2HREA

Structure of human ferrochelatase variant e343k with protoporphyrin ix bound
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title Substrate interactions with human ferrochelatase
pubmed doi rcsb
source organism Homo sapiens
total genus 138
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hreA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hreA01
2DJ5A 2HRCA 2Q2NA 1C9EA 1HRKA 2H1VA 2XWQA 1N0IA 2HK6A 2Q3JA 2PO7A 2QD5A 2AC2A 2AC4A 2PO5A 3HCRA 1LD3A 1LBQA 2QD3A 1DOZA 3AQIA 4KLAA 2HREA 3LYHA 3M4ZA 1QGOA 2QD4A 1L8XA 2XWPA 3GOQA 2XVXA 2C8JA 4KMMA 4CCSA 2XVYA 2PNJA 3W1WA 2Q2OA 4MK4A 2JH3A 1C1HA 1TJNA 2H1WA 2QD1A 2XWSA 3HCPA 4KLRA 4F4DA 3HCNA 3HCOA 2XVZA 1AK1A 2QD2A 4KLCA
chains in the Genus database with same CATH superfamily
4PQRA 4ZJYA 4ALJA 4R54A 3H7IA 4YCBA 5KUTA 1NVAA 1P1IA 4JP5A 2WB2A 4EJSA 4YRKA 3VPBA 3T4UA 2DFDA 3U1VA 5IPFA 1WJGA 3IPXA 1K2WA 2FVYA 3A58B 1O2DA 3N0XA 2VHYA 4FPXA 1SOAA 2ZREA 4EPYA 2ESRA 4X63A 1BJTA 2CXRA 4GP7A 1KYYA 2YICA 4CIVA 1OH5A 1W8DA 2G17A 4IMIB 3A6FA 4KO2S 4QD3A 1Z74A 2VEDA 4R0NA 4YWJA 3STVA 1OT5A 4HNQA 1IMOA 2EDAA 2JA1A 2NUAB 3S1LA 3ITNA 2HWXA 2J5RA 3WKDA 1H9CA 3RSSA 5KTSA 2EHDA 3PHLA 5C3MA 3LUHA 2ETXA 1H5NA 2P62A 5JR3A 1JDTA 3QF7A 3H5LA 4GOJA 1UC8A 4F85A 4DLWA 4RTQA 5JXGA 5EERA 3RWOA 4V03A 1OFUX 2H1VA 1N7JA 1UBOS 1KNXA 1DRVA 2YJ5A 4TV9B 5A4FS 2W7TA 3TQOA 4F46A 5D6OA 1ODJA 5KJ1A 4AQDA 1LPOA 1N6RA 4J0IA 1WTCA 4PQEA 1SWWA 3PD1A 4EGSA 1Y80A 1JI3A 5FOVA 3RBZA 1MAUA 4KXNA 4LJAA 1CVLA 3HJNA 4CGYA 3PFGA 3IDFA 4U9IS 1U7TA 3NWEA 4R84A 4Q1FA 1SBHA 3T5BA 2I5PO 1W4ZA 1WCIA 3E5MA 3I05A 3WOHA 3ZHCA 4ZAWA 1Q21A 2AL7A 1GNTA 2QTTA 2WU0A 3EF1A 1SU4A 3ET5A 4XPIB 4YBZA 5FOSA 3P2JA 4A8JC 4BGIA 2AG1A 2QX6A 1IY0A 1IYZA 1OPXA 1HL3A 3QX8A 4RKQA 2X8BA 2E87A 1M8FA 4IXTA 3U61B 1OW3B 4Z1OA 5J23A 1OXKB 3AHGA 3NOXA 5CEEA 3OEED 2DHRA 2P2CA 3LUKA 2BJHA 3AFIA 1X94A 3MINA 4XYLA 4INPA 1IVSA 2C5HA 3S40A 4Q4DA 3ZEIA 1CD5A 1LLFA 1U8FO 3EZXA 3N1UA 3VYVA 4DCVA 1ZKDA 5CA1F 1OAAA 3HYCA 5FHRA 3SF0A 2TMGA 2QTFA 1ORDA 5CT8A 5EIOA 3AJDA 1L9XA 2WSYB 1J33A 4JGGA 4TGLA 2B8EA 4V0MA 4X6UA 4C05A 1ZUD1 4PG5A 5AXCA 4KZKA 4YRLA 1FQWA 3PHHA 2WWRA 3UQYS 1S02A 4QRIA 2NU8B 5M34A 4Q48A 5KTOA 3PFKA 3V00A 5BP7A 1U65A 1IAVA 3UTCA 1N2BA 4JSTA 4YJ3B 3TG2A 4IDNA 3RF6A 2FI1A 1JG2A 2DPXA 2UZ3A 1GUBA 1WB5A 3HWX1 1LQTA 4IDDA 2GXUA 2VP5A 5EKXA 3TFQA 1M2KA 1RI2A 1TYBE 3TOVA 4KRYA 1FZTA 4K8OA 3RAJA 4HT3B 1W0KA 5ICCA 1G20E 2ACKA 5GTDA 4YC7A 3T5CA 1UK7A 2FK7A 3G0DA 3FDZA 1VXRA 5U1PA 2ZTVA 4RD1A 5HKAA 3L7MA 1TK2A 2BGRA 2Q99A 2X8LA 3LO5A 1ZGAA 3RS3A 4YCSA 4XEUA 4M0LA 3W1VA 2PIDA 2VF8A 2CBXA 3KUDA 3AINA 3MZ0A 3OO0A 2PMCA 1DAHA 1G3RA 3GIDA 1JFVA 3FGNA 4LXTA 3MTDA 3FVVA 4QQFA 2GBPA 5KJCA 4PZAA 3THXA 3MTAA 5MN4A 1ETHA 5I7AA 2C95A 2JJ2D 2FQQA 3A4NA 1PJ3A 5AVXA 1Z8NA 1KOFA 10MHA 4XFJA 4BV3A 5LB4A 1R4ZA 2Q2OA 5CMLA 1YJ5A 3FFWA 4MV5A 4ESVA 2Y6UA 4TLCA 3ZDBA 1C1HA 1W36B 1Z22A 4L3WA 3HL4A 3TDNA 2XNCA 4F6CA 4XX0A 5JJBA 3WC4A 2NOAA 4Z4HA 3TZEA 2D1TA 5IDVA 3C6BA 2QN1A 4GQBA 1P0FA 4OL9A 3BRSA 3P97A 1SAYA 4RVSA 2CXTA 2EJUA 2WKRA 3IFSA 2BFEB 4IKOA 3ANSA 2MSDB 1YS7A 3KLOA 4FYJA 4ND8A 2ZETA 3IJRA 1HRKA 3CGGA 1FTQA 4A73A 3G8YA 1MBZA 4FMPA 5ALXA 3SVZA 3JQAB 3TLGA 1RMYA 5JBNA 2H9AA 4JLDA 4R9UC 3FSJX 4AXXA 1M33A 1Z56C 2ZUUA 3BGVA 3RVRA 1E9DA 1HQKA 2HIHA 1B6GA 2PSJA 3JZMA 3AR9A 2ODWA 3TTUA 4IBOA 4QPNA 4KFCA 2GPSA 3UV7A 2R1TA 2VQSA 1EGVB 5EQTA 4YV0A 5KYYB 3HEAA 1A76A 5AVJA 3RK0A 4K8RB 1KEPA 1D0SA 2PWYA 3QA3E 3EGDB 4Y98A 3ZHZA 4C0XA 5IAKA 5K8IA 4NZPA 4AJKA 1L7QA 1GPAA 2DMRA 1NSFA 3ORHA 2GBLA 1WS6A 1NG1A 1N6NA 3TJMA 4Z7JA 3UT6A 2YN4A 5JAMA 2PU7A 1EFUA 3PNLA 5EMMA 2J0UB 1QLHA 1X8JA 1JU4A 3G7SA 3I9V6 4J0QA 3BGDA 3K0AB 1A98A 1I6KA 3PIRA 4WK0B 2PRJA 4C3OB 4AO7A 2FR8A 5EKDA 4ZYWA 5BQ3A 3DOHA 4ZVQA 1WO8A 4BQOA 5IUNC 2BOVA 1TAQA 2FX2A 1T9KA 1D6MA 1XZDA 2HZBA 4NBSA 4LDQA 1KBOA 1PZXA 2L2QA 5FWAA 1BHJA 1WW3A 3WXMA 4HV4A 1QGUB 4UQOA 5B53A 4URZR 3VU0A 4ATNA 1HZZC 2XVMA 3OEHD 2JD0A 3VKFA 4J7AA 3MT0A 4QUEA 3VR2A 4MUEA 1I2AA 1II8A 1XRSB 4FS8A 4QDOA 1CVIA 4JDUA 3LV8A 4NHOA 2GXAA 2NVUA 3OQHA 4XTRA 3PSHA 4L16A 4EY4A 3ER8A 1E79D 3UGQA 2CJYA 2RHDA 1ZM4A 5KU7A 1D2CA 4C14A 1HTTA 4EJ2A 5D3MA 1NL3A 3A36A 1DXHA 1XGKA 4IVPA 3H4TA 3QHAA 3ETLA 4JN6B 3TM5A 4GT1A 2JS7A 2W2LD 2X0IA 4PIMA 2BMFA 4ANFA 5A9SB 2PJRA 1BOFA 2EEPA 4YHBA 2WV7A 4WLNA 1CZRA 1MAVA 1VLQA 4PLYA 3NV9A 2HHAA 1JJFA 2J3DA 2Z83A 1Q2UA 1WCWA 4R3WA 5AW6A 5BW5A 4EWLA 1GARA 2OORC 2QV0A 3ETCA 2XNSA 3EXIB 1GPUA 2WWWA 3GUHA 1EHIA 4CV3A 2XMBA 5THKA 5IKXA 3OZTA 1KEEB 3OSZA 4JROA 4QUGA 1KZ1A 4NATA 2VHTA 4LYHA 4MROA 3DMRA 2GSWA 2LVBA 1TGYA 1NIJA 1QS0A 2YXEA 5CLHA 4H1HA 3UJ7A 4R8KA 4YDQA 1I2ZA 2HT6A 4R0VA 1G8MA 4YFVA 3RK4A 1U2SA 1E98A 3LUJA 4GLBA 1JF8A 3NBFA 5EQDA 1QIDA 3PHIA 4FZVA 1MN6A 4JIGA 1QK3A 4FSHA 1SQFA 1E9FA 1XMIA 4IJMA 1V9LA 3ZX5A 4BWFB 4EY6A 4RL6A 5KX5A 2H1IA 4O4HF 2RDMA 2W6ZA 2ATEA 1UPCA 1FFGA 1ZFNA 1X7HA 4G0YA 1TVMA 2WINI 2TECE 4E30A 4HUQB 4OTZA 5EXTA 1P8AA 3HSSA 4BGVA 2IY8A 5K9ZA 3M7IA 1JH9A 3FFAA 1J8YF 1Z5WA 4JLUA 2RGRA 2P9GA 3HKCB 2YDXA 5FI3A 1W73A 5H81A 3BQNB 1ZG3A 2DPMA 3FNHA 4ZYVA 3L18A 2PX6A 3G2IA 4ASUD 3UT0A 5BR1A 4JI5B 4RAOA 2CXOA 2D5IA 5CVUA 1U8XX 1BDJA 4ZOEA 1XVLA 3C41J 3VKUA 5CXUA 1I6WA 3VHXA 3OZCA 3KZOA 3I04M 4FLEA 4O2AA 3V1MA 2J33A 5AK5A 2D0DA 5JYCA 1ESCA 5AVYA 3O03A 2ZYDA 1PR6A 5DHUA 4OX9Y 1AURA 3EB9A 3F1KA 3PXBA 4DNFA 1FP4B 3GLHA 1S3GA 5KYKA 2ZIFA 4KW7A 2F1IA 4LOIA 5FUMA 3UGJA 3L5OA 2WFZA 4DNXA 1TAGA 4ZIRA 4ZI5A 2XVAA 1TUBB 3IOBA 3WMGA 2Z56A 4D5EA 1A4IA 3C39A 1GGNA 1PZFA 4LSMA 1Q1EA 2WOOA 3SHVA 1UZUA 2I80A 4IPTA 2DUJA 2XOXA 5F64A 5LKRA 2ZEJA 3S44A 4DJTA 1XYGA 2VDJA 2Q1SA 2QZJA 1RADA 4N40A 4ZTZB 1FQKA 2AQHA 2UXDB 4Z3KA 3COWA 1EVLA 3JQ6A 5CDSA 5E1OA 1A1VA 3A6LA 4R2JA 3GX1A 4HAVA 1ZVMA 1E5VA 2OHVA 3FDXA 1N6HA 3HU2A 1JFRA 1LBTA 2VQEB 4K28A 1CUUA 2AT1A 1JHVA 3H5OA 2A9KA 2HF7A 2ZI5A 3BXPA 1F4PA 4OQPA 4XOUA 2PUBA 5C1DA 1H6CA 1JALA 1MOPA 1DX9A 1Z62A 1C14A 2XE7A 4TTVA 3EPHA 1BD4A 4N01A 3P4UA 1ODTC 2I71A 1OGJA 3WQHA 1U5CA 5F9FA 3K9NA 4ZC8A 1HFJA 1U0RA 1G21A 2J85A 1P45A 5TB5A 1PWZA 1JLMA 3KTFA 3CVYA 1UDBA 1KK1A 2OY0A 2W6JD 5CFQA 5FT9A 1MQ8B 1GZ5A 4BMCA 4O8CA 4NWIA 1VKOA 4LJ8A 3ZBUA 2R6ZA 1SVNA 1U63A 4C4OA 4WBSA 5IXYA 2QYHA 3VSCA 1R6TA 4LOKA 3X2SA 3VTZA 1DC8A 5CDHA 3ICQB 1MB0A 1QIKA 2ZR8A 1Z8DA 2ZBEA 1RQ7A 3IMGA 4PW0A 5CA0A 4MPRA 3SZGA 4BCBA 5IJWA 3MCWA 2BHTA 3EQ6A 4W7SA 1X7XA 3IRUA 1DBQA 2FK8A 1W5FA 1WP9A 5BSUA 2H7XA 4BO4A 4BUCA 3IDQA 3HP4A 1USIA 4HLCA 4WLOA 2G71A 4N5LA 3DZGA 1MOQA 2C2YA 3DC2A 5BW6B 3PITA 1THGA 3WHLA 3ZWXA 4LHXA 4KL8S 4BX2A 1Z4LA 3GWZA 3VMFA 1KERA 5B58C 1WDLA 2B30A 3HACA 3ENZA 4Y2JA 5HK9A 4FWTA 1RRCA 2L69A 4O6VA 2FNAA 4I4IA 2ZYVX 3EXEB 5CB4F 5DEOA 2EL9A 1ANKA 2JCBA 3AR6A 3FHCB 5FNVF 3R75A 3R0VA 1OHHA 1NMQA 1OREA 2GHTA 3FDFA 3O1LA 1KDRA 1USUA 3WL5A 2MU1A 5FV7A 3NETA 5I7OA 4LWOA 3TGPA 3BHJA 5MFZA 3GDWA 2EC5A 3EGOA 4DR2B 3EJ6A 4IZHA 3HXPA 3JVEA 2P91A 3OCCA 3A37A 3FA2A 1A50B 1EAYA 4ED9A 2QM3A 5D7NA 4DCSA 1Q22A 4UHDA 5DW3A 5L7TA 3HV0A 4O25A 2IFTA 3DL7A 5C8YA 3HBAA 4Q01A 2DBVO 1UJBA 4WDQA 3VKWA 5C1OA 4HDAA 5REQB 1X8XA 1BW9B 4G81A 1FC0A 4GOXA 3T94A 1SQ5A 1TCAA 2FSVC 1T36B 2PFSA 3CEMA 5G41A 4TV8A 2O2EA 3T54A 4OF4A 4J29A 4EIWA 4CQMB 1L4NA 2ISQA 1ISGA 1IXKA 2O7SA 3JZFA 4B73A 2HSWA 1DO0A 2VRNA 3K9QO 2QI9C 3NNSA 1VCNA 4YCNA 5FEUA 2AEFA 1CJCA 1R6VA 2LGJA 2GK3A 2V4MA 3OIVA 1JHZA 5LD2B 1M1ZA 1KZ4A 1UINA 1KIFA 1ZWLA 1SUWA 2VAMA 1EI9A 1R15A 2VH1A 5GONA 2ONYA 4ZJPA 2VATA 2FUG1 2FP4A 4C03A 3GDHA 2CSXA 5A4MS 1P72A 3JD1A 3Q98A 2BKEA 1M6VA 2ERCA 2VQ6A 3LGAA 1H2WA 1L4UA 2XTNA 3IUNA 4LV6A 5AVSA 2A9RA 3BJEA 3WICA 4TLBA 3FOWA 4FQ5A 2VJBA 4L07A 1J2YA 5EZ6B 4ARZB 5MGNA 5KOJA 1EA7A 4GBED 3PXDA 4DXDA 4MI1A 3A6JA 1QQ6A 4HZGA 5M29A 4WZAA 5CB0A 3F98A 1KP3A 2FPLA 1FFHA 2JCYA 3QFHA 1F60A 4YJDA 4HEA6 2ODAA 3HR8A 4CGZA 4OXNA 1GA6A 3E7PA 4OFWA 4RKFA 3INTA 2H3EA 4A27A 1NQXA 3CG4A 1UBMS 3U4IA 1TW3A 4JVOA 3E82A 3OE5A 1CBUA 4OQFA 2OD2A 1H22A 2AN5A 5J4KA 3JAWB 5EWMA 2VK2A 3FYHA 3ENKA 3I53A 3MHPA 4L5AA 4LYGA 3KYDB 3HYRA 4RTNA 5KMGA 3IT0A 2JHGA 2ODPA 1OFUA 1RP7A 2XSZA 2P77A 3L6EA 1SUSA 4YRFA 3LIPA 3ANNA 2P6UA 1GPMA 3HWRA 4PQGA 4LVNA 5DV9A 3U4DA 4E5NA 4HWPA 2PPLA 1A7AA 3ER6A 3P1JA 5CX4A 1DAKA 3WDSA 4DG8A 1JLKA 2WILA 3LQ2A 4DYHA 3ESXA 3RDPA 2AGVA 3UMGA 2V0GA 4D9EA 2OM2A 1I4LD 4RHUA 5H7XA 2WWVD 4JLBA 1MJGM 3QH4A 4LE2A 2QRPA 4IGAA 1J8QA 4XD2A 2JZCA 3A9CA 2ZIXB 3DHNA 4FDVA 4P6VF 1C3XA 2DZDA 3K9CA 1TJYA 1RWPA 4R71A 3WBKA 2VPYA 4M9SA 3MA0A 1M2OB 4YCDA 5LXTB 4QWMA 4NJOA 4DA8A 3O3NB 1NVFA 1YI1A 2H2HA 4ZKDA 4E70A 3AM5A 2FG6C 1OLXB 2WM3A 3FCOA 4MPTA 3BM5A 1LRLA 4B71A 1ZD2P 4BYGA 2V7QD 1IVNA 3K92A 4KX5A 2PXAA 4NZNA 1R88A 4K9KA 3JQ8B 1NZFA 4AICA 5J9FA 2G9RA 1SXQA 4BLTA 3ZX4A 3VZRA 4EFNA 4HVAA 4LIPD 1N1GA 3JX9A 1T2VA 1SWVA 4ER6A 2ZVQX 1R4MA 5CTJA 5T41A 4DA6A 3MGCA 3GBVA 2GA9A 2CMDA 1KZ6A 2GO1A 4IFIA 4JY7A 2ENWA 3ZY5A 4OKIA 3JASA 4TKVB 1EFPB 4F6RB 3W2HA 2YNMC 3H8SA 4R6WA 4CIYA 1KETA 2JDID 3G2PA 1Z4NA 5TLSA 3H9JA 2PR7A 1H2FA 5IP5A 4BBZA 4RKYA 1ADJA 4S12A 3RYCA 1L6RA 3T5TA 1S3FA 1C81A 3B3GA 3UFXB 2O8CA 1HRDA 4RPCA 5EUQB 3OMLA 2JAOA 3NORA 5FBQB 3IUEA 1E6CA 2AR9A 1JQLB 4R05A 3N6XA 5TMPA 1O6CA 5FA5A 3WTCA 3BXZA 3CRVA 3BILA 1GGEA 1NAIA 2ZUSA 4XWGA 3UB3A 3FYTA 4DSNA 1CIPA 1BE6A 2CCGA 1EMDA 1KI2A 2HNKA 1RZ3A 1ZUNA 4RPHA 1EVEA 2O0KA 4YBRA 1VJCA 3TFOA 5C53B 4GU5A 4QIHA 2C94A 4YGYA 3I2KA 4HGOA 4DA9A 1NKVA 3D3WB 1TT5B 2C9MA 1CQZA 2RFLA 2GZMA 1LX6A 4IR7A 3ODPA 3KQQA 4K9OA 3S70A 2WZDA 1E69A 4V39A 5H0IA 1QRUA 2IF0A 2HSJA 3LE8A 1A71A 1G8HA 3L40A 4QNMA 2BGMA 3SIWA 3W9BA 1PT6A 3BXXA 1V2HE 1CUVA 1Z6YA 2AG8A 4MS1B 4MP3A 4LY9A 4A6EA 3GEHA 2ZJ5A 1SCIA 2NUPB 1ZSVA 2VJKA 4K9MA 2NAPA 3H2KA 5JAQA 2NPOA 1EWKA 1NUAA 3QBDA 2XKKA 2F00A 3EAGA 3V1KA 2W6PA 3IVGA 4GUAA 3WSWA 2JATA 3ZR4B 4CKWB 4JQYA 3PK0A 1Z29A 2WB4A 2XMZA 3FPHA 1RMQA 1ULBA 1BVUA 1Z36A 3G7UA 4US1R 3RYFB 1H6DA 2VT7A 3E9ZA 3GFSA 4E07A 2NTVA 3TNJA 5JADA 1T2UA 1NKTA 3GLQA 3OLVA 1D7AA 1KYQA 1U3TA 3I2YX 2OV6A 3PI7A 4NJMB 4UBKA 4UOQA 2V9ZA 5AW0A 5GZ1A 1MZPA 2IBMA 3DLCA 4B84A 4V0ME 1NF3A 2EWWA 3KDSE 4XJTA 3TQHA 1K4MA 4HH3C 1VGRA 1ADYA 5A0VA 1G1AA 2A14A 5ALIA 4AJIA 2IH2A 4Q9KA 4PLPA 4LFAB 5I7SA 3AOEC 4ARAA 5KQPA 3I39X 4Y2PA 2PLNA 2V9PA 3U62A 3WNZA 4RL4A 1K92A 4A92A 5KC9A 1A9OA 3KEFA 3WB1A 2PAAA 4BO9A 1FS4A 2BGIA 2O7NA 1B6TA 1JMVA 3DBRB 4URFA 3DLPX 4IRXA 1UFQA 1X38A 4XKJA 5AIAA 1L4YA 1MF7A 2WKQA 3E15A 1O6FA 4QBKA 4CIDA 3AUTA 3FVWA 1E4VA 1P0IA 2P67A 2IYLD 3EH1A 5EWLA 3VJLA 1IQRA 4F9EA 2HEIA 2O50A 2LW7A 1FUIA 5AKHA 3KDPA 1MIHA 3DOEA 1AV7A 3SC2B 3ROTA 3KB1A 3C3MA 4CM9D 4MO9A 1P3JA 1TCBA 3Q40A 3MT7A 3T7TA 3VR4D 3KXKA 4ZT3A 2JFHA 3VXKA 1XLUA 3PA8A 4R8SA 1WULS 2Q1TA 3NKFA 4FZ3A 4J76A 2VJMB 2WJWA 3OLYA 1IJFA 2QM0A 3NDIA 2GRJA 4YECA 3B7GA 2ZSUA 3G17A 3I3SR 5AK0A 1DEOA 5F5XA 1DV1A 1NBOA 2F3TA 1CZUA 4L76A 5FUWA 5E1DA 3KBBA 2UYQA 4QTYA 1JA0A 2UVQA 1XR3A 4FFMA 4FW9A 4RDHA 5KNCD 3PKZA 3CS3A 1WETA 2C3YA 3BXGA 3CZPA 3O0DA 1HFKA 4B7UA 1P7PA 1JBQA 1U28A 4FI3C 4G0UA 4MKRA 2DBRA 4E5KA 1IOZA 3AR8A 3OX1A 2HSDA 2C4UA 1RXWA 1UMCB 4CM8B 2HF8A 3SS7X 3ZOZA 1HYEA 3BXOA 3DAPA 3ZH2A 2O3UA 3NDJA 4F21A 4WCVA 4YJKA 4Y0NA 5BOSB 1YE3A 1IN1A 2EOAA 5LQMA 3I8OA 3TH5A 5F5NA 4MLPA 2DB3A 1COWA 1UOOA 8ADHA 3BHNA 2NZ2A 5HZKA 1KFEB 1J7JA 4M1OA 1OOEA 3I32A 1BXRA 1NBAA 1QVAA 4M2LA 4INAA 5B3AA 3ONFA 1A8SA 1X7ZB 5KQLA 2UXCB 3OIDA 1C8LA 4YXWD 1DIRA 2WZCA 3KZCA 3TRIA 2V6GA 4H3HB 1W4BA 5BUSA 4EG3A 1NI5A 2MYUA 2XVYA 3IPRA 3T9CA 4B3XA 3CR8A 3O47A 5AK3A 3FFBA 4IDBA 3AR5A 3J81k 1D7OA 2FWNA 2FGJA 3Q5GA 1L1FA 1P2UA 4DFDA 3OOYA 3CPJB 4ZZ2A 1A0OA 1J2EA 1JKIA 1YA8A 5JMTA 5DWQA 4CPDA 3G13A 2WJVA 1ENZA 1CDZA 3AUSA 4L4RA 3LHDA 4H15A 4KR3A 1N3LA 2NQ2C 3H6KA 1S8FA 4GPBA 5GWXA 3M34A 2XRZA 1YR3A 1ACLA 1ZYUA 2C88A 2I65A 3GRCA 2C78A 4ZVTA 1XCJA 5KWSA 2IS1A 1E94E 2HK6A 2D4HA 3DLAA 3GG2A 4D46A 3PSAA 4FMCF 3AFHA 4AS3A 5JD4A 1P7WA 2NUAA 1E7SA 2FW8A 3GZNB 4AN1A 2WYWA 4FOTA 2EWVA 5AHKA 1SG9A 4H4CA 3BWCA 2G9QA 5FHQA 1GZUA 3H4VA 3LPMA 4Z4CA 5CNMA 1Z45A 2BR4A 3GDOA 3FPSA 1M1YB 5IJ0B 4P4LA 1U9JA 1NVVQ 3SKXA 4YAUA 5KVVA 3CR3C 1LDGA 1T24A 5EIBD 5F1YA 2Q4TA 5BSFA 1XJ5A 4TV9A 2OXIA 1O97D 4NBTA 3SEQA 4PWZA 3QVVA 4ZO7A 4XLTA 1OXTA 1Z4IA 4P0TA 4MWOA 1XMXA 3PXEA 5E6RB 1SH7A 3A1WA 3NU1A 2JFWA 5H9VA 4UEQA 2DM6A 2YRXA 4D9HA 5BRAA 1VSVA 1HNWB 5D3ZA 1PU2A 2R47A 1PCXA 3R77A 4PG6A 1HE1C 5T4BA 3RS8A 2OWDA 3RAPR 2F3QA 3MERA 1CP2A 1KVSA 1TA0A 1NW5A 1ZS9A 3GA5A 4KV9A 1NBHA 1ZH4A 4LXQA 1B41A 4DRXB 4E13A 2EZ8A 1DKPA 2R2AA 3HJTA 1D1QA 5DIFA 3RADC 3LQ1A 2H2DA 1VXOA 3DL0A 1O9GA 1KS9A 4H35A 3P26A 4QBHA 1DQRA 4W9NA 2PWZA 3JQRA 4B9AA 1FQJA 4WFKA 1N3IA 2OXEA 4LXUA 5H83A 4IZIA 3A7EA 2UUBB 2ISSD 4A03A 1US8B 3IX7A 1SUIA 2ETVA 2VUIB 3HADA 1A4UA 2GM3A 2YJTD 4GOMD 1G2IA 1TJ4A 1K5DA 3EIUA 4PQYA 2X9QA 4DIKA 3CY6A 1I94B 4DBLC 1TF2A 5CK5A 3E35A 2C2KA 2R8PA 3DAGA 2VJPA 4FTWA 3T1NA 4ZRNA 3WWEA 4E33A 5E7JA 1PYDA 2X6RA 3W3AA 1QRRA 2WF7A 4IRMA 4TSFD 1ORTA 4TXNA 2VDWB 4X97A 4YJ3A 5ARDA 4B7ZA 1UL1X 3DCIA 3BFXA 1CZLA 3GC6A 1EQAA 4DLVA 3SWWA 3Q8MA 3CNNA 5FO0A 3GRAA 1ZMXA 3G1UA 2AWNA 4BNKA 2O8BB 5GZ3A 3R6TA 4IEFB 2J9YB 3ADKA 2HK8A 4I4CA 3VYSB 3DOCA 3CEPB 1L5OA 1Z6QA 3AI2A 4G85A 1ZMOA 5EJ2A 5AQ1A 1V1RB 4OHYA 2YXBA 4BL5A 3SBEA 1NYTA 4P93A 3KXDA 1A9ZA 2YHUA 3AJ8A 3OM0A 3I4CA 5KQGA 4I8DA 4POAA 3D8RA 4LY3A 3TD6A 2WVHA 4NMWA 4K7JA 3URMA 3ABOB 1YZQA 3RPEA 1KBZA 1U3WA 2NQ8A 4J43A 5H70A 3MLAA 1GNQA 1R8JA 1SPXA 3PRHA 3Q3GE 4GHWA 1AZWA 2D8MA 4P7FA 4QTXA 3NUZA 2AB0A 2DP4E 2QNIA 4OBXA 5EIBC 4DAEA 2R66A 1Z39A 4IDEA 2G4CA 4L3OA 4IZOA 5EUBA 4JB0A 1O97C 2I2CA 3I2GA 4KR2A 4DR3B 1ZJWA 4Y1GA 2IWHA 4KO4S 3C7CB 2DYKA 2QLFA 2P3OA 1PQWA 2Q0HA 3GLHE 3NLLA 3LBNA 2P2SA 4MTCA 2H4FA 3GNLA 1JMKC 1P5RA 4BE9A 4BVFA 4R1MA 1EBUA 3UAOA 1WSWA 3GUYA 1WHSB 3OU6A 4JUIA 2WFLA 3E7XA 4OB7A 4WESA 4K0RA 3WB0A 1L8XA 1Y89A 1IN6A 1FZQA 1XXHA 2G28A 5AVOA 1VDMA 3EYWA 3L01A 4RHFA 3X1JA 1UJ6A 3H83A 2EXXA 4ZKEA 4I7EA 2VBGA 2BFEA 2YMPA 1NONA 3AX6A 1T9GS 5FUBA 4AY6A 3D6JA 5DP2A 2EJWA 3HVJA 5BQ5A 1QRDA 1E1MA 3H6HA 1T0HB 2CE2X 3TNLA 3TLBA 4HH1A 1NTRA 1FLAA 2AZTA 1VYTA 4ER0A 2BHNA 2QSYA 4YN3A 3N74A 1Y7IA 2W11A 3OOWA 4LRTB 2VHCA 4EG7A 4YLEA 5SY4A 2DFNA 2ZB4A 4PFKA 5ALFA 1WXIA 4CUZA 2ZJBA 2I6QA 5ICFA 4ZCTA 2PIAA 2QD5A 2QIOA 3STYA 2AC4A 2B0JA 1QGZA 2BFAA 4MLDA 3T35A 3PL5A 2A0WA 3HXTA 5HYVA 3FRHA 2QV7A 3WZLA 4ZT6A 1QV6A 2BC9A 4JYCA 5KYYA 1Y6FA 3ICCA 2G5TA 3UJ6A 4E2WA 2FPSA 1KI1A 4GYWA 2R1VB 4C5AA 3CHYA 2HFKA 3DXZA 1V7PC 4GSLA 5FPKA 1RNLA 1D1SA 1G21E 5HCNA 1SC6A 3ZU6A 5BUQA 1ABEA 1RCUA 1HYHA 2MT9A 3ND9A 3TLEA 1ZAYA 1EVJA 4QASA 5DTEA 3E27A 3QXCA 3EIQA 3PNVA 1SU6A 4TWIA 3OLWA 5JCOC 4DLBA 3SLKA 1C41A 2KE5A 2Z5VA 3RHTA 2C4MA 4YCCA 3KAKA 1J2RA 3NHBA 4DQDA 1YMVA 3D6UA 4L7VA 4DQ0A 2IODA 1E1QA 2Y3IA 1R74A 3I6QA 4FHEA 4LPSA 2YV5A 1FVHA 3I72A 3IIIA 3MAAC 4TX1A 2NP6A 1C9DB 5FFFA 3LKDA 4NDZA 3P0JA 3ONNA 3Q88A 1RM4A 4IJQA 4MVJD 5JSUA 1PK8A 4Q4JB 1QGUA 1YDMA 1OQAA 4N4AA 4EZBA 3GA7A 5KX5F 1NJ8A 1XL1A 1CE8A 5CBPB 2FOXA 1E2MA 3Q12A 4CLRA 3ER9A 2GPNA 1P6XA 3QWIA 1RKBA 3LG2A 3V7YA 4GSYA 4ALIA 4ZV4A 2OQIA 4OUDB 1TLFA 4Z0TA 3RKRA 3O26A 1PIWA 5ISMA 2OLKA 2CB0A 3M9LA 3ADBA 4EBFA 2Z8YM 3WLIA 4JJGA 5J1TB 3C6ZA 1RBMA 2JLRA 4JHLA 1BEZA 1JIKA 2CNKA 4OH1A 3CVUA 1W2HA 1Y8CA 3OZUA 4CM1A 5KREA 2Q1WA 1HMPA 5H80A 4BJ6A 1JDNA 2G83A 2P6OA 3JVIA 2H1LA 3G5MA 4C7OA 5BOVA 1XCPA 5IMBA 5SZIA 4P4GA 3KAPA 2E6KA 4GE3A 4G5SA 4UD6A 1P4JA 3U3MA 1YVEI 4YMSA 2A9PA 2PH1A 3HM2A 1ZJJA 3C3YA 4XI9A 5EG5A 3K2IA 2OZLB 1KEEA 2L18A 2TSYB 2G4LA 1NUQA 1LJ8A 2BV3A 4AZSA 1MX3A 4K86A 5EXDA 3UAZA 3UHAA 4R1OA 3MBKA 2FCRA 4D8UA 1M5TA 1CF2O 3DQQA 1J00A 1P44A 3ELUA 3VH1A 3K16A 3KB6A 3WB2A 2D00A 2SHKA 1H3NA 3BBLA 3LIIA 3IKMB 2GEFA 1KZ9A 3PWSA 2EKZA 4MIKA 2AZ4A 1N92A 4F1JA 4BKQA 2ZRJA 1L5RA 1VSTA 3JAKA 2GD2A 3TUIC 3VV2A 2IYXA 4L5IA 2RGEA 2A9FA 3T4XA 3FETA 1EBFA 4ADSG 3VPAA 2XOKA 4WZAE 1JHXA 3T4PA 1ZJ4A 1FDOA 5I9SA 3PGKA 7GPBA 1XG5A 1P2GA 1MAWA 1EGMB 4QJBA 1E7RA 2FSIA 1M8KA 2IHNA 1YASA 1WZUA 3EG9A 4M9CA 3DBIA 1JR4A 2B3DA 4YB8A 3TTWA 1YB7A 1T8SA 3EC7A 3DB1A 4HLUC 1GZDA 3ZY3A 2EGUA 3MPUA 3NYWA 4ZCQA 3ZHYA 4RM3A 1WQ3A 4W1SA 2CY0A 4X1KB 4KOAA 2I7CA 1FMCA 3CINA 1YL7A 2OHIA 3ROMA 3RK1A 4CM4B 1Z16A 5FXMA 4D81A 3A32A 3EFHA 3RS5A 4CFSA 1Z83A 2OCLA 4Z3DA 2FP3A 3BIJA 1WBDA 3UB2A 1XYYA 2TMYA 4LF9B 1CY2A 3CO5A 2X40A 3WYCA 2NYRA 3AZQA 1SRRA 2E6UX 1KJQA 2O48X 4UKDA 3DS8A 5E7QA 4YT2A 2BGGA 5KQRA 3ZD8A 3A6KA 5EVJA 1TUBA 4QTZA 1Y5LA 2H85A 4NMHA 2VLBA 5CNKA 3WIVA 3ZHSA 2Y67A 5HKBA 2BI7A 1HSOA 3QKRB 3HTXA 4N0QA 2I6FA 2X5KO 4OGGA 1ZMBA 4N7BA 2NNLD 1BH6A 4DDVA 3HC7A 1L1EA 5JS2A 4DIBA 4RLFA 2GF2A 2O2YA 4TWJA 2HTFA 4MI6A 4L4XA 4GH5A 1U80A 3OZIA 2GI4A 3BSYA 4GPTA 3M4YA 4O63O 1VE6A 1JN0A 1FXUA 4OSOA 5F3DA 3C6XA 1D2GA 2ZVJA 3E2MA 4HXGA 1GFZA 3JYLA 3HCPA 2FE4A 3IE0A 3ABZA 2X5OA 3PUJA 3RD5A 4PC2A 4HLQB 3RABA 3QVJA 1Y1QA 2ZYSA 4Q93A 1NU6A 5KSYA 2HLNA 1R5OA 4QPCA 1H6AA 3OA2A 2REOA 2VYNA 2H8GA 1FMFA 2YN2A 3GEMA 3N6RA 3RIYA 4FM9A 1XDUA 2QUKA 3H8JA 2VZ9A 4UUBA 3DT6A 3D54D 3B6KA 3BZUA 4AJ4A 3KQNA 3HUFA 5IVIA 3OUZA 5C8YF 5J58A 1PJTA 3TEMA 4DGSA 1TFUA 4NE2A 4FCWA 3OWOA 3L4SO 4F7DA 2NO5A 2IZ5A 3WS7A 2BZ0A 2J31A 3WI7A 2YJNA 1JKXA 1TQHA 3BCUA 4TV8F 2RONA 4XLLA 1I3KA 3WOVA 5AYVA 1KDYA 1RRGA 2ID9A 2VF2A 4WV3A 1FRZA 2A30A 1V8FA 2Q7XA 3T7JA 3ZQJA 4CMIB 1PR4A 1SKMA 1NDQA 1A7UA 3IL2A 3UKOA 1QGED 4UTOA 4JJ4A 1FDUA 4P22A 3RJZA 5GONF 1N2GA 4MQ6A 4XGQA 1RJ9A 4LOJA 3R7BA 3O8DA 4DMCA 4W5NA 4YAJA 2DHCA 2XQGA 4J0FA 5DNWA 5J4LA 2Z08A 3A7DA 4MA0A 1ESMA 1O94D 2R68A 3AQIA 2P68A 4LZNA 3FZGA 1I0IA 1POXA 2JI4A 1HBJA 1RPAA 2AI2A 2BKLA 1YDFA 2GK6A 4RD6A 4V02A 4E22A 1ZK2A 2PVCA 1TCCA 2GBFA 2Q3EA 3KEOA 3QVXA 4HPWA 1HDYA 2NO7A 2WWYA 4TRJA 2B37A 5IK2A 4A8JA 4Z7OB 5AM3A 1K6XA 2HA5A 1TYZA 3KLPX 3X1YA 5A03A 3L5KA 1JAXA 1YS9A 4BO8A 1F4LA 2F59A 2QQ0A 5ICSA 3IQZA 1SUCA 3N0WA 3RAGA 3TEJA 4JLKA 2OAGA 2VF7A 4HDMB 5CFZA 2X2OA 3HY6A 4OMCA 1CJKC 3RBAA 5B5SA 1P2FA 3EDRA 3LH5A 4R8RA 2FFRA 4FSDA 3SJ7A 2OGSA 2ZZMA 2ACWA 2CLIB 4IDGA 1BW9A 3OTQA 4YUWA 5I5EA 1SEPA 5FFNA 1QK5A 3AVXA 4HUJA 1QQ5A 1LF0A 2J0QA 4G1VA 4AS1A 5JH7A 2XB6A 3FX2A 2IE0A 4UE3S 4Q9LA 1YZKA 4NBWA 3OPYB 4C20A 4GKJB 2FEAA 2O8VA 3GJ5A 2Q5EA 1OA1A 1FK8A 5B37A 1OI7A 2H1CA 4HI0E 2C9YA 2HCBA 2UZIR 3T7KA 1SVIA 3Q7SA 1UPXA 4B81A 4BCCA 4RTOA 3T12A 2HYDA 1J20A 8MHTA 3GH1A 2VEOA 2PUVA 4FLMA 3OX4A 3WVNA 4XWKA 3EBPA 4KACA 4ARZA 5AW1A 5JD5A 5L4NA 4KODA 1T1JA 4LNHA 2Z2ZA 4BFYA 3R3ZA 5DCWA 4ECEA 1PD1A 3EIHA 4Z4QA 4ER5A 1Z6XA 3AF5A 3E3NA 1NYRA 3UA3A 5IYZF 4Y67A 2IEZA 4JU9A 1PT9A 3ZI0A 4AECA 2FMKA 4HDQB 3TIVA 1Z5ZA 3B9QA 2HCRA 4KUHA 2X22A 2CLHB 1B15A 1JQKA 2GSDA 3CWCA 3MPOA 1AY0A 1VYVA 4KK3A 4EGCB 5G3YA 3KYDA 5DX0A 2WP0A 2GYUA 2GM9A 1DTWA 3FW1A 2HSGA 5BV7A 3IP3A 4MQBA 4OKNA 1SQ6A 3DO5A 4G5QA 5JS8A 2QNRA 3V8EA 5H16A 3RIMA 4B0PA 5A4JA 2P3QA 3ZNPA 1UMBB 2Y1OA 4TTIA 2PQ2A 3T3IA 3CRRA 2JLAA 4BO5A 5TQ2B 4DV0B 1VIVA 2GM4A 3MBIA 1EEHA 2C54A 1KEVA 1U2GC 2AIRA 1YIDA 4U6QA 1VL5A 4H6PA 3WGUA 3PR1A 4JP1A 1RHJA 5G0SA 3GCXA 2HA0A 5FWDA 5JECA 5D8DA 2KB0A 5EMLA 3TQCA 1QFZA 2H5JA 5EJIA 3VGPA 4PRYA 2GAJA 3NVKI 3NRCA 3OZ7A 1I7QB 3JPYA 3PFCA 2HA2A 2OGTA 2ZIXA 2XNKA 3NTOA 1U90A 4TS9A 1NPTO 4D4JA 3A9WA 3OEEA 4HB0A 3B1KA 1UCFA 2X4DA 4JYBA 4O3FA 2FN9A 3WGLA 4IF6A 5BSVA 4B3RB 2C2WA 1X7DA 3F74A 4FFBB 4FYYA 4GSKA 1AQYA 5HFAA 1O5IA 5P21A 3X44A 4EATA 4AK9A 4MV3A 5FJIA 3H9BA 5P8WA 5A1JA 2CUZA 2VNHA 3UBMA 4UQLA 2P9ZA 3IVCA 3D4PA 4IIVA 3L8ZA 1X2BA 2F3PA 2PR2A 5DULA 2ODEA 2J3LA 1VOTA 1Y6QA 2ODBA 3ZW8A 5FTNA 4NF2A 3TSOA 1CB0A 4IDFA 3KOUA 4ROTA 3BG5A 4M89A 5J59A 5H68A 2WWXA 5AKJA 3S2FA 3QMPA 4GVXA 5A1TA 4R31A 4WOCA 1IBRA 3N8HA 3OLQA 4DC9A 4QRDA 1HOXA 4DAOA 3QEMB 1XTPA 2E55A 4XDGA 1ZNXA 2VBFA 1EFPA 4RPIA 5T7BA 3UT5A 4BB5A 3GGPA 5BN5B 3TCXB 1P9WA 3ZDFA 3NYIA 4U1RA 5JSHA 1EVKA 2MHCA 2V7XA 1P29A 5CJPA 4BNDA 1ZLYA 5KTMA 1B3BA 3UFXA 4N41A 3RG8A 4M0EA 1Y42X 1KEUA 2CLOB 3DFFA 4ZQFA 4KLNA 4KSBA 1BMTA 3AU9A 3BSFA 4HLDA 2EX0A 4CNBA 4LGVA 2PZAA 2AUTA 2W2VA 3KWLA 3L4JA 5JLAA 1MO4A 2XMCA 3IO3A 3GEIA 3MT8A 3W7AA 5DOVA 1Z12A 5A2GA 2WAMA 1OB2A 2Z6QA 1L5WA 1UPAA 1O3YA 4DQVA 5JD3A 4QGBA 1N9GB 1HUQA 1TGVA 2OZVA 1F0KA 1EZ1A 5I9NA 3BIOA 1ZN8A 3AJRA 1HZZA 3H18A 5JXHA 2CYAA 4PX9A 1XD2B 1B14A 2WHRA 1TU4A 3JW8A 4MQEB 3VO2A 1AGXA 1PSWA 1XOIA 3N2KB 2JJ2A 1DBIA 3D3WA 2FUG6 4RVHA 5LLTA 2HBZA 2WFAA 2ZDHA 1ADFA 5KDLA 4CKXA 2Q4DA 3KSUA 3PXAA 3GMSA 4GAEA 2X77A 3HB0A 3GOHA 3H1EA 4AJLA 2Z3ZA 1EA5A 2AZMA 1E1NA 3I9FA 4MS1A 4TTJA 4A6PA 2GZAA 1W88B 4DZTA 2NUPA 4H7DA 3FUUA 4ZN6A 5JDCC 1T6YA 2QR3A 3U3KA 3FTEA 1SOWA 1E2PA 2QSJA 4IXNA 4BS9A 4IO1A 5A6VA 5B2EA 5KSZA 1TVEA 5BSRA 2ZUFA 1ECPA 3ENWA 3MD9A 1NU8A 4CKWA 3GF4A 4ALMA 2QMEA 3C3WA 3MLEA 4X85A 4LYEA 3PB3A 2DGDA 1EQUA 3HO6A 1QUEA 4TTSA 3RYFA 3TJRA 4ENUA 3WHKA 2XGMA 3PGXA 4Q4AA 1O96A 2YWRA 4NJMA 2J09A 3FPGA 2JEZA 3KJHA 5FFMA 5J2TF 3Q10A 4DS3A 4E7OA 1Q1AA 6NULA 3IT2A 2H2IA 5L6LB 3EFEA 3K5PA 2RCNA 4QJ4A 5CH8A 5EHNA 3REGA 2ATCA 4P58A 3HNRA 5CAEA 4ZYZA 1HEIA 5FOTA 4AZWA 5CNIA 5LIPA 4LJ7A 5E3JA 1XCMA 1PP4A 1HEYA 1ZL0A 5J2UB 1WNFA 2WJ3A 2BP7B 2C0PA 2FEPA 3IQFA 4FHZA 1E3MA 2AG0A 1FDWA 1TO6A 2CCKA 1DARA 1PTKA 1FTSA 4GYKA 1UC4B 2HF2A 1ZY2A 1P2BA 3ESAA 3OG9A 5PNTA 4QQKA 3HFRA 3THRA 3KHKA 3QLJA 3WBBA 4ZHQA 3DBRA 1QTRA 3OT1A 1Q6ZA 2LCQA 4XWWA 1Y7TA 3ED5A 3ZJ5A 1JG1A 3QSYA 1G66A 3OCXA 4B2LA 1PWEA 3H04A 2ZWOA 4M9QA 3TI7A 2GN0A 2PS1A 4BP9A 2AKEA 3PDWA 3RR2A 1C7FA 5FV4A 2I1WA 2V97A 4AYTA 3BWXA 2QJOA 4DBVO 1BS9A 3QNWA 2B6HA 2GKSA 4NENB 4KGVA 4CL8A 2R6GA 1NASA 1T91A 1XKQA 2GN4A 3SC2A 4D9CA 3PYMA 1MOSA 2EATA 2QTWB 4J6EA 1EFDN 1OYOA 1ZUIA 2FMFA 1RACA 2GCOB 2JNWA 4RQBA 3H8WA 3OEHA 2V4ZA 2ZJ3A 5G0TA 2BWJA 3GEEA 2VJMA 4XUEA 4NBRA 4G37A 3W8NA 1NQ5A 1KE1A 3WNDA 1LX7A 2PUWA 2YOFA 4JOBA 4N8EA 5DNVA 5DXFA 4B3TB 3DHVA 1WD7A 2XODA 3PFBA 1E79A 2ES4A 4IIYA 1KA9H 1C1DB 3GGDA 2XF2A 5FWYA 3E9RA 2FKAA 4Q47A 2Q07A 1AKWA 3F9IA 1VJRA 3CVOA 5FULA 2W2LA 1SZDA 2WUEA 3ME5A 1EAMA 1KY3A 1X7WB 3GJ6A 2B1GA 4AY3A 4WXPA 1SUEA 4OP3A 4YRAA 4C4AA 2FR0A 1DC7A 4JOSA 5BOSA 2XCQA 3CKYA 5FCDA 4WCFB 3DZJA 1TT7A 5K99A 3TR0A 4QFCA 3IR7A 3V4LA 2G36A 3EX7C 2WJYA 2JLVA 3I2FA 3L8GA 3WMFA 3AF6A 2ZM6B 3TXAA 3GMDA 4EAAA 4H7KA 3R9XA 4TV9F 2XQIA 3NTXA 4KQ2A 3DOOA 4RY9A 2R7KA 5FTMA 4AMBA 4AJ9A 5JJIA 1BO6A 4RBNA 1X7ZA 5ICGA 2HU7A 2DUUA 4C06A 1QH1A 4NZ9A 4DV6B 3HNPA 4BZWA 2CWWA 1PGJA 3L7JA 2H3HA 1TMYA 2PPVA 1YQ9A 1M73E 3ZHRA 4B85A 4B3FX 2ODQA 4YA6A 5F3WB 3PDUA 2RI1A 5I8WA 4ER7A 1JE1A 4BNFA 3RTDA 3UF0A 1HDXA 3WFJA 2QAIA 1BXZA 2WJZB 1MV8A 1XRNA 3A1SA 3IOYA 4FWIB 4ZZ0A 1BMQA 1MABB 2GJ9A 5C5DA 1EGQA 2C29D 2EKPA 2GAAA 5K4HA 2DH6A 2B83A 3THSA 3S8YA 5B58T 4HMOA 4IOMA 4QUDA 3RSOA 4FB5A 2I6GA 1TIBA 1Y8AA 4KFSA 2C07A 2HLDD 1UBLS 1Q17A 5I9TA 1SXJB 4PHTA 3Q8XB 1F1JA 4BEJA 4RA6B 3UWKA 4YRTA 1UAAA 5IARA 1GIAA 2W6MA 1R37A 2N75A 2X7XA 3HCWA 4U2CA 1XF9A 2F1JA 3ZXYA 4KNWA 1YBHA 1N2IA 2BGNA 1RYNA 4ASUA 1E9EA 1M1YA 1ZWKA 4QL3A 4U7HA 3N2EA 3VNUA 1SC4A 1C8VB 3BWDD 4OLFA 4PSUA 4L8FA 4WI1A 3BB3A 4OHZA 4YRBA 3WIDA 4RK4A 3Q6IA 1NP3A 3RCBA 1MJNA 2XNDA 3CLSC 4YJ3F 2H92A 2PYIA 3PG5A 1GZ4A 1V25A 3A3NA 4P34A 5E6RA 5GOTA 5H3HA 4BVKA 2BBSA 4DJJA 4M38A 2BBOA 2OHOA 4EFLA 3T95A 2HOQA 4M0PA 2X3UA 5L3ZA 5G1NA 3KOMA 2IHBA 2KBEA 4LRYA 2LIVA 5A6SB 3RRFA 3UW1A 1DUIA 4FYHA 4G07A 4TLLB 3RIGA 3IRVA 1RW4A 1I0LA 5AO9A 4DRXA 2YW2A 1JJBA 1ZK0A 3I5AA 4LBVA 1YOVB 1GD1O 4KNVA 2ZI3A 1JWLA 1JV2B 3H2JA 4OH7A 3VR5D 5BQXA 4MV6A 2FSVA 4GRDA 2EIXA 3LT4A 4FVTA 3QNMA 2PMKA 4DDUA 2RH8A 3HHEA 3T3NA 1B2LA 3SC3A 5AW8A 3QX3A 3EWSA 3NM4A 1RAHA 3VSEA 1MGOA 1Q7RA 2WF8A 5DDIP 1HE2A 3M81A 2C77A 4CMJA 1OIWA 2F8MA 4IHJA 3LKZA 3GJ4A 1TIPA 121PA 4LEIA 4AZVA 4CIXA 2H9IA 5LC1A 5F51A 5BSEA 5IX8A 2CE7A 3CURA 1JYFA 1OU4A 3IXQA 5LQSA 4CL3A 2J67A 4NBKA 2JGIA 2PJUA 1LF5A 5GM2A 1TKCA 4B44A 2ROQA 1VMAA 1WLSA 1QPBA 2P1DA 4TXLA 3QIVA 2I1LA 2VDWA 1E0SA 1KPHA 1OTXA 2W6JA 4LJSA 4Q7LA 4DQUA 3GGCA 3L2OB 3B51X 5B4UA 2ZG6A 3CB2A 3HCDA 3B13B 1RQNA 2GLTA 5B7QA 1ECGA 4F5ZA 4TZTA 2CFCA 4IUBS 5ERYA 3FTPA 4ITRC 1G7RA 2H1RA 2P7IA 1FFWA 2QQGA 2QY6A 3ACCA 4UBLA 3OE7D 3KJGA 1WDTA 3WWOA 2ZCJA 2QRVB 1R12A 4BX9A 4YXFA 3DWGA 2OESA 3GJSA 3H8VA 4JBLA 1UEJA 1YIOA 2QYOA 1I4DD 5B57C 4HQ6A 1ADBA 2QROA 4X3OA 4CHGA 1ZOLA 1IZ9A 2NXWA 5D5PA 2PUGA 1D04A 3TE6A 3TMAA 1ZNWA 1S9DA 3SI7A 2QZSA 2G9VA 1MC5A 3W6UA 5G40A 2AHRA 2DT8A 2B94A 2CNBA 3BZWA 4JH0A 5CLJA 3SKVA 1UEIA 4N3NA 2WUWE 2WSLA 3H17A 1M72A 1RVV1 2HMVA 3TPCA 4EEXA 2Q8QA 3TZ6A 2R0QC 1XQ9A 4YMHA 4ER3A 1RM3A 1P3DA 5KNDD 1ETUA 4X91A 3SE7A 3LDHA 3QELA 5C8VA 3JCZA 1WU8A 3LQYA 4DJ5X 4OAPA 2FUKA 1QHYA 2Y1EA 3DVQX 3H1GA 3T1TA 1HQDA 3D4OA 4US0R 4ERXA 4UEWA 3JQEA 3N2NA 2P9HA 3Q85A 3DV0B 3B8EA 2CLDX 3GK3A 2NZVG 2REXB 5LBUA 3ZGLA 4B3MB 2D2VA 4AG3A 3D9QX 5ERGB 4M7PA 1OV4A 3D5QA 4XYBA 5BSWA 1LBIA 3K0CA 4OLBA 2WM2A 3E6AA 4P5EA 3QA9A 4Q1EA 3WYDA 5CYOA 5DTJA 1ID1A 4LNAA 4N6OA 4V0LA 4DMMA 1RXYA 3BOSA 3CKLA 1MDFA 1CX9B 2ODNA 4NNPA 1ZVJA 4YIKA 4LQ4A 2XYHA 3TR5A 4ZCLA 5A9TA 4WECA 3OQ6A 3OEWA 5L3QB 1SD2A 1KJZA 4IJ6A 4RTJA 2NLOA 2JANA 1ODIA 4PX3A 1TB4A 1XF1A 3NHLA 4QSMA 4G1MB 2OBMA 2ZQYA 4URWR 1C2TA 2R1VA 5CR9A 1NF2A 3K31A 2Y0CA 1GZ3A 3IMCA 4HDCA 3SQNA 3SYNA 1G8SA 3QU5A 1LQUA 1JAHA 1UBCA 1Y37A 1MXHA 1YQXA 2CXHA 5CDTA 2YW9A 1Z8FA 1UFKA 4MMXB 1Y8QB 2EW8A 2F4VB 1M2VB 4NZMA 1JLLA 3TBHA 5I3ZA 2B92A 4O2BB 1F3OA 2EFHB 1RWNA 2WU1A 3K30A 4GPEA 3HUUA 1OX5A 4TLAA 4UQPA 1SVOA 2FW1A 2CMKA 1G8JA 1P6QA 4O4LB 4G84A 4LFCB 1EU1A 4EHAA 3VSBA 2FRDC 5EKSA 5I9LA 5JTTA 2JH8A 1IATA 4FDMA 5A0TA 3VFDA 2BFDB 3HB9A 3DMYA 1EBBA 1E32A 2D1QA 4M8IA 4BTEA 2BE9A 4B35A 1KSFX 1KXJA 5EE5B 3KSAC 3WKCA 1M34B 4JP2A 1DC3A 2JEYA 2DOKA 4P98A 3AIOA 4RABA 3VU3A 3QXSA 3ZWOA 1Q7GA 2JK0A 1KAMA 1NVTA 3WGYA 4OUDA 2YKGA 1HURA 2CZCA 1LVGA 1OZ0A 2J9GA 4HO1X 4KMRA 4TRRA 3TB4A 2YXPX 2BCEA 2I62A 3EEQA 3GJTA 1IWBB 2XGGA 3I4LA 2FWIA 4GVLA 4NU8X 3RQSA 1QP7A 1G8GA 3O4GA 1POWA 1V1MB 3RAFC 4QG7A 1E2KA 1FVFA 2GCGA 3GI1A 4QQRA 1JIQA 2X5XA 4OI4A 3EYAA 4FUTA 3ND7A 1E3QA 3ULKA 4E5MA 2IYSA 2A9QA 1JJAA 2XUDA 3PHBE 1AXGA 3A3YA 1U9ZA 1UWKA 2QW1A 2V7QA 1W0JA 2CXSA 1VKHA 3HSKA 4QXRA 2IDMA 1V3QE 2YXDA 3G2QA 3W79A 2CK3D 2OZLA 1KIAA 4F71A 2XUAA 2O06A 1UPTA 2IEGA 4PNZA 2YYAA 2DEUA 4CU5A 3GJZA 2GZHA 1GTZA 4JJFA 3RFCA 5ED0A 1GRRA 1QVVA 1T2EA 1WEHA 2CBZA 1OJLA 1T34A 4NOLA 2HXYA 1SURA 3G49A 4ZT5A 1PTJA 4UM7A 5F9MA 4AKEA 3ZTWA 2JDIA 2A59A 1CRPA 4CR6A 5JXWA 1EX9A 1S0UA 2A0XA 3JQBA 2PZ8A 3AEKB 4P86A 4OHKA 2DQ4A 4W5WA 4N8DA 3K9HA 3N2LA 2P30A 4LV8B 4YMUA 3Q2IA 1XQVA 1JU3A 2JHCA 2I4LA 3ENNA 3JU3A 4NV0A 2PEYA 1M7HA 5FBKA 3PENA 1CQWA 5M5BA 3HJFA 4KQ6A 2IZZA 4KQWA 1OWMA 3EFOB 3IGFA 2CHFA 4JI7B 3VUFA 2RHBA 3C8HA 1N2JA 5IJ9B 2YWXA 5DSXA 5JWHA 5D87A 5L8VA 3CTPA 4CG1A 1E2EA 2FWJA 1OE0A 1WKCA 2P4UA 3B3FA 1L4MA 1ZI9A 4WKGA 3AM4A 2PL5A 3X43A 1WPXA 2J5KA 3HPQA 4UZSA 5JBIA 1G5TA 4C0LA 4X1KA 1QAOA 4Y1FA 3KV1A 1AVTA 3LA8A 2Q7OE 2XUZA 4PE5B 4CFYA 2AWOA 4CM4A 1TF5A 2NXNA 4KVAA 1A5AB 3HFJA 4I1RA 4KBGA 2AQIA 4C5CA 4J7UA 5DNEA 3D6FA 5LU8A 3GRUA 3UO8B 1CJSA 1X86B 5CFRA 4AD8A 4D74A 4TWBA 1RXSA 2GEBA 3VO9A 5JNWA 2QXTA 2YYSA 2A5YB 3NOVA 4JUCA 2WA2A 4NOMA 1BRMA 3PT9A 1F3LA 3BDVA 1FRFS 1CP3A 1KORA 1PJAA 3KT3A 3QKRA 4MCAA 4DIEA 4YAIA 5BN3A 2QBYA 1IN5A 4QEKA 2HW8A 4FFOA 3C43A 4QYIB 4BC0A 1D9XA 4CUKA 2W42A 2IZ7A 1U8EA 1Y8RA 4I99A 1GGHA 4N5HX 1RI4A 4KITB 3ADPA 3PRKE 2OCXA 3WP0A 1I8TA 1YDGA 3QOWA 1JQJC 1J70A 1UBKS 2QMYA 4JLSA 3LOPA 2IV3A 4DSOA 1TZ2A 2YWGA 2P5YA 2JJQA 2AFHB 1I6LA 4UMVA 1UQTA 2JJMA 2PRSA 4DT1B 1G9TA 4QPPA 5TS3A 4NXMB 4DSTA 3C1OA 3DE7X 1CSEE 5CFOA 2ZTLA 1FJGB 2W83A 3M9XA 2SKEA 3I8SA 3W8FA 1XEWX 1F14A 3CC8A 3O75A 3TNDA 3ZVMA 4KYIB 3DJYA 3RRZA 3THWB 1Q1BA 3H5VA 2DJIA 2B61A 2RSLA 5GOZA 1Z08A 3EGXA 3FGPA 1SB9A 2PFKA 3NG1A 4A0SA 3LL4A 2BKXA 2CWDA 4HVTA 1E5XA 4DLNA 2W2TA 2OG1A 1E5QA 4G36A 1FPMA 5DRYA 3KVNA 5KWEA 1D2EA 3GJXC 1Y7PA 3AFMA 3ZTYA 3BORA 3PRJA 1FNBA 1YWGO 3KJEA 4GYJA 3E23A 3PDJA 2A94A 2EKQA 3CZ4A 5CTAA 3S99A 2OMEA 5H5JA 3U4AA 4AM8A 4EKGA 4CM9A 3KRTA 5A7HA 5TARA 2QTHA 3ADOA 4BLOA 3VR4A 4CMIA 1IAQA 4I6JA 1ML4A 4W5TA 3D8NA 4D25A 2ZUEA 1Z2OX 3RO7A 3S1AB 1QIFA 4R5HA 5ALSA 2PV0A 4X3PA 1GLVA 5EJ5A 4GXQA 5D7BA 2RHTA 5CCXA 3TIXB 2CJFA 4KQMA 4INZA 2WP8J 2A1TS 2VPZA 2GJ8A 1W87A 2UVPB 3BUSA 2IYFA 2MR6A 2VN8A 1AE1A 3CF2A 4BLUA 5KNCA 1NW4A 3LPNA 2NTEA 2ZR9A 5TY0A 3L1VA 4AL4A 2ZI9A 2YZ2A 3EAFA 2W22A 3I6BA 5LBIA 4NS1A 1SK8A 4OYRA 2CLFB 3O31A 3REFA 1ZM9A 2AA3A 4GI7A 2CF6A 3KHUA 4JC4A 5CBPA 5A2QA 1TFRA 4GVPA 1YCFA 3W5UA 4QRHA 2XD9A 1RHRA 1TPZA 3LAWA 4EI7A 2MWMA 4WLUA 1N7GA 1U0LA 2BY4A 2J3QA 4HDMA 1AN0A 4ZQHA 5FUQA 3G2KA 5JUWA 2HU5A 3TNFA 4Z49A 4YWHA 4LUCA 2AEEA 1PJ8A 3NXKA 1DOHA 3PFNA 3BK7A 3UCXA 5IFKA 2WJHA 1I3MA 4YXWA 4L6IA 5TX7A 2Y1FA 1E7QA 1EUCB 1PDWA 3ECAA 4AJHA 4EHNA 4F4CA 2YMMA 2CEKA 4OHFA 2G40A 1DCFA 3D4LA 3IQXA 4AIRA 5C5IA 2X3FA 2R85A 2V4UA 3ISVA 2X5NA 1U4SA 3OPYA 2BYTA 2O3SA 1RAGA 1QG2A 3DDHA 1J0BA 1QFXA 1DIHA 2DG2A 2BFWA 1Y81A 3Q2OA 1P9RA 1FYVA 4RGBA 4N39A 5TPWB 3OSUA 3SQDA 3DJFA 3TM4A 2Z6VA 3HFSA 5EA2A 1NKSA 2OXRA 3SMQA 4BRZA 2CMHA 2FDRA 3GFRA 3JWHA 1RYFA 1NC1A 1A96A 3AEYA 4GWLA 4HAIA 4YRCA 5GJVC 1B76A 1T9GR 2Q2QA 4GL2A 4B34A 3QPWA 3RRBA 4CV0A 5HRUA 2W6OA 5LXTF 5K2MA 1NJ2A 2RB4A 1D6NA 3TIGA 5JISA 5WRFA 3O73A 3RYHB 1NVEA 1PD0A 2H0RA 3E0QA 3GUUA 1K8QA 3HJUA 4FYWA 4MB6A 5COQA 3ROPA 3WL8A 3VJRA 2ZB7A 1GPDG 4G01B 3FOBA 4UNIA 4NY1A 2AC2A 4JR2A 3IA7A 2QP9X 4B5LA 1NX9A 3NQ41 4OHPA 3CH7A 1GQYA 2SCUB 4EUFA 4K6HA 2V3WA 5A9RA 3VPGA 5BYAA 2ORIA 3FSRA 3ZK9A 5IVHA 2L17A 1PX2A 2D2EA 4GLFA 3BKXA 5K6AC 2H4JA 3CZMA 1VKJA 3RW9A 5AVWA 2Z9DA 2RGXA 4EL0A 3I58A 5ALYA 2IYUA 1N2ZA 2V3CC 1PEAA 2ZKLA 4PHCA 1YU9A 3F8SA 1XRPA 1YHYA 3KZVA 3FR8A 3LY8A 5AKIA 5FKJA 2V0NA 4ZQBA 5KVAA 2X8JB 3ZWVA 4B87A 2B5WA 5JDIC 3IAM1 2W37A 3PBKA 4GO1A 3UH0A 4N5MA 3V1TC 4F2GA 1AA9A 3QPDA 4OGLA 1QOPB 1WVMA 3SCZA 4AN4A 1JWAB 1P9LA 4BIIA 1P9NA 6ABPA 3ZI7A 1A4XA 1AXEA 1NQWA 2F6RA 4FGLA 4KE7A 1N0UA 2OLJA 2LUOA 2Y92A 3I0NA 3PWKA 3I2IA 4JLMA 5G0VA 1LY1A 1VJ1A 4D02A 1DBSA 1VBFA 4ROSA 4BVAA 5L40A 3ZDXB 5A5VA 4HGQA 2ZWAA 4DC1A 2A7QA 3H99A 4G5XA 4GLJA 3FTCA 2GESA 2Q5FA 2J5QA 2G1JA 2I3ZA 1PLJA 1HPLA 2EIHA 2XVZA 3KKZA 3WZMA 4HNTA 3ND6A 2J4DA 4LMRA 4YACA 3RFUA 1LI4A 2OBYA 4MW4A 4R3NA 1RYEA 2V7UA 1QMGA 3LKVA 1Z5OA 5TNXA 1E6MA 5BSMA 4COKA 2I22A 3H0EA 2AMFA 4TMYA 4TTTS 3LPAA 5JAIA 4K81B 3R5XA 2R86A 4TSFA 4WKOA 3W90A 1S96A 3VZCA 5LYJB 4AY2A 1X1RA 3QLTA 5JFTA 4Y7CA 1KZYC 5TPZA 3FE2A 4HPXB 1XRMA 4XXHA 5C34B 3CN9A 4Q15A 5BN5A 1Z0UA 4Y2SA 1RRPA 5EFZA 4G0MA 5JCOA 3GLGB 3FMIA 3LD9A 3B6MA 3SLGA 1RAAA 3SM9A 3BWVA 3IV6A 1SFRA 4WVFA 4V0RA 3HCNA 4C43A 1NW6A 3EBOA 2MSEB 2XKJE 4CMCA 2X3YA 1FQOA 2ZIEA 2PFGA 4YT5A 2YY5A 1E99A 3O8OA 3N39C 2CL6X 1M1YE 3BEDA 1G5PA 4G4SP 1EIZA 3Q1LA 2RHLA 1WXGA 2GQ0A 4HFNA 5IJXA 1U8AA 1QLWA 2VH5R 1KJIA 4C2AA 2B69A 1XD2A 2IHKA 2KSQA 2XT0A 1Z4MA 3AK4A 2A9OA 2VJQA 3FLEA 3W1WA 2CHVA 4U3JA 1BGXT 1Z4PX 3L0DA 3TQFA 3OJFA 4H4EA 1GU0A 2P2YA 2I3DA 4J0EA 3OKAA 3TEFA 4XQ9A 3EC1A 3QOYA 4KMSA 1TM2A 2F64A 4Y2XA 2Y4OA 3X2EA 1XUOA 2ID8A 4A8TA 1WABA 5ES4B 5ESDA 4GZLA 3RC9A 1RZRD 3K1YA 4MGIR 1YUNA 1ZK1A 1PF7E 1CFZA 2R8RA 3IERA 1UANA 2CKMA 1WMEA 3DZBA 1LWOA 1SOVA 3NXSA 3HXQA 1J06A 4E4RA 3LCRA 1QO7A 5G1OA 3U26A 4Q6BA 4P33A 4ZV9A 4F3YA 2F9LA 4OQEA 5FL7D 4OVKA 2HDHA 3F46A 1P80A 4R8LA 4OLAA 4LF8B 3VJKA 4TUYA 3OIWA 4I1VA 4NVRA 4YMWA 4ITUA 1KEZA 3IESA 4QGGA 3SAJA 1U4OA 1YO6A 3FCUB 1AQJA 3EIOA 2XB8A 3FVQA 1AKNA 1SZCA 1ZISA 2GNPA 4BIMA 3UVEA 3PEUA 2ORWA 3R5KA 2CUNA 3WQQA 1P7YA 1V5IA 2BBTA 3I1IA 4M8LA 2P40A 4N8SA 4BFCA 4ND1A 4LV5B 4UW9A 4F06A 1U5BB 5B6PA 2ZAOA 2IYVA 3O4HA 4NTZA 1XZ8A 1W34A 4RAQA 3TTVA 5KU1A 2VO1A 3KVRA 4BB6A 4FGJA 1JPJA 4RVGA 1WKVA 1Q57A 4CMEA 1RCFA 3OZGA 4PSVA 2DWQA 3RVQA 3LHSA 3LX6A 5AM2A 4UHKA 1XVTA 4EG1A 3R8XA 1Y82A 3RBXA 1H1LA 4Y8VA 3PD0A 1FP6A 2ZJ8A 2WD8A 4L5YA 1EWRA 4XVQA 1QCCA 1LV7A 3QJGA 3SJZA 4OGFA 4QFMA 1ACMA 1CY6A 4RY2A 1JVNA 4LFBB 1Z6TA 3JD4A 1DC6A 3RT7A 3RSLA 4IEEA 5CH3A 4I50A 1T5IA 4ISBA 2JAHA 5K20A 4UEOA 2HYIC 4PBRA 4J0CA 4EGAA 3TL3A 2DQKA 2DRIA 3N9IA 1ZNQO 5EP4A 3UXYA 1M7BA 2O2CA 3EN0A 2BTOA 1N78A 1GL3A 1NMSA 4NJEA 4BMXA 4HLUA 1NT2A 2ZUVA 4ESHA 4H1WA 5EZYB 4HQ0A 4K9SA 2GO7A 4M1ZA 2B8JA 1GPJA 3K0FA 4DEXA 1FXSA 4MVJA 3HGQA 1AIPA 4C4RA 2PQ0A 3DVAA 3WGKA 2GCOA 2C8VA 4G8JA 4L5JA 2OYCA 2E2WA 2DBYA 1T4GA 1ZIXA 1K8RA 2CJXA 1NVBA 5C5CA 1PG5A 2I78A 2IZ6A 2WMNB 4YUYA 3CXRA 4NBNA 1V7ZA 4F56A 5JO0A 1WDKA 2I4MA 2NPFA 1IPFA 2QLJA 1PG0A 1Y4ZA 2FFJA 3LU1A 3TINA 3L1JA 2E0IA 3CH6A 3FY4A 4Y6RA 4R83A 4KEAA 4ZO9A 3N2GB 1XJWA 1C1DA 3FBWA 3GAMA 2DFLA 1FUUA 4HB4A 4UUPA 3QPVA 4YPOA 1NVUQ 2VYQA 2OBLA 2FUCA 2F3SA 1COZA 1ACJA 1O8CA 1U3GA 3UPDA 4JI2B 2EFJA 1X7WA 1ONNA 4MUXA 2I4IA 3EPJA 5K8CA 4GXNA 3QXXA 2C5EA 3G2HA 1NX6A 3P32A 3UAVA 1XTJA 1T5LA 1L6IA 3F71A 1Y3CE 3LUCA 5DH9A 5C51B 1PQUA 3F7OA 4LZOA 5JZBA 1WXWA 2FA9A 5HSGA 3BXEA 4NE9A 1FNMA 3G79A 1YHNA 3EOZA 1EG2A 3AOGA 3LLCA 2RAUA 5EHGA 3RJ9A 4ZTUB 5CD1A 1XWIA 1RYMA 2BAGA 2HMAA 1LSOA 2Z3WA 3L7IA 4WNCA 2A84A 4D43A 3REQA 5LMNB 2WJJA 5BN4B 3G2NA 2BEWA 1A2BA 4K6OA 5CDFA 2QZ9A 3HA7A 1WUTA 4K9DA 1YJ8A 2IE8A 1Y1SA 5EGSA 1BE0A 1QP8A 1KC1A 5D51S 1GNPA 4J1TC 5JW6A 1VL8A 2R8OA 1PN3A 3PUIA 4N12A 4JZYA 2P5UA 4QXOA 5MF6A 1MABA 1GKYA 4YVFA 1M0EA 4YUZA 2J07A 3W34A 2PV7A 3PQ6A 1YUBA 3ZE9A 3D6HA 4I14A 1DOZA 2ZW9A 3CCBA 3M8KA 1O95D 3H0KA 1E3JA 4YRJA 4M1SA 3J7TA 4ZU1X 2KPOA 3WL4A 2NZYA 4LISA 1C4OA 1V3UA 3H11B 4Q3DA 2QI9F 1E89A 3ZWQA 1SHZA 1KI4A 1KY5A 4HKTA 1ZXLA 3HZZA 1JEQB 4IHJF 3NR2A 2W6ID 4MPPA 4EGJA 1DX4A 3MD0A 3RSGA 4GR9A 2XUPA 2WAYA 1BEEA 1WZEA 1XAIA 1LB1B 1G38A 1K97A 1PFKA 1NLFA 2QIPA 1IPHA 3BB1A 4LXIA 4RXMA 5GP1A 1GQQA 3KKEA 2JI9A 2CNNA 3L1HA 1R9MA 1CR6A 4EY7A 1IWOA 2CGEA 4RLHA 3BMOB 2WE8A 5K3DA 4DOMA 4YCMA 4GE0A 4WJLA 4NMXB 4CVNA 1RBZA 2A3RA 4XGIA 5H59A 4Q82A 3WGMA 1QNFA 1FMTA 4B46A 1T8WA 4UBMA 3SHQA 2JBAB 3AFOA 4R9SA 4TYWA 2VT2A 3OKPA 3OF2A 4UMDA 4UDXX 2V7VA 1QH0A 3E9QA 4FJ2A 3F49S 3AFNA 4XUDA 3V42A 2II6A 3BWBA 3D31A 3I9MA 3COVA 3FGOA 4FEAA 4ZO6A 4OY3A 1JX6A 5JSYA 4MYRA 3EGVA 1YZYA 3RWBA 3N53A 3O1IC 3KSZO 3O4VA 4KU4A 2NADA 2CFSA 3LNCA 1FA9A 3MCUA 3NBKA 3PEEA 4JQZA 3CQ9A 3KZMA 3NKVA 4M86A 5TE9A 3QVTA 3O1JC 3JQ7A 2L19A 3UWMA 4CEHB 1R10A 1N5OX 3OJOA 4DMGA 4WA7A 4HB2A 1MPXA 3G5UA 1SG6A 4IMPA 2QM8A 2ZBVA 4I36A 1B0AA 1C0IA 1EM8B 1L7AA 4FN4A 2NO0A 2OV8A 4HWGA 2QE6A 1QIJA 1MTZA 4MUBA 2Q21A 3NWBA 1EFVB 4PZYA 4D0LB 1KO4A 1YZFA 1ZK4A 2GAOA 3R7NA 5I4BA 1CUSA 2J87A 1YVRA 3F6PA 4QECA 4A10A 1VBMA 4BB0A 4ZFNA 5BV0A 1N7IA 4RFSB 4B6EA 3Q0IA 3ZZ1A 2BHSA 3EVDA 2IUFA 3QXJA 4I2VA 3AW8A 2ID7A 2BFOA 2NUTB 4I9HA 5IAEA 1I0ZA 2FMUA 3C24A 1EE9A 1K7FB 4R98A 3ZQKA 4D9NA 1IOWA 3SFZA 3L07A 3LT5A 4MAMA 3WLTA 4N18A 4QGHA 2QPTA 2C7GA 1SY7A 1E9AA 3EVTA 1XSEA 2RMKA 4MR8A 4B3BA 4DLZA 4EJFA 4H18A 5DEIA 5JY1A 1R8YA 2D06A 5AR1A 5JWOA 1U0HC 4KUGA 5EHXA 1GGVA 1SN7A 3P2EA 4HNAA 4WGFA 5JV5A 5DYNA 1ZXXA 3AVUA 2Q27A 4EUSA 1E6KA 1F6DA 2FQYA 2ZYHA 3RV3A 3JD3A 4D4KA 5FEMA 3IIJA 1SIOA 1R9JA 4ZVRA 1O94A 1V9CA 1Q0PA 2F9MA 2VDNB 2QL6A 4GZMA 4NABA 1VSBA 3EY4A 1HDZA 2GD6A 3RRNA 1ZJZA 3EZ9A 3NAZA 4Y2GA 1QANA 3BHMA 2J9ZB 2QE7D 2XWQA 3LXMA 4H3VA 1DDIA 4QDTA 4KXMA 4J3JA 4Q02A 2XQKA 3SEAA 4WZZA 1XK7A 1V95A 1C30A 2YIVX 2QRHA 1K3UB 3R1IA 4PFQA 5HRAA 3CU5A 1IL0A 4RK7A 5F98A 4ZEXA 3T7SA 3NGXA 1W5SA 4LX0A 4N0PA 1OTYA 3ICWA 2GBCA 4DLPA 1W59A 3C5EA 4OGKA 4R2IA 1WBJB 4KFUA 1S7CA 1U9IA 5ANRB 3ASYA 2O0MA 1KHHA 1YVDA 5K3FB 5MHTA 5KHOC 4N6GA 3EAQA 2VIIA 3H5IA 4KIGA 4PPQA 1QAQA 4I4LA 4L02A 3BJZA 2NG1A 4RV5A 4P7BA 2CNOA 2OILA 4COOA 4DG9A 3A6PC 2JAUA 1L1QA 4CLHA 3BJIC 5DNCA 4M87A 1RWWA 5KI6A 4XIIA 5LL6P 1QHEA 1G6HA 1O7JA 3EISA 2DBZA 3KOYA 3M89A 1RRMA 2HK7A 4L0QA 4DL9A 1O5OA 2ZCVA 2FW9A 5KKAA 6REQA 3DFUA 3LY9A 1ZNYA 2YASA 3JARB 2YWCA 4G8CA 4EJSC 3K0BA 1ZGJA 2P3SA 5EZQA 1XYVA 5JU6A 2L0XA 2QN3A 3HN7A 4HJRA 1O0CA 1RVDA 1XZIA 4MRAA 1U7OA 5JNSA 5HIMA 3I01M 1OTHA 4JEIA 1BHQ1 4OATA 3UMRA 1N0VC 3A26A 4KJXA 2FZKA 2BF7A 4B3CA 2DFVA 4J49A 1KK2A 4QX6A 4E4TA 5JZ9A 1TRHA 5FNZA 4ZCSA 4TMWA 4KP7A 4EO7A 1PYOA 3NHAA 3NYQA 1UXHA 3ZGOA 1ZGZA 3HDJA 3FIJA 4H7IA 3F3MA 2VI5A 2CNWD 3MCAA 3KR0A 2FVXA 1BVHA 4OQXA 5LZ5A 3ERCA 3E3LA 4HCJA 3EULA 3THOA 3PX2A 4V2UA 1M2VA 3MTIA 4G67A 1RABA 5DGTA 1LBQA 2JIDA 1MB9A 2C5SA 2R1UA 1SG0A 2E82A 2QQFA 4IH4A 2WYHA 2OENG 2E4UA 3OP1A 4NHEA 4Q00A 4AUKA 4NYIQ 4ETMA 2O2GA 4Y0VA 3E9DA 3EF3A 1KQOA 5C37A 1ECCA 2BFDA 2JA2A 1TKBA 3GHYA 1VHLA 1L7MA 2C2ZA 1QO0D 3L77A 1MRNA 1JAYA 3HVUA 4XM1A 2XDYA 3BICA 3U44B 5LUAA 1M34A 4C07A 4EZEA 2VYFA 3BMXA 4AURA 4BCDA 1YDHA 5KNCH 3P4YA 5C4IA 2F8TA 5F21A 4JSRA 5DLDA 1QZUA 2J6BA 3PNYA 1FX1A 3HKEA 3CN7A 4I6GA 5HF6A 3E9EA 3GT3A 3NVAA 5FUYA 2Y1KA 3OPYI 4OHBA 2G1AA 1XPJA 4IIHA 4KDFA 4Z6KA 4LJLA 1UBFA 1V1MA 2FSUA 3ANXA 4FT2A 3OZXA 4I4TB 3OFKA 3LK7A 2NP7A 4M46A 1UM8A 5ARBA 1V11B 1ESEA 2D3TA 4PLGA 3D7RA 5LR6A 3N58A 4FFWA 4KWIA 4DTIA 4GR5A 2JW5A 4LVOA 3F3KA 3FWYA 3PFFA 4JI1B 3RC7A 3ZLUA 2X76A 1NUPA 4BAUA 4W5OA 2IRWA 2DX7A 5LPNA 3KR2A 4IRUB 4MQ5A 4RTMA 4OXXA 3IVRA 4KHZA 1U8YA 4X1YB 1NXXA 4D57A 3DM5A 3W2TA 2B7BA 4FI3F 2HO5A 3E7DA 4MOWA 4RPJA 3CSSA 2YQ5A 3UENA 1NXVA 3SR0A 3TD9A 2J08A 2OV4A 4IWNA 1BG6A 2PGIA 3I28A 3IODA 4L0CA 1M2JA 1VIAA 1VL6A 3C3BA 4MQUA 5DZSA 3S2YA 1C80A 3S4YA 1D2RA 3AB8A 4MEBA 5G1PA 1NBEA 4MW5A 2PGOA 1V7QA 2DT5A 5IM5A 5J5VA 3BQ9A 4F5WA 4FOSA 3AEKA 3BIFA 4FN5A 2F48A 2I33A 1V16B 2X0EA 4OGWA 1L5KA 3L7YA 3GELA 4O2LA 3UMJA 1EP1B 1EUYA 4PANA 1BMFD 4HSEA 2ZITA 5KOHB 4RMJA 2BCGY 4KQHA 2AI1A 2X41A 4GR4A 1H9AA 3F5QA 1BVRA 3EXG2 3GRZA 4WN9B 2WOJA 2R5FA 3ZZMA 4BFZA 4CIAA 4WKCA 1RP1A 3G8CA 5IXJA 3ABQB 5D5QA 4L5CA 2C4NA 4WXHA 3BA6A 5ALUA 2G4VA 3LUAA 8LDHA 4R4JA 2HT1A 2FWMX 4Y2VA 1I3NA 1X19A 1QGYA 2QF7A 1DAEA 1X3SA 2DKNA 2IXDA 1W6UA 2YS7A 3BH7A 3TLJA 3JATB 3QLUA 2UZ1B 4HSGA 3AFGA 3BAZA 2UYGA 3T3OA 2CFOA 4GPZA 2SBTA 2V7BA 4X84A 1YK1A 1G8FA 3EEBA 4QARA 4BXOA 3O21A 4RK5A 1W4CA 2OUIA 3T7RA 3O83A 5ALDA 4CG0A 4CZ2A 4KXQA 2P35A 4UXJA 2VZ0A 1VLJA 3WL3A 3C1TA 2PLRA 2OKGA 3I30X 2A5GA 4K2HA 5B36A 3W2EA 3F97A 3AG5A 1KBQA 1ZHFA 1OXUA 2BEUB 1P91A 3IKJA 4RMNA 1PHPA 3V48A 1DKQA 4CKEB 4E7PA 4F8YA 3JQGB 4GBMA 2ZOSA 1NVKA 3JRWA 1XN4A 4JC8A 4WOPA 4YAEA 4Y6GB 2QTMA 1RXIA 4Y1EA 1CRLA 3MJVA 2QLBA 2WKSA 2XZPA 1O54A 3KQLA 1I14A 4RK1A 1Q16A 3NH9A 1PDVA 4RJ2A 1T29A 1QYWA 1J90A 3INYA 2JK1A 2RC6A 1IIBA 1SVLA 1UP6A 2R7NA 3TW6A 4BFXA 4O59O 4KRXA 5DCLA 4NCBA 2D2XA 2IXEA 3P0RA 2R00A 4F4HA 4KX3A 1V3TA 4Q12A 4LRSB 4MCJA 3NPAA 1GITA 1XKTA 5BRNA 1G3UA 1NVWQ 3MTGA 2I7VA 1SULA 3MGBA 5AOVA 4F93B 1ZR2A 1OH7A 2PT5A 3PPIA 2QVYX 3GD5A 5BYBA 1T6XA 3ZGYA 3GFBA 1M6WA 2NU6A 1MB4A 5I3CA 3WLMA 4YYEA 4RUKA 4DW8A 2QTGA 1IY8A 3THWA 1VA5A 1E6UA 2GBLC 2ARKA 3FIUA 4LSZA 2JLXA 1GKUB 4UVGA 3NHJA 1E2HA 3BJRA 1P5JA 3FM9A 4LMBA 1O6GA 2IYEA 4RVFA 5K8UA 2XLCA 2C0QA 1TEHA 3UG6A 2ZFUA 5D2CA 5LVAA 2RI6A 3K1JA 4G63A 3PHJA 4X9XA 2HXGA 4RTPA 3TF5A 4KYVA 1K89A 3GIWA 4MR7A 3ROQA 1P1JA 2Q28A 2UUCB 3O93A 4NE7A 1E9RA 3H0CA 3MOGA 6GPBA 3WLAA 4LK3A 4RDCA 2EARA 2HGZA 5FOWA 4Y9TA 3FZEA 4NPAA 1YMUA 1NA5A 2AYXA 3S1AA 4EGFA 2QLLA 1KTIA 4X54A 1AU9A 2CVHA 4ZQCB 2P11A 5IH3A 3BRWD 1Y4SA 1H05A 5CPFA 3OZFA 2XZTA 4EKYA 4Y2UA 3IUYA 2UVPA 2JFPA 3A4VA 4G0QA 4Y1RA 5AICA 4JC0A 4M1TA 4IDQA 4TMFA 4G4JA 1RXVA 4LJ4A 3VOSA 2MOKA 2GPBA 1KJJA 2VTDA 4PU0A 1H69A 4XRRA 5LSAA 4BRSA 1U02A 2YVLA 2HKIA 3USES 3P0IA 1VPWA 3U80A 3HUEA 1RRFA 5JVDB 4BTVA 2PAFA 3U19A 2HRZA 5T64A 2HMSA 3N75A 2O6HA 2C4KA 3LZ6A 2A0FA 2BFCB 4EG4A 1E1RD 4OL0A 1EVYA 3AY0A 1J21A 3ZXSA 4HYQA 5FO1A 1TUGA 4C0JA 1OV6A 1FNCA 4F9FA 4C89A 1PWHA 1EUCA 3KXIA 5TQ0B 3WWDA 1E63A 1FX0B 1J9EA 1STOA 3ONDA 3P9YA 1FDTA 5CLQA 2HBRA 3PJFA 3U48A 1R18A 1UBHS 3D8HA 3IT3A 3B53X 3QU4A 1KYZA 4U2EA 2KQUA 1ICEA 3D3NA 1C1YA 1C4WA 3ZK8A 1SCUB 1PGPA 1DXQA 1L7XA 1V37A 3COYA 1ZZGA 4HD8A 4Q4HB 4NCHA 3LFTA 5GZ6A 3UUWA 3ZTTA 1A5BB 1T15A 4RKEA 1Y7HA 4MVJI 3WLNA 2HIGA 3EXFA 1ZUWA 1R3DA 2R3SA 4AVYA 4B4OA 3P8ZA 3IURA 1C0PA 2HLDA 2A2ZA 1M3SA 3OZEA 2BFFB 2GZ2A 2Y2VA 2VOJA 1C4XA 3TCKA 1D9ZA 1X0VA 1JSLA 2JIMA 5K1ZA 4BZPA 5K0JA 3B6IA 2YZ7A 3W6ZA 3RYHA 1XDDA 4WADA 3DAOA 3NGLA 2ID4A 1X87A 2VSQA 1E1CB 3D3QA 3KSDO 1DIGA 3PC7A 5DLQC 2A0UA 4FU0A 3JY6A 3CUVA 3SZ3A 1KAOA 2ZU0C 4ZOLA 4DV1B 1S8OA 1A95A 1XQWA 5IVPA 4W6ZA 4XWTA 4LDZA 3VPFA 1NBMD 1N4DA 4MVJE 1CUAA 2E9SA 3H2ZA 3G2OA 3KYBA 3SFVA 3Q7TA 4KYUA 3MQ2A 3BE8A 4DM3A 4QEZA 4RTKA 2C57A 1OLSB 4MJ7A 5JC1A 3HBMA 2VVTA 2WJAA 3NKLA 4K6MA 1PR0A 2R62A 3OQIB 1WF6A 2FSFA 2QD4A 3R09A 2PZLA 4PLCA 3UK1A 3EMVA 4YV2A 1TUEA 3KJZA 5I8PA 1B23P 3N3AC 4YH1A 3AKYA 3INGA 3RT9A 5BNWA 2P0YA 1YBVA 2X8JA 2GK7A 1HL7A 4CMAA 4C5BA 1T5BA 3C0KA 2D0OB 4O4IB 4QOEA 721PA 1OXSC 1OF1A 3LNTA 4MPJA 1DLIA 4M9XA 5FBZA 1GZVA 5A5DA 4HH4A 4RCZA 2IEIA 3VH2A 3WYFA 2RAVA