KVAA 3I04M 5L7YA 2F90A 2QW1A 1BKDR 1PT8A 4UTXA 3WSWA 1U8FO 2BN4A 4XSGA 4V39A 5FJIA 3IKVA 3WG9A 4KXWA 1V16A 1FEZA 3HCDA 4EB3A 3UHOA 4UVEA 3RAGA 1JA9A 2I29A 4QQRA 1NQAO 2WSLA 3G2NA 2QT9A 3FTEA 3HFGA 3CF4G 3D8TA 4MW7A 4BBPA 4C3UA 3JASB 3AVTA 3W2EA 5CHYA 3SQMA 3OO1A 4YJKA 5AW5A 4ZOLB 3VNUA 1E1RA 3EXEA 1BDBA 1EPUA 2ECQA 2V7GA 3HU3A 3FGOA 4KN5A 1E2JA 3TTSA 4AMZA 1YBAA 4TXJA 2UZIR 3RQSA 1U2DC 5BVGB 3ITNA 4UDNA 7ADHA 4IXMA 3CSSA 1AQLA 1GL3A 4KE8A 3GFBA 4E15A 5DX8A 1SHKA 5K0BA 3BGDA 1UBKS 2IDZA 4HQNA 1EJBA 2R25B 4CCSA 5C1BA 1SG0A 4NE9A 4UCFA 4MYCA 1YC5A 2VPZA 1JHRA 1U6KA 2QPOA 2ZANA 1ZIYA 4UMFA 9ATCA 1RPNA 2GZHA 3NGLA 3MERA 4JLKA 4LWQA 4XCVA 2OYSA 1KSGA 4YASA 1P3JA 1KMNA 3A7EA 3F7MA 3ZCRA 4GLFA 1U5BA 4CM1A 1OASA 2HA2A 3K53A 2F67A 4WL0A 1F8YA 2PWBA 5CXXA 3VC7A 5CFZA 2BZGA 4HYTA 4CQNA 3EIHA 1P0FA 4FEGA 2W70A 5A5DA 5EJ5A 5LP1A 1AKQA 2GTHA 3VYWA 4ZO8A 4EZIA 1HV8A 1LZKA 2CB0A 1D6SA 3AUXA 3H6HA 3K2BA 5KOJA 2BV3A 4FR5A 5IDWA 1EBFA 3ROTA 4NI5A 4Z5XA 4KB5A 3B1XA 5C5EA 3ZW8A 5A9RA 2G63A 4DQDA 3UW1A 4MKRA 2HSDA 2A58A 3HA5A 1BA3A 5GIPE 4F7WA 1P6XA 1W5AA 3R41A 1C7JA 1JHAA 1Z39A 2CZGA 3RVRA 1CUWA 3GRAA 5BSVA 2UXBB 1NP3A 2IITA 2NV6A 1FQOA 1XCGB 3B9PA 3F74A 2FYTA 3FWNA 3ZG6A 3Q87B 3LBIA 2EAUA 2Z4SA 3K71B 5E8JA 1N6IA 3GA5A 2Q4RA 4K05A 4F2HA 1G66A 1SXJB 1E3LA 1BEUB 2Z5VA 1OAKA 3OI7A 5BYAA 3ICQB 3ZD7A 4KV9A 2ODTX 3P9PA 4URYR 3RI3A 5JCOC 1WCWA 2LZ0A 1N6PA 1C8BA 1TFRA 4HDNA 1R0CA 4HRAA 2I55A 3TR5A 3VZBA 1X7XA 1YS1X 2YFQA 3OIWA 3EH2A 1QK3A 1IN1A 4J49A 3IP6A 1MAHA 1X2BA 5D00A 1XZKA 3HM9A 4J0HA 1Z2AA 3ZV7A 2PMWB 3AQIA 4MKXA 2BP7B 3KS9A 5T7BA 4CTOA 1T4CA 1WXXA 2H29A 3OJEA 3PXBA 1T91A 2ZK7A 3DTNA 2JAXA 4IGIA 1WKBA 4JB3A 4XOIA 2OFFA 2VS1A 3PFCA 4N9WA 2MT9A 4YMVA 3KAKA 4LECA 4BJ3A 4E31A 1V3QE 2QU8A 2X40A 3IOBA 3KQQA 2MYUA 3KZKA 3NT5A 2ZT5A 1NN3A 1RCTE 1A97A 2D4HA 1BKYA 3EDMA 4BJ6A 1L5KA 4EJ2A 5IASA 1GNVA 5KJ1A 2R00A 1XYYA 3EF3A 3FIJA 5GADl 1NVVR 2HLDA 2VSXA 4BQPA 4F3TA 4CWAA 2NUPA 4XSHA 4MUIA 4YB8A 2EQAA 3OG9A 3GF4A 4KDEA 1AXRA 2RFLA 2YFHA 4OATA 2XMSA 1ENYA 2QQGA 3CGWA 1IAVA 4GMXA 3UYLA 4BP3A 1UMDA 2Y66A 3BILA 2MINA 1YDGA 4IUDS 3ZHVA 3DE5X 4FT4A 1XDUA 5CH8A 1GGEA 1YDEA 5B3LA 3MTEA 4DR1B 2IPMA 1YKGA 1PFVA 1YRAA 1YQWA 2CNWA 3G9QA 1KYVA 2I6XA 4OHOA 3FYHA 3L8CA 3RTBA 4P4NA 3V32A 3ZKAA 1HDZA 3AUTA 2CDAA 1MOSA 3D3WB 3D2AA 2IHKA 4RZXA 3DMFA 3ZHRA 5CDFE 4I46A 1J4AA 4ZODA 2F6RA 3U7IA 3UENA 1NRWA 2AHOA 3WNDA 4BFVA 1LWNA 5DHPA 1DIOB 1M1YA 1NUAA 1CUBA 2YY5A 4N39A 1CS0B 3ND5A 3GZTB 4B45A 1FRVA 4OQYA 4X7BA 3KSAC 2YXNA 1BRTA 4B71A 4P92A 1KI2A 2IOFA 1V3TA 5BW6B 3TLZA 4BNJA 3N0TA 5LIPA 2ZBUA 3O31A 4RTKA 3HU5A 1IB6A 4KVGA 1Y3IA 1U1CA 1Y8QA 4II2A 1ZR2A 4H0CA 2VDMB 2ZBQA 4B3MB 1XDWA 4EG6A 4P7GA 2NU9A 2DPGA 1KMHA 6Q21A 1BXRB 3RS4A 3WSTA 7MDHA 3D59A 2EHJA 4LW8A 3WOHA 4L9SA 4C7JA 1DQRA 1GTVA 2D3WA 2FFRA 2YQ5A 1HZJA 4CU5A 3PDWA 4EHJA 4PSVA 4D42A 5ARDA 1TPYA 1IPEA 1RQPA 2NZWA 1L5MA 1Z5WA 2XV1A 4FS8A 4PZYA 5AIBA 3VSEA 3M6LA 4KQHA 5A6SB 3TEMA 4BX0A 1JJFA 1TCAA 2DTDA 3SE0A 4U7DA 2O8EB 3UPUA 3CKKA 4IZHA 5AHRA 4XSVA 4Y0NA 5MFPA 5JSZA 3MUOA 2VXCA 2ZRJA 5LLSA 4B6SA 3PDIB 4GO1A 4ZREA 3QRWA 5DPMA 4U7TB 4HV4A 1BHJA 2FI1A 3N2GB 1RNLA 4D9NA 1VXOA 2B4QA 3GHHA 2PX0A 1TLFA 4J43A 1XMSA 1Z8HA 1C9DB 4L74A 3VPCA 3TECE 3LNCA 3DVAB 1PK9A 1ZGJA 2NO6A 2PDAA 1NBMA 3H6GA 2PXHA 2XYHA 3I32A 2XZLA 2CL6X 3QE0A 3KKKA 3EDYA 1KO8A 1TGVA 3C15C 2WU4A 2WUEA 4J2HA 5DGHA 4RH3A 4HS9A 2AJDA 2RONA 3PR2B 1CQJA 2BUCA 1FS6A 1FMTA 2W83A 5CIYA 4TL9A 1H5NA 4GI5A 5FTJA 2V7VA 4AP9A 4BX9A 5KUTA 3HXLA 2FJUA 2I8AA 1VYHA 2PUHA 1BOFA 2ZYWX 4OM7A 5EIAA 1HR0B 5CFOA 1RC8A 3G2PA 4CLOA 4OFWA 1C8LA 1GA4A 3FYUC 3KUDA 3PDHA 2WRZA 4YPOA 4BQIA 1VJ0A 3OJLA 1YJ5A 2XX3A 1H66A 4TV8A 3S2FA 2XUIA 1CSEE 1Z8DA 3LHFA 5E9QA 2C4UA 3EASA 3WBBA 3GFOA 2CWDA 4MQFB 4E5PA 1YQUA 2HF2A 3EPJA 3L92A 4BIIA 1P5JA 3FFTA 3DOJA 4NCKA 4JQYA 1PP4A 4EA8A 2BHTA 4DIEA 3TO5A 3OCJA 4IH4A 4EGAA 2GNOA 5ENZA 2HJRA 4URZR 1PJSA 1AS3A 4BEJA 3MGBA 2GZSA 4K9MA 3WAJA 1L4UA 1MOPA 1U9ZA 3ST7A 4TMYA 1T8TA 5B1SA 5D3MA 4Q01A 4UZFA 4A73A 2G4VA 4GOOD 3JQFC 4N65A 5AHXA 2SNIE 3HGMA 1G2QA 2JW5A 5LZ7A 2B9VA 4MARA 4QYSA 3NGMA 1PEYA 1IN7A 1X1SA 2CJWB 3FIUA 4RPJA 2WF7A 3HCRA 3K4QA 1DAMA 1DVRA 2C7PA 3KXIA 4BZXA 3AVUA 2WWWA 4PW0A 4YRKA 1DRVA 3ZZ0A 4IIJF 3PX3A 2NIPA 3ETGA 3S99A 2L19A 3QI2A 1DINA 1B93A 2LP4Y 4RQTA 4RBNA 5EZ5A 4JKIA 1GL9B 3ZY5A 1IPHA 4G0WA 1KGSA 2JLYA 1SQ6A 4NP6A 2GEKA 4YT2A 3WK7A 1C7QA 2NSDA 4GZ5A 1BCRB 3OZVA 4QUAA 1TM4E 1FTSA 4GEKA 3WL4A 2R85A 1JEJA 1GGFA 1J56A 2ZYAA 1DRJA 4L0MA 4R9SA 3WR5A 4ZYTA 2D00A 1Q7CA 2C2ZA 2QRNA 3HDTA 3HRHA 4LZLA 2O0LA 3GRVA 4O2AB 3Q9NA 2BVNA 4MW6A 4RV5A 3FAKA 4WERA 1X0VA 2AXEA 2WIGA 4XJVA 3S2SA 4OI4A 2PX4A 1GLVA 1YD7A 3AFHA 121PA 4LX8A 2E0IA 5JY1A 4R2XA 1O5OA 1ZEMA 1G5PA 1EFTA 1PJ4A 4A8JB 4CI9A 4CKCA 2FWJA 1MJNA 1EDDA 3AG5A 2JANA 2C2YA 3K9LA 3NBYC 2C4MA 3K0SA 1RXUA 1Z0IA 3EGWA 4X84A 3UO8B 1FDIA 1GZ3A 2GHRA 1F0NA 3DQQA 3LBYA 2QB5A 2QUKA 2Q0SA 3Q7PA 3ASUA 3KJFA 4RVOA 5JPIA 3QLEA 4YCNA 5F1OA 1QXSA 3K1AA 1T4GA 4O3FA 2O50A 3DFIA 1K6XA 4Q5IA 4AZ3A 5F64A 2X1LA 5B7GA 1OWPA 4GAEA 3C8UA 2ZIXA 1GJRA 3IIEA 2W2QA 3KJNA 1WXHA 1QH8A 5IT9A 2WIBA 4J9VA 4QQ8A 5IJ9B 1U7WA 3SQXA 2ODEA 3O2SB 1V1JA 1YFLA 2WSBA 5C4GB 3SBOA 2JGIA 1SBTA 2QP9X 3TLEA 1RHQA 3OEED 1A7KA 3M3PA 3IAM6 3GLGB 1A7JA 1UXOA 1YFZA 2FEMA 3IVCA 1Y8ZA 4BLOA 2QX7A 1GL7A 2GEDA 1UT5A 1EINA 3PXXA 1UEXC 5CX1B 3O95A 2J09A 1B6TA 2V54A 3GAAA 3A4VA 3P2JA 1JEOA 2GBPA 1FQJA 3NNDA 4DCCA 4H4EA 2C9DA 4DV4B 2AOVA 2BD0A 3OA0A 4OQPA 2FWMX 2B36A 4R1LA 2R65A 4WCFB 3WRYA 4Y7DA 3ZWQA 1Z34A 3LWNA 3NVAA 5JNRA 1QQTA 4UDYX 1O6GA 4IIBA 1HNZB 5LBUA 1QTRA 4I6JA 3W7BA 4AY5A 4EY5A 1AM4D 1U02A 1DL5A 2VH2A 2OQVA 4NICA 4FUTA 1ODIA 2P65A 1TXGA