2HREA

Structure of human ferrochelatase variant e343k with protoporphyrin ix bound
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Substrate interactions with human ferrochelatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 138
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hreA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hreA01
2QD5A 2QD1A 1N0IA 4CCSA 2C8JA 1C9EA 4KLRA 2PNJA 2HRCA 2XVYA 1TJNA 2AC4A 4MK4A 1LD3A 3M4ZA 2PO5A 2XVZA 2XVXA 2JH3A 1L8XA 3LYHA 3GOQA 2AC2A 4KLAA 1LBQA 3HCOA 1AK1A 2QD2A 2H1WA 3HCRA 2PO7A 2QD3A 2XWSA 2Q2OA 2XWQA 1QGOA 2Q2NA 2HK6A 2Q3JA 2XWPA 3HCNA 3HCPA 3W1WA 1HRKA 4KMMA 2H1VA 2QD4A 1DOZA 2HREA 1C1HA 3AQIA 4F4DA 4KLCA 2DJ5A
chains in the Genus database with same CATH superfamily
4GR4A 5B1YA 4HDNB 5FA5A 1GIAA 4WZBB 3ZV5A 4FEYA 2AC4A 4M55A 2C97A 1H94A 3HJHA 4MUFA 4MI6A 4XFJA 1B0PA 3W6UA 1ABEA 1UDCA 2FRVA 4BX3A 1ZGGA 4MTLA 5B37A 3TD6A 1Y5MA 3GCXA 3CLSD 3UV7A 2C7PA 4DTCA 1CU1A 4JDPA 5KJEA 3PUXA 4NR0A 5E38A 1YCGA 2NN3C 2FOLA 5EHNA 4Y2TA 1C1YA 1CNFA 3BIXA 1KK2A 3BQMB 4CPDA 1S02A 3NHLA 1VHLA 5JAQA 2GARA 4AXXA 2YW9A 4MWGA 5EWLB 2YHIB 2PMKA 2AG8A 1Q0TA 4F4DA 1V11B 5TMBA 1YZGA 5ES3A 4ZODA 3DVAA 2RGAA 1CRQA 4YC7A 3TLAA 4L4RA 3TRFA 1VIMA 2JGLA 3IXLA 4MPPA 4Z0TA 2CWWA 3OEWA 1Z6QA 2G9UA 4OUDB 1NI3A 3KTFA 4M9XA 2GEJA 3I0ZA 4QEZA 3V3KA 4MWSA 1Z25A 1I1QB 3ER6A 1X7XB 2JJ2A 1UBOS 1OIXA 1YULA 4CEJA 2A58A 2VYQA 3T5CA 1Y6FA 4CDRA 2XRYA 3CN7A 1KJYA 3GRAA 1NVDA 3PUHA 2FMXA 3RTEA 1HFEL 2OENG 5AOCA 1DPFA 3WGVA 5EPOA 1UXKA 2G08A 1UMBA 2Y1OA 4J0KA 4JR0A 4DWJA 3TLYA 2GK7A 3MMPA 1W1IA 3U3JA 2ZE6A 5H68A 1U8ZA 4ZJPA 3KEOA 2ZYSA 2J4FA 3D6JA 3JVVA 1PWXA 2NVBA 3OZGA 4INPA 4J07A 2WG2A 4MA5A 3G8BA 3KZCA 1WMSA 2OGZA 1Q0PA 4L8FA 2ZRCA 3KUUA 2D5LA 3ENQA 3OX3A 1ECLA 1VP3A 5T41A 4CM6A 4EO4A 3IMFA 2EL7A 5JD5A 4YVFA 1C0EA 1L5SA 2AJCA 4ACAA 4EGSA 1QH8B 3GFFA 4KQHA 2XUQA 4RF5A 4RA6B 4XVUA 1XR3A 2YFQA 5LKRA 2C5FA 4YUVA 3P2IA 1W73A 4HH0A 2CJWA 3GLIB 1ZNXA 3ESRA 1KOLA 5HUJA 2MYPA 5C4MA 1YNOA 2X1LA 5DGHA 3HB7A 4NCXA 3C3AA 1XJ5A 4E14A 2PANA 1X42A 2FSHA 2IDKA 3FMFA 3RUIA 4HD8A 5KNBD 5JTUA 3JCZA 3QKSA 4B48A 1UDXA 4BLUA 4JXZA 3SDZA 1C0KA 3IDFA 3EW9A 3AILA 2Q21A 1P9OA 4LTMA 2CXPA 1CJTC 3C4VA 3HXPA 3FBWA 3BD9A 3HVRA 4BXOA 1BGXT 3ZN2A 4J1QA 3KVYA 4CR7A 4QZVA 2YASA 1OXSC 1QX3A 3AUSA 1FP1D 1OT5A 1YBVA 2H48A 4TMVA 4K88A 4WWHA 5A4JA 1H2YA 5AKYA 3IQGX 1UH5A 2XMBA 3O4GA 1NJ6A 2GMWA 2HWYA 4UHEA 1XCMA 3IIJA 3L7NA 3OVMA 4PHFA 3FCYA 4Q05A 4LHZA 4KTTE 4JB8A 4DG5A 2O5CA 3M6FA 4I6GA 4XARA 5U4QA 1TO6A 5BV2P 2G63A 5IVPA 3D3KA 1CUIA 2PKQO 4E1VA 4Y9SA 3NNDA 4R8MA 4C0BA 5BMVA 4RDIA 1SVUA 1WNTA 2W6MA 3WISA 1E2LA 2XSZA 3VYWA 3AM1A 1ZDMA 3I12A 1OA1A 1HTBA 2HPAA 2AEFA 3FUWA 1DO0A 1QCZA 1ZCBA 1ZUD1 3LOUA 4DDTA 2H11A 1YGPA 4B3HA 1CQWA 1MH1A 3O3NB 4FXPA 3SX2A 3EJWA 4E31A 5G40A 4YAEA 3QPUA 5JDCC 3UANA 4Q3AA 3PC7A 1GUYA 5LB4A 4CCWA 4N47A 3Q4GA 4MA4A 2DUJA 2J5XA 5ISMA 1P0QA 3HABA 1QTQA 2VKQA 2W6PA 2J46A 4NE2A 5F1KA 2JLXA 1ADBA 2NNWB 2WFZA 4Z0PA 4P0QB 2WJZB 3B2QA 5CVJA 5LC1A 1UXGA 5KOIA 2D2IA 4LJ5A 3EQ7A 2AWNA 5B7GA 2UU9B 4J1TC 4RFSB 1C0PA 1NBMD 4TL8A 1C9DB 5KQLA 4KRFA 4NCHA 3IELA 4L28A 1DCTA 3GCWA 2RGXA 4JELA 3PWTA 4HEQA 3PPWA 5LPNA 3RYCA 2O4UX 2GCOB 4JLKA 5K0SA 1DAGA 4PGFA 4OV6B 2G7MC 3ZV4A 3B52X 5LDHA 5AVJA 4B40A 1SQSA 4IDAA 2HLDD 2QZZA 3GUCA 4ZK6A 5KZMB 1BHSA 2IODA 3GD7A 3GLQA 4UU8A 1GPJA 4AF8A 1WBBA 2Y76A 3QITA 3BGIA 4HTFB 4LI0A 2EFJA 2YN2A 5HQJA 1P2SA 2FR8C 3B89A 2VVTA 4RVOA 5EUMA 4X7RA 5CNKA 4ZAWA 1F0KA 3MF4A 3DKKA 4GKVA 4OHKA 3ASVA 3W1EA 3WSTA 1SVMA 1I4DD 3SBEA 3ANTA 1CRLA 1J09A 3NAMA 3ZDAA 2ZYAA 4CMEC 3B1FA 2GK3A 3OQ6A 2H4ZA 3PTZA 1PZHA 3TFWA 2EL9A 3VJMA 4D0GA 2MOKA 2XJ4A 2WI8A 2WOJA 4BNKA 3GNSA 4JGGA 3IP5A 1C0IA 3PWKA 4NAUA 4OHCA 5FA6A 3UAGA 1LLCA 2I7TA 3H04A 3L7JA 3PC8A 1VG0B 5PNTA 5KKCA 2ZI9A 4HI0E 1J4AA 1I01A 3IV7A 4J91A 1RM0A 3AOEC 1AURA 4KGZA 1ABFA 2PUJA 1UBKS 4MVJI 5BQXA 2VRCA 4Z1MA 2W00A 5GONF 2AFVA 2LNDA 2QY9A 2W37A 3U60B 3LQ2A 1N2CA 4HZIA 1JHZA 1CR4A 4TRRA 1IRIA 2BMFA 2G0AA 4IR7A 3NBYC 1TZMA 3UB3A 2I3ZA 3LLCA 4HPJB 3GW8A 4DUPA 1KDTA 2OYRA 4H7PA 4H9GA 2JAUA 3CB4A 4LNUA 1YJCA 3SZOA 2AYXA 2ODTX 3SZGA 2W6JD 4AYWA 3PFHA 2NU6A 2J0UB 1Z3IX 2POCA 1ZD1A 3A6ZA 1RYZA 2GM9A 3OE4A 4ND6A 1TQ2A 4EA7A 2QLTA 2RJ3A 4G0QA 5E2AA 1D8TA 1BDIA 3FDZB 1X74A 2GZDA 2JI7A 4ZQCB 4E03A 3F46A 3DLAA 1LSUA 1SHUX 4GXNA 3O03A 4LN1A 5I01A 1H2AS 3AJDA 2X8JB 3I9NA 2ZDQA 3LSYA 3TKYA 5GZ1A 1NM5A 5JCJA 1SNYA 1DDIA 2L17A 4ZAGA 5HF6A 5AI0A 4X64B 4LVNA 4F93B 3JQAA 3D81A 3WMGA 3HADA 5FPKA 3BRQA 3EK2A 4AG3A 1TPYA 4TUYF 2J32A 4OAQA 2JLAA 3GZ4A 5B3AA 2ZT6A 2Q8PA 5J3JA 2XUHA 2YIJA 3GIDA 1QU3A 1OXVA 4TMTA 3G13A 2OHIA 4QUAA 1RZRD 5ALRA 5KOJB 2VJQA 3GUYA 1NVMB 1KYVA 1E1CA 3WK6A 2Q5OA 5EJ4A 3C7DB 2R7AA 4PU0A 1SBCA 2O7SA 3CHYA 3OHMA 5LCXA 3MEQA 2G72A 4M21A 1BDJA 5EIEA 5HR5A 2RAVA 5L3RA 5FF9A 1VI6A 1RQPA 1D2CA 5EERA 1D4AA 2CMGA 2H2GA 2R62A 2OBFA 3JASA 1Q2UA 1UBMS 3ET5A 3FIUA 3IP7A 1A50B 3S40A 3THSA 4CCSA 3ILXA 5K4HA 4XTRA 1T3SA 2NPIA 5LNK6 5FWNA 1Q14A 2C88A 2O06A 2QBYA 1ZA1A 4A8HA 5K03A 2ZJ8A 3TPZA 2WZBA 3BMCB 2CBXA 4JUBA 3ICCA 1RKUA 2X40A 4HF7A 5TMEA 3RLFA 2HUNA 1P4HA 821PA 1BEZA 2OHHA 2A5JA 2HMWA 2O05A 4LA4A 1RXEA 3LP5A 5EJMA 4YDQA 5JJCA 3BD8A 1KRWA 1A4IA 2KJQA 2JLRA 1MVNA 4L4UA 5BQ5A 4O4IF 4JLJA 4WOPA 4UZSA 4B71A 3SJAA 2PNFA 4AY5A 3HCBA 2VT2A 2XV1A 5LR6A 2JA1A 2BFFA 4Q3LA 2CMKA 3FWPA 2IHVA 4G1BA 3FY4A 2V0CA 5BWOA 4H7FA 3AMVA 1HMPA 1SELA 3ZXYA 4UHCA 4LYGA 3L5KA 9GPBA 3TMYA 4P80A 4QC2A 1PZEA 3N3AC 4IDEA 2V03A 3FFAA 1O0SA 3FVTA 3PC3A 4LV8B 4M8KA 1FXSA 1XFAA 2R6R1 1O87A 4BY9E 2ZBQA 4D81A 3WYAA 1U0LA 1LV7A 2REXB 2WF8A 3DT8A 4M83A 2PR7A 4R4JA 3QWAA 1PTJA 2O14A 3RVQA 5TB5A 1OBHA 1CPYA 3HCEA 4BB9A 5ICMA 1YF3A 2V7TA 4GKJB 5GJCA 4U2DA 4L0CA 5BN4A 5EMHA 1H1DA 1RI2A 5DYGA 4BO3A 3FTNA 3VOAA 3C1AA 4XA8A 3LBNA 2Y9PB 5IXYA 5IVIA 1J0CA 3I3SR 1WRBA 4GMXA 1IHXA 1LW7A 1OLXB 4R1LA 4XIJA 1SXJD 4FDTA 4LBWA 2WD7A 1ACJA 3RGGA 1WF3A 4LWZA 1COWA 5HS6A 5M2QA 1G42A 2Q0SA 5JAHA 2Z2YA 5HF8A 4YV7A 3K6KA 3RFUA 3JYOA 3OTHA 4GKKB 5BVHA 4UULA 2E0IA 3NAQA 2RGGA 1IHDA 2ASVA 2DPMA 3KJIA 3WQSB 2C0QA 4DZRA 5F23A 1BMQA 2AG1A 3AR7A 4G9EA 3RRNA 1O95D 2WQ6A 3KIPA 2YBDA 4DIUA 2BKUA 2NQ2C 5LJIA 2B21A 4N6GA 3OC0A 4TN5A 3ORHA 4BO0A 3AQIA 2XNDD 3CF4G 4I5DA 1JWBB 1TUIA 4JP2A 1UXOA 1GQRA 2FJ0A 5DBHX 5FPTA 1M2WA 3RV3A 4BP1A 5C8YB 4FD3A 4HWPA 4IDNA 3VO2A 4GLJA 1LVGA 2Q8QA 3DR5A 1ZN9A 1D4FA 4RJ2A 4UM8B 3AVYA 3MVEA 5EYPA 1QNLA 1U9JA 2BSXA 4KV7A 5KNDD 2QU8A 1ZPDA 4MW5A 5IN5A 1YQQA 1Z8NA 4WN9B 3HN7A 5CM2Z 3QPCA 5DOVA 2C9CA 5MFZA 5JBIA 4CHGA 5BR1A 1OROA 2JGNA 2WIKA 4BO1A 3DOJA 2OBYA 1AGRA 4FFRA 5T8KA 4QU9A 2ZCVA 5B55A 3DT9A 4MXDA 3CF2A 1V41E 4QXQA 4ROTA 5BXYA 1LVUA 2CLFB 5E9JA 1F9AA 1HNXB 1PR2A 3AONB 5AVSA 1Z4LA 3LWBA 2D54A 4GX5A 3W3AA 4M0FA 4UBJA 4HWSA 4ZXFA 3LT5A 3UT5B 3WR5A 4CFZA 5FBVB 1Z8DA 3ESQA 1A9SA 3K9NA 5KTTA 4K6KA 1PVDA 1XQ9A 2HXGA 4QOIA 1ZA2A 1WIWA 1T5OA 3G5LA 3IOBA 4L57A 4R1QA 2QT0A 5FNVB 1HBJA 1X13A 2QAJA 3A3OA 5EVJA 4JS0A 4DAEA 4IGKA 3KB2A 1UXIA 1RQ2A 1DSSG 2UVPA 3R3WA 1O5TA 2AF4C 2YRWA 1J2JA 4B3TB 5F9HA 4BS9A 5JCOA 5M29A 2VAPA 1VPLA 1G1MA 4M1ZA 4H2DA 5G4KA 1R00A 3HL0A 3NI2A 4MWZA 1ZMXA 2CZCA 3DBHB 4I4LA 5CNMA 3GT4A 4G07A 5JDIA 2WDPA 4XUCA 4DCTA 5JPCA 1H5QA 4EI9A 3K35A 1C1XA 3DOCA 2BP7B 1G3UA 4OQYA 5I47A 1GL9B 2AW3A 4GLLA 4M9RA 3HNOA 3GNLA 3JARA 2P6RA 1JSZA 4U5QA 1DARA 4MS1A 1X9IA 3USZA 4FMCB 2FEMA 4V0OA 3V4PB 4OQQA 1DQSA 4LF4B 4F46A 1CDZA 1G5FA 1Q1AA 2RKWA 2YHSA 2Q5EA 3EEFA 1V47A 4KXWA 2WWTA 3ZEAA 1DO2A 4TLAA 2NUPA 4CFYA 3RT1A 3PNVA 5IYZF 3TSAA 4R9SA 3VX3A 3R7LA 3N05A 3H6KA 3RDPA 1IM5A 3ZNPA 2FU5C 4NK4A 5BNTA 3I8XA 5J2UB 3JATA 1GGEA 2BFOA 2ZJ4A 1A95A 1H3FA 2R66A 5CEJA 3MC1A 1XEXA 2YV1A 2PBZA 3E9MA 4J9VA 4ARSA 2O9JA 3BILA 2NVWA 1WBDA 5TT0A 1E0AA 1GPAA 2G67A 3R4CA 4X1IA 2OCYC 1G8MA 5IVHA 4AY6A 1P62B 4TXLA 4LIPD 1T9CA 4CODB 3PQ8A 1CIPA 4QJBA 4BQPA 1JQLB 4GZ6A 4BWYA 3CNBA 3UKOA 3PTAA 2O7NA 1LKZA 2FZ5A 4I1RA 5IJ0A 2L69A 2M1XA 3EFEA 1V8PA 1U81A 2JCVA 2LD4A 3PEEA 1AQJA 1ECCA 3F6EX 3ADKA 4QVGA 4RE5A 1ZVJA 3CU5A 2C3YA 1YRLA 1SY7A 1CDEA 3DAFA 3SXUB 5COQA 4PS0A 5T6BA 4FW8A 3EZFA 2LGJA 4KPUA 4L3VA 4PSUA 5TY0A 1EZZA 1JFLA 4GPBA 4PPFA 5ALMA 1MJHA 2BLLA 3I2FA 1ZY2A 4AX4A 3CZCA 5E6UA 4PFJA 4CIXA 4N3NA 4AU1A 2Z4SA 4PZYA 1U28A 2G7ZA 3FE2A 1JQEA 1U8YA 1ZR2A 2C0PA 3T5AA 3BIFA 1Y63A 4OB8A 4EX7A 1IBCA 3A70A 1CUWA 3B3QA 4IL5A 4KQ2A 3BERA 4NHEA 4NQZA 4DFDA 4B5LA 4K03A 5IKEA 3VYSB 2PBRA 4J0CA 1Q84A 2QGFA 1CLUA 4P35A 1R0SA 1QGOA 4EB6A 1BX3A 3PXXA 3E3AA 3GA0A 4MW7A 3KOZA 4M0EA 2VPYA 3WDMA 1PK9A 5JADA 3GEHA 2EZUA 1R0CA 1UC5B 2WNHA 2ZROA 4RKWA 5F5LA 4A16A 1A7UA 2UYHA 1N5LA 1RKBA 4MO2A 2VXOA 2JFVA 2R1VB 3CXRA 3W6ZA 2HXYA 2WF6A 5JTTA 4ZZ0A 4OHWA 1PJSA 2AKYA 4R9RA 5FL7D 1RYNA 5CDHA 2JK0A 4US1R 1M7GA 3ZHYA 1IN6A 5KYXA 1AJEA 3PL5A 3WGUA 3EMBA 3CZAA 3PPYA 4J4HA 5CCEA 1HQDA 3LYAA 4L5JA 3W4KA 3WXBA 2GYYA 1XLVA 3GELA 1C3OA 3N0TA 3W7AA 1QJ4A 2X8BA 4V2IA 4BOYA 3G0CA 2AZ4A 2NO5A 4H1VA 3JZIA 3DEKA 1IFXA 1PJBA 3L4BA 3OPYI 4AKGA 2V3WA 4PG5A 4OGFA 3MWDB 4O33A 1SHJA 4HAXA 4HNSA 5TE9A 3WXMA 4V02A 2EEPA 4CQLA 2E4UA 4BO6A 1ZL0A 3TLGB 1T3GA 3K3PA 2R86A 3RFXA 2G0NA 3Q41A 1J06A 4YJGA 3NOVA 1P5FA 2P2GA 1A72A 1T1IA 4NK5A 1TDJA 6NULA 1G3MA 2IOYA 2O3QA 3A58B 3E23A 3FPBA 4ZRNA 2IV3A 2QRMA 3WYGA 4F2WA 2YY7A 5CEFA 3PV0A 5IU6A 4LF5B 4FILA 4M54A 1V45E 4LYDA 4KIGA 4KSCA 2ZG6A 3C98A 3G17A 1CR6A 1TVCA 1WHTA 5I45A 2AUMA 3FIJA 4XR4A 3TZQA 5CFQA 3CKMA 2K4MA 2WWFA 3HCDA 2X8LA 2VDNB 5EZSA 5CB4B 1KE1A 1HZZC 1XLTC 1IJKA 4S1PA 5HQ3A 5AQ1A 3T7EA 3DNMA 3A2KA 1DDGA 3NWBA 1O4VA 2R11A 4HKTA 3WLKX 5CXSA 2QIPA 2ZBPA 1OYWA 4AXBA 3DLTA 4Q9LA 1SCIA 4YHHB 3T5TA 5J5CA 3DHNA 4YB8A 3FB4A 3U7QB 3UICA 3GEGA 3NATA 4YMTA 1MOZA 2QVGA 2Q4OA 3A6FA 4PO1A 1AK9A 3G59A 4NZ9A 4PZEA 5F12A 1ZM7A 4HAYA 3NVMB 4YWHA 1SA0B 1DT5A 1UBSB 5COBA 2C2MA 1B00A 2ZK7A 2R8EA 4W1PA 1ZM3A 2ATCA 3IPXA 2VNIA 4GOOD 4HSGA 3RS3A 2BGMA 3N87A 4E2XA 1OBVA 4JI6B 3VR5D 1DBQA 3QPBA 4GOND 4ARUA 4KO4S 2EZTA 1IUKA 2H8GA 4LRQA 4EYGA 4N1AA 1M8PA 2IUTA 4KIFA 2P1ZA 3VNQA 1JWAB 4UTPA 2LVBA 4WXPA 1P4SA 4EJSB 2B98A 2XUJA 3TLXA 1JBKA 2EU8A 5CFRA 3AY0A 4BNGA 1GUZA 1S4QA 2Y0BA 3H65A 1C7QA 1HOTA 1U2EA 1WDWB 2W2NA 2XY4A 3RQSA 3TR6A 4DTIA 3EBPA 3ZHUA 2NOAA 4HMOA 1Y34E 4RY2A 2C5HA 2X4LA 4JBYA 5FDFA 2C7RA 1VE9A 4DIOA 1OD6A 2P4QA 4R2IA 5GGXA 4BZZA 1L1QA 1NXTA 2XQKA 1ETUA 3VISA 3FDIA 3INNA 3KQTA 3MRSA 2YIMA 4AMGA 1M2VB 3AIMA 3OFJA 5E0OA 4Q1BA 2R60A 2Y99A 1UKAA 4JL8A 5IWCA 4KCGA 5H5JA 3EGCA 3SXPA 1AG9A 3EYWA 4JYPA 1FE8A 5JS2A 2OHGA 5FPPA 1Y4UA 2R6AA 5TGZA 1NYTA 5IS2A 1PGOA 3LLVA 3W6NA 2BH2A 4RHTA 3RYHB 1YQXA 2C5GA 5IT9A 3WRWA 4CF4A 2C54A 2PUEA 1EX6A 1HORA 1KFKB 4P2GA 4PSAA 3HJAA 1JHMA 2PLFA 2WTAA 4L4SA 1RTKA 4NZZA 4LXGA 4C78A 4IIYA 1HURA 1FX1A 5TF4A 1P4RA 4FYKA 1O08A 2GD6A 2Q2NA 1IUOA 1U63A 1P31A 5LP6C 1OZHA 4RF2A 5AH0A 3D0KA 3WTBA 4QREA 1X3SA 3BMOA 3H5LA 3M5DA 4X5OA 4Y2QA 5CH8A 1CY1A 3VSCA 3BXPA 4LWOA 1NQUA 1PQPA 5DI3A 1GRNA 4WFQA 1XA3A 4XLTA 1IPHA 2KHZA 5FO0A 4ZC8A 4D98A 2OBXA 2BYTA 3A6GA 4F2PA 9LDBA 4PQYA 4BCDA 3GZNB 2R8BA 1WDKA 4URZR 5BW8A 2QJTA 3MFQA 5D1HA 5DHQA 3EPPA 2XE6A 4QU5A 3BRSA 4GX1A 4UQOA 3ZQJA 3HN2A 1RBQA 4TS9A 1B6TA 1OI3A 2Q3CA 2P75A 4KH0A 1JYEA 1DTWB 1R5BA 2A33A 3NHWA 4RK6A 3TD9A 5J1SB 3CVVA 3F1KA 2AMVA 2WIJA 4H6WA 4R68A 4XASA 5HILA 5AUNB 5K0TA 2PCJA 3DHYA 3E4CA 1I7PA 1KK1A 3BJMA 3FUXA 1N8SA 1KEUA 1Q83A 3FPCA 4QUDA 1T0JB 2QYHA 3F3KA 1C9JA 3BFJA 4U6QA 5FEUA 3OF5A 2OR3A 1U2GA 1Y8CA 2HO5A 3CUEF 8LDHA 5AK6A 1I1OA 2A5DA 2K5UA 4YRQA 2WAXA 2YV5A 1XMQB 2QVCA 2ZAOA 3G68A 1PG2A 1YZLA 3VR5H 4C06A 3KYBA 5IAEA 3CJTA 4I55F 2DHRA 1L9KA 1GPH1 3MELA 4C43A 5KWEA 4C5CA 2P35A 2D7JA 3O8LA 4JT4A 4XPIA 3KT0A 4MDYA 4WD3A 2VIIA 1T5LA 3UMJA 5IDXA 1JMVA 5I4BA 1R8XA 1SUFA 3B70A 3W2GA 3KEQA 4IHKA 2J6IA 3W2HA 5FAXA 2ZIAA 5ITWA 1LBQA 5KPJA 4E13A 1N2HA 2GKGA 3RRYA 4BBJA 1H5NA 1TX4B 3HB1A 9ATCA 3CRRA 1YOVA 2NTEA 3DDOA 3I53A 4BWVA 1CQIB 3I04A 5KYYB 3EG5A 1ZK3A 1N5KA 2QRHA 4NZMA 4WESA 1Y6RA 2KI5A 1IHOA 5A71A 4CM4A 1W85A 1GZVA 3OCZA 1YQUA 2HF9A 2Z8ZA 4LZWA 2ZDHA 1SKYB 3F5FA 2XQJA 2IYLD 4HS4A 4MCAA 4KWIA 4L6AA 4ND5A 4PANA 3UGKA 4MARA 2O3TA 3BEDA 1CY2A 3QXGA 1QANA 4X6UA 4NYMR 5CAEB 4YTEA 5MN5A 1DOHA 4K81B 2B5WA 2C2ZA 3M6IA 4XSGA 4ERXA 1PZXA 2XXAB 3I5UA 4RTJA 1IHUA 1RJ9B 4OJKA 3MJDA 1NFQA 3V9PA 3ROXA 1L9XA 2P1DA 1IG0A 1R6UA 2P4SA 1A5AB 2QTVA 1BSVA 1UF9A 5EZQA 2QD2A 1AQIA 3T5GA 3E7WA 5IJ9B 1FPQA 2GRAA 4HX5A 2FK7A 4JIGA 2HR1A 4W6QA 2FNAA 1D6MA 5TF0A 4AN4A 4B33A 3QYFA 3WIDA 3R6TA 4NBSA 1ZBQA 1RABA 2UUAB 1FFAA 1ZEMA 4MV9A 5KC9A 4JUIA 1DWPA 1CVIA 3GAAA 3JQBA 4QNRA 1UCFA 4ZDWA 4AYXA 4BV8A 1KOJA 1VOTA 5JISA 5KMGB 5ALYA 3EZ9A 1FY2A 1U3DA 2BFBB 1WCYA 5EQJB 3KSAC 1K3FA 2OORA 1LNSA 1SHLA 5K0BA 4FE4A 2F6RA 1N0UA 4NFYA 3FW1A 3LXRA 2NO1A 2HZ7A 4GPEA 4N7MA 1VM6A 1VP9A 2ISQA 4BP9A 3DFUA 2O0MA 1NIPA 1E2QA 1GRCA 1SURA 4G6ZA 3DEIA 1FMTA 1K5DA 2RHRA 2FR0A 3A28A 3EVAA 3EQ9A 4K6OA 5K6TA 4XCVA 3LUFA 4WNYA 2B4KA 2Q62A 5BN5A 1Y8RA 1C8VB 1P8JA 4GBMA 3SQXA 4REQB 3GLGE 4RPJA 4M0UA 2VCYA 3RVDA 1XA0A 1QH1B 1UANA 4TTVA 2X2PA 3MTGA 2AGVA 3DL0A 3PNMA 2G71A 2ZUWA 2KB0A 1JEAA 5LZ9A 3QU2A 2DHDA 1KDVA 4EELA 1ECGA 5I9IA 2I91A 4G1EB 4HNAB 4JSYA 1EP9A 2HQBA 3QY9A 3ZZ1A 2Q2QA 2UAGA 3KE8A 4TT3D 3EZGA 4ZPJA 2OO5C 3ZOZA 1ODFA 2EHDA 3BGSA 5LD2C 4C5BA 1JDBC 1G4UR 1JVSA 3U3KA 3GNTA 5FI0B 1WUJS 4PNEA 5C8XA 4Y1RB 2G76A 1ZIOA 2IYNA 1TRKA 4ASUD 4QVIA 1WZCA 1U3GA 3QWBA 3WTCA 1T1EA 4Q9JA 1G7SA 3AFMA 3ORSA 1Y37A 2FLWA 4NZPA 4KYUA 1J42A 1FXWA 4L8YA 4UDYX 3RRBA 1W87A 2X3YA 1HYQA 5CW2A 1TM4E 4A8JA 3CRW1 3FWHA 4ZN6A 1JXOA 3D6UA 4ZEMA 1GTMA 5A3RA 2GLUA 2YJ6A 1C4OA 3HVJA 4PCLA 5FI1B 3ZE0B 4DDMA 4JX9A 2R7NA 4Q1CA 3RO7A 3FXAA 3SFTA 3NKLA 3ZCTA 1WCWA 5GTDA 4ZI5A 1FQWA 2XADA 1JJ7A 3C8DA 3FSEA 3SYKA 3CH6A 4BLVA 3KQSA 1PN3A 4WVFA 1QRRA 3JXEA 1AV7A 1C4XA 3AHFA 2VRWA 2FYTA 3V8BA 1GNPA 1H0SA 2F17A 3AU8A 3PS9A 1XMVA 4I4TB 1XTQA 2C83A 5H0IA 5BWMA 5HVNA 1G1AA 1IXRC 2R5NA 3ICPA 1YAJA 3VYVA 2D74A 1YU6A 1KERA 2H85A 3P32A 4L4YA 4C3VA 1BVHA 3MT8A 3PIIA 4BMVA 1E5XA 2YC4C 3U2QA 4IHAA 2IU6A 4QHTA 4CTOA 4L07A 2CXNA 3LUAA 4WK0B 4BFLA 4A6EA 5JS1A 5B7NA 2KYRA 3LW7A 1A9XA 4R40A 3K20A 4CR6A 2GJSA 2EW1A 3QUSA 1JVNA 4W1SA 1S2LA 3L7KA 3TOZA 2ZIFA 4FFPA 3D2AA 5TNXA 3GPIA 1YS4A 4EAAA 3PC4A 1J8DA 1Y8QA 4ZYZA 1FTYA 3P2EA 3GL9A 2Q3MA 4HG2A 3STHA 1R0YA 4BAZA 3PDJA 3IT3A 2CGEA 2FWJA 4BDSA 4U7WA 1KNQA 3E2IA 3RC9A 1FSPA 4RUKA 2V7QA 3LWNA 3PDIB 1AKMA 4QDUA 1ULSA 1IUPA 4HZUB 2WJIA 1PCXA 2XDAA 3CG0A 3HZOA 2RBGA 1X7YA 4O4LF 1E5TA 2EP7A 1WBJB 3T7SA 2P5YA 5A4FS 3R0JA 4EECA 2ZANA 3EFOB 5F1OA 3SFVA 3EGXB 1NMEA 1O96A 4DR5B 4J2HA 4QOSA 5TJ9A 1NVVR 4X41A 1H4QA 1W4LA 1D2HA 3TLKA 2CUNA 2TMYA 4KLNA 3LHSA 1X2BA 4WSOA 4I3FA 4J6EA 2DBZA 4PAGA 3IAS1 1Q0ZA 1TC1A 5JHGB 5IM4A 5JO9A 1C8BA 1NLZA 1GQYA 1GPNA 4U2CA 4CHTA 1Y48E 2SKDA 3GRPA 4ITUA 1LBEA 4X1OA 5EJFA 3SZ3A 1W0KD 3TOXA 2WT4A 4MW1A 4D0LB 1W36B 1GRRA 4NL4H 3TW8A 4QGSA 2VTVA 4AO8A 4ZT3A 1GZSA 4JKYA 1LDNA 1KFJB 3TZLA 3ZG6A 1NLUA 2BFNA 3X1KA 2JZNA 2IXBA 1SVOA 2NWQA 3EXIB 4W4TA 1T24A 1V16A 3HXOA 3AY7A 3B78A 4MRAA 3IRUA 3O82A 2LV8A 4FM9A 2FG5A 1W0CA 4MVYA 4EFNA 4H7IA 3NBXX 3H2BA 3Q87B 4DV7B 3ND6A 2A5GA 4CTJA 2ORED 1ZS9A 3DMYA 3KKOA 1CJBA 3FCOA 2YYAA 5DLYA 3AX6A 1JX6A 2V9ZA 2GBGA 2NM0A 2OWDA 2X6TA 3CNOA 1X39A 2W2KB 3QFTA 3RBVA 5EWJB 5E9WA 4C7XA 2HA2A 4WNIA 2P68A 5GMOA 1SK9A 3WHLA 1OYVA 1R8JA 6PFKA 4KPEC 4NU8X 3OOHA 1YA6A 4C6SA 1Q6YA 2I7VA 1J1UA 4ND1A 1FU8A 5MGNA 4G0YA 4TLMB 1Q0QA 1C1DA 5ETJA 3NTUA 4LDQA 1V3QE 1XMOB 2IGBA 2REQA 4GBED 4J4BA 2YVAA 1VHTA 5IHPA 3H3JA 3GHYA 3M9XA 4PLVA 4E88A 1DU4A 1C7IA 1SQ5A 2PWPA 1NBIA 2PX3A 2ZULA 4B6FA 3D2CA 1VFNA 4GR9A 3A04A 1DG3A 2ORVA 1Z5PA 2Q2VA 3R6LA 4FS8A 4H0NA 5F7JA 3CX8A 4QAQA 3KXKA 3PHGA 4LE1A 1ZOLA 4CKXA 2WM9B 3DCIA 4KDRA 4JC5A 5AXAA 2YFYA 3NBMA 3FNRA 5EFOA 5ILOA 2Z5VA 1TMOA 1ZH6A 2VDWB 3CF0A 3GB9A 1ONSA 2GM5A 4IEFB 2FPIA 2WIBA 3C8UA 3LHFA 1Q11A 1ZGZA 3O8DA 3QPWA 3ONNA 4J7UA 4NJMA 2IYXA 2ZB7A 4K46A 3KO8A 4E09A 4QPPA 2X3UA 2YMQA 4FLFA 1SUCA 2PGDA 2YWXA 1QHEA 1EB8A 3B53X 3GT7A 1X7ZA 3RVRA 1G9TA 5M04A 3FJ1A 2L42A 3L82B 1ULZA 1IULA 4IIGA 4HVCA 2DLCX 3AERB 1YJ5A 3CPSA 5KB3A 1FFEA 3HU5A 2OXTA 1Y0BA 1NOKA 5DCYA 2B83A 1M0TA 1S7GA 4HDMA 4L22A 1RD4A 3HDJA 2WSLA 3M0EA 5JFOA 4PC2A 1BQ4A 3RROA 2JCBA 3H97A 4FFSA 3V32A 2NU6B 1JHRA 1Q1NA 1X1DA 4LGVA 1ZH2A 5B7QA 3FGZA 4OUKX 3RUDA 4B3DA 2DEUA 1CUBA 4D45A 2E21A 2FN8A 4XM2A 4I50B 3OIFA 1GUFA 4O3FA 3SU8A 5C31A 1NW8A 1IM2A 1SU6A 4FE7A 4ERNA 2ZS9A 5FQOA 1M2NA 2HCTA 1NN0A 3DD5A 3AEQB 3ORQA 4MWDA 3PEWA 2OXRA 3T52A 1M72A 2WSIA 5JVDF 3QLTA 1XZIA 3JAWB 2BEUA 2JRCA 3FN4A 4MQ6A 3GLHB 2PT9A 2YNMC 3OA0A 4G0MA 1AN0A 4WV3A 2K7ZA 1SXHA 1VG8A 4YT5A 1SCDA 2J3KA 4B7UA 3V1NA 5KEIA 3OU7A 4F5WA 4NDAA 4FD2A 2HY7A 1IY8A 3NDRA 2H06A 4J1TA 5L40A 1C7ZA 4OU4A 4IW3B 3NEPX 2GCIA 4PC6A 3IR7A 4NAHA 1EVKA 2NTVA 1OKKA 4M7OA 3B6KA 4ZKEA 4DLZA 2P69A 4NOLA 3EXHC 5JZSA 1Q21A 4FSHA 2GS9A 3G5TA 4JT8A 3COSA 2D59A 1WLSA 2ZRFA 1JV2B 5AESA 3QK7A 3AUXA 3GBPA 2L82A 2VJAA 4OP2A 1PZNA 2Z1MA 3CR3C 4KHPB 1BROA 3CPHA 5AW9A 4CLEA 2O2EA 1QMGA 2RAFA 4XVHA 4F06A 5EZYF 5HTKA 2ID7A 3K0AB 1K6EA 3DVLA 1YE8A 3ZK9A 4B76A 1IMJA 1XTSA 3PXUA 3EUAA 2GZHA 1G8JA 1ODKA 1UKVY 5BVGA 3HNRA 1U9CA 4NIMA 2W6QA 2IU0A 1VG1A 4ZO8A 1MIOA 4OSOA 3LCCA 5LB2A 2XNHA 1ZJJA 2EJBA 3L8YA 4CMEA 1J99A 4ENQA 3WMXA 3BB3A 3VJRA 3DAHA 4UMDA 2R8ZA 2VTBA 3ZCRA 1ZXBA 2WNSA 4NCBA 3CNNA 2ACEA 2SNIE 4EY3A 1D6NA 3I5YA 5CDFA 3TNDA 4AZVA 4I99A 1Y7IA 1Z2CA 1FTSA 2YDXA 1GSHA 2DH5A 2QPTA 2HQOA 3AOEA 1QV6A 1R6DA 2AMYA 2W2LA 2BFEA 1R0RE 4ODIA 1EM6A 3JQ7A 4GAEA 4R7GA 4F4UA 1Z4NA 3RS7A 3VM6A 3ED5A 2WT8A 2O1XA 1TVEA 2JD1A 5BUSA 5LYYA 4J75A 3RNLA 2JFYA 1SZCA 1WU8A 1T4GA 1I2MA 4UTRA 4G8CA 2OESA 3KJEA 4C07A 5ABPA 2EX0A 2IWRA 4GRDA 1J1ZA 1RMQA 1ZD2P 4CTKA 2DWPA 1L4YA 1KC3A 3CT6A 4TTJA 5FTLA 1KPIA 1Z6XA 2R85A 1XAJA 2BGLA 3BWDD 3TXAA 3ST7A 3IOEA 4X7BA 2J8ZA 1YDFA 1F17A 2YWDA 4M98A 4CIAA 5I7HA 1REQA 1RC1A 1T8YA 5GZ6A 1USIA 1AQLA 2G36A 5F76A 1HY3A 5D01A 1JDTA 1T1SA 2WKSA 1OAAA 3H1BA 3KDPA 3ULKA 4ZV4A 2HHHB 1GZ5A 2FFQA 1P61B 2Q7DA 3AEYA 1E96A 3B9RA 5AWFC 3BMNA 5JRDS 1KYXA 2M6LA 2E87A 3TQHA 5KTKA 1TKCA 2FWMX 4D43A 1W25A 4QICA 4Z86A 4B4DA 1Z5WA 5KVVA 3V5NA 1S3SA 2I7CA 1BMTA 3VSAA 4OL9A 3H5OA 3D6AA 1NNI1 3SC2A 1IDOA 3EXFA 3QVWA 2DWQA 4E33A 1WY7A 2PH1A 1OTXA 2P0AA 2ILVA 4FDUA 4I1IA 3W05A 3MCWA 1DAOA 1LJLA 4G9BA 1X80B 4J1NA 1KNXA 3UJ3X 5C1OA 3AW8A 4DMLA 1TJPB 2BRUC 2DRIA 2PJZA 3B6MA 1ZJWA 2GLXA 4YRMA 3TRKA 3VKUA 4GQIA 2H3EA 4K3VA 2VPIA 3EDQA 3FDFA 4A2WA 2V8BA 1W93A 3CRQA 3HGQA 3M6UA 5JAMA 3QX3A 4QXAA 3S2GA 1BW9A 1R16A 3MB8A 2FW1A 2OAQ1 3KLNA 5LYJF 2ACVA 1JR3A 4RDXA 1SBHA 3HKBA 5B1HA 2Z0MA 4D1YA 1GEEA 2OD7A 4WACA 1VXRA 4E11A 1T8PA 1Q57A 4RZHA 3PP8A 3EGVA 2V8OA 3HR7A 4E2WA 3FWKA 1R4NA 3VC3A 2JBWA 4MOWA 1XCOA 2D5BA 4J94A 1KOFA 2XCSB 4R0MA 4PZCA 2C2KA 3DE0X 4XYEA 4DDHA 1YJQA 1IEWA 4OHZA 4MP8A 1MR3F 3CIFA 3ZBUA 2B1RA 4C6TA 4DNPA 3AM5A 3BCUA 2AKEA 2NO0A 2ZUEA 1UAAA 1GA4A 4TTAA 4PBRA 4BU0A 4M1OA 2QPLA 2HLPA 2XE8A 4NQRA 5EXSA 4C6RA 3P5SA 1L3IA 2E7ZA 1PKEA 4RIHA 2ZJ3A 5B5SA 5C46F 2ADFA 3PDUA 3F1LA 3GO4A 1RAEA 4C76A 4BP3A 2B8NA 3BH7A 5A3VA 4PGAA 1F6WA 3TLEA 1BJKA 3AF2A 4MP3A 5G4KB 2BR5A 3PICA 4Y6QA 5JASA 3W2TA 2V45A 2FMHA 3L8MA 1C2TA 1A71A 1ZUNA 5A03A 5H4GA 1GTSA 3HDYA 3IAM1 1AQYA 3LT1A 2H17A 3VZSA 2ISSD 3NKFA 3W06A 2O4CA 5A2QA 1Y3CE 4AZ0A 4UJ5A 3ZWDA 4EEKA 4R81A 2XDQB 4GBJA 3QHAA 1CP3A 2J3MA 2Y1GA 4M38A 3S7TA 1RPJA 3BAFA 4HB2A 3VKHA 3ZY2A 3G2NA 1EE1A 3K1AA 3L0OA 3L92A 4EKDA 4N5IX 3BDIA 3KQLA 2IITA 2L0XA 3MRXA 1L4LA 1TM5E 2OSBA 4PLWA 1FB5A 3VR6H 4DCUA 1OFGA 3SDSA 1R5JA 2OBNA 2CK3D 3JYHA 1Y81A 2V55B 4RL4A 1Y9DA 2VEDA 1Z26A 4NYJQ 1WETA 3R9XA 2DX7A 3KZ1E 4Z8YA 1W4AA 1JYSA 3MM4A 1TADA 3AUUA 5GONB 3PD0A 5CFPA 1MGPA 4EYOA 1TIKA 4JLNA 4LXUA 4WL0A 3ISJA 2DP4E 3LUDA 1JYFA 2R8OA 3SEFA 4V3CA 2XKKA 4M46A 5AKLA 5HQTA 3ZY5A 1N6OA 1PW7A 1KVSA 1SU7A 2P9QA 4I3GA 4EKNB 3T3OA 3N2YA 1CNEA 4R8RA 4X54A 1NMYA 1K9SA 1IONA 1R0XA 1Y1LA 1YQTA 1GPWB 3DEAA 3KXLA 5IXSA 2W0SA 1BG6A 3MLBA 4RAQA 3SJBA 3L4EA 1V6AA 2C7VA 3LPLA 4KAFA 3U7EB 1VDMA 2C9OA 4ZCMA 4WBNF 5AK5A 1KTIA 5I9TA 3DA8A 2CHUA 4ZAFA 1LK7A 4JJKA 2B94A 2NU9B 2CY0A 3NUQA 4ZANA 5GADl 3H1TA 2WWYA 4QLBA 2Y0PA 2WJJA 3LLSA 2B25A 3T6KA 4HDKB 3SMVA 1C3XA 3HU3A 1NNLA 2CNNA 2HJ9A 4JC0A 1HC7A 2D0IA 2ODNA 1MAAA 3I0NA 1W8DA 4G4SP 2NUTA 3S5UA 3BWEA 4BFTA 3LFHA 4TUYB 3O4JA 3RAEC 3FHLA 1MT0A 4DLWA 2Z2IA 2J3DA 2VWGA 2GQ0A 2IHZA 3QELB 4MV0A 4PAQA 2H1LA 3T38A 1KWGA 3ZVNA 2HRCA 4ZYVA 5B2EA 3WADA 1QVWA 1NBWB 4K9QA 1XQ6A 1M1NB 3AT1A 2ZBGA 1TE2A 4F4FA 1DIRA 2FWAA 4DWOA 1A96A 5L8VA 1WV1A 2P9CA 1XZDA 3S68A 1L7EA 4DM4A 5AOBA 2HU2A 3MCZA 3TW0A 1EUDA 3KAJA 3LXUX 4HXGA 3HP1A 1DJMA 1UFKA 1Y3DE 1SWWA 3O4IA 5FLEX 1SB8A 1BVRA 1GT6A 4JU8A 5E2IA 3WDKA 5L4NA 5A0TA 1TCCA 1X92A 4FR0A 5ECDA 2IU4A 4HEA6 4YJHB 1CX9B 3B8EA 2FG7C 2GTIA 2CLHB 1AGYA 2A5FA 3GBVA 3H4IA 2OCKA 1K98A 4TWBA 1EFKA 5EESA 4J7XA 1MJFA 3UKJA 3F6YA 5JOQA 2VLBA 4TWZA 1VB3A 5FOSA 3W2EA 1KYYA 3D3WA 3O74A 3OD5A 1TTHA 1RYYA 2GRUA 2BFPA 1WCIB 4FGLA 3SKVA 5FBQB 5I7WA 2CVZA 2XMPA 2ZB4A 3R8FA 2QQ5A 4Y9TA 4QYTA 3DMHA 3QF4B 4Q82A 3RF7A 1SBIA 2FWNA 4O4IB 3VOBA 4BVBA 5DXFA 3CEMA 3S8EA 3P9ZA 4OMUA 3I45A 4LZLA 3SHWA 1MX1A 1QHGA 4L78A 4QOGA 2B34A 3ANSA 1A8SA 3DP7A 3OIDA 4QPZA 4KYTA 2IZOA 3E9NA 2D7CA 3HXLA 2Q3JA 1E2NA 4JUAA 3GPLA 5LQAA 4AS1A 2WKPA 1FBTA 3IAEA 4CL3A 3KJXA 2JGDA 3A37A 2DR3A 2P9EA 4WLUA 3RUEA 1YE3A 3FNQA 2CVOA 2WBLC 4K0KB 2LIPA 4WA7A 4WZBE 1O9GA 1MXHA 4DKXA 2XCQA 4EVIA 4RD0A 3BVPA 4W7IA 1V37A 2XB2A 3LWZA 3EY4A 5LJLA 5GIPE 3TXXA 3CINA 4KGDA 3PNPA 3V1MA 1VZ3A 3AIKA 3HN6A 3DHEA 4TV8A 1BDBA 5H82A 3JYQA 4A2PA 3KQMA 3KYDA 2B5VA 3C24A 3T3DA 3LY8A 1P2TA 2W6ZA 2Y1EA 4P4GA 1CUGA 4YLEA 2B78A 5HQ3B 4B85A 1JIJA 1GZ4A 2PSFA 4M37A 1QHSA 1XJCA 2Y2UA 1GFIA 3HBFA 1M8GA 1OVMA 1SU4A 2J9FA 4PGHA 5FOVA 4JAVC 4AP5A 4LECA 4PZ0A 4V3BA 4Y6OA 1R6VA 3F6RA 4YRDA 1L4FA 3RC8A 1EJ0A 4ECAA 4A5OA 1RE1A 2CFTA 4P34A 3TB6A 1FDTA 3TM5A 2AS0A 1W1WA 5DHUA 1W36D 1KEWA 4BO5A 1ENZA 3ORRA 5KQMA 5ENVA 3OP4A 1A4RA 1ORIA 5JYDA 1P29A 4JQOA 1Z56C 4TYNA 4J3JA 2FPLA 3FYDA 3I6MA 3LUPA 1GFZA 1B76A 1QRAA 2DWOA 4BVLA 2PLAA 1GGKA 2E1PA 3UM9A 5JFGA 1CJSA 2EYUA 3ED1A 4G5OA 1EP1B 1PNQA 1TGVA 3RVMA 3S81A 1CUDA 4YRCA 4RD2A 2Q9CA 3KVOA 2UYOA 3E8XA 3EN0A 4M1YA 4RSGA 2QG4A 2R6GA 1CF9A 1SXGA 1XXHB 5HXAA 1BH2A 1MKYA 1XZPA 3JR7A 1OF1A 3I61A 2KBEA 2AFHA 2QGZA 2QR2A 4U2KA 5JD6A 4G5FA 4DLTA 1KTVA 1FDOA 2H6EA 2XTAA 2OLEA 4Z0NA 4HNTA 2XWBF 4P33A 4DRYA 1Z0FA 2DUMA 4AVYA 1PWZA 2JDID 1QGUB 3ZQUA 4DIKA 3G0IA 4ZCTA 3BCSA 3URKA 2V3VA 3NDIA 2OV4A 2ATEA 5HRCA 1KZ1A 2ZJFA 3NPAA 4K2HA 4KQJA 2W43A 2LR0A 3HJTA 3LXXA 3TBHA 4CKBB 3QNUA 1RPZA 4ZIRA 5B12A 2V6GA 3R9IA 4FEGA 3L49A 1CB0A 1UDRA 5FWYB 4WZAB 3DAOA 4ATNA 2WINI 3K9GA 2I62A 2Q4RA 1WHSB 3GGSA 3LCRA 2JFXA 1DOAA 2XOKD 1FP4A 3GZJA 4CW7A 4FHDA 5EUCA 4U7DA 4J0GA 4J0HA 2QKYA 5T57A 5I9LA 1SUAA 1YKFA 2AQHA 2BHSA 2VDQB 4MVJA 4NNJA 4CTNA 2P3SA 1KJ8A 4F7DA 4BMCA 3LOPA 3KLOA 5T4HA 4TYYA 3KD3A 3ADBA 4BKRA 2PUAA 5EIWA 1J97A 1E2DA 2ECFA 3OFND 4GC5A 1NUHA 3NLLA 5D3QA 3S5JA 4UNQA 1LS1A 3WLLA 3QVJA 1MG0A 2VATA 3K7EA 4DT1B 1YXMA 1QLHA 3PHBE 1PV2A 2VSFA 3BJZA 5TPZD 1Y9ZA 2XD9A 1PR4A 5CW1A 2AC2A 3PFGA 4MCHA 3ZDRA 3I73A 5DGCA 1A8IA 2VQSA 2IIQA 1UOEA 4P7JA 5DMXA 3C6YA 4ALMA 1FOEB 1V2GA 1EEHA 3LI2A 2I76A 4M49A 2PU7A 2XNSA 2VXBA 1H2RS 3OLXA 4BASA 4FFMA 4XW2A 3ACDA 5KTOA 5H3CA 2O0KA 1JA9A 3WYEA 5BQPA 3NDPA 1L5ZA 5ITVA 5TIIA 2J45A 4X60A 2PGJA 2NXCA 1HZZA 1ORVA 1XLTA 3L06A 5EE3A 3MTQA 1N0IA 2XMSA 4DNOA 5DN6D 4BQFA 1U8XX 4E15A 1JR6A 1L7QA 2QE7A 3WHIA 2COKA 4TGLA 4GVPA 1Z2OX 1LPSA 1WPRA 2WUFA 5HCIA 2WB4A 3RSSA 3JW8A 1TQ4A 5IYZB 4XFKA 5ARCA 1Z7YA 2GN4A 4W5JA 1OFUX 2JHCA 3BK1A 1JAXA 1EX1A 3WVNA 2ZU0C 4W8GA 1WXIA 3BWYA 4JOBA 2DFKB 1PZFA 5JIBA 4JD5A 1X8LA 1MV8A 1X7WA 1P0CA 1Q7TA 1I6WA 3DZHA 3FA2A 3GJRA 4B81A 2OPHA 3NRJA 4F12A 4F11A 3QLVA 4K9KA 2UYYA 3REGA 1N7GA 2OMKA 4ZICA 3QKWA 3L01A 3JQPA 1R88A 2ZT5A 2J59A 3ZD9A 1QG4A 1OWOA 1YUBA 3QKUA 4IGEA 4LOHA 1KKLA 1J23A 3OSUA 5EFZA 1PFVA 1D03A 2P41A 4QUBA 2PQ6A 2PY6A 4WGGA 3KKMA 2Y9MB 1E0KA 1VHWA 1H2XA 2D0OB 2FRXA 3BE4A 4BNNA 1QIEA 2QYOA 2GZ2A 1E8NA 2WKQA 3LX6A 2C2GA 2VI5A 1YB5A 5JSHA 1DG1G 4KK3A 3ZXXA 4KAJA 1V39A 5E6SA 1I4EB 4FOSA 1KU6A 4OHPA 4ETMA 3ROPA 4BAGA 2HSDA 1D0SA 3QU5A 4OXNA 2O8CB 4UVGA 4MROA 3W04A 2BCGY 3WB9A 2PS0A 3KUCA 4D96A 4B34A 3ANMA 4DA8A 4F0JA 3T3HA 3F8WA 2B8JA 1K7FB 1MNQA 1OH5A 1Y89A 4FX5A 1UK8A 1VL1A 2KLHA 2P4EA 1F5SA 1DO8A 2V6MA 3C48A 3O8QB 4L5CA 2ZYDA 4I3HA 2F1IA 4Z4HA 2F1KA 3NC0C 2AN5A 1QHNA 3EGWA 1WL8A 3X1JA 4PZLA 1H6BA 4LDRA 3KVNA 4BTEA 5HW0A 1AQNA 4X1YA 1QRSA 3OY2A 1WUYA 2G4VA 3KQHA 1JDSA 5C4IA 3IYLW 2XZTA 2O2ZA 3LRPA 3E2PA 2E2WA 2GT1A 1PNVA 2NZ2A 1BJTA 4MCIA 4QDJA 4BKMA 4ETNA 1NFRA 1N2EA 4JLVA 5AD1A 4WIAA 4OLAA 1JFFA 3MIIA 2LPMA 1MTZA 1LF5A 4EJMA 4YAKA 4EKIA 3L8HA 3LPMA 2BJVA 3MMNA 3KJGA 4XDZA 1Y98A 2A7XA 4HQKA 4TZTA 2P9GA 2WWGA 4D9GA 1KEKA 1M5UA 1EFRD 1HFJA 1P80A 1TKRA 2M2IA 4YAWA 4R31A 5DGDA 4UBIA 1ORDA 2FUG1 3OX2A 1T0HB 5FYDA 4GDMA 3CG4A 2G6TA 1IOWA 4XTCS 3GGOA 1V1RB 3ERCA 2CLDX 3W9BA 3L1HA 4MIEA 1I13A 4MUGA 3LCMA 4QQ8A 5JFTA 1WKCA 3CLKA 1LBIA 2R8PA 4R9UC 4CIDA 3TLMA 2AJ8A 2FWIA 1SN7A 4HADA 3VTFA 4WCFC 4K6FA 2D2FA 2PRKA 2I6GA 2BMVA 3KPJA 2AF3C 3IBSA 1WD5A 4ZRMA 3JWJA 1XGKA 1FSFA 1LI5A 3FHJA 2CCKA 5EQTA 1SUSA 1ZI6A 2FZWA 4F85A 2PGOA 1PLJA 4F1WA 1A1VA 4UHHA 2ATIA 4EHIA 8ADHA 2BAGA 3GT3A 5A2GA 1ZJ5A 1SOWA 1KK0A 5BXQC 4XEUA 3DZKA 2V0NA 1HEUA 1BEEA 4BN5A 4PLPA 3UJAA 4CMJA 2BJHA 4NG4A 4OBEA 4D6YA 4IJUA 1EFPB 3S1LA 1JZTA 4LPSA 3AIIA 4MIOA 5KSPA 1P8AA 1XRLA 1CVRA 3EHDA 4HGPA 4D41A 1XPRA 4EPVA 1MO6A 3TJRA 1W76A 2V7GA 2KMLA 3RM3A 4EHJA 2IIBA 5T5QA 4S12A 1J00A 2UUPA 3JQFC 1HQKA 4I9FA 3TZCA 3I1YA 3ZOKA 3IFSA 4FCVA 1YR1A 4IP0A 4MS4B 3B6JA 3DFZA 3SIPA 1BIFA 4NMLA 3R7WA 2R751 3W6OA 1JEOA 2SECE 4DPKA 3WA7A 4P9NA 5E4FA 2NNLD 3RT7A 3GOHA 3RTCA 3ZZUA 4KAXA 1Y42X 2NXWA 5DIZA 1J24A 4P86A 1UBEA 4CKCA 1OHHD 3R41A 3LQKA 3R6GA 1KQ3A 1G21A 1CR2A 2EDCA 4QQFA 1TIBA 3CBGA 2AIRA 5K8UA 1XXLA 4KO3S 5BQOA 4D9BA 3HLKA 1CZRA 1T1GA 1W9HA 1YB2A 3K6RA 4WI1A 3TUZC 4TS4A 2AE2A 4N5HX 2NAPA 4MYTA 3C8ZA 5T4BA 1X1BA 1U3TA 1EE2A 1D2NA 1UL1X 1P44A 1PEYA 2W4MA 1ZZEA 3DUFA 4NBVA 3WK7A 3VMFA 3EC2A 5FBWB 4XWWA 4GR5A 1MPTA 3M4JA 3Q2KA 3J81A 2WWHA 1QZXA 3CA8A 3GJ5A 3DGEC 3H16A 1LRJA 4Z9XA 1E4EB 1H3NA 1GY8A 1XKTA 4N49A 4IUCS 1DKPA 1UIRA 2PVCA 4TV9F 3LW8A 3FPHA 4JP8A 5IT4A 3TG2A 4IPTA 1O8CA 2JIZD 2H1SA 1NW6A 3IXQA 4QDXA 1QPZA 1N2JA 2JHGA 5DMHA 4C88A 4PY2A 1AIPA 3CURA 3PR1A 3OCYA 4H60A 1QS0A 1OXXK 4EHHA 5NLLA 1E1MA 1QHYA 1XTBA 1Z4PX 3O8RA 4AZ3B 5A4AA 1BFDA 5BQFA 4EFMA 1C3JA 1X1SA 1BD3A 1VA5A 3N3BC 5IM5A 3VGJA 2PRZA 4CCAA 5IBQA 4X24A 3OF2A 3MPOA 5K2OA 2JHPA 2XH8A 3O1JC 3QWHA 1JSRA 1Q7RA 2AOVA 3AP2A 3AHIA 2J6HA 4O4HF 1T4BA 2GAOA 3SX0A 2PXAA 3VNRA 4FWTA 3N6VA 2ONYA 1DINA 1G20E 1JQAA 2IPNA 3R0QA 4P8RA 5F5XA 2QR3A 3EIEA 3ROEA 1A0OA 4J03A 3DTVA 4ZU3A 1EWYA 3R40A 2BCJQ 2F48A 3GDHA 3VR4A 3PB3A 4PHCA 1E9FA 3QBVA 1G6OA 2GPWA 2I6FA 2ZT7A 4O0LA 2CC2A 2I4IA 1YK0A 4G5HA 4YRNA 2W6ID 3PDHA 3AUAA 3DCYA 4Q9IA 4X8OA 2XWQA 5HPYB 5L3QB 3GYGA 1RRCA 2ZSKA 3ROFA 5AKHA 3WBFA 1E2IA 4A8TA 2HSWA 5JLAA 3OZDA 3QJ5A 1L5MA 2W8BA 3D02A 3K0FA 2D1FA 3GMDA 1GPMA 3DWEX 3SYRA 3TVDA 4TKLA 3KQVA 4NS1A 4RD1A 3U1VA 2B0JA 3TZEA 1XB2A 2QMHA 2JL1A 4QGAA 4NDNE 4AWBA 2QRQA 2YICA 3HUTA 2H54A 4TTIA 4JDUA 3B82A 4ER7A 4RNCA 1KJIA 2GYWA 2QMEA 1I9GA 3JQ8A 1FFYA 4MQFA 5HKBA 4R2KA 1QQ5A 1F8GA 3PQ6A 1GV1A 3EHEA 5H83A 5C7LO 1FJ2A 3OZFA 1V95A 3MS7A 1ZC3A 1C41A 1USWA 3O2QB 5JXGA 5HGXA 2FX5A 3DE6X 1GUDA 1KMQA 2XECA 3R76A 1YMQA 2EFGA 3LUGA 4J6FA 3GRUA 1D3AA 3OURA 4FBGA 4RLFA 4EFKA 5J4KA 3Q2IA 2WMNB 2GAJA 2PZGA 3FPJA 1QOZA 2IELA 5JNVA 1V2HE 2Y27A 4I55B 3LY9A 1J2TA 3I01M 4YMVA 5TEVA 2QX4A 3K1ZA 2RK6A 5EL0A 5EJEA 3QUAA 1KRHA 2R79A 1XU4A 3HZRA 3DZFA 4O4JA 3ZD8A 1E92A 3NOQA 4AKSA 3PX3A 3WZLA 4XM1A 5KQSA 4GUAA 4NJEB 4WKBA 5TXGA 1R7RA 3PXEA 2H51A 2XAUA 4GYJA 4G41A 4DVGA 1JZSA 1CY7A 5K0LA 2ZRAA 1ADCA 1T5IA 3M6WA 3M6MD 1BXRA 4E5MA 1YZKA 3PYXA 5K8IA 3NALA 4DANA 2Q2OA 4TL7A 2J07A 3EWNA 2V7BA 1X87A 4V1CA 1BCRB 1JKXA 4JB2A 5JJBA 2JLSA 1MO5A 2L2QA 3LYLA 4OLJA 5KTSA 1NN1A 1V4BA 1TXGA 1U7OA 2YN4A 1L5FA 3E05A 3ESCA 5FJJA 5TQVA 2B1IA 3EIOA 3A1EA 2FX3A 1R15A 3FFBA 1USVA 1YKGA 2YBEA 1NC1A 3BXFA 4IVRA 5IW8A 3TECE 2QM7A 2OM2A 5FI3A 4YR9A 1HDZA 3MTBA 5EI5A 1RS0A 1E7SA 4N8DA 3B9PA 1KXZA 4I5IA 1FNNA 4K9MA 4UHFA 4DSOA 5A02A 3NJ4A 2K7FA 4ZTUB 1A9QA 3DYIA 5HJ2A 1E6WA 1KGSA 1VBNA 1QIFA 3SQOA 3K1JA 2GPNA 1F51E 1OI2A 3P27A 1OI7A 2QZSA 3MBIA 4BO2A 4O25A 3FUUA 4X95A 3RVBA 1FDRA 1VCIA 1ENYA 4Q9NA 1XYYA 2WRZA 4RZSA 4BNDA 1N0VC 4EYEA 4G5RA 3K0HA 3QPVA 3IH5A 4L4ZA 1N9GB 3V2IA 4D4HA 4DJEC 3L7CA 5CNIA 3ONWA 1A5SB 4FOTA 2C2BA 3CUWA 3E7PA 1XP8A 4P5EA 3V2GA 5JZBA 2B6HA 4J0QA 4NY1A 5K2MA 4ZFNA 1I4OA 2DBVO 1S2MA 2F4NA 3LF2A 3C8MA 1CUVA 2QPAA 1DRUA 3A2MA 1G5PA 4ILKA 4MLDA 5LMUB 1W47A 4MHTA 1SCBA 3DMGA 3JD1A 3TCNA 1TC2A 1MENA 1NKSA 3K09A 4DIMA 1B2LA 4LBVA 3GARA 1DAIA 1MEOA 2EJUA 3EVBA 5FJIA 4Y18A 1GTJ1 1P91A 3U4QA 1TTPB 4XDHA 3VZBA 1EWVA 4KRYA 2J41A 3U4IA 3WMEA 5D51S 3T4EA 5KYUB 2JIPA 4FCWA 3P9KA 3L05A 4BC0A 4FHZA 3RIMA 4J0FA 3KZOA 4QOHA 3EG9B 4FYHA 2O2HA 4NECA 5BR4A 3N2GB 1U3UA 2HOQA 2WZCA 3FKJA 2C58A 4NWIA 4A0QA 4BZPA 5KX5F 1W49A 2ECPA 2JKZA 3CZ5A 4XVRA 3NM5A 5TQ2A 1DKOA 3DTTA 4QG7A 1GCOA 3COPA 3C87A 4WCDA 1L8XA 5BVGB 2OZVA 3X1MA 2NACA 1W2HA 3VPSA 1F9EA 4R1UA 2I87A 5IKPA 1JEQA 1NY5A 5JS7A 1AMNA 4RMGA 4N5DA 2ZYWX 3KKKA 1WEHA 1YVEI 2ZBDA 2X8AA 4DJFC 4CEIB 1CXZA 2C1ZA 1ZYUA 1YIAA 3NHUA 2ZVQX 2QNIA 3KWLA 1OZAA 1USUA 2RJNA 2DHQA 3HJUA 4NENB 2NXEA 4MV5A 4RDHA 3LVBA 1DPGA 1QYRA 4UQLA 2H92A 4B31A 1TAUA 4LXHA 3GEEA 2B4TO 1JKMA 4JJ8A 5F51A 2D1TA 4RVDA 1JQDA 2R44A 5BWLA 1ZK1A 4F7WA 2XRMA 3HB5X 1J8YF 3ESXA 4IQGA 3TGWA 2CVFA 4TMXA 1BA3A 3PKJA 3S4YA 3ASZA 5JNLA 1JPUA 1RJEA 2ZPUA 1F8YA 4ND8A 4U8GA 2CFIA 1IL0A 3FYUB 1Q15A 3EYAA 3HJCA 4PBTA 4ZI3A 4HUQB 3I6YA 2X5NA 3ICEA 4OB7A 1WXGA 1EXWA 1Y5RA 3NBFA 5HJ5A 4BTLA 4AW9A 4JJGA 2PUDA 3X2SA 1XRPA 2F43B 1V1MB 2WYUA 2CXHA 2PRJA 1VIYA 1XEFA 1K7YA 3FUVA 3NHSA 3OSZA 3UW1A 3DL4A 3HR8A 4NCAA 1U0EA 3EGOA 1SC9A 1VA4A 1VKJA 1RJGA 3U7IA 4FUTA 3VVCA 4U7PB 2VJNA 3L6UA 1XUOA 5LZ8A 4AQDA 5FR1A 1PJRA 1FDUA 3QM1A 4B44A 2JZCA 3OBIA 3ITKA 1ZH0A 4TMZA 5HFNA 1FNSA 1W5AA 3CS3A 3F71A 3FYSA 3WY9A 1IXYA 4Z4EA 3OUZA 1UT8A 1CRWG 1KPGA 1V5IA 2ZS7A 4HC4A 4B4VA 3UK2A 4LXQA 2O8EB 4FOPA 2G8LA 2YFKA 2YNMA 1E62A 3KB8A 4PZAA 3I4CA 3SIRA 1ZU4A 2FMKA 2RHCA 4YLGA 5C53B 4YUYA 4O4LB 4HYEA 4C22A 1H9CA 5ALQA 3TVTA 2XTNA 4AF6A 1FNCA 4RNDB 2I65A 5DTEA 1UK6A 3EXHA 4HVTA 4NPHA 2WUDA 5E6RA 5KTNA 1RVV1 2OXIA 1R0ZA 2VK8A 1FRNA 4EGCB 4AI6A 2OBLA 3JQRA 3VVMA 1O9HA 1RU3A 3LBFA 3FTQA 4RHFA 2A78A 5HKKA 4BYMA 2GYUA 5FLKA 3FDJA 3L41A 5K8VA 1EXDA 1BCSB 3RVKA 2JI4A 2NUAA 2VA9A 3Q7SA 3CVOA 5KAMA 4QDKA 4NMXB 1NRXA 5ALNA 1F0PA 3ROGA 3NWJA 2WTUA 2HW8A 3PQ4A 3IKMB 4GNKA 2YQ4A 1IY2A 1RRFA 2I78A 2ZUUA 3QJYA 4X0EA 2QUHA 4C6TB 2WF7A 1JQBA 1QCCA 3AEUA 3FZYA 4Q4AA 4DMFA 1IBLB 3EA4A 1KZHA 5ANRB 3WIEA 2BSAA 1R27A 3ZZ0A 2EJWA 2P9TA 4FCCA 4GICA 5MF6A 4G36A 4JASB 5JMTA 1TK2A 2A1IA 2ONKA 3JD0A 3U1TA 5TS3A 4B47A 3AI7A 4G63A 4OJTA 2WMDA 5C0OE 3KWJA 1IIRA 1ZGJA 2OCLA 3CE6A 4FNAA 3AVWA 3EZ2A 3KSUA 2QX6A 2I8CA 2HSZA 2W2MA 2WJAA 4PVCA 1NUQA 1XRJA 1MDFA 4KMOA 2IHKA 2RK4A 4LRWA 4BGDA 2PMFA 2V1UA 3HH8A 4A5SA 2YCLA 4WXYB 2H7XA 3CKYA 3MWFA 1XQVA 2CKMA 2BMEA 2A4KA 3GROA 3U0BA 1ZVKA 3WMWA 4RH3A 4C4RA 1M8JA 4QKQA 1DC6A 3F4LA 4GNRA 3FKQA 2EWWA 3FFTA 4FUQA 5I5EA 4F6RA 4YXWD 5E4YA 2HWXA 3HYSA 1S8OA 3H86A 4GH5A 4UHJA 1XDZA 2RB4A 3ONFA 1S9HA 1N2OA 2IHNA 1VE6A 2EEZA 4ARVA 3CR8A 4MWCA 5CU7A 4H7JA 4GM0A 1LBHA 1A4XA 4TTPA 1RI3A 2C3PA 4HAIA 4RD6A 2BGNA 5TSDA 3GEPA 4O8CA 4KITB 1U90A 1QK4A 1BS9A 4R1TA 3OX4A 1X0XA 2VPPA 2WNIA 1ISPA 2VBGA 1TM3E 1EM8A 4JT2A 2Z5FA 1LVHA 1U1GA 1M34E 2PH5A 4DV3B 1II8A 4GS5A 1GR1A 1MRZA 2CE7A 3S1AA 2HYDA 2UZ0A 1H65A 3H8SA 4KBYA 3VDRA 2NLOA 3QI2A 4U7HA 3WG9A 4A26A 1MQ9A 1NVWQ 5E7JA 4B3JA 5HZKA 5KU1A 3UIEA 1LI7A 2CYBA 3O83A 4CG2A 1MABB 1RHJA 2PMCA 3DOEA 4O5OA 4PYRA 4CMKA 4LSMA 5F4ZA 1DELA 4QUGA 1M2EA 3KNZA 5J43A 1P9RA 1RLJA 3IA2A 1JU4A 3FWYA 2MSEB 1K89A 1T4CA 1ZKDA 1VLJA 3K2EA 2GOYA 1DOZA 3OFSA 2XZPA 2PJUA 5HK8A 1FX0B 2XNKA 1OUMA 3UWKA 1KZ6A 3AH8A 4TMKA 5AVQA 4PC3A 1H2FA 3JQGB 1XCPA 4R2WA 3TDKA 2YVQA 4BC1A 2FUCA 4C3OB 1Z63A 2I7DA 2JRLA 1QQ6A 3DS8A 4FQ5A 4L9SA 2FPSA 4UMVA 1L4GA 5JVDB 4ARZB 1E5LA 4IDDA 2Q1TA 2RAPA 4LYHA 1PNOA 1EAMA 2NT3A 1G3IA 1QOQB 5AVOA 2ZYUX 1K5HA 3E8SA 1AHPA 5LZ4A 4MRMA 2ZVDA 4PX9A 3ZGLA 1DADA 4OTZA 1DIOB 1ZCZA 5F77A 1C30B 1J0DA 3G1UA 3BS4A 1QRTA 4GLOA 4PN7A 1VKZA 2HHLA 4IIFA 2RK3A 2GBIA 1K27A 3BM5A 4HAOA 4I0WB 1SKYE 4I8IA 2ZSFA 3ROMA 5F7XA 1PDWA 2VDUE 4QGBA 4UBMA 4OI2A 4W9NA 421PA 2HBQA 2YCBA 3BJEA 3QUQA 2QX9A 4FFWA 3T1NA 5SYNA 1F3LA 5JXIA 1ZC4A 3WJ2A 4NBUA 4R2HA 5EZYB 2QM8A 2VDRB 1UMCB 1XMPA 2Q6IA 4L08A 4OQMA 1J5XA 1SFRA 2QLJA 1OR8A 2O3SA 4KHZA 4AECA 5AJZA 3K70B 2PG3A 4DLXA 4EZIA 2O8FB 1XF9A 2W42A 3OOYA 3I2KA 4IILA 1I3MA 4FCTA 1J2YA 1TT5A 3BWBA 5BV0A 3U4AA 4DOMA 4JI3B 3DW3X 4Q3OA 5K0FA 5LLSA 4V38A 2Z3ZA 3WLPA 4LHWA 3PHLA 5A6VA 1OREA 4H27A 4EKGA 4XQ9A 4OFXA 1P0MA 1A88A 1LTHR 1XHLA 2ANBA 4RZ2A 4GMFA 4D46A 4G5QA 3DAGA 5CIYA 3OE1A 4J7AA 3D8TA 4G0NA 3TKAA 3UJCA 3UG7A 4ARAA 3T61A 4G37A 5HP4A 2FGJA 4AYTA 1B26A 5J23A 4HLDA 1JMKC 2G4CA 2PMEA 1OAKA 3SEAA 2YIDA 4HHEA 4MCJA 4EHBA 2ZYHA 2Q3FA 5I7VA 5DWVA 4RM3A 4BQIA 1U7DA 2XUGA 2CWDA 3SX4A 2DYKA 2GCNA 2V54A 4TOIA 3V8EA 4B7AA 4DE5A 2XBLA 4DV6B 1F0YA 2HBYA 1FTWA 2W6OA 2OLJA 2ZE7A 5FBHA 3UPUA 2H7VA 1N6HA 4HB4A 1YJAA 3PUWA 1EI9A 2IF0A 4MMYB 4JWTA 3FTPA 3D3QA 1XD2B 1WOYA 4CWAA 2ZM6B 2GJ9A 3IBGA 1UZLA 3OOSA 1DIGA 4C0XA 2OOSA 3NFYA 3NR2A 4L2IB 3OF3A 4D74A 4IHQA 2WP8J 2R4QA 2JH8A 2V3CC 4FQ8A 4AG5A 4ZHSA 1LBTA 2QENA 1KO7A 1U2DC 1U8UA 3IULA 3LKBA 3WYFA 1WPGA 1IXZA 3A14A 3QEMA 3W8DA 4WXMA 5FBZA 5LFAA 4D92A 5B57C 3ZZNA 3PR3A 1D8AA 2EC5A 2VSOA 5KYGA 4H7EA 2ZZMA 2ERXA 2UUOA 2CJFA 1E9VA 2VZLA 1FNMA 2RH5A 4ZP1A 4UUBA 2IX3A 3AWDA 3T7KA 4GKAA 5CLQA 4XVCA 3QW2A 2R7MA 1EIZA 3ZE1B 3U1BA 3HMQA 4JYAB 2IYVA 4L76A 3LUKA 3NYWA 3R23A 5TLSA 3DE5X 3GVHA 4KE9A 4RMJA 1A5ZA 4EMSA 1P7PA 1QGZA 3GJXC 3EARA 4S2UA 3STUA 2BM9A 3B3GA 2PXXA 3QVUA 4HDOB 4UUMA 1K6MA 4JOCA 4L8LA 2AFHB 3AEZA 5JECA 2NV2B 1U9IC 4L9AA 4UM9D 1B42A 3KJQA 5CT8A 3MAGA 2QRPA 3MQ2A 1VCMA 4ZI2A 1VJCA 3E4DA 2IXFA 1THTA 2C2YA 1NBMA 5DHSA 3Q7RA 5LYJB 1KVUA 4IMRA 4K9RA 4UNSA 4OBBA 4CV3A 1P4AA 2XMGA 3FHCB 1MC8A 1Y3BE 1TVMA 1GZ3A 4GPTA 4KBFA 1NJFA 4MMXB 2GPJA 4KLCA 3FNEA 1V8DA 2XYHA 1WNFA 4KWEA 3KZVA 3IAUA 2IUSA 3QYAA 5HGJA 4AY3A 2HLDA 5CB0A 4B17A 4B73A 1CUZA 1M2HA 4HRYA 2O8BB 3ZDCA 1CUSA 2NO6A 4NBRA 4B32A 1YB1A 3O7WA 3VPDA 1J70A 1DV2A 3W77A 5BURA 3C43A 2BT4A 4YLYA 1TAHA 4X94A 4D97A 4FFDA 2P9HA 1NBAA 1YDHA 3V1LA 3D7RA 4EA9A 4FFBB 5BWBA 1NN3A 5HX7A 1XL0A 3B36A 1JWLA 4MEAA 4DCVA 1KJZA 3HFGA 4DLYA 2H08A 2WABA 1O94C 4G0VA 4HEHA 1J6UA 1TI7A 4KO1S 1EFVB 2GVNA 2P91A 4KE7A 3P0EA 4C3ZA 3L0YA 1AVTA 1NA5A 3AI3A 1MX3A 1NAHA 3EASA 3VU9B 3T1TA 3UYLA 2G6BA 3DAYA 4IYJA 4F4HA 3OPQA 3PUZA 4KDCA 2HCJB 3HR4A 4TXHA 4Z7OB 2FEAA 2BJWA 3A1DA 5JSUA 4HQNA 1XJWA 4KFRA 2JFNA 2WUWE 3A32A 5JPDA 1AZTA 4A0GA 3G6WA 1QHHB 3FF1A 2ZI5A 5DBEX 1DAFA 4FYXA 2WHXA 3GH1A 3HGTA 3V4SA 1KEPA 1RBYA 2WHYA 3EW7A 1ZM4A 4WBXC 1DC8A 1HPLA 5GWXA 1ISSA 5G0WA 2AZTA 4G4SO 5ICFA 3RS9A 2W2VA 3A6KA 4DCMA 5LNK1 4M0KA 3MD9A 1E5QA 4WINA 1UPFA 5BN3A 5ALOA 5EGSA 3EY9A 3E53A 3TOCA 1JT9A 1NQVA 1ZD8A 3ZWQA 1L6IA 4OJNA 1BKYA 2BN4A 1MG5A 1X1CA 4UXIA 1U1EA 4E2FA 1APBA 5AOAA 2MINB 1E3DA 1T3HA 3NM6B 4P4NA 1V71A 2W6JA 3BHIA 3BQ9A 4H4EA 1PL7A 2QUAA 5BW6B 2BGJA 5KTYA 2P2LA 3HO8A 3AF1A 3PWSA 2M6KA 4FMDF 1ZXXA 4L8GA 3U3DA 3JQ9A 3NC1C 3ZI7A 1W59A 3C6KA 4Q1FA 9LDTA 4I08A 1GWNA 1U2TA 2O1SA 3PJDA 1CQXA 4IXMA 5DN9A 1C9KA 2YS6A 3OJXA 4LVUA 4BKPA 3K6SA 2OCXA 3Q7TA 3CVJA 4IG9A 2HCFA 4YP0A 1KS9A 1HL3A 2I66A 5LL6P 1MB0A 2R6ZA 1N92A 2NP7A 4PLTA 2ZQZA 3C5HA 1S8AA 4BMPB 2KLBA 1EESA 1V25A 1XMIA 5JY6A 2WAYA 3HZZA 3HTXA 2W70A 3NVKI 4F4JA 4Y1GA 3WB2A 1K63A 1QONA 1ZUHA 4C2AA 3W5AA 1JLKA 2NZJA 4O1IA 4Z4GA 1RYMA 3G0DA 4Q4JB 4WBNB 2XQIA 4XOIA 3ZXUB 3H8VA 4OREX 2AQIA 5HDQA 4E94A 4WY5A 1HDXA 3VOTA 4MLZA 4MVCA 1R4ZA 1P60A 2W9XA 2JLBA 4JI8B 1UC9A 1JEEA 5DNDA 4DCOA 2C95A 1FCJA 2W2XA 1D2AA 4XM0A 2HQSA 2FXIA 4OXIA 3F8SA 1NI4A 2GO7A 2BUBA 3SPXA 6REQA 3V8MA 4LF9B 3O90A 2ZTLA 1GCAA 3DJYA 4G9GA 1AM4D 3V8QA 1DJNA 3HUDA 3UK1A 2BF4A 2ZTSA 5DBGA 4TLDA 1NIJA 5CT5A 2AUTA 5AJHA 5DULA 1IWPB 3OEHD 4KRXA 3W5CA 4HL6A 2AQKA 1KVQA 3X44A 4WQMA 1JF8A 5D3MA 5JNUA 3SHVA 1U11A 1EWKA 3FM9A 1QUFA 1U9YA 3OE7A 5EIFA 2YW2A 4L5IA 2PUBA 3L1KA 4B3GA 1OBOA 1OXMA 1A7JA 2CMDA 3QOWA 4RGQA 4UU7A 5DGXA 1YQ9A 4HNQA 3RS4A 1G41A 3T5MA 1ZEJA 1JH9A 1IMOA 1M5TA 1U3CA 3I23A 3NP7A 1FFDA 4L0QA 2NVUA 4N5LA 2FE4A 4QBIA 1U2SA 2MYUA 3UCEA 1BEUB 1N2CE 2OTCA 5IG2A 1T43A 1Z4QA 4LE0A 5CVEA 1F06A 3OY7A 621PA 5KVQA 4INAA 3KHSA 1JIIA 3IQHX 5FWXA 5JHHB 2X86A 3UN1A 3ZD7A 2GN0A 2JLZA 3OCJA 4R1MA 3LL4A 1SH7A 3KELA 4H6VA 3ZKWB 1XBTA 1Z2NX 1ZL2A 1VLVA 2H7CA 1YB7A 4IF4A 3KU1A 4O2AA 2BL4A 5ECWA 3WJ7A 1I8TA 3DGFC 1XZKA 2I1QA 2J6CA 3EXEA 1IZ0A 3GEMA 1EK2A 3C0KA 3NHPA 3QTLA 4KGXA 4KIUA 1EFLA 1VL5A 2C2XA 1QTNA 1XCGB 5TQ2B 4KREA 2VK4A 4DA9A 2R25B 1L4KA 2HO4A 5FAKA 1UBJS 5C3UA 1BWQA 3SF8B 3AL3A 4TXJA 4DY4A 2JCYA 3OIUA 1ZNWA 3F7NA 3NONA 2CDBA 4MDHA 2QD3A 3A10A 1F8XA 3CW9A 5CJJA 2NU8A 2C4NA 2B36A 3V1UA 5JYBA 4W5QA 3SE7A 1JU9A 2WFMA 3K9FC 4K28A 5TS2A 2YV4A 4DLUA 3S2IA 5H8WA 3SOZA 3ZDBA 2FCAA 1Q1QA 1WCXA 2XMRA 3E48A 5EWMA 4M8IA 5IUKC 2B9VA 1ZLYA 4LZAA 4ZCSA 3W4JA 4YRZA 4QXMA 5J47A 2PUFA 1XZHA 1SCUB 3AHDA 4P83A 1A9RA 2OKGA 2X9QA 4JVLA 1XEAA 2LDBA 3ZVRA 2PO5A 4GXRA 4ENWA 3UY4A 1U98A 5HBRA 1XP5A 1VJGA 2MHCA 2WU8A 2XUPA 7MHTA 1WD7A 3QXXA 1WMDA 4K05A 3MRVA 4LXTA 2H2HA 2WFLA 3CSUA 4IJ6A 4YDHB 3R7WB 1NXQA 2XNDA 4JENA 2JJMA 4MV6A 3KEGA 3UWPA 4D8TA 3I5MA 3RHTA 3K71B 2A9RA 4KUEA 1E32A 5JH7A 4D6PA 5LOVF 1H93A 2AOWA 3ZQKA 2NP6A 3GFTA 4Q01A 2DFPA 3PFIA 4H1WA 2HMTA 3LDUA 5TPWA 1R9GA 1VBMA 5EHGA 1JNYA 1K5PA 5A9SB 2DFTA 1PG0A 2VDLB 4BU1A 4EX6A 3DPIA 3B8HA 3KWMA 4MQ4A 5DW3A 1XD9A 5P8WA 3TZHA 3GEIA 1NTRA 2QMZA 1QZTA 2HB6A 4PG6A 1UFOA 5C7OO 2NZUG 3BBPA 2ES4A 1G2QA 4YPFA 2PKQP 5HIMA 4NTZA 5K3AA 1KMMA 1SKMA 2P67A 1GKUB 2XODA 5JATA 2HWKA 4U4AA 4RM2A 4CETA 3SQNA 1JSLA 3PEFA 5E7IA 5LMZA 3UUWA 5SY9A 2DTEA 1V6SA 1L0BA 4PZUA 3DEFA 3V7NA 1DC4A 3IUQA 5B3KA 3GUUA 1AQUA 4RIFA 3G6KA 1YOBA 3LD9A 1ULBA 2GXQA 3DV0B 4TKUB 3MMSA 2FJUA 4EB3A 2ZSDA 1Z75A 4NH4A 1HE2A 1UDWA 3LDHA 1SJ9A 4Y30A 3HY4A 3G2QA 2FGKA 2HD4A 3N8NA 5IC4A 1N6LA 4UTXA 3I8SA 3RYCB 2A86A 3G8AA 2AD5A 3BC1A 3OLWA 2HK8A 4PBSA 3SBXA 1C7EA 1MOPA 3TW6A 4OQZA 3OLCX 4P36A 5C5EA 1O9BA 1VI2A 1WZUA 4JBHA 4X20B 3JALA 2OZPA 1P45A 1CG6A 2Z58A 1PBTA 1VJ1A 3CLTC 4WCFA 3PHJA 2H4FA 4WTOA 1CY0A 3O0TA 8MHTA 2IYTA 4LOIA 4DYVA 5E1BA 1E7WA 1A5TA 1FVFA 1VJRA 2G06A 3PKZA 5DCUA 3RRZA 4BLTA 4G0WA 3UOAB 4A0RA 5CTJA 3CR7A 2NV6A 2BMDA 1OBCA 3I8OA 2GVZC 3I39X 2PIAA 3WOHA 2R1TA 2FTKE 2ZBFA 3KE9A 4XWAA 1NL3A 1LRLA 1SHTX 5DB4A 4XQCA 5AVYA 2N3ZA 3V4VB 2Y1CA 2VP9A 3UV3A 3Q0EA 2C7OA 1NPTO 5DDIP 1UKBA 3WL5A 3AFHA 1T2EA 4OK6A 4AJJA 4CKWB 2XRZA 5EHQA 3H4VA 3K0FB 3ZWCA 1ONNA 4HDNA 1Y5NA 3BA1A 4EFDA 1KYWA 1OQAA 3DEHA 3GHHA 3I52A 3N58A 2AVDA 4WZBA 3OTWA 2QJRA 1Q0SA 3PT5A 2CHFA 2DKNA 3SN6A 3JQFA 3WHPA 4NXNB 1FZQA 2Y2VA 4EWLA 4KIWA 2ZBUA 3HSSA 3X2EA 3QI7A 4QBTA 4V39A 1U0GA 1UP6A 4Q21A 2EIXA 4QLOA 5JROA 5IT5A 4LF6B 3N7AA 1O89A 4KRGA 3NZEA 2GVDC 3T9CA 1J90A 1TF5A 2BHNA 3IV6A 1CE8B 4GECA 2EP8A 4P0TA 4TQGA 4WE3A 4BMSA 2ENUA 2JIQA 3OFKA 3RD5A 3SSOA 1PSWA 1UJBA 2P1RA 4XJTA 1PDVA 2YHIA 3NG1A 5EWLA 5F98A 4CBVA 3PPXA 1V11A 5D7BA 3TQTA 3WA6A 1CJVC 2V7WA 5FBKA 1RYBA 3IR5A 5JBQA 1EJBA 5KUTA 3ND7A 2KM1A 1D4OA 3M1IA 5E0KB 2N47A 5ER6A 1K92A 2XCIA 2AZDA 4AJKA 2BGRA 1CIVA 4OUDA 3VNSA 1YRWA 5BMOA 1XE3A 2BFMA 1Z0DA 2AKAB 2QG9A 4TMWA 4NEQA 1X7XA 2O2JA 4GP9A 4ZV9A 5A5FA 1MX9A 2BFDB 2OC9A 1ZOOA 3D2BA 2FQQA 2GWHA 4JLMA 4M1EA 4DXDA 5JI3E 1ZMTA 3H5NA 3JD2A 4Q34A 1RAIA 1KI3A 3ZI4A 5JAUA 4CI9A 1L8LA 1LX7A 3WHKA 5CITA 1GV0A 5A4KA 1QOPB 4LF7B 3THOA 4DC0A 1DI0A 3D8RA 4RABA 5B7PA 1E20A 2ILTA 5KJ6A 2ZZKA 3K70D 1LK5A 4OFWA 1EP3B 2RG1A 3WRXC 4EVRA 5ALLA 5T64A 3GRRA 1H69A 1Q6ZA 3DBLA 3A27A 4WNCA 4S35A 5AIBA 3CO0S 4JUFA 3AUKA 5JCXA 5FFNA 3OPYB 2GPBA 2W22A 2YWGA 5C1PA 4DUYB 3QMMA 3PGKA 1Q12A 1RHQA 3AZPA 4MRRA 4WECA 1OWMA 3ZHXA 2VHCA 4L8VA 4DMMA 2UXDB 1G8AA 3U7GA 2H1VA 1W94A 5FL7A 4RA6A 3ES9A 4EYQA 4JEMA 1CQJB 4MITA 3IJ5A 3PA6A 4BNYA 3ROTA 2R6FA 3CMMA 3GLIA 3C41J 3PE6A