4C76A

Crystal structure of the fmn-reductase msue from pseudomonas putida kt2440.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
182
structure length
182
Chain Sequence
ARVIRVVVVSGSLRAPSRTHGLLQALVERLPAVLPKLEVHWVRIAELSASLAGSLERDSASADLQPHLQAIEQADLLLVGSPVYRASYTGLFKHLFDLVDHQSLKGVPVVLAATGGSERHALMIDHQLRPLFAFFQAHTLPYGLYASVESFDDQRLADPAQFERIERVLDTVGAFFHIPVAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FMN REDUCTASE (NADPH)
publication title Crystal Structure of the Fmn-Reductase Msue from Pseudomonas Putida Kt2440.
rcsb
source organism Pseudomonas putida
total genus 62
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 1.5.1.38: FMN reductase (NADPH).
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c76A00
1TLLA 1AZLA 3B6IA 3ESYA 1CZKA 4QOJA 3ZHOA 2Z98A 2QMZA 4YALA 2A5LA 1SQSA 1T0IA 1CZOA 3SVLA 1ZWLA 3OJXA 1KBQA 2FLVA 4LTDA 1ZX1A 4ICIA 5B3LA 1AKWA 2FAXA 3O73A 1CZHA 1WSBA 4DILA 2BF4A 2V5UA 3KLBA 3OX2A 1J9ZA 5EAIA 3GFRA 1AKTA 1FLNA 4XDHA 5EA2A 4GR9A 2RG1A 2D5IA 2R97A 1QHEA 4GI5A 5A4KA 1RTTA 4F8YA 3U7RA 4U7HA 3KAPA 2FOXA 2FX2A 2QR2A 2QMYA 4FGJA 1QRDA 2XOEA 4OXXA 2QWXA 3W7AA 1J8QA 3L9XA 4QOIA 3OVMA 3OX3A 1FTGA 2QX9A 3L9WA 1CZRA 1B1CA 3N3BC 2V5VA 5FA6A 4C76A 4CETA 3GFSA 2R96A 2Z9BA 3LT5A 3FX2A 3NHKA 1FVXA 5LJIA 2FDXA 4C0WA 4XDGA 1AKRA 4NULA 5F51A 1X77A 1D4AA 4N9QA 3W79A 1D03A 2KQUA 5LMCA 1CZNA 3N3AC 5BUCA 3NLLA 2QX4A 1E5DA 3U7IA 2M6RA 4ZVNA 3NHJA 4Y9RA 3TZBA 4M0CA 2XODA 1OFVA 2V9CA 3ESZA 1H66A 3B6JA 3LCMA 5LVAA 4LAFA 4NLLA 2Q62A 1YCFA 1OBVA 4ZVMA 4YAFA 2OHIA 2WC1A 4DIKA 1WSWA 1RLJA 4CF6A 4J8PA 3F90A 4Y7CA 2OYSA 2HNAA 1QR2A 4GQIA 4Y9UA 3R6WA 1YRHA 4ESEA 3FW1A 1DXQA 4C14A 2BMVA 1AKVA 3KEGA 1AKUA 2ARKA 1YCHA 4FGLA 2OHHA 1ZWKA 3NHRA 4BMOB 4YAUA 3ES9A 3FJOA 2X2OA 2BN4A 2MTBA 5EMNA 1NNI1 1FLDA 3HR4A 3OWHA 5LBUA 4HS4A 1YOBA 3NFRA 2Z9DA 2AMJA 4U7GA 1RLIA 5F4BA 2BPOA 1JA0A 3HA2A 4PTZA 2HNBA 2F1OA 1AMOA 5F12A 3TEMA 1AG9A 4YQEA 2FZ5A 2HPVA 1BU5A 3W78A 3F2VA 3NHWA 3FNIA 1DXOA 4LA4A 1FLVA 3P0RA 1C7EA 1XYYA 5B3KA 3NHUA 4QOFA 4PU0A 4PTYA 4YAOA 2BZSA 5FUQA 4QOGA 4HEQA 4QODA 3B6KA 3G5MA 1BVYF 1F4PA 2W5UA 1FX1A 3K20A 5LLDA 4D02A 5NLLA 5FX2A 1AKQA 3EDOA 3KAQA 3RPEA 4LTNA 4R81A 3QE2A 1DX9A 1XT6A 1D04A 4YAWA 1JA1A 3GFQA 3OX1A 3S2YA 3NHPA 4S24A 3NHLA 1FUEA 3NHYA 1YCGA 3EYWA 1CZUA 4U7FA 5LBTA 1OBOA 3JSXA 3NHFA 3B6MA 4H2DA 1GG5A 1TIKA 2OHJA 5LJLA 4LTMA 2GSWA 3D7NA 5NULA 5TGZA 3N39C 4QOHA 1SG0A 1YKGA 1XI2A 3OJWA 2MWMA 2N1MA 1H69A 2X2PA 4H6PA 2Z9CA 2KLBA 6NULA 3F6SA 3QFCA 1AHNA 4C0XA 4ZVKA 3GAMA 4FGKA 4N82A 2FZVA 1RCFA 3W77A 1V4BA 5ULLA 1J9GA 1FLAA 3K1YA 3O2NA 4N65A 1YDGA 2QX8A 1VMEA 3NHSA 2ZKIA 2B3DA 1T5BA 4QOEA 2FCRA 5JROA 1J9EA 3UXHA 3UXEA 1CZLA 4DY4A 3F6RA 2FVXA 2QX6A 3ESXA 1KBOA 3HLYA 4BMPB 1XYVA 1C7FA 3QFRA 2Q9UA 2MOKA 2MT9A 3TE7A 3FVWA 4ZVLA 2M6SA 1QBGA 3OWXA 1I1OA 4FX2A
chains in the Genus database with same CATH superfamily
4X94A 4DSUA 3HO6A 2G1JA 4WZBA 1HPLA 1OCEA 3NT4A 3PCXA 2XAAA 1HDCA 1T6XA 2ZANA 3IUNA 3PDWA 3NMUF 1U2TA 1I30A 1C1DA 1K6MA 1P2SA 4CQLA 4NX2A 1ORWA 4MQLA 5DEIA 2QR5A 3OZTA 3GARA 5TPWB 3R3UA 1MVNA 2ABWA 2BHSA 3M2PA 2WWTA 1II0A 3BN3A 3K0KA 3ZIAA 2BFAA 4J29A 4W1PA 4MKZA 2VKTA 4DCMA 4KI7A 3WL5A 4BNDA 1K89A 3NDPA 3RIXA 2CMKA 3WO0A 1LK0A 2ZI6A 4BP9A 1ZUWA 1BD3A 1GY8A 3GRPA 3VR4D 5EIEA 1TM2A 1SH7A 1ZUHA 2WOOA 3CLTD 1RYYA 3FE2A 4OA5A 4XVUA 2PK3A 3NIGB 1LQ2A 2PGIA 1IOZA 4IO0A 3R0XA 4PAMA 4U2BA 4B3GA 2N0SA 1A4XA 1U0EA 1UKBA 4R1PA 5DBGA 3IT2A 1RJ9B 4B48A 4KREA 5HQ3B 4CT4B 4GL4A 5AJXA 2OQRA 4BE9A 2RBEA 4CL0A 2RC5A 4ZEOA 2JRLA 1OXTA 2FUNB 2R8XA 5CYPA 3RRJA 1UMDA 2J7PA 2BFNA 1KK0A 3I72A 1WR8A 2G06A 1H42A 3IPCA 2IOYA 2HF8A 1GGFA 3EK2A 1FK8A 5EL0A 1M2VA 1SHUX 2BEUA 3I4FA 5DK6A 3R3XA 3VZQA 4LY9A 3ETHA 3CIFA 2X7XA 2O6LA 1I5OA 3NM6B 4WRRA 3EVEA 2OFPA 4CKCA 1L8AA 1Y9AA 1TJYA 3OIDA 5IUNC 4JQYA 1K4KA 1KQ3A 2JFYA 1M1NB 1O6ZA 2QW1A 3SYLA 1CVLA 1LBIA 5JSZA 2ZT5A 1OW3B 1M67A 1E3QA 2DR3A 3BWBA 2HHCA 4TSKA 1L5RA 3UMSA 3WIEA 3U1TA 3DBRA 4O4JA 5BNZA 1KO1A 5K6AA 3VO1A 4KUHA 2OYCA 1EWVA 3MN1A 1J33A 1HKUA 1D0VA 1ZCFA 4FGJA 1W85B 1M1UA 3OA2A 2QN9A 1EDOA 1CDOA 1I0LA 1P4HA 4YCJA 3V80A 3EGIA 3TXXA 2C2YA 3IJ5A 2WJYA 2O8EA 4LOAA 5EGNA 4F6CA 4KIGA 1FNCA 4NU6A 5SY9A 2NTEA 4XTCS 5KNDH 3NUQA 3COZA 4E0BA 1QFMA 4Y1EA 2XE7A 4H1TA 5TY0A 3FROA 1FP1D 1WHSB 1EP3B 2R79A 2D8AA 2Z2IA 1W36B 5IVKA 3KSMA 3DEFA 1V37A 2DJIA 3Q9NA 3K2EA 3I9JA 2Q4OA 1JXQA 2GCPA 1J1IA 1DINA 2QU7A 2R6CA 3PF9A 4DNFA 1B93A 1QIIA 4GC9A 3N2EA 4RQBA 3CLRC 2ECPA 3BRCA 3EVTA 4DEVA 4PX9A 4Y2TA 5I7HA 2GPSA 2XD9A 1PFVA 1BCSB 3HHEA 4PNHA 4BBAA 1OU0A 4Q9DA 4DCNA 3ND8A 2I2FA 5FEUA 1FX0A 1T2FA 1E2HA 4OB6A 2AN1A 1VBKA 4B81A 4BX0A 3VTAA 3THWA 1HF3A 3VMFA 4H1HA 3TLXA 2JKYA 1O7JA 1YZQA 4MARA 3MTDA 3GG2A 1E9VA 2QNBA 2MSNA 1DCTA 5FTKA 1U3GA 5MN5A 3MWEB 3ENNA 1R0YA 1F2UA 4M1KA 1ESDA 1IH8A 1GCUA 4MRPA 4Q16A 2ZR7A 2M6KA 2H8GA 3QVUA 4OLHA 3SICE 1R88A 1YR7A 4A8JC 1XAJA 2ONZA 3AESB 2FUKA 3HXLA 1WRBA 4TSRA 3EULA 4M0PA 3WLKX 4B3CA 4JI0B 1QZXA 4F3KA 5K0GA 3HJBA 3BMOA 2JS7A 4FMCB 2NZVG 4R2WA 3GXOA 2AMLA 2VJBA 5LMCA 2ADFA 2ZRDA 2V98A 3WGIA 4FOPA 1P1JA 3UWDA 2VS1A 1XRSB 1ZVJA 3HB7A 3L05A 3GPBA 2FZCA 1O03A 2ZQZA 3T1QA 3LCCA 4KPYA 4W4TA 4KUEA 4WNYA 3ZKWA 5M29A 1S5PA 3HR8A 4MA4A 2ZAYA 5GJWC 4W1SA 3X2SA 1NZFA 2IODA 3I2KA 1XP8A 3MRSA 1MX9A 3G2OA 5CNMA 1DARA 2PRZA 1EI9A 2G40A 2RHWA 3P9IA 5EIWA 3JYOA 5I6DA 3C7KA 4OHWA 1JT2A 3GK3A 4NH4A 4Y9RA 3VH4A 2DQ4A 5I45A 3PENA 2H52A 2VH5R 5LWHA 3QU7A 3LWZA 3DDHA 3G9UA 3GLFA 3LXMA 1LF0A 4WFJA 2O8CA 2OBFA 1GQQA 3TXYA 4I6JA 2DWPA 3EOBI 4NLLA 3FNRA 3L84A 4FOSA 5A3SA 1X3SA 4I1OA 421PA 1E9EA 1OBVA 3C5VA 1Z06A 2QN8A 3HUTA 2IDKA 3R7FA 3CT4A 1ZOOA 4LE1A 2HREA 2VYVA 3NNDA 4C2UA 2FOIA 1LH0A 4DLVA 1EDBA 1XJCA 3IXLA 5EQFA 1R6TA 1XTQA 2J0UB 2BI8A 4K86A 1LWOA 1ZD5A 1GO2A 2Q99A 1P61B 3GVPA 4QGAA 1YZUA 4W8HA 4EF6A 3CSUA 3H5WA 1EWRA 2VZ0A 4Y0NA 1WQ3A 4GPTA 2C78A 2PRJA 4Y7CA 5DFAA 1GAQA 3B1KA 1HM5A 2JF0A 4BE4A 1OILA 2ZYTX 5CB4B 2XE8A 5IS2A 5C46F 2GO1A 3G79A 1AMUA 2OG2A 4PHTA 5E4JA 3MIZA 1VFPA 4QC2A 3EDRA 1X14A 4GBGA 4N6NA 3KYIB 4AW9A 1A9RA 2X7JA 2AL7A 4ND1A 1AKVA 2FK7A 3M5PA 4U6QA 4CI0B 5CX1B 3G0IA 4NCHA 2EFHB 3CQ9A 4DLLA 3PTZA 1Z4LA 2IF2A 3KIPA 4ZC1A 2HR1A 4Y6QA 5HA5A 4M9RA 3I76A 1SVSA 1OGYA 2WHEA 3RSCA 3VVLA 3WYNA 1LA2A 2FRDA 4AQDA 4DLNA 2WQ6A 1T2NA 1PR3A 3ES9A 3GA5A 4FZVA 4B76A 4UTNA 4YAUA 4DREA 3HRIA 4Z1MA 1RHUA 4EPYA 5FFFA 3OFVA 4NATA 3D31A 1Q22A 2X2OA 3O6VA 2EKQA 2YOGA 3OT4A 3TMYA 4D8UA 5JCPA 3LVBA 16PKA 4Z9AA 3K70D 3FWKA 2O1EA 1Z6ZA 3E35A 3MQ4A 2VJMA 5KWIA 1PG2A 3WDKA 2HGZA 3WGKA 3BMCB 2X4IA 1GZDA 3GNSA 3KWFA 1SUDA 3N2GB 2JGMA 5KSZA 2AXEA 2G7ZA 3L77A 2ZBGA 3AHIA 1ZZEA 3RADC 4UQLA 1A9XA 2XB2A 2IPAB 3ABIA 3D54D 4LZNA 1XDBA 3TIVA 3B1XA 4PQYA 3I2GA 2HL6A 1Z5VA 5TT0A 2IOFK 3I1YA 2BR5A 4HSEA 3LWDA 3IQEA 2GAOA 4K9NA 5C5EA 2QTHA 1WQ1R 3UIEA 1OBCA 5KPDA 5FL3A 1A9QA 5FULA 5K8JB 2CL5A 2W4MA 2X2FA 4GWGA 5E4TA 1OB2A 4J3JA 2ZKLA 1JFFA 3EXG2 4PTZA 1FFGA 4PCUA 5LA6F 3GLKA 3BGWA 4UM7A 3U1BA 1SNYA 4YS6A 2G7MC 2QJWA 2CXOA 3L1IA 3QH4A 1P19A 3ZYZA 4TT3A 2XUOA 1M3SA 1E3TA 1OYWA 2WUEA 5AW9A 1D1QA 5C3MA 5DYYA 2FP4B 2YVLA 3UH0A 5CA1F 4LDNA 4NY1A 4RK5A 1SC9A 4HKTA 2KI5A 1RZVA 4MUAA 3KU1A 1DXOA 1Q95A 3R9XA 2QGNA 4RFLA 2CDAA 1WABA 1MENA 3KUUA 1XBTA 5IJ0A 4J2HA 4IO1A 2GYWA 3EAFA 2DRIA 2FN7A 2CCKA 2QXYA 4OXRA 2BMJA 1OE0A 2A1TS 1KFKB 1I8TA 1IXSB 2ZRIA 4ZI7B 4BQOA 5H3LA 1CSEE 1ODFA 3CF0A 4LI0A 4A27A 4CG3A 3WL3A 2PWBA 3KAJA 4NMHA 3Q87B 3DCNA 4U2DA 2O1XA 3NYWA 1RQLA 1Y9EA 4X7MA 1FSZA 4DT1A 2DGDA 5LBIA 2AQHA 1PW7A 1NSFA 1KVTA 4N1AA 5ESRA 2NU9B 1R6VA 3ZV4A 5LZ9A 1E63A 4PSDA 3DBLA 3IUQA 3R3ZA 1VSVA 1FX1A 2WSLA 4CG1A 1V4NA 3ZVRA 3PV0A 3QY9A 2ZYAA 1LW7A 2OXIA 2XOXA 5M7EA 2EW1A 3T3IA 2NO4A 2B99A 2J45A 4NK4A 2J6HA 2XUIA 3UHPA 4I4TA 3H65A 3DEZA 1N8TA 2CDCA 2FW6A 2J4CA 4LJAA 1KMCA 2EGHA 2WFLA 4OJMX 3DMDA 2PX2A 4ECAA 3CNQS 2BRUC 2BE7A 4JI7B 3RVPA 5ITVA 3MWLA 2E21A 1ZIXA 4YX9A 1WY5A 2NO0A 5C8XA 4D02A 2UXCB 1VKJA 8MHTA 1R64A 1Z33A 2HIMA 4IINA 3UBMA 3W5SA 1A0OA 1BKSB 4Y2QA 3MLAA 1PI3A 4WI1A 3L1KA 3CUSA 3OQJA 3HB4X 2DX7A 4AMBA 3U62A 2GX6A 4LKRA 1XKQA 3T4XA 5DCLA 2AFRA 1YBMA 2OKGA 3KQOA 4TWBA 1G8MA 2Q5QA 2OENG 4J4HA 1NOKA 2WFAA 1WVMA 2GMWA 2ZE6A 3PQ5A 3RPEA 3A4YA 4EHLA 1A77A 3V4ZA 1C9DB 4PX5A 4QTUB 2OXTA 1O0CA 3IEUA 2OSBA 3S5UA 1HDYA 1UDBA 1XZPA 2R8ZA 3HVUA 1FTYA 2D3TA 3I2IA 1S9HA 2CMDA 1CUYA 1NQTA 1GVNB 2XXJA 3ZLUA 4W7HA 2DULA 3LC7O 3LW7A 3KAKA 5AOCA 3ZLJA 1YCGA 1GUDA 1I1NA 2CJXA 3PJGA 3WKBA 4AUEA 2V7PA 1SIUA 3G2LA 4JFRA 3K9FC 3QBDA 5K7SA 1QGOA 1N7JA 2Z1MA 5DO9A 4TV9F 4JQOA 4BPRA 4BVAA 4NBUA 3ZGVA 1PTKA 1TZKA 3GRVA 4BFTA 3N0XA 2ZJOA 3FH0A 5C7OO 1XTJA 2XNSA 2BFOA 4QM6A 4BFLA 1JR4A 1Q0ZA 3SF8A 3RWMB 1CUAA 1DFHA 1JQBA 3N8DA 1DWUA 3JW8A 4LDZA 1UPXA 2HA4A 5HS6A 1WA5A 1E9BA 1XFAA 3DL7A 3RC1A 5HQJA 1L3CA 2C9OA 2JNWA 2ZR0A 3ED5A 3GRUA 3NRJA 2QR3A 2WJWA 3A9UA 2W58A 3EJ6A 5HJEA 1XAIA 5KYYB 2V4MA 1IWBB 4A7PA 3D8RA 2P5UA 1UC9A 2OPBA 4OA8A 2F3PA 2C3UA 2HBQA 2GZMA 2IBMA 3MA0A 4IDOA 2C2GA 3UVEA 3HYLA 1T9AA 4AIIA 3UB4A 3CN7A 2Q1SA 4MS3A 5F76A 2XZOA 3TUZC 1GV0A 3WHIA 1CJMA 4EFMA 1G5TA 2WJHA 3ZD8A 1XTUA 4A82A 3D7RA 4UPDA 3VJMA 2O23A 1IVNA 1ID1A 1PT8A 2YJ3A 2PNFA 1HE1C 4WZBE 4FCVA 3YASA 4D9GA 3BK1A 1V1MA 4Q5IA 3GWGA 4KACA 3GEDA 5CFZA 5K6RA 2YZ2A 1TK3A 4DJJA 1ZGJA 4JELA 2JG3A 1D2NA 4BFUA 3BIWA 3B6EA 1GILA 1Z2EA 2IXBA 3NCTA 4FMDF 2I1QA 5CT9A 3SZ3A 2KE5A 3SYNA 4U3JA 1S2GA 4CYMA 3C3PA 5A9RA 2H17A 4UMDA 4CMAA 1A7UA 1G17A 1E9SA 2P4QA 4MYTA 4YT5A 4Z1MD 1EIWA 2O0JA 1DTEA 1QB7A 1G21A 3R40A 1TFRA 4KN9S 2X1VA 1R9GA 3T3OA 1ZBDA 1JALA 4HFNA 3EG9A 4CKEB 5TLSA 5ULLA 5ADUS 1FF9A 1XCLA 5EKTA 4QNRA 4BN4A 3TW6A 3UKOA 4C6TB 3BZBA 1ICEA 4TYYA 2H18A 3DZ8A 4QUDA 4MK4A 3WL8A 2Y93A 1L8XA 2XDYA 3R3WA 2H4FA 1M2GA 4QX6A 3FDFA 4DV4B 4V3BA 2H08A 2YYAA 4TMFA 1SXQA 1K7EB 3NNNA 1HK7A 3B9RA 4WBNA 3VZRA 2FPGB 3BE6A 2FF5A 5JROA 4NRDA 5KAPA 3ABZA 2Y2UA 3JPWA 2QG6A 2B30A 1A5BB 3ITKA 4UDXX 1G2QA 4RK1A 3VM6A 3ZE6A 4I36A 1F4LA 1QIFA 2GTIA 4L0MA 4LGMA 5EXDA 1R8XA 1E1QA 2FPUA 3M5CA 1OAOC 1U2DC 4O2AB 2I4LA 3LC1O 5TDHA 2JH8A 2WQZA 1IXYA 4MQBA 1Y6JA 1S2LA 1H2FA 2C42A 4LBWA 4EIWA 5KHLB 1YTLA 5KTTA 2ZM6B 4AG6A 1USWA 2PBZA 3HL0A 4TT3D 3BGOS 1K3UB 2HW8A 4EG4A 1QF6A 1CWUA 1PEYA 1R15A 2B4KA 3WGTA 1XEXA 1MVOA 3IESA 4OL0A 1K3TA 2ASEA 2GPNA 2RKOA 2ZBQA 4YP0A 4BZZA 4D9EA 5HVNA 4RTSA 4QUEA 1ADCA 4TWAA 5A02A 2CV0A 4GKJB 3LLSA 3WBBA 2JEZA 5CT6A 4JHXA 1V1RB 1NW7A 4B3TB 3CR3C 1U8EA 1MT3A 3O21A 1Z0DA 1ZRNA 2Z5VA 4K46A 3Q0TA 2RGGA 3B82A 2ODWA 3FNGA 1PP4A 1XTIA 3TEFA 4RO0A 4E14A 1CHNA 2X13A 2QPOA 1OLXB 2OCLA 4XYGA 3IE2A 1IJBA 2MSDB 2RGBA 2W2OA 3E82A 3RV4A 1FCJA 3OLQA 1HSOA 1BXRA 3LCRA 4KAFA 4F1WA 2KS6A 3B6IA 4TTJA 5FQNA 1IIRA 3TH5A 1K68A 3JSAA 3B7WA 3W1EA 1CZKA 4LG1A 1BEUB 3E5HA 4ZDWA 3WLHA 4ND3A 1QS0A 3R9KA 3ZLVA 4B40A 2XA2A 1YZLA 1PDVA 4N8DA 2Q3BA 3KNZA 4YP9A 3VR3A 4D45A 1WMFA 1E2IA 1CZOA 4NYMR 4UM5A 3V42A 1RWQA 4OKNA 1K2WA 4JBWA 3TLEA 4HADA 5AVRA 4MRSA 1Z8HA 2X14A 5SYNA 4NF2A 3PE3A 4DJEC 3QKTA 1D1TA 1SCIA 2C1EA 2H7XA 4AKTA 3N8NA 4PSUA 2PAFA 4E5PA 5CEJA 2QN6A 4MV9A 1VE7A 3U6KA 1TM1E 2FQ1A 3B38A 1WSBA 4Q1EA 4UM9D 3QE3A 3CO0S 5K45A 4DILA 1IEQA 1DTWB 2PS1A 4JWTA 4KR9A 1DXYA 4AWXA 2Q1WA 2VJNA 1LKZA 4RAOA 4JUFA 4WBXC 1IQ0A 2G88A 2W6JA 1U8UA 1DRWA 5JBNA 4OLAA 2FPXA 1L5FA 1UXJA 2NO9A 2PH3A 1NI4B 3KYDA 4HUJA 1UBKS 3EPLA 4B7UA 1RR6A 2X9LA 2ZRPA 3FOWA 5L6LB 4UEOA 3EXAA 4KN5A 3KHUA 3NAMA 3H19A 1GU7A 4KR7A 4O4JF 1XTTA 5IZ4A 4I3GA 2C1ZA 3EF0A 2DTDA 2Y1KA 4KO8A 4CODB 5CBPA 5GOZA 2B2XA 1QHEA 3AOEC 4FMBB 4R6XA 5TS3A 1FJXA 1VE1A 4JJAA 2Y0CA 1LS1A 3GRRA 3RVMA 3P7MA 3ZLTA 2V03A 2HRZA 3AJRA 4R1NA 1NVDA 4ZQHA 1EQUA 5DNVA 2PGOA 5AKJA 2ZZMA 3DL0A 3K9WA 3KBOA 3S7ZA 2VAPA 4ACBA 1VIYA 3WB9A 4UZEA 2CL0X 4BKMA 5L6MB 3DOHA 4FC7A 5AI0A 1SBCA 1BRMA 2DE0X 2ZI5A 1GEGA 4B6EA 3MJFA 3Q15C 1BDJA 2E18A 3QOXA 4DQKA 4Q34A 1TKRA 1LDBA 3GWZA 1GGEA 1YZTA 5CPBA 4YV0A 1D2HA 1EK5A 2X3FA 3DVLA 1Z5UA 2QUBA 4IRMA 4N7BA 4BQSA 3BMQA 1NFQA 3WAGA 1UZMA 1N2ZA 1Z3CA 1NATA 2OD7A 1DZIA 2PH5A 1CZRA 3DB2A 1Y3CE 1QMGA 2JA1A 3DYVA 3V6MA 3U3DA 1CY6A 2DCMA 5CLGA 2UDPA 2W6PA 2B1QA 2R0QC 1JLLB 2IW3A 4JKIA 4MV4A 1D8TA 3ETCA 4AF8A 5BSMA 3LP8A 2R00C 1V71A 3D8HA 2HCBA 3ZWVA 1QH9A 3C3KA 4JA0A 1DWQA 4FHZA 4GPIB 2PMCA 4XD7A 3UMFA 4Q9AA 1SA0A 3NT5A 3ZNOA 2IOFA 3ZXIA 1LX6A 3KQUA 5AVWA 4B6OA 3BFPA 4BLVA 1O87A 4L15A 1ZXXA 3I8SA 4KMMA 1UC5B 4V0SA 4ZD6A 1WUTA 1L7RA 4JBGA 4M53A 2OAP1 2XLBA 4XB1A 5BOVA 1L8OA 3K1TA 4HQFA 4YJFA 4C0WA 1TQDA 1L4FA 3KVNA 3LG2A 3TG8A 2UYOA 3GRAA 4RPIA 2FB9A 1NOJA 3GFOA 4RPLA 1QGYA 5H4HA 1N5RA 1BXGA 1BWRA 4V0LA 3ZI0A 4LMAA 4XTRA 2BGUA 3AONB 3G7NA 3K53A 4ARCA 3W79A 3OT1A 3EYAA 3QPUA 4FMPA 3OKAA 1F8FA 2NUBA 4M9ZA 4G97A 4WFIA 1KVQA 5DRYA 1VJRA 3X1MA 3HRHA 5L9AA 4LWPA 5EE0A 4JP2A 1CNEA 2VUSA 3WYDA 3GELA 4MW9A 2WU0A 4Y6OA 3K0HA 3TQSA 4XGKA 1LJUA 1MIOB 1U8TA 2X0RA 4BBZA 3MMNA 4MGKR 1OKKD 2ANBA 3AILA 4EZEA 4HT3B 1TVCA 2QTMA 1MHTA 3HA5A 4N0DA 2CLIB 4P4GA 1E1QD 4M0CA 5KQSA 1LVUA 2O5VA 1SOUA 2ZDGA 1Y34E 2QE7A 3Q8XB 4XKJA 1OI2A 2C4VA 3RUHA 4EMUA 2X8LA 5FQOA 4CRWB 1XQ1A 2JIOA 2YV3A 5LVAA 5IF9A 5EMMA 5A7GA 4B8ZA 2OD9A 4F3RA 4GO1A 2WT4A 4RVUA 1JEJA 1B14A 2N46A 2NADA 5F3DA 2G4LA 5AVOA 3ZCRA 2ETXA 221PA 1PKEA 6GPBA 2IYAA 4EHJA 1UWCA 4JOSA 2CFRA 3RGGA 3A2NA 1OXKB 5LYJB 1EZZA 1OASA 1Z0JA 2QRVA 4GXRA 3ZE1B 4DDWA 2DHQA 1K0FA 1E3IA 2I4IA 2IHJA 2W6NA 3IOEA 3U1VA 2I76A 5L53A 1KIMA 3NM4A 4G2NA 1DC3A 1RXEA 5K1ZA 1Q0UA 2BE9A 1N0HA 3FPBA 1A76A 2QJRA 4LBZA 5AVXA 3R4VA 2DM6A 4CM1A 1U0TA 3BFXA 3FGOA 3QKIA 2I0FA 2Q45A 4X3CA 1GLGA 4WZAE 4C04A 2ZIWB 5GZ6A 1LDEA 1SXJC 3FW1A 3M33A 2BZ1A 4P38A 3ANTA 1K88A 4MV8A 4BAUA 2EGUA 1YAJA 1ZM3A 2PV7A 4WESA 2L0XA 4XFDA 1KSJA 3KEGA 4HLQB 2J9YB 3MLBA 1E89A 3R20A 1YDEA 3WGNA 3WL6A 3EXEB 4BKRA 3WBJA 3HEAA 2WV7A 3WYAA 2OHHA 3G89A 1PHPA 3O0TA 2Y1DA 3PXCX 1C41A 2YRFA 5DM2A 3VH3A 3H4MA 5I7FA 1ZWKA 3NHRA 2I3AA 2D5BA 2ZREA 1RXCA 3H1BA 2GN6A 3VTKA 1EVQA 3KJFA 2G0NA 3GVCA 3A9TA 3D4BA 3ZIUA 1GXSA 2UZ1A 1DLIA 1U28A 3NQ41 4BVKA 4KK3A 2NXJA 4MLDA 3ZD7A 1W48A 1VG9B 2AA3A 2AN4A 4FSDA 4PYJA 4ZCLA 1ZN2A 3I6YA 4RHFA 3U17A 3FBGA 1QH8B 4A9AA 3EEYA 3CZPA 3KVVA 3QX7A 1AZTA 4HFMA 1M6VB 1TQHA 3OHPA 4HDSB 3TRFA 5ICGA 3NVKI 3MZ0A 1ISSA 1N9ZA 3NDJA 1GKLA 4NKRA 4CLHA 3OI7A 2FTKE 3KKNA 1P9NA 3AB3A 3AH8A 4L5AA 2FG5A 3LLCA 2OV1A 5DWDA 3ZHRA 2PH1A 3IHKA 5BMVA 1F7UA 1K9SA 5KQPA 4O8ZA 4CKXA 2OXCA 2WSMA 2VBCA 1E3WA 1I4OA 3H11B 1ZAYA 1OJ7A 2I7DA 4BHTA 4ZZ2A 2ZJ0A 3KVYA 2OUIA 5D1HA 4DZZA 1YB2A 4XRGA 2FHSA 4M21A 1Z4OA 2H2GA 2A9PA 3FRIA 1EXDA 3G49A 1FS4A 1NL3A 4ZREA 3W34A 2AHRA 4LRYA 2FFHA 1I80A 1Z56C 2JW5A 3OF5A 1U3VA 1WZEA 2VN8A 4A15A 2B4AA 5JO9A 1SXPA 4DA9A 2P3QA 3PDIB 2P75A 3PQ8A 3ZHYA 2OGUA 1M0WA 5T4FA 3JD2A 1U2SA 3PQ2A 2Y92A 4FEAA 1PJSA 4O4HB 1E1KA 3II6X 1JEEA 4EKIA 4FYYA 2A6PA 2H2DA 5JAQA 1I3MA 1VL0A 1CEXA 5JVDB 5IAAA 1N6LA 1YZYA 4PSKA 2V7GA 3KSDO 2V4UA 2HUPA 3I3OA 4I1SA 1WU8A 4KWTA 1ILEA 4QOFA 1P9LA 4H27A 4D99A 3V2HA 4HNTA 4HNAA 4I2VA 1D6MA 4D57A 1DG3A 5I9TA 1H0SA 1O96B 4NBKA 3WXBA 1O5TA 2EXXA 4QDOA 2JCXA 2XY4A 3WRVA 3AVUA 1Q6ZA 4I4TF 2QVLA 2BEWB 3L7JA 1P4JA 2EX4A 1VHWA 4O08A 1HRDA 3SHQA 1E69A 3INYA 4DUZB 2BFWA 3U4HA 1ZDMA 4FJ2A 4P92A 5DOZA 2R84A 4NWIA 1PKXA 3MBKA 5IAOA 4EHAA 3I04A 1UBCA 3FZEA 4Q4AB 4QD3A 4GYJA 3JS5A 4COOA 3AQ4A 3C7DB 4K3UA 3PLAE 4B46A 5FOQA 4LQDA 3EW7A 1W87A 3RRZA 4QNMA 2ZIEA 3JXEA 4LXXA 4URWR 1YB5A 3UAGA 3IHLA 1MMFB 4X63A 4X8LA 5EOVA 1WUYA 2XUQA 4LF6B 3MQ2A 1Q7GA 3T7EA 3T7SA 1VA4A 3ZPXA 3H5RA 3HWX1 3PX2A 3B12A 4GXNA 5FWNA 1G21E 1YZKA 4TVKA 4ZC8A 3DCJA 5TS2A 1J8FA 1NC3A 1H4TA 1P72A 2JIDA 3A9CA 2F1JA 1ZD9A 3M3PA 4KX5A 2GYYA 3ROTA 1JHOA 3BIJA 2UZ3A 3K6SA 3AUAA 1CJTC 5G41A 1B0UA 4FD3A 5AI9A 5JZBA 4FYKA 2CV1A 2VDOB 3HCCA 4Y0VA 4ZIRA 3ORYA 1JA1A 4OUDB 3CINA 3KUCA 1DAKA 1O9HA 2WTEA 4A3SA 5IW8A 1JNYA 2VDMB 2HV9A 1TEHA 4OH1A 4E03A 1D1PA 4E33A 3TZKA 1OBOA 3K6JA 1OWMA 1QRRA 3K8ZA 2QE7D 2YFYA 5K3BA 2BDEA 5E95A 1D7OA 2Y1GA 4RIIA 1DT5A 4B6RA 2V7UA 4Q1CA 1KYYA 3LBHA 4PZEA 2AWNA 2YR0A 3R3JA 4D74A 4V2UA 2QTTA 4JCOA 5DBFA 3ZHZA 1VOTA 2EFJA 2PSDA 4FNOA 4OK5A 1B8NA 3FPJA 1BFUA 1LXCA 3P9SA 2WD8A 4S0XA 4DJAA 5FPKA 1E2QA 4LVCA 4P93A 4KFUA 2PBFA 5FPHA 4BNGA 1I6KA 1GZHB 3Q7QA 3A3KA 3LSYA 3A7EA 2IU6A 3HMKA 1SUPA 3UUGA 5HOEA 2VTBA 4NHOA 1RI4A 5KOIA 4KFSA 4MHTA 3DFMA 3KT0A 1ZCZA 2GAFA 1H5UA 5G0WA 2BGJA 4UNNA 1YKFA 3KZ1E 3SZLA 4JP5A 5HM8A 2XQJA 4CMCA 3O8NA 5FBQB 4IIXA 4UEWA 3HXPA 4IQ8A 2PUAA 4C3ZA 3DMRA 5BV1A 5JCOC 1Z5OA 1NR1A 5JNLA 5CH8A 2I4OA 3PC3A 4FU0A 1AU9A 2G67A 3DOCA 2I2DA 3VR5H 1SVWA 2HQ1A 2KLBA 4E5NA 2HPHA 4PVDA 2VHUA 2BFFB 1F0YA 1FNBA 1N7IA 2QB5A 2XMZA 3N59A 4EUHA 5E9JA 1R8SA 1AHNA 1TJ3A 1HI9A 4R2KA 3TRKA 4HLDA 2OMEA 4ILEA 3FOFC 3W05A 1FUUA 2GPWA 3L43A 1PV4A 2FWBA 1P7PA 1V5WA 3FPFA 1DKRA 3RS3A 2GOYA 4DR3B 5DLEA 3T4EA 3OPYI 4IDDA 4IOKA 5KWSA 2JEYA 3GN1A 4L57A 2PGJA 2PMKA 4N3AA 1XLVA 2H59A 3FFBA 1F3LA 4MSUA 4R05A 1YR3A 5H80A 2BCGY 2C04A 3NV7A 3CRNA 1BG6A 1IB0A 1EBFA 1GHTA 2L17A 5JJBA 4MRAA 1I3OA 4KWEA 5E0KB 1RZRA 3U4CA 2YS7A 5J1TB 1YZVA 3GT4A 5LLTA 2F3TA 3BULA 3V9PA 2B98A 1WG8A 2VSXA 4AX4A 4DOMA 2DHRA 2QL7A 1VHDA 1I2AA 4J0FA 1TKCA 3FZGA 3JTMA 1LY1A 5EE3A 4ZYWA 1MX5A 3VPXA 3F4BA 1XTPA 3FKJA 4BBJA 3LXUX 3PPIA 4TXMA 2FN9A 3NVMB 2INGX 5AW2A 4QATA 2W4QA 2CV2A 5JNVA 3MS7A 2A92A 2DFDA 2WSSA 2PGNA 1GTZA 3P0EA 3B36A 3IQDB 4IOJA 4OGWA 4R8KA 2JAWA 4LS3A 3CZAA 4MV6A 4M4SA 3LUKA 4ZZ1A 3EXFB 1EE2A 4IDGA 4NZMA 4FFWA 5CNIA 1QJ4A 4PXSA 1T4CB 3JQ9A 2V3CC 2ZVPX 3D6TB 3EIOA 3LUFA 3D6VA 2ATXA 4YQFA 3RTGA 3MNFA 3VDMA 4TMTA 3TFWA 3AVPA 3ZJYA 2GKGA 2J9FB 1S8AA 3VMMA 5LKRA 3LT4A 1Q92A 1QO7A 1ZVKA 2QZ4A 1PYGA 2VP9A 3FNEA 3C1AA 4I99A 4B80A 4OOFA 1B42A 1R4ZA 5L3QB 2XTJA 2PLWA 3CZ5A 1J8VA 4LJ7A 4HVAA 1MZVA 2FYTA 2BJHA 2JGJA 3NP7A 1NQAO 1IZ0A 3CF2A 3K72B 1CEYA 4CR6A 1JSLA 1O0SA 1XRLA 1J09A 3RIHA 5A2GA 5DPMA 5JYEA 3OUZA 1JG3A 2CMHA 3ZXUB 3UMGA 1E7SA 4PYMA 5AKXA 1KSGA 5LB2A 4RDCA 2G76A 3T3GA 2QMUA 3EH2A 4RENA 1F60A 4KHPB 5KB3A 4B6JA 1OFUA 5JAUA 1ADYA 1CF2O 1JSZA 4CXMA 4EHKA 3A1TA 3F5MA 3PNBA 1U9JA 2AQKA 4U2KA 4LYGA 4HB0A 4AMYA 4KJXA 4J1TA 1JKMA 2C0CA 3IQXA 3EISA 3CLTC 2KHZA 3RYCA 4E13A 2WTBA 4NOMA 1S0UA 4R71A 1FZQA 2FLVA 1NR7A 1XKXA 2PNJA 2FSHA 4Z3OA 3G6KA 4ICIA 1DRKA 2NV0A 4M7RA 4PHHA 4FX5A 3SM3A 3MGKA 5BURA 1V9CA 4RE5A 3WFZA 3D81A 4LK2A 1WO8A 3RVKA 2AVNA 3K8OE 5L3VA 3WB0A 2VHXA 3MW8A 1TCUA 4C30A 2WUWE 3CZ4A 1QANA 4CU2A 4R31A 2X5KO 4YJDA 2D2IA 3DUFA 4UQOA 3QUSA 1ZK3A 3OZSA 3B1FA 2ZU6A 4W5WA 4QDUA 4D42A 3RC7A 2PYZA 2A9VA 3H1EA 2JFVA 3QMMA 4NONA 1L7OA 3U40A 1SBTA 4AZVA 1AKTA 2QRPA 1M1ZA 1F06A 2TS1A 2ZSEA 3VNAA 1NASA 1VM6A 3ZK7A 1J4AA 1GOTA 1SHTX 3P9ZA 4A73A 1CEQA 1E3JA 1YKSA 4UM8B 1GA6A 3IFSA 1K06A 1SM4A 3EEIA 3TB6A 1J2UA 4C3UA 1W8IA 1WDMA 3IVGA 5DTEA 1JKJB 5BYAA 3CWCA 1RZ3A 2PZAA 4IHJB 2VPZA 1WHSA 2VA9A 3OD5A 4U7HA 4YHBA 3KAPA 2FX2A 3PQ7A 2HC9A 3V33A 4EQ6B 5EQTA 1QF7A 5JALA 2DP4E 1TGVA 2PMEA 4F97A 1W29A 5LSAA 1C8LA 3EE6A 1A82A 4MICA 1RWXA 4IL5A 4B7AA 2J1LA 1F17A 3Q7SA 1O97D 1QYXA 1Y9DA 2G1AA 3W7AA 4OIFA 1CR1A 1GGKA 1LLUA 4L3WA 3AM4A 3ETNA 4X00A 3AR5A 4OHKA 4GRAA 2IPXA 3GGGA 5AJZA 3LVFO 4MI1A 4XLTA 3T3PB 4AJ9A 4MS1A 1JB1A 3IH5A 4QLAA 3HWWA 1FOEB 3O3CA 5AESA 2H0AA 4YR9A 4EVSA 3LSTA 1XDUA 3VAZA 3VR6H 3I28A 3I5MA 4ZRDA 1NI5A 3Q9UA 1VLLA 2PE5A 4KSYA 4GE3A 1CV2A 4PYOA 4HX5A 3CU5A 2BKXA 4BRWA 4EZBA 1OROA 2BEVA 1DLJA 1JZQA 2EGGA 2YRXA 3BWCA 3VSDA 3VO8A 1L4NA 2WJ4A 3OIFA 3PPWA 3MJEA 2R96A 2ODNA 1O94A 3F9CA 4QUGA 3STHA 1E2UA 4FBMA 4HWKA 4D9HA 1LI4A 2B20A 1P44A 1P6XA 3HM2A 4FT2A 2OQIA 4OYHA 4P9NA 4QEZA 4MR8B 3RWOA 4DCTA 3BRSA 4KJZA 5B64A 4C89A 4DRXB 1C4XA 1Y4ZA 3LUDA 1S96A 2QD4A 1DC4A 1KA9H 2GPAA 3PFFA 3KR2A 4OIMA 2WNIA 5HIMA 2C7RA 2PT6A 2CBZA 3QVGA 4OHXA 3JYPA 3REGA 3T1NA 2PUCA 2R48A 3G82C 5IBPA 2AQIA 3IEKA 1IRXA 2HNKA 4LE0A 4IJWA 1CX9B 2EKLA 2I03A 4RFSB 2VG8A 3VZSA 2WDPA 4P8RA 4JLPA 3WMWA 1QORA 4FYHA 2JEOA 2F1RA 3B3AA 3I0ZA 1AJEA 4PRYA 3TINA 3BORA 3FVRA 1JAYA 2G6TA 2FX5A 3ZHVA 1NURA 2GRJA 4GD3Q 2HF7A 1BROA 1R6DA 2PGLA 2JFZA 3N7TA 5E1DA 4BTEA 1JPJA 2JFFA 3FA2A 4DHEA 5CEFA 5KUTA 2B37A 1XYGA 1UKZA 2DBVO 2X0KA 3GGCA 4LSZA 2H2WA 1O8BA 3SZUA 5BUCA 3GJ0A 3AYZB 1I32A 2H1CA 2W2MA 1V45E 3I0NA 3QP9A 4KV7A 3BQ9A 2OQVA 4ZEVA 5HMLA 4V24A 3ENZA 1Y1QA 3BVPA 1E3LA 5FHRA 3DE1X 4LMRA 1Y1PA 2D54A 1TO2E 1R0WA 2QZ9A 2WSSD 4DIMA 1Y4AE 3UICA 1YVUA 1X1DA 1R50A 3KP1A 2FH5B 2VJPA 3F78A 4D8YA 3VPSA 1NRXA 2G1UA 3M6LA 5EP1A 3TBHA 5B4VA 2VQEB 3ZDCA 3VOSA 4J6FA 1BCRA 3VPGA 5BXQC 4O29A 3QYJA 1H66A 4G3XA 1USUA 1E2LA 1R6UA 3SBDA 1H2ZA 1ESEA 1NMEA 1RRPA 2J32A 5AJUA 5BQ3A 5LQKA 1U5BB 1QPBA 4HDOB 2J3DA 3AJ9A 3EUEA 4WN3A 3W5BA 4AKGA 4KUGA 2OTCA 3RT7A 3ZY5A 5B7GA 2Z57A 5CB4A 3RFVA 3A7DA 5HZHA 3TRJA 3THXB 2Q7XA 4IIVA 1EX1A 3I05A 1EFUA 2HMAA 3QBVA 1MP0A 4WINA 2WIKA 4YTEA 4GR4A 4HP8A 3WMFA 5C81A 1GDTA 1VG8A 4M0DA 2V65A 2JPDA 4CL3A 1E6EA 3QEOA 4I3FA 3TVDA 3NIWA 3VA7A 4JYAB 4D4KA 1JLKA 3ZCVA 3KJHA 2HBYA 2BH2A 5AXCA 2VPQA 1T1RA 2C95A 2JHPA 4RVCA 3G88A 2ZJ4A 1WL8A 4MR9B 5C32A 1KNQA 3VSBA 3TR6A 4J43A 1Y1TA 1CUDA 4NPHA 5IKOA 2OR3A 2FSVA 4HDNA 4NL4H 2XCUA 3SP1A 3W9UA 5JMWA 2HX1A 3CIOA 3DHYA 3NV9A 5LU9A 1RM3A 4II7A 1XK6A 2NO1A 4MMXB 3UA3A 4CM4A 3SVTA 1YRHA 5DIFA 3JQEA 2BFPA 2JK0A 4S1VA 1YVRA 2J7KA 4MVJI 1IZ9A 1OPXA 3LPDA 1AUXA 2GK7A 4HUQA 4U9IS 5JMPA 2ZPTX 3FNHA 1XZ8A 2F59A 3N76A 4MH0R 3KLPX 4JI1B 1B1AA 3EGXA 1VG1A 3DL2A 3RUCA 1YCHA 2CFSA 3NH9A 2XV1A 5K0BA 2IZ0A 2CBGA 1VIAA 3CW9A 4JZYA 1MGOA 4WE3A 4YAGA 4O1MA 4OUKX 5L95A 5SYMA 4O3MA 1P9OA 2A94A 3FGNA 3A1DA 4D3YA 1FQWA 2IBSA 1I7SB 2ZSFA 5AP9A 1ECGA 1DV1A 1HEYA 2KWIA 1ZVVA 1T10A 5LC1A 3BOSA 3RSQA 4I9GA 3S8YA 4GF5A 4RTPA 5CX4A 4HGOA 4KXUA 1HXHA 3QYPA 4OSOA 1LNSA 4PQFA 3HCFA 5F21A 4TZTA 1CUGA 3A1NA 3F6YA 3P5BA 2HLPA 1YJXA 1DQZA 1E7QA 2GKOA 3S8MA 4CJXA 3T5GA 3JR7A 1LEHA 1RLIA 1TZBA 1FS5A 1H65A 2W8ZA 2X19A 3DF9A 3GMTA 3U4QA 1SOMA 3QGMA 1YVEI 2FP4A 5DP1A 3V34A 1MO6A 1A98A 2CJFA 3KPWA 1X1AA 1G7RA 1F4VA 2XSZA 4P6VF 3GG9A 2PKQP 1FRZA 2VEDA 1VBNA 1SC3A 3AUXA 3NEAA 4FKBA 4L6CA 4XIJA 4RZUA 3UAYA 4BXOB 3T5TA 2DPHA 4G5QA 1NUTA 4TVOA 5B7NA 1BE8A 2PFKA 1APBA 2HOQA 3IQGX 3LD9A 1ZICA 5KOJB 4G86A 3G9ZA 1Q50A 4CLXA 3OZEA 4ZXPA 3K9LA 4QRIA 4V2IA 2B21A 3G68A 2M2IA 1ND6A 4ZI7A 1P0FA 2MMGA 3VYRB 2FWIA 1PJ4A 3F2VA 4CG2A 4PZAA 1KXJA 5EYPB 3KQPA 1KRXA 4WECA 4IQ4A 4YV2A 4Q7MB 1CRLA 1R66A 3QXSA 3BHIA 4DDUA 1M2KA 4LA4A 3FR7A 3L0ZA 4EBBA 4TVSA 1VPEA 5DX0A 5KNBH 5KYXA 3AHJA 1C7EA 3AJDA 3ZI4A 1F3OA 2AH5A 2X41A 3C24A 4S1NA 3UFXB 1G55A 1JX6A 1XDZA 3QZUA 2WV9A 4MWBA 4PYNA 2YBEA 1WXDA 4KP7A 4LDAA 4RZIA 4JA2A 5K3AA 5BSGA 4X45A 2IHNA 2QSYA 4FCTA 3RODA 2BGRA 3KZXA 1UWVA 1BMFA 3ERCA 1AIPA 1NLUA 2X42A 2ZEJA 2VQDA 2A7QA 4OGFA 3R7WA 4NPCA 5AO9A 1GUBA 4PICA 5I9LA 3VU9B 1E9CA 2AJTA 3HXQA 2JCGA 1JIUA 4RMIA 4TYMA 3UXMA 1AGNA 1QVWA 1IBKB 4R3NA 1W35A 5EHGA 1O94D 1YS4A 3PUXA 4PSCA 4BUZA 2X86A 4Q4DA 2BC9A 2Q8NA 4BZXA 5F3WB 4RM2A 2PXCA 3NUZA 1CC1S 3M4YA 5H70A 5LFAA 1PJ3A 3K4QA 5JLAA 4DIEA 4L5JA 2RAUA 2XUPA 1G5FA 3V8VA 2YVKA 2R65A 2QLTA 5A7HA 3WIDA 1GPLA 3CE9A 3ANSA 3FDJA 3M9WA 1Z0KA 3QQ5A 3QMPA 5BUZA 3I12A 4FZ5A 5MFPA 3LNTA 3QEMB 4V0ME 2FXIA 3QJ5A 4FEYA 1P5HA 4UCXA 3PX7A 3KV3O 1RWMA 2CY0A 2CLCX 4KNWA 4ZOLF 5E9WA 5JWOA 1PL6A 4AJLA 4DR4B 4J94A 4QBFA 4BFYA 1WKBA 2DUUA 3KAQA 1VP9A 3LA6A 3X43A 3ZVLA 2IV7A 5AQ1A 5I51A 1JJVA 4K6FA 2C84A 4N7JA 4RYLA 4WY8A 4U7DA 4PNZA 4QT4A 2ZSBA 5GAJA 1T9KA 1KJNA 4B9EA 3QE2A 3ICQB 4CR8A 3H13A 1ENYA 2DBQA 2IYVA 2F3SA 5K2MA 5J43A 3WLRA 4Q02A 2I67A 1G5PA 4PONA 3WLFA 1O9BA 4JYPA 3WYGA 1DEXA 2B0JA 3IQFA 3PJEA 1QUEA 4WBSA 4BGEA 3WIOA 4N01A 3RQIA 2CHQA 3O4HA 4PGFA 1L7NA 1LRLA 1JR3A 1QLJA 1SK9A 3OPYB 4QJIA 4ZGBA 1IN1A 3MXTA 3C70A 3DO6A 3D5TA 1H2EA 2Q21A 2AG5A 3KZMA 4BNXA 2KB0A 1Z16A 3AEXA 3NKLA 3E7FA 2BMEA 1Q14A 4LOIA 1YDWA 1P7ZA 2X9NA 4M99A 4PIMA 1LQTA 1W1UA 2HIHA 2GSWA 2BTQB 2ZRJA 3KYBA 3OPVA 5CP8A 3HY6A 5THXA 2CEKA 5CDUA 3QWBA 2R86A 4GP9A 4D3XA 3AZPA 2BKVA 2SCUB 1Z2CA 1WNFA 5IYZB 4L8YA 5FO0A 2WNHA 4I50B 1QAQA 3KQKA 2F1HA 1R74A 4NARA 4HMPA 4MUKA 4ZT4A 5HZKA 3ZWCA 3QM1A 3GU3A 2ECKA 4DIBA 4C78A 1OU4A 5FOVA 3ASYA 13PKA 5CH3A 2GN9A 3PT5A 2Q50A 5IG2A 3G17A 3H5LA 5JEDA 5J2UA 2B8NA 5BO5A 1XPOA 1HKHA 3LM8A 3PQFA 2GBLA 1TE2A 3M82A 2V0GA 4MB6A 2WICA 2A1UB 2O3JA 1UL1X 2CNKA 3GRFA 3N2IA 4D7AA 5JSQA 3E53A 2YNMA 1G8HA 1CJBA 1DBVO 1S4MA 5FCDA 1U1GA 3P8ZA 4F5WA 5SICE 3TGLA 3W5AA 1F8YA 1DIOB 1FFBA 1C30A 1Z8FA 2GK6A 1NQWA 3HJUA 4UREA 1XZLA 3TR5A 4ZHQF 3GFVA 2LUOA 1J1ZA 1M2HA 3H5OA 3RKUA 4DPKA 8LDHA 1FVHA 2NZUG 1J2JA 4HDKA 3TPFA 1N6IA 3LVQE 3HXKA 1IPEA 3KXLA 3C0KA 3I2HA 4Y6SA 5ALFA 4XYBA 4D8VA 4RKEA 1V8OA 1L5KA 3TTVA 1VE3A 4FJ0A 1V5EA 3CLVA 1ZNZA 1RCTE 4O2AA 3KCNA 3NBXX 1J9GA 4NOKA 5DMHA 2WUVA 1OTHA 2VZLA 3TDMA 3TNFA 3WWYA 3ZU4A 2JLWA 2DHEA 4HO1X 4D0LB 3RHFA 1ML3A 1RPTA 4AXXA 3AK4A 5J4HA 3GUVA 1QC5A 1TL7C 2DKOA 3OJLA 1M1YB 3SFZA 1MC4A 2FSGA 2G9RA 5EMJA 1OUMA 3FPCA 4RL4A 3I09A 3NPMA 3DDOA 4WHMA 5CM2Z 5TF4A 1DC7A 1N2GA 2WHQA 2XSZD 4LC1A 3X1XA 3P4YA 2X3UA 4YP1A 2PUVA 1V1RA 5IVDA 5LLSA 2L18A 4BEBA 1PWZA 3COVA 3EDMA 1OMOA 4OVKA 2YJZA 3ZKAA 4COKA 3L8EA 3QVVA 4LYEA 2XXAB 1PX0A 4UW9A 4HZIA 4DY4A 3B48A 3P0IA 3VHXB 4KZKA 3HB0A 5AJTA 1FVOA 2X3YA 3D1JA 2IS6A 1EB9A 4Q37A 1EJBA 1UMCB 1PDWA 1PR9A 1LK5A 2EX1A 3GEHA 4NESA 4UVHA 3I2YX 4YRCA 5DCYA 5F77A 2TMDA 4O1IA 1EEHA 1MQSA 2IELA 2PZLA 4E2XA 1V9LA 1PEDA 1Y63A 2IXDA 2PZJA 2XVYA 3GGPA 4MIYA 4DR1B 1Z5NA 2DKNA 4NAVA 3M4ZA 1DMSA 2QP4A 2LVBA 2BSAA 2B4TO 4CV1A 4U5XA 4B1FA 4NNOA 4EPTA 3HKBB 1JDNA 1Q0RA 2Y71A 3ASZA 2H2FA 3K73O 4RTNA 4OX9Y 2IXAA 2JARA 3NH6A 1KPIA 4RCZA 4RMGA 4WKNA 3ROEA 4HAUA 1ISRA 4RF5A 1BMFD 1LZLA 1Z08A 7ADHA 1XQ6A 2IRWA 3JQ8A 1E4EB 2ZWPA 5JV5A 2IUTA 2W6QA 2M32A 5EEGA 5CD1A 2IXGA 4L5CA 4NNJA 2IIVA 5LQSA 1MJHA 4W9RA 3ZDEA 2IYWA 1IUKA 5E3HA 4DBZA 2Z98A 1PCXA 4IP0A 3RS9A 1IFXA 3WQRA 1BA2A 3PB3A 3QIVA 3RSFA 2K6GA 2OXEA 3LI2A 3DEJA 1FBNA 1KAEA 2P9FA 2ZB2A 4LOKA 4XASA 4DMUB 5KYTA 1NI4A 3ETEA 2DLCX 3UOGA 3CVOA 1J5EB 3R8CA 5HDQA 1ZX1A 5A1JA 5FPTA 1BE0A 5I4KA 1G8GA 2HQBA 5TX7A 3QI2A 2X0IA 4GHWA 3Q3GE 2WJGA 1BE1A 1TTHA 1XZMA 1EK6A 2EJBA 2ZBVA 1KO5A 2C7GA 5HK8A 3ISTA 4CV2A 5L51A 2DERA 1A96A 4D3DA 1NN0A 2QN7A 4EYOA 2VPWA 1S4QA 3FWPA 2FETA 1XA4A 4I55A 2EVWX 4BNIA 3KO8A 4QREA 4AI6A 1ATZA 1PK8A 4RZHA 1S2OA 1TT7A 4YHHB 1FFSA 4Q19A 3ZE7A 5BNWA 3ANYB 3BILA 4CEHB 1AN9A 2B1RA 3C3AA 3ZWNA 2VK2A 1AGYA 4H7PA 4BDTA 4QTYA 3A3NA 1JIQA 1EX6A 1O77A 1LBEA 2FDRA 3D8BA 3FSGA 5CH5A 2P9JA 3H5AA 3F6CA 4GR9A 2RG1A 1AB6A 4JFAA 2YHIA 3GHHA 4CIVA 2QLLA 3IA2A 2ROQA 2ZJFA 1P31A 2CZQA 1NQVA 1COZA 3TE6A 1BA3A 1QQAA 2AD5A 1E77A 1MG0A 2O0MA 5A4KA 4GEKA 4CCYA 3GZJA 2CVZA 4GBMA 1QAOA 1XFDA 2OCBA 4FR0A 1PUJA 2B9EA 3DEHA 3LFTA 4GECA 2FOXA 3O1HB 5ADHA 1A5ZA 4J9UE 3H2IA 3C3CA 1V8BA 4OQYA 3O82A 4ALNA 4KO2S 5F2KA 3JZFA 3SMVA 1PWHA 3DJYA 2GF0A 4Z86A 5JAPA 2GZ2A 1JLLA 4XGRA 2EJUA 5B7PA 5HIAA 1OI3A 1L4BA 3NATA 3TZEA 4A1OA 3IQZA 1TADA 3OZRA 2IYOA 3LK6A 3I9LA 1UK9A 4X91A 2CJPA 3KQLA 3RUFA 5EZQA 1RFLA 1SUFA 2F64A 1WOMA 1GUYA 4RPHA 5F5NA 3HFSA 2WKPA 3EQ7A 5FBKA 3EZ2A 3AR9A 2XCIA 3QBEA 4QOIA 4MI9A 5EWLB 2RHBA 1V3QE 2RGWA 3G1WA 2FZ4A 5JRJA 4O0LA 1LLDA 3EODA 3WOVA 4FMCF 3DUWA 2Q7OE 4CTJA 3HEMA 4ZXFA 5KS2A 3BTOA 1EVLA 2ZJYA 2AOVA 1PZMA 1AMNA 2B2NA 4I2NA 1JEQB 2VJQA 2OHOA 3VKGA 3KJGA 5DX8A 5EWJB 5BP7A 1DKMA 3GPDG 3N2NA 3PDUA 4BRUA 4NCAA 3QHQA 1CJVC 4TROA 4MTLA 4MJLA 1GIAA 3U0BA 1W0JA 2X15A 4M1YA 2QRUA 3UGTA 3NHKA 1FVXA 5JDCA 2O3RA 2YNMD 1RPNA 2J07A 3IURA 4IDBA 5A3VA 4A0SA 2RIPA 1ZP6A 2IS4A 2GEKA 1I10A 2OLJA 5D2CA 1D5CA 1X80B 4OHUA 2YJTD 1ZW6A 2F7SA 4MQ6A 3TVTA 1GTSA 3ENQA 3KYJB 4GP6A 2CSXA 2FNAA 3T7AA 1TUBA 2B83A 2AW3A 3HU1A 3HNPA 3B1WA 3DM5A 2EOAA 5FBZA 5ALTA 2FQXA 5BSWA 4Y6GB 2ISSD 3I6ZA 1QP8A 3MF4A 1PX2A 4GKAA 2VTEA 4JI2B 1JYFA 4JX9A 1JR2A 1ELOA 1KC3A 1WXEA 4RMNA 3PEWA 1LNZA 4G0MA 3LX5A 4D4IA 2ZATA 4A16A 1TMKA 4HWRA 5JAMA 3ZH9B 1SPXA 1DO0A 4R1TA 4RH3A 1K7CA 4N18A 3I1IA 2QI9F 5K3EA 2E5FA 3IPYA 4BCCA 2VO1A 3OQBA 5JD4A 2ZTSA 1Z36A 3GLHB 3WISA 1XTBA 4ZK6A 3RSZA 1FP4B 2GSDA 3GBSA 3QKUA 5CB4F 3B70A 3TX6A 4QL3A 1IMOA 1XCMA 2YXNA 4XYEA 2GVZC 3FHCB 5LYJA 3JQQA 1N2BA 2Q0QA 3KLOA 1NPDA 2RH9B 2QYTA 2GAAA 5AKLA 3VJRA 3HDHA 1E2DA 3B6JA 5CUQA 4I1YA 1Y7PA 5MF6A 2XGMA 1OFIA 1L5QA 5L8VA 4XPIB 4HN2A 1Q11A 1ZD2P 1T3ZA 5F9MA 4EGCB 5GGXA 4PAGA 3TI9A 4LMPA 4D9FA 3DBVO 3UWSA 4BB9A 4DCJA 1VKZA 1ODCA 1G5HA 3KTDA 5CDSA 4EA9A 5T4EA 4B3FX 4CKWB 3AC0A 1NV8A 1ZMOA 1QZZA 1ZD1A 5E7QA 4BQNA 2UUOA 3T5PA 3IAAA 1TQ8A 2ZR9A 1XZGA 3EARA 3K7EA 5HUQA 4KYVA 2PXAA 2PZKA 3KQTA 4BLRA 1UCFA 1JSXA 3W2GA 4KOAA 5B3JA 4B47A 1WXHA 3G23A 4TYPA 2OHFA 3RI3A 1DUVG 1KHHA 4V39A 1IXRC 5TQ0B 4IIJA 3LKZA 4RUKA 3O5AA 4XQEA 2H54A 3IMFA 4G8BA 2I3GA 5EJ9A 1FFWA 1T8RA 3L8YA 4O2BB 5DNDA 2ANCA 3U3KA 3L18A 2NVUA 5AHKA 5JZMA 1V16B 3MS2A 2OPHA 2H31A 3DDNA 3NJRA 4ZALA 1QH8A 1YOVA 2W2NA 3OTWA 4AJ4A 1ARZA 4KR2A 1VLMA 3QA9A 4GX2A 3TLKA 3A4NA 2EFGA 4R2MA 2WU8A 4ZICA 3P27A 1TO1E 3QVOA 4ZA2A 3RS0A 1RQXA 1N32B 3PT9A 2G6BA 4PYRA 2QTCA 1CY2A 3Q7EA 4RVDA 3RABA 1U8XX 4IBOA 3DWEX 2FW9A 1P62B 3K5WA 4G0VA 4Q1VA 2YJ6A 1NT4A 3JVDA 2WYIA 3KPYA 1KWGA 4IXMA 1CIPA 3KALA 3WAKA 4C0LA 2ZTMA 3PNMA 4DR2B 1YOBA 2FFBA 2L19A 4WX2B 1I9GA 1T4GA 1R6BX 3BWEA 5AJWA 2QOEA 4Y9SA 4EYGA 1AM4D 2Q3HA 4X3OA 3BH7A 2X5OA 3FSGD 1T6YA 2IZ5A 2NZJA 4CIAA 3NYRA 1NQ5A 2G17A 2I4MA 5H83A 1GPWB 1PN3A 2CK3A 1KC1A 3L7BA 3ESRA 4FYIA 5CPFA 5FORA 5IPFA 1I7PA 5EJ7A 4ZI7F 4HXYA 2IEDA 1CJUC 3GLVA 1O5OA 3PHHA 1V5GA 2O2EA 2WM3A 4FWBA 5JVDA 4FN4A 3A70A 5JG7A 2AZ4A 2NO5A 3E0QA 3OE4A 1QE3A 1XD9A 1Y8RB 2HXYA 2YINC 4O33A 2VKQA 4JYBA 4CDGA 2QRKA 3KKMA 5JSYA 2FPIB 1JLHA 3TG2A 2PX5A 1A9TA 3AGQA 5AVTA 1U3CA 1NUSA 5EUCA 3AKDA 2C97A 4ZVSA 1DKUA 3VC3A 2ONKA 3AKYA 3BX1A 4CTNA 2EQ5A 3HKEA 4U6NA 2AOUB 4DRYA 1JIXA 3MINA 1C5KA 1U0BB 2IZZA 4E07A 1LTHR 1GGJA 2XPCA 1E2FA 4BO1A 3HCBA 1JIJA 3G02A 4YRLA 3ZU5A 1VGQA 2MDTA 2RGUA 1NAIA 1X2BA 2W6CX 5EZSA 4EHNA 5CFOA 1C2YA 4A6DA 3DOEA 1YGYA 1E0JA 3DR5A 4OAPA 1JFSA 2ZZKA 1JBEA 2R7MA 3P2JA 3HY3A 4IM7A 5K8VA 4KQ6A 4Q15A 5AW8A 1G0OA 1WW8A 1VYHA 3IP7A 3MJSA 1M74A 3NCHA 3O7WA 4OFZA 5ALDA 1RRFA 2ZTVA 1ECLA 4MR7B 3W2EA 3EPPA 3AJAA 1QG4A 3W5CA 1IAQA 3SXPA 5E6UB 3O47A 3PNVA 1S3GA 3G5MA 1O89A 9LDBA 1J90A 1SY7A 2EYUA 2XHZA 3H9UA 3HCRA 2EZTA 4RFVA 1EHCA 3LRPA 1W0JD 2R6GA 3S2IA 1GAXA 1MTZA 4XA8A 1EK1A 1HFEL 2JI6A 2MYPA 3IJPA 5C1BA 1S6YA 4P4SB 4IDNA 5L4LA 1PFWA 4HDMB 1KO4A 4G37A 3OFKA 3PC8C 4YJ2B 3F5FA 3T1HB 1IG3A 2C00A 2OB1A 2UZIR 2YY7A 5D00A 5JDIC 2CVPA 4QUHA 1V35A 3TDNA 1UP4A 2OV8A 2V7XA 3H8VA 721PA 5KNDA 3IX7A 4P3OA 3D6MA 4RJJA 3ZQKA 4P81A 4WCFC 4LVOA 5JTTA 5EI5A 4C08A 2PU7A 2FR0A 1GADO 4KPFC 5F23A 3FHLA 2VL7A 1Z5PA 4NYIQ 4ZAZA 1AN0A 1JMYA 4KV9A 4TTQA 4K0KB 2DPLA 2GBGA 2H07A 3C43A 3EDOA 4BVBA 1SG6A 4DJDC 3KUDA 1Z22A 2XZDA 1YB7A 3LQQA 4PLHA 5SY6A 4QRDA 1IY2A 2VJKA 4YO7A 3WK4A 5GGYA 4AX8A 5AKZA 4MS4B 3RQSA 1TOAA 1SBHA 2HSGA 2VDQB 1K66A 2O7SA 1DX9A 1XT6A 2HWUA 3IAHA 4DCOA 1ZN9A 4E2WA 1AO3A 3V5NA 3H9EO 1M34B 3A1VA 4UE2A 1Z26A 1JQEA 3A31A 1PD0A 4KMOA 3FI0A 2OCYC 3GJ4A 1VCHA 1SD2A 1H5QA 2PD4A 1JDPA 1XCOA 1G7CA 2W6ID 3IIKA 3JSXA 2Q5IA 5JWRA 1T0HB 1EFKA 2C57A 2O0KA 4Y2UA 4K26A 4IHQA 5E7IA 1A1VA 1F1BA 2P1ZA 2YXEA 1GKKA 2HK9A 2ZIUB 3VNRA 3MB5A 3JAWB 2WLTA 5FUYA 3FTFA 4Q4LA 1VL6A 3AVTA 3PPXA 2PSFA 2B69A 1XKTA 2EKZA 2FUEA 2OHJA 3PJDA 4Z7OB 3IO5A 4PLTA 4P7JA 2P90A 3BYZA 4JIMA 1GWNA 3FOZA 5G4KB 4NAHA 1MGPA 3BPSA 1TLTA 4L08A 5T67A 1E4OA 4JOBA 4BKUA 3UMRA 4M8SA 4Z3DA 1VCOA 3DO5A 1F2VA 1O6CA 1SG0A 2NVWA 1ETUA 1RYBA 1XI2A 4FD2A 1CS4C 2XMDA 3TKLA 3HDQA 2J6IA 3OMWA 3LUJA 4JQCA 4RJIA 4MP6A 1YRYE 4E08A 4RTMA 1OH8A 4BNLA 2X2PA 2E82A 3MGAA 1NSYA 2XH8A 3ADPA 4I5GA 2SNIE 4ZT7A 2PTGA 3V4LA 3QPVA 3CPHA 3ABSB 5FNZA 2Q1YA 4I1VA 4DL9A 3AUFA 4QUIA 2ZRCA 1OFHA 3F6SA 2I2AA 4NI5A 5DTRA 1ABBA 1M2FA 2NU7A 2VK1A 4IIYA 1Q3KA 1OH5A 2I1WA 4RGVA 1Y89A 4WW0A 1RS0A 4C4OA 2PKYX 4L7QA 1U2QA 4XQ0A 1H22A 1HNNA 3V7UA 4B3RB 4PIPA 1IK6A 3Q3EA 1FVFA 1HGXA 1WTCA 3A2MA 4FGKA 1W73A 4O2AF 1F2TB 4DJTA 1NJ5A 3DAYA 4HYQA 4GXQA 4L0QA 3TW4A 3MTEA 4C0SA 1U11A 2FEAA 3NOXA 1RCFA 3REFA 3P2EA 4FLEA 4NJMB 3H4IA 4FVTA 1A4RA 5I7WA 3VVMA 1V26A 2PUGA 2UAGA 5I7UA 4A0HA 2ZSKA 5DHFA 4CTMA 2C59A 3FNFA 5H3HA 3G0BA 4V1CB 4D9NA 5F2OA 1ISPA 3EXFA 5AI6A 1XA0A 1E1CA 2D4AA 1T4CA 2G09A 3AZQA 3H3FA 4IDHA 1UWLA 4MV3A 4ENUA 4N65A 2XKAA 2VSQA 3WWPA 1MEEA 4RK4A 5P21A 1ONNA 3R5TA 5KTYA 4X9XA 4ALMA 2DC1A 3L6DA 5KKNB 4KIFA 5IDVA 4LNHA 3OPQA 3UCXA 4Y98A 1EBUA 2BM9A 3M9XA 4QGFA 3ZHSA 5L3QA 3WL4A 3HZRA 2BIFA 1CZLA 1ID8A 3QVTA 1JTFA 3DFIA 1S1CA 1YNOA 4OI2A 2HA0A 3A26A 3G8AA 1IZ8A 4BO5A 3RRXA 3R2JA 1XNHA 4UAJA 4PG8A 3H1FA 1R0LA 2A30A 2YWHA 3DZCA 4WOCA 3HFRA 3TTUA 3V8BA 4QPZA 4DB2A 5AIAA 1ZOLA 4ZDKA 1YQDA 2RGEA 2BT4A 1PS8A 2J48A 5DZSA 3CZRA 1JU9A 1P5JA 5TJHA 4N7MA 3CISA 5TB5A 1G3RA 1TYEB 3MCWA 1G1MA 1N5MA 2XWQA 4KEAA 4GOXA 1ZJ5A 2R6ZA 2IE0A 5BYJA 4AO8A 5IRCD 1IVSA 2XVAA 1Y7LA 3NZEA 3U80A 2P2CA 3RJTA 2NAPA 3MWKA 4NH0A 3UPDA 1T6NA 4DG5A 3HBJA 4WN9A 4YWJA 5LZ7A 1R5OA 1YJQA 2DPYA 2KMLA 2QQFA 3HL4A 2WF5A 2XYGA 1YAHA 4QAJA 5I5GA 5I7SA 3P9YA 2P8SA 2VOEA 2QENA 2WIJA 3GUUA 4HL6A 5LQNA 1UEIA 1C3OB 3X1ZA 1N77A 2XKJE 3WA7A 2R9VA 3VBCA 2BGGA 4LDJA 3JAMA 2O07A 2VDLB 1KU0A 5IM4A 2QVCA 3RJ9A 2NO6A 4IILA 1V3VA 4CLEA 1Z7EA 3LXXA 1T2DA 2Q7DA 3TEJA 5KWEA 1Z5WA 2PJDA 3JRNA 3UUFA 2QMZA 4CM7A 4BZPA 1ANKA 4JHLA 4Q7EA 4RJLA 2A5LA 2E5WA 4XIYA 1DOHA 1Z6QA 4TVBA 3GYGA 3LTNC 1H93A 4Q9NA 3BICA 3E81A 3WTCA 5A4IS 1ZK2A 5CITA 5DRTA 2PG3A 3FMOB 1OQAA 4L4ZA 4RKYA 4WFKA 3F7TA 5A4DA 5A7FA 3PF8A 4JVOA 4RD6A 2JIZD 3ZNQA 5KNDD 1C4KA 1ZNYA 1CVIA 3VYUB 4MYDA 3LY9A 3DOUA 5FJIA 2QTRA 4I9FA 4P32A 2QJTA 4C7JA 5A9SB 1C3JA 1Z88A 2Y1CA 3BGDA 2WBLC 3QBJA 3NAGA 4HLUC 4E5SA 4RNDB 4YPFA 2BF4A 2JZCA 2V55B 2QG4A 1I13A 4EKNB 4AMUA 4FOLA 1JAIA 1A97A 3W3ZB 3IDZA 1E6CA 3A06A 2GZAA 5JI3E 1NUUA 2ZJ1A 4IQ0A 5DJ5A 3TL3A 4OKIA 4EGAA 4MV7A 1BDMA 1YFKA 2VYNA 5FR1A 3DH0A 1X15A 5FADA 2CLFB 4GOMD 4LJYA 4D8WA 1VHTA 4LJSA 5A5GA 3FSRA 3FNBA 3LFHA 2WPDA 3D3NA 2LCFA 4GXTA 3WWEA 1ZNWA 1MO4A 4IRUB 1K5GA 3MTGA 3PFCA 3R5JA 4PW0A 2RK6A 4YROA 3ANMA 4HNQA 1JWLA 2V7EA 3UHAA 1O6GA 4UBOA 1RTTA 4YUVA 3ZWPA 4YFYA 2C7OA 4GI3A 3E1KA 3N1UA 1UM9A 4OHOA 2OILA 2IHZA 1QXSA 4OQFA 4CG0A 3EPRA 4NV3A 2QR2A 4YC7A 5T4BA 4ALIA 3SG0A 4N41A 2NTJA 3WI7A 2CSUA 4GZ3A 4OCZA 4I66A 1O97C 3LDUA 1C4WA 1FE8A 3DV9A 3NTVA 2F17A 3JARB 1HQDA 3V48A 2HPAA 3A05A 1USIA 4HS9A 1TPZA 1EXMA 1P7WA 3QXXA 3UJ9A 2J3MA 2HLHA 4PINA 4K81B 4TYWA 1RYEA 1SRQA 2Z3ZA 3CJTA 4R8VA 4ZYXA 5C7IO 5LL6P 3G5AA 4QDKA 5DGXA 1AURA 3V8MA 1ZUD1 3ZGLA 3KUKA 2PUHA 1M7BA 4KO1S 4QU9A 5ALGA 5HIIA 4TZ6A 1TC2A 5D6OA 1TA9A 3BB1A 4YJGB 2MINB 1ZNXA 5BQPA 3ZVNA 4DIFA 4C76A 3L8ZA 2PX4A 1TPYA 1U8AA 4ZCPA 2QIOA 3PVSA 1INLA 4B3SB 5BRAA 3FOCA 4H35A 4TMXA 2DSTA 2FE4A 4M9XA 4TV8A 1JDTA 2VP6A 3DT9A 1JB9A 1VHLA 4RABA 2Q3CA 5AJYA 4D4HA 5I8ZA 2GK4A 4BASA 1AK9A 3WBKA 3G6WA 2I4TA 1WTAA 4B6QA 3ZD6A 4K5QA 1ZH0A 3GD7A 4W6QA 4UASA 1QO0A 2QNIA 4XX0A 3IQWA 1RMTA 1LF5A 3PFWO 3EPJA 1RXSA 3SC4A 5IBCA 1GGHA 3JV7A 3X44A 4Q6BA 1LRJA 2XI4A 3ADDA 5CTJA 1ONPA 3HWSA 4MHOA 1JHVA 3KX2A 4IMJB 4E3ZA 2VDJA 2V6GA 2SHKA 4WAUA 2O0LA 2X4LA 3AL2A 3PVCA 2H4ZA 4RSHA 2P2SA 3TFQA 3IV7A 4BGVA 5DASA 4D43A 1CZNA 2AT1A 2CD7A 3MTAA 5LYJF 1J56A 1A8QA 1U4NA 3RUPA 3WLIA 1U5BA 1V4VA 1U2PA 2NACA 3N3AC 4EB0A 5BWLA 5FWYB 5LZ8A 1BZYA 2EP8A 1U2GC 2R3SA 1KEZA 2X6QA 5D87A 2ZAMA 3CWZA 2HIAA 4CL8A 3ROZA 4FTWA 4QQFA 3GJXC 1CR4A 5IC4A 4A0GA 3PDCA 4P0PB 2P77A 4KDRA 3MMSA 1P3JA 3JQ9C 2NU8B 4F5DA 3RYFA 4MPPA 1A8HA 1ZJ4A 3H2KA 4R1UA 4DPMA 3N0RA 1Y1LA 3OLWA 4ZOQI 3KKKA 4YECA 4ZAWA 4DDTA 2PANA 1X1TA 4XWGA 4P53A 4EEXA 2JFQA 2YHUA 2MSKA 3FJ1A 1BKDR 3QELA 4LIPD 2B8TA 4E6EA 1Q21A 1DGQA 4X7BA 5B57C 3TB4A 1U9IA 3ITNA 2C1XA 3Q7TA 1FDRA 1C3XA 3DFFA 3JVEA 2VLBA 3GOHA 1STOA 3BCUA 5EJ4A 4L4YA 4IIJF 4ND5A 2Q9BA 4MWTA 4ZYLA 4DIDA 3F4LA 3DHEA 1F38A 3COJA 2UYHA 1UPAA 5DI3A 4B4VA 5KWVA 2IJGX 3MTBA 4JC4A 5E4FA 2W2VA 1JQDA 2QW0X 4HDRA 6YASA 4U6SA 4MW0A 1XJ0A 2VZEA 3B2QA 3ICPA 3ZCSA 4E46A 5JQWA 2OYSA 2QM8A 4G1BA 3B13B 4RLSA 1YHNA 4I8IA 2Q5JA 5FJJA 4HRAA 4Q39A 1ZGCA 2AKAB 1MB2A 2PZFA 4PE5B 5TMEA 2I80A 2VRWA 1DAIA 1KI7A 2VDKB 1F8XA 2JHFA 3H2SA 3HE3A 1J2YA 2BGTA 2Y1EA 3OY7A 4G25A 4YCAA 1Q7RA 1YE5A 4O2LA 3L7YA 5EIOA 1Q2XA 3L7LA 3QU5A 5HF5A 4QG3A 1X1CA 3ZUPA 4K28A 5IMBA 4AUNA 2X8JB 5HGJA 4PF1A 2XUKA 4ZPXA 1KF0A 1SU4A 3GUHA 5ITZA 1LJ8A 2Q4BA 1QHNA 3GL9A 3M9LA 1HNXB 3TQOA 3B20A 4H18A 3O4IA 3HN7A 2V3VA 2VJCA 3DV0B 1X42A 4LCBA 1F1JA 1Q7TA 2R2AA 5LB4A 4AY4A 2HA6A 3SI7A 5B2EA 2BBTA 4W8GA 1R4MB 2G9NA 3COWA 1X1BA 2RBGA 3RT1A 1L7XA 1RBZA 2GN8A 2XZTA 5I3CA 1FXWA 1XDSA 1OTYA 2NUTB 1NF9A 5F7XA 1QLWA 4Z0NA 4UAGA 5KYNA 1RXUA 2QBYA 2YIJA 4ETIA 1KOFA 5IAEA 3QLJA 1UBUS 4BO7A 1UJBA 4O4HF 3HO8A 5I4IA 2RE8A 4EUKA 1N34B 2QQ0A 4CMIA 4FQ7A 3I23A 4ZAGA 4F60A 5JVDF 1Y81A 2GCGA 3CLSD 1SD1A 3MC1A 2ZJ7A 3EVNA 2C5SA 4QUBA 5KYGA 1ESZA 1UK6A 2YZMA 1GKUB 2WPDD 2IY9A 3JRWA 2FZLA 4GMFA 3B7PA 4MW7A 1SO8A 4Q3EA 1V6SA 1W36C 1S3IA 2VNAA 1VPDA 4RCVA 4BMNA 1EE9A 1WMAA 4BO2A 3K0FB 2IKQA 1N4DA 1VLHA 4AURA 2C5FA 3UFXA 1KI8A 4UVEA 3C97A 2RHLA 4G1UC 3EJWA 4TXJA 4FDMA 4AT1A 4BKQA 1H94A 5T3UA 4IJQA 2CUTA 1U1DA 1WW3A 1GCAA 1GZ6A 2WZBA 2ZRAA 2HTEA 2BFCB 4MUXA 4XM1A 5CVDA 5ER6A 4YQEA 2AGVA 1BU5A 5AD1A 5JPCA 2O8BB 3SNHA 1YS7A 2P5YA 1ATIA 2DSNA 4M1ZA 4NP6A 3WHPA 3G0GA 4RSMA 3T3HA 2XB9A 5EZYA 4BU1A 4OBWA 1RYZA 2XWSA 1ZMRA 1SVLA 2CLSA 2IOQA 2ZU0C 4KG7A 4M8IA 4R3UC 3WGGA 1OXXK 1G66A 3MGBA 4TKVB 3AR6A 1K7XB 1NSTA 2QM0A 3DV2A 3OUTA 2XMBA 3I2FA 1THZA 2ZB7A 1QCDA 2FFJA 3PU6A 4IIHA 1S3FA 5EJ8A 5DYWA 1DMRA 1R37A 4U2FA 5EIHA 1RQGA 4H1VA 1GQ2A 4PU0A 3PQ6A 3JYLA 2IYZA 3H4VA 3ZE2B 4C0BA 1S7CA 1AGRA 1O94C 4QODA 1XA3A 4UBJA 3KQHA 1BFDA 2OCPA 2GPTA 4L6IA 3B3QA 3HGMA 5HE9A 4CMGA 4WTOA 1M33A 4OAQA 3OU6A 3BMNB 4HX9A 2Z6UA 4KDFA 1AVTA 5I9BA 1WXWA 3HUDA 3HUEA 3BGSA 1RIIA 1Z6XA 2VAVA 3QU9A 4Q7KA 5IT0A 1VMAA 3T34A 4X6YA 1QFXA 4PO3X 3LLVA 1EFPB 3FB4A 5FEMA 3G8YA 2OLEA 2BELA 2IX3A 4IHKA 3GVIA 4TXHA 1EWQA 2VNKA 3M49A 2P9GA 4CF7A 1QO0D 1PNOA 4HH4A 2EFCB 2H06A 2QN2A 2ZUWA 4QFCA 1UBOS 5AI8A 1T9HA 5GV8A 3DR3A 4AJKA 4DS3A 1BXKA 4PCVA 2IYFA 2Q2WA 4GNKA 5TQ2A 1GZ5A 3HXOA 5JTUA 2ZXUA 4YCCA 5ENDA 1FBTA 1TJNA 2GJ4A 2E4XA 1VDMA 2XBLA 3REQA 1ZIPA 1U04A 1MOZA 1U0LA 3H9CA 3HY4A 4IXWA 1G5QA 4HGZA 5KU7A 2ZOSA 1E2MA 3DTNA 1Z75A 3TLZA 2VT3A 5D5HA 4P3NA 3U9TA 3ICCA 5EMHA 4KRYA 4RPJA 5IZCA 1L4MA 4KH0A 1LW6E 3BBPA 2RBKA 3ZBPA 2R1ZA 3O2SB 1BGXT 5TPZA 4W5QA 4KQKA 2H29A 3Q3IA 1VLJA 2C77A 3OTGA 2NLOA 1AXGA 1H85A 1YZ3A 4LWZA 1GPAA 4QXQA 4AC9A 1DJQA 4S24A 3E0XA 4GI7A 1D6SA 2QI9C 1FFXB 3MT0A 4DIOA 2RAPA 2BISA 4AN4A 1P5FA 4WL0A 2HF9A 3M6FA 1J20A 2Z8XA 4FYPA 4I50A 4WMLA 1Y48E 4PC7A 2QRHA 2ERCA 1QHSA 1UOOA 1IE3A 2PUBA 1RVV1 3HN6A 3LP5A 4B34A 4PN3A 5JCJA 1HT0A 4QYWA 4ZU3A 3LGAA 2Z3VA 3RVDA 4C88A 3BTUA 1C1DB 2QT1A 4CQLB 4P3KA 1UKEA 3D4PA 4YJ3B 1C7JA 3H5TA 3I5AA 3AF2A 4IXNA 4AY5A 1R1DA 4HJRA 2RHMA 4WGFA 1QH1A 4R6WA 1I2BA 1JVNA 1TU0A 4LHSA 2I9KA 4EH1A 4BNDB 2A1UA 2AJLI 1DQSA 3CNHA 5IDYA 4P5EA 3P96A 2WHXA 1ZD8A 4X6UA 4D9BA 1UZNA 5BMOA 4CMEA 5F7JA 3H9QA 1OH7A 1SXGA 2OO7A 5TV2A 2NU6A 1F51E 3IP6A 3OZXA 5DSTA 4KLNA 5B1DA 3WSTA 2ZJBA 3DBHA 4NZZA 4ENSA 4AKHA 3DMHA 4PGHA 3BSWA 1M83A 1Q1AA 4GW3A 2OCDA 5LMZA 5KNLA 1C2TA 4HGYA 4XWTA 4BTLA 3OCYA 1IOLA 1GFWA 7REQA 1SCKA 2CLMB 4P2BA 4MYSA 4ZCSA 4LZOA 4AJ1A 3DTYA 4AYWA 1JKIA 3K70B 4AJHA 3NGXA 3E9ZA 1QYIA 5LQRA 4LDRA 3THSA 4R9UC 3BF8A 2D1FA 1HORA 2OBBA 3A4IA 2P9BA 3WRYC 1A9OA 5K2OA 4DYVA 5FR2A 4X64B 2I34A 1JI3A 3D6NB 4RANA 4RA9B 3SEQA 1UOEA 4QXAA 3U7EB 2EP7A 1JQ3A 4ZQCB 1M2VB 3GFTA 4QTXA 2EU8A 2O2DA 2L69A 3OESA 1T9DA 3FM9A 1SZPA 4IXDA 4LZZA 3HBFA 3O8OA 3DNMA 1RRVA 4PSVA 1ZIOA 5HCIA 3TI7A 4D56A 3F6BX 4PAQA 1ZMBA 3O3NB 4H0CA 3WNZA 3ZDYB 5JSZB 1R16A 1WJGA 2ZGVA 3ZCTA 4CL2A 5JYDA 2V8OA 3VR1A 3DBRB 5LNK6 2VHJA 5BRNA 1X8XA 3IXQA 3MQFA 2WAYA 3S99A 1Y8ZA 2AMYA 4S1PA 4JOQA 1IBMB 3K16A 4F21A 3K1YA 2XXAA 1VSQA 3EXHB 2QX7A 3OKCA 1VE5A 3TRIA 1F2DA 4MRRA 4EECA 5ALHA 4XM0A 2YWRA 3T3NA 3GJ8A 4F3TA 4UE6A 2P7HA 2XNHA 4R1OA 5A62A 3NC4A 3C1UA 2XDWA 3STXA 4C4TA 1ULUA 4CM3A 4UHCA 3D4LA 4KIUA 4PTLA 3WP1B 1L3BA 3VC1A 2AK2A 3PC6A 4H9GA 2J3KA 4F5ZA 3D4NA 3LGXA 3NBFA 3SQDA 5TEVA 4CDMA 1CEEA 4Z53A 3M3HA 3H97A 2VXBA 4LBVA 3K15A 3WY9A 3ZS8A 4WEOA 5AKEA 2WVJA 4BMDA 1HMPA 1I24A 1X92A 4W9NC 4XUDA 4BLWA 1NXTA 3FYUB 2EWMA 3GDHA 4GLJA 1QGZA 1ZQ1A 4HGQA 1FX0B 1PT7A 3BAZA 4PGAA 3ESXA 1XLTC 3Q0EA 4DNOA 1Q12A 1MFZA 3D3QA 2NYVA 4L07A 4Q6WA 2EJTA 1SCUB 2WMDA 4FBLA 3Q3HA 4KE9A 4BMPB 2Z1NA 3HABA 3OG9A 1FP7A 2QT9A 3PVZA 3R4CA 2D1YA 1AO0A 3TE7A 3ONWA 3L7KA 3CF4A 2VDRB 2M6SA 5BSUA 1JG7A 4EEKA 1F2UB 2PLNA 1GAWA 1L4YA 3ESBA 1MBZA 3ANXA 3EQ2A 5MDHA 3W8FA 2D5AA 4BO0A 4YRGA 3HYCA 1RYMA 2X8AA 3HJHA 4F7DA 4XVRA 3R74A 4BCDA 1EESA 1PFQA 2M1ZA 2GVDC 1P75A 1T0UA 2Y67A 1JDBB 1EA7A 3K9CA 4JENA 5ALQA 2IDZA 3EC7A 2OAEA 4MV1A 4QYMA 5J2TA 3U2QA 5IAKA 3RLIA 1IZ7A 1OWPA 1T6ZA 2WZCA 2BFEA 5FPPA 5BY2A 5J5VA 1RRGA 5KDLA 2PMFA 4EPRA 1SQSA 1NYTA 2DTXA 5A71A 4B7ZA 4AAYA 3O2QB 4ZCTA 3FWNA 2B25A 1QCYA 2LIPA 2RI1A 3ZKWB 4RCYA 1IM2A 3OJXA 3PR2B 3ESDA 4DGQA 1R0SA 4IHJF 3ZDDA 2H2HA 4ZOCA 1P5RA