4C76A

Crystal structure of the fmn-reductase msue from pseudomonas putida kt2440.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
182
structure length
182
Chain Sequence
ARVIRVVVVSGSLRAPSRTHGLLQALVERLPAVLPKLEVHWVRIAELSASLAGSLERDSASADLQPHLQAIEQADLLLVGSPVYRASYTGLFKHLFDLVDHQSLKGVPVVLAATGGSERHALMIDHQLRPLFAFFQAHTLPYGLYASVESFDDQRLADPAQFERIERVLDTVGAFFHIPVAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fmn-Reductase Msue from Pseudomonas Putida Kt2440.
rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords FMN REDUCTASE (NADPH)
total genus 62
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 1.5.1.38: FMN reductase (NADPH).
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c76A00
1FUEA 2XOEA 2V5VA 3FX2A 3L9WA 2M6SA 4QOJA 3L9XA 1D04A 2QWXA 1I1OA 3EYWA 1AHNA 3D7NA 3NHWA 2R96A 3FJOA 4PTZA 1FLDA 2N1MA 1CZRA 3UXEA 5JROA 5LMCA 4DIKA 4CF6A 1QRDA 1YRHA 1SQSA 5FUQA 3EDOA 3N3AC 4NLLA 1YDGA 5TGZA 2BN4A 3QE2A 3F6SA 1FTGA 1RCFA 1WSBA 4U7HA 3O73A 1AG9A 5EA2A 3TEMA 1V4BA 3NHJA 3U7IA 2FAXA 3GAMA 3NHFA 4N82A 1C7EA 2FOXA 1H66A 1WSWA 2FVXA 2Z9DA 3OX2A 2HNAA 1QR2A 3NHLA 1RLIA 1KBQA 4H2DA 4DY4A 1J8QA 4BMOB 5LJIA 2FX2A 1CZKA 5FX2A 2D5IA 3KEGA 3KLBA 2Z9CA 5LVAA 1CZLA 2MTBA 3GFRA 4S24A 1XYVA 4QOEA 5LBTA 1OFVA 4LAFA 5B3LA 2Q9UA 2Z98A 4Y7CA 1VMEA 1AKWA 1DXQA 4N65A 3W78A 3OX1A 3R6WA 4H6PA 4YAFA 3W77A 4C0XA 4ESEA 5ULLA 4QOFA 1TLLA 2KLBA 1AKUA 4ICIA 2M6RA 2Q62A 3KAPA 1QHEA 4QOHA 1JA1A 5FA6A 5NULA 3LCMA 2BMVA 2MT9A 1DXOA 2QX6A 3HLYA 3N39C 3U7RA 1AMOA 2A5LA 3ZHOA 2F1OA 4ZVLA 2BF4A 4J8PA 2WC1A 5BUCA 1AKTA 4D02A 4LTMA 1AKRA 2OYSA 3N3BC 4M0CA 2X2PA 3NHUA 4LA4A 5F4BA 1F4PA 3TZBA 4C76A 1YCFA 2MWMA 4ZVNA 5LBUA 3FVWA 2Z9BA 1J9EA 1JA0A 3B6MA 1D4AA 2QX8A 4FGJA 3OVMA 5EMNA 5F51A 4ZVKA 1E5DA 3F6RA 4XDHA 4YQEA 1XYYA 4R81A 1FVXA 4GQIA 2BPOA 4PU0A 1KBOA 5B3KA 5EAIA 1FLNA 2ARKA 2FDXA 3LT5A 3OWXA 4FGLA 4U7FA 3S2YA 1OBVA 4C0WA 3NHRA 3OWHA 1J9ZA 3ESYA 3F90A 3GFSA 4N9QA 4YAUA 4Y9UA 2KQUA 2QMYA 1CZNA 3O2NA 3OJWA 4BMPB 1J9GA 3NHPA 3B6JA 3G5MA 1ZWKA 2QR2A 4YAOA 3TE7A 5F12A 3B6KA 2HNBA 3NFRA 1QBGA 2B3DA 4HS4A 4OXXA 4PTYA 1FX1A 4QOIA 4Y9RA 4LTDA 1YKGA 2RG1A 3NLLA 1DX9A 3OJXA 3NHKA 1T0IA 4QODA 2AMJA 2ZKIA 3JSXA 4C14A 3W7AA 4U7GA 1CZOA 1ZX1A 1CZHA 3QFRA 3FW1A 1YOBA 4GR9A 1XI2A 2OHIA 2BZSA 2FZ5A 3F2VA 3OX3A 4HEQA 2X2OA 4DILA 4NULA 1BU5A 5NLLA 3B6IA 5LLDA 1FLAA 2QMZA 2GSWA 1NNI1 1TIKA 3ESZA 4YAWA 1D03A 3UXHA 1BVYF 1RLJA 3FNIA 4LTNA 1B1CA 1X77A 2XODA 2OHJA 3GFQA 2FZVA 1YCHA 4YALA 3P0RA 4FGKA 4F8YA 2QX9A 3HA2A 1ZWLA 3W79A 2QX4A 2FLVA 6NULA 4ZVMA 3QFCA 2FCRA 1FLVA 2V5UA 1AKQA 1T5BA 1YCGA 4GI5A 1OBOA 3ESXA 3ES9A 3HR4A 1XT6A 3K1YA 4CETA 3RPEA 1AZLA 5LJLA 1SG0A 2V9CA 1CZUA 3NHYA 4XDGA 5A4KA 4FX2A 1AKVA 2HPVA 2R97A 3NHSA 1GG5A 1C7FA 2MOKA 2OHHA 2W5UA 1RTTA 3K20A 3KAQA 4QOGA 1H69A 3SVLA
chains in the Genus database with same CATH superfamily
2H92A 3SHOA 2M6SA 2RH4A 2ZRHA 4K3UA 1NDQA 3E9CA 1BNCA 4PTZA 1XDZA 5EJ6A 4OBWA 2N1MA 1AQJA 2XLCA 4Z9BA 2LWIA 3I34X 2FQWA 3EC1A 1ATZA 5DWVA 3LLUA 3AINA 5COBA 3KQUA 2XRZA 4C03A 3RIEA 2FG6C 1NYQA 2I1VB 1B6TA 3V80A 1VMAA 3H5VA 1HOTA 1EA7A 1SUAA 1NQXA 4HUJA 4KJXA 2DPGA 4RJLA 4L6CA 1G4HA 2I9PA 3FWHA 1TX4B 1PNVA 1DQPA 2EKQA 1VECA 1Z3CA 3CRMA 4BAZA 3VU8A 4P08A 1P1JA 3L6UA 5H9WA 3A32A 3RF7A 1REQA 2P5TB 4TL8A 1J07A 4K9PA 2ZUCA 4R2LA 1UC9A 3TPFA 1CZLA 5B3LA 4O5AA 4Q1AA 2BFMA 4IMJB 4LZOA 2R6FA 4RA6B 4R8RA 2QNBA 5KOHB 5L53A 5INTA 1CFJA 4COKA 4XX1A 4DDHA 1KYQA 1ZVQA 2PSHA 3DUFA 1IMJA 4TTQA 5HFJA 3FWKA 2HSGA 5JARA 3NWOA 3VJKA 5JXIA 4X95A 4MPTA 4MIEA 1MOZA 3FD8A 2R8OA 4P1ZA 3LUHA 4LC9A 2A35A 2CXHA 2PQMA 4TQUS 5C3MA 4D8YA 1ULUA 1T9HA 1GFWA 1QBKC 1YJCA 3F4KA 1FP4B 4IIJB 3ZOZA 1KIMA 4ZIRA 4BWYA 1GRQA 3LXXA 4AJEA 3RUAA 3VVMA 4YUAA 4IYJA 3WB1A 5B3JC 2ZJAA 1SIWA 3BIOA 5HFNA 4BVKA 1UPBA 3F71A 4XM1A 5B7NA 2P2CA 3B9QA 4XYMA 5DTJA 1G3RA 4A2WA 1UXIA 1ZBDA 2EOAA 4EGSA 2QAGA 1N4DA 2QN7A 4ZKEA 3RUPA 2ARKA 2HBYA 3I61A 3CLUD 4CM4B 1C8LA 3C6XA 1ZSNA 1KSJA 2BGUA 2H2DA 4J1QA 1ABEA 4BMVA 1ACJA 2YQZA 4KMSA 4JUDX 4KYUA 2O0LA 1I13A 1N9GB 2TMKA 1FQJA 3TE7A 2A4MA 3SG0A 3A6DA 3D1LA 3D3JA 4FFNA 3ZTTA 3KT0A 3INRA 3L8YA 1HQDA 4MS1B 3NIGB 3PQ6A 3DOJA 2VT7A 2WJ4A 3M4JA 4IDQA 4F9GA 3G3EA 3DUFB 3E3OA 2G0TA 5DSZA 3TVTA 1WTCA 3FPCA 3WKEA 3ESAA 1XTBA 3ETNA 4V0RA 4KR9A 4MVJI 3ZUGA 2EKZA 3CU5A 4Z7NB 5K20A 4TZ6A 3HWSA 3KTFA 3MLAA 1AHHA 3DE0X 3DDZX 2G17A 2YXLA 3U62A 4E33A 1YQDA 3MA0A 3HN2A 4CM5A 1V7QA 3AY0A 3FNIA 4G5SA 4H0FA 1VB5A 3SS7X 1E6CA 5E7IA 4P54A 4BFVA 3OLYA 4R01A 2CBGA 5EESA 3OQMA 1J8YF 2PXAA 4CV0A 2P75A 1USVA 2DBYA 2AR9A 3BGOS 4DC0A 2VYQA 5FTLA 1CJUC 1DEOA 2HAEA 2O7VA 4L9WA 3ZNNA 3BXGA 2YZGA 2ZU6A 5G1PA 3LSYA 4Z9AA 4YRJA 3V7NA 5BSRA 3RT1A 3VU3A 2UZ3A 1OI2A 3X2SA 1LSSA 1QQ7A 4DCTA 4MRMA 3HXOA 2HPVA 3AG6A 4KPUB 4EA8A 2YRFA 2JBWA 4RVCA 1TM5E 1YFZA 1N2CE 4UHKA 2BAGA 4RVDA 1G4AE 3VR4H 1C1DB 3NWBA 1T0BA 2L17A 3CVOA 4YMGA 5DM1A 1L5FA 4KZKA 4X8OA 2QRVB 3A1TA 1IQPA 1B1AA 2GN1A 2SCUA 5HBGA 2IJGX 4D7AA 3K15A 1CUCA 3C3YA 3LKZA 2NVBA 2XQKA 3PQ4A 2X1LA 3DJFA 4EMBA 2D1TA 3MTBA 1ZBQA 1IZYA 2IP2A 4LJ4A 1YQXA 3QUTA 4ML3A 5KTMA 3FWPA 3AKCA 2PS3A 4LOHA 2FVXA 4W63A 1U8ZA 2DUJA 2HO5A 3DXZA 1XOIA 2CK3A 2JVJA 1P72A 2Y9MB 4UJ3A 1YTUA 1ZFNA 4OSEA 5LJIA 1RWBA 4ZVQA 3QGMA 4X41A 4KQ6A 2R9VA 5BNZA 1HNXB 3AHJA 5CLQA 3RJMA 2LUOA 2ZSEA 2AZ4A 4LPKA 4QJIA 1L4HA 1F4VA 4UE3S 1T91A 2JZCA 4TV8A 4Z4EA 2P9GA 2PZFA 3H1BA 2QMEA 2ZOSA 1KR5A 1U7UA 4KFRA 4Q39A 2W90A 1EJ2A 4PX9A 3MTEA 4BLUA 2VUUA 1VIDA 2QY9A 3KUKA 4G4SP 5FLXA 4DR3B 3P7MA 3GC6A 3NP7A 2OXFA 4DQLA 2YZKA 3OG9A 1CF2O 4CKBB 1D6JA 2N47A 3RC9A 1GTJ1 1XX6A 2RB4A 2UZAA 2C9DA 1NWCA 3CCFA 3HVUA 5BYBA 3ZH2A 2EKDA 4MVJA 1QQ6A 4MYUA 4QGAA 3U4QA 1CUBA 4DY6A 1E6UA 4TYNA 4ZYZA 2OFOA 1KOGA 3OTQA 5LBUA 1EK5A 2Z9BA 4YJ2A 5JSZA 1H94A 1XRRA 2G7MC 4UNPA 1NXVA 2R4TA 4M9UA 3EGXA 1RQLA 3A0UA 2NNLD 3K5HA 2V3VA 3IBFA 3V2GA 3AHGA 1EM8B 1I30A 2P2ZA 2VP9A 3HV2A 4M9QA 3T1NA 4HLDA 4RF4A 1DCMA 4RJKA 1V9SA 3KYIB 1EP3B 4A6XA 4C4OA 2VXCA 1UP7A 2RMKA 3STXA 4JJGA 1UM9A 2R5NA 1O1YA 1X70A 2Q7XA 3ZK7A 4OLBA 1DLIA 1XCMA 2AKYA 4N0PA 2DFLA 3BE6A 3LYAA 5C4IA 1IHUA 1RXCA 1KJWA 1F6BA 1XQ6A 1SIBE 2XUAA 2RE8A 3GLTA 2NT3A 5J47A 2YYZA 1XQVA 3MWDB 1Q7TA 3IP3A 4QOSA 1ZCFA 2FKNA 3C4VA 3EIEA 4FHEA 3B1WA 4WASA 4CR6A 1CUXA 2V7WA 4HX5A 4E4TA 2WA2A 4LJ9A 4GL2A 2A5JA 3LBAA 1OAOA 4YJ3A 2PQ0A 5HSGA 4Y6LA 2CYAA 3ZYZA 3CYFA 3H84A 3HJNA 4YCBA 2C97A 1GPKA 5HQTA 3K53A 3R7NA 1YF3A 1L5OA 2CLLB 3QNWA 1QH0A 4NR0A 3ROQA 2QE7D 3CTPA 4R41A 3QW4B 3FPSA 1QLWA 1NLYA 2PVPA 3LWBA 1V8DA 4HXFB 1Z4PX 1HV8A 5ED4A 2ZBVA 4XLTA 4HFMA 1RI3A 3CF6R 2QL7A 4F11A 4PYKA 3OPQA 2OKCA 4RF5A 5J9FA 1OMOA 8ADHA 2AB0A 4DNOA 1RM0A 3G0IA 1VE9A 1VJ0A 4X60A 1Y5MA 2W2KB 1RWWA 4EMSA 1OBFO 2P0AA 4A3SA 4AO8A 3PR3A 5LXTA 2DKFA 5HRUA 3A9TA 4YUXA 1EXWA 3EDOA 1D2EA 2Y76A 4FCVA 1YB5A 3QE2A 1WUYA 3PUKA 2C03A 4FFWA 4LSGA 3RR2A 1R0ZA 1QIFA 4GWKA 4BMPB 2YCBA 1IN6A 3DNPA 3DZIA 1KQNA 1UMDA 1SN7A 3DR5A 4KZPA 1CUIA 2GDJA 3BULA 2OMEA 1WABA 2PLAA 3FGOA 3AFGA 4H2DA 5BVGA 4EBBA 2ANBA 4JB8A 4F97A 1FDWA 4IAOA 3FHJA 2AOTB 4D8VA 3D43A 3CUEF 1XZLA 4RF2A 2G28A 4U2BA 3RC8A 1C30B 1XWWA 4LVCA 4X84A 4C87A 4IKEA 3WRXA 1IAVA 2QAGB 1L1FA 3KEFA 1VGVA 1YZ3A 1ZYUA 3BXXA 2D3WA 2AFHB 1U0BB 1FXWA 4IO0A 4P82A 2PSSA 3GBVA 2QQGA 2E6UX 1JLKA 2GZDA 1BJKA 1QPBA 4M49A 3GLQA 3RVJA 1GNVA 8ABPA 3M5WA 1DXYA 1H8EA 2GYUA 4X1IA 3ZGXA 2VG8A 1FRFS 3Q9LA 4YMUA 4WBXC 4RCVA 1Y0BA 2W7TA 4C21A 1H2AS 4GSLA 2ZS8A 1V4NA 3DD5A 3GH1A 2K7FA 1FFHA 1L7NA 4A03A 3T4UA 4PZZA 2ZT5A 4JI1B 4FYIA 4BDTA 1I0IA 4ER0A 2CVZA 1JHDA 5AKLA 2XH8A 2HMAA 2RHRA 4KQFA 2VSQA 3GT3A 1X1TA 2JLRA 4G3XA 2QXYA 3PIDA 3BFPA 3OWHA 1L8QA 4M2LA 1JFFB 1N34B 5KNDD 1TVMA 4JR1A 2OQIA 4O2AF 4U5XA 2VC2B 2JCXA 2VHCA 2H1CA 2GM9A 2O2YA 3P9ZA 4KLZA 4ZMBA 3NFRA 3HWRA 5GV7A 5HEKA 3LOUA 4EK9A 2QW0X 3BYZA 4M0LA 1KJZA 4KNWA 2BM8A 4CZ2A 1D07A 4KHPB 3E7XA 1ECJA 1W30A 1CZOA 4V2UA 4D8UA 2O2ZA 3U3ZA 4OHPA 3PXUA 1LNSA 5I7EA 5JZMA 3AK4A 5K9ZA 2OBYA 4LDZA 3ST7A 3UFXA 2WWIA 1VHQA 1ZJ5A 1AQYA 2Z2JA 2PGXA 1J49A 1I1HA 3IR6A 3QKRB 4EKNB 4F56A 3C39A 1GTG1 1MDFA 4CTKA 3D2BA 3GX1A 2ETXA 1N1EA 4YLYA 4CRWB 4XQGA 2XR1A 3OZDA 3BZBA 1MO4A 2YCLA 2VSXA 1PR9A 2MINA 1JF8A 2P6UA 1IMOA 2RGEA 2A9FA 2C5LA 3BD8A 3NANA 3Q40A 5DCYA 2C5SA 3QKIA 1E1CB 1OVMA 1RPZA 1QP7A 2WUVA 4FDAA 1N8KA 3IODA 3CVJA 4AMYA 2AMFA 4R6WA 1Z45A 1M6EX 3U6KA 1Y4SA 1C3OA 1ZKDA 1X7WB 4MRAA 5LA6B 4DIUA 1GQFA 3N5KA 4P7BA 5FT9A 2JLYA 3KJQA 1LV7A 3WYGA 3TDMA 5JZOA 1Z7YA 3VC1A 4QC2A 1T3ZA 3IOMA 4R16A 4BZQA 5HM8A 2GTHA 4TYPA 4UM9B 2F1RA 3T3DA 3CPSA 1FVHA 5FV4A 4D1YA 5JAMA 2R44A 1W0CA 3BXZA 1V6AA 3MJRA 4ZC1A 3DOUA 3WGHA 2AXPA 3V4VB 3O7WA 4O25A 3V4RA 1R6DA 1Y9ZA 2LPMA 1NPYA 3GLSA 5ABPA 2CK3D 2D2EA 3B12A 3E9NA 2O2CA 1E5XA 1NC3A 3DZFA 3IKLA 3QPWA 5AVUA 3E3LA 3L0OA 4V24A 3V3TA 4UOEA 1MENA 2WF9A 3F7TA 3H2BA 1HFKA 2XWJI 4IOMA 4BKRA 3EX7C 1T5DX 3IP5A 4Q3NA 3E4DA 4XD7A 1UBGA 4AF7A 1CUGA 1GT6A 3KX2A 1M8JA 4XSVA 1GY8A 1DWPA 3EIXA 4C0JA 2YFKA 4HZGA 4YQFA 2C2BA 4C7OA 5ULLA 4YR9A 3Q5GA 1V7PC 4TTPA 3LQRA 3EBLA 2H8GA 3W9SA 4N12A 5H83A 5BUZA 1Z47A 1TECE 5C7IO 3I53A 1LRKA 1XMVA 2H1WA 5IH3A 2DFVA 4HXYA 3RLIA 1MO5A 2MT9A 1IVNA 1W2GA 2E5LB 4RTNA 1KJQA 2LP4Y 1GPAA 1PT6A 1KRHA 3L2OB 4C89A 1JT9A 4DBLC 2YFQA 4JSYA 3V7WA 2VWPA 4P4TA 1TGYA 5KYNA 1FTWA 1HT2E 4AMBA 5IJ9A 1UZMA 1KY2A 4Q3OA 4IHJF 3EPLA 1JLHA 4MR9A 1BMDA 1SOVA 3TR6A 3W5AA 1PK7A 1R27A 3GF4A 4MARA 3TUIC 1TZCA 4FHZA 5CG1A 2I2BA 1FVXA 2NYAA 2PCLA 2QLBA 4NF2A 2ONZA 4QJ3A 2ZVPX 3L05A 1RQ7A 4P33A 5EL0A 3FWYA 5M04A 3Q8WA 1N0HA 2X77A 1OIWA 3S2SA 2Z8ZA 4IDFA 3EVNA 5ELLA 3WKCA 2OORC 3B70A 1XNGA 5J2TF 2Q3FA 4KVAA 4KE7A 2YWJA 2COKA 3PGXA 2Z1NA 4NYMR 4TX1A 1MNAA 4US1R 4R7GA 5WRFA 4RK6A 3U80A 1CZHA 2WR8A 3M7IA 3NV9A 1WAMA 4WCFC 1UFKA 2GEBA 2OBXA 2X3YA 4X3CA 4KAFA 2PZKA 4AJOA 4J91A 5J4HA 4LWOA 1HOXA 4P4NA 1MQSA 3PR2B 4G1FA 4LY3A 1FLAA 1Z2CA 2PRZA 3LG2A 1RXSA 1S8OA 4LJ7A 3ZD9A 2KW5A 3HO8A 2H31A 3LHKA 1Z38A 3C8MA 4D9GA 3FOAA 3L8CA 4RTSA 3UAZA 3BL5A 3L43A 2QTRA 1FNNA 1TO6A 5LQRA 1VCIA 2FV8A 2WDPA 2WP0A 5HUQA 3ZVMA 1ID1A 3O90A 3DAHA 2AOXA 2WP8J 5CIQA 4F9FA 4HN9A 1F6WA 3UUEA 1JFTA 1YO6A 1Z5PA 5ALHA 3UG7A 2Q4BA 2L18A 2O6LA 4RWZA 2ADOA 2W6PA 5FTMA 3LX8A 4EGCB 1EM6A 1KKMA 5C8YF 3EXG1 1AKVA 2ZQZA 3PSHA 4J6FA 1D7OA 5HMLA 2IK8A 4F3CA 1MW9X 4K9LA 3DTVD 1U3UA 4BQSA 3P27A 1C9MA 5IX8A 3RV4A 3AEQB 4Q9IA 1I1OA 1KYYA 3D7NA 3KB6A 1TQ6A 4FOLA 4UC0A 2EBUA 1ESZA 1PLLA 1D2MA 2IIBA 2VUTA 2IT1A 3PT9A 4HGQA 4PFQA 5AKGA 3VC7A 5FUVA 1Y5LA 5JZVA 3I0MA 2BMFA 1U31A 4Q5IA 4X92A 4OJYA 2HYDA 3THYA 4CLHA 2FB9A 4ZOCA 5D5HA 2YHSA 5A4AA 3TLXA 2EDCA 4Y3UA 4E11A 1C7ZA 2VHEA 1MUUA 3GRAA 1OE0A 3HJBA 2EZ9A 3QPVA 4OQQA 3VZPA 4GOLD 4DLTA 1HT1E 1Y89A 2PSFA 1N2OA 4KBFA 2D4HA 1V8FA 1DBWA 2AHOA 2R8XA 4ZOEA 3WK7A 3GFRA 3R7SA 2AFIA 3VBCA 4U7WA 4MNTA 4OF4A 1MVLA 5JLJA 1G8AA 5FPKA 1E2QA 2HDNB 2PZMA 4PSUA 1CB0A 3K1ZA 4PIVA 1OSNA 3SNHA 3WBJA 3KPJA 4JB3A 3DYVA 4NENB 1GSAA 4DADA 1R9NA 1CE8B 1YI1A 2OYCA 3OE7D 2OPBA 1IY1A 1UXKA 3EUEA 1JI0A 4M1ZA 4Q9LA 4S35A 1IRXA 3F97A 1JAYA 1PT8A 4PLGA 5GAJA 5DM0A 2YHBA 2AHRA 2MR6A 5ESWA 2JEYA 3PC8C 2PHZA 5DV9A 2VPXA 4B47A 1Q0QA 3TS1A 4AJIA 1VBNA 5IM4F 2OBMA 5KYXA 1H9AA 3NTUA 3AIIA 4OH1A 4QO7A 5IDVA 3K9QO 3MTIA 3ZXUB 1E5TA 2OMKA 5CYFA 4GP6A 1MVNA 1U7DA 4K2AA 3K0SA 1SURA 3K0CC 4FDUA 2P1ZA 2VNKA 4KE6A 5HILA 3ZCRA 1IWPB 3I42A 4P5EA 3ICWA 3ULKA 5L3QA 4B31A 4M83A 3S2IA 4Q9JA 2FDXA 4RDIA 1YDEA 3UVEA 2CJXA 4WJZA 3U7EB 2QA5A 2C2ZA 3QPUA 5TDHA 5JT1A 3NVKI 2H0RA 2ZJOA 4WLFA 3NX4A 1TKCA 2GOYA 4HNQA 3VI3B 4RMNA 1TFRA 1JSCA 4BVLA 2QRPA 1PFKA 4B81A 5JSZB 4JODA 3ZHTA 2VP6A 1QYWA 2FZEA 3H2SA 2ZIXA 3JPYA 2CT8A 5JRDS 2SKEA 3H9QA 2OC9A 1DO2A 1QHHA 3BXPA 4KH0A 4URFA 2F00A 4Q4AA 1N2JA 2DQ4A 4IX9A 4QVKA 4EW6A 2XF8A 2FEPA 4R98A 4RM3A 3MCUA 4R2HA 5HWSA 1E1LA 1GUZA 3FGZA 4TROA 1C2YA 1L5MA 1PT9A 5E0KB 3QLUC 4QTXA 4G86A 3X1ZA 3KOOA 2AEEA 1RLJA 2ZULA 3CZCA 2O8VA 2XDAA 3CZPA 3CG0A 3OCCA 1GNTA 1H2FA 1GZ7A 2P3SA 5DE3A 3ZK9A 2P40A 1PJSA 2VF7A 1EUDA 2QX9A 1T1JA 1W581 4UQPA 5TGTA 2OWDA 5JLAA 4PZCA 1FSZA 2J45A 2JH8A 3WG9A 2W4IA 4R1OA 3RAFC 1OHHD 2XF2A 1YB4A 2DUNA 4XCVA 3WIOA 3UATA 2JGKA 2VBGA 3L6CA 4ENRA 4ZHQA 5KINB 3AX6A 1QKKA 1WB9A 4N54A 3SIPA 1UJNA 2CL7X 1D6SA 1EFPB 3NWJA 1HE3A 2F64A 2GO7A 3K31A 1LBHA 1YQGA 4OD0A 4MVCA 5DHTA 4EQ6B 3C7TA 3CE6A 3FFBA 3U7QB 5ARCA 4TYWA 1MBZA 1AKYA 4MQEA 3O3MB 5EERA 4AJKA 4CFZA 2PR2A 1FRNA 4KTVE 3DO6A 5GMOA 4BVJA 5J4LA 3G88A 4EB6A 1Z0ZA 4EW2A 1FW8A 1GYPA 4YRMA 2UXCB 3GNLA 1D8TA 1F8FA 4JR0A 3UB4A 5BRJA 3UAYA 1Z6TA 1ML4A 3HP7A 1UJBA 1MT3A 3RKRA 3HH8A 1BMQA 1SH7A 2ZJ1A 3IOYA 3QLJA 5THKA 5EIAA 4YP9A 1ORDA 5CA1A 2I7XA 1IJEA 3GFTA 2I80A 4PVDA 3W2TA 2PE5A 4KQXA 3OTHA 3SHFA 2COUA 1C0LA 2CMDA 3CXRA 1QIGA 3QF7A 3QUSA 3H7AA 5E8RA 3VZQA 4AZVA 1N3IA 4WI1A 1SRRA 1T3HA 2EWWA 2QD3A 4DV6B 1X7WA 5LA6A 4L5CA 1J8MF 1EX7A 2MSNA 2Y92A 4BNHA 2UZIR 4EIWA 2Q3HA 3P9SA 1YIDA 1L1QA 2QD1A 1ZK3A 1JL3A 1SCUB 2ZYVX 1XROA 2WJPA 4UU7A 1OW3B 2VF2A 1I7LA 2H18A 1B0PA 3P2OA 3NIBA 2YIJA 2QVXX 3DMFA 3TTXA 2D3TA 2R7LA 3FETA 5GWXA 2Q5HA 2GEDA 3CY6A 2GN8A 4RQTA 4A16A 1BYIA 2OY0A 1U4OA 2GXSA 2NXCA 1WIWA 2NUTB 5JD4A 3UAOA 3V4ZA 1YR2A 3W1VA 3F6EX 2QW1A 3RHTA 2XWBF 1PW5A 3IOEA 3LMKA 1OX6A 1BHO1 1ZQ9A 5FBLB 1YNSA 3DWFA 1F0KA 4EM6A 3HI6A 2A9OA 2HJHA 1TEZA 2FHSA 5DTIA 3G17A 5ILGA 4KACA 2PZGA 3E48A 3LUFA 3DTTA 4YK7A 1DUIA 3L0SA 2WHQA 1Y6FA 4MKIA 5JDCC 3GFSA 1FYWA 5U4QA 5FJJA 2XCRB 1B6SA 3WB0A 4CQNA 1KU6A 4UU1A 2O8CA 4WCFB 2J5QA 1FA9A 3LK7A 4NH0A 1M1XB 5FRDA 2WSMA 2Z0MA 2DBRA 4F5DA 3UZUA 4HDAA 1DLJA 2JRCA 4LWQA 4M46A 5EQJB 4F2WA 1E4OA 3DW3X 1FPMA 4QQ8A 1M67A 4ARSA 1S2GA 1Y8AA 3I0ZA 5E1BA 4YMLA 2OHIA 3ETLA 3SC6A 2O9JA 1J09A 3IGFA 4MGYR 3HR8A 1CYDA 2B5OA 3IDQA 4L78A 4EY4A 3K5WA 1Y4ZA 4L2IB 1XVIA 4Q1CA 1KNQA 1P73A 3QMPA 3ZZUA 2FPIB 3C1TA 3PHLA 2ZJZA 3QFCA 4V03A 2IZ1A 2NUPA 1B3RA 5GJVC 4CUJA 2YXBA 4OGKA 2ECKA 4EVSA 1F2TA 5JEEA 2PFKA 3D6HA 1IUOA 2QYHA 1FFXB 4ETIA 2Y0EA 4HV4A 2QTFA 2WAMA 3W3AH 4QT4A 1KEEA 2W6CX 1BE8A 1SD2A 1Z6QA 5LMNB 3TLCA 2YV5A 1ZGHA 4HGPA 1N2SA 2OZLA 3OECA 5KYUA 3L9XA 3HBJA 4I8DA 1Q0ZA 3MXOA 3TJMA 3DVQX 1Z4QA 1A04A 4Q3AA 3PNQA 4Q16A 3NETA 1A7KA 1EQAA 2UDPA 4TLDA 5JAZA 4PIPA 1P6QA 4EY7A 4JJFA 1ZOLA 2W70A 4OQFA 1UOPA 1I2MA 3IJRA 1F5SA 2RCNA 3A8TA 3MJ4A 3RVQA 3DBRB 4XEHA 1U9CA 4UPDA 3LWNA 1P0PA 3AKYA 3DKRA 4X64B 3V9PA 3RUIA 1L6RA 1MO2A 3M4NA 5IMBA 4I2VA 1WOYA 1GKLA 2BP7B 3UEOA 3W5IA 5BSVA 5I7VA 1XVUA 1COWD 1IATA 4QPJC 3KKQA 1QKJA 3L6EA 1CJMA 5A0TA 4HBGA 2OBNA 3TQHA 3KZKA 5L3QB 2Y1DA 3BDAA 3DEIA 4E31A 3LU1A 4L02A 3LSTA 4X44A 1YKSA 1QCZA 4LEIA 4MS3B 3QKWA 4F6RB 4MRNA 4H7FA 4ZVUA 1EH5A 5HQ3B 3DZCA 1HRKA 5HVNA 1WL8A 3S68A 3N7AA 3AFIA 4ARCA 2QK4A 1W1UA 4PHGA 1L7OA 1SHLA 3ZE2B 2PKWA 2AI2A 1J56A 4CDNA 2BF4A 3HL0A 4DV2B 2ZAYA 4BCDA 3PENA 1LPNA 4JKIA 2FMXA 4JI4B 4YHBA 1T6YA 2AOTA 1TL7C 3OZRA 3R6GA 4IHKA 4KYVA 2IPMA 3FVQA 5JD3A 3I2GA 4K28A 4U9HS 3JQBA 4O3MA 4MR7B 2ENWA 3BK2A 2XKJE 4I99A 4KEAA 3WKAA 5F3WB 4IDBA 4HNSA 1KBOA 4LUCA 4AS2A 1I3MA 3I92A 1P81A 1Q19A 1AGNA 4PS0A 2P4SA 3NNNA 4AG3A 4DM7A 1HX7A 4WV3A 1O95D 3LFTA 1VSUA 5ENDA 4UE6A 3NIDB 4ZVOA 2F3RA 1W8IA 4CMIB 4ALIA 3NPAA 5FQNA 3VKFA 3S28A 2PT9A 2V65A 1C9DB 1VL0A 3ORRA 2I2DA 4K1XA 2FQXA 4UFPA 3HNPA 4ER6A 3RU9A 3NG1A 3U39A 4PPFA 4AW9A 3PXEA 4RTKA 1U0RA 1VIVA 2VHYA 3FOBA 3NEPX 3KLOA 1KE1A 3AR4A 4B6EA 3F73A 3HDYA 3C98A 4MIKA 4HGOA 3TPCA 4B09A 5JH7B 1UK6A 2RK3A 2GI4A 5AK3A 3G1WA 3M6FA 1Z17A 1X1QA 3TW4A 3Q12A 4F04A 1N92A 3GRKA 4OTZA 1RJ9A 3L02A 2LD4A 3U2QA 4MRRA 4WBSA 3BN3A 4M86A 3I4CA 4OL0A 5E6RA 3U61B 4F4IA 1R88A 1E96A 3VDRA 1Q2XA 2QVYX 4DA4A 1K5DA 5KYTA 3E7WA 3CE9A 1YMQA 3AR8A 3UNXA 2ZSKA 3PFCA 3V2UA 1RWNA 3WFJA 1E2HA 4S1WA 2EYUA 2WFAA 4LHSA 3VTKA 1OGJA 1SVWA 1IN8A 1E20A 2RHHA 2Y1XA 2ZB2A 5F7ZA 2C8LA 5CRIA 5ITZB 3L3BA 2R7AA 4F85A 2JS7A 2FKAA 1FLDA 4HYEA 1JJ7A 1KAOA 2WYIA 2C9OA 2IS2A 5DNEA 3I58A 5B7QA 1EXDA 3GI1A 1HDRA 4YMSA 4MLPA 2HWWA 5GJWC 1SHJA 5D86A 3R5HA 3TMKA 3WK4A 2N9UA 1V2HE 4WBNA 2WM2A 2GARA 3UK1A 1ZN8A 4I8IA 1J1ZA 2OGUA 3UC9A 3UK7A 4F8YA 1JLRA 4X3OA 4ZI2A 5LUAA 1JEJA 2OR3A 4GD3Q 2O2HA 4GKKB 4G8DA 1W76A 4Q4HA 4CEHB 2WWTA 4XM0A 1GPUA 1KMMA 1PRYA 2C3MA 3VNSA 1XTJA 1MABA 4M7WA 3RVOA 1RAHA 3UB2A 4LFCB 4NDZA 3LQ2A 2J3DA 4F96A 4OI0A 2RGNA 1I6LA 4KX5A 3KJNA 4TLBA 1DQSA 4XUDA 1UBOS 3ONEA 1JQJC 1LLUA 1M0EA 5AHKA 3UCEA 3UJ8A 1JDUA 1QAOA 1QO0A 2V54A 2GN4A 2ZYRA 1GCGA 1I7NA 1SIUA 4K3VA 5CFPA 4RY8A 4ESEA 1XTUA 2YWBA 1U1FA 3ET5A 2DUWA 2GD1O 3AR2A 1G2IA 3F9RA 3TGWA 4DDVA 1NMZA 4PYIA 1MP0A 3MB5A 1WNFA 4EKDA 4LZNA 3ZHUA 4Z54A 1PJ8A 1LK5A 1FTQA 3QPCA 3D2AA 2MMGA 3ZKAA 1BXRA 4EA6A 5CYGA 2F3QA 4U2DA 2GN9A 5JXWA 2CJYA 2N42A 1CPYA 1N57A 4RACA 3P32A 3AGPA 5E6UA 4PBSA 4TTAA 1ADBA 3RSQA 3SPXA 4JJ7A 1CERA 4UAGA 3REFA 1VJ1A 1KQOA 3H99A 1VSBA 4GX0A 4LX8A 5C1OA 3DEAA 2ZBFA 3ND9A 3E9QA 2JL1A 4UMDA 2A9VA 2FSIA 3OIGA 3AUYA 3HB5X 1LPMA 5DF1A 2M32A 3QX9A 4LQLA 5F9HA 1AS3A 3V55A 1YD7A 1EBBA 1HPLA 3OZ7A 3FGPA 3NIWA 2NU9A 3N58A 1QSGA 2G8NA 3NAMA 1Q1EA 3BTUA 3DOEA 4MYDA 4O4JB 5FTNA 1E3JA 3DNFA 2O2XA 2CHGA 1AQ6A 2VPIA 4I55F 4Z0HO 3S27A 4EY5A 1EX9A 4V1CI 5JC1A 1DX9A 1XJWA 3NHAA 1TB4A 2JDIA 2A86A 4JUAA 2Q6KA 1EBFA 1VIYA 1US8A 3ACBA 1OA1A 1GN9A 2B1IA 2R1ZA 2TMYA 5L45A 4KLAA 4AT1A 5TLSA 3FMGA 3GK3A 4DLXA 1DL5A 4DS3A 5LU9A 1XF9A 1MB2A 2A9KA 2G9QA 3IOBA 4INAA 1MFPA 1MEJA 1AHIA 1U2DC 3DLTA 4H35A 3C8DA 5KTOA 4UTOA 2JLUA 3TECE 1J25A 1MA0A 1Q3TA 4IVPA 3N7UA 3QVKA 1M72A 3ICOA 1EINA 2BFCB 1TAHA 1GEEA 4ZP1A 1AQNA 3KLMX 3GN1A 5CB0A 1XDWA 3E6AA 2VWQA 3ITEA 3KXDA 1BZYA 4BNTA 4Q1BA 3TZEA 3D7SA 4GF5A 4UU0A 1BA3A 3A1SA 3ER8A 3M83A 3FZQA 4E2ZA 4DG5A 1UDWA 3KBBA 3QE4A 1YI8A 5REQA 2CV0A 2PXCA 3FYUA 5G4KA 3WO0A 3DZJA 1IJFA 2C0PA 3JPWA 3LPAA 2GETA 4D9EA 1FU8A 3FKSD 4LGMA 1H85A 3PZBA 1IQ0A 4IXMA 1ZM2A 2Z30A 3F46A 2ZATA 5ALSA 5AW4A 5D1HA 3QJGA 3UXEA 3WQHA 3BFVA 4EG4A 2BHTA 5A4FS 1JSZA 1K0FA 2XJ9A 1Q7CA 5F1YA 2X0NA 1FFBA 2YJZA 4KIWA 1PU2A 1P31A 4MUGA 4CKCA 4D98A 4IHJB 2YWHA 3L5OA 2HT6A 3MZ0A 1HBJA 3H4MA 1JIKA 1RHMA 1VL1A 1OLXA 3CSUA 2PNFA 1PFGA 2ID7A 3OD1A 4IQFA 4RK5A 1OX5A 4EW3A 3WDKA 1Z16A 1TTQB 3IXLA 4GP9A 4XYBA 2D2FA 3U4HA 5HS6A 2CVHA 4KYIB 3ZE7A 1TM7E 3AEYA 3FI0A 2QZ4A 4N5MA 3TRIA 1T13A 4WKPA 3WGVA 2AJDA 3DL7A 1RADA 4HS9A 1CRZA 3BH0A 4O1IA 3NM4A 2OYRA 3Q3HA 1TK9A 3KZCA 4ASUD 4OLHA 4GT1A 3PF8A 1P9RA 4H27A 1CUFA 5IDWA 1T3GA 3IBYA 1DOHA 2YS7A 2J0UA 2X0KA 4UTZA 3O83A 2P78A 4D56A 3BMXA 1GTVA 1V35A 3H75A 4MB2A 2WTXA 4XYEA 4BN4A 1QMGA 2Y05A 2DY1A 4M1KA 1KE2A 1CR4A 4WESB 2P2NA 1GZUA 4YBZA 3W90A 2ZWIA 4J07A 5AI0A 3KUXA 2AUMA 2WIKA 2ZBGA 2OE2A 3LY5A 5EEHA 3T9CA 1ORWA 4LTMA 4Q1DA 3NOQA 1PJAA 3QXCA 2O3SA 4YRZA 1WOMA 2BEWB 3F2IA 4I5FA 1JA0A 4QL3A 1JJIA 3VGPA 3A06A 1YUBA 3OVMA 3T9EA 3ZI0A 3S1AB 1TJ3A 2WSSD 4GQIA 3I1FA 4LHWA 1F0NA 4DSUA 2BCEA 3O93A 5IAJA 5IFLA 5KCZA 5D8DA 5ARBA 1KA9H 4HH3C 1GZHB 1HG0A 4R31A 4RULA 5A0VA 2IV7A 3H8SA 1S2MA 3AZOA 3HCEA 3QXJA 5EZYA 4QASA 3G0OA 3UMRA 4C7BA 3E23A 5YASA 5I9LA 2D62A 4RSHA 3WIBA 4TWRA 2VDRB 5ALEA 3UMMA 2WKWA 3CX7A 2RHTA 1G21B 4OBXA 5CDHA 1EQUA 1Z33A 3MF4A 4HHEA 3F3YA 4EJ2A 1Z0JA 4NY1A 1NWHA 1H05A 2QRMA 3IEUA 9ABPA 1KDZA 3O31A 2VKQA 4L0CA 2BE7A 1EVIA 4H7PA 4YIHA 1SWVA 4OHBA 3A05A 1TIKA 1XKXA 3BILA 3JQ9C 4RD1A 4E3ZA 1UWCA 4I66A 3FJYA 1I1NA 5MN4A 1LDNA 3H1EA 1DEXA 1WXXA 2HUPA 2CYCA 4R83A 1G8KA 2J3IA 1Q77A 3KU1A 4NK5A 1U3VA 3KUCA 5LYJB 5DP2A 5JYDA 3GPLA 3H9JA 4QBFA 4FFDA 2BGWA 2X5OA 3V7YA 5BW4A 3WL3A 3UAWA 1FUKA 5IYZF 1DEAA 2W00A 4B8WA 4WLOA 2PRJA 1RRCA 1YRAA 3D8RA 3EC2A 1KDRA 4UXHA 1L5WA 2G0AA 1G8SA 1WULS 3L4EA 4XW2A 5AXAA 4GMKA 2UU9B 3ZDDA 5JS1A 1R16A 4BB5A 1AB6A 1TQHA 1P2UA 3JQGB 3W5VA 3L1VA 4M0UA 1NBAA 1VHJA 4I4TB 5D51S 2HMSA 1OA0A 2ORIA 2DFDA 1CD5A 1NOIA 1L1RA 4F06A 1XNQB 2IXGA 4CIAA 4HL6A 2GHRA 4YHHB 1GL9B 3EIWA 2H9AA 2JFHA 2WNIA 4NZ9A 3ABRB 2WKRA 2O59A 1T1GA 4BKPA 2PL5A 4CKYA 2MYTA 2FW6A 1O8CA 2BEUA 5KWSA 1BE0A 3V6LA 1RJDA 1NW6A 5EHQA 4IL5A 4RM2A 3T3EA 4MICA 3GUHA 2BKEA 3G2MA 2ZZKA 3LPNA 3AU9A 4G0PA 2FFBA 5EP4A 3WB9A 3WGOA 4DV3B 1R0KA 2FN9A 1PKXA 2EW1A 1NP3A 1XDUA 3HUFA 4JVMA 1WZEA 2VI5A 4BLRA 1QGAA 1DINA 3GCZA 3N0WA 4L95C 5B57C 4OYLA 3WLNA 1N2CB 1XTRA 2B8WA 2NGRA 3H1GA 2WICA 4U8HA 1JKJB 2FEXA 3IKTA 4M1MA 4ARBA 1PP4A 3U4AA 1VLLA 2C42A 4F92B 5IXJA 3E35A 1XPRA 1R1DA 1JPVA 1DFHA 1Y8RA 1SVIA 2AG8A 2QG6A 4GWGA 1QM5A 2XXAA 1KAMA 3ZHOA 1Z2NX 2H29A 2WPNA 1JEDA 3PL1A 2J7KA 2CKMA 1PNOA 1VJTA 3AVUA 2BHSA 3M4ZA 4I4TA 1Z4KA 1VBMA 4JVNA 4DMLA 4YT4A 2QTVB 1IK6A 1L5GB 2FSFA 3E7FA 1QIEA 1TF5A 5EY5B 1A4XA 1L4BA 3MWLA 3H1TA 1KNXA 4MX8A 1C4OA 1JEEA 5KTRA 5KDLA 3OQPA 3JATB 4DVGA 4EG3A 4R2JA 4WCVA 5CM8B 3U3OA 1LSUA 1XRQA 1GG2A 4JI7B 1W85B 5BY2A 4PYMA 2ZK7A 2WM3A 3WA6A 3FDJA 4Y2JA 4ZCRA 2GCGA 1IU9A 2HBZA 2QF7A 4OUDB 3RTAA 1R15A 4Z9XA 4MQ6A 2VDKB 3EVGA 4UVIA 3ZE1B 3P2IA 2XKKA 1B23P 3B82A 4HDCA 1C9NA 1KC1A 1JPJA 2DPLA 1KPIA 2TMDA 3D8HA 6AT1A 4XQEA 3BWYA 1NW8A 1PL0A 5KHLB 3HN6A 1R74A 4BECA 2B30A 2VDUE 2N46A 1G60A 3I2YX 4GUAA 4UKDA 4QD3A 2VXOA 1SKUA 3GRPA 5JCOA 1Y1PA 2WEKA 4DIOA 4MUAA 5CVDA 4JOQA 2VNJA 5JNWA 3WZMA 1N2ZA 1L5SA 4B80A 2VJNA 1Z7GA 4KMMA 4YAWA 4AY4A 4BE7B 3FBGA 1BQ4A 4GLLA 5BPHA 3OP1A 3I9OA 5EHXA 3NIFB 5LBIA 2P2SA 3KT6A 2RGWA 3EZ6A 2BR4A 3EZNA 3BWEA 1QZ3A 3I4FA 4HGZA 1NUPA 3PFKA 3BTOA 2YIDA 4F2GA 4K9NA 3ABOB 4XSGA 4DJDC 1U5BB 3G8CA 4KIUA 5EP3A 2VYND 3DL0A 1CIJA 2UYQA 4EY8A 1FBNA 3FKSA 5AVTA 1EA5A 3DAPA 4IGAA 3SNKA 2I22A 4ND6A 4F72A 1FSFA 1RT9A 3OIDA 1E92A 1U3FA 2J5RA 4I36A 4XR9A 2GPWA 2P9QA 3PU6A 4EQZA 4I50F 3GLGE 2WJYA 4QPCA 5CLLA 4UD6A 1DAHA 1CRWG 4UAJA 2HDWA 3GMDA 1QH1A 4JDPA 3LQQA 4ZIRB 2HQSA 4HQKA 3ZV3A 4TV8F 1THMA 2CLFB 1CQIB 4L0DA 4MUMA 1IPEA 3PHHA 4V0ME 4GOJA 3ZHVA 2GD0A 1NXPA 4J1TA 3P97A 4QJ4A 1U3GA 3KYDB 1S0UA 3D0KA 1YS7A 1VPLA 3QOWA 4XCXA 2I4OA 3OF2A 5F2NA 1NN5A 1OYYA 2I0FA 2AVNA 3EEYA 5AMXA 1JTEA 1AF7A 4NBSA 4O59O 4OHVA 2EKBA 1QGYA 1C7IA 2M98A 3N8DA 4PXYA 4ZC8A 1THZA 1YE5A 1JVSA 4OO3A 3FCEA 3X1JA 2JI4A 1ND5A 3NTRA 1GUFA 5I4BA 1G8MA 2B35A 2ZYSA 3GEEA 3A36A 4W99A 4CL3A 1Z18A 2XGMA 1JBKA 1GDHA 1XG5A 2ES4A 2WHXA 3FA2A 3ZX5A 1QLHA 3I5YA 1AXRA 3ZZ0A 2KLBA 4HLNA 3KWFA 1A50B 1BCSB 1A8UA 3SQNA 1EB9A 4NDNE 3WLEA 3IFSA 3G2QA 4NNJA 5GP1A 1I9CA 2CF6A 3RT7A 3MTAA 1U02A 2ZR9A 4Z3OA 1A4IA 1WCWA 3C7CB 3KETA 2XTZA 1A2BA 3FI9A 3MJDA 3P9CA 4YTEA 4OHOA 4TT3D 2QJFA 3T9DA 3Q7RA 2PWBA 2QL5A 1LUAA 5FR1A 2UV8A 3ZHRA 2RH9B 2YN0A 1DU4A 4M4SA 3V5NA 3VPDA 2AOWA 2JIDA 3AFNA 4HQLA 4YV1A 1I4OA 2BPOA 1JJVA 4D4JA 2AN9A 1CQIA 3B7GA 4ARUA 3U5TA 4YUZA 5KVSA 2YBDA 4D43A 1E94E 5JZBA 4Z5XA 1RQPA 1JHQA 2RJOA 3FF1A 4Q12A 2AZDA 4TV9A 5ALXA 4GXRA 3AIOA 1Z83A 3H83A 5BSTA 3T7IA 4YXFA 4AKGA 2F4NA 2JD1A 2ZRMA 1RYYA 2JNWA 4OPMA 2Q4RA 3QYAA 3RFUA 2FMFA 3TN7A 4IDHA 3WRXC 5AW0A 1H9CA 3Q8XB 3AM3A 1J0AA 1O4VA 5AUOB 3DM9B 3H0CA 3G49A 4Q4JA 5THQA 4ZI7F 4QWWA 3II6X 3M89A 1QU2A 4QARA 3KKZA 1EVJA 1CJTC 3B13B 4MVJE 4OM7A 1PZEA 3RBAA 1BO6A 1NA5A 2JJ8A 3GVPA 2PA0A 4RKFA 4NV3A 1GZSA 3PPIA 2QG4A 3PGVA 4P22A 1XBTA 2NPIA 1ECBA 4LJ6A 5EUBA 4DSNA 4ER7A 5CEFA 2DSTA 3PGA1 3LP6A 5IBCA 2FETA 1NBOA 1ZZGA 5H5JA 4ITVA 2BBTA 1APBA 4IICA 4ZYUA 2WYHA 1SB9A 2GPJA 2GVNA 2HMWA 6ADHA 3ZGZA 1G8FA 4PO1A 4O2BB 1TU0A 5L3SA 4AIIA 2SHKA 2BFEA 4HH1A 4XUCA 3EXG2 2ZWOA 3BHNA 5JH7A 5DM60 1MO3A 3EWAA 3PGMA 3EDQA 2X0DA 5BOVA 4GPZA 3E18A 2ZSAA 4HH4A 4MJ3A 3B38A 3ZW9A 3BCHA 4A5OA 3GUZA 5J5AA 4AY2A 3ND7A 1ZNZA 2A7XA 4JLBA 3UMSA 1W1IA 1ZIDA 3ZVLA 4AO7A 1CVRA 3ADPA 4W9RA 1H2YA 4B3JA 1JHMA 1ORHA 3F6SA 3IOCA 4W7SA 4C22A 1KI8A 2QMHA 4MK4A 4EHJA 1KSHA 4QA9A 1M8KA 2C20A 2HNAA 2HRQA 3TKAA 2ZRJA 2GNPA 1EFUA 5DMHA 5LLTA 1M2NA 3WMEA 2NU6A 4LV8B 1EMDA 5AXCA 3HP1A 1FE8A 1FUUA 4ILEA 3AP1A 2RIPA 3RTBA 1D9ZA 4A1FA 2H2AA 1JPUA 3GZNA 3LBHA 3H2JA 1A5ZA 2VT3A 5HIJA 4ARIA 5ERYA 1FU7A 1Y8ZA 4BV9A 2I33A 3UB3A 2Q45A 1GPMA 1Q16A 1D7AA 3CFYA 4J29A 4L27A 2RK4A 5F7XA 3LNCA 3SLGA 1E7MA 1RAGA 1ZSVA 5L7WA 5TMEA 3RYFA 4N0EA 4YRAA 4Q3BA 3KQWA 4BX8A 1L3IA 3KE8A 5EJFA 2OL4A 4AQYB 4Y6PA 3OFKA 1WZIA 1PR1A 2POQX 1QTQA 2GCPA 3WIEA 4OYYA 1AA6A 3IPLA 3BJEA 5H82A 4XFKA 2AYXA 1SUIA 1G18A 7REQA 4JROA 1CCWA 4RPCA 5AK6A 5AKYA 4A23A 5HIKA 1CY6A 1RHKA 2IXTA 2LW7A 2XUGA 4Y6SA 3SR4A 1T9AA 3F6RA 4BNWA 4JLUA 1W48A 2CV2A 5KNCH 1BWRA 3L18A 1JXMA 2PT6A 3ZWMA 1QG0A 1I32A 2CDNA 2ZRDA 3MK31 5AT1A 1AY0A 3S44A 5I8ZA 5C1IA 1XZKA 4MP3A 1HE4A 3ZW8A 2HQRA 4DNFA 4LOIA 1ZUIA 3C3BA 3O2NA 3HVIA 1YFLA 1MHPA 4NCNA 3AR5A 4S12A 2PEZA 5AM0A 3SY8A 3B9PA 2Q8PA 4LY6A 3E8MA 4F2DA 2C8VA 1JWAB 1RS0A 1YB7A 1VCOA 3KDAA 4ENWA 3SBDA 4YJKA 5JS2A 3VU0A 4MCAA 5D3MB 3M82A 4WHMA 3D0QA 4W6QA 3Q9NA 2IU0A 3ZE0B 3GLHE 1Q84A 3UW3A 4Y6OA 1VC2A 4NBNA 3W9BA 2QG9A 2CDBA 3KJGA 3P45A 3F8SA 4HYQA 1YZYA 4PLFA 2C2GA 3EIUA 3NKFA 3SI7A 4RDCA 1Y1KE 2QL9A 4Q7EA 4E4YA 4EJ0A 3BMCB 1G8GA 2JGJA 2PZJA 2BKAA 3MUFA 3JWJA 4ESHA 1J2TA 1ULAA 3FAKA 4OMFG 4AKIA 2O52A 3PUJA 4NBLA 1WW3A 2RGYA 1J22A 4J4BA 2XVZA 2NXJA 4KXUA 16PKA 4TXHA 1DMSA 3RSGA 1LSJA 3RYHB 4A8JA 2AMYA 4LRUA 1H65A 2C2YA 3BTSA 3C74A 3EYAA 4B6SA 4ZHSA 1SG9A 1GFZA 3M1LA 2IOHA 2PL9A 2XMQA 4G1EB 4IZIA 4N7MA 2ONJA 1UKZA 1WY5A 4LYJA 3UKDA 1H4TA 1B6RA 2FUG1 2HRZA 4YO8A 4BIMA 3F5FA 2QN3A 3P4XA 2Q6TA 2B7LA 1IOZA 3FHTA 3TUZC 1EUZA 3MT8A 5G0TA 1KF0A 1N0WA 2TRSB 3BEDA 3U4CA 5JSFA 4LF7B 3DV2A 5PGMA 2GEJA 3FNEA 1DFIA 3D3KA 4CHGA 5H02A 4CIYA 2J07A 5JC8A 3LCRA 3OJEA 4EOGA 1IULA 5IABA 221PA 4P0QB 1U7ZA 1V4BA 3GLVA 3GCGA 1ZL2A 3ZDEA 1H66A 3HB9A 4TYQA 4XRRA 5DSXA 3PKJA 4ACAA 1CSEE 5F7JA 2A9RA 3AFOA 4TXNA 1C5KA 1IEVA 3W9YA 3ICPA 4GKVA 3BD7A 2BUCA 4F6CA 5TIIA 1P5FA 1TZJA 3VPHA 2YW2A 4LOAA 2TMGA 5HA5A 2BEJA 3OFJA 1I3OA 1V4VA 3L0IB 3V33A 4EI8A 3VNUA 4RVHA 4G5YA 1DO0A 1P7VA 2VDPB 1M1NA 3UMJA 1TK2A 3STYA 4KREA 1YRLA 1ZM3A 2X13A 4Y18A 3UBTA 1DXQA 1X8LA 3DZBA 1UT5A 1X2EA 2G9NA 1YDWA 4PYJA 4A0QA 4BB9A 1NVKA 1Q0TA 2FWBA 2XIJA 1FIUA 2H4FA 2J9FA 2VSFA 2CE2X 2F8MA 3Q3VA 5D5PA 3ZIDA 4BO3A 2XJ4A 3NXSA 1H2XA 1ZP6A 2K6GA 1ODFA 2DP4E 1RQ2A 4TZKA 4EG7A 1TM1E 2WINI 4JP2A 5KREA 3NBKA 4B3GA 5BQOA 1NX6A 4YRGA 2DHDA 4RK0A 2B4RO 4R69A 3NBYC 3OLVA 4C4AA 3GP3A 4TLCA 1KYWA 3RYTC 1WBDA 1KZ4A 5ESXA 4ZVNA 2B0JA 1XD9A 4OKSA 2V4ZA 4RIGA 2D2VA 2WD7B 3IIKA 2UYCA 2BT4A 3QV2A 5EMNA 3LKVA 4AMGA 1XYYA 5EEGA 3DDWA 5LLSA 3WDMA 4DMCA 2JCGA 1LLFA 2ZE7A 1ODSA 1X7YA 3A4YA 4FGLA 3RRBA 2WOJA 4X7PA 3S8MA 3LL4A 4DCGA 2HA6A 1N0VC 5K2OA 4PTLA 4FEYA 3QZUA 4LXIA 3A6FA 4UNIA 2PD4A 3ROKA 3T15A 3U7JA 1X7ZB 3NHPA 3VTFA 2VSNA 3DYIA 1JQ3A 4H6VA 3F5SA 4YLEA 3SZ3A 5CFMA 4UBOA 5L4LA 2CWDA 5IASA 3ZGNA 4QYSA 3EW7A 1U11A 4QQNA 1R8QA 5JWRA 3OEWA 2CFSA 3OZIA 1RKVA 3IH5A 2OO7A 3MHTA 2X9GA 1ZY2A 3IB6A 1EK1A 1QE0A 4A8TA 2QEQA 1BC5A 2WD9A 2YOFA 4U6NA 5IVIA 5ALQA 4D5EA 2QV0A 3DLPX 1EAMA 1HQKA 1PHRA 3NGXA 3MS2A 5KSWB 3GIDA 5K8UA 1OT3A 4ED9A 2EJTA 2DHCA 1Z5VA 1R4MA 1W0KD 4QUBA 1VPEA 4BAUA 3B53X 3VX4A 2VYFA 5FPQA 4CMEA 5FPHA 3TI7A 4LYHA 4YJFA 3N2GA 5BVHA 3O82A 4A6DA 4DJEC 4I8XA 2VZLA 2JZOA 4AG5A 2IYAA 3K2BA 2P4QA 4QDJA 3GVIA 4MMXB 4C0HA 3FRHA 4DNPA 1X13A 1YGPA 4ZQIA 2DVMA 4NEGA 4BU1A 3WVNA 3Q8KA 3A9UA 3KXIA 2WFLB 4R9SA 4RL6A 4XDGA 3L1HA 2IUUA 3I1IA 4OB7A 1EGHA 2Y0DA 2ZT7A 3ETHA 1E3SA 3QWBA 3E7PA 2A3RA 1CY4A 3T5CA 4N5NA 5A4MS 1Y8RB 1CZRA 3W6UA 1H8HD 1OXSC 4LGCA 1YUMA 2DERA 2JI7A 1IN1A 4W5JA 2OVFA 1FBTA 2Q6OA 4JLVA 5DWDA 3UKJA 5B55A 1AXGA 1FTGA 3FDZB 3I2KA 5HK8A 2J87A 3DXYA 1PFUA 2FAXA 4WZBB 1A5AB 5HBRA 4HPJB 1P9WA 3LXMA 4DARA 4YMTA 1TQ8A 3CH4B 1YNOA 1GAQA 1L5QA 1W96A 1N5RA 2PZBA 4PQRA 2HLDD 1CJSA 3BMOB 3OHMA 1Y9JA 2Z9CA 4OREX 1M2HA 1YS1X 4QGBA 4YLGA 1U0FA 1KDOA 1BDJA 3KKPA 3KV1A 5A3JA 2Q46A 1CR2A 3DMHA 5KVQA 2BEUB 1NLFA 2P9ZA 2PAFA 1EFVB 3TKLA 2AXQA 5F98A 1YUNA 2QYOA 1I14A 2FP4A 4NBVA 1LNQA 4WQMA 5HQJA 4B4UA 2IYWA 4DPMA 4DR4B 2H17A 3DT6A 4OYRA 3DONA 2BKUA 4KO2S 1A3CA 5G02A 1AD2A 5GQSA 2MHCA 5BWNA 1A0OA 1YRQA 3BCUA 2PPVA 3GJTA 4RADA 4Y0AA 4EHLA 1T9KA 2OO3A 2V7XA 1NJSA 2P90A 4UOQA 5CFOA 4JD5A 4DSTA 2WWYA 2NVWA 4M37A 4MQFB 2R60A 2DBZA 3IV7A 2VPPA 1PR4A 3ZWKA 4A6PA 3USES 3VAAA 1Y7LA 1KO7A 2JLBA 3UN1A 4FFVA 5AKJA 1P0MA 2EG9A 4L07A 1SUFA 2OAEA 3PYXA 4HGYA 1DWQA 5ALUA 3SAJA 2HLNA 3PPYA 1VLMA 3UMCA 4BB0A 2FN4A 5DIZA 5DMXA 3DLIA 3GJ3A 2AZTA 3SSMA 1XMPA 3GAFA 4MVJG 5T6BA 1Y1QA 1J20A 1YGYA 2DX7A 5EWLB 5CEEA 1NRXA 1VKJA 3HUUA 4RYDA 1QCDA 3ZHQA 2DCMA 1ISJA 1ECPA 1UC5B 1XFAA 1XMIA 1LBQA 2VS1A 3GT7A 3AT1A 4YDHB 2ZJ5A 3ZD6A 4J0JA 3T3OA 2GXAA 5IK2D 3ZQ4A 2NO5A 2PKQO 2HBRA 2NACA 4U7GA 4AS3A 2ZI6A 1JN0A 4LZPA 4UATA 2ODNA 2ZRQA 4HSEA 3WL5A 5BR8B 2FZ5A 4C0QC 3CV3A 5BVGB 4JJKA 1R0WA 4RD2A 3U26A 1D6NA 1G7SA 1TMKA 1YOVB 3H18A 3HI4A 4MWSA 3VNQA 3KQTA 1TA9A 1GCIA 2V74B 4IM7A 3SSNA 3N75A 1RPTA 3OY2A 4DWJA 1W4BA 5JVDA 3GLFE 4B6OA 3K16A 4Q9HA 1DZ3A 1CF4A 1W4LA 4NKRA 4DJFC 1QIIA 1GILA 2O2EA 1L3BA 2QLFA 3F3MA 3OAAD 2B1RA 4MKFA 4Q05A 3AUUA 1QRUA 1HDXA 1OKKD 5AWFC 3HKCB 2QVZX 4CMJA 2HHHB 3VU9B 2Q4TA 1U9YA 4U2KA 4FC6A 1L5HB 4WBNB 3IJEB 3EF0A 3ZPXA 4AXXA 2A9PA 3RAPR 2GFQA 4NOJA 3O8NA 1ZK4A 2ZBDA 3N6RA 1CLUA 1ZMXA 2QIPA 1FFCA 1QHSA 4HXGA 3WGZA 2FWPA 1NBIA 2C8KA 5DBFA 4Z2YA 3OQ1A 1OLSB 3RVKA 4CKWB 5KU7A 4YPFA 1KP3A 4NLLA 1G20A 2C84A 4EI7A 1SZDA 1BXGB 5AJHA 2OHOA 3SQMA 3SF8B 4XIJA 4ESVA 1M0TA 1C7EA 2GF0A 2GZ1A 4HVLA 1JXQA 4AICA 2P0EA 3UT0A 1XALA 4NEHB 3JX9A 1Y8QB 3QUBA 2F48A 1KFEB 3B3JA 1EKXA 2ZRNA 3SS9X 1THTA 2QX7A 2XMCA 4L15A 4JBLA 3VOSA 1NU8A 5LVAA 4YAEA 3LGXA 3B1YA 4M1EA 3EPKA 1TDJA 3SEQA 2A78A 1JIJA 4TSKA 3GXBA 5KWIA 4CUZA 2JIRA 2Y1EA 1BFKA 1MC8A 2BKXA 1Q0HA 2Z8YA 4IKOA 4WACA 4JI8B 1TK3A 3KEQA 2B94A 3I5UA 3I9V1 2XMZA 2EP5A 1Q22A 2Y1OA 1CUJA 1K98A 5CURA 3SZGA 2I1LA 3UV3A 3PX7A 4U9UA 1MQAA 1VE5A 1FS4A 1V6CA 4CDRA 4TMZA 3HKCA 2FJPA 1JA1A 3MJSA 3MTGA 1LLDA 2JFGA 4FT2A 4DUYB 4W7HA 1U2GA 1WPRA 3CINA 1KR2A 2HCRA 1Z4IA 1H23A 2HWYA 4R71A 3KXLA 1N2IA 3W8DA 3S2EA 4YREA 1JHAA 4K5QA 5L9AA 2C5GA 3PNLA 5AOVA 5ADWA 4G1VA 1SBYA 3BIFA 3F6YA 3UUFA 4C9BA 2C58A 3BWBA 3ZVNA 1A5TA 2GAJA 1VPTA 2PG3A 2PGIA 2W0MA 3UH1A 1BW9A 2YVQA 2DYKA 5DNCA 1RC8A 1NJGA 5B3KA 2DULA 3LHSA 4R68A 3RRXA 4DJTA 5J4YA 1G59A 3DOCA 3HO6A 5AKIA 2PGDA 3LCCA 1BFUA 1UKBA 2AN5A 3AIKA 4UUNA 3SIXA 3NTVA 4J0HA 2GB4A 4RVSA 4UNRA 5CXXA 4XPIB 3GJSA 3E84A 4JBIA 1Z0SA 3NGLA 2VLIA 1RPNA 2HIAA 2ZIFA 4FN5A 4HAVA 3FHLA 4LWPA 2DLNA 4HATA 1TT5A 4MYSA 4OK5A 4QODA 4TV8B 2HA3A 5I9BA 1UPUA 4B4KA 3OJ0A 4PBTA 3UGKA 4BUZA 5I7RA 2E9SA 3L0PA 5A0FA 1H0RA 4B4VA 1E0KA 3QELB 3RBXA 5D00A 3G9UA 1XU7A 1A8HA 5F64A 5CK4A 4GZ5A 2XDYA 4RWEA 3OO0A 4ZOBA 3QVGA 5AVOA 4KR7A 5A05A 1WM1A 2EQBA 3UIEA 3C24A 4P31A 3CUYA 3KQMA 4QFMA 3ELWA 2FEAA 4B6RA 4JXXA 1PQYA 2WK1A 3JD4A 4HWTA 4H7JA 2WB2A 2B92A 2FXIA 1ZC4A 2QORA 4L0QA 4RXTA 4AY5A 5E95A 4OYHA 4H3VA 4QE3A 5EQFA 3VH4A 1P0IA 1HKUA 1OAKA 5REQB 1W36D 3AI1A 4KTTE 3ZY5A 3D31A 2IEZA 3PTZA 2I3ZA 5BYJA 4ARAA 1UZNA 1TUIA 4LYFA 4GC9A 4GFDA 1ZNQO 2HIMA 3MTJA 5BN4A 1GKIA 3OJFA 4IQ4A 4TVSA 1XZJA 2GN2A 2PK3A 5HIIA 3TW8A 5CR9A 4J3FA 1V37A 1RD4A 1NMQA 2G67A 1JFRA 4RPGA 1OLXB 4IIFA 4F3RA 4N76A 1CR6A 2GAOA 1EWKA 3H87A 4M1OA 2XA2A 4BJ3A 1KI9A 2LGJA 5A6SB 5CJPA 1T34A 3GEBA 9LDTA 1IY2A 5E9QA 1H8HA 4BNZA 1BWQA 5C34B 2E3JA 5IDXA 1BMTA 5ALYA 1CF9A 1A5SB 1EGQA 4BL5A 4HNUA 1TJ4A 1T2NA 4RZ2A 2O2DA 3M5PA 2P65A 1VSQA 3PLNA 1R6BX 1U8EA 3ORFA 3DB2A 4IVQA 5D85A 4MA0A 5HM6A 3K73O 3Q11A 2XE4A 5AR1A 1AK9A 1CXZA 2WSBA 1WCXA 4QEDA 4R0VA 5DGCA 2HA0A 3SZUA 3T4PA 1M76A 3A1FA 3LUPA 4EUEA 1P74A 3AOEA 3L7BA 5ESRA 3ZNQA 1PR3A 3ZWQA 4ZO7A 3A1UA 5DT2A 3WC4A 1XRSB 3BDIA 1DBSA 4YFVA 5IUJC 4G85A 1XNRB 3GLKA 5CJJA 1Q6YA 5BN3A 3T5AA 2F1KA 3OA0A 1K3TA 1QS0B 4BKOA 4L5AA 1IIBA 1SD1A 1IOLA 1DKUA 3QU5A 5DH9A 2ABWA 5FHQA 5BSGA 2ZXFA 2H54A 1JE1A 2EYQA 1C80A 3NHUA 2XAUA 4GE0A 2OEPA 5IDYA 5KYVA 4U3JA 1U9JA 2VH1A 3WMFA 2H06A 2GNOA 3FVWA 5U1PA 1OAOC 5DXAA 5ETJA 5CDUA 4RF3A 4B2IA 3JWEA 1OGYA 4UZEA 3G2OA 2GD6A 1DKRA 5DLYA 1T3LA 1URPA 5LZ8A 4ALKA 4C0XA 4Q01A 1K0UA 4JIGA 1L4YA 1OH5A 1O9GA 1ECFA 1N6PA 5C80A 2YNMD 5C4GB 1PUIA 4I1PA 3LVQE 4HFJA 3S99A 3TNDA 5ECGC 3MUOA 2PJDA 3R09A 1ZSYA 3R9XA 4TPKA 1U2RA 4BCBA 5IFKA 3OP4A 1MAWA 1WQ3A 3QXSA 1MMFB 5CDFA 4AZ3A 4DJ5X 3WIVA 4BY9E 1WDTA 3LOPA 3LT0A 3O4VA 1QFMA 5IZCA 2BELA 2C3OA 2VPZA 1JHRA 4DDUA 3MM4A 1IBMB 3W5CA 1RDFA 3Q5EA 4DILA 2AQHA 2J46A 4H1WA 1C3JA 4TZ0A 1EUDB 2WRZA 4JCCA 2QTTA 1J4AA 4RE5A 3V1LA 4Q4DA 4X61A 5AUQA 2BUBA 2VA9A 2Z6AA 1P4SA 3K1TA 1TNDA 2IXEA 1VZ2A 1MB4A 3GFQA 4HQ6A 5H59A 1RKXA 1W93A 2IKSA 1RZRA 4AS1A 1A1SA 2L0XA 3DKKA 2ECQA 2PLWA 2XUIA 4JYMA 3E22A 4P92A 4G09A 4BASA 3HTXA 4K05A 5ITZA 3B6ZA 1XVLA 5K0CA 5A9TA 4LNUA 3HLTA 4MLCA 1OBOA 4BP1A 2C61A 3WHKA 3L8EA 2DB3A 1NKTA 5IN5A 1W9MA 2FUEA 4LMRA 1KI1A 1JKIA 2HI0A 4J1NA 1W0JD 2NO7A 2YTZA 3A9SA 1R4NB 2Y67A 3GZ4A 2QUJA 1Y5IA 3BC1A 4E70A 2RD2A 1MCZA 2O7SA 1CQWA 4YONB 3CT6A 3MWDA 2UYHA 3C8UA 4MQEB 4NCIA 1H4QA 2W6QA 2R96A 1J8FA 2QSYA 2QTLA 1PGJA 1F1JA 3Q6IA 1VFNA 1Q95A 1YIAA 3EVZA 3LP8A 2V8OA 2ZB4A 4KK4A 4MQMA 1X1SA 5TQ0B 4D8XA 3A4TA 4NOKA 1M6VB 5KYKA 4LDNA 1Q92A 4F3YA 3SMVA 4UTNA 1UKYA 2CFIA 3AJ9A 4REMA 4HDOB 4C29A 4ABTA 3E3AA 4XYLA 1QVZA 2PMEA 4TUYA 3KQNA 2CLSA 2P3LA 4I14A 4TS1A 4MWCA 3RCBA 5EJAA 3KEGA 4DLWA 3WICA 2PKRA 2YJ6A 3KKNA 3THYB 5I5EA 4P80A 1D2AA 2G4CA 2QPAA 5D01A 3UC5A 4P32A 1E1RA 1XEWY 1T26A 2OD9A 1GLNA 2B4TO 3DBVO 3L8HA 3QENA 4JVOA 1Y5RA 2HMVA 4LF5B 2FPUA 1JKFA 4WLUA 4M9ZA 4RK4A 1YVRA 4EITA 4MWTA 3RRZA 2JAQA 1YWGO 3SD7A 3GNSA 3C87A 4NICA 2I9KA 1SKAA 1NJ1A 2VO1A 4NECA 4M88A 1ZA2A 1XCPA 2VZ9A 1Z06A 3F6CA 4GBED 2AE2A 1NULA 4LJLA 1G20B 1GZVA 2Z5VA 3BVPA 4P4GA 4MYTA 1I2ZA 4MUIA 2KM1A 3X3HA 4MHSA 4YT8A 2G7ZA 3OZAA 1GZ5A 3Q2OA 1UBSB 3C6BA 1XMXA 3GW8A 2REBA 2WHPB 3KZNA 4W7IA 4ZQGA 5BMOA 1KORA 3MAJA 3OQBA 1T8UA 2TS1A 2Y27A 4ZI5A 1ZI6A 2A14A 4MLZA 3CMMA 5JZ9A 2DLDA 2QM0A 3C4JA 4CMBA 5KU1A 1PNRA 2OFWA 3IVCA 3QVVA 2EFDB 2Q5LA 2YV2A 1G6Q1 4XPZA 3K9BA 3KPVA 3EDCA 3EBPA 3V6MA 2X3UA 4GMGA 1C0PA 3F7NA 5LYYA 1PJLA 1BYUA 4NFSA 5JMPA 2D1SA 1P8JA 2WAAA 1DTEA 2RARA 2GZMA 2X1VA 2CKDA 2XKBA 1M7HA 5EWMB 1C2TA 2OCLA 4LVUA 4HWRA 1WLYA 4RFSA 4D8WA 4A6EA 4OV6B 4WSOA 4DA9A 4DTIA 3R0VA 1CS4C 4XWWA 5EUCA 4FSHA 4GH5A 1LTHR 1VJDA 4RNDB 3TRDA 5K0FA 2QJRA 4YRTA 4EGAA 5M3BA 2REXB 3ITNA 2H63A 4OI1A 3O84A 3JD3A 2OK8A 4R6XA 4PBRA 5ARDA 3THRA 4OLAA 4GNKA 4EVIA 2WVHA 3OE5A 3HU1A 4AJHA 2BFDB 1LKZA 3IMKA 3V1NA 1Z74A 3SX2A 4TYYA 1YQEA 1FOEB 4LNUB 4UM7A 3ZCXA 4DAEA 1N6NA 1SQGA 1SOWA 2DHEA 2AE1A 2FEWB 4JBXA 1ORVA 2FK8A 3E22B 4UM5A 5HCNA 1NPDA 1T2DA 1KWGA 1Y6QA 2JHPA 5C46F 2D1YA 1YR6A 4F5WA 2IUFA 2BW0A 3EXHC 4TKUB 3FNGA 3VUFA 2Q3DA 4G1CA 5EXXA 5T64A 4CKCB 5CXSA 1X7XA 1TVKB 1KARA 2EKPA 1Z28A 4DA8A 5KTPA 2QRJA 2QXTA 3AEUB 3G9TA 4NJMA 5EKSA 1ZUHA 3E05A 1XTIA 3GB9A 5I7AA 2FOIA 2FFJA 2A5FA 3RTDA 2NTEA 2RBGA 2QB5A 3WYFA 5KQMA 4RTRA 521PA 3NS7A 5BSHA 2OB2A 4WDRA 5H0IA 5CVTA 4G1UC 3TKYA 4PHCA 3DF7A 4QLAA 2OWEA 2NU8A 4GI7A 1XCGB 4WZZA 1E3WB 1ARZA 3BWMA 3NAQA 4EEZA 2AKEA 1XPUA 5TARA 2ESRA 3WZ2A 4J0EA 4B9AA 4DSOA 4PLWA 5LIPA 3MJHA 4CODB 2CCJA 5EJIA 1JUDA 4DYHA 1A98A 3PLAE 4TLAA 2YL2A 1AN0A 3O38A 3O4FA 3O0TA 3QLUA 1DARA 3ZEIA 1O96B 2AFIE 2QSJA 3MGCA 1II8A 2MCFA 2A8YA 4UBJA 3KLBA 3IIMA 3LLMA 4WY8A 5ALMA 1UCFA 4U3JB 4F4UA 3SXPA 3N8GA 1V0JA 3QYJA 3BJMA 1JH8A 2ZFUA 3G0GA 1YH3A 1N2EA 5AVQA 3OKPA 1CHNA 3AJDA 3FNQA 4AU1A 4F3NA 5ADUS 3ACCA 3RVLA 4NK4A 4QXRA 4MV1A 4UREA 3RRNA 1FNDA 3JW8A 4ZODA 1CP3A 3WJ2A 4LF9B 2Q1SA 4MZDA 2GDZA 1KHHA 4QM7A 4QOFA 2AUNA 4L4SA 1DAEA 3C6KA 5TQVA 4Q4CA 1XK7A 2WPDA 4EZBA 2P4EA 3PG5A 2PZ8A 1LBEA 3BD6A 1RM5A 5FA6A 5HGXA 4G0MA 2QP3A 1FCJA 4QFBA 4QBIA 5CK5A 2NADA 5B53A 3QKSB 5NULA 3SJ7A 3UJPA 4E3WA 3VA7A 1NM5A 1PZHA 2UYGA 1NI4A 4MV0A 1RWXA 3DO8A 5FA8A 4MDYA 1BCRB 5IP5A 2RGCA 1ESDA 4CWAA 1SPXA 4FSXA 3LHFA 1D4FA 1VLJA 4AM8A 1DEKA 1G5TA 4D4HA 3KFLA 3B48A 1LNZA 5J4KA 2IWHA 4PAWA 2DKNA 2OP0A 3HDJA 1O3YA 5FHRA 2AF3C 1P5HA 3I23A 4BPRA 3DMNA 4K9RA 2AC7A 4XTRA 4Q3LA 1Z0AA 2H48A 2EFJA 1CQJA 1TC1A 4PG4A 1AVTA 2HD4A 4XFDA 2NVUA 4MV4A 2QUIA 5FLYA 3QYFA 2L82A 1NUAA 1JLLA 3I04A 3C3EA 3HYLA 4HLCA 3IAHA 4RXMA 5ANRB 1T5HX 5M29A 1SCJA 2LDXA 3WOVA 4FE7A 4MA5A 4RTJA 2PEYA 1FU4A 2F9FA 1HMYA 4J0KA 2WE8A 2W6IA 4M0FA 1S2IA 1N1DA 1XU4A 3ILSA 1K5PA 3GJQA 3GROA 3NM5A 3P19A 4MQ4A 1V6SA 3G7SA 4P86A 2QTHA 3WBBA 4C4TA 3N07A 1V71A 1PDWA 1C8VB 2Y1KA 1ZA1A 1ZW1A 1SK8A 4YPOA 4JDUA 5K3FA 4C2AA 4V0QA 3GBSA 5JNLA 2P4UA 1QRSA 1CDEA 3FYTA 3STWA 1PR5A 3CNBA 4MP8A 4RK7A 1BDBA 1UEIA 1GQYA 3A58B 1G98A 4WH0A 3IEIA 3AVYA 2RB5A 4MB6A 4HT3B 4LDQA 3H0EA 2Z2YA 5E38A 1QC5A 4PFKA 1GPWB 2AJ8A 1FMJA 3H11B 3BIXA 3ESBA 4W4TA 3UV6A 2I8AA 5BO5A 3R7DA 3MCTA 1E4EB 1B15A 2YW9A 3DZHA 3LC1O 2GR9A 3P9KA 4I81A 4EB0A 4FP9A 3TMAA 4Q3KA 4J9VA 1SR8A 3U9SA 2JGIA 3T12A 1W2WB 3U40A 3TBHA 4WLVA 3VKWA 5KQGA 3U9TA 3VR1A 4X8HA 2M1XA 3S7ZA 4CBVA 1ABBA 1T9ZA 3LK6A 5E4JA 1RVDA 2D13A 5B58C 4LSMA 2QVCA 4MPPA 4PG7A 2I7DA 1RWMA 4E1VA 1ZN9A 1AGYA 4RK1A 4DIKA 2WPDD 2WUEA 2ATEA 2FJUA 1E2DA 1WHSB 2X8AA 2XX3A 1NRWA 3C8ZA 1U8YA 3CZ5A 4FUQA 4IGKA 1ZNWA 1KU0A 1GVHA 1R6UA 1UDCA 1RQNA 4C5CA 4BEBA 4NU5A 4F46A 2V6FA 1RYEA 1P60A 2JFYA 3O73A 4GW3A 5K3AA 4XWGA 3VKVA 2X19A 4D4GA 4DABA 1FTSA 4MR8A 3RARA 2H4ZA 3QWHA 2XXAB 1P2BA 1UDXA 2DAPA 4QTYA 1HYGA 5CPBA 4Q4AB 2ZUSA 3GL9A 5FX2A 1OFGA 3BK7A 3GRCA 3BXEA 1TUBB 1HORA 5DBIA 1OXMA 3DLCA 2B4AA 4G24A 1ODLA 3CJQA 1L4UA 1BRMA 1U3CA 3DVSX 3IQZA 1TEHA 2FZ4A 1U2TA 2ZJ7A 4IZOA 3NYQA 2AC4A 2X41A 1E3EA 5JU6A 2JLQA 1W87A 2C07A 3TYXA 4Q66C 1ETHA 4MPJA 3UGTA 4FDTA 1UPAA 3Q3GE 3VH1A 5C8VA 3MCVA 3TB6A 2FFHA 4GXQA 3LOQA 1TAQA 1XQXA 3A9VA 4C7XA 2AK3A 3FBTA 3GCWA 3GFPA 3KVRA 3QNUA 4CN9A 1E0SA 1WP9A 4Y1RB 1GNLA 1GT91 3CLUC 4G5HA 1F5NA 2ZR0A 2JKZA 1XRNA 3GG2A 2PJZA 5DGTA 2V4UA 3IEVA 2V96A 1BIFA 2JIBA 1TCBA 4DIFA 4PRLA 4G97A 4C01A 1JDSA 2IYNA 2QGNA 4JQOA 5EJ4A 5JHGB 2NUAA 1Z88A 2G08A 2HCTA 4RH3A 1ZGGA 3D2LA 1TO1E 3G5LA 5J2UB 2P3OA 5I7SA 4WOKA 1Z2EA 4GEGA 3OPNA 2B21A 2INGX 3J80A 1QYIA 3Q3JB 4U2FA 1ZM9A 1NR7A 1D1TA 1P4AA 1XLVA 2WTBA 4EPRA 1FP7A 1UOOA 3C70A 3BS4A 4HPXB 3ZG6A 1CDOA 4DYDA 1K2VN 4X54A 3TZ6A 2PYZA 1LDBA 4QPNA 1NSYA 1U1IA 1ZICA 2F6RA 3EGDB 4KH1A 5EE9A 3OQOA 10MHA 4GYWA 1EK0A 3KFXA 4OL9A 1K7FB 1JHZA 2OG2A 2AMJA 1DRWA 4H17A 3KKOA 3TWOA 1UXOA 3N2NA 2ZIEA 2BSAA 3WNDA 2IOFA 2W48A 2VHUA 2BRUA 1LQTA 2AK2A 4XQ0A 2I54A 2FZWA 2L2QA 1GSHA 3OX3A 3PEUA 4FYKA 3SXJA 3RIXA 3DTNA 3DTVB 3QEMB 1DPGA 4GSKA 4BHTA 2P9CA 3EXEA 4H4DA 4QUEA 1TD9A 5EXEA 4O5OA 1SUEA 4HXEB 4W5QA 2CWWA 3JZMA 3UQYS 2FZVA 1P33A 3EG5A 1WV0A 1R4NA 3F3SA 2BOVA 1DHTA 3S2ZA 3G9XA 2WZQA 4GOXA 4YEDA 2XMDA 2NUAB 5JISA 1DFGA 4YMVA 1JAHA 1HDEA 4WA8A 5E6RB 1HTBA 1NBME 4CJXA 3U4QB 1RAAA 4FDLA 1AUPA 1T9GS 3PDJA 3MERA 4PANA 3I8OA 3ZC3A 1WUHS 1A96A 3NUGA 3K9HA 4IHAA 1AS2A 4PRKA 3CLTD 4BAGA 4BQPA 3CX3A 3U6BA 4BMDA 3GZJA 4HJXA 4OHKA 2J3MA 3M5DA 1W4RA 3TJZA 2BYTA 5SV2A 5TVGA 4EDHA 2D0DA 2H1RA 3P96A 1BH2A 3RASA 5FAXA 2WU8A 4CCWA 4ZCIA 5JYEA 3OO1A 4DCUA 4J75A 1BS2A 1WXWA 3KHSA 4OXQA 3IL2A 3E8XA 5DCLA 4XVQA 1RE0A 4KQ1A 2HDHA 3EWNA 3TZKA 1TGVA 1YACA 5IZCC 3FJ1A 4PG5A 5KZMB 1LFDB 4X20B 4AJ2A 1W5TA 4LMBA 4QHSA 5IH7A 4I4NA 4JL8A 4WJKB 4C06A 1M34A 3LW8A 4HDRB 4JMPA 3ELYA 3RRMA 5ALGA 1CZKA 2Y1WA 3GUCA 2A67A 1EYZA 1ISHA 4WPGA 4GOMD 4C7VA 1DQYA 1ZESA 1LBTA 2V3WA 4KXWA 1AO0A 3OAAA 1XYVA 1I7SB 4J03A 5K0JA 1NMYA 5HNKA 2O14A 5JD6A 4ID3A 4JR2A 1Q12A 2ADMA 1H1TA 2HWXA 2RAUA 5FWNA 3WKBA 1X7GA 4FBMA 4B2YA 4DR2B 1W19A 1RYNA 3F5MA 3W78A 3FE2A 4URYR 5HUHA 3LGAA 3BE8A 4IINA 1JGTA 3HYRA 1N6OA 1B8OA 2V4MA 3SJAA 2PKCA 3SWWA 3UWSA 1EX1A 4KQIA 3KL2A 2Q3LA 2C00A 2XTMA 3A1CA 3KQYA 4WCFA 3Q3EA 4MW0A 8MHTA 3MMSA 2QHXA 2JAWA 1QYVA 1VCNA 5IJWA 2BHLA 3LM8A 5ALZA 2DJ5A 5HKKD 1NONA 1WEKA 1VJ5A 2R4UA 4PM4A 3NJ8A 2RIRA 4JFRA 5JCJD 3BHJA 3WRYC 4WVFA 1XHLA 1B0AA 3ZLUA 3C3WA 5BSKA 3I6IA 3FDFA 2BFBA 1A76A 3H9GA 4BLPA 4L72A 2ERYA 1D4OA 1EQ2A 2FRDA 4GLBA 4L8VA 4AJPA 4J94A 3G0BA 4XDHA 3ZKWB 4MW6A 3TFQA 2OAQ1 4B0OA 3PP8A 2WG2A 5DEIA 4WZBA 2HO4A 5FI3A 2J0SA 3OD5A 4C4PA 1T2UA 5I45A 3CRQA 3GGJA 4KFSA 5IUKC 3GLUA 1BU8A 3X2FA 4WTOA 2VJKA 2AV6A 1IZZA 4ZCPA 3DLBA 4N0DA 1NNLA 5T8KC 3OI7A 4G4IA 2ZXUA 4JQSA 5TC4A 2WJGA 3IUNA 4MR9B 4W8HA 3VGJA 1M7GA 1GO2A 1KGSA 2VQDA 3L49A 3AF0A 3Q6NA 3ZY4A 3VR5H 4YN3A 4DL9A 1NXTA 2OM6A 2JCYA 1NVUQ 1N1MA 2VRCA 2O0KA 1W36B 1AKMA 1NOKA 1PGQA 2BUAA 2NTVA 3PPXA 2BL4A 3NVDA 4FOOA 4N01A 5E6SB 5GOZA 4QU5A 3ZCQA 5AVYA 2O8BB 5JJLA 4W1RA 3VPAA 1UWLA 1JJAA 1CQJB 1RI2A 3IQXA 3IMGA 1LC3A 4Y9SA 5F3DA 2DR2A 1UODA 3AKDA 1EG7A 5ALPA 3KUDA 4WKOA 4IIJA 4P0TA 4FLMA 1L7EA 5K0EA 5BSWA 3SXUA 1FLVA 2JANA 3N7TA 3T52A 1T5BA 1MV8A 2WNSA 4X91A 1PQUA 4B48A 5I7OA 5K4GA 2H4XA 1A97A 3KALA 2GWRA 1C3VA 2PU7A 1U3WA 4RVUA 8OHMA 3NORA 3NPMA 4EELA 3KAQA 4JB2A 1YDHA 2EVWX 1HTTA 2OD7A 3EPRA 4BQOA 3B3GA 2B7CA 3S1LA 2DCUA 2ZSHA 1E1DA 1XWIA 2BKLA 4YROA 3OURA 4Z7JA 3L7MA 2SBTA 3NH9A 4BE9A 4MP6A 3MS4A 2QR5A 5IMSA 3Q98A 4QM6A 2P5UA 2BFPA 3ISJA 1X87A 1EI9A 3EBOA 4RL4A 1G2QA 2FSGA 1ZLXA 3CGGA 2JHCA 5IKOA 3STUA 1T4CB 3RVRA 1PD0A 1P19A 1FJ2A 1P7CA 3TEMA 4X6LA 4ANFA 3A28A 3B6EA 3T61A 2ZQYA 3H9CA 1E0DA 4MCHA 4DQ0A 1ES9A 2J4CA 4AJ9A 2H4JA 1X7DA 3ZJUA 2P3QA 3CH5A 4UU8A 4EFLA 1NNUA 3EF3A 4JBWA 1A2KC 5G1OA 5A3SA 3PD0A 2CSXA 2JRLA 3P9QA 3D5QA 1NOJA 3E81A 3HJRA 4KFCA 3G7UA 2H2HA 4DFDA 1YKFA 1BX1A 2CNBA 2IU3A 4LCBA 4U8GA 4IIYA 1H0KA 2JAOA