2HREA

Structure of human ferrochelatase variant e343k with protoporphyrin ix bound
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Substrate interactions with human ferrochelatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 138
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hreA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hreA01
1QGOA 2Q2NA 3HCNA 3HCRA 1DOZA 2QD5A 2PNJA 3LYHA 3W1WA 4CCSA 2DJ5A 2H1WA 4KLAA 1LBQA 4KMMA 1AK1A 2H1VA 3GOQA 3AQIA 2AC4A 2XVXA 2HREA 2XWSA 2QD2A 3HCPA 1TJNA 2HRCA 4MK4A 2Q3JA 2PO7A 1N0IA 2XVZA 1L8XA 2QD3A 2Q2OA 2QD1A 4KLCA 4F4DA 2XWQA 1LD3A 3HCOA 1C9EA 1HRKA 4KLRA 3M4ZA 2PO5A 2JH3A 2XVYA 2XWPA 2HK6A 2QD4A 2AC2A 2C8JA 1C1HA
chains in the Genus database with same CATH superfamily
2C4VA 2W2QA 2HPVA 4OQLA 4OMFG 1BE8A 1SVOA 1ZQ9A 2OXIA 3ITEA 3R3ZA 4S05A 1YRLA 2ZUCA 2E18A 1E2PA 4PCVA 5D8DA 3V7YA 2C57A 4DC1A 5IKEA 1OJ7A 2J3LA 3H3FA 1SKBA 5SY9A 3SR4A 3VO1A 2PUFA 3D0OA 2R3SA 3BWDD 1VJCA 3Q3IA 4P4GA 2WMNB 1T5TA 2BR5A 2RGUA 2ZSIA 4EX7A 4LY0A 2ZT7A 4UPEA 1OLSA 4TSRA 3SNHA 3OEHA 3ZNQA 5EHZA 1FJHA 4JYPA 2Q1XA 2AX3A 4YB8A 2HLDD 5FNVB 1JQJC 1PN3A 2HCRA 4J03A 4LJSA 4XYEA 4K88A 4XOUA 2X15A 5HMLA 2QR2A 2LTAA 2FSSA 1IEXA 2CXHA 4JROA 1EWKA 1FUYB 1ZIPA 4FZVA 3TTVA 3NMUF 2B99A 5I8ZA 5KYGA 1Q50A 1R27A 2GNAA 1EBBA 5KNDD 2C99A 2Z6QA 4E4RA 4EWLA 2QLJA 1KBQA 4LW8A 3RTGA 1IMOA 3IAS1 1NL3A 5I4KA 4D0LB 4RY8A 4YBRA 4EG4A 1RMQA 4R1OA 3CMCO 4OIMA 1AURA 2XNJA 1BQ4A 3GT3A 1IHUA 1CIPA 2VJNA 3NDPA 5IMSA 3U19A 2XZDA 1APBA 3J80A 2YXBA 4DV5B 4E13A 4HDCA 1DC8A 2WSBA 1SQFA 3WL5A 2BEUB 3GOHA 3HKEA 4QTYA 5HM6A 1GUBA 2HLDA 4BNIA 3LPLA 4RADA 3AI3A 3GQBA 2VF7A 2I34A 1Q0HA 2EVWX 2V0NA 3CX3A 3PC6A 4PHTA 4Z2YA 5COBA 3E2IA 3WOVA 4B6EA 1SG6A 2P1ZA 4UAUA 2Y1FA 1YR7A 1JAXA 4U9IS 4MQEA 3C6YA 3BMXA 4JLOA 4ZCPA 2JFQA 5NLLA 4H1WA 1FVOA 1VLJA 3GA5A 4FYPA 4K6KA 3OZBA 3ER6A 4ROSA 3UWOA 5EIBC 4U1RA 1SJ9A 3CONA 1D07A 3JQ9A 5KTSA 1J1IA 4K03A 5GGYA 4EFNA 2F67A 3RF6A 1ZL2A 4FMCF 2A30A 3F7NA 3GZNA 4K9SA 4DA6A 4ECAA 4BV8A 2H3HA 4RA9A 2DETA 1UKAA 3D3QA 4K9NA 1C8KA 2P3OA 1M8GA 2A1TS 3LRXA 4LBWA 4XWYA 3KQPA 4RESA 2C98A 4QFBA 2VFAA 2X86A 1D0VA 3Q3VA 5EHGA 3NC1C 3HJNA 1AQLA 2PGJA 3RC2A 1C9DB 2WDZA 3ZWMA 2HCTA 1VLLA 3UENA 1R6VA 5K7SA 4TYQA 4RV4A 4WOCA 4QAQA 1P7WA 1DBRA 2BTQB 2WR8A 3RIYA 1SHJA 3P4YA 3V7WA 4S0XA 1PR6A 1NVFA 1PQ4A 3X2EA 5B3LA 2Z4SA 1W0CA 1D6MA 1OHHD 4DB2A 5BMOA 4F5ZA 3OIYA 1W5SA 1WF3A 3DFUA 3UHJA 3EQ7A 3PFCA 4OU4A 5BSTA 4M9XA 4AXBA 3RT1A 1DWQA 2PWBA 3PQ5A 3R0VA 4QEKA 5ARDA 3STYA 4C43A 1X1TA 4EO9A 4JVNA 1AN9A 3RVNA 4FC7A 4XH9B 3MJ4A 3G2KA 4BFXA 4DKXA 5MGNA 2C1EA 3HKDA 1B26A 1E5TA 3CUVA 5EE9A 4K9LA 1H8HD 4FWBA 4ML3A 3TI9A 4CT4B 4E5PA 1D4AA 2ZUVA 4NMLA 2YJGA 5H70A 1IEQA 3UK1A 3WJ1A 4YMTA 2B1JA 2V1XA 2E4XA 4PPFA 5EIWA 1S5PA 2C00A 3O91A 4U6NA 1IXYA 4K46A 5I6DA 3KTFA 3FVTA 5JISA 3TGWA 2OCAA 2R47A 3WIDA 5AVZA 3C3BA 3EF1A 3NTXA 1C3OB 1RQ7A 1ZCZA 4AECA 1OHHA 2BZGA 3CO5A 5IKPA 4EGFA 1QFYA 3U0BA 1DI0A 1OI7A 1IXSB 5CDFA 1NOKA 4B80A 1FF9A 2BR3A 3KQYA 3IUSA 4MCIA 4PQRA 1JALA 3AC0A 3K8YA 2H2DA 3I3OA 3H4VA 2RGDA 4EZIA 4EPXA 4YV0A 3DUFB 1QMPA 1F2TB 1JXQA 2DH5A 4KFTA 1U1IA 1LC3A 2WTEA 5B1DA 4F4HA 1THZA 3ILSA 3RE1A 3DHNA 2NUPA 3BL8A 3GFBA 1M6VB 2QLNA 3G0GA 2IV3A 3WKDA 1LK7A 1G66A 4B6SA 1KMHB 3D4LA 5DB4A 4NYJQ 1BA2A 1QIKA 2Z98A 2GO7A 4XW2A 4BKMA 5L51A 1GPUA 1M10A 5FPHA 2RE8A 5EXTA 2RDMA 4K05A 1ZU4A 2HA0A 3H5VA 1TKCA 3JALB 4U63A 1XJWA 3SEFA 3BAZA 2PQ6A 5DHTA 2ATEA 5BRAA 1G3IA 4DZZA 3KR2A 1EM8A 1H2FA 4WLVA 1YQUA 4PAWA 3KKOA 4PFKA 2X23A 4OXXA 1M8FA 3X43A 1CZUA 3F2IA 2OZEA 4MWEA 2ZULA 5AW5A 3D3JA 3CUSA 3ESXA 1RBQA 4LFCB 1R4MA 2D00A 3BIJA 1GG5A 4P38A 5FLYA 1PR3A 1T34A 4WZBB 2IEAA 1R9NA 1Q57A 3AP2A 1J0XO 1A5AB 4J2HA 3VDNB 5GADl 3BCHA 1NQ5A 1LVHA 1SIOA 2QU8A 3UW1A 2WT4A 3U4HA 1PJSA 3JQRA 3V7FA 4CN8A 1TM5E 1V7ZA 1ZGHA 2F1HA 4JQYA 4ZCIA 3UH0A 1HXHA 1O9BA 3WK6A 1HZZC 1KXJA 1E9CA 3M4XA 1UZNA 5CXUA 3E2MA 4MUMA 4TTIA 4G0MA 2PRZA 1JYSA 4GKBA 5FQNA 2IIVA 3MZ0A 4YTEA 4AZTA 2RKWA 2VPWA 2A1IA 2GFQA 3ONWA 4Q4JA 5IUNC 1BDHA 1YB5A 3NV7A 3EIEA 3OQIB 1UFQA 3ROMA 2ADMA 4MK4A 2IHKA 2YJTD 4QOFA 3V1UA 4AQ7A 1E1NA 4F6CA 3ODGA 3MK31 4CTMA 3PXCX 5LIPA 4PPYA 4EGAA 3AG5A 1Q7EA 3BB1A 1NFFA 5D2CA 3UO8B 5LA6A 5KTPA 1GGMA 1D5CA 1M73E 3K0BA 2QK4A 1QLJA 1VB3A 2WAXA 3M9XA 3MELA 2IYQA 2Y1OA 4WXPA 5KOHB 1BD3A 4Q39A 1OLXB 4DDTA 2GT1A 2P4EA 1ZLYA 3B38A 3GFVA 1X9GA 3AUJB 4JP8A 5KEIA 3MJTA 1Y42X 3SBXA 4X20B 4HQKA 1YMVA 4ZXFA 2DEUA 3L7NA 5B12A 1XYYA 3E7DA 2NP7A 3RIMA 2VSYA 3TTYA 2W6NA 5KWVA 3QV1A 1CUJA 1NRJB 3H04A 5EWLA 5IBCA 3OIUA 1C4OA 1TD9A 3H0EA 4G41A 1UBRS 3KKKA 4R9SA 1QH8B 5JXIA 1ZP6A 4F5DA 2XF8A 2Q8QA 1NJSA 1QH1A 4HQNA 2F1IA 5TF4A 2FTKE 2O6LA 4IDPA 2OHVA 4Z0TA 1GVNB 5F9FA 2PXAA 4B79A 3RSHA 1JHMA 4K6OA 1R6BX 3QBDA 3F1LA 1PS0A 1NQWA 2HF9A 2NUTB 1GGKA 4PXSA 5GZ1A 1NR5A 3EF3A 4MZDA 2DRIA 5H4HA 1OLSB 2BFNA 2TMYA 3DT8A 1XHLA 2A8YA 1UZMA 2A7XA 2QTMA 2VDVE 3WICA 5K6AA 4XRRA 4KQ6A 5IZ4A 5J40A 1RM0A 3I01A 3M7IA 5FIUA 4B84A 2AXQA 5HCUA 5KVAA 1T5LA 4A27A 4HBGA 2E1RA 1HNZB 2D54A 3M5DA 5D85A 3A1WA 2VXOA 3FMIA 3FYCA 1K9SA 1E2DA 3LC1O 5J9FA 5T8KA 3VVMA 1K4YA 4WLOA 4AJLA 2F43A 1DMSA 2ROQA 2Z4TA 3AF1A 4TLEA 2XMCA 4CKEA 1P2BA 3CRVA 4ALMA 1M1XB 5LXTB 1CF9A 3BQNB 3HS3A 3GDWA 2WYOA 4MV7A 2FSPA 4P2BA 1QIGA 4KO2S 4C0SA 1QPGA 1IY2A 1MU0A 5JCPA 3GZ4A 3D8UA 1M34A 5JANA 1QRSA 4BKUA 2H5JA 1G1AA 3IVXA 5ALJA 2RHLA 2C58A 5AKZA 4HP8A 1FMTA 1XRLA 3PUXA 4OBEA 5EG5A 4QUIA 2XTMA 1NLYA 3QW4B 3RAPR 1JH8A 2BSXA 4FX2A 4UBOA 3V8MA 3NIBA 3FD8A 5CDHA 3M6LA 4BJ5A 4EP1A 1UQRA 1YNOA 1T35A 1TU0A 1NYRA 1JIQA 1MOPA 3ASZA 4GMHA 3ILYA 4OQZA 3G8YA 1ZAKA 3HACA 3VQTA 4ZK2A 2DUUA 2XXAA 1I0LA 1SWWA 2OCDA 2VJBA 3DD5A 3ZWQA 4AJ2A 1OZFA 3KJXA 4L16A 1O6BA 2EX4A 4IILA 2PRKA 5KQLA 2GCGA 2ZYIA 1QMGA 2BRUC 4W1PA 4PZAA 4KYVA 4CM7A 5E6RB 3JZIA 1G4UR 4R8LA 1ISPA 1WETA 4RF2A 1Y3FE 1XE3A 3B1KA 4H7KA 2NPIA 4QJIA 5JWHA 4OJNA 2BGIA 4XQEA 3P2EA 1R0WA 5F33A 3C3DA 3FNEA 1O94D 4N54A 4UHJA 3CG4A 4ZRDA 1FXWF 4N7JA 4AKHA 2HQ1A 1QZTA 1TKAA 3OZVA 1PKXA 1V16B 2FUKA 2GRJA 1QGZA 1W93A 1PYGA 2P6MA 1JR4A 3MWEA 4L57A 1I7SB 1CRWG 2P9BA 1ABFA 3NBAA 1PLLA 3DNPA 3RF7A 2YDYA 4WXRA 5EYPB 2VK8A 2IU3A 3KHUA 3K73O 3WHIA 3GLUA 3N74A 1P33A 5AJZA 2VWPA 3FR7A 3QM1A 4OBBA 2I0FA 4TLDA 4XQCA 5CTAA 1T4DA 4HQOA 1G38A 1DTWA 3ZHRA 4GI1A 3DE7X 4LNUA 3A3OA 1U0SY 4KXXA 3ZDBA 2QSJA 1I7LA 5IYZB 1XVUA 3DZCA 4L4RA 2D2FA 4RHYA 4X1IA 5ECWA 4Y2SA 4M0LA 4NLLA 2ENWA 1E7RA 1TVMA 4IPTA 4F04A 3WB0A 1O94A 4JJEA 3GB9A 1B8NA 2I03A 2Q3HA 3G23A 1EVQA 3OE1A 3TKLA 4PPQA 4V0RA 1QX3A 3NGMA 1SOWA 3NW9A 2BH9A 2X0RA 3DB1A 3QJGA 1BQ3A 1X7WB 1H2EA 2OCKA 2HUNA 2PY6A 4JSRA 4L5JA 2YJ5A 2YL2A 2C0PA 3QVWA 2H5IA 2AMVA 5CW2A 2H2AA 3OMWA 4H1HA 5ITZA 3FPLA 2RB4A 1KO8A 3PWSA 3IB3A 4QSMA 3IOBA 2NO7A 3HM2A 1BX1A 1FU8A 1LSOA 1VBNA 1Z08A 3BZUA 5F78A 4DLTA 1EIWA 3AI7A 4QYWA 3BXPA 2YZKA 2ZCUA 5EFOA 2I2AA 4AX4A 1KFCB 3DBVO 3W04A 5B3JC 4J94A 2YWHA 3KEQA 4AX8A 5LZ9A 2WF9A 1N2BA 4TLLB 2A5DA 3JZMA 4JDPA 2E87A 3KT3A 3W4JA 3C3AA 2H59A 5I7VA 1FFHA 1P8JA 1VXOA 3WB9A 5CVJA 3WWEA 1GGJA 3O8QA 1EPUA 5CM2Z 2QI9F 2WKRA 2IXAA 2H1RA 4L07A 5AKXA 4DS3A 2QSZA 5EZQA 2JFNA 3PUJA 1MFPA 3B51X 3OAAD 1ZM4A 5BXQC 2E85A 4BTLA 4TVOA 1SCAA 2DFTA 5EAIA 1OH6A 5FHQA 4EG5A 3LCCA 2CVQA 1Z5GA 5FPKA 5INTA 3RUFA 2VQ3A 4C76A 4F2DA 1X86B 5HUJA 5HZKA 4UKDA 3L0IB 2B4QA 1W5EA 2VDOB 3TG8A 5KQPA 1ZM3A 3RSOA 5JAHA 3EVBA 2Q6IA 3QE9Y 2AOUA 3GAMA 2HBZA 4MS4B 3PXGA 1JFRA 1MAWA 3KOXA 4CGYA 1KKMA 1YDWA 2AXPA 5IXJA 4J0HA 1KWKA 4MEAA 3H87A 2H07A 2BDEA 2DERA 5JNLA 3A06A 1YDEA 3OAAA 3C7AA 2QW8A 3EHDA 1YL7A 3N76A 3H2SA 1V3UA 3A4NA 4HDKA 2CFTA 4JI5B 1VL6A 1DFHA 3NHMA 2WU4A 4Q4JB 4R2LA 4RE5A 4EKNB 3LQFA 5EKDA 4DY6A 3UJ6A 1I3CA 5CR9A 1ZVQA 3HCWA 1YQEA 3PDUA 5AJWA 1E3EA 3U1BA 1LBEA 3CN9A 4CN9A 4X97A 1UMBB 1E4VA 3KOWA 3AJEA 3HEAA 4RIEA 3STHA 3W90A 4MHOA 2ACWA 3I05A 3KLNA 2ZB8A 1G9SA 1DQRA 3AU9A 1C50A 2YRFA 2VZ9A 2NV0A 1NQVA 1U28A 3HSKA 2Q5QA 3KVVA 2CNDA 1TTPB 3WDLA 4YCBA 3ZV7A 2A9RA 3H2KA 4C5BA 1LTHR 1PAUA 1TJNA 2H52A 3NTLA 5G0VA 1LNZA 1KEEB 3EW7A 5FKJA 4TV8F 5FL7D 4ZCSA 3GLGE 5TDHA 2GK7A 3EARA 3IAM1 5EE3A 2BR4A 3HXPA 3CURA 1VG0B 3OCXA 4G97A 5KYKA 1S8FA 2EFDB 3DS8A 1ZUD1 3HYCA 3SXPA 2ZB2A 4AROA 3MS4A 1PKEA 1UQTA 4P83A 4TXMA 4ZVQA 3TW6A 3VC3A 2I6QA 3C15C 3G0CA 4JKIA 3RG2A 4C01A 1L6IA 2P91A 3P2MA 3UMGA 3GAZA 5A1JA 3UGTA 3CLSC 4OI1A 4YHHB 4KB5A 1YXMA 4XUEA 2O2XA 2G6TA 4LXTA 4WWHA 2OOSA 4L8YA 3NTVA 1L4HA 1AQYA 3IIIA 1FLDA 2RI1A 2O4UX 4KVFA 4I3FA 1ORRA 2C7VA 1F5SA 2V98A 4JI6B 4QVKA 3GRZA 4MNTA 4M98A 5FLKA 4MQ6A 3QE4A 3HZHA 4RAQA 4V0ME 5FL7A 5GPBA 3EXIA 2NVUB 1RRKA 1VCHA 3Q88A 1ONSA 4OQYA 5ALEA 5DM2A 4KIGA 4QG3A 4URXR 4YMVA 4MUGA 2O06A 3EMBA 3F49S 4QTTB 1WBDA 2RHBA 2ZYWX 2WPDD 3FGPA 1U0EA 1GU7A 2P5TB 4DLXA 4YYZA 2VYND 3RVRA 4ACAA 1PJBA 2KBEA 3L1KA 3DXXA 1S4MA 1CD5A 4CKEB 4RKFA 2XQJA 1QCYA 2DT8A 3S55A 1I2MA 4COKA 3SZRA 4DLRA 2DBVO 1VE6A 1YJAA 3ND5A 3ZBQA 3KSBC 3RC8A 3CNQS 1LPSA 1AS2A 2A3RA 4L8FA 2X8WA 1DEKA 1M34B 2W7TA 4G65A 4C6TB 1X0VA 4YRZA 4DDUA 1E64A 1SVLA 1KORA 1XTVA 3RYTC 4NZZA 1Y5RA 2DXIA 1Y9EA 4L7VA 3U6KA 3L9WA 3P9YA 3DE2X 2AQ8A 2FEXA 4EEXA 3HCDA 2GN8A 2W00A 4AJIA 3K70C 1MO3A 4BCDA 1SU6A 5E2BA 2WPDA 3FTDA 1DOAA 4CF5A 2B36A 2JD1A 4LWZA 2P4UA 3RVLA 5HQ3A 5TF0A 4DAOA 4DZTA 2B34A 3NBKA 3DF9A 4Q3DA 4ZT2A 2JIDA 4A15A 3RS8A 2VG8A 1T26A 4P7BA 2AC2A 2ZRGA 3NDIA 1YMUA 4LOJA 4CMHA 2WD7A 3ZX4A 4C7OB 1EFPA 2QMYA 1LA2A 5ANRB 4EARA 1FTYA 2RC5A 1LBQA 1UMCB 4CF3A 2K6GA 1QKJA 4MLZA 3NEYA 4PNEA 2OY0A 4IEIA 1ORIA 2D1QA 5F64A 2GCOA 4L27A 2EDAA 4TUYF 3VU9A 3PICA 5FJJA 1Z5WA 4GEKA 5L4SA 5K8UA 3GVXA 2HMWA 3DOUA 3RUHA 4O02B 4F8JA 1HY3A 2UYOA 4IVQA 1JFLA 2O57A 1BRMA 1DO2A 3WMEA 3AY0A 3GRVA 4XM1A 4N8EA 1NYTA 3N39C 1C1DA 2M1XA 4YASA 5ADHA 3L4EA 3QQ5A 4L0MA 3EB9A 1MQAA 2OORC 4Q3OA 3LECA 4AIIA 1WZNA 3TGPA 2C83A 1E94E 1FQOA 3KTAB 1TQ8A 3OJEA 3SQXA 4H3VA 4LNUB 4YRCA 4C2BA 2XMRA 3QLTA 5FOTA 3QFFA 4X1IB 4FE3A 2WWYA 1GCGA 3KB6A 2R86A 2PUBA 3JSXA 3NXSA 4OX9Y 1KY5A 2BMVA 2X0FA 4A9AA 2FPWA 4RDIA 3BILA 1XK7A 1T6XA 2NSHA 4UE6A 1YHNA 4WLUA 2CE7A 4RVFA 2GHIA 1UINA 2ZW9A 3OO1A 1J5XA 1KZYC 1JU9A 2QXYA 5BSHA 5D1HA 5ITZB 1AV6A 4B6QA 1BROA 3DE3X 3CVOA 3W6ZA 3BE5A 3LW7A 3QPWA 1ZOIA 3LDGA 3WDSA 3G88A 2H2HA 3HLTA 3KK0A 3LL7A 3VOTA 3VBEA 5A2QA 3IHWA 2D62A 4HDSA 2DHCA 4WCFB 4B32A 5EJAA 4KAXA 4BVGA 3DFIA 1K7SN 4MUAA 1COWA 4WZAB 4JT9A 4J0JA 4OEHA 3O8NA 1G5QA 1MT3A 5T64A 5K0ZA 3BIXA 3WLMA 1JAIA 1O95A 2EBWA 1A8HA 4KK3A 1BJKA 4JYAB 2AFIA 3WGMA 4KO1S 2HQRA 2JGKA 1IN5A 3H5IA 4M0DA 3UM9A 3ZS8A 2FWAA 4M55A 1FE8A 1MC5A 2PSSA 2ZR9A 3HJGA 3D0RA 2R1TA 3PL5A 4GOKA 3VC2A 2IY8A 4D7AA 4XVRA 4I5FA 3RSLA 5ALZA 2HUPA 5DIZA 5ESXA 5ARBA 2J7KA 2J3MA 1WM1A 2D0OB 4KPUA 3HKCA 2ZUUA 1RVV1 3G02A 4EPWA 3DMRA 5CNIA 2IBMA 1GRQA 2Y67A 2REBA 4BX9A 5IJ9A 2PA3A 5HKAA 1UANA 4YRLA 5ITSA 2G71A 3U31A 3T7DA 1WDMA 1KEUA 2W2PA 2ZSJA 4H17A 2CUZA 2AOUB 2QIPA 4QASA 4LYAA 3W3ZB 4O4IF 4DYVA 2BFCB 2VBIA 1U5CA 2VNSA 3A4MA 3N87A 2FSHA 2R87A 3OFKA 4U2GA 1B6RA 2FPLA 4YMHA 3C7DB 5JDIA 3E58A 3KS9A 4GMXA 2Q0XA 4NU0A 5T67A 2YDXA 4EELA 2ZYAA 1ZHOA 1WVGA 4S1TA 3ZD8A 5HKOA 1OC4A 1PZGA 2NSJA 1K7FB 2XE7A 2ZJ8A 4RZIA 4WCVA 3RKRA 4WINA 5IT4A 4CM9D 1TZKA 4EAQA 2XUIA 1N1EA 1WKVA 3T3OA 1DP4A 3TL3A 4DM7A 3RV4A 2YIVX 3AR3A 4LE2A 2GKSA 3B1JA 2WICA 3GHHA 4AMVA 5D3MA 3N6VA 3IEVA 1FS6A 2BMJA 4Q82A 1LJUA 4J7UA 3VR4A 2Q1SA 4KQXA 3H4IA 4K26A 3LP8A 2D5AA 5K3FB 4DIBA 2O4CA 4WIAA 4AZVA 3DAFA 3AY3A 3Q40A 3I23A 4P4SA 5AKKA 1KI1A 1TA4A 4DIUA 3OKCA 3OQ1A 3I9OA 1PW7A 1ZXLA 4EA8A 5GVSA 4K0KB 2VSNA 1UOEA 3HB4X 4TKUA 3N0VA 4QBKA 3WIVA 4BNDA 5SYNA 1I6MA 3NTOA 4PZPA 5LLDA 4C3VA 4QGSA 3WAKA 3IIJA 1XP8A 1TAUA 3T4PA 1LFDB 4CM9A 1ACLA 2WMDA 2YHIB 1P4RA 1KFKB 2NX2A 1M5TA 4KPGA 1GCOA 1TVKB 2XUKA 3CFYA 4I1YA 3I72A 3P2JA 4FQ7A 4N40A 4OHXA 3U3OA 4PW0A 5DLYA 3E03A 3N05A 4MVJG 4M8IA 1P0MA 3TRDA 1OXVA 3Q5EA 2I71A 4X66B 1F2UA 1LX6A 1LWOA 3G7SA 1KGSA 1TAGA 1SVNA 2C9MA 2XUAA 1GAXA 2XSZD 5IBRA 4TRMA 3EXIB 3STXA 4U7WA 4EMTA 1L4NA 1HSOA 3DJFA 2I7VA 1XA4A 4JQZA 4OH7A 1WVIA 2JGDA 4RKYA 4XOIA 3IUQA 3GT0A 1XPOA 3TK1A 2WTUA 4UHBA 3DTVB 5JSYA 2OFWA 2AX4A 2YHAA 4URUR 4ZO8A 1YQ9A 2CXOA 3NIFB 4BBJA 1ZRSA 3KKEA 1TFUA 1DBQA 1NV9A 1TGVA 4TWAA 3U09A 1EE1A 4G5YA 1JKXA 4PX3A 5FYQA 4GM1A 4DLBA 4EHIA 1NASA 5K0EA 3VNVA 1OV4A 3DJYA 3HPRA 221PA 1PW5A 5A3JA 4JU8A 4R41A 1PGQA 3RTAA 2M6SA 1X42A 2J67A 4OFWA 2QM3A 3FAKA 1QHIA 4QYSA 3NXKA 3TTSA 1II8A 3MF4A 1CT9A 3MC1A 2B8EA 5CLQA 2XSZA 2Q3EA 1UJ2A 1BHJA 2BONA 4V0LA 5JCOA 3LQKA 3FMGA 5I01A 2C2KA 3TNDA 3MA0A 2AFHB 3P1JA 2ZUTA 4EL0A 2V0GA 2HIGA 3SOZA 1KPGA 3S1LA 4Z49A 3COVA 1WQ4A 5G41A 3GLFB 5L6LB 1FRFS 5JVDA 1R5JA 1I4DD 2Y27A 3N9IA 3BSYA 1ZO8A 4JC5A 2P2SA 1YB1A 1SU7A 3PC8C 3UHPA 1EE9A 1MJGM 2NV6A 2QVCA 2WY2D 1SU4A 4KRFA 4IQ4A 2YBEA 5GP1A 1NNSA 2WD7B 2I6XA 3KUKA 3OE4A 2GFIA 2WP8J 2WZCA 1SQ5A 3JTMA 2H1OA 1CVRA 2J5RA 2ZE8A 3AV3A 3EWIA 3LDUA 1Z06A 2CDNA 2IYSA 1C4KA 2C84A 1MN6A 4WE3A 4I4NA 2HMUA 2C2XA 3VU9B 1HT3A 3GDGA 1FLNA 2GWRA 3KR9A 1Q92A 4LPSA 1DC6A 3C7CB 2BEWA 2V96A 3FOBA 4HR7A 5AHOA 5F7ZA 4EUEA 3JV7A 3RGGA 1MEJA 2Z1MA 5HQTA 2EXXA 2VQSA 5KDOA 2CMKA 1SKUA 1Y1QA 2DPXA 3RRFA 4EL5A 2QXUA 1RACA 2Q2QA 4ADSG 5JBQA 1JZQA 2J0QA 1X7HA 4X8LA 3VAZA 3FOFC 1ML4A 3KSZO 1QXSA 3KZMA 2C4TA 1L7NA 1HSZA 1VPVA 4YRSA 3OLCX 4JWKA 4ZYUA 2GCIA 2YVQA 1V39A 3O2SB 3PA8A 3TD6A 1GDHA 1XCJA 1RAEA 3F5FA 4PZCA 4J6EA 5C8YA 4D9HA 1RXEA 2HY7A 3TDKA 7YASA 5TPZD 4KKVA 2Y92A 1A72A 3AUXA 3BJIC 3G68A 4CV3A 3FOCA 3DEHA 4EITA 3LGXA 2GASA 3D6TB 3L0CA 5KSWB 1IOWA 1BD4A 1QYVA 2W6ID 4EF6A 5I4BA 3GLIA 4KNVA 4JJFA 1B15A 4Z1MD 1Q2XA 4BXOB 3T5AA 2WF7A 3MBIA 2J1LA 1N77A 3SDZA 3SX0A 5AVWA 1WB9A 4E30A 1T4GA 3TCNA 2X40A 3OOJA 1PQYA 3EGOA 4LHSA 1FUEA 4GP9A 2W70A 1FL9A 9LDBA 4K3UA 2WUVA 1JEAA 1JSRA 2FGKA 4GX1A 4F0JA 3ZQ6A 2QT1A 1ZU5A 1TT7A 3WLLA 1V8OA 3LO5A 1ENYA 5EHNA 5HE9A 5TPZA 3VO8A 4ZJYA 1TK3A 4MA0A 5I9IA 3QX9A 1E2QA 3EASA 2E55A 4DJ5X 1XQWA 3AV0B 4YIHA 2AF3C 1VLVA 4IL5A 1M2FA 2ZLBA 4B45A 4QATA 1SHKA 2W6IA 1RKXA 3VJMA 4AC9A 4YS6A 2ZUWA 3L92A 4RF5A 2IHJA 1A5SB 1GEEA 1RWQA 2R1TB 5AYVA 4Z1MA 3HVRA 1ZR2A 1KK0A 1T0PA 3HZOA 5AK0A 1CDZA 4MB0A 4HD8A 1YJCA 4O0MA 5K05A 1GQ2A 5JYDA 2CV0A 2XHZA 4N6NA 4H77A 2GN2A 4H0NA 3NO4A 1V6SA 5CXQA 5AVSA 2AZTA 1QC5B 1IYZA 3LBYA 5IJ9B 5LP6A 5LJIA 2AT1A 3NIDB 2R8YA 1X6VA 5DV9A 1VHTA 3QXJA 3I32A 1BE1A 4R0VA 1DRUA 2CKMA 4UCFA 3UWPA 4EJSA 5DYNA 1ZRNA 3IVGA 4YUVA 4JMPA 1G8HA 3M1LA 1IY0A 1XZEA 3IKVA 4G09A 4JP2A 5JAIA 2BGTA 2VOJA 4Y2YA 3UGJA 3ON5A 3O83A 1HOXA 2JAPA 3EIOA 4MW6A 4C22A 1VMIA 1VSTA 3WGLA 1DAIA 3MYYA 3PXUA 5DK4A 5KQSA 3HU2A 3ABZA 3GC6A 3PT5A 5GM2A 3FOWA 5A4FS 4IQ0A 1ONBA 5AW7A 1N1GA 2ONZA 1DADA 3MAAC 2H6EA 3QYPA 4NH0A 1D4OA 1EXMA 2FF7A 1R0XA 2TS1A 4IXDA 4YIKA 1J0DA 4HI0E 5LBTA 3TZQA 4AURA 3ZHYA 1G6KA 2NM0A 3ZCUA 3GZJA 1R00A 3JQ9C 3RS9A 4UFOA 1SKYB 2IXFA 2IDJA 2RD2A 1YBFA 3N2KB 4FBLA 1HYEA 2MDTA 3PEYA 2JLSA 5AH0A 2IRWA 1UBFA 2WJPA 1TOAA 5CVUA 4G26A 5ITVA 1VPWA 4P4SB 3P71T 4LK2A 4ESOA 4XAQA 4JI7B 1E7MA 2H4YA 2I9KA 4AQYB 3OEED 3W8DA 1SXHA 4C4AA 3AUFA 2MYUA 4W9NA 4MR9B 1Y4AE 4CWAA 2GNOA 2AG5A 2R6FA 4GM0A 4TKUB 3ZQKA 4A8PA 1E6MA 4HGPA 5F1PA 4X44A 5GV8A 1Y5NA 4BNDB 3MG9A 2FN8A 2QVGA 3L06A 1P1BA 1P3Y1 3TSZA 4QNMA 2JGAA 3EQ9A 2V5UA 5D7BA 1L5GB 3EGEA 4ZVVA 4ZT4A 4TTQA 1NXXA 1D6SA 1MPXA 1XFAA 4HRXA 1ULBA 3LP5A 2GEBA 4F4DA 3I83A 3KLOA 1X7XA 5E0OA 2PX3A 2EYQA 4PQFA 1CY0A 3CIFA 1O1YA 2UVPB 3RFVA 3TKAA 1VIYA 4Q1CA 1D1PA 1Y4UA 4JLKA 3PFBA 4XGQA 5H0IA 2PH3A 3NOVA 4QDTA 2R8RA 4MYCA 3OEEA 4F5YA 3JWIA 4OJYA 1XA3A 2G06A 4QUHA 5GJCA 3L0YA 3LBNA 5E7IA 3OHMA 2GTPA 2HQOA 4PAMA 4IMJB 2FKNA 1PZEA 4V0NA 3NRBA 2JGIA 5F12A 2LCQA 3T7JA 1NQAO 2B8TA 1J25A 2JAXA 2XB8A 1K0UA 2IDZA 2ZVJA 3CEAA 2GYWA 4KXQA 6PFKA 4B3BA 4U02A 2BFWA 1GM5A 2GJSA 2QN3A 3TW8A 1PJ4A 2VTKA 4MYTA 1WB6A 3VR0A 2V03A 3WRWA 4G0OA 5LCXA 1PT6A 2A58A 4UHDA 4ZDIA 2EP7A 2V8OA 4RZQA 3R1IA 3QYAA 2OAQ1 2VLBA 2YRXA 3CTMA 4AF6A 3CNHA 3E9RA 4R1QA 2HO4A 4LRTB 2JA2A 1T1EA 5H3CA 3EH2A 2D2IA 3CR3C 4OGKA 4WERA 3LZDA 1FU4A 1RHQA 3GEIA 1RKQA 1ZN7A 3C5WP 3HJBA 1AZSC 3K32A 3PQ8A 4OXQA 1KMQA 2EKQA 3VISA 4GLJA 4AWAA 1EI9A 5T3UA 2OZLA 3SAJA 2P62A 3ZY3A 3TOCA 3K15A 4AUKA 1ZJ5A 1SD5A 1CHDA 1LPMA 2JAHA 3QVGA 4FYHA 1AD2A 1G20E 2CLOB 2F1JA 2ZBDA 4XR9A 1JB1A 2XTJA 3BMOB 4UBNA 5A03A 3IT2A 3RYFA 2X58A 4IFEA 2PXXA 4HB0A 2CLMB 4BN4A 3X3HA 5J4VA 2LW7A 1DXQA 3LPNA 4YECA 5KPJA 2WWVD 3RAJA 4JIGA 2PMBA 1NYLA 3TYXA 5LNK1 3QEAZ 1U8YA 4FCTA 3DT6A 2HPAA 4PZEA 2HL6A 4R8KA 1ZNXA 3KUXA 7AT1A 1FFDA 4UMEA 3R44A 2OO3A 1U0FA 3JYNA 5GGXA 4MHTA 4Z53A 1G5FA 3WLQA 3EC7A 3ZR4B 4UD2A 5BNFA 2C7GA 2QS9A 3MWDB 4NE2A 5JD4A 3A6FA 3HWRA 3WWDA 1GPYA 4TKVB 1SO8A 4GRDA 4Y2HA 3U3JA 1I24A 2J3JA 4IIGA 4NCHA 1Q0RA 3KPYA 3Q2OA 3X1MA 3MUNA 4NBWA 4BVHA 3HJFA 3ZE0B 1RYHA 1AXEA 2X4IA 4Q37A 2GEDA 3EVDA 3SG0A 1JLKA 4YJ2A 1L1FA 1W9MA 1EFHA 2I4NA 2VHXA 2XEDA 3GG9A 4BP9A 1UM8A 1JMYA 2GYYA 1Y9ZA 3IHKA 3S7TA 3C41J 2H2GA 3DQPA 4TMYA 2BWJA 3EZFA 4MI6A 3BWMA 1XN4A 3TJZA 3QTTA 1R5NA 4HXEB 1DVRA 5TQJA 3D6UA 2QWXA 5D6OA 2UUAB 5JAOA 1T5DX 4ROTA 2I22A 2X7HA 4WKNA 5DGHA 4MYDA 4KW7A 4L4XA 4C7JA 3EODA 3R0IA 2YJ3A 5H81A 1VYTA 1G21E 2VA9A 1KOJA 1YRBA 2VL7A 1N6PA 2GYVA 4WK4B 2ZGVA 1F8FA 2YYSA 1W9HA 1LC0A 4ETWA 4OYRA 4YONB 3FM9A 4OP1A 3B89A 2NO6A 3LSYA 4BL5A 5KMGB 1V4BA 1NW5A 2RIRA 3NEPX 3VSEA 4ASUD 3T3NA 3R7SA 1K7YA 4CKZA 3BE6A 1UJ4A 1PUJA 3F3MA 3G5AA 4URVR 2QUJA 4BJ6A 4A0GA 2HN9A 4YAJA 1SURA 13PKA 1KDPA 4DGSA 2F3RA 3W5VA 4IDAA 5BQXA 1HNNA 3GNQA 5K6AC 3AM5A 1E9SA 5DH9A 3VJLA 3KDSE 5HBRA 5AJHA 3L93A 3A9TA 4UTPA 4PS1A 5LZ7A 2PXHA 3SBDA 4DT1A 1X8XA 3WX0A 5AI0A 3FVWA 3OQNA 4KR9A 4B6PA 2NO5A 2C54A 4QQ8A 4PLHA 1GPBA 3EDRA 4NHOA 4RDXA 1P80A 1ZKDA 1ZNWA 4ASUA 2WAYA 3AFNA 1DKUA 3WG9A 2ORVA 2IZ0A 3NB0A 1S2NA 3K92A 4BMNA 4YR9A 5E7QA 2B92A 4XWAA 4EJSB 1I01A 4XVCA 2NZUG 3A3KA 2BT4A 4RPIA 1MB0A 1C3VA 2AN5A 2FVXA 3C3CA 5BOVA 2CLSA 1JEDA 3AIOA 3I9LA 4DABA 1JEYA 1I1QB 1NYQA 4RD6A 3M4NA 3ET4A 4OTZA 1T2CA 4EA7A 4YV1A 1L7QA 2C3UA 1QFXA 1KPIA 2HV9A 4LOLA 3H9EO 2PPLA 3WVNA 4EK9A 1GADO 2VT2A 3HRIA 1XEWX 2WQ7A 3MRTA 3U3KA 1ESZA 4AYXA 1VPLA 4XI9A 4P4TA 1NHWA 3C3XA 3QBJA 2C4NA 4JX8A 3I2YX 3S5UA 4C0QC 1ISJA 2Y0CA 2WJZB 5DCYA 4UC0A 4ETMA 2EG9A 1CQWA 1VJRA 3RVQA 2PPVA 2C59A 2WBLC 3R3YA 2ID8A 2R1VB 3FN4A 4O4HF 1Q3TA 5TT1A 1KMMA 5DDIP 3G5TA 1P2SA 1ZICA 3QQPA 5PNTA 3WKEA 4BMVA 1UOPA 3HGTA 4RIIA 3JZAA 4AJHA 2PKWA 3N2IA 4LGCA 1D03A 5K3AA 3FTEA 4J16A 1P7VA 3Q1LA 4B7ZA 1F06A 5FH9A 2PXCA 5A3QA 4DIFA 2C7BA 1A69A 2FWBA 4J3JA 2HBYA 5JZSA 5GQSA 4PSCA 3RJ5A 1KMCA 4Y9TA 4KQFA 3IUBA 4RTLA 1QE3A 2H2WA 1P2VA 2G4CA 2QD1A 1RXSA 2PH7A 3M1YA 3SVZA 4C1NA 4RQUA 4ZQFA 5IC4A 1DX4A 4I4IA 2PT6A 1YT5A 1J56A 5KPDA 1U3CA 1ZVVA 1FYXA 3DV2A 1AVTA 1CY2A 1I2CA 1ZXBA 5DOVA 4YRGA 3PKZA 2ODAA 3HCRA 1OV6A 1J2YA 4TQAA 4EGCB 2IBSA 3QGMA 4WDRA 2IKSA 1NI3A 4RH0A 4D56A 3ICEA 1E3IA 5KWIA 2YQ5A 3O1IC 4MWSA 2OBLA 5EE1A 3ZGVA 4RM2A 4BNHA 2FEPA 2NTNA 2IIPA 1CE8A 1N8SA 2V97A 2Y1DA 3UJ8A 2LV8A 4DW8A 2YY7A 1O94C 1V1RA 2Q5CA 3P7MA 2FUG1 2Q49A 4FEAA 5CEFA 1DC5A 5EHXA 3U4QA 1XTBA 4IJ6A 4FYXA 2OBFA 2QP3A 3BWYA 1Z0FA 1XDZA 2YQ4A 3WGHA 1MDFA 2XUGA 4BNFA 1CB0A 2P4HX 4E5KA 1WDKA 1IK4A 2E4AA 3TNYA 3VR5H 3KM0A 4AJPA 1HR0B 1K4KA 5HUQA 1ECFA 2C88A 3EWNA 2LPMA 5A4DA 3K0AA 5C31A 3Q8XB 1GLGA 3GVIA 4L2IB 1I6LA 4Q1EA 1PTKA 2FRXA 3AM4A 3C8ZA 4LVCA 3MPOA 2Y6VA 3RVPA 3R3WA 5ELMA 1IRXA 3BDAA 1NVKA 4MX8A 2NU9A 1BMDA 4MV0A 4RFLA 4JKYA 4WVLA 1EP9A 5LFAA 4BO8A 4Z4EA 1AF7A 1H66A 2EJBA 2QQFA 2PKRA 4IDOA 4PCLA 1I2ZA 4MVJP 4C4SA 5G0WA 3R6TA 2JPDA 1WMDA 2XDAA 1ADGA 3OP1A 3EZNA 1U2SA 3O1HB 3D1LA 4M2LA 4KVAA 4G63A 4CDMA 3HSSA 4GW3A 1KRXA 4ZN6A 1BMQA 2FN3A 1Q7BA 1ONNA 4G6ZA 3GRFA 1YQTA 2ZS7A 1YNSA 2WB4A 5DBEX 1PV4A 4DV6B 1ZUIA 4GYKA 3RS0A 1JQ3A 1OD6A 3L9XA 1QHFA 2J6CA 5KNCH 2X4DA 2QM8A 4RM3A 4K8RB 2QF7A 4PZYA 1ESCA 1UZUA 5F73A 4YLEA 4K3VA 2FW6A 1RMYA 5FOVA 5LQCA 2PMCA 3EUFA 2O0KA 1K89A 1ZG3A 2E21A 2PEZA 1Z4JA 3DBIA 3JASA 1WMAA 1HYGA 1N2HA 5GVRA 3UJPA 1DUVG 2AEEA 5IM5A 4IUBS 3CBGA 4WFKA 3T7SA 1VG9B 3PHLA 4XIGS 3TL2A 1N6RA 1Q3KA 4OGWA 3NOOA 2WNIA 4GR5A 1X2BA 3P5BA 3BERA 5F5XA 2H5LA 3ZDQA 2AMFA 1VG8A 2ASVA 2Y4NA 1S3IA 1FA9A 3H19A 2C5GA 4HDOB 4TXLA 4F06A 5KVVA 1RU3A 4L8WB 2D5CA 3OCZA 5HRUA 4ZYVA 4K9DA 4ZTBA 3E9MA 2Z58A 2WKQA 3ZBUA 4YJ2B 3I92A 3PJFA 3DOHA 3IE0A 1OA0A 3LRTA 4UJ3A 4QOSA 3H99A 5EA2A 4AG3A 1CJVC 1BXRB 4M9ZA 3L7OA 5BVGA 2C4UA 2G1UA 1U28C 4YRMA 2E4ZA 2ERYA 5FYDA 1II9A 3IOYA 1MRNA 5CB4F 2G17A 4WADA 4XWGA 5L7YA 1EFRA 2ZYUX 1SXJA 3C3YA 2EKDA 3I2FA 3IIKA 3IQDB 1C9MA 1NFQA 4F4UA 3HSYA 3ESBA 2NZ2A 1PG5A 4D9IA 1PR0A 3I37X 5KSYA 2PRSA 4LE0A 5DXJA 1C29B 1DWUA 2O1EA 4DZRA 5I5EA 4OYYA 1KMIY 4D0GA 3NG1A 5B58T 1BDBA 4OAPA 5EVJA 1ZMBA 5IF3A 2H0QA 4FQ5A 3GBPA 4ARIA 1ICEA 1J0BA 3H97A 4RACA 4C4XA 5C1PA 3KQLA 2R62A 4RZXA 2Y1LA 4UQOA 5LWQA 1NUAA 5IANA 3CRNA 1KEVA 2D7JA 3BM5A 3LRPA 3N53A 4YQZA 4KU4A 5IH3A 3RIEA 1Y8RA 3SHOA 4BTVA 3NBUA 5C3UA 3DVSX 1EA5A 2R2AA 3FY4A 3O0TA 2J5BA 2JGNA 4TVSA 4K9KA 4US0R 1JE1A 1MO2A 1KNXA 1V45E 1USVA 3C45A 4YUYA 1E32A 2VKTA 3LC2O 1SKQA 3I6ZA 4PHFA 5IX8A 2CV2A 4J07A 2BV3A 1AKNA 1PJ8A 4EOGA 5TGTA 1YL5A 1T9BA 1MBZA 2CLFB 1GA4A 1UC9A 1F12A 3BSFA 3HB1A 3OCVA 3OFSA 1RQNA 3TLAA 4AP9A 4Z1OA 3QHPA 4UASA 4PC3A 1P3JA 1XT6A 3E4DA 1AOXA 3CX4A 1V8ZA 3NWEA 4J91A 3PHCA 2Q5HA 3BWEA 3DMGA 1OI3A 5J4YA 3V1NA 3QOFA 4C0HA 1MJHA 2NO0A 2NT4A 3SYLA 2J0VA 1GU1A 3P32A 4K9MA 3ZZNA 1HEYA 4X45A 5CA1B 1TDJA 3CLUD 2W6MA 5FTJA 3GNSA 2Z6UA 3AEKA 3N0TA 4G24A 3QI2A 1SUAA 1BVRA 4BE7B 1V48A 2IZ1A 1P2DA 3R4CA 1T8PA 4M8LA 5DZSA 2VO1A 3MMSA 3S27A 2IH2A 3SZOA 4D5GA 4QM6A 2BYTA 4L0CA 2XIQA 5ALLA 1IK6A 1R2QA 2PS9A 4CKYA 2XGJA 3EUAA 2X2FA 3H9CA 4NCKA 3BTOA 1Z56C 1CU1A 4B3XA 4LRQA 5I4CA 1DSSG 1XN1A 1ZH8A 2GPTA 4C87A 5A0TA 4ZP1A 1R50A 4GSYA 7GPBA 2OCIA 1IY9A 2AR0A 4I2NA 1DEHA 4PGGA 4IFIA 4BQPA 2QRKA 3WZ2A 3C6QA 2WUDA 2Q28A 5AR1A 2E4VA 3UFBA 2M6KA 3WZMA 2IHTA 3CWZA 3B1VA 2JHGA 3KJEA 1E1MA 3KXLA 2MJLA 4JNKA 2O2SA 1NIJA 4X6LA 2RJNA 4IICA 4YVFA 3UKDA 3W1WA 2GEUA 2R79A 3DKPA 5KVSA 5CT4A 4Y6RA 4DUZB 1U94A 3G8DA 1ZCJA 4WBNA 3JRWA 5TQ0A 4DR2B 2XAAA 3QSGA 3A37A 4HVLA 3G13A 1M6WA 5FOXA 5JTTA 5FBZA 1M83A 2Q3LA 4KQWA 3VGPA 1FRQA 4E31A 2TECE 4MR7A 3ZHTA 1LRKA 4D4KA 4TUYB 3RYIA 3ZHOA 1WCV1 5AESA 1DJOA 3GD7A 5JMOA 2GHQA 2DHDA 2H4HA 2ODTX 4B1FA 4GP6A 1AC5A 3MCWA 3HBNA 1G5IA 4EUNA 4B3RB 2WOJA 2EX1A 4ZHQF 1V1RB 5B1IA 4NH4A 1E9RA 5JYBA 3ZW9A 3U4QB 3PLAE 1CDOA 1KYVA 2WFLB 5REQA 4BLPA 5IM4F 3KAJA 3QLEA 3AEZA 5IUKC 1LS1A 3BGSA 4HNGA 3U81A 2QX6A 4OFBA 3L6EA 2HADA 3GYBA 1GV1A 4LMAA 3ZC3A 2G5GX 1OT5A 2OD2A 1KERA 1YQDA 2OMKA 1DV1A 3K0AB 1E3MA 1N2JA 5BSVA 5LQDA 2VNAA 4TZ0A 1JI0A 3S29A 3A04A 4UM7A 3T54A 3EY9A 3GH1A 2OA0A 3CCCA 1RW4A 3H5OA 3UQYS 4EG1A 4B4WA 4Y6PA 2E0IA 4H2DA 1KYQA 2XWBF 1VOTA 4S1OA 3RM3A 4BMYA 3NS7A 4HVCA 2PUHA 2SNIE 3A4TA 3GJYA 3O4JA 4P84A 3ZGOA 3D4NA 2OP1A 3QXCA 5T4HA 4DMCA 3ZCXA 4FFMA 2QYTA 4C08A 4DLZA 5CYFA 4PC6A 1D9XA 5AW9A 4C9BA 3WY9A 3G0HA 3H1FA 3NDRA 3TUJC 1TADA 2PDAA 3EH1A 3AG6A 1A77A 3AF5A 3ESQA 3IH5A 5FUVA 3SJUA 3WL3A 1ZGAA 3KT6A 4MITA 5BW4A 4FNMA 5AJVB 2GPSA 3OSZA 2O1SA 1YUBA 4AQDA 1U8UA 3TD9A 3UJ9A 3OPYA 4CLRA 1QYCA 1UPUA 3RROA 2XD4A 2I80A 3D9QX 5KWEA 2W4MA 2F9LA 5JQGA 4HPXB 3UUGA 2ZSDA 2M2IA 3KO8A 4PN3A 1ZGGA 3T1YB 2C5LA 3LUDA 1YGYA 2O3JA 3C8UA 4MWDA 4F60A 1YR1A 5C1DA 2C03A 3CF6R 4MV9A 2WLTA 4PZZA 5E95A 3S5JA 1T8SA 3F47A 2JC3A 1FBNA 1DJNA 3HA7A 1GZ4A 4DDWA 3QG5A 1QFMA 2JJ1A 3EZYA 3O6VA 3DTNA 4JENA 2ZYDA 3DTYA 3I04M 1RI3A 2FMIA 3H05A 3Q3HA 5JDIC 3A6GA 3OJFA 4ZDJA 1E79D 3JSAA 3HDTA 2QG9A 4TS9A 4UUAA 3JU3A 1K8ZB 2Z6VA 1J6UA 1VJGA 1G1MA 4XE5A 2CF6A 1KZ4A 4L15A 2PUTA 2NT3A 5DBGA 1X1DA 3QUQA 4O1HA 1Z47A 3HPQA 5FPYA 3RLFA 4D8VA 1DRJA 1RTTA 3UKJA 4A91A 5AIBA 3QYFA 4PO9A 5AJXA 4EVIA 2L18A 5I3CA 4EQZA 1CEEA 1U2GC 1Q16A 3COSA 1KO7A 4EI9A 2IF2A 3HI6A 3A8TA 1RSZA 5H9WA 3IT1A 3DVAA 2C9CA 2I66A 3OTWA 4YK7A 4GOJA 1KI3A 3N8KA 3F0TA 4R84A 2X19A 1AGYA 4Y3UA 4JLUA 4KGVA 1OKKD 2BGMA 1SXJB 1JLLA 1XVAA 3D7NA 4MA5A 5U4XA 3U5ZB 4L6AA 1JHPA 4L5IA 4WASA 3W5HA 5IFKA 3WYNA 2DVMA 2ETVA 2QX8A 3TLXA 5FXMA 1Y3IA 3VKVA 2CJPA 2VYFA 2YYYA 2Q5LA 3RIGA 1LI5A 4CTKA 5KSZA 1U31A 3EDOA 3K35A 3K9BA 2APJA 3G85A 3T3PB 2CGEA 4O2AA 4DMMA 4LF5B 3MNFA 1VG1A 1UWCA 1ZC3A 3UJ3X 4LF9B 4O5OA 3C8MA 3PDIA 1GD1O 2B0JA 3QVKA 1RI4A 2RGWA 1WWKA 1S2DA 1YZTA 2I8LA 2J09A 4AKSA 3UG7A 2R6GA 1ITZA 4FR0A 4P86A 3D6MA 4LDAA 2JJ8A 1Y8RB 5JS1A 2IXGA 4AN4A 3FIUA 5KO2A 4HEA1 5ALSA 4DILA 3CCFA 3E3OA 1ZWLA 1XQ1A 5G3YA 3HDVA 3NTUA 1BMFD 2ACKA 3PEEA 1G8YA 2C9OA 5ED4A 5TQ2A 3V34A 2ATCA 5EMLA 4DJDC 2W2KA 2BEKA 4G0YA 5BWLA 2F8SA 2PX6A 3VYVA 2HJGA 5F4BA 1JDJA 4MVXA 1O6CA 2I29A 3IMEA 4I3GA 3WMXA 1OIWA 1EVZA 1QHNA 4P8RA 5FFMA 4BNXA 4YCLA 2X8LA 4OXNA 2G77B 3TFQA 5AXBA 2FX5A 3CRW1 1UOOA 3A4VA 4GWLA 2F00A 3SC2A 2IODA 1Z0IA 3CEHA 4ESEA 2X2EA 5B7NA 1DOZA 3EGWA 5EJ6A 4KQIA 2ECFA 5CP8A 3NTQA 5JCOC 1J33A 3FSGD 2AHRA 4JBNA 1BMFA 3AEKB 4LXIA 5FFNA 1MB3A 2Z8YM 5AOVA 2Z9CA 3SC6A 1Z0UA 1EDBA 4ABYA 2RG7A 5HJEA 3LHDA 2WWTA 2YOHA 2QJFA 3V48A 4U9HS 1WIWA 1L5HA 5CB6A 5DTRA 3V32A 3I8SA 3MN1A 2FDCA 3LTNC 3F9CA 4HQRA 4RQBA 1I80A 1GPAA 4HF7A 5DF1A 3T3MB 2JLAA 4IG9A 3A9RA 3RNLA 1PZNA 3FHLA 2V8BA 4DSZA 5CDFE 5DSTA 1WMFA 1FS4A 3K09A 2P2CA 1G4HA 1T9GS 1V4NA 4V0KA 2OCXA 3AKDA 1I5EA 2PT9A 3O7MA 4E4TA 2V4UA 2JDIA 3CZRA 1A95A 5FLXA 2DWPA 2EC5A 2YN2A 1EX1A 3AB7A 3AEYA 3OPXA 1G18A 3W3AD 5B30A 3PHJA 5CEJA 4AJOA 1RZVA 2ZEJA 2B4YA 3FSGA 4D3ZA 5J3JA 4B73A 2HWWA 5HCIA 5EXDA 1Q1ZA 1VC2A 5DGIA 1U4NA 1T2UA 1VSBA 2EW1A 1H4TA 1Q1EA 2FOIA 1H2XA 5CB0A 4PGHA 5J5VA 3D8BA 2PKYX 3MB5A 3ZGLA 4NZYA 2AD1A 5TQ0B 4XIFA 4N0EA 4WBNB 1E2HA 1Z8DA 5GIOE 1L4FA 3CR8A 5CFPA 7REQB 2A1UA 3MTEA 1ECCA 4CMAA 2XRMA 1AUQA 5CT5A 3B1FA 4GC5A 3GJ8A 4QL3A 5IULC 1LRLA 1K66A 1OFIA 4RK6A 1JFFA 4IV5A 3PE4A 1JHZA 4Y9RA 3W3AA 2HKIA 4OJQA 3D5EA 2JRLA 3AMVA 1CUIA 2ODPA 1GPJA 3VHLB 1T13A 4EHBA 3E84A 4LEIA 2GPWA 3NC4A 4BNKA 2BMEA 4YWJA 4R7TA 2H4WA 4QGGA 4ZA2A 2RJOA 1CYDA 5JBIA 1M5RA 4IIHA 4Z0NA 4Y8VA 1P0FA 1GO2A 4ND6A 3FPSA 2P5YA 3AI2A 2V9ZA 3JVDA 3THYA 4G4IA 2PU7A 2AI2A 2IQIA 3BJRA 1OF1A 1ZISA 3O0DA 2Q3BA 1KI6B 4FS8A 4NR0A 1U2PA 1FFWA 1M7GA 1JDPA 4DYDA 1VRCA 5HDBB 2X77A 1ELOA 1G5HA 3RK0A 1G17A 1WSBA 3C8HA 1ZHFA 4OLAA 1E18A 1G2PA 3ZD9A 4DCUA 2GSDA 3DLAA 4DWOA 1TM1E 2NSLA 3BXZA 4P92A 1MABA 2RFLA 3KQSA 2OUKA 1Z88A 2ONYA 4DPMA 4JB3A 3SYNA 3WKBA 3E22A 3IPRA 2ISSD 4XVHA 3N07A 1FSZA 3V7UA 1IQ0A 2ZOSA 4KAJA 2EZTA 4BC1A 1Y5MA 2BCEA 4JLJA 3A1CA 3RRMA 3H7IA 4RDHA 3T1VA 1C8LA 2IEZA 4GL4A 1CUFA 3FKJA 4MARA 4CHTA 1DDGA 4CMJA 1DELA 1S6YA 4X92A 2QN6A 1MG0A 2ZB7A 5I7EA 4Q4CA 3ESAA 3O26A 4ONEA 4R6XA 3AESA 4CMKA 2CNOA 5LP6C 4LJ7A 1QKIA 3MSXA 4LJ9A 4F45A 4M21A 4AMZA 1ZM2A 3ONFA 5CXSA 1BIFA 4PN7A 2GILA 5AM4A 1JUDA 1N6NA 3ZGYA 4D8XA 1QHGA 1RC8A 5LQJA 2PCLA 1KDRA 2JJMA 5EP4A 2OBMA 1W19A 3W0LB 3TF5A 1HMPA 1J8FA 5B1YA 2RIPA 2VHJA 3ICWA 4MRMA 3T5GA 3T9FA 2VDLB 1V47A 3NH6A 1QNFA 2PZMA 2WHXA 4CPDA 1KNQA 5B2EA 3A28A 3MTAA 2C2YA 4LZNA 4AMUA 4TTRA 2H63A 2ZATA 1KU6A 1DIAA 2OXFA 3ZVRA 3K3PA 2KBFA 1CKEA 3FBTA 3RRZA 2QRLA 1OTXA 5HS4A 2COUA 3TR6A 4NE9A 4W5JA 1KARA 1U3WA 1UK7A 2W2XA 3ZKWA 2J85A 4KQKA 1X15A 2EGHA 1IL0A 1EM6A 1MOZA 1Y34E 4S1PA 5AP9A 4J1SA 4N49A 4ARUA 4FLEA 2W8BA 4WD3A 5J4LA 2X9NA 3KKNA 2UYGA 1IY1A 1R5BA 1I0IA 3EFOA 2ZBRA 1A9XA 2JL1A 4LV8B 1DRKA 3UB4A 5C34B 2ZE5A 1TGYA 2IHVA 3X1JA 3O8RA 1RPZA 2QQ0A 1M34E 1WB5A 3K8OE 3M1IA 1FQWA 4NHEA 2EFEB 4DAEA 4W9NC 3TFOA 4BLRA 2PV0A 4K8OA 2DPMA 2ZYRA 3O95A 5TT0A 4JXZA 2G4VA 4UNNA 4O4JF 4QAJA 2JG3A 4FMDF 2CVHA 4CMIB 3IPYA 4G3XA 1AKWA 1QV9A 2FQWA 1BS9A 1JDZA 1H6BA 1Y89A 4JXJA 4HEA6 4O2AB 4B6JA 1Z2EA 4MUFA 3E18A 1WCXA 1RAFA 2PHZA 2QNBA 3PDIB 1Q95A 3DBRB 3EVGA 4XB2A 2O2CA 2QYOA 4NEGA 1AKQA 5EUQB 2NG1A 4Q66C 2H2FA 5F1KA 4U7JA 3U3MA 2DPGA 3UXYA 4FHDA 5GINE 1QTQA 1WU7A 4EHFA 4KR2A 3HWSA 2O3TA 5JO9A 3KYDB 3OZGA 1A7UA 4IYJA 3WGQA 3ZJ4A 5A3SA 2I6GA 3AR6A 4LSMA 2PWAA 4H15A 4L22A 2WE7A 3JAWA 4FHGA 4RKRA 4ZOLF 3V8VA 2N46A 5KKNB 3TEJA 4I0WB 3WO1A 4Y2TA 2VWQA 1QO7A 4PF1A 3M2TA 1M1NB 1KZ9A 1YAJA 3NUQA 1ZGBA 2H7VA 3QLUC 1QHSA 1DAGA 2G5CA 4LYJA 4PAGA 5JS6A 3VJRA 3X1DA 4GKKB 1GITA 3WLEA 3HA5A 4C03A 4ETIA 2H8GA 3TQSA 3WLKX 2WHPB 3E4CA 3F3YA 3HYRA 3VPGA 4DA8A 5COQA 3BS4A 3GOQA 3WIOA 1JDTA 4DDMA 2FDRA 4O4LA 5ELXA 2YYAA 3ZY4A 1YRYE 4HX9A 3WL7A 2O52A 2QPTA 1PZMA 3RS3A 3VZBA 1TB4A 2HZBA 4KK4A 4TV9A 1S7CA 4XD7D 3A6LA 2NTYC 4V24A 3PHHA 2MSNA 1Z2DA 1TU3A 1QAQA 1IVYA 3OTHA 1I0ZA 3FNRA 3TBHA 5BMVA 4ENSA 5MN5A 4NOJA 1P6XA 3NCHA 1PG2A 3UAYA 1W8IA 1RYDA 2PIAA 3GRUA 4CCYA 5BUZA 2GETA 4KNYA 3ZYZA 5L4NA 5JAQA 4BAGA 1SXPA 1XXHB 3EVEA 2NQ2C 3K2BA 4N5LA 5HBGA 3TS1A 3KG2A 2PYDA 4PTZA 5KX5A 2QTBA 4HDMA 3BUSA 2GK3A 3JQAA 3E9EA 4UMVA 5ALUA 3D4PA 4DR1B 1P2FA 2BGLA 3K9CA 1NPTO 1A9OA 1PNRA 4MV3A 4YRJA 1ZK4A 1YQQA 3AVWA 1XQYA 5TS3A 4YC7A 1JWLA 1GPNA 2DR3A 1L4GA 5EJMA 3ZPXA 3GA0A 4XD7A 4BPBA 2I33A 2NNWB 1V8DA 2CSUA 2GUWA 2IYLD 4E32A 1B1CA 2FEWB 3GPBA 3N0XA 4J0EA 2EFCB 4Z2AA 2G1JA 3P2OA 2QDXA 4GKAA 2BMWA 3KSRA 4X24A 2QQEA 4MV4A 3TRHA 6ADHA 3LDAA 1XFDA 1Z0ZA 4NFYA 1KOLA 5H4GA 2PGDA 3DHWC 1C0EA 4NJMA 3LPDA 3SM3A 3BD8A 4AY3A 3DC7A 1E96A 1O6GA 5ILGA 3SEQA 3UV7A 2QTTA 1W5BA 3H83A 2HFJA 1WXQA 4JCCA 1OX4B 1UCFA 2ORED 1N5DA 3SWWA 1MX1A 2B37A 3T5TA 1N5JA 1NC1A 2LRHA 2SCUA 3AVPA 3PD1A 3RI3A 3ZHXA 3NHJA 4K2HA 3QUCA 4J4HA 4G5QA 3Q85A 4UU1A 1U7HA 3RV3A 3L7YA 2DTXA 3T52A 2AG0A 4XFKA 2PQMA 1MX9A 2OP0A 2QRPA 3B5EA 3DKIA 4EF5A 3ENNA 4LXUA 3M3HA 3WV5A 1LSUA 3KU1A 5LMZA 1B0ZA 2DWCA 2OCBA 4MGYR 1H4VB 1U4SA 4D46A 5EHQA 1RLJA 3FTNA 2NZWA 2ZXFA 4DB4A 5BYJA 5AD1A 1Q0ZA 3BXXA 5CG2A 2YQZA 3O73A 1NVXQ 4A5SA 3SDBA 2CKDA 3VZSA 2VTVA 1VPTA 3O21A 5AM0A 4DCJA 3MBOA 2H51A 1O7JA 2VA8A 1Y7HA 1J99A 1TYZA 1VGQA 3O8OA 4US1R 1X70A 4YP0A 3SQOA 5CBPB 3WGJA 1U2ZA 1NHGA 4EW1A 4DMUB 4PQEA 4TTTS 4I3HA 4M0EA 5EJ2A 3O94A 1UC5B 3O2QB 1P4GA 5J5CA 1MUUA 2FZCA 1IU9A 4DWJA 2Z04A 3IAAA 5DNUA 3K0FA 1H4QA 1D8TA 1GDDA 4PLWA 4RTNA 3TM5A 2WSMA 3UVEA 1ZIOA 2YZ2A 1EB8A 3N8HA 4MYRA 1F3LA 3AESB 4BKQA 1T15A 1ADJA 4R2JA 1BA3A 5BQFA 4Y6LA 2V6JA 3KQKA 3K9GA 3T1HB 5JEDA 1XV5A 3GJ0A 3KPWA 5E1DA 1JA9A 2FJPA 1G8KA 3HVJA 1DAMA 3M9LA 3OFJA 3O2NA 4MIOA 5AKLA 4PXYA 2I9PA 2C2MA 4BB9A 3LAWA 4E5NA 3KQTA 3DUWA 1HE2A 5J4HA 5M7EA 4NZMA 4LRWA 4Y6OA 2FG7C 2CEAA 3FI0A 4DUGD 4EBFA 5HCNA 2CMGA 2ZM5A 5E3HA 4E3WA 4L85A 2J9RA 1O54A 1XRPA 5T3YA 1NVTA 2YR0A 5JALA 3MS7A 3QBEA 1GNTA 4ND7A 4BCCA 2E5FA 5A7GA 1LCIA 3AM3A 3OX2A 4ZODA 4AZ3B 5K0TA 5JMPA 1H0SA 4OMDA 1VPEA 2I91A 1QK5A 5CVDA 4F6RA 2BDUA 3RLIA 4G8CA 3AHCA 3ZKWB 3TFWA 3JARB 3TW0A 2BFBA 1EJ0A 2ID9A 2RHTA 2UKDA 3MW8A 3DG9A 4X0EA 2VAVA 1M5UA 5G0UA 1P29A 3ZDZB 2V59A 1QR2A 3EFOB 4DUGA 3U44B 1LPBB 4R6WA 3FLEA 1PQPA 4J16C 2XNHA 2R1ZA 2B1GA 4EB0A 1BCRB 4CM1A 1G8PA 4OK3A 4XSHA 2AUTA 4O8CA 1E58A 4TKZA 4YFVA 3EOZA 4F21A 1ZUHA 4XVUA 4TZ6A 2AXNA 2RK6A 3B3GA 3GUHA 3E7PA 3KUDA 1AQ6A 1R0KA 3LKVA 2R84A 2F64A 4PC1A 4DPKA 2VDUE 1NN5A 1P7YA 1BEUB 1QGOA 3ENVA 4KHZA 3PRKE 1L1EA 4RA6B 5HGJA 2QVZX 4HN4B 2QX4A 1ISFA 2CJXA 1WLYA 5IMBA 2R9VA 1L7AA 1B23P 1YR8A 3GQVA 4ALJA 4YRBA 1AGXA 4ISBA 3TSCA 2WOOA 4BZPA 2QMHA 4O4HB 4IF6A 4JR1A 4N3AA 1MX5A 3ET5A 2HA2A 2QP4A 3I4LA 3JAKA 4OHMA 3G6KA 4C05A 3T7KA 2Z9DA 1SOVA 2XUDA 2NZXA 2GXQA 4MRVA 1FTSA 2UDPA 2WILA 4KWEA 4HG2A 2CEKA 5DSXA 3I0NA 4QIHA 1MNQA 3I64A 3ZS9A 3AM1A 1NKVA 3LUFA 1GZHB 2UVDA 3HP1A 3FDZA 2HK8A 4PX2A 4Y2JA 3RHTA 3HBAA 1H2YA 2M9MA 4MAAA 3BHNA 4GBGA 1EVYA 3E5NA 2G4LA 2IF0A 4JXXA 2O7QA 2VBCA 2VJOA 3OIFA 5EMNA 3ACCA 4OATA 5FRDA 4NBRA 1YC2A 5BPFA 3NNSA 5DN6A 4WNCA 1L7DA 5BR7A 2A6PA 2FMHA 2YMQA 3CT6A 4GVPA 3JWPA 4XUDA 3RBAA 3IE2A 2EBFX 2YFYA 1BNCA 1JSLA 1M3SA 1ZEJA 2J07A 2R60A 1ZINA 4WOKA 4WA8A 4DIOA 3E48A 4O4LB 3UY4A 4FGUA 1Z7EA 4KREA 4I1RA 1RLIA 4DR5B 4CMCA 4X7BA 5FV7A 4O33A 3TIXB 3HFSA 3UMBA 4QFCA 4GR4A 1MVOA 5JBNA 1W52X 4OU5A 3GRYA 1FTGA 1UDAA 2R6JA 4OHBA 5SYMA 4OUDB 3VVBA 1MA3A 3EXG1 1KAHA 1J7KA 4MKZA 1F0PA 1QIIA 2WIJA 3LYLA 1ULUA 1A8QA 1D2RA 1DQPA 4OHVA 4PO3X 5I9SA 4M0UA 4ARSA 4DWWA 3AVUA 2AJDA 4HNSA 4MJLA 2OTCA 1Z15A 4FSDA 4NG4A 4RYDA 4DUYB 3ZKAA 1U1FA 3VYSB 1E5DA 2LZ0A 2Q3JA 2YXDA 1S0UA 3KX2A 3JQAB 3NKFA 4C1BA 2FYTA 2C07A 1XRNA 4M9SA 4IBOA 3HP7A 1GGVA 3LFHA 3PC3A 4FGJA 4JLDA 4DCPA 3B6MA 4YP7A 1R0RE 2ZTVA 4R9RA 3LBFA 1YZVA 3U61B 4BP3A 3DYVA 1JHXA 4X91A 1I3LA 1QHHA 2OOKA 2QJTA 5F2NA 3LY7A 3DVQX 1OAAA 2IOYA 2AFIE 3DDZX 1IUOA 1OUMA 4BKOA 1GQSA 2C04A 2LCFA 3GEBA 2Q7OE 3T1QA 1GTRA 2P9HA 2QB5A 3D64A 2QRZA 4LC0A 4HYTA 3A1NA 1QVWA 4F1JA 3TTXA 2A9QA 2R1UA 4MIKA 4EO4A 3KCNA 5TMEA 5BOSA 1JKJA 3JPWA 3E05A 1CCWA 2XT0A 3GK3A 4DXDA 2J5QA 3EZXA 3Q8WA 2FSUA 1I7NA 2XE4A 2GPJA 3L6DA 3NBZC 4NVRA 1ZM7A 4A1FA 2Z3ZA 2Z43A 1P5FA 5DRTA 5CX4A 2R6R1 2WVGA 3AL2A 4QTZA 4KJZA 1T5SA 5AJTA 1NTOA 1LJLA 2E1PA 3SP1A 2SCUB 1XZNA 2WTXA 5IHPA 5K0GA 4ZAWA 2J3EA 4MUXA 4PWYA 5AKYA 1H9CA 2GN4A 1BDIA 5JNVA 3QKRA 3UANA 3SF8B 4A6DA 4BC0A 4F38A 1KQ3A 4RHFA 4ZIRB 5B57C 5ESRA 3DEKA 1RFGE 4NICA 3SJ7A 2XVXA 2RAFA 4YNBA 4PVCA 2B98A 4XFJA 4DFDA 4EYGA 5ALYA 4OA8A 2HNAA 3CPHA 1GCIA 4IIYA 4EDHA 2O2IA 3A6DA 4Q19A 2UUBB 3ELBA 3O38A 1QUEA 1GN9A 5G0SA 3RT7A 3TVDA 4B7UA 1U8EA 4RTOA 2FMXA 3KVYA 1E0DA 1YZGA 5CB4B 1X77A 2M6LA 1KR5A 1WO8A 4J1NA 1MGOA 1F8GA 2HLHA 5EWMA 4ZV4A 3DGFC 5G0TA 1Y8QB 4K9PA 3O93A 1T4MA 1HTBA 4NECA 3LXRA 4WBXC 3A32A 3V33A 4V0QA 3ZHSA 3EPHA 4JHLA 1TUIA 3CXUA 1P60A 2BFFB 1K6XA 4MMZB 3ADKA 3ILHA 5JSFA 5K20A 1SUPA 2ZE6A 3A70A 1DAEA 3K0FB 4RSGA 5IZCA 1Y6ZA 5HTKA 3QKUA 3IDOA 3BXHA 2P3QA 1ESEA 5DFAA 2WM2A 2LR0A 1DRWA 4L76A 5AO9A 4DV1B 1WQ3A 2SKEA 4E2WA 4Z7JA 4EEKA 1PWHA 2QRQA 1AB5A 1P2GA 3IQXA 4IHJF 1X3SA 3O2JA 4D45A 2Q4DA 2R7AA 1FDUA 1TZCA 1VHJA 1WF6A 1WV0A 2OM6A 3BTSA 1QB8A 4QC2A 4R1PA 4W7IA 2X0JA 3M33A 2WUWE 3NHFA 2HXYA 3S6JA 3A4YA 3PWKA 3SZ3A 4PWZA 2B83A 2JFHA 5LMCA 1V1MB 2PR7A 3K53A 1D7OA 1ODCA 1IPFA 4MI1A 3CPSA 5GOZA 5IT5A 2H9YA 3ZLTA 5J47A 3LHKA 2GHTA 1TM7E 1AZTA 1J09A 3K1AB 4G1VA 4B47A 4G2NA 4EUSA 4PBSA 2CD9A 3T3IA 4LX8A 1JZTA 4OREX 5K0NA 5JCXA 1P81A 3HK2A 5ITWA 1P77A 4HFNA 4KYIB 4TTJA 3R7FA 1C30B 2C9BA 2HA7A 2XDQB 4JYCA 4DMRA 2BFBB 2BSAA 1THMA 1XCGB 2LP4Y 2GQ0A 2QM7A 2GZ1A 3TXYA 2XCIA 5FP0A 4GWKA 4H4CA 3L8HA 3F4BA 4X3CA 1MW8X 1XZJA 2LUOA 1ADFA 1LGYA 4ND3A 4P3KA 1YI0A 3LY8A 3ZXSA 3CLUC 4QO8A 1T8YA 1FP4A 2IS2A 2OFOA 3FPKA 3FA2A 1VHQA 1A27A 4BNYA 2XMSA 4FIZA 2XIJA 1MENA 4RFSB 3ZE9A 4YXFA 2CL5A 1ADYA 2AEMA 1SG0A 4O08A 1USGA 1X39A 3CZQA 3ZWDA 4R0MA 3GROA 3W5BA 2FMTA 4N4AA 4JUBA 5CFQA 2VTBA 4LKOA 4WMLA 4B3TB 3BHJA 4P35A 5GAJA 5CITA 2N47A 2XLCA 3DLIA 1ZW1A 4HAIA 3UQZA 1N5LA 2CFIA 3EEOA 4LRXA 4IWXA 3PT9A 4XGIA 5M3BA 1GGEA 3KR1A 4RNCA 1FFXB 1U98A 1ZMOA 3C1UA 1YF3A 5DT2A 4Q5IA 4X8OA 2HWUA 4BLUA 3IS3A 3A1TA 2FVYA 3QPCA 3VSCA 1WHSA 4QNNA 1YZHA 4EAAA 2I3AA 2YY6A 3QXGA 3ZE2B 3ZYCA 4PO1A 1ZBQA 4R69A 4TLAA 1TMKA 5SY4A 3I4FA 4OV6B 3BCUA 5C1IA 1BRTA 4QRIA 1LTKA 3EWSA 5U4QA 4IJQA 3OZAA 3AP3A 2NAPA 4TWJA 2GCPA 2JA1A 3AOGA 2AI3A 2FH5B 4POOA 1R64A 2FPSA 3IXLA 4EPYA 3ABRB 3V1TC 1J2UA 1LDBA 4RKWA 5B4VA 3QKSA 1BU8A 4M37A 4MTCA 2DBZA 4R8SA 4ZICA 3W2GA 1X1QA 3ISVA 5E4TA 5K3BA 3UCEA 4ZHQB 3H5NA 3PCRB 2IGBA 4YBZA 3G3EA 1NW9B 2OL4A 2QTWB 1RPTA 2AHOA 3ESYA 3NAQA 4NYMR 1E92A 2FWPA 1T5HX 2ZUSA 2O9JA 3KZ1E 1CY6A 5SV2A 2XI4A 3JQ6A 1TXGA 4GICA 3BGIA 1Y48E 3G2OA 3A0UA 1UAYA 1IQRA 2AR7A 3ZBPA 2ZWVA 3FFBA 3BE8A 4F3NA 4J7AA 4Y1FA 3VOBA 2CHVA 3KLBA 3GLIE 5BQPA 2XCTB 1W49A 1J23A 1IN1A 2H16A 2A0KA 2IYPA 5DX0A 5FQOA 3G2MA 2LD4A 3V3KA 1QGUA 1W4AA 1VJ5A 1OBCA 1YQGA 2JVJA 2O05A 4RMIA 5ETJA 3LT1A 5B55A 3BH0A 3AP1A 2QN1A 3KBBA 4JJIA 4IGIA 2VHQA 5AI4A 5EJ7A 3ONVA 3EISA 1TRHA 2XADA 3GVPA 3KHKA 2ZG6A 3W8FA 3NT5A 4D6PA 1Q12A 1CZNA 3DMFA 4JL5A 3MCUA 2FZKA 2VOEA 2XBLA 4GPD1 2GRAA 4S12A 5DMHA 2ONKA 4OSPA 4C4ZA 3V8PA 3C6MA 2G7MC 4BMCA 3SBOA 2JFOA 1N0IA 4F3YA 4C7MA 1JKJB 1KZ1A 1GILA 3RJZA 3FJYA 4U2KA 4UTVA 5C7OO 1IBLB 4UXHA 1J8DA 1CHNA 2FJ0A 2XUOA 3OZUA 2NXEA 3PTZA 3UW3A 4OHOA 3UWSA 5AVVA 4HAYA 4JJ6A 3DAOA 5EWJA 4KC0A 1QVAA 5AIAA 2W98A 2ZTLA 1ADBA 3IBFA 3AYZB 1MQ9A 2NYUA 2ZTSA 1HDIA 4ISCA 5A5FA 1Y9DA 2BGJA 1UDBA 4HX5A 3VX3A 1D1SA 2Y2VA 2PL3A 4AZ0A 3VR5D 2NP6A 2GM4A 3IC5A 3S68A 3JQEA 3QKRB 1JAYA 4EY6A 4ZI7A 4BZWA 3GCGA 3KOOA 1YS2X 4RZ2A 3D4BA 3LC0A 1IC6A 1HQDA 3A2MA 3R5XA 3HYLA 4E03A 3G2QA 2BVNA 5FO0A 3ZX5A 4QQRA 1SUSA 3ZU6A 1RYMA 2JGLA 6REQB 1G0NA 1ZRHA 2B4TO 2J33A 4EENA 2JHFA 2EZ8A 5EXEA 5IFLA 1HURA 4RQTA 4I50F 3ZZTA 2OE2A 2R8OA 2CFSA 4OHZA 3HL0A 5FBKA 4GBMA 3BRQA 1QF7A 3DZKA 1NJGA 1W2WB 1X38A 2C29D 3GCZA 1OYVA 1Z68A 1HDYA 1JG3A 2FP4B 3R23A 4IDGA 5EWMB 3VOAA 4UZSA 4PSUA 3VR5A 3OI7A 3DXYA 3OWOA 1T6ZA 4GVLA 5ICMA 1Y3CE 1TUEA 4JT8A 3F9RA 4BAZA 4KYUA 1L9KA 3OQVA 4DNXA 4TL6A 2O2ZA 1LBSA 1QYDA 1H93A 3CR7A 2QTZA 1RLTA 4S1NA 5GONA 5TMDA 1M72A 2DPYA 1LNSA 4LDQA 4ZTUB 2BP7A 5DTMA 5AXAA 5ILOA 2XMQA 3DP9A 5DI3B 1I7DA 4Y2XA 5CA0F 5TJ9A 3BGWA 4UJ5A 1HE8B 3N59A 4PEVA 1TI7A 2MSLA 3ELWA 4EYQA 4BDSA 5C5CA 5HOQA 5IVKA 3H75A 1PZFA 3P9CA 4RXTA 1IBKB 3SSNA 3H9JA 2HIMA 4M1TA 3M1AA 5IXYA 3Q9LA 4F4IA 3QWBA 3DM9B 1X1EA 1H0RA 3A27A 1Z17A 4QOJA 2D1YA 5JT1A 3VZRA 2ZREA 3CH4B 1LV7A 3A1EA 3A6ZA 4TV8A 3FUCA 4NAHA 1T24A 1UEXC 2QNRA 3PFKA 2XB6A 3UFXA 2GCEA 1ZD1A 4YGYA 4CKCB 1W581 3NX4A 5F76A 2HSZA 2HT6A 4BGIA 4Z9BA 2QV0A 4BQOA 5AXCA 1GIAA 4TTSA 3REOA 3KQVA 2OB2A 2C95A 2PQ0A 4KO3S 2CZGA 3LM8A 2ZIVB 4RDCA 4LJLA 2ZRKA 2H2IA 1RJGA 2Q6OA 4QODA 4O25A 2N75A 4UW9A 1USWA 2P3SA 4CL3A 4ZVUA 2VHTA 4NCBA 2W6OA 5JS7A 5ELLA 5EERA 4Y6SA 4ALKA 3N58A 3K09C 1AA9A 5L40A 2AKEA 3ZIUA 2A0YA 4HNAB 5JR3A 3DDNA 4O3MA 2JCSA 1R9GA 1JSZA 2R6AA 2L19A 2GWHA 5FPSA 1SA0A 2WWXA 1P0CA 3B8HA 3JTEA 4ZAXA 5FA6A 3INGA 4KQCA 3DFZA 4CZ2A 3MTJA 4E5YA 2HHLA 4LK3A 5TLSA 4QD3A 1BE6A 1NG1A 4JVOA 4RYLA 2YMMA 4IDEA 2UZ4A 1DMRA 1NW6A 4UPVA 1GZ6A 3RK4A 4QPDA 4TMZA 4NS4A 2FY8A 1Z8NA 2F59A 3LFTA 3MS2A 4DCSA 4P0QB 4CR7A 3NVKI 1HFEL 1T1RA 1P1CA 4MKGA 1ECJA 3VH3A 5DM70 1XEFA 2WNSA 3I2JA 4L6CA 1XPUA 4JI2B 2ZIWB 2ZR8A 3BRSA 3HCNA 4IH4A 4WI1A 3DZGA 4YACA 4INPA 5JADA 3P9NA 5KYUB 3GFFA 3HVKA 1N1DA 2BFOA 5JDCA 2FKAA 2FPOA 3L0ZA 1N0WA 4Q9DA 1QQ7A 3FHJA 1IQPA 4INAA 3CB2A 1DIGA 1HLGA 5FUWA 3H2GA 1MQ8B 1TCCA 2DLCX 3VKGA 1GVHA 2VZ0A 3PPWA 5BN4A 1NBMA 2AN3A 1JPVA 1N5KA 2Q7DA 1XSEA 2G9ZA 3E9QA 4XCQA 4Y2VA 5JECA 4GE3A 3K2IA 3Q9NA 3VI4B 1KOGA 1PU2A 3D5QA 1HX7A 5L3QA 3FYUA 1ORDA 1LDGA 4W8HA 2QT0A 5F2EA 4BGDA 4DBZA 3QY9A 4D9NA 4DBVO 3HLKA 1ABEA 1XO1A 1R66A 1TC1A 2VWGA 2AJBA 1I51A 3BL5A 1KOFA 3DV0A 3NP9A 4GLBA 2JD2A 1T3GA 4LQCA 3NONA 4MQUA 5CYPA 3TMYA 5KNLA 1B6GA 3QFTA 4QE3A 3WFJA 3WBFA 3KWJA 4G56A 4ILEA 4ZD6A 2JBWA 5L53A 1PVDA 3PQ4A 1MO4A 3EGXB 3UMFA 4QECA 3BCSA 4DMGA 3LOUA 3DZFA 2ZU0C 2DYKA 4MWTA 2Y0EA 2BM9A 4OXRA 4ZJPA 2DWOA 5CIQA 4UOZA 3U60B 3VI3B 3S28A 3VRHA 5JZMA 1XYVA 3MEQA 4C4PA 3BF8A 2CXRA 3Q87B 3TE7A 2OV2A 1JR3D 4M8SA 1XDWA 1FS5A 1UT8A 4B2YA 3UMMA 3MJSA 4R16A 1AKTA 4R2IA 1CJKC 2FUEA 1IHYA 1OXBB 3IJ5A 1ZK1A 2I3DA 4WKOA 4WNYA 3VSAA 2AB0A 3FPJA 3W05A 4BRUA 4ZCRA 4AD8A 3IAUA 5DW0A 3TDNA 4YJHA 1WEHA 3VGJA 2FXIA 1EVLA 1NDUA 4YXWD 3UPTA 4MGEA 1TJYA 4AG6A 4QHTA 4ZC8A 4P36A 4QQNA 1OLOA 4LJYA 1SUCA 4NNJA 5IDVA 4W5RA 3DT9A 5C1BA 3I1YA 2J32A 1XL1A 3QKWA 4JUCA 1U3UA 1FNDA 2J4FA 1I3MA 5EN4A 2OT3B 2Q46A 1XYGA 2DQYA 2JVKA 3LCJA 3X2FA 3S2IA 2B1QA 1SHZA 4FCWA 1HLFA 1P1IA 1WDLA 4L9RA 4UUBA 1AQNA 3THXA 1GZSA 2PSJA 3V97A 2O2YA 1IHOA 1WW8A 1YSCA 5JRDS 3RARA 2YH2A 1PX2A 5DGCA 3R7WA 2O0LA 1PR5A 2C96A 4BNTA 1M33A 4EG6A 5EWJB 2OCLA 3HHPA 4M8NE 1YOVA 4DVJA 5J4KA 1NAHA 1DARA 2D4AA 3AHIA 4YXWA 2H7CA 2W6QA 4MCHA 3RRJA 3DDWA 1ACJA 4FMPA 1QOZA 3KKLA 2IE8A 4FDMA 5DYTA 5IVIA 5AW1A 4NDNE 4DR7B 4IJMA 3Q11A 1AO0A 4ZI7B 3D2LA 2H06A 3S99A 4UVDA 4JOQA 2HK7A 3QBVA 4CMEC 2Q9BA 2Z08A 1CNMA 3MT0A 1BGVA 3GWZA 1BE0A 3AVXA 3EFEA 4F6LA 3IKMB 1J06A 2FG5A 2V0CA 2R00A 1T36B 3A1SA 2I4OA 3KALA 5KKAA 2RHOA 1MJGA 1P1RA 2J4CA 2CVOA 3EBOA 4UAGA 3HO8A 3O3MB 5THKA 3RVKA 3T0IA 3MWLA 4BBAA 4I8XA 2JBHA 4BMDA 4LJ8A 4NEQA 4CL2A 3CLRC 4O4IA 2OWEA 1GU0A 1P1FA 1OFVA 4IXTA 1EESA 3GMTA 2WABA 3KC2A 4WN9B 5KDDA 3GJ6A 5JY1A 1XTTA 1Y3DE 3B53X 4O4JB 4FMDB 3QELB 4Z99A 2ZXUA 1GPMA 3C1OA 1P7PA 3FG9A 1PV2A 3BZWA 5KTKA 1ZUWA 1VYHA 3ANYB 3U2QA 5BSKA 2HHCA 3VYWA 5ISMA 3DAPA 5LN1A 5BUQA 1EHIA 5KTRA 1CJCA 1QG2A 2WM8A 2VSQA 1GG2A 1V41E 3KZCA 2ONJA 1MJNA 2C3OA 3WYEA 4HNTA 3TX6A 3NWJA 3WNQA 1NX9A 2A94A 3U49A 2AXEA 3QFHA 2FETA 4Q3KA 1T2FA 2K7ZA 4H4DA 5LM3A 3NRJA 3EOBI 1JJIA 2P2GA 2Y1WA 1P7ZA 3M6MD 3R24A 1PFYA 5CX1B 1Q0UA 3SQNA 2AH5A 4M6WA 1QX4A 4IMIB 4L5AA 4EYSA 5AM5A 3E27A 2HF2A 4J9VA 4LDZA 1R12A 4Y2RA 1KAMA 1Y1RA 2FEOA 1V7QA 4ZO4A 4QDUA 3UFXB 1WRBA 3T3DA 4X94A 2NZYA 1OW3B 2EWMA 1RZ3A 4AIRA 2GR9A 3FPHA 3IP6A 1FTNA 2NUAA 4YT8A 1JT2A 2QRGA 2GSWA 3VVLA 4R3NA 4EW3A 1CJTC 2DQKA 2PLNA