4QYIB

1.95 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' with hepes molecule in the active site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
171
structure length
170
Chain Sequence
b'IEIKDTLISEEQLQEKVKELALQIERDFEGEEIVVIAVLKGSFVFAADLIRHIKNDVTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDAEKYRNLPFIASVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine phosphoribosyltransferase
molecule tags Transferase
source organism Bacillus anthracis
publication title 1.95 Angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from Bacillus anthracis str. 'Ames Ancestor' with HEPES molecule in the active site
rcsb
total genus 56
structure length 170
sequence length 171
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qyiB00
2HCRA 2EHJA 4RQAA 2VFAA 5HIAA 1P4AA 5BSKA 4P84A 1ZN8A 4OHCA 4LZOA 4M0UA 1J7JA 1I14A 2JKZA 2H08A 4X44A 1STOA 1XTVA 3ACBA 1ZN9A 1LH0A 2XBUA 5K51A 2DY0A 1P18A 1QB7A 5IPFA 3MBIA 3LRTA 4RHUA 1BZYA 4FYMA 4LYYA 1R3UA 1XTTA 1PZMA 1G9SA 1AO0A 5KAPA 5KAMA 1I13A 4RHXA 2H06A 1GPH1 1U9YA 4WMLA 4Z1OA 1HGXA 1BD3A 1O57A 4F8EA 3OHPA 1QK5A 1DBRA 1P17A 2FXVA 1ECGA 1L1RA 4TWBA 4JLSA 2YZKA 2P1ZA 1Y0BA 4P82A 1ECCA 1ZN7A 1DKUA 3H83A 1G2QA 4P86A 4WN3A 1FSGA 2PRYA 3DMPA 3GGCA 4QYIB 1O5OA 2JBHA 1NONA 1QB8A 1OREA 1TC1A 1OROA 3DAHA 4PFQA 1A95A 4LZAA 1CJBA 1BD4A 3S5JA 1NULA 4M0PA 1XZ8A 1I0IA 3DEZA 1G2PA 4JITA 4ZFNA 2IGBA 1QCDA 3M3HA 4M0KA 1L1QA 1QCCA 3OZGA 4RANA 4RAQA 1V9SA 3OZFA 1IBSA 5BQOA 5ESXA 1QK4A 4RACA 1Z7GA 5IAOA 1UPUA 1G9TA 5ESWA 1DQPA 1U9ZA 3HVUA 1UPFA 4QRIA 2GEBA 4X45A 1ECJA 1XZNA 3ACDA 5BRNA 1HMPA 4RAOA 4RABA 4RHTA 1TC2A 5JSQA 4KN6A 1YFZA 1MZVA 3MJDA 2JKYA 4QYIA 4P83A 1WD5A 1VSTA 1W30A 3GGJA 3QW4B 2E55A 3O7MA 1JLSA 3KB8A 1VCHA 1GRVA 1QK3A 1P19A 3ACCA 4MB6A 4P3KA 4RQBA 1A96A 1UFRA 4P81A 4RHYA 1ECFA 1XTUA 5JV5A 5HKLA 3NAGA 4RV4A 5EUCA 4LYGA 4IJQA 3N2LA 2C4KA 1A3CA 4S2UA 3LPNA 4P80A 3G6WA 1A4XA 4PAWA 2WNSA 2PS1A 3GEPA 5E38A 1A97A 1D6NA 5BQPA 1OPRA 3EFHA 4LZNA 1VDMA 1A98A 1DQNA 1DKRA 1I0LA 2H07A 4RADA 2PRZA 2JI4A 1JLRA 1I5EA 1ECBA 2AEEA
chains in the Genus database with same CATH superfamily
4ND1A 4HNAA 2V4MA 3G1TA 5J47A 2C0CA 2C42A 1EHCA 1NV9A 5DH9A 2HH9A 2D74A 2X13A 3OF2A 3T3MB 3PD1A 3TTSA 4FHCA 5JXWA 5CVEA 3VMMA 5E3IA 2UYHA 2VPYA 2C9YA 3W3ZB 1EVYA 3DXZA 3T7SA 2HX1A 5F7XA 4CIXA 1I1QB 2JVKA 2NP7A 2MYPA 1GZVA 3C4JA 4N8SA 4H18A 3AILA 2JH3A 4QQ8A 4XIYA 1K7YA 1TM2A 2H5JA 4MRAA 1P3Y1 3IA7A 1O3YA 2WIBA 1G6HA 4UOEA 5JIBA 1N2XA 2BEWB 2QTBA 3V4SA 4IQ4A 1KOGA 5KWSA 2YWBA 2W48A 3KOUA 1S1CA 1ZGGA 3S8MA 3GP3A 4WFQA 1G7SA 1NP6A 1W19A 2XPCA 3EMKA 2QVZX 2YIMA 5ALXA 3ZWYA 1PJBA 2IUTA 4N5HX 4QEDA 5DHPA 1I2CA 5GOTA 5D8DA 1RZRA 1JEJA 3K05A 2KPOA 4YY3B 2D5AA 1RU3A 3V34A 1K2VN 3U5TA 1RWVA 2Z1NA 1P1IA 5AKLA 5GWXA 1BWQA 1FTGA 3LUHA 2CFTA 3I53A 3CUSA 4CL2A 1U2PA 4IH1A 4ZGWA 2PSFA 2FGKA 5DK4A 3U4CA 3A4LA 1OLSB 3E05A 1LPBB 3NNSA 4YASA 1RS0A 4F5YA 5K6TA 1LV8A 1AH2A 3ZQUA 4K8RB 4Q4JA 1LDEA 3CEAA 3LYLA 5E9WA 2A9QA 3CUEF 1O89A 4ARZB 5D84A 2KWIA 5E8JA 1EBBA 1TPZA 3RUHA 4D82A 1PJ2A 1E9EA 3QV2A 3F4KA 1XJQA 3KM0A 1UWCA 2M9MA 2DH5A 5ESDA 5ALRA 4KMMA 3EXEA 2XZDA 1ZEMA 4MA0A 5IJXA 4KFTA 4CLDA 5JNSA 1AJEA 3CKMA 1L0BA 2CXUA 4EB8A 4K7JA 2F3PA 1U8UA 4Q1BA 5JO9A 2GXAA 5AQ1A 3DMFA 2UXCB 4M98A 3L7KA 1XZLA 3WHLA 1ZGCA 2J3HA 3BRQA 3AUYA 5FUBA 1E5LA 2FMIA 1RHQA 1VJ0A 2VAPA 4FSHA 2Y0EA 3L77A 1L7MA 4ZVUA 2O50A 2WJ3A 2ZYVX 3BULA 4G5QA 1A9PA 3PVSA 2G7MC 4FBMA 1UJ5A 1L4EA 3UJ3X 4E30A 5AKHA 3KYJB 1FPQA 4XUCA 1O7JA 3AX6A 3E5RA 1CFZA 3HSYA 5CNIA 4EAQA 1JLSA 1UEJA 5C8YF 3VSCA 1Z22A 1E6KA 2GVZC 2JI9A 4ZVSA 2FX5A 4NPCA 3TLCA 1W5FA 4HWSA 4P7BA 3AZQA 2Z9BA 2Q1XA 5CA1B 1CUCA 2C7VA 1G16A 1GQYA 2RCYA 3BMOB 3M1LA 4W1SA 1EINA 4XH9B 4CCYB 4Y0NA 5FWXB 3IJEB 4U7TB 2DBQA 1C9JA 4KQ9A 1HEYA 2JDID 3FPFA 3PUIA 5SZJA 1OSNA 4WK4B 2LCFA 3WBJA 3AR2A 5ALGA 4DMLA 4H7EA 1WJGA 3BIOA 3C6KA 3DNMA 3ENNA 3IMGA 2VWQA 3KVOA 3L93A 3BQNB 3NRCA 3R7LA 4A7PA 4B4DA 4DLRA 1HE2A 2NXNA 1YJ5A 3IAFA 1ENPA 2BUBA 2I6SA 5L7YA 1PF7E 2JI4A 4FD3A 2BRUC 2CZGA 5I45A 2P90A 1EGHA 2PGOA 3IVRA 4HLUA 3PC7A 1L4FA 4IDDA 4Y1RA 5FA5A 4LX8A 2P6MA 4PVCA 1VCOA 1ML3A 4QDKA 1QX3A 3CZ9A 4BO3A 5BURA 2BCEA 5KJ6A 5L3QB 1JHUA 4TL6A 1YSCA 4MDHA 2PWAA 3P2EA 4AKHA 2ZUSA 4RX1A 3B1VA 2E1RA 4FN4A 5DN9A 3BAFA 3GRFA 3ACBA 1WXEA 5IVDA 4A5SA 4D8WA 4EFLA 5KTTA 4CN8A 3DMRA 2WWXA 1MNQA 1WHSB 2BFFB 3O4FA 4FOLA 5EP4A 1CR6A 4HP8A 2IUYA 1MTOA 4EG4A 4JASB 3RV4A 4D7AA 1CDEA 2HF8A 4DB2A 5K3EA 1ZMTA 2DBVO 2F3TA 3M49A 3NTVA 3RABA 3VZRA 4XB6B 4DIKA 3Q9LA 3ENQA 4Y1RB 3TCKA 2Q3DA 3PVCA 1QU2A 3CB2A 4NR0A 4ZIRB 3FXAA 5KYYA 4IQFA 1P62B 4OPMA 1M0SA 3LLSA 5JYBA 4G1EB 1UBCA 2O6HA 5I7RA 2ZE7A 5JZSA 3U4IA 4DUZB 5A04A 1YJQA 1QTNA 2ZBDA 1Y3FE 3EXFB 4MR9A 4Y6RA 2ZTMA 4ZOEA 2MR5A 3T94A 2ZJ3A 3DT9A 4MEAA 3FTQA 4LQ4A 4C6HA 2P11A 2C83A 2FDRA 4WN3A 4C4XA 2V3CC 1N1MA 1QP0A 3BXFA 1P0FA 2CBXA 4LXIA 5LDHA 3OCUA 3I5YA 2B25A 1V16B 2WM2A 4MVJP 3PNVA 3RIYA 1KY4A 3HBFA 3WGZA 2B1IA 4A8JC 3L40A 3KL2A 3T7IA 3KPWA 2LR0A 3Q7TA 4O33A 2OY0A 4D46A 1N6PA 5JR3A 1QC5B 1BMQA 3N8KA 4F3RA 3QVGA 1ZVJA 1N9GA 1YS2X 2JEZA 4RZQA 4WGGA 4RZHA 5DM60 1LK7A 4P0QB 3DA8A 2PWBA 3FWKA 3GAAA 1G2PA 2F4NA 3EGIA 2GM5A 3ZE7A 2ZB2A 3KQWA 4MVYA 5JQGF 4EO4A 3QE9Y 1ZGBA 1V48A 4KBGA 2NXJA 4Y2HA 3U26A 3EDRA 2J85A 3JWEA 3LCRA 4XIJA 1RAGA 3D8NA 1JF8A 2PL9A 3F5MA 1OYWA 4BDSA 3ROZA 621PA 1RPZA 3ZI7A 1J8QA 2JIBA 1SGWA 2F90A 1YHNA 2QT0A 1MC5A 3F6PA 4PYQA 1T4BA 3DG9A 4I8IA 5DTMA 4BJ3A 1L4BA 2FLWA 4D74A 2EXXA 3BMNB 4X45A 3DMHA 5AXBA 2B37A 2AVDA 1GL6A 1NU8A 4XFJA 5HUHA 3O5AA 4RPHA 2HYDA 3EQZA 5AJHA 4Q4AA 3SKYA 3DNPA 4AJLA 1GTSA 4Z0NA 3WLMA 2Y1DA 5L95A 1HYBA 2FW9A 1KMMA 4II2A 2GLUA 2FP4A 2CXSA 4I5GA 4PWZA 5DBEX 2QIOA 3DT6A 4R4JA 4BO4A 5FJJA 2VYCA 1GGVA 4OXYA 1DX9A 2A6PA 4TQAA 3OLXA 3DQQA 4CU5A 1P44A 3IBYA 1REQB 5DOZA 5JS8A 2MMGA 1Z5VA 2Y0BA 3FCYA 5B6IA 3U7QA 2ZR7A 4URUR 4H59A 1EXNA 2I6UA 4BKUA 4CJXA 1Y5RA 1E4VA 3WIDA 3DEKA 1S8NA 4WKNA 2ZRFA 1KE2A 5F76A 3PUYA 2R85A 1NVKA 4R81A 3ZKAA 3U4QB 3JRWA 5ICMA 1E2LA 1QBGA 3EH2A 4EHLA 4GDFA 3E15A 1B8VA 4MMXB 1P5HA 4XD7A 1H4VB 4B79A 4RVHA 3WK7A 3PR3A 4D9GA 4OHOA 4CCSA 2GJSA 5D5PA 3PNLA 1OXUA 5JSUA 1VKHA 2C84A 4OHVA 1NYRA 3L6CA 3JQ9A 3DP9A 4EY8A 4HYQA 5I4IA 1NF9A 4TOIA 1QFJA 3MG9A 3LUGA 3E2PA 1BKYA 3W8EA 2PTGA 2ZIVB 3PF8A 5B58T 1FP7A 2FMHA 1R8SA 2W6IA 2P6PA 4IICA 1II9A 4RHUA 2A9RA 1QR6A 3NP9A 4OBBA 4TL9A 4Q34A 4Z4EA 3LA6A 2B6HA 2P6OA 3Q8KA 5JATA 2A57A 1LLDA 5BMVB 4OHYA 3ETNA 3LQYA 4MA4A 4LC1A 2QVLA 4NAHA 1DT3A 1MRZA 1N9KA 2WIDA 5HR5A 1ML4A 1QK5A 3WSTA 5F33A 2OV1A 5HRUA 4N54A 4TWBA 3VI4B 1NFFA 4JB3A 2P5UA 1P6QA 4KQCA 3MXTA 2NSLA 4W5WA 3FMOB 2J4DA 2NX2A 2WE7A 4PX3A 5D7BA 2A4MA 3A1TA 1RR6A 2ORVA 4TKUB 1DEXA 2G8LA 3FSJX 1GEGA 2FU5C 4IGEA 4LXYA 3K7EA 4V0SA 5DRTA 1XIVA 1XT6A 2IC5A 1WMDA 2WG1A 3UWPA 5EKUA 5D01A 2W70A 5JJBA 4E15A 3IBCA 4FPXA 1NQAO 4JLBA 2CK3D 4EHBA 4DDTA 4I08A 4NBTA 4BLTA 1QS0A 1X1CA 1VA4A 4WOKA 4F04A 1CZLA 3KUKA 1LFAA 1KNQA 1GCOA 4JITA 5HBGA 2JK1A 4WCFC 5CJ2A 4R71A 1NBIA 2FSVA 2VDWA 1KAMA 1O8CA 1NFRA 3OF5A 3EEQA 1C7ZA 5G0SA 1SEVA 1EK2A 1GWNA 4QM7A 1UBEA 2G88A 2N1BA 3FGOA 1PWZA 2UUCB 2I5PO 3OFNA 1CZOA 2YDYA 3OLQA 2I7TA 5K20A 4FYYA 1G9TA 1ESZA 4AY3A 3QLVC 3RRNA 1IRXA 1TVKA 1CS4C 4D9BA 2V5VA 4MGEA 2X7HA 1N2CA 1DAOA 3HB9A 1N0HA 5I6DA 2FEMA 2P0AA 3FNGA 1PNVA 2CFRA 4ZRNA 3QTBA 4GP7A 4Z9BA 4QO7A 2I9KA 4LY9A 1GV1A 2GBCA 2HIGA 3LWBA 1J1UA 3T35A 4H6PA 3HJHA 1Q14A 3G8BA 1UBJS 1ISJA 4CQMB 4TMFA 3H16A 4BRSA 1VP3A 4OHRA 4G56A 3I09A 1A27A 4YJGB 5T4FA 4F91B 4JR1A 1EGMB 2XVMA 1M74A 3H11A 1SA0B 5GP1A 3ZN2A 3DVAA 5IWCA 1F20A 4JXZA 4Q82A 2PR2A 3I83A 1M76A 2QKYA 3DMDA 3IJ5A 3AETA 5DSXA 1Z0JA 1Y7LA 5BWNA 2IX3A 3HO1A 3C3DA 1MPTA 2YJ6A 3QVUA 5AJVB 5F1OA 1M2EA 2X3YA 7AT1A 4ND5A 4PQRA 4NEGA 3CIFA 1A7JA 3PHJA 2CDCA 4RF3A 1WULS 4DABA 4JU8A 3RFFA 4EUFA 1T8PA 2OOKA 4XEUA 1GT91 2ZUVA 3ZVLA 4MUHA 4BFWA 2VA8A 4OL9A 1LBIA 2GEFA 2SHKA 3AIKA 1XCMA 4RPKA 3PE4A 3G0CA 2VXOA 2Y1GA 4YJ2F 2QSJA 1YFLA 3R44A 4LY0A 2QD1A 4ZT5A 3LCVB 3GDFA 3R5XA 2P5YA 1OGYA 3Q0IA 3G9QA 2IK8A 5AR1A 3NCHA 2ZUFA 3VKWA 2GTHA 4ARAA 3COSA 2E4AA 4L6IA 5KTSA 3MRSA 1B16A 1KI8A 3HY6A 1XTRA 3PEWA 1PZMA 2I4TA 4CF7A 1U0TA 4V39A 5AW8A 5DX0A 2AC7A 2WTXA 3SDBA 3WGKA 2VYVA 4IILA 4FFOA 4URFA 5C5CA 4AIIA 2QE7D 4OGGA 3OAAD 4ZZ3A 3FUVA 5ADVA 5KC9A 4F5DA 2Z0MA 1JHYA 2PX8A 3E3LA 4TN1A 3RQSA 3V7WA 2BMAA 3VU9B 2OBMA 3G2OA 2FW6A 2VWPA 4F5ZA 2W4MA 4I99A 1XRMA 3H83A 1YJCA 1B2RA 3J7TA 4K8OA 3THWB 1QP7A 1AKEA 1JEEA 2ZSBA 4AF6A 3WR5A 1BXZA 1F6DA 2Y1OA 3Q7EA 5BR4A 1NPYA 1GGNA 1R0ZA 4NU5A 3SC4A 1N5OX 4NBWA 3GQVA 3WJ1A 1SM4A 3RUAA 4MVJH 1ISGA 1CE8A 2R65A 4K6GA 4UVGA 4ZDIA 1Y3AA 1FP1D 1PT9A 1P0IA 1X7XA 2NVOA 2IUUA 1VMIA 4RKYA 3Q85A 3WNBA 1GN8A 1PT8A 2FR8A 2IGBA 2JFZA 2KBFA 3M4NA 1DC6A 5IYZA 5DTEA 2XDWA 2W83A 4N8EA 1KMIY 1XZHA 1M6VA 1L5MA 3FF4A 3IAXA 2ZIFA 3KPYA 3ONFA 5K45A 5AUQA 5BQOA 1P5FA 1ORRA 2PD3A 1U7OA 2JFPA 2IH5A 4I8DA 2LDBA 4JIMA 5H3CA 5BN5B 1ZI9A 1U7DA 1YZUA 2PUHA 1BHSA 1G3MA 4IIXA 3FNRA 1QZZA 4JKIA 1VSVA 3HY4A 4MR8A 3X43A 4DQ0A 2B9EA 1UM9A 3WLIA 5K0SA 2SKDA 5LD2C 4S1WA 3HNOA 1QTQA 1X1EA 2DWCA 3P9KA 1QMPA 3G82C 3L0IB 4FUQA 3THWA 1CJMA 1PT7A 4M1EA 5HXAA 3NFYA 4GXRA 2Y1EA 3AO0B 4KXFB 4NFYA 4BCDA 1AUVA 2NACA 1A8QA 3K31A 2R96A 1QYCA 2M1XA 5LL6P 4ZT4A 3LUCA 3H4VA 3BDVA 2XQJA 1EEHA 4A6PA 4F3CA 5CD9A 3ZBPA 1WCIA 3HA3A 4UUBA 5FNVB 1YZFA 1A3CA 3MTEA 1R88A 1P80A 2Z04A 3G6WA 3OCVA 4P33A 2HXGA 5CH8A 2C20A 4PAWA 5JARA 3AM1A 5CFQA 4RJTA 1MEEA 3QEMB 5LXTA 2VYNA 4NCKA 1E3DA 3CH5A 4ROTA 5TF0A 4C2BA 4HWRA 4HWOA 3IOBA 4EGAA 1X1QA 5IANA 5K8LA 3QMMA 4FYWA 5AOCA 4Y2TA 5AVZA 4YJ3A 4ZREA 3EAGA 3UJ6A 1W4ZA 2ZU0C 3WMGA 4NZYA 1QH0A 2G40A 3OICA 3KE8A 5F5NA 1E18A 2C7PA 1HK7A 2UKDA 4QBGB 5K3DA 3FYDA 4ZARA 4AJOA 3WC4A 5CG1A 2Q41A 4CM3A 1JL3A 2C5AA 3IIEA 3WK5A 1RXIA 2ORED 4I6EA 4M8SA 3V6MA 4URVR 2XBUA 4E08A 4UPEA 2DVMA 4LDRA 1RXEA 3C24A 3I2JA 3H1BA 3QA3E 5JOQA 2ONKA 2JCVA 2Q2NA 4M6WA 2R6HA 2JCBA 2AN5A 3JWJA 3B5JA 4MYHA 4DCPA 2PGLA 1ZITA 5LOVB 2MU1A 3GLHE 2I1LA 2NT4A 2QI9C 2CXRA 3PE3A 2AQIA 4BOYA 4R1UA 3MC1A 1BS2A 3BGSA 1VL1A 3KSUA 4Y2PA 1ISMA 4LGMA 2YC4C 4MLCA 4Y1FA 1BW9A 3LSYA 4HS4A 4I1UA 3QELA 1TQ8A 1UOEA 4UVEA 2V1UA 2XCRB 4RPJA 5I8ZA 2WU4A 4BMCA 3QH4A 2EFGA 1QG6A 2NVBA 3NIFB 4ZCMA 1M1NB 4I6GA 3D0OA 5TS3A 1X7WB 2LRHA 2VLBA 4JLJA 4PAMA 2YHIA 5G4KA 3VSDA 3SVTA 1MIHA 1BN6A 2P27A 3UK7A 1H9BA 3L7LA 4OQDA 3V1TC 5CB4A 3ZCRA 4AI6A 3DC2A 2C5EA 1J25A 3CO0S 1BFKA 3CW2A 2CXOA 2F43B 3TAHA 4OHKA 1T0BA 1ONPA 3EIUA 3KR1A 4HYEA 4KO8A 3V2GA 1GNRA 3QM1A 4PZUA 4YIKA 4H16A 1XOIA 4DR7B 3C3CA 3T1TA 4JUIA 4BC0A 5DF1A 3T3DA 5K5EA 2FLKA 3S0JA 3OM9A 3EXHA 4LA4A 4I55A 1D2GA 3I2FA 2J9GA 3QITA 4R3NA 3ZQ6A 1HX7A 5FPSA 2HB6A 2WQ6A 2J5QA 3I2YX 4EGCB 1ZR4A 1I7DA 1E8MA 1LLQA 4AROA 2AEJA 2WTNA 1YBAA 2BF4A 3Q5GA 1W73A 4Q4LA 4N18A 5FWAA 4U7DA 3SG0A 1M8JA 2FVXA 3MTIA 5TQ0A 4N3AA 2GD2A 2VRCD 4RFSA 4N03A 3AV0B 1TOAA 4RV5A 2HPZA 3BJZA 3SQDA 4PO9A 3TZBA 3W2FA 2VTBB 3N39C 4Q47A 1BX1A 3AFNA 1AV7A 1AT1A 1K5GA 3OBBA 4R5HA 1LPPA 1KAEA 1RJGA 2PZJA 3KHKA 5G1PA 3UOAB 1PBTA 3NTUA 1FFSA 4DM3A 3MFYA 4TMTA 3W2TA 2QD4A 4RFLA 1UC5B 1WPQA 4PLPA 4XVUA 1BA3A 4JT9A 3U3MA 3H9BA 4M7WA 1L4KA 4MB6A 2Q62A 4MROA 1UINA 2FOIA 1LRKA 1WMSA 4FW8A 1R0YA 4MP3A 1K4MA 1BWSA 1Z0IA 4M87A 3M6WA 3RSHA 3T4UA 1RI2A 1FRQA 4MS4A 1H2HA 5CB8A 1Z29A 4EHKA 5E6SB 4JJ4A 5KO2A 1E1MA 3HVIA 4QQFA 4WK2B 4M53A 2X19A 5DM4A 1P73A 1PSWA 1GPAA 4P4SA 4AMBA 1TF7A 4BGDA 3COJA 4NWIA 1T3LA 5LB4A 4Y1GA 2LP4Y 4PG4A 4B8YA 1JX6A 3LK6A 4GOLD 4HRXA 5EVCA 5JSFA 1GNPA 4QPPA 5BXQC 1U8ZA 5IZCC 2WP0A 3JASB 3WP1B 4Z99A 4S2EA 1UJCA 4Q16A 4F86A 4P58A 1WY5A 4YRDA 1R5JA 4NE7A 1AZLA 1RRFA 1XD8A 2P40A 1I1HA 2CMKA 2DBYA 5JQWA 3RAFC 4U6SA 4GLFA 1DWPA 3AIOA 1GPYA 1U28C 3GU3A 4HXGA 5ETJA 3ZDRA 3H75A 1BHO1 2Z56A 4IGIA 1BU5A 4D9FA 3V42A 3ZG6A 5JO0A 2Z2KA 3DHYA 4LSWA 3HRIA 5DGTA 1N36B 4MKRA 3SJUA 5CLGA 4M99A 1CERA 2YINC 4MYTA 4PGMA 2G17A 4L1KA 4R6WA 4ARIA 1OF1A 1Q17A 1R4MA 1DX6A 1ZK1A 2Z2IA 3TD9A 5CFRA 3JTMA 1OE0A 2FG7C 5FWDA 2QRVB 4RHXA 3Q3HA 4NYJQ 4XLTA 4LDNA 1Q0SA 1JSRA 2IP4A 4G4JA 1KO5A 3AFOA 2FDXA 4MRSA 2X8JA 1KDPA 4I66A 1J4AA 1VLVA 1X80A 2WYOA 4HLNA 4GOOD 1SCNE 1S6YA 3QUQA 4C29A 4FDUA 4OJNA 2QTRA 2IYUA 2RGGA 3PF9A 2QL7A 3K8QA 1JG2A 4M86A 4TYPA 3ZIDA 2FWBA 2WYUA 1RWXA 3QVTA 1S2NA 5D1NA 3MINA 2ET6A 2Z43A 4ZK2A 5I7UA 2PLWA 3DM5A 1OMOA 1P0CA 3OEWA 2H4JA 3PCTA 4Z0TA 3W2GA 3INRA 4D0GA 3RUPA 1IB0A 2HRRA 4WECA 2DBZA 5CP8A 4HAWA 4B71A 4P4NA 3BORA 1H22A 3CRQA 2XE6A 5KYXA 4KODA 4YMIA 5EWJA 2FWIA 3PNYA 4A3SA 4WFKA 4OGWA 1LI5A 1UOPA 2VZ0A 2ILTA 3KFVA 1Y63A 2Z2ZA 4DLNA 5A62A 2X23A 3ONNA 1FFCA 3B7WA 4ZO8A 4UTVA 3PIRA 4FKMA 4CW7A 1KK3A 1QF7A 2JBWA 5IFKA 1YB1A 2R6AA 2VDJA 3GLHB 3VC2A 3K6SB 2P8JA 3OMWA 5F78A 4F4DA 1OLOA 2HHLA 1N9GB 2FCAA 4JFRA 1QO9A 3TQQA 2VBFA 2XE7A 1C1DA 2VJNA 3FWYA 2FN3A 4S24A 4BN0A 1AGRA 2A7QA 1OIVA 1GTMA 1LW6E 1GOTA 3LI2A 1PR6A 2D3WA 1W87A 4I1VA 3GX1A 5L3SA 3EVDA 3R5JA 4H1HA 2P9GA 1HV8A 3U7GA 1VCHA 2DLNA 5UKDA 1GUAA 3BX1A 4KN5A 3HDQA 1Y4ZA 4DJAA 3CTMA 4NVRA 4RGVA 1SXJE 2QEQA 1XTUA 2OORC 1FVXA 3QE4A 5TSDA 1KU0A 3WO0A 4MV5A 2UYGA 2QXYA 3GW8A 4QVKA 3DOUA 2FZCA 3DMGA 4AJ4A 1UFKA 1SHKA 1Z08A 5HNKA 4G8CA 3QMWA 1HDOA 1KXZA 1M1YA 3C4VA 4KNVA 3GEDA 1W4RA 2H52A 4EUHA 5D3QA 2PVSA 3LPAA 5A3RA 4TMZA 5DB4A 1T0PA 4TTVA 1W0KA 3QPDA 2H92A 2D5BA 2OO7A 3FBGA 2FK7A 8AT1A 3DSRA 4LOHA 3UWSA 4HRVA 4TSFD 4YPVA 4EX7A 1C1XA 1IPFA 1I2ZA 3I0NA 1SVMA 5L3QA 1C30A 1L5WA 4LZOA 2W2TA 2X1MA 4C0HA 1UFOA 4S1OA 4WV3A 3T7TA 1Z6XA 3F6RA 3PGLA 1UIMA 2JLUA 1U2EA 2FEKA 2W2QA 2GARA 3OZSA 4I4TF 3JQFC 4J43A 1MO5A 3V6LA 3TAXA 2V96A 2PRJA 5C8ZA 1I6LA 4PIPA 3S2YA 3KPUA 1QRTA 2O0HA 4XGNA 2ZETA 3P2KA 4KDFA 1PT5A 4M22A 1YBMA 1QFSA 4BBZA 5A5DA 5I7OA 1B7GO 4UHCA 5HFNA 4CLOA 4B47A 1M2KA 1Q5PA 5D5HA 2OQVA 4IO1A 3N2GB 1MAAA 4RLQA 4YJ3B 4XUEA 2ZYDA 1NSFA 1WTAA 3W9UA 1E9RA 3TW6A 3GRPA 2VF4X 1A8PA 3B53X 3ORRA 5KWIA 5LVAA 4R8RA 1ISSA 4B2YA 4W5OA 5HP4A 5FV4A 4LZZA 4MIOA 3G2PA 5DEOA 4ZEXA 3D2AA 2ZXEA 5E2AA 3Q15C 2XUAA 2B83A 1OT3A 3IUYA 3C8MA 3GG2A 4OU4A 4YPFA 3UW1A 3ZY4A 4ZVPA 4L51A 4GD3Q 1NJ8A 4IFBA 4KKVA 1UUFA 2GPSA 4US0R 1OA0A 1I3CA 2ZRDA 4J76A 3KALA 3PUWA 4ZOBA 3JASA 2PUJA 4B35A 2NZVG 3OQ1A 3H4IA 1C9YA 1KIFA 2WMYA 4ZFNA 2VK4A 3RVOA 1J33A 1HMYA 2VRCA 1YRQA 3OPYB 4KU4A 4EJFA 4FIDA 5B1YA 4RD4A 5JD4A 1I4TD 4C87A 2WUFA 3MEQA 3KZ1E 2FZ5A 1QIEA 3LA8A 4J03A 3QUSA 1J42A 3TB4A 3M6VA 3BD8A 3LC2O 1PTJA 5FBVB 1MHTA 1F2UA 4BB0A 5IEJA 4JA2A 3F1KA 4Z9AA 4ZANA 3TJMA 1OIWA 1XK6A 3SZOA 5FJIA 5I9NA 3EWSA 1ID8A 3PDWA 1EA7A 1K7XB 4HGZA 5K0JA 1HTWA 1WWKA 3DAGA 3NEYA 1Z2EA 3DE1X 1X7WA 4WCDA 5IM4A 1ZD9A 5DT9A 2J5KA 2BFEA 3KXPA 1QAOA 4C7BA 1G5QA 4BEBA 2J8ZA 4MGKR 3PK0A 2RGNA 1VJ5A 5AJZA 1YA4A 2EL7A 1T8YA 3NHZA 3IOYA 3KEOA 4X1YB 4PZDA 2DX7A 1KJQA 4UBNA 1SCQA 3KC2A 3L1KA 3JAMA 5AHRA 2OXTA 5FBHA 2FMTA 2HRZA 1XKLA 1P7PA 1GCIA 4DQLA 4CTNA 3E70C 2PS9A 2HIAA 3ZZMA 2X4DA 3N6RA 4GXTA 2GCOA 1A88A 1EESA 2BGJA 3LT4A 4MW2A 4UXIA 1E0KA 3RVBA 1C3LA 1KORA 4C4RA 4CV2A 3ELBA 2RG1A 1GCGA 1HLFA 1R5BA 4ZQIA 2NNWB 2PX0A 2UDPA 1LVGA 3B1KA 3CZ4A 3GZTB 3OI7A 2RJNA 4M1WA 4WNIA 2E9SA 1R16A 1YTLA 1ILEA 4ZI7B 2CJPA 2JRCA 5AXDA 1XHLA 4OB6A 1R6BX 2RH9B 3AKYA 5T4BA 3CF2A 1IHYA 3RU9A 4EUSA 2DCUA 5BYAA 3LX6A 4RZ3A 3AIMA 2PZ8A 4KWTA 1AE1A 1XFAA 1G5HA 4F4JA 3U3JA 1AUQA 3VO9A 3I0MA 5BRJA 4EWLA 1A2QA 3II6X 3LXMA 4XGIA 5C8XA 4AAYA 4DTIA 1LJLA 4NCHA 4GRAA 2P3LA 2WJGA 2YV4A 2ZYUX 3BKWA 4CIBA 5MN6A 1UODA 2ZQ5A 1U90A 3OJFA 2C8JA 5ICGA 3CZ5A 3O74A 3QF4B 2P4EA 4PLFA 3ZHOA 2JD2A 1MB9A 2JH9A 4M1TA 4E70A 2YKGA 5CLQA 1MJGA 3JALA 4FNGA 4DQVA 4HMQA 1U0BB 1LQ2A 2ST1A 3NT5A 3ND5A 4P5PA 3GPDG 3PLAE 3FTNA 3WP0A 2IYOA 3R5FA 4B4KA 1NBEA 1UAYA 2G0TA 3B36A 1OU4A 1NBAA 1F0KA 1QNLA 2A67A 1DKOA 1MH9A 1Y0BA 1WUYA 3GCDA 1U1IA 3K94A 4WH0A 4D4LA 2QU7A 1BQEA 1DO2A 2BGIA 3FR8A 3F97A 3ITDA 3PFCA 4J0JA 1Y9DA 4LOAA 1NX9A 1SUAA 1WXQA 5REQA 5KYNA 3DBLA 5E4TA 5ES4B 1XCGB 1P1HA 3FTDA 4BZQA 3IEIA 4QJBA 2HCJB 5KNDD 4I46A 4QUDA 2QRZA 1D1QA 2R6ZA 5JMTA 1FBNA 2VBIA 4RVUA 3QEJA 5K1ZA 3HKBB 3QTLA 1OTYA 3VYRB 5MGNA 1BCSB 5SV2A 2FLVA 2IXEA 1Y8QB 2OOSA 4FZ3A 2FQXA 4BFXA 3Q1LA 4LYJA 3UW3A 3UJAA 4C5BA 1JFVA 1S9DA 2PR7A 4LCEA 1UC9A 5F7ZA 3NVAA 3SBDA 1H8HD 2RAVA 2YH2A 1XTSA 3KTAB 1KYWA 2X0JA 2YNMC 2Q1WA 3PEUA 3QPWA 4MB2A 3KSMA 1XVAA 2FTKE 2QX9A 3A4MA 4FWBA 4B82A 1VLHA 3CYFA 1KPIA 4K5QA 5E7MA 4JYBA 3QWHA 2ZS7A 5JDCA 3BL5A 1ULSA 5ERGB 2OAP1 4MQEB 5J9FA 1TW2A 1IBLB 2VDMB 3BUSA 3ESBA 3LQ4A 4QDXA 1RWNA 5KQMA 4YRCA 1XD2B 4L16A 3GRZA 1GZ6A 3CZPA 2JC3A 4ZAVA 3UB3A 2F8MA 3GGSA 3GRAA 2UV8A 2FPOA 4U6NA 3U3ZA 1X7GA 4DT1B 3GLFA 1UIRA 3FBTA 3HDHA 3ZPXA 3KPJA 2QN2A 4JEMA 5IRCD 3KDSE 3MRVA 5K3AA 1V2GA 2ZR0A 2Y9MB 1T1IA 2J31A 1T6BY 2GF9A 2QORA 2XOXA 4YCLA 1RXVA 2GJ4A 4KPYA 1WMFA 4K2HA 1HLPA 3EXIA 3PGJA 4BHTA 4MRVA 1SIWA 5JBNA 4DDMA 5AK4A 4I4TB 2B7LA 4GS5A 2ARKA 5AVRA 1XDUA 2J9XB 3D7MA 3E23A 1WQ3A 3R4VA 3I2HA 3AFHA 1E8DA 4ZICA 3FN4A 4Y30A 1FNDA 5J4LA 3IPRA 4X97A 2GEVA 3NJ8A 3V8PA 3DT8A 3FPAA 3NGXA 3R41A 1KFEB 2W6ID 4WNAB 4D8UA 3ROQA 2F64A 2AUTA 2V65A 5GY7A 3ZCUA 2J0UA 5ALEA 3S44A 3WZLA 4DA6A 2IYPA 3SSNA 1RRCA 5K0CA 1UCFA 2R4TA 4UDNA 3KKOA 3SYNA 3WGMA 4F2GA 1GTVA 4X44A 5M29A 4ER6A 1TKAA 3Q0EA 4WINA 5CCEA 1L1FA 4I4LA 5KTKA 1MV8A 3N6XA 3X1XA 4OK5A 1LI7A 4PSAA 1HT2E 2XRFA 3SN6A 3DFFA 1S01A 4YRFA 3SMVA 5AXAA 3SXPA 2GJAA 4D5GA 1URPA 3C3AA 1U4OA 3DBRB 3ZJ5A 3V3TA 3LPLA 4BVKA 4RVSA 3WRVA 3DL2A 3DVRX 4JJ8A 3NVMB 4M1SA 1GA4A 4TTJA 4IIDA 4WMLA 5C7YA 3ICEA 4Q9AA 1A8UA 4HWPA 1ZQ9A 4F8EA 1ORTA 3A9UA 1XDZA 1Y3CE 4MV8A 1FYDA 3AGPA 3IDFA 5FQNA 5KNCD 4UTRA 3NHKA 1YS4A 4PLWA 1A2OA 2GPBA 5F2NA 1Q21A 3Q3CA 3OM8A 3L9XA 2Y71A 3SYLA 2I0FA 4R84A 5JYDA 4TZKA 2C7OA 4EPWA 2ZAOA 1W581 1G20A 3AIIA 4X7PA 5B2FA 4UCFA 3KTFA 4XQGA 4AQYB 1T5HX 1EG2A 2M98A 3NKLA 3E1SA 1PKXA 3BJEA 1XK7A 1Y48E 3TM5A 4HT3B 1US8B 2H7YA 4M21A 3AV3A 2YNMA 1WEKA 4RHEA 3ZWCA 5JZOA 5J2UF 4LN1A 4BPBA 2D4AA 2MDTA 1T2AA 3DONA 3DV9A 3KBBA 2E5FA 1ISHA 3QX8A 3VOBA 4YRIA 2ADFA 2RBEA 2YZMA 3FD8A 1E2BA 3A3NA 2IBMA 5FI3A 2ZM6B 1N0WA 2QP4A 4NCNA 4RAQA 4ZHQA 4NHEA 2GD0A 1HNWB 1M1UA 5HWSA 1QYIA 1UKAA 2YS7A 4Q9NA 1ZH2A 2PWZA 3RC2A 3UAYA 3ZR4B 4DCNA 5EERA 4HRAA 1VCIA 2YFYA 4EY7A 1I24A 5KJ1A 1WUIS 4EDHA 3VNVA 2MINA 3EARA 2HI0A 2YN0A 3LT5A 4KRGA 4BLPA 4ERNA 5DWVA 3W2EA 3BKXA 3E9QA 3H87A 5D1HA 2O14A 3G9TA 4JBIA 1QIJA 2ON6A 3A1NA 3OE1A 2FZWA 4N0QA 3W5VA 4A0HA 1NJFA 4D9HA 5AM2A 5B5SA 5C4MA 4UD2A 3UUFA 2BCJQ 2D0DA 2VZ9A 4OGLA 3N0TA 5CH5A 5IF3A 5KQGA 3MBOA 4TLDA 4DNXA 1QG0A 1RIIA 2ZJFA 4GLBA 3O26A 3ZWVA 4ZJPA 2QMHA 2LNDA 1QFMA 3H99A 2IV3A 5JMWA 3QLUA 1CXZA 4MUAA 4C6TB 1QO7A 4RVCA 5JMPA 4I36A 1RE1A 4YLGA 3OU7A 1XZFA 2HQBA 2V97A 3EZYA 5C1BA 2XUOA 4E88A 4JKOA 2RI1A 3BF7A 1AHIA 4ENPA 1JILA 1L2TA 4MYDA 4V2UA 1NJ6A 2Q5FA 4L4RA 3UAOA 2FOLA 4MCIA 2QMEA 1KEVA 2EEZA 4ZI2A 2YX1A 4PX2A 5G40A 4MUKA 4KUHA 5FI5A 2YZGA 2FA9A 5KJFA 5L3RA 3A9VA 2JJ2A 7MDHA 1T1EA 3WJAA 2FF5A 1CB0A 5TC4A 4DL9A 2W37A 4MYRA 4CV3A 1RI4A 2AEEA 2P9QA 5KYYB 4CU2A 4AJJA 1PKEA 1XJWA 3PJFA 4H35A 4TRNA 1AMUA 4EVRA 3ESYA 5FI0B 4NSNA 2OHVA 2NADA 2OYSA 1RWOA 2P3SA 1Z7EA 2V8BA 4E94A 1Z5NA 3L5KA 4MAMA 1P6XA 4QUIA 3WSVA 1TFUA 2QAGB 4CMKA 5I7SA 1WG8A 3CLTC 4PX5A 4UPVA 2VHJA 3SFTA 3PGMA 4XUDA 2H4HA 1Q6YA 3OEYA 3VC3A 1FDVA 2ZYIA 3A1UA 1JIXA 2C5BA 2OWDA 1CU1A 1ZBQA 2QN1A 2XTZA 3BMCB 3OQIA 1XMXA 1ZSNA 2GYWA 2HDHA 1QLWA 3N5CA 3QLUC 5KAMA 5LUAA 4LF9B 1AIPA 1Z4JA 2Y9PB 3AHEA 3ISVA 4B0PA 2ZRBA 2EKZA 3ZWKA 4UCQA 3HO6A 2CY0A 3ON5A 4KR0A 2FPKA 2O57A 1MOSA 4M37A 2B1RA 1O9BA 2ZK7A 3B20A 1CP3A 1L7QA 4PC6A 4PS0A 2JGAA 5TT0A 3RRMA 3ZNPA 4A82A 4D26A 2CMHA 3MT8A 2QSYA 4KR7A 1Z26A 1IWPB 1XNHA 1OAAA 4PSUA 4B6EA 5HM6A 4R0NA 2EBFX 2R8EA 3E7PA 2OZEA 5THKA 3ZGVA 1WHTB 1M6YA 3DS8A 1R4ZA 1JPNA 1E7SA 1QQ6A 1ZUD1 3KR0A 3QXJA 1TW3A 4GKAA 2FPPA 4HN9A 4KYTA 4PFJA 4AW9A 4C0LA 1ODKA 1VI6A 3W5IA 4RVFA 1ZH4A 1IAVA 2NAFA 2VH1A 1LS6A 2FVYA 2PBRA 2PYZA 4OA8A 3VVCA 3ADOA 3TIIA 3HDGA 4TX1A 4ND4A 4BMNA 3U4DA 1P2TA 1YONA 4EHDA 3QX7A 2IZ7A 3HI6A 4WKBA 4C0JA 1ZH6A 5F2KA 4U5QA 3H9CA 2H4ZA 3IEXA 1FUUA 3F71A 4LEIA 1MB2A 3M6MD 1Z8NA 1KDVA 4QKQA 5IDQA 3JYHA 3PC2A 1ZD2P 3QEOA 2DT5A 3RYHB 4TLMB 2F1OA 4KWEA 5LKRA 2BM1A 3OCWA 5EXTA 3SWWA 4F1KA 5EUBA 3VKHA 2PGDA 5CPBA 4WZAB 3OBIA 1ILWA 1U8TA 3FUWA 3NALA 4UHEA 1YRHA 4N0DA 3GOQA 5KNDH 4LS3A 2I7DA 3L9WA 2HPVA 3AL3A 3TZQA 3VGPA 4RFSB 3C5EA 3FYUB 1IXRC 3IQEA 4CYMA 5LNK1 2QNBA 3L05A 1B3BA 2AFRA 2AMVA 4P5DA 4RTSA 4X3OA 3ZDYB 3JQ8B 3KOYA 2BMDA 2XUGA 2BPOA 2ZWAA 3BE6A 5DTQA 1MOQA 3VX3A 1Z4OA 2VP5A 1FNCA 1HE5A 4V1CA 3ES9A 4BNZA 1QVWA 4PZZA 2RHGB 5FT9A 4PWYA 4Q9LA 1AC5A 1KR2A 2D8AA 2Q3BA 2XJ4A 2ZVPX 3AQ4A 3NH6A 4DCOA 2I8AA 2XLCA 3T7KA 3W78A 3SZRA 4DKXA 5LP6B 5FBRB 1N5JA 2HC9A 2YC2C 1WMBA 2OTCA 3HCPA 6AT1A 3FDZA 2IEYA 2Q46A 2ZVQX 1YBVA 3KXKA 5B3KA 1JWBB 1TE2A 1JWAB 5DBHX 4FGZA 3QBVA 4O4LF 5A4DA 2N47A 4A8HA 3THYB 3DUFA 2JFWA 1E7QA 2H5IA 2Z9CA 4O4JA 3MS2A 4IKEA 4WZAA 3A27A 2W98A 5ED0A 4DV7B 2BGGA 2B4KA 3WGTA 4OI1A 2GN0A 3HDTA 1JWLA 4D81A 1COWD 1EQUA 4YECA 3TLAA 3WMRA 1I5RA 1KE1A 1P7ZA 4EY4A 3TFOA 4L5AA 2R4QA 5F4ZA 3QVGB 4PPYA 1YDFA 4Q12A 3VZPA 4HFRA 3RUIA 2I3ZA 3S3TA 4O4HF 3SBEA 4OFZA 3RC3A 5BP7A 4F93B 5DNYB 3D4LA 5EJ8A 2VP0A 2WA1A 3FE2A 2FWMX 5LYJA 5KEIA 1F0NA 7REQA 4YDSA 4R9NA 3LBFA 4FS8A 1SCIA 2E48A 4TSKA 1P29A 1XAJA 3CPEA 3IEKA 4IZHA 4M6WB 4MWGA 1EFPB 2YZ7A 4HDSB 4NECA 1LVHA 4E5MA 4G41A 3MT9A 4KZKA 1RQ2A 3B8EA 4WZZA 1NXTA 2HMYB 3WRYA 4FSDA 4NBVA 2G0AA 4XRRA 1J8VA 1B8PA 3B9QA 4WASA 3ZOZA 2NWQA 3VDNB 5LDDC 4K9DA 4M9RA 3HZHA 2A7XA 3AEKA 5G2OA 2OPHA 3ZH9B 3KEMA 4G0VA 2DOKA 1N77A 2ATVA 3OPNA 1SUCA 4GI3A 4JFAA 4MPTA 3G2NA 1CY8A 1SELA 1W46A 3KQYA 1RFGE 3ORQA 1EZZA 4N5NA 5KTYA 4HPXB 2ZQZA 4DLTA 4AJHA 4EA9A 4TXJA 5H0IA 4MS1B 3AU9A 1Y3BE 5K9ZA 4D2IA 1F38A 4FE3A 2EFHB 3VFDA 4BNNA 3SC3A 1YCFA 1ZNWA 5LXTB 2QTVA 4U9UA 2IOFK 2YWRA 4PAOA 5JAUA 5J5AA 3OQ6A 5GVRA 1T2EA 3IO5A 5CNMA 5JCZA 4GR4A 3ROFA 1S7GA 5D87A 1ADBA 3SQXA 2XKJE 4TMWA 4TWAA 3I8SA 3WV5A 2NV0A 3TTWA 2BEUB 1Y8AA 2HMVA 3ODGA 3AEUA 3RYFA 3PXCX 3HUEA 4UZFA 3DXYA 3UGKA 1AKRA 2FSPA 1IDOA 2KQUA 1AK1A 4MQBA 1D04A 3CN7A 1OB2A 2GJKA 2WPNA 4I7EA 3NWBA 1AKYA 1GPBA 1UKYA 1XQ6A 2VAXA 3N0XA 4ZALA 4RL6A 1EXDA 2F8TA 3SHWA 2POCA 3P4UA 3HKDB 5ILGA 2IY9A 3KNZA 1XZEA 2VDNB 4IHQA 4BIIA 3EWNA 4Z4FA 3CVOA 1HNXB 4D8TA 5L7WA 4OHWA 1A9TA 2ZI5A 3PJEA 4AZWA 2OLJA 1XN4A 4DR1B 4AECA 3FG9A 2OCBA 2QLLA 3TRHA 5A0TA 2GN2A 1DI0A 4OLJA 5COAA 5TVKA 4JGGA 2LKDA 3MWEB 2YVAA 1ZMBA 1KH1A 5IBRA 3ULKA 1G7CA 2GEBA 1DG1G 4ER0A 4XX0B 4B46A 1Y9ZA 3E7WA 4Y98A 4G2TA 3EPKA 1PU2A 3GBSA 2ORYA 3CWZA 1MX1A 4W1RA 1D2EA 2G67A 4F2WA 1NVTA 2VN8A 4CKBB 4GP9A 1BXKA 2JIMA 4HXFB 4YUZA 3NKFA 1JRLA 3TD2A 1JFLA 4MA5A 2HU5A 1H66A 1VRVA 2VO1A 3HBLA 1LV7A 4JI0B 2N1MA 1QHFA 1PEKE 4RV9A 1NLMA 1OXVA 2W2KA 3H8JA 4JXKA 4TTSA 1Y9AA 5C1OA 4WA7A 2AFHB 1KI6B 2XLBA 2Y27A 1VG9B 4IUBS 4M0LA 3IQGX 4PXSA 1OKKD 3D3EA 4WXPA 3O7WA 3EVFA 4C2AA 1OB5A 4H3SA 4DAOA 4IDPA 1TUIA 1MOZA 1FEZA 2BEVA 4ALMA 3N87A 1U8EA 1YRLA 3GB9A 4NEHB 4RETA 5FO0A 2YY5A 1MQ8B 1XMQB 3LWDA 4EPTA 2HQRA 3T06B 5CDTA 4AULA 3BILA 2Q3JA 3IAEA 3SP1A 2IS2A 4LSMA 3Q4GA 3JXEA 1F0PA 3H7IA 2Q5JA 5CFNA 1M10A 4OBWA 2YHUA 2OHJA 1YUBA 2IHNA 1NQOA 4MKIA 3F5SA 3A6ZA 3AVPA 2PPVA 3X1DA 1WZ2A 2I1VB 4KRFA 5EQTA 2ZRNA 1VIVA 2CXTA 1ZJ6A 2OK7A 4LX0A 1VPLA 3DKPA 4LI3X 1KYZA 1QQ5A 4FEEA 3UFBA 5IPFA 5F9MA 3PHGA 4LHZA 4LV6A 1K7SN 3QFRA 5BVHB 1IXSB 1RLIA 3IEUA 1VBFA 3OLWA 4WJZA 4Y9SA 4CLRB 1VLLA 1O95C 3AESB 4W82A 3TSCA 3AW9A 1OR8A 4WUTA 2O19A 2WU0A 1XG5A 2KX7A 1YDEA 5NULA 4HEJA 1C7QA 1FTNA 2PBZA 4H7HA 4HQ0A 3IVXA 1PYGA 2CEKA 2ONZA 5I9LA 1NVEA 5LMNB 1S9HA 3F46A 4R3UC 5E0KB 4DJTA 4UATA 2K4MA 1E2QA 1Y8RA 1TVCA 4J7CA 3K0CA 5AWFC 1HETA 4FCVA 1P7VA 5JYCA 4XB2A 3M5WA 1DKMA 4REQB 2PNJA 1N78A 4FQ5A 1KHTA 2XZPA 3IHKA 4CV0A 2B78A 1OREA 3EFEA 4NCAA 2JGIA 3CW8X 5DNDA 1MJNA 1DMRA 3FFXA 2EIXA 1ULHA 4FFMA 4KLAA 4MUXA 4PO3X 3VDXA 5HSGA 3HN7A 3M4ZA 3TXAA 3QG5A 2O2CA 3Q11A 4IIEA 2FI1A 3EJWA 2GAJA 1C8VB 1DELA 4NPHA 4EZBA 4EVQA 1P39A 5AESA 3TKLA 3UENA 4OXRA 4LF5B 3EZXA 2VAVA 2WRZA 4X71A 3VZCA 5B3AA 3VNUA 1Q1QA 2C2HA 1J00A 3U3KA 1HM5A 4DA7A 1YFJA 1AKUA 3BIJA 2AQHA 1Y8QA 2F1KA 3L7IA 2C7BA 2Z2YA 1P5RA 1KEPA 5DNAA 3TLXA 3O8NA 4D4KA 4DREA 2BFCB 3D59A 5I7EA 2IOFA 1EJBA 5ESWA 4F6RA 2QQ5A 3BEOA 1BJRE 3FPKA 2Z1MA 2G77B 2ZUTA 1ZM4A 3RRYA 5BOSB 3RYCA 3AM4A 4C7MA 2YMLA 3ITKA 1T1JA 1LLUA 2R8PA 1JEYB 2OHFA 3RRBA 2YIJA 3C41J 4HJRA 4LJAA 3EG9A 4DLKA 4EOGA 3TJZA 5KZMB 3M6AA 4XE5A 3L6RA 1N4AA 2JGEA 3UHAA 5E4YA 4UNIA 5HIIA 3O6VA 5CW2A 3L06A 1R66A 3TTXA 4BNTA 4W9MC 4KWIA 1RJ9B 2PMWB 2RK6A 1GR1A 3V9AA 2D5IA 3OA2A 1S4QA 3REQA 3EGDB 4EYQA 4WX2B 4QQKA 1DJLA 1T13A 3IELA 2A9FA 2QTAA 4ECEA 2WR8A 2AK2A 5ES3A 5SZIA 1TUGA 3N2EA 2GBPA 3N6VA 4IIGA 5ELMA 5KYUA 2NUTA 1JFSA 1IUKA 1RMQA 2BUCA 3UO8B 2PKWA 3WGIA 5JCOC 3L18A 4FEYA 3W5BA 4LDJA 5B53A 2BYTA 1ZNYA 4IMRA 4K6CA 2X5JO 4WOJA 3G88A 2HZ7A 3LGXA 4A8JA 4YRKA 3ER6A 3DO5A 2WHRA 1Q83A 1RKBA 1RZVA 2QP3A 2B4AA 2RHOA 3KAPA 4G63A 5ITWA 1SOAA 1VB3A 4Q1EA 4TXHA 2ZATA 3CRVA 4P7GA 4V0OA 1W4AA 2G25A 3DDZX 2WD7B 2Q6LA 3LOPA 4F84A 4IJVA 1YC5A 1N8TA 2G80A 4RGBA 1GM5A 1RYBA 3KB6A 3N07A 4BVAA 3RROA 1I3MA 5DHQA 4ZEMA 4TMYA 3LHDA 3ZZ0A 3SZGA 1C9EA 1QB7A 1ZZEA 4TYMA 4UHHA 4AUMA 3LWNA 4BV8A 1VQ1A 3AVVA 1RAFA 3QUAA 1AXRA 2GRJA 4FE7A 3M0EA 5EKTA 1M33A 1A9ZA 1BXGA 3E61A 3OEED 4QRDA 3IVMA 5G0TA 3TB6A 2B7CA 2WA2A 4IOMA 4BIMA 5IKOA 2J0QA 4QGFA 1O57A 3DP7A 4ZCRA 3LTEA 5DHTA 1E3WB 3UT6A 2NYAA 4EZEA 2C78A 5KNBD 4F85A 4CQLB 3OPVA 4UBOA 4TSRA 4YUWA 5BWCA 4X8LA 2P4SA 4ID9A 1ORHA 1YOBA 3S2EA 5CDYA 2XNDD 2P69A 4HNVA 1FFXA 2AYXA 3L0PA 2HF9A 3PJGA 1W34A 1YZLA 2ZB7A 2RI0A 1F6WA 3CH7A 4YT8A 1S3IA 1J56A 3SQMA 4CF4A 3ECSA 4Q3KA 2IV7A 1JTVA 2FFRA 3NI2A 3ZH2A 4JEIA 3CGWA 4IRUB 1SKYE 3PKJA 5F4BA 5KNLA 2CXPA 3OIYA 3OZ7A 1GTZA 5HPYB 5AUPB 3E3OA 4XWTA 4H4DA 3IHWA 5FWYB 2C9DA 4GNKA 1YCGA 4B3IA 1SUBA 2I7CA 4PG5A 3OTWA 3B12A 1U2DC 2WKRA 5AJTA 1H2EA 1SHZA 4IPTA 4WGFA 1NF8A 4URXR 2HEGA 2W4QA 2OGSA 2P7HA 3OMLA 4Q3BA 3NBMA 1BOOA 1E3IA 4IINA 4L95C 5I7VA 3BF8A 3DGEC 1JG4A 2GRAA 4AMGA 1U0HC 4BEJA 1N2CE 4RM3A 4EX6A 3U37A 1TEZA 3EE6A 1V95A 3AF2A 1N2EA 2B34A 1E1RD 1U8AA 2PH3A 1FNNA 3E5NA 1WU8A 1DE0A 2PG3A 1PZFA 3LAWA 4QOJA 2I1QA 4EGQA 2BTOA 1Z6ZA 2HUPA 3FJ1A 4MRNA 1S3SA 1I80A 3S27A 4AJKA 1SBHA 2VBGA 1J2TA 2G7ZA 2YWCA 4HHEA 4EVIA 4IKOA 4K9LA 3K71B 3E48A 3BWBA 3C8UA 3ICWA 5LZ2A 2RAUA 1KDRA 1ZX1A 3T54A 4DRYA 1K86A 1OPXA 1T8WA 2GUGA 2ORIA 3MWDB 4PN7A 3WY9A 5JAOA 4V0ME 4G67A 3DFKA 3WK6A 2QZJA 3R20A 1FQKA 1ZL0A 3CJRA 2WSYB 2Q6TA 3H2JA 4H0NA 1IONA 1BEUB 2QL9A 3E03A 4QC2A 4TTTS 3EDOA 4Y7DA 1WCYA 3OIDA 4DDVA 4OREX 3GPLA 4WXHA 1ZAKA 3ZXSA 1R7RA 4LYHA 3AZOA 4JUDX 4WWHA 3M5DA 4UASA 1ECBA 1ARZA 1Y1KE 3FPEA 4FR2A 3F5DA 4CKCA 3D8TA 3MQFA 4Y3UA 3Q41A 2KI5A 5EMJA 2GNOA 2IYEA 4IGFA 2O2ZA 5KOIA 4BLWA 2VK8A 1S7CA 3H2GA 3HWWA 3IR7A 5TGTA 4C4OA 3C6YA 5B4UA 4D25A 1PFYA 4JLKA 1H5UA 3ADBA 4OI0A 2XDQA 1KI9A 3EPHA 2ZJZA 1GG8A 1QYXA 1L5GB 4G1MB 4MJ7A 1DPGA 5K09A 2C92A 3HNRA 1OBVA 5E9AA 1FJXA 4LJKA 2A0WA 3E7FA 3CV3A 5M04A 2I4NA 4YYEA 4CM8B 2MINB 1PQUA 1USUA 3K70D 3KLPX 3N76A 1XA0A 2G07A 2Q5IA 4IDOA 3H5AA 4LDAA 3BTOA 5CM9C 4GOMD 2LCQA 4IS2A 1CZNA 1M75A 1NRIA 2VQ3A 3RREA 3W1VA 2ZSIA 3DKVA 1OGJA 3SR3A 1G1MA 3DFZA 4TLEA 3T41A 1QG2A 4YRRA 5CCBA 3ZD7A 3M8KA 4AKEA 1T9AA 3GGCA 4HNTA 4GX5A 2IHYA 4H3KB 3N58A 4JQYA 2PN1A 1E5VA 1C14A 3FMPB 5DBGA 4PCLA 2A94A 1K3TA 1RKXA 1QDUA 2FJUA 3QHPA 2FEWB 3JQ7A 5JI2E 3ADKA 3CNEA 1ADFA 1YACA 2H1CA 1QONA 1C1DB 3OE4A 3QE3A 4OBEA 2OQ2A 4ALKA 1MO2A 1IM5A 1IUOA 5BT8A 4BVGA 3GJQA 3FCXA 1H6BA 4QWMA 4BLRA 5AW4A 1H3FA 4MGIR 5JRZA 2Y0CA 3JVIA 7ADHA 3IQXA 4WCVA 3SPXA 2ZAIA 4MB0A 1U1DA 1SUIA 4CI9A 5L9AA 4DLZA 5FL7A 1PG0A 3AY6A 1A04A 3EPRA 4ZOCA 3W6PA 2QT1A 1ZM2A 2WT4A 4LHYA 1HTTA 3FHCB 4M55A 2A1TS 4RACA 1KVSA 3GLKA 4QUKA 2OCYC 1JH9A 4M0FA 1PV1A 4M36A 3OF3A 4BLVA 1BJKA 3F49S 4C4YA 5EHNA 4YV0A 2QE6A 2BGRA 5ALMA 1CCWA 2D2XA 4QA9A 5BYKA 4RTPA 1ONOA 3QEAZ 4RABA 2C61A 5KKAA 3AQIA 4CF3A 3L4JA 3MJDA 4QYIA 3RVJA 1GTG1 3IPLA 1C3EA 4YP6A 3K9LA 5LZ5A 4JP2A 5L45A 4XARA 2C3UA 4ASUA 2AEFA 3TGLA 2XNKA 3H2SA 2CUKA 4AWBA 3QF7A 3D9QX 3LDUA 4H9GA 4JL6A 4P3KA 4RQBA 3C8ZA 1M2VB 2HN9A 3DZBA 5TT1A 4G89A 5A2QA 3R9WA 1JDPA 3N75A 1VI5A 3I6YA 2ZJ5A 4FKZA 2BZGA 3G8CA 1DOHA 3DAYA 3T1HB 2EQ5A 5CTAA 1X8JA 1IN4A 1XPUA 2J9ZB 1IXZA 3PTLA 4LF7B 2C3PA 2ZXFA 4IR7A 1DIRA 1Y5MA 3QFSA 1SD5A 5HTOA 1H1TA 1RQLA 1V1MB 4YMHA 3KJFA 3HBNA 4X8HA 1VLJA 2ZVDA 5AI4A 1E5TA 3BHMA 3NG1A 5SY9A 2Q4RA 1SUPA 2GCEA 3BRWA 4IXDA 5C34B 4XSHA 1TB4A 1Q0LA 4DLPA 4EG7A 1J0DA 4YRPA 3M2PA 1U5BA 2PLFA 1BE1A 1XXLA 4BGEA 3V46A 1EEXB 5KHAA 4WEQA 1MC8A 3W4JA 5DCLA 1FDSA 5I47A 1ZOSA 1OCEA 2FUEA 3L1UA 2D1FA 2ZZMA 2QG4A 4FOSA 2JKZA 4WLOA 3GDOA 4WZBE 5YASA 4CLEA 4G9BA 4R8LA 2H17A 2YWEA 3KKKA 3TLMA 2OBBA 2ZB4A 4B17A 3T9AA 4ZEWA 3E9DA 3TLJA 1LXCA 5BV7A 5J5VA 2P2DA 2JK0A 1R3UA 4A0QA 2P9FA 3CONA 2CT8A 1UP7A 1WDLA 5FBWB 3UGTA 2DBRA 3VBCA 3L0BA 2AT1A 3GQBB 4IO0A 3UQYS 2HPAA 1ORWA 2IXFA 4JOQA 4Y0AA 4MS3B 3SHTA 1PZEA 2XMGA 3LT0A 3H8WA 1DHTA 3I5UA 2JAPA 1K63A 3HB0A 4ZEOA 3UUEA 3ZGNA 1ECGA 3D3WA 4HDKA 5AJWA 4KKXB 3TX2A 2QS9A 2AI1A 3MD9A 4K40A 1Q1GA 3T9EA 4YAIA 1XDGA 3GT7A 4A10A 2WWVD 5LWHA 3E9NA 3LECA 4CIYA 4KSBA 1HSZA 2HWUA 3JATB 3VR2A 4R2KA 3HJNA 4FFBB 4JK3A 1OFUA 3YASA 1F5NA 1E2NA 1U28A 3RC8A 1I7NA 2H9IA 4J2HA 4FZJA 1VECA 3HMQA 4FVTA 4KYUA 4PZEA 1FXWA 1KP2A 2B21A 4AO7A 1ZD1A 4UTNA 2XWJI 1Q57A 4HEA6 1AUXA 1HTBA 1TPYA 3S4YA 2CXNA 4PXAA 3GLFB 3PFIA 3LRPA 2FPGB 5DE3A 5EJMA 2O8CA 3FCSB 2NTNA 4HFJA 4UUNA 4NZPA 3ZWQA 2ZE8A 4CVNA 2AMFA 4IQ8A 4DCSA 4D0LB 2Q7XA 3DOFA 2QL6A 3GG9A 3H9UA 2HK6A 2RBKA 4N5DA 2H3EA 4LDQA 3VISA 2DMRA 3LVFO 4ND8A 4RZXA 4BBPA 2FEXA 4MSUA 1QBKC 4DXDA 4D3SA 4F9EA 1GNVA 1DJMA 3K9QO 5THQA 3T9CA 1GG2A 2GETA 1CTQA 3KT8A 1H3NA 1ZJZA 2RBGA 2WUVA 2ZAYA 3LDHA 3RB8A 5AVQA 4R9VA 1Z7GA 1RZ3A 3CUTA 2OG1A 2PXCA 4X92A 4J16C 2R8YA 3GZJA 5E6UB 4BE9A 5A03A 2C5HA 1RRGA 5DCWA 2G1KA 2O06A 2B99A 2L19A 4AJ9A 1B0UA 1KMCA 1MABA 4HR7A 3BTUA 3OX2A 1PJTA 4LYFA 4DANA 2I4LA 1H0KA 2MIIA 3NHBA 4COOA 1NUAA 3FNHA 2AG0A 5AKIA 4I1YA 4KE7A 5E8RA 4KEAA 4AXBA 4NHOA 4DMCA 1Q1EA 3DJYA 3IUNA 1U7XA 1LSUA 3CF0A 3L8MA 4HG2A 1XLTA 5I9IA 1GCUA 5JZBA 2QN6A 3FY4A 1HKHA 5EKXA 5CX1A 1BU8A 1Z06A 3H05A 3C4QA 5LLSA 1OXXK 5C46F 4DLAA 4G09A 1K6EA 1NP3A 1JFFB 3WLTA 4BPRA 3T3NA 2BLLA 5I7HA 5TR9A 3IXQA 4I81A 1YL7A 4H7DA 1CRZA 3U48A 2AB0A 4H60A 2AUNA 1OAOA 1PJSA 1U0JA 1YVDA 4R16A 5THXA 3UJPA 3VH3A 10MHA 3R8CA 1T36B 3FF1A 1ZH0A 3WVNA 5ITSA 1GPDG 5E3HA 3W4KA 1OASA 3VPDA 4DIBA 1A4IA 1RM0A 1SPBS 2CHQA 3FHOA 2NTYC 1Z38A 3FYHA 4A27A 2O48X 1P8AA 2VF5X 3ZLVA 4YRNA 3B82A 4BMXA 4DA0A 2Q4OA 3GVIA 3ZDCA 3IT0A 3TO5A 1Q95A 1UKCA 2JJ8A 5EMMA 3ZGXA 2PMCA 1U1FA 1OC4A 4FN5A 1PW7A 3OZUA 4NYJR 5TQVA 5IM4F 3OEHD 3AP1A 2E7ZA 2GK6A 3IFSA 2QSUA 2WTUA 2WZBA 4TTQA 3T1VA 4XZ3A 3G89A 4I5FA 1E4EB 3IIIA 1Z8DA 5IVKA 4LUCA 4GPZA 2LE0A 1GYQA 2CVZA 1G7TA 4IW3B 5LJIA 1GU7A 2B1JA 5AVVA 4H1TA 2ACWA 1DKQA 2ODNA 1IZ0A 4YR7A 1TZMA 2A1UA 2Y4NA 5EE3A 1XCBA 4P2GA 2NMVA 2B61A 3LL7A 4DR6B 2PCJA 2HCBA 5DP2A 3KQUA 1JAIA 1WCIB 2DFNA 4YC7A 2SKEA 3D02A 3TOXA 3MAJA 3DGFC 5F9HA 4NXNB 3PCRB 3W9SA 1ODLA 3BHJA 4UBLA 4WKCA 3D6MA 2DH6A 3EEFA 4UZEA 1DIGA 1CQZA 5CTJA 3HXQA 1T2CA 3TM4A 2DTEA 2C97A 4AJ1A 4ENVA 5GGXA 4R8SA 1UMBB 1GZ7A 1HDEA 1TT5B 2GPNA 1DBIA 2Q3FA 3JQPA 1PHPA 4XQ0A 3U80A 1P75A 4B85A 2E4UA 2RJ3A 4E1BA 5TPWA 1KA9H 4U5XA 1JTFA 2RGBA 4X7BA 2BL4A 1JE0A 1PLJA 1XELA 1P4JA 4J0CA 2BBTA 1Z6TA 3EAFA 3MCZA 2DB3A 1UJNA 3W77A 3GLQA 2EZTA 3C3JA 5GAJA 5FAKA 1XXHA 5B7PA 3EULA 2NV6A 4EABA 3NHPA 4TKLA 3HL0A 1W29A 1NI3A 3OQVA 5AW7A 5GONA 3HO8A 2A58A 3MW8A 4OUDA 1ADJA 5HF8A 3UMFA 1B73A 1XYVA 3V8RA 1EFDN 4EF6A 4HDOB 5SZKB 2B82A 1L4YA 5ERYA 5TQJA 1GY8A 3RQIA 2BM8A 2FKNA 4ARVA 5GV8A 4N65A 1UKZA 1XPOA 2ZYAA 3F7OA 6GPBA 1X7XB 4GZ6A 2JI8A 1RLJA 3PFKA 4PFSA 3U4GA 2PJDA 1QKJA 4M49A 4PLHA 2VL7A 3ACDA 4QGHA 1C1HA 1AMNA 3CUWA 2H4FA 3H6KA 4I5EA 4OYYA 4QULA 3RTBA 1RRMA 2O4UX 2P9ZA 1MAUA 2VUIB 1Z74A 3H8VA 1ACLA 4HSEA 4LC0A 4NE9A 1N34B 1PVVA 2HRCA 1ZM9A 3SC6A 4BZWA 3VBEA 2O7RA 3DCNA 1GKYA 1EK6A 4ZQFA 4DMFA 1PGOA 2E4WA 2H4WA 2K2QB 1WSWA 3GK3A 4O2AA 5JJKA 2RK4A 3EFOA 5C8YA 3L41A 3UYLA 2WVHA 1C1XB 2EU8A 3K8OE 2GJ8A 3H5NA 4F11A 4G37A 3SVZA 3W6ZA 3UN1A 5AUNB 1XKXA 2F1RA 1WSBA 4GKVA 4JDPA 1UDRA 4D4MA 1KJWA 1P9OA 5JHGB 3ZJ4A 3E18A 1XRJA 1IJBA 2ZI9A 1Y7IA 3FOWA 2JANA 3OFKA 4PRLA 3D2BA 4RY8A 4IDNA 5EIFA 3V4PB 5K6AC 4V0RA 2HCFA 1F1BA 3EXG2 2JL1A 3DD1A 1HFKA 4H1UA 3EQ6A 3T9BA 4RYLA 3VR0A 2F62A 2AG6A 2IZ6A 1AF7A 5F51A 4LXXA 2RHDA 4F2PA 5B1SA 1EE1A 1KJNA 1TIPA 4RKEA 3TVYA 3ICQB 3RYIB 4I9HA 5DI3A 4E31A 3LP5A 4B3DA 5DXAA 4EL5A 1V3VA 3IAS1 2J4CA 2NAPA 3HFGA 1VMAA 1OLXB 3HGQA 4Q7KA 4MUJA 1H65A 3R7AA 3BM5A 4BUCA 1E6LA 3RC9A 5HVNA 5LZ8A 1LLCA 4KP7A 5L3SB 3WAGA 2H1RA 3E35A 2VQEB 1TEHA 4XI9A 1U2DA 3LC0A 4FHFA 4JH0A 1WZCA 1XRRA 3LHIA 4CG1A 2P0EA 4EFNA 3AR4A 4UMFA 3GLUA 4ARBA 5JS6A 2XQIA 2YWHA 4PYOA 2FPRA 5DBOA 5FOTA 3KJEA 4MWTA 5A7FA 1Z18A 3BH7A 4X84A 4LY3A 2WHQA 4MGYR 4M0EA 4JJKA 2FSUA 3AI3A 4RHFA 4JOSA 1L7OA 2ZJ8A 3R23A 1U5CA 2XAAA 4P82A 2GCNA 2AD1A 2OE2A 1L5SA 3HUDA 2SCUB 3OZAA 4E2ZA 1DX4A 4DWWA 5H68A 4D4JA 1SBCA 3R09A 1BAPA 4M1QA 4DLBA 4WVLA 5H02A 4LHVA 5EJ2A 2JBHA 4ZAYA 1AXGA 1GITA 1D7OA 3O4HA 1BO6A 1N2CB 3OT1B 3UMSA 4DUGA 1W36C 1NQTA 4TV9B 3FFTA 4J1NA 5G0UA 2RGAA 1EAYA 4MW9A 2GAAA 2P2NA 1C29B 2QN7A 4FE4A 4NESA 3V8MA 4MO9A 5KS2A 1E1RA 2OAQ1 4LJ7A 3JPWA 3DAFA 5E7JA 3WBFA 3WA6A 3HR8A 2EJWA 1U2RA 1E1CB 4ZKDA 5HQ3B 1GDHA 2JLQA 5DU2A 4UD6A 2VNIA 3ZJTA 3D3KA 1I1NA 3OZGA 4WIAA 2Q0XA 4LY6A 5TJHA 5JXJA 4C89A 4FD2A 4OQLA 1J2RA 1JEAA 1QVRA 2PXAA 4MOWA 2ZB8A 1VOTA 3LHKA 5EP3A 3AETB 4BKPA 2AJTA 4TGLA 1FJGB 2OD9A 1EVZA 4ESHA 3AF6A 2H1HA 4BGIA 2ATIA 3CVXA 1GYPA 3IB3A 4TYNA 2CFCA 1DUIA 2ZUWA 4DUYB 3VKGA 1JQEA 3Q1KA 3OA0A 1YDWA 3UVEA 4A0RA 3IP8A 3VRHA 4BNWA 2WU3A 4RYDA 4CM7A 2F9MA 2AVNA 5IG2A 1CYEA 3NWPA 3O7MA 1CUHA 3RJTA 4KGDA 3BB3A 5T6BA 4DUGD 4XGRA 4FKBA 1WZEA 4D41A 1TYEB 1U98A 3TQSA 2M2IA 3AOEA 3GFVA 1E6WA 3HYCA 4L3OA 3ST7A 1TVKB 3P52A 1A76A 3OTHA 5CVUA 1R0CA 5CVTA 5ADWA 2HNBA 4RY2A 3VR4D 1QVZA 4B6PA 4WESB 3ZDBA 2CD7A 2W6CX 3BXGA 1H2XA 3A2NA 4B9AA 4DB4A 2QI9F 2Y93A 4BYGA 2J30A 4EPYA 2YRWA 3C87A 1GSIA 2AZ4A 4HGYA 4L8FA 3UQZA 1I2MA 2PS1A 2YN2A 4UU1A 1GD1O 4K6FA 4XA8A 5ESRA 2Z9DA 3I2IA 8ABPA 3V8VA 4QODA 3KSDO 3IP6A 3H97A 1OA1A 3LP6A 3D2LA 4XYEA 1E1KA 4LBVA 3WOVA 1M54A 1RHKA 2GM3A 2GWRA 2OCIA 3A26A 3B70A 4F8JA 3ICVA 3W06A 5BMVF 1JT2A 1X80B 4HGQA 2CZQA 3CY6A 2QLFA 5EIEA 5F2OA 3LXRA 4FXOA 4EEZA 4QUHA 1ZVVA 5I4BA 1ZGJA 2D5CA 2OILA 2BTQA 3QNWA 1NHGA 3SEAA 3LT1A 2VHCA 4Q7MB 3CIOA 4CZ2A 2GO1A 1J21A 1PUIA 4MCAA 4H7PA 4LJ6A 5T8KC 2RKWA 1QV7A 4QEZA 1AGNA 3LLUA 4EFMA 1U2GA 5A5VA 3BWCA 3HCBA 1V6CA 4UTOA 2RB5A 4Q9JA 5T7BA 1VPEA 3WV4A 2X15A 3LQFA 3FUCA 2IGTA 3LY9A 4EK9A 2C7QA 3G5MA 3TSYA 4GBED 3WL5A 1K7EB 4RD2A 1Z17A 3P2JA 1A9RA 1V5WA 2BJVA 1NT2A 1RBQA 3UPDA 2GZ3A 5KUTA 4EY5A 3F5FA 2Q8NA 2OCPA 1RLOA 1RCFA 1XRLA 1YZNA 4N7JA 3PQ3A 2IUEA 1ZMRA 4MXDA 4YV1A 4PTLA 3OE7D 1JHZA 1U9IC 3QLVA 3WMXA 2AMJA 4B73A 1CUZA 1P7WA 4F6LA 1WO8A 3DEFA 3G2MA 3GCGA 3VKUA 3W5SA 4BL5A 5I4CA 2UYCA 3MCAA 4LOLA 4FOPA 1UMCA 3EGWA 2WJVA 4R9SA 4Y8VA 3GEEA 3VYSB 1ZA1A 3ZC3A 1MLDA 3EQ2A 4FILA 1SUFA 3LZ6A 3MMZA 2VDRB 4X6XA 5KB3A 1NQXA 3QU4A 4RIHA 2IZ0A 4JI8B 3H1TA 5IBCA 1A71A 1IVSA 2B6NA 1O94C 3DCJA 5JG7A 9ATCA 3R6WA 3MJVA 2H7XA 1E3TA 3B6KA 3IJRA 3LU1A 4KGVA 1MW9X 6REQA 4DLXA 4EJ2A 2OPBA 4AY5A 3W9BA 5AFSA 3D8BA 2WJJA 1AQJA 1RLMA 5JUWA 1J49A 1MPXA 1QCCA 2VUTA 4JLNA 1NJ5A 1EWTA 3OD5A 1QRUA 1E2PA 4UAUA 2CMGA 4OB7A 3AOGA 3FKSA 4JELA 4ZEVA 2BP7B 3ZVMA 1X7ZA 4ADSG 3IIMA 4NMMA 5FIUA 2C07A 4FYKA 1YU6A 4JB0A 4OH1A 2EFEB 1IHXA 3GELA 4AC9A 1QC5A 1OD6A 1WAMA 3M9XA 2ECKA 1O77A 3JQEA 2IIQA 3BSFA 3MHTA 3TLBA 4PPGA 3ETLA 3L3BA 4L4YA 2N9UA 1RQ7A 3M6UA 2XGSA 3ZY2A 5JSQA 1MAWA 4RK1A 4DLWA 2IELA 5J59A 1AKQA 1LX7A 3LUBA 3G5AA 4C21A 3K0FA 2DTXA 3ILHA 1Z7YA 5C1DA 4M8NE 4R6XA 4XD2A 4D1YA 1JYEA 2DZDA 1QF9A 3ABQB 3QMPA 3EODA 1C0PA 2CYAA 2GK3A 3HXTA 4K9PA 5DI3B 1E1YA 2P7IA 3LE8A 1E94E 2OHHA 4N3BA 1R0LA 2G06A 4AO8A 1LQUA 2X58A 1DUSA 1P2VA 1W76A 1GZ4A 2ZT6A 5JV5A 4GNRA 1H0HA 2HD4A 5T4HA 3V4ZA 1YJBA 3I5XA 4GG1A 4HLUC 4UUAA 3F9RA 4UPDA 3T9DA 2VDLB 3TXXA 4YRGA 3THOA 5LIPA 2A2ZA 4RXTA 4HZGA 4Z3OA 1QNFA 1TA4A 4XKJA 3GEPA 4GUAA 3NUGA 2F8SA 2D13A 4M0DA 4JVNA 2IA5A 1Z7WA 1V2HE 1TGYA 2PGAA 1YK0A 4XM0A 4ZT6A 3ZI4A 5DHFA 1ODIA 1FYWA 2ZRGA 4CM1A 1FTQA 3WIOA 2WBLC 3I01A 5CXSA 3FLAA 2VFAA 3AF0A 1R9MA 1RNLA 3DE4X 1MJGM 2OM6A 3F67A 4QOIA 4D8VA 3KCQA 3E2MA 3JQ7B 3HYTA 4C0WA 3A70A 5HZMA 2ISQA 2OCLA 3L8FA 3PWSA 2DF8A 3RWMB 1PD1A 1TLTA 1OHHD 1G8MA 8ADHA 4H4EA 1CLEA 3QVSA 2XH8A 4QWWA 3EBOA 4JMLA 5AVWA 1U4SA 3L8HA 3O8LA 2OV3A 4FMPA 3EMDA 2GHTA 4OP1A 4BVHA 4EW1A 5FR2A 1X1AA 2V98A 1P7YA 1SZDA 3WQQA 3NZEA 2ZAMA 1T5BA 3A3PA 3A4VA 2QJRA 4FCTA 2PANA 3UV7A 1H1DA 2AW3A 3KCNA 4KLRA 2GLXA 1HGXA 5EMHA 2EJBA 4RIFA 3WLEA 2P4QA 1JS1X 2BFCA 3OD1A 2ZANA 3ZE9A 4AUKA 2JVIA 3R7BA 3ZGZA 3AFIA 5GGYA 4PIMA 4R1MA 3V4RA 1SU6A 3Q8LA 2PZKA 1M6VB 4G0UA 2W11A 5GM2A 3GJ4A 1OZFA 4E14A 1CS0B 1E1QA 1IZ7A 1QIMA 2C31A 4B4VA 1KC1A 3HG7A 2IFTA 2OWEA 5HJEA 1HC7A 2AN3A 2AXQA 2ORWA 3KTOA 3K1AA 1YWGO 1QGDA 2NU6B 2NQTA 5A1TA 5FUVA 2QYHA 5ALDA 2J6IA 3EASA 3M3DA 2C4TA 2OFXA 2V7QA 1UK6A 1VJDA 1G8KA 1ZNQO 5FR1A 1SU8A 5EZYF 2AJDA 1YFKA 5FFNA 5EJEA 2YXDA 3ZS8A 1FLNA 2GZMA 4PLTA 5HJ7A 4C76A 1KI1A 2YUIA 1PSZA 3M6XA 2FSHA 4GI2A 5BN4B 3SQOA 1F8GA 1AURA 5DNEA 4O29A 3VH4A 1WMAA 2EDAA 1XHFA 3UBMA 1K4KA 2FJPA 3C1OA 1USKA 4IDGA 4LNUB 4EKIA 5A02A 3WQHA 1A5BB 1JKFA 2OGWA 1WBBA 3IBFA 4QRHA 3P20A 2J07A 1A5ZA 1TQ4A 1JH8A 1ODTC 5DBIA 3D0KA 2XTNA 2NP6A 2R6GA 1G5IA 2VCEA 3H0KA 5EJIA 4ND3A 5GONB 1Q0QA 3DZKA 3PEEA 2PE5A 4C0AC 1E4EA 4MPRA 4DUPA 1YMUA 1M83A 4NH0A 1DU4A 3SICE 3VR2D 3PYMA 1L4MA 2Q2WA 2TYSB 1UKEA 3RWBA 2FPXA 4HQRA 4FB5A 4XEHA 3EVGA 4QBIA 2EZ8A 1QDEA 3BHNA 4H08A 4M46A 1WDKA 3U3OA 2FEPA 3PNOA 2ZJOA 3BRCA 2FN9A 2DFDA 4LJ9A 1IXYA 3TQTA 3TEFA 3JVEA 3P94A 4EMUA 1N8NA 3RNOA 1WXXA 4RLHA 4CT0A 2V1XA 3D8HA 1VDMA 5IKPA 3ZHUA 4BE4A 2PJUA 2OLEA 2QYSA 5CH3A 1U8XX 1JKJA 2F3SA 2R25B 2VP9A 5BSWA 3IULA 4CEIB 4XDGA 5H3LA 4Z4CA 4JR2A 2J5BA 3SM9A 1WNFA 1JXMA 3C3YA 3H42B 4O0MA 5HEKA 2OBFA 3L7MA 3WK9A 2XNJA 4EKEA 3U7IA 5CCDA 5HMLA 2ONYA 4WLVA 3HU2A 2JATA 3UMYA 3L7CA 4HNAB 3FWZA 4B2LA 1KAGA 1P2FA 1VP9A 3GUVA 3W7AA 1BC5A 1R12A 1ZGAA 5BORA 2OV2A 1T9GR 3T4EA 2Y1FA 3M5PA 3AHIA 4Z2YA 5J2TA 1M1NA 5DWDA 2A84A 3VVMA 3Q6MA 4ON9A 5B12A 3KQNA 1V47A 5FYQA 3U6KA 1EFAA 1IK6A 2EGGA 3CZQA 4XVQA 2P79A 1VIAA 3GLVA 3UUWA 3GEHA 1KJ8A 2FEOA 4D3FA 1C9DB 1VLQA 3H2YA 1Y9EA 2L17A 1ZIOA 4X0EA 4CMGA 5AJXA 2ENUA 1B26A 2EG9A 1NKSA 4KLZA 3TW0A 4DTCA 3BOSA 3DQPA 2A0KA 3K5IA 2QSZA 4R2IA 3GLGA 3T5CA 3TZCA 1UWVA 1Y1TA 3MFQA 1CFJA 3AR8A 4NAUA 4B33A 4EJMA 4D9KA 5DN6D 5FV7A 2IF2A 3THXA 3CISA 1CNMA 4XOIA 1JDVA 1ZMOA 1F2TB 1GZDA 3W3AH 1L8XA 4G0MA 1H05A 2HDWA 3CRNA 3DOHA 3KD3A 3KHUA 1E9DA 4NH4A 4M0PA 5CBPB 5IK2D 1KDTA 3HJRA 4MPDA 1JHXA 1EWKA 3SX2A 1RRKA 4PG6A 4Q19A 5KC8A 3KBOA 1RC0A 3R6LA 3HKEB 5I4KA 2HLHA 4S3MA 5IT0A 1M7BA 1W2HA 3H5TA 4P9NA 1U7HA 4CCWA 2X1HA 5ILQA 1TF5A 4D42A 1E66A 2VP2A 3NM4A 2JEOA 4UHDA 3EGEA 4M9XA 4PXYA 5K05A 3A9TA 3C43A 4JC8A 1YZTA 1QG4A 4HGNA 1V1JA 3W1WA 2MSDB 4LZLA 2XRMA 4UNRA 4BMYA 4ZV9A 3WB2A 5D3KA 1EX6A 4UAGA 4GF5A 1K89A 1QWSA 2MSNA 4EJ0A 3TAUA 3IYLW 1P8JA 1PR3A 1QJCA 1QHHA 2FF7A 4WADA 1FUEA 4X1IB 3UJCA 4I4NA 4XWKA 3A1WA 3HR4A 5C35A 1ACJA 4OEHA 3H9GA 3HCEA 3ZE8A 2F00A 2CEAA 1IATA 2YBEA 4KREA 3DKRA 1LKZA 2ID4A 4MUEA 5PNTA 5JU6A 3TKAA 2B30A 2VIIA 2CVPA 1W5AA 4CL0A 4RE6A 1KJ9A 4HN2A 2AJBA 4MHTA 1K6XA 2WWFA 3W3AD 1TYDE 1T4MA 3MLBA 3KZNA 4OKSA 2AWNA 5JZMA 1JG1A 4FQ7A 2Q4TA 3DWGA 3LT2A 3H0CA 4EO9A 1AVTA 4QPCA 5HF9A 5HQTA 5IYZB 3ESDA 1XMVA 2GVNA 3OFVA 1ZSYA 1VPTA 2R1TB 2Q3EA 4LXTA 4MWZA 1IUNA 3EZGA 3PBKA 3VJKA 5IHXA 1XVLA 2PQ6A 1EUQA 1SVKA 3EVZA 5BSTA 1BFUA 3DYIA 2XWPA 3QOWA 1IEVA 4RNCA 3IUBA 3K15A 4Z4HA 2WWYA 4NU8X 4XYLA 4M0UA 1GGJA 3FETA 1ABEA 1T9HA 4QD3A 4N9WA 4D6XA 2QYTA 8LDHA 4XPZA 1FU8A 1OZHA 1NR5A 5L6LB 1XC7A 2FP4B 4I9FA 5HS4A 1YI1A 4HDRB 2I4IA 1Y6FA 4L5IA 2HMWA 3DXFA 1KU6A 1E7WA 3LRTA 4HAYA 4PBSA 4X94A 3E2IA 4FYMA 5EKDA 2JD1A 3TCXB 1YVRA 1G9SA 3EX7C 2R44A 4QTUB 3DBOB 1OWNA 2P65A 3LFTA 3JZFA 2CVFA 5AW2A 4J4TA 1ESEA 3H9QA 3AVXA 2OCXA 5H59A 2Z6AA 1Q2XA 2XCQA 1LU9A 1O4WA 1YKGA 3FNEA 3C3BA 1P17A 3SLGA 5CURA 4Z5XA 3QIAA 1KI2A 2IW3A 2X5KO 3DULA 4DMHA 4UNPA 3V7NA 5B7NA 4F5EA 3U60B 3L1HA 4IOKA 3MLEA 1V0JA 4PZCA 5T64A 1E5DA 1JMYA 2Q2VA 2YXEA 1E60A 3R5TA 3K0KA 4J0QA 4GM1A 2HTEA 1VJGA 4CEJB 1DO0A 3HXPA 5JD5A 3ASYA 1QYWA 5CGZA 2QU8A 2ZCJA 5AM5A 1T9GS 4JJIA 3K8ZA 4GAEA 4W4TA 3N7AA 1WPRA 3TZ6A 3FOEC 2Q3LA 1OOEA 3O9MA 1TLFA 5BW5A 4H7IA 6LDHA 4YAUA 4XX1A 4FYXA 2A4KA 3LY7A 3NHSA 3PXEA 1UMDA 3PFFA 4G1VA 4KC0A 5ULLA 5DRYA 1VBMA 1WXWA 2C2ZA 3NORA 1KXJA 4BQIA 3PFHA 1RWBA 1CUWA 3BBPA 1CY4A 1U1CA 3K0HA 2CGEA 1X2BA 3ZTWA 3TOCA 5HRAA 3V48A 3BMNA 4F4IA 2XKBA 1OV6A 1CSEE 2BGNA 2NIPA 4EPRA 1NXVA 4ZMRA 1GYRA 5FL3A 5LMZA 5ER9A 5A5EA 4YRSA 3GN2A 4RM2A 3G17A 2FSSA