4QYIB

1.95 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' with hepes molecule in the active site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
171
structure length
170
Chain Sequence
IEIKDTLISEEQLQEKVKELALQIERDFEGEEIVVIAVLKGSFVFAADLIRHIKNDVTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDAEKYRNLPFIASVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.95 Angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from Bacillus anthracis str. 'Ames Ancestor' with HEPES molecule in the active site
rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Hypoxanthine phosphoribosyltransferase
total genus 56
structure length 170
sequence length 171
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qyiB00
1JLSA 2HCRA 2H06A 3G6WA 1J7JA 2PRZA 3HVUA 1WD5A 4S2UA 4MB6A 1XTTA 3GGCA 1LH0A 1G2QA 1V9SA 1ZN8A 3LRTA 1ECGA 4LZAA 4P83A 4F8EA 4RQAA 2IGBA 1ECJA 4PAWA 1BD3A 4RHXA 1BD4A 1HMPA 1VSTA 1P4AA 3GGJA 3QW4B 1I14A 3GEPA 1QCDA 2C4KA 1QB8A 2PRYA 1QK4A 1ECBA 1A98A 5K51A 1OPRA 1XTUA 5BSKA 1R3UA 3DMPA 3EFHA 4FYMA 4RANA 1UPFA 1JLRA 2PS1A 3OHPA 5JSQA 1P17A 1PZMA 4RHTA 1FSGA 5KAPA 1GPH1 1XZNA 1DQPA 1I5EA 4WN3A 4IJQA 4M0KA 5E38A 1L1RA 1U9ZA 1VDMA 3KB8A 4P84A 1G9TA 3OZFA 4X45A 2GEBA 2P1ZA 4LZNA 1DKRA 1A96A 4JLSA 4WMLA 4QYIA 1D6NA 1GRVA 3DEZA 1ZN7A 1CJBA 3MBIA 4LZOA 4TWBA 4X44A 5KAMA 1VCHA 3H83A 2H08A 4KN6A 1I0LA 3NAGA 4RQBA 4Z1OA 2JKYA 5IAOA 1ECCA 2EHJA 1W30A 3S5JA 4M0UA 1UPUA 1QCCA 2JI4A 4LYYA 4P86A 1U9YA 1O5OA 1A4XA 3LPNA 1P19A 3DAHA 5IPFA 3ACBA 1NONA 1O57A 1G9SA 3N2LA 2JKZA 1XZ8A 4RABA 1NULA 1BZYA 5ESWA 4RHYA 5HIAA 1HGXA 1A3CA 3O7MA 4RACA 5BQOA 2XBUA 4RV4A 1I13A 2AEEA 1QK5A 1L1QA 2DY0A 4RHUA 1A97A 1P18A 1ZN9A 2VFAA 1OREA 1I0IA 4P82A 1OROA 1IBSA 2H07A 2YZKA 1XTVA 1MZVA 5HKLA 4LYGA 1A95A 1QK3A 1Z7GA 3ACDA 4P3KA 4RADA 1DQNA 4OHCA 4RAQA 2FXVA 3ACCA 1UFRA 3MJDA 1DBRA 4M0PA 3M3HA 1Y0BA 2E55A 1STOA 1TC1A 1G2PA 4P81A 4PFQA 5ESXA 5BQPA 1QB7A 5BRNA 5JV5A 4RAOA 1DKUA 4ZFNA 1ECFA 2JBHA 1TC2A 1AO0A 4JITA 4QYIB 3OZGA 1YFZA 4P80A 2WNSA 5EUCA 4QRIA
chains in the Genus database with same CATH superfamily
3BORA 2XB8A 2TSYB 3OP1A 3ZE0B 4EJSA 3OO0A 4LRQA 3AKDA 3H5TA 3NG1A 3RROA 2L42A 5HKKD 3RF6A 4GC9A 2C1ZA 5KNCD 1PW7A 3IP5A 1TCCA 3GMTA 1TJNA 3B3JA 3KB2A 3L84A 3WWOA 1Y1KE 5JFGA 3G2IA 4E4RA 1GPDG 3VQTA 1VKNA 3M1IA 3SC2B 5EJ7A 1GZ3A 1PEKE 3CB4A 3S1LA 4C0WA 3GP3A 3I73A 1W0KA 4AP9A 3NALA 4B48A 1GM5A 1PWEA 3E22B 2PWPA 2I2CA 4KNYA 3LBNA 5CYPA 2L2QA 4DDUA 1IVNA 1PZXA 4JXKA 3OEEA 4FI3C 4PYLA 2XCQA 1L5HA 3EGEA 1I1HA 1M0WA 2IPNA 3DTVD 3DPIA 3TSAA 3A0RB 2YN4A 3L6CA 3ZTWA 3RI3A 3LUDA 5HJ2A 3X1XA 4TYWA 3BJIC 4MUBA 3DW1X 3HB7A 3KOZA 1IXSB 1ZD3A 2ERXA 4FYPA 1E6EA 4IDAA 4KPUB 4QQNA 5HG0A 2HPHA 1QX3A 4KN6A 1RWMA 3FGZA 1AUPA 1FZQA 3RABA 1TF5A 5DM70 3OHMA 1U0LA 1ECCA 2W2LA 4DNXA 1FJXA 3HUFA 1QIGA 3JASB 4N7MA 5FAKA 4ASUA 4FR5A 2AZDA 3KSMA 1ILEA 2FWIA 2Q4OA 5BN4A 4OGLA 5GWXA 1XJ0A 5HKOA 3EOZA 5MHTA 1BN7A 4WZZA 5COAA 3H5RA 3NBQA 1B6SA 4F5WA 1IJEA 3WISA 2HO4A 5DT9A 4WBNA 4LDPA 3SHFA 5BVHA 1K3UB 1NOKA 3H2SA 3UWOA 1A27A 3E3MA 4EG7A 1G6Q1 4WL0A 1QU2A 1ODLA 4LC9A 2PUHA 4JLPA 1UWVA 2XCIA 3AR4A 2O2GA 4JI4B 2R6GA 3DE2X 4ZVMA 3SZGA 2PKRA 3O95A 1YB4A 1CS4C 3JWIA 4LY3A 1M5TA 1C30A 2D8MA 3QEKA 5J4YA 3ZDCA 1ELOA 2BPOA 1W2HA 2A9JA 3NHMA 3DO6A 1YHZA 1TVKB 3RSLA 2FV8A 3V7UA 1G7TA 3KTAB 4X91A 1H8HA 3N3AC 3AP1A 5ALJA 1KC3A 3BZWA 1R12A 3HFJA 4NOJA 5DNEA 4ZOEA 1KYVA 1GL9B 2J5XA 1GCUA 1K27A 3URKA 4YJHA 5HZGA 2VDKB 5CYGA 5B4VA 1CP3A 2HNAA 2RJOA 2HXSA 3LW8A 5F35A 3ZV5A 4BKQA 2IU3A 3U31A 5DN6D 5K6TA 3C3BA 1QIFA 4LOIA 2H1OA 2XNHA 1KQNA 1IU9A 3H9BA 1C9NA 1DC6A 5DV9A 1E64A 3KSAC 2XOXA 3B13B 4KFTA 4EKDA 2O8FB 1HKUA 4N5HX 1QTIA 1Y3HA 3HKCA 4HQOA 4UHEA 2OBXA 4Y2JA 4BFWA 3O1IC 3BOSA 5HW0A 1QUFA 3FTQA 4LQCA 2FEAA 2H3HA 1UPBA 1SXPA 3IJ5A 3W6PA 3QLVA 4EEKA 4B32A 4H2DA 2NYAA 5KZMB 1EFAA 5B53A 4NYIQ 1E2BA 3TL2A 3SQWA 4W8OA 4B44A 4YRRA 2WOOA 1C2YA 1GGVA 2XF8A 2F64A 1NBEA 5BQXA 1N1MA 1PKXA 2B1JA 3JZIA 2Z8YM 4GWGA 4R41A 4BQRA 4X20B 2ZJBA 2XUHA 2JW5A 2Y4OA 3W78A 4RMNA 3HBFA 1ICIA 5C7IO 1J22A 3D4IA 5EHZA 1SIUA 3HU1A 1P9WA 2J30A 1NVVQ 3IL2A 3S2FA 2HQSA 4YCNA 2E48A 4GNKA 1KOLA 4L9WA 1GGFA 3P0FA 3BTUA 1T0JB 1SN7A 1V11B 4TWZA 4WCFA 5JUWA 4H59A 5JI3E 4ENQA 4RKRA 4GP9A 5I01A 3L1UA 3E9CA 3ORRA 3UV6A 1S2IA 4R5MA 4WZBE 4S12A 3STHA 1APBA 5HUQA 3ZZMA 3I30X 2DBQA 3B82A 1PGNA 4MVYA 1GXSA 1JDBC 3IOEA 2BJVA 4HAXA 3OU7A 5KKNB 3LPAA 4EO9A 5EINA 2I3ZA 4JODA 4AY3A 4Q9HA 1I4EB 3PDWA 4A03A 3D8UA 3MA0A 4FZJA 2A9RA 2RFLA 2C82A 2GCIA 2ZWIA 2I6GA 1DWQA 3AY0A 1E6WA 3NCTA 2Y6VA 3GRRA 1XWFA 4KXYA 1JX6A 4CMCA 4BCCA 3AI2A 5JEDA 3QUBA 5HZMA 2DHQA 3K6RA 4F92B 3FTPA 3ICEA 1V4NA 5HKBA 1T8PA 3HPRA 3L6RA 2FPLA 3K8OE 3TMKA 5LMNB 1W30A 3OQJA 3SY8A 2BI7A 4YJ2F 4O63O 4MWZA 2BMEA 2IT1A 1QC5A 2AVDA 2J59A 3OFNA 2X3UA 5DU2A 3A1SA 1MB9A 3EVAA 4MOWA 1WZIA 2ZYTX 4K2AA 5JISA 2M6KA 1AXEA 2POQX 5DYGA 4WXHA 3RVLA 2OVBA 1EFUA 3NWOA 4BNUA 3OUZA 4I1PA 2QVBA 1CRLA 1JAXA 1XQWA 4X1KA 1FS6A 3DAOA 1XZLA 4PO8A 1TVMA 4X97A 1C1HA 2ZJ3A 3DE4X 1OWPA 1P1BA 1M2KA 1OU0A 1IHOA 2XGGA 3J80A 5K0LA 3A1WA 3HJUA 2JCXA 2J9FA 1FUKA 1K2WA 1QP7A 4W1RA 3FAKA 2GXAA 2R11A 3G8DA 2CZQA 4IDQA 5GPBA 2PBZA 2CLOB 1DHRA 3VUEA 1U3VA 4OLHA 5EZ5A 4IFBA 3ZDDA 1GPWB 1MFPA 4UDNA 1L8AA 2XB4A 3LW7A 3G8AA 5J4VA 3FDXA 3GGOA 2QD4A 3MTEA 4P3KA 1WXXA 3VR5H 1RC8A 1A9SA 4MA4A 4BQFA 1EVKA 5JJCA 3ETDA 1DI0A 4D8TA 1ZLYA 3PUZA 4MW9A 1L4FA 4RLSA 5H3HA 2E89A 1HFKA 3ZY4A 3D7KA 1DAPA 3LC1O 3E27A 1JIVA 4F6RA 3TOXA 1QO0A 3ZU3A 1LWOA 5A71A 4K0KB 1E9BA 4HWOA 3UENA 2GF9A 4OJYA 1FDOA 2D5BA 2QOEA 3M82A 5DB4A 4C3UA 2V4MA 2QY6A 2XCUA 3WHKA 4OQXA 1NFQA 1KYXA 3A1UA 3MAGA 1T3ZA 1WQ4A 1FXSA 3EUFA 3AF6A 5B36A 4PIVA 4JI6B 5EUCA 4BKOA 2CXOA 1QPGA 4JLWA 4A5SA 4OQMA 2XR1A 1VI6A 3JQAA 1TJ3A 2Q1SA 2QX9A 4OKIA 4RYDA 4ZO8A 3V33A 1E3QA 1U3WA 4UBNA 2D6FA 3LCUA 4RPIA 2ZVPX 5ALHA 5JASA 2PH7A 3ZHTA 3INNA 1VJ0A 4EA8A 3DQQA 1T43A 1T29A 1PD0A 3N2ZB 3PNYA 3UWDA 4S1NA 2XYHA 1LVHA 1B8VA 3AJRA 1CUDA 2LDBA 3PKIA 3QLEA 2X14A 1CF2O 1T1JA 2LUOA 3SSAA 4XRGA 4B3IA 4CN8A 3QU2A 2GCGA 2PBLA 4HAZA 1G55A 1N2ZA 3OZEA 1IEXA 3BIOA 2HHCA 1H6AA 4JQZA 3WGLA 1A82A 2PSJA 2QQEA 3WYDA 5HVNA 4JLSA 3F2IA 2X4IA 2PL3A 5IYZF 4V1CI 4I1VA 4FSDA 3LLSA 3KKPA 3L4EA 4ID9A 3UJ7A 1OYOA 1CUWA 5J2TB 5E7IA 1N6NA 1DJMA 1G17A 3I1IA 1E3JA 4A2PA 1NBWB 1U7HA 3PVSA 1LI4A 4OBEA 1BX0A 5FPPA 1U0OC 5LCXA 5DGXA 3X3HA 2OZPA 3F5SA 1XU4A 2ZWOA 4OH7A 2W6NA 3G59A 4KVAA 3L06A 5GP1A 5CJPA 2QW8A 4EFMA 5BUSA 2ZSFA 4MLPA 4ZO7A 4YUVA 4A0HA 2V6GA 3RVJA 4GNRA 3FOCA 2P5YA 3N6RA 1F4VA 4TT8A 2P91A 3F1LA 4B6EA 1J99A 2YV5A 4M83A 4RVFA 3RRNA 3AB3A 2UVQA 4ZEWA 3F73A 1TT5A 2Y71A 3AUYA 1UOOA 4TM8A 4BFTA 3DBVO 4RZUA 3SM3A 2X0IA 3DMHA 5AVVA 2RKOA 4ERXA 4F6LA 2KJQA 3O38A 5CLQA 2GWHA 2B4KA 2CYCA 2YZ2A 3STUA 4B80A 4DC0A 1FJGB 1TD9A 5JHGB 2DY0A 3NNSA 2VZ9A 3EFOA 4L9RA 3HDGA 5HILA 5TPWA 3WR5A 1FFGA 1RJDA 2HCBA 3MCTA 4OHBA 2A1UA 4HBGA 4BMVA 1WCV1 6REQB 1I3KA 4MPTA 5BSEA 1U7DA 3I0MA 4MVJI 1IZ0A 4P6VF 2NGRA 4UD2A 3LT2A 3OUUA 4QPDA 2NU9A 2OO7A 4MVCA 3I05A 4RKYA 3N59A 4H15A 3P8ZA 2W4MA 4D25A 3PWSA 5F7OA 2BP7B 3FSJX 4K6GA 4YVFA 1E2MA 5FR1A 4M9ZA 2OOKA 1DRWA 3Q0TA 1OLOA 3M3HA 5JZVA 2AFVA 2H8KA 3QQ5A 4S0XA 4X0EA 3N6VA 4S1WA 3OM1A 1KZ1A 4DLSA 2Q3MA 3EGDA 1NJ6A 2AQ8A 3N2EA 2XE8A 3JARA 2WUVA 3PQ5A 4N47A 2C0CA 1WUIS 2G4VA 4BWYA 1NX9A 3W8EA 5DLEA 4ZFNA 1K5PA 4AN1A 2NN3C 1M3SA 2XWPA 1QZTA 4Z3KA 1Y4DE 3LF2A 3SQNA 4P80A 3I2KA 4HX9A 4LDAA 1FVOA 5KYNA 2J4DA 1FMTA 1YQTA 4GXTA 2N1BA 3E8MA 3MWDA 4B9AA 3O4FA 4OLAA 4YP1A 1RRVA 4INZA 4EARA 3TLBA 4EHHA 6ABPA 3VBEA 4RGBA 1YASA 2FG5A 4B17A 1SCUA 2IXEA 2VCEA 1DTWB 4CW7A 4KO8A 2I6SA 3E5MA 2MU1A 4QOHA 5CNJA 1I3OA 3PG5A 1B1CA 1KKUA 3KTOA 1IM2A 4Y2GA 1E2QA 1R7RA 1YZYA 4D4JA 2B61A 1Y3FE 5TNXA 3G82C 1QTQA 4R7GA 2XUFA 2Y9PB 4BIIA 4BLVA 2CNNA 3PSHA 4D6XA 4Q3AA 4ZT6A 4TXHA 3JD3A 1E20A 1W73A 2Z4RA 3O75A 5AKJA 1JU3A 5BPFA 2OHFA 1WRBA 3V32A 3LKBA 4IHQA 2EF1A 1KERA 4GOMD 2C3OA 4PAQA 1VIVA 1T8YA 4LUCA 2ZTUA 1E5VA 3FPFA 1ISRA 4ODIA 4BMOB 2FUKA 3JALA 1VSVA 1H2HA 4Q4AB 4AY6A 5A6VA 2W70A 4REQA 2CB9A 4JJ6A 4WEOA 1EXMA 3SKXA 3K4QA 5JJBA 1DBQA 4L76A 5IAOA 4WK0B 3B1KA 3RBZA 4FDTA 2QUBA 5CHEA 3ZTYA 1U2ZA 2IODA 4JL5A 3VR3D 1QKKA 1NVBA 2PZAA 4OYLA 4ALLA 5C7OO 1W44A 5FJJA 3QKIA 3QG5A 3DEFA 3HRHA 3UXYA 3BE6A 3VYVA 3AVXA 1Y1SA 2Q45A 1OAOA 5T64A 1WEHA 2WA2A 5EXDA 1B2RA 2WJHA 1FE8A 4KLCA 1V8ZA 2KMLA 4N5NA 1K5HA 4QBKA 1GPNA 1BGVA 2DR0A 4W99A 3ECAA 3TXYA 4WVLA 4HXGA 1JHYA 5F3DA 3GYGA 2JFUA 4OLJA 5I7UA 3U09A 1NONA 5GINE 1NGSA 3F7NA 3OOJA 4GX2A 1F12A 4GLFA 2GHIA 3PR2B 2B4RO 3ZDRA 1GFIA 3H4VA 3TAUA 1JIIA 4DRXA 3W1EA 4Y0NA 4A0RA 2OXFA 3PIDA 1NIJA 3EX7C 3QE0A 3BMOA 3YASA 1B74A 3OU6A 4ZQHA 2J9ZB 5BMVF 3TQQA 2B5WA 2XUJA 3C6KA 3TW4A 5IC4A 2VSNA 4CKEA 2GYWA 2OBFA 5FFMA 2EBFX 4ZU3A 3ETNA 3ROKA 3C7AA 4O5OA 2PMKA 2H9IA 1WF6A 4OB8A 1D04A 1W48A 3V7WA 3U2QA 2R7LA 5LP1A 2NYVA 1NQUA 4R40A 3U7QB 1YZFA 4REOA 4Z86A 3WMRA 3ZE7A 3H0CA 1BC5A 2JKVA 4LMBA 2F59A 3VZSA 4UW9A 2G1UA 1JFRA 1HZZC 1SB8A 4RSGA 1DQNA 4BQPA 4Z53A 3MRSA 1Z5ZA 4RK5A 4F5YA 3Q7RA 4YRPA 3ZHUA 3K9NA 2FLVA 3SC6A 4YRNA 2GM4A 1AE1A 2V7PA 3IUYA 2JCVA 5BSGA 2DB3A 1BE1A 1BDHA 1ULBA 3LBAA 4NABA 3G8YA 3KOMA 4JJGA 2Z2JA 1XHEA 2J48A 3L6DA 3WV5A 2NTVA 4REMA 3L8CA 1PQYA 3WYFA 4ZVOA 1SM4A 2WM2A 1O7JA 5LJLA 5TXGA 1EDBA 1SPBS 3PRYA 5KSYA 1T2FA 1VPDA 2WFZA 3WK8A 1O03A 1T5HX 2VHXA 3D4LA 2D0OB 1L5VA 3DTNA 3GU3A 5E8RA 2PLAA 4QYMA 5EMKA 1F0PA 3TW8A 4AN4A 1ZRNA 2W43A 1VHJA 3I8OA 1FCJA 3LY5A 4MWSA 2UZ1A 4XPIB 1RNLA 4DM4A 4F4FA 3ZWMA 3Q3JB 1BD4A 5T6MA 1IRIA 1PTJC 4NKRA 2QVCA 3KKOA 2BI8A 2MSEB 3QF4B 5E6SB 1TCAA 4JOBA 3Q3IA 4NZOA 1N5KA 4MW0A 2C7RA 4I5DA 1XVVA 3BXEA 1HL3A 3HNRA 4Y6PA 5DWQA 1W5TA 2Q07A 3QSGA 2C58A 1MABB 4CGZA 5DKFA 3LT1A 3DL4A 3MGGA 2PD4A 1V4VA 1IB6A 2IYTA 2YWHA 5CIYA 3HP4A 2X7JA 4I5GA 5SZIA 1GRNA 1B4DA 3T06B 5EP2A 2M32A 5K0FA 1H4QA 4YXFA 2CHUA 3A3YA 3JYNA 5CGQB 1NJ1A 3PYXA 1O8CA 3GDHA 2JJYA 4ES6A 3U5TA 2AWOA 2ZT7A 2BE7A 1LSSA 3TJZA 1EX6A 2PLFA 3FKJA 3QXGA 1MP0A 4G1CA 4JT9A 1WR8A 1Y33E 3H83A 4HRAA 3MRTA 4E5SA 3FSGD 1QWSA 2ZIWB 3JU3A 4H1UA 2ZS7A 1PX2A 3PC8A 1JFFB 2ZRJA 1FRZA 5DBGA 4TZKA 3UUWA 3RTDA 5ADVA 1YZNA 2J9GA 2QR3A 1QAMA 2IYEA 3I92A 2EJUA 2ID9A 2X8WA 4ISCA 4DB4A 1L7MA 1IY2A 2PZGA 3QF7A 1KMHB 2XDYA 3ZCQA 4Z1MD 5ES4B 1NN1A 4LTDA 1TFRA 2HK7A 2WEKA 4DKXA 1OH5A 1KEWA 3N7TA 3WGKA 3W6ZA 1NJ2A 2DJIA 1GG8A 1SQFA 1GV0A 1Y8AA 1U4NA 3E03A 1FF9A 3OU2A 3DFZA 1W5AA 4G25A 5IPFA 5MN6A 1GCGA 3QJGA 4U5XA 3DLPX 2F55A 3AERA 1M7BA 1UT5A 2WNIA 3ONVA 1KI6A 1E1DA 3DG9A 4M1WA 5K3FB 2PUWA 3V1YA 4AB1A 1JMVA 1KHHA 2WUFA 2QT9A 5CK5A 1T2AA 4I4CA 3VSDA 3DO8A 1Y5LA 1UJ6A 1K7FB 4R2LA 4F9EA 1UBNA 4LBWA 4XGIA 2ZRFA 1KVSA 1IY8A 3RVKA 4BRWA 3A6FA 3KVOA 3SJCA 1SUDA 2JLAA 2ZFUA 3QV1A 3I2JA 2CKDA 1IHXA 3QMMA 3HFSA 4MQEB 4Y2HA 4H18A 5BUCA 1C50A 3G2HA 4YALA 2ZU0C 4RD1A 1HYEA 5K09A 3WGMA 1C1DA 1U0FA 2BLNA 4Y0AA 5GJBA 1CVIA 3W77A 3DFUA 3IRVA 5HF6A 3OTWA 2QD3A 4IV0A 2BH2A 3GRYA 2VWPA 2V45A 3EZFA 4DA8A 4Q4LA 4LZWA 4NBLA 1P2UA 4GXQA 1J0AA 2QE6A 1M2GA 4PVCA 4Q15A 1ZK3A 4TLEA 5EZ6B 1OT5A 1U2TA 2JIRA 3ZHOA 3UJ3X 4WDRA 2HQOA 2D4AA 2Q5IA 1D03A 3GQBB 4I9HA 1S4QA 1O95C 3RJMA 1E5QA 1SVLA 3G0IA 3IQHX 2Z95A 2JD0A 2I7DA 1CDOA 4Q1FA 3B1YA 4N18A 2H1VA 2VJDA 2IKQA 2FSPA 3NNNA 4RW0A 1U6JA 5A4JA 1TKRA 3C6BA 2O57A 3WGGA 4AYWA 1RXEA 2TYSB 1NXWA 2C9MA 3DPSA 3LCJA 4I1SA 4RELA 3TTXA 2ZE7A 4C30A 5KNBA 2EX4A 3OCUA 1XRMA 3KWLA 5H82A 1A0OA 2ZYAA 4HQNA 4EM6A 3HDYA 3ZXXA 3CYFA 3LBHA 1PKEA 4PRKA 5ED0A 3UJCA 1DUVG 1SEPA 2OORA 2OT3B 2FPXA 3KOUA 4WY2A 5EKUA 5HRAA 4GKKB 2BGJA 2XYGA 2KQUA 2WJYA 6LDHA 4QXPA 3LS2A 1ZIPA 2ENWA 4L8YA 1N5RA 1BG6A 2ZJ0A 1DCKA 2OV2A 1UXKA 5KSPA 4FCTA 3BYZA 2BKLA 1E3EA 1P0CA 1QFSA 5DHSA 3WQRA 2BEVA 2NIPA 1PTKA 2ZYGA 4TT3D 2ZZMA 3CR7A 3AJDA 3JSXA 4OOEA 3DCNA 3EZNA 3EBPA 5JSZA 3B6IA 3M70A 4RPJA 4X45A 2HCFA 2ACKA 5DHFA 4DQUA 2L82A 3FH0A 5KVCA 1MQAA 5KWVA 2IU4A 2NXWA 5CVVA 2EBWA 1HE2A 4CKCA 1V45E 1J0CA 3JQRA 4JC4A 4CEJB 3BK7A 1RWKA 3BFVA 4NNOA 4Y1EA 3RSOA 1RCUA 1G19A 3ZR4B 4EW1A 5B6PA 1KH3A 2LP4Y 2FMKA 3NH9A 1PQPA 1TNDA 2VPWA 3S2GA 4GL2A 3GLQA 1AGYA 1IDN1 1RWVA 3WGQA 3M2TA 2EVWX 2XNDA 1S4MA 2GXUA 2YNMC 1DS6A 4UE2A 2HQRA 4PGAA 4ZRMA 3R7DA 1AUVA 1GT91 2V65A 2EARA 1SQ5A 1PR1A 2J6IA 2PAAA 3H8SA 3TSZA 3C16C 1RZUA 4DCCA 3T8YA 1G0OA 2ASVA 4QFDA 5DK6A 5TMDA 3M1AA 2OCXA 1E32A 4RPCA 1KDPA 3FMGA 3K8QA 4P5PA 4FWTA 3OQVA 2WYHA 3RSGA 2YV4A 4OQNA 4QD3A 1WM1A 4ARZA 2YKGA 1S2DA 2DWQA 2HXGA 2V1XA 2VJAA 2O0HA 3UFXB 4D3DA 4NE2A 1VL5A 4LXYA 2ISQA 1ZD9A 5FBKA 4C08A 1ZGJA 4CMEC 4HRYA 2XGOA 4EYKA 4HDOB 3SIRA 1UR5A 1F7VA 4U00A 2OD7A 3QHAA 4RHYA 3UWMA 2QJTA 2PJDA 3B9QA 3GVIA 3SVTA 3QVOA 4MWEA 3IQXA 4KIFA 4Y6LA 1GY8A 3A0UA 3R0ZA 2BM0A 1S96A 3GO4A 2IXBA 4KQIA 2FSGA 3RRBA 3Q9NA 4RHUA 5KMGA 3FPSA 3ONDA 4X60A 3OIGA 2DHRA 2YVUA 3DUFB 1IEVA 1K9VF 4QU5A 2Y0BA 4HQFA 5GOTA 4CCWA 4DFDA 3ZZUA 5LQNA 1LI5A 1Z13A 4JYZA 2V03A 3HM2A 4G4JA 4JQOA 4TTPA 4KLAA 3SX4A 3TQCA 3K6SA 5C53B 1M1YE 5BN3A 4GOND 2XWQA 4OHCA 4EK9A 3EIHA 3FRHA 2VKQA 4US0R 3CM0A 5EJ2A 3AF4A 4K40A 3N8HA 3UAGA 4GKVA 1O6GA 3U16A 2G5CA 1EX7A 3ERCA 3F49S 4LJ9A 4BNZA 2I4MA 1J9ZA 3QITA 4GHWA 4MQMA 1VB3A 4RCZA 4DWWA 1YVRA 5I7FA 3COYA 1V6SA 5FOUA 4XCXA 3N9IA 4XEHA 2JB9A 1UM8A 1TEHA 2HGZA 1FFWA 2H5EA 3BWXA 3IUQA 4KHZA 4PFQA 4QQFA 2BM1A 4V0NA 1O6FA 4F8JA 3K09A 1Z5OA 4WHMA 2UYQA 2ZRQA 4BNVA 1LV7A 1VBFA 4E2FA 3CF2A 2GD6A 4EY4A 2C2KA 2VH5R 3RJTA 1G66A 1NJ8A 1PR9A 1SK9A 4FGJA 4MXDA 3TOCA 5JD6A 4G4GA 3QVSA 4FE3A 3KJIA 4DABA 4IYJA 3HCOA 4Q4HB 1U02A 4PIMA 1NN3A 3MLEA 3QYJA 1PNVA 3WZMA 2QM3A 3QPDA 3GEBA 4ZA2A 4UUOA 4KJXA 4A8PA 1Q50A 4HS4A 4RO0A 2KLHA 1JT2A 5JS2A 4BMYA 1Y6GA 4P5EA 2WKSA 4IEEA 5C8XA 4TLAA 1ZHFA 3MSCA 3MWDB 1Z0DA 3GFFA 1LBTA 1YE3A 4LDZA 5IYZB 4KVGA 1RZVA 1JMYA 3EB9A 1U2DA 1VZ2A 5DXJA 5TY0A 2FA9A 3Q5EA 5H81A 4CDNA 5LQAA 4QHTA 2ZS9A 1DPFA 1ZUNB 2RSLA 4A2QA 4GEKA 2F43B 1FP4B 3FNEA 2WUEA 1E8MA 2GCOA 4BFLA 2OCGA 3UHPA 1KYYA 1JIXA 4P3YA 3JXEA 1PE0A 4CT4B 1Z0JA 4LG1A 5H9VA 1DKRA 3E2MA 5BMVB 3HTXA 3S0JA 2J9YB 2QF7A 1Q77A 4C2AA 4RSMA 1CJBA 2V8OA 2RIPA 3DV0B 3WL6A 4BLWA 2EZTA 3KXLA 4W5JA 4PE5B 1F4LA 1ZUD1 4H0FA 1NVWQ 3QKSA 4CQLB 2ZQYA 4BO3A 4UU7A 2VNAA 4Q4AA 1E2HA 4R16A 3GUVA 3ICCA 4NHEA 5AVQA 4JEHA 1T5BA 1IOLA 3U44A 4BJ1A 2QLJA 3DEHA 4GKAA 2BUCA 3HYSA 4HH4A 2CSXA 4YRMA 1X19A 2ZTSA 4Z4CA 1F8FA 3O4RA 4B8ZA 2WMNB 2IUFA 3B70A 4P7GA 1OE0A 4ETNA 5K3CA 1CQJA 1YH3A 1VYUA 4P08A 4G4SO 3TI7A 5FOQA 3BJRA 4JELA 2CHGA 5BO5A 4FFPA 1DTEA 1VE5A 2FW0A 1NXOA 5I7HA 3DOIA 1JFSA 1HI9A 4OIFA 4YJGA 2OV6A 5BN5B 3MT8A 3NX4A 4C21A 1Q0UA 1ZM9A 3EVEA 3AHFA 4WNAA 3W9YA 4KX3A 4U0KA 1XRQA 2IYYA 3CVYA 3NLLA 1QKJA 3IEIA 3RTBA 1BU8A 2A57A 2OO3A 5T6BA 1NRWA 2R86A 1CG6A 3UH1A 1TMYA 3C3CA 5E6UB 3EPJA 3BXPA 1IOZA 2W2PA 5IH3A 1BXRB 3PC3A 4LTNA 1KK3A 5FWYA 3GRFA 3BE4A 3P45A 2IEBA 1RI2A 3PPWA 4IJ5A 4I4TA 4QGAA 3RCBA 2B1GA 2E4WA 1ZD5A 4RXMA 3IMEA 1PWHA 4ZRDA 3VNBA 3N8DA 1YBAA 4MUYA 3E0QA 3AGPA 2IOFK 5CXSA 4IS2A 2MR6A 4MYRA 3G0HA 3KZVA 3NHRA 4HN2A 1B1AA 3HLKA 1LUAA 2H51A 1L5ZA 3DVRX 2P79A 4URUR 2GBLA 3IO5A 5BRNA 4EYEA 4TVBA 4BLUA 5K8LA 3GFTA 4PYQA 5JIBA 4LAFA 3CUEF 2IXGA 2YYYA 4BEBA 2B4YA 3B6MA 2WWVD 1HZJA 3H0EA 3MLBA 2JFPA 3UCEA 5EKTA 2ADOA 2Z2ZA 2JAOA 4DDWA 4V1CB 3QI2A 4U7HA 4BVBA 5GJCA 1TM4E 3E23A 1MH9A 1UMCA 3EXG2 5FV7A 4X94A 3BIJA 2PHZA 4OQQA 5AH0A 4ZMSA 1U65A 3L0ZA 1WDMA 2LCFA 4DQVA 2OL4A 1PDWA 3DKRA 4EJ2A 3CURA 2O0MA 3IS3A 4GPBA 3HN2A 2NO9A 2ZWAA 3KNZA 3GEPA 2JJ1D 3QW4B 5CVCA 2YVAA 1FTNA 4X66B 3PEEA 1ORVA 2HBRA 1V5WA 2XGSA 1BO6A 3B1WA 3INRA 5EIAA 1F14A 1ABFA 1T6ZA 1W9MA 3TSWA 3WWEA 3FWHA 5DJ5A 4ZVSA 1LRKA 5A1JA 1NYQA 1Q20A 3W3AD 4EI9A 2WAYA 2OESA 4EG4A 4ZK6A 2DTEA 2G6BA 1SD5A 3AM3A 3R4VA 2WJPA 5HWSA 3ZWNA 1RRPA 4PINA 2YJ6A 3PQEA 4JXXA 2I7TA 2ONJA 3U19A 3WTBA 3H0KA 1MRNA 3Q3CA 1A96A 2VZLA 3D59A 1N1GA 1RKXA 1QNFA 1UKBA 3LXUX 3AESB 2ODBA 2FU5C 3EA4A 3WWZA 4DYDA 2MMCA 2QPLA 2Y8EA 2P9FA 3H42B 1PN3A 3JWJA 2W2QA 4HFRA 2P78A 1P5HA 4C0SA 2ZANA 2VT2A 3OC0A 1GCAA 1XTKA 3P9ZA 2XA9A 3HMKA 4BRSA 1Z6QA 3SVZA 4L8WB 4JP3A 2B20A 2ZTHA 3NNDA 1SCQA 4RC9A 1RJ9A 2WZDA 1FX0B 3U4AA 4WD3A 3TQOA 4B3BA 1PSWA 4QVKA 1B16A 2W6ID 3SFTA 3VDXA 1OIVA 3M6MD 3FVTA 1TYBE 2IY9A 4AYTA 1PHPA 5F98A 1K88A 1NIPA 3D7LA 2H2WA 5CP8A 2R1VB 1TF7A 2DFLA 4P35A 3H8WA 4NMXB 4YJFA 1E1NA 1NOIA 1XCPA 2QE7D 1QONA 3FHCB 2GB4A 2QM8A 4OOFA 2DE0X 5JANA 4H6XA 4RDCA 3E4DA 4DG9A 2W6CX 4AK9A 2ADFA 3UMCA 4YJ2A 1BXZA 3EQ2A 2IS6A 1BDBA 4YP7A 2UXCB 4NBRA 1SKMA 4G1VA 1OZHA 3WJ2A 1M5RA 5C80A 3LV8A 4RJKA 4MVJF 4ZCQA 4RTMA 3R7NA 5T5QA 3ADBA 1YL7A 3OF2A 3UJ9A 4JLUA 3V3KA 1E7MA 2IIVA 4LJAA 1KMIY 2VP2A 3PRKE 1AS0A 3ROPA 2ET6A 4GLOA 5A06A 5E9JA 3L3BA 4LBYA 4QAJA 4OYYA 4FXPA 1XK7A 1BCSB 1RYFA 3L4BC 2V7UA 1RJGA 2VTEA 2EW8A 1XP5A 2Q99A 1KQ3A 2F00A 3K5PA 3SC2A 5B7NA 4B2LA 1J09A 2OKGA 1XD8A 5LLSA 2QN9A 5EJFA 2JJ2D 2BAGA 2D0PB 2L17A 1BQ4A 5LQMA 5EYPA 1J42A 2GYVA 2ZDQA 1JLLA 3SZ3A 3C3MA 1CHDA 2DFNA 3H9QA 4JU8A 1UXJA 2CN1A 2RB5A 2VF8A 5IZCA 3E7DA 5L9AA 1YU9A 2IELA 2NV2B 2SECE 3MJVA 3EHEA 4X6YA 3ND6A 1BROA 3T0GA 3K9WA 3OZGA 4DA6A 4RFSA 4AS1A 3TN7A 1F3OA 1PG5A 3NAZA 1M34A 1U3CA 2O07A 4D56A 3HU3A 5BY2A 5DGTA 1YDMA 2XOKD 3Q8MA 3A3NA 2P4SA 5C35A 1I9CA 1GEEA 3K5IA 3HB4X 1V1MB 4YFVA 4ZV7A 3KQTA 3D3WA 4L0CA 4K6MA 3CG0A 4AUMA 2QAGA 3SJBA 5IRCD 4BAGA 2DEUA 4XWWA 5GMOA 1J9EA 4MW7A 5ABPA 1HC7A 4Z4HA 3GK3A 1P0QA 2XOEA 3DOJA 3F47A 4J94A 4IDBA 4WOCA 2V5UA 1ZVKA 1N9GB 2YS6A 4O8ZA 1H0KA 1N6LA 5B1HA 3RBAA 1CB0A 1IG3A 2ZDHA 3CIFA 5HMMA 3BFKA 4JQYA 4TL9A 2G1PA 2CNKA 1DIOB 1COWD 1T15A 4ZDWA 3ETEA 5CIQA 3FKSD 3LY7A 4CKXA 4Z3OA 2REXB 3QIVA 4ZKDA 3IDAA 2NPFA 4GGOA 3ZV7A 5KNCH 4P84A 3WL5A 3EEIA 2IBMA 1TMKA 4R05A 5FUQA 2C3UA 1U5AA 2ZIEA 3AHCA 4ESOA 1YRQA 4KXUA 4H1TA 1PNRA 1SH7A 2JGMA 4QNRA 4PXYA 4LS3A 1R5OA 4TWBA 1XXLA 2DQKA 2AOTB 2J3KA 2XYRA 2IYXA 3ENZA 3TNLA 4FHDA 5H9WA 3ZGXA 2VDMB 1P75A 4M0CA 2I2FA 3A28A 3I76A 4IG9A 4NDAA 4AKSA 3KT6A 1SBZA 3GT7A 3HUTA 5DTEA 4DMMA 1WW8A 4FYYA 2QTAA 1BEUB 1E9RA 2B78A 2FK7A 2ZXFA 4IF4A 4RBNA 5E7QA 5A6SA 2FUG6 2A5DA 4WKBA 4MKXA 1MDFA 3S6JA 1DO0A 2F48A 1DWOA 6AT1A 4K6OA 2BV3A 4UE3S 5AI6A 5JVDB 5CJJA 3GLGB 4NG4A 3OQIA 1W4RA 4HB2A 3GJ5A 2XTNA 2GTIA 4PCLA 4ZI7A 2HO5A 3S2EA 2Q9AA 2P4UA 2DQSA 3UPDA 2FW8A 4TMXA 2C2OA 1E18A 2IYFA 3PGLA 2EG9A 3I34X 3OEHD 5BT8A 1N77A 5IJXA 1G21E 2WR8A 3JWPA 2I0FA 3P9CA 2X13A 3BS4A 3KYCA 4KXVA 4LV5B 1P74A 2HDOA 2ZPTX 3EGXB 1TZ2A 3C6QA 4EY6A 3GOQA 3IUSA 4GMXA 4LX8A 4Q6WA 3NGXA 2WD7B 3V6LA 4B7CA 2QTLA 3B7PA 1L1QA 3G02A 5LP6C 3ZOKA 1YB1A 4EHNA 3PT9A 3KLMX 4UTRA 2V0NA 3LSYA 4L4SA 4PHTA 5TB5A 4C03A 1S3IA 3DLIA 2NNWB 2ZE8A 4FMPA 1UKEA 5IC5A 1R5NA 4RYLA 3JRXA 4ARVA 3PC6A 1SBIA 2IHVA 1QH0A 3D6AA 4N65A 2WILA 2XEDA 4D8WA 4YR9A 3OMWA 1G20A 2WYWA 3R0IA 4S1PA 5HIJA 3TFQA 4DMFA 3MN1A 2TMKA 4J0EA 3PQ2A 3TE6A 5ITZB 4GMHA 5ELXA 2D1YA 3JYQA 3N6XA 1P9RA 2JHFA 1WP4A 3HB1A 1AS2A 1QVRA 5F7ZA 4MVJG 4UBJA 5HTKA 3W04A 2IUYA 3TLGA 3BQNB 2CNWA 1K68A 5DGHA 2NO0A 3U80A 1E92A 3G9ZA 1D2EA 2IL1A 3H17A 1RQRA 2RH8A 3DMGA 3N2GB 4QATA 3HCEA 5JYDA 5HIMA 2CXUA 4CE6A 2FN8A 3PX7A 1JSRA 4C43A 1U7ZA 1WMDA 2B4AA 3DAPA 3I39X 5IT5A 3AR8A 1Z7BA 1XK6A 4YQEA 5JC8A 1YDWA 3L7AA 3SKYA 2JLRA 2NSYA 1YE8A 1EXNA 1Q7RA 3GPLA 3L7MA 1U0RA 1QE0A 2IF2A 3KQQA 1YHYA 3U9LA 1U8AA 3F5DA 5CA1A 4G89A 1H8HD 1SUPA 3GMDA 2BBSA 1B6GA 2ECPA 2JHAA 2OAGA 3U61B 5KI6A 1XA4A 4IS3A 2NACA 4NFLA 3C1UA 2G5TA 2PLNA 3GJ6A 2PVSA 3WLAA 2YH2A 1DP4A 4A8JA 1T9HA 2G4LA 1Z4MA 2H1IA 3MCAA 3P0EA 2HNBA 1DDOA 3FYHA 1R3DA 1R0LA 3LD9A 3OCWA 4GI2A 4BLOA 3H8JA 1BE0A 3Q15C 1FVXA 3JW8A 2G82A 3LQFA 1FFYA 1R64A 3RVQA 5I4CA 3L1VA 1XTQA 1I10A 2QRVA 4G4IA 4RZ2A 1DG1G 1X1TA 4OFXA 1CUCA 4H31A 5ELMA 1JKIA 2O48X 4K6HA 2B1RA 5L6MB 2A2ZA 3H1PA 4GDFA 3NDIA 3RBXA 4Z9AA 1XZCA 5TVKA 2QJOA 2V7WA 1QUEA 3VYUB 4DRYA 4MQFA 1W1WA 4Y2VA 1WXGA 4QX6A 4CLOB 1I8TA 1BAPA 1CKEA 4K05A 4QDUA 4R8MA 2WT8A 3IERA 3UH0A 1HTWA 4UEJA 3SXUA 3VGPA 5L3VA 4M38A 4Z0TA 4MRNA 5BSRA 4R1NA 3AY6A 3LGXA 3UJAA 1OA1A 2JLZA 4RK4A 3GB9A 4EP1A 4BY9E 1MFZA 1MO3A 1TE2A 2ZUDA 1ZCAA 2QJRA 3EIOA 4XJXA 4KOEC 3U3XA 4DY4A 1EHYA 2QYTA 4LGYA 1GUZA 4HVCA 3H2JA 3Q85A 4XH9B 3RUIA 2OFOA 5KHOC 1ODFA 2AIRA 3KOWA 3P9KA 4B76A 5HQTA 4EG5A 3OSZA 4U0JA 4WLOA 2RK3A 3ROMA 3FLAA 4JR1A 4UCXA 4YMHA 4F1JA 3B7WA 5FOXA 4AF6A 1YULA 4XQEA 4E32A 4HNAA 1DJQA 2CBZA 2Q6VA 4OP1A 5TT0A 5LL6P 3UMMA 4GI7A 5TPZA 1D0VA 1HGXA 4FMCB 2ECQA 1NKVA 1E61A 4CM8A 3AR5A 1P5RA 3GX1A 2QVLA 3GJ0A 2IWHA 2C8VA 5FUVA 2EP8A 4EELA 5IVHA 3GJRA 4CGYA 3GEEA 1W9HA 2W8BB 2FN7A 3HRIA 1SBNE 2WU0A 3WGHA 2IHKA 2QLFA 2RHHA 1L7OA 4N4AA 2G5GX 1C1YA 1ZNZA 2FUNB 2DPGA 4E30A 2GT1A 5FBWB 3UY4A 1PQUA 2WWGA 4OI4A 4E6EA 1JH9A 2QW1A 3B2EA 4QUIA 2C57A 3W06A 3FWZA 4P34A 5ITVA 2X7XA 2BTQB 3HS3A 1GUBA 1J49A 3G13A 1GPJA 1R0WA 3PQDA 5K6AA 3MOIA 3EF3A 1G5FA 4ZKEA 1XSEA 3CX3A 1WQ3A 4IRUB 2GDJA 4KCGA 4NSNA 4RVSA 3ZU4A 1GRRA 1JDBB 1KSHA 3TEJA 3ILHA 1CIVA 1T4CB 4LFCB 1AGPA 1VJ5A 4EI8A 3AYZB 4IXNA 5CLGA 4BX8A 5KVAA 1NMSA 5BW8A 4EL5A 1EZ4A 4JQSA 1GSHA 4JK3A 1FNMA 3EXFB 3W0LB 3F5QA 2VRWA 4NOMA 1WOYA 1J8DA 2O2XA 2QRHA 4LOLA 3CUUA 2CXHA 2JHPA 2OYSA 4DVJA 1L7VC 3V42A 2OB1A 1I3LA 2YV2A 1LK7A 3KZOA 1NVMB 3NP7A 4IMJB 5E2BA 3NHWA 3IB6A 2ZIGA 3NM4A 2P9BA 5ADUS 1V1RB 3DZCA 3N39C 1L7EA 1LH0A 1RYYA 4O5AA 4TSRA 1MNAA 4MGHA 1E69A 2EKQA 4ZO4A 4OI0A 4I8XA 3NIFB 1KWKA 1Q0PA 3KXKA 5T4EA 4KXWA 4H4EA 5DXFA 5HF8A 5TEWA 1M0TA 3ZIUA 4CLRA 2FSFA 5C4GB 1ZG3A 3BL6A 3OMLA 3BFJA 3QV2A 3RYHA 5JXHA 3WDKA 5AUNB 2WTAA 1YIAA 4KXXA 3AIKA 1K8YB 4HG2A 4KX5A 4EI2A 3AU9A 4OFWA 4RM3A 4FDAA 1A9XB 5FT9A 5BSHA 4MI6A 4YJ3B 4AU1A 1H5UA 1SBTA 1V47A 1C4WA 3OT1B 3OY2A 4RF4A 3P2YA 4ZAXA 2NO5A 4ZZIA 1SWWA 3Q3HA 1F6BA 2I1QA 5K2MA 1Z8HA 4Z7QB 2AL7A 1JHMA 2LIVA 1ZOPA 1NR7A 2I4RA 4FSXA 4KFRA 4LZOA 1T0BA 5G0VA 2CUZA 3PHJA 5BYKA 2F8LA 3OJWA 3RSSA 2GSWA 2GYYA 1YJ8A 4I50F 4MVJH 3PHCA 1KOJA 5CM9C 1LPOA 2Y0PA 4JOSA 1WL8A 1C29B 2HA7A 1W0CA 1Q16A 2PXHA 2QRQA 2XNKA 2ZRIA 1NBIA 1V5GA 1G60A 3LP5A 2HIAA 2H57A 3OE7A 5F51A 5TPZD 3M4YA 4EZIA 5JQGB 2AKEA 1ORIA 4G0OA 1PGPA 1A2KC 3QELA 5AWFC 4RIEA 2B34A 1JXOA 1L3BA 2Q4RA 3WC4A 5JZ9A 2IBSA 4UEQA 4GVXA 3QXCA 1IMJA 1P2FA 5ELLA 2AC2A 2BHSA 4BP3A 2NVUB 3VA7A 3B8EA 2AWNA 3IXQA 1MW9X 2Q3DA 4YV1A 3ZX4A 3R3YA 4XPZA 5CMLA 3KJQA 2ZUWA 2FSHA 1Q2XA 3FFTA 5KOJA 4MHSA 4D9KA 1MTZA 4PPYA 4XB6B 5D01A 10MHA 2NT3A 2A9FA 1QYXA 4QFMA 4RZXA 5BWMA 5HNKA 1NQVA 1VBKA 1PLLA 2QU8A 3FUWA 2BN4A 4H6PA 4M1EA 2JH8A 4MMZB 4OMDA 3SMQA 1JIJA 2PIAA 2ZIAA 3QE3A 1U11A 4MGIR 5A4AA 421PA 1X80B 4L2IA 5KJ6A 1NUQA 2VXYA 3CPHA 3R7FA 1O0SA 2WHXA 1T3LA 1JE1A 1MDBA 3U3OA 1GQOA 1JR3D 2VK2A 4PSVA 4QOFA 4XUDA 2VUSA 3EAGA 5KINB 1JKJA 1EX9A 5LDDC 4UVEA 2PUBA 3ELBA 4P4SB 1KR5A 1PAUA 1RKQA 4DF3A 5EA2A 3W3AH 2PH3A 1USKA 1DFHA 2JZCA 3BTOA 1DRKA 4WBNB 1HDCA 1KF0A 1WP9A 2VT7A 4RTJA 2W4IA 4LQLA 3TIFA 1R8QA 2AKYA 1T9CA 1E2IA 2AMYA 4N0DA 3FHJA 3WRVA 4HAIA 3WLRA 1JG6A 4ZYYA 1V2GA 1GQRA 2H1HA 4CV2A 1ESCA 4MAMA 1WSAA 5A3SA 4JT4A 2AXPA 1SU7A 2DC1A 2A1TR 2ZJ8A 1XL0A 2OHGA 4X1IB 2PCJA 4FJ0A 4UD6A 3HFGA 3QEMB 1JG2A 3TM5A 4XDZA 1W87A 3QXJA 1GTRA 2VHEA 3FYDA 1CU1A 1ND5A 3B9RA 4I50A 1XHLA 5KYWB 2VDVE 4H3HB 1J7JA 3PICA 1E2LA 5HGJA 4BNTA 2VSFA 4ITVA 3GGCA 4QL3A 4PC7A 5ALKA 5BW4A 4K2HA 3OPYB 1TZMA 4FPXA 1FMLA 1FUUA 3D7MA 1LDEA 4FGKA 5M5BA 5EVCA 2ZG6A 4QG3A 3L07A 4DMCA 4Z7OB 5AK3A 3K20A 1FX1A 1HDEA 4TMWA 1INLA 2PX3A 1JPVA 1XLTC 2ZTLA 1MIOA 3KB6A 1K0FA 3EMBA 4XGNA 5EQJB 3T1YB 4HUJA 2HR1A 5ECDA 1Z4NA 3LUPA 1E2JA 3OPXA 3V4ZA 3HU5A 4AJOA 4DLXA 2MYNA 1OV6A 1D8AA 2G80A 4JC0A 4EZEA 1MR3F 3SZUA 1WSDA 3EE6A 3O1JC 3B12A 5DTRA 3KR1A 2IPMA 1OAOC 4FTWA 4IDEA 2EOAA 1XALA 2IHTA 3TRDA 1JHRA 1ACLA 1U80A 2O8VA 2WSLA 4QGGA 1QDEA 5FUBA 5TQ0B 3I5XA 4W5OA 5DGDA 2HI0A 4E1BA 2J3EA 3N8GA 1NMYA 2YR0A 4M0LA 3GGPA 5C9ZA 2QN3A 4BB6A 3DS8A 1OV4A 1NUTA 1W4AA 3TD6A 3ZDAA 2QMEA 2NSJA 1I7PA 1AA9A 4UTPA 5J4HA 3EW7A 2VWGA 4L8LA 5KVVA 1JQBA 1IN5A 3A36A 3K72B 2O7VA 1SQSA 4A0SA 4NEQA 1BJKA 3CA8A 3CEAA 2VYCA 3JD2A 5TLSA 1DT3A 1L7AA 3MTGA 1UAAA 1H23A 3ZDXB 2P0EA 3O91A 4LWQA 2I2AA 2AG1A 4MLZA 4FUQA 3F98A 1HQYE 3QVJA 5JNUA 4CMIA 5KOHA 1QOQB 1FZTA 3SYKA 3FETA 2VF4X 2HHHB 2HN9A 4WY5A 4BFCA 1AM4D 2O05A 4XIIA 2PEZA 4LF4B 2RGWA 1S1CA 4Q16A 2JFZA 3W8NA 3OZDA 1JECA 1YU6A 1NVGA 4KQ1A 1D2AA 2OP0A 3VHQA 2RIRA 2XKAA 2O2YA 3IPCA 3BIXA 2H7YA 5GZ1A 4JD5A 2VNIA 2GD0A 4TS3A 5JNWA 1SD1A 2Q46A 1QRUA 1OGJA 4D5GA 3FKSA 3KRTA 4OATA 1L4KA 3B6JA 4Z2YA 1TKAA 3E3AA 3N2KB 4QOIA 1C41A 3TVDA 3C2QA 3BFPA 3T34A 3A9UA 1A4UA 3G9UA 5KYUA 4Y7DA 1M0EA 4IUCS 3PFNA 1K8QA 2DPLA 1E58A 1ZNWA 2G09A 5P8WA 4ESEA 4CIBA 1QH8A 1UMKA 4JBXA 2OO5C 1KEVA 4AZ0B 1K8RA 1KWGA 1EJ2A 2GNOA 3EZ2A 3FPGA 3E1KA 3E1GA 4J0HA 4RAOA 4WBSA 3TLGB 3B20A 1Z37A 2PZKA 4E13A 5IASA 2W6OA 3UQYS 1NNUA 4C5AA 4FNGA 2CJYA 4O8CA 3QWIA 2PY6A 2AD5A 4N8DA 3AUSA 1S9DA 3H19A 4CV3A 2MHCA 1R88A 1U99A 2VHQA 3ICVA 3NHAA 2J5KA 5CX4A 2GO7A 2HMYB 4Z9YA 1K6XA 4OD0A 2MSDB 3QKRA 4IDPA 4ZAYA 1IZZA 1OQAA 1XKTA 1JQ3A 3QTLA 1WUHS 4D46A 1CPYA 2AFIE 2GM5A 2TMGA 1WXWA 2ORWA 3U4DA 3HYTA 1M9NA 3BMNB 3RK1A 1OBFO 3GRZA 4UNRA 2XVZA 2I1LA 3EA5A 3LLUA 3REOA 4B5LA 3CXUA 3HJGA 2WTEA 5FL3A 3DC7A 4Q3OA 2QUJA 1MGPA 2Z58A 2DVMA 5JNSA 3PT5A 3TOVA 4TQ9A 4DT1A 3FX2A 4TTTS 4YECA 3GF4A 5KX5A 3R3HA 2X5KO 3E70C 4QBFA 5FNZA 3NRBA 5SYMA 2MSLA 3C7DB 1O97C 3EMKA 1GARA 4KAJA 1QYCA 1S6YA 2J67A 1BOOA 1CP2A 1QHXA 2IQIA 2WPDD 5LWHA 3PGJA 2AN1A 4OQZA 5EG5A 5IN5A 5JW6A 1IAVA 1H4TA 4RPKA 3UJBA 1YKGA 3MS4A 2I3GA 4NAVA 4CLOA 2G72A 1FFBA 4MQEA 2O19A 2QM7A 2QTNA 1WXDA 1YZ3A 3AJ9A 4XXHA 4XQCA 1QHGA 4V0ME 1QQTA 5DX8A 5KJFA 2VHCA 3F6SA 2V9ZA 3KPWA 1EEXB 3WLTA 1IEQA 1T0HB 5AVRA 1LPSA 2O8BA 4ZEVA 1JSLA 2WHQA 2BKXA 2F1HA 4B46A 3JQ8A 1EJ6A 2FDXA 4MW1A 3I52A 3ADPA 4M1SA 3KQSA 1DUSA 3V2IA 4UQLA 2OV1A 2ARKA 2P75A 5AXAA 5BQ5A 4HEQA 1H2AS 5LA6A 4PPQA 1HE8B 2C8LA 4NJEB 3GNLA 4HN9A 4YH1A 1ZVJA 1L5LA 1QLWA 5EIXA 2A88A 2B5VA 2XHZA 1TOAA 5J2TA 3S7ZA 2X8BA 4CM8B 3CONA 4JHXA 4DGSA 4ZI3A 4LI0A 1P1JA 2FWPA 3PPYA 3SSMA 1G6OA 1CUJA 3TZQA 3TO5A 1RQXA 1ZOSA 2PSHA 4HDQB 1GGKA 1TIKA 4XTRA 1JEJA 1LFDB 2ZJZA 4CMAA 1NURA 5K4GA 4JROA 4LVOA 5ALNA 1BS9A 2D4HA 3DTVB 5GAJA 5GM2A 4CG3A 4I1YA 3F4KA 4EMUA 3MJHA 2IUTA 1UEIA 3MWKA 3L1IA 1T3TA 2QZPA 2C2BA 1SZPA 4BVHA 9GPBA 3E7FA 3ADDA 1IWPB 3DYIA 4GPTA 3QVLA 2ERCA 4ZPXA 2QDKA 5FI5A 1YOBA 3WBJA 4GSKA 4LDRA 4RHCA 3RC9A 1X39A 4IIHA 3OOSA 2W00A 4U6NA 3VC2A 4B4DA 2ZBPA 2PJUA 1ZM4A 5ANRB 3FB1A 2RGUA 3HXPA 4EOGA 1XVTA 1B43A 1XU7A 3ENNA 2ZJ6A 4N0MA 2O7RA 3GAMA 3V1UA 4B6PA 4BMNA 1L5FA 2YIMA 1YB6A 1M73E 2VJLA 2WZCA 1H42A 1KEZA 3DMTA 4CKCB 3BGIA 3G68A 1ADFA 2WBLC 2J08A 5L7YA 4F84A 3NVDA 2RGEA 3Q3EA 3CEJA 3BC1A 4IF6A 1QFYA 3QVMA 3KIPA 1YFLA 2VTBA 3F3KA 4D0LB 4URFA 2WSSD 3PA6A 3WFJA 1VSTA 2NAFA 3TL6A 1TQDA 4ZQIA 4Q02A 3JQBC 5KJ1A 4BWVA 4BRZA 3TFOA 4X7RA 3TK1A 5DNCA 3DTTA 1NT4A 2CF5A 4CTNA 4R2WA 4WBNF 1XHFA 3ZNNA 1UADA 3ONWA 1R00A 4NCIA 5I9TA 5K8JB 2AG6A 4NPHA 4RF2A 4UOEA 1CQIB 1PNOA 5EIBD 4CLRB 1HEIA 3MD9A 4YRGA 1PEYA 1WABA 3D8SA 3AEQA 2NZWA 3LIPA 9ABPA 4RTPA 3H4MA 2V7BA 4HADA 1OWLA 1EBFA 3KVRA 4RJJA 2BGIA 1WZEA 3JQAD 3T94A 1EGMB 3WK6A 5CB4B 4NC9A 1W36D 2VPYA 3L49A 4GWKA 3LP6A 4K9DA 3M4NA 3S55A 4AO7A 1XMXA 4GR4A 1AQJA 5LYYA 5F76A 3Q2IA 2H31A 1UDWA 5IEBA 3V2GA 3ZDZB 1E2PA 1NMXA 2X2OA 3O9VA 3P26A 3DE1X 4MR7B 2J3LA 4IR7A 2OFWA 4QTTB 4R5HA 2WV7A 3UAYA 2DECA 4EKGA 4E1VA 3VYTB 4UC0A 1X7XB 1MG5A 3NT4A 4GZ3A 4Q19A 1Y6FA 2XD9A 5KOIA 3ESQA 1A9QA 1NC1A 2RI1A 3FE2A 2BISA 4GMGA 4TSFA 1SC4A 2VNHA 3OX4A 1H2FA 1HBJA 1UJNA 1XKLA 4MPJA 3OCVA 2P9QA 4L78A 3WB0A 3K0EA 2P27A 1T9BA 5LLTA 5CUQA 1T8WA 1SHLA 4BTLA 2VP4A 1SHZA 3WIOA 2FHSA 3JATA 1TW2A 2FPWA 2WIDA 2Z30A 2GAJA 2PBRA 4L4XA 2FRVA 1Q15A 4B81A 2I66A 1L5SA 3AXTA 2QX4A 5JAUA 1RYHA 2DOKA 4NG5A 3TLEA 4YRKA 2V0GA 1VZ3A 3HKBB 2YIVX 1UFOA 1KFCB 4F1WA 3BSWA 3CLHA 3V34A 3PE6A 1U8CB 1DCFA 1G1AA 5JSHA 3G2LA 2SHKA 3WIUA 3A9WA 1EJ0A 2BGTA 1VLZA 4MQLA 4GR9A 4AMZA 4EHLA 3NM6B 2AZXA 2RCYA 1ZN9A 3IAEA 3GZ4A 1QH9A 2GA8A 5ALEA 5H0IA 2RGGA 2CLMB 2GN4A 3II6X 2VTDA 4PZEA 4RCYA 4TGLA 4TV9F 5T3UA 3TLAA 3UT5A 3AFNA 3G6KA 3U3ZA 2LGJA 4XIGS 2XUKA 4US1R 2JCBA 1GNVA 3STTA 1XFAA 3HUDA 2FPIB 2WU8A 1J33A 5AW7A 4I14A 1QFZA 4PS0A 4BB9A 5BWLA 4DCSA 1Q1AA 1RQPA 2HSJA 3PVZA 4IKOA 4PY2A 3TIGA 1XRRA 3G2MA 2H2GA 5DHRA 4DSNA 1XN1A 1FRFS 2BDEA 2BKAA 3CPJB 1RQNA 3K9BA 4H4DA 3B8HA 3U6BA 4PCUA 4WOPA 2HTFA 2V7QA 4ZWNA 3ME5A 2DETA 4O25A 1VLLA 5AKHA 1B0UA 2O3UA 1ATZA 2BWJA 3FROA 3KKNA 3A4YA 1CUZA 4GI1A 4ACAA 4EY7A 1BS2A 1CDDA 5A3JA 5EY5B 4K9RA 3JARB 3COPA 2RHOA 3I8XA 3NOOA 4KZKA 4L5IA 2OK8A 2I99A 1NW3A 1IMOA 1WOMA 2CVOA 5CJ2A 5LC1A 1NP3A 1R0BA 3IB3A 1XD2B 4AZVA 1ZI6A 2O7QA 2ZRKA 5EN4A 5KJCA 5JD4A 1ENOA 1TA0A 1UJ5A 1KI1A 4RVGA 2N46A 4I50B 2WJZB 4RENA 4OHRA 4R1OA 1R4NB 5I9NA 4FD3A 3RAJA 1O4WA 2PRYA 2CVQA 1TW3A 1A98A 1BGXT 1WB4A 3AB8A 3TH5A 3OPYA 4YDQA 3AG5A 3NJ4A 4BU0A 4DIBA 1KXZA 2IZOA 3BE8A 3IVRA 2Q5QA 1Z73A 2QN2A 1JFVA 4KC0A 4N03A 1E63A 3H6GA 4NY1A 1EBBA 4XDGA 4LF6B 3K2BA 1MNQA 2QIPA 4BZXA 1PIWA 3K1AA 1FK8A 1SZJG 3OQBA 3Q6MA 5DHAA 2CDRA 1L1RA 3NETA 2XB2A 1R4MA 4C78A 2JFFA 5IJ0A 4L3OA 1OC2A 1F2UA 2XCLA 2XMPA 3BTVA 2AMJA 2GEBA 4D43A 2CT8A 1NUSA 1H2BA 3P0IA 4YASA 4OJKA 4BMXA 2C04A 4PWZA 4R1UA 4EJMA 2PWBA 2AR9A 2PMDA 1ABBA 1XXHE 3ORQA 4JBNA 2NV6A 1R0KA 4FMDB 2GPTA 5G41A 721PA 3QWAA 4B3CA 4AG5A 3F6RA 3UN1A 2CL0X 3T5MA 5K3SA 2F3TA 5IVKA 1XQ6A 4KQ2A 1E0DA 4JYPA 4A27A 3MWLA 4BP9A 1X1CA 3ASZA 2QRNA 1GTVA 3RM3A 3PUVA 4LVNA 1UOEA 1BU5A 3BRWA 3KSDO 1PT9A 1MQSA 3ROEA 1LTQA 1V16B 2AEFA 3FN4A 3PXAA 4TRNA 5DMXA 5JTUA 4WLNA 4C0AC 2WE7A 2JFGA 1UXHA 3UUFA 3HHEA 4AJLA 6YASA 4R68A 4AMGA 5ED4A 2RE8A 3C6MA 1X92A 3KQYA 3X2SA 1D5WA 5B6IA 1YVDA 1EDEA 3IOCA 3S2YA 1H8EA 4TOIA 5FD8A 3ORHA 3TJMA 2H52A 3WZLA 2GTPA 3D6JA 1WAMA 4DCVA 2VTVA 3PNVA 4D2IA 3D54D 3Q7QA 3ZHZA 3QLTA 1JQAA 1US8A 1SUSA 1T35A 5CDHA 4B84A 1Q0HA 1TQ8A 4QBIA 3A3KA 1R0RE 1HM5A 4D41A 4FGSA 3CJQA 3HDTA 4HN4B 3TG8A 4GXNA 3KHSA 3QVGA 2HC9A 2FCRA 1J2YA 1EFRA 1X1EA 1S7GA 2EKLA 3ACDA 2W9XA 3O2SB 3OIVA 3PFBA 4FOPA 3AKZA 2HYIC 5EKXA 3QPUA 3A4IA 2GZ1A 1RYBA 2YZGA 4AJKA 2OCBA 2NZVG 2VSQA 2OE2A 1FP2A 4LF7B 4LVUA 4E3WA 5JR3A 1LA2A 1IOVA 1BWQA 3AJ8A 4P81A 3OZTA 4GPD1 3FOAA 3OEYA 3IA2A 2XX3A 4TMVA 3ZNOA 2H1RA 5C8YB 2L18A 3EQ9A 2GRUA 4F4IA 3RGWS 4HL6A 3VR1A 3KZCA 5CM2Z 4CMHA 3HJHA 3PI7A 3PJEA 2RG7A 4ZMRA 1CF9A 1UJMA 2JAPA 1MGOA 1KI2A 1RM3A 2QP9X 3EK2A 1NW7A 4IFTA 3VR2A 4DLPA 2C9OA 1U0TA 4CG1A 4Q05A 3AESA 1QSGA 5DSZA 5M04A 4RK6A 5K6RA 4WSOA 2HCRA 1QPZA 1WHSA 5ICEA 3PQCA 3IOYA 1WD5A 1XA3A 3EIQA 2JA1A 3I45A 3JQGA 2VAMA 521PA 1ODKA 5AKIA 4F9TA 5KKCA 2QNIA 2VT3A 3LT4A 1K98A 4POOA 4KRXA 3B1JA 2OZLB 2DLCX 4WJZA 3M6AA 2NW6A 4PGHA 4XCQA 1I2MA 1WXIA 3KPVA 4HXYA 4W7HA 4Y1RA 2W71A 4UZFA 1GPUA 1P9NA 2Q5JA 1R3UA 2V98A 4EG0A 1H69A 3ZWQA 1A5ZA 5AVJA 5BSKA 3LQKA 1W7AA 5A0TA 3DQPA 1G4AE 1L5KA 1HA3A 1D2NA 1Z25A 1RI1A 2XKBA 1KZGB 2VDRB 1Z5UA 1NLFA 1PZMA 4IEFB 5TS2A 2YFYA 4YP9A 3N0WA 4UUQA 2BMWA 1Q7GA 4M6WB 3S2IA 2JGJA 3K9HA 3R9IA 5IDQA 4OFZA 1IZYA 1BA2A 1BCRB 1RKVA 5DYIA 5IK2D 1WBJB 4HFNA 1U9CA 2H6EA 2V0CA 3FB4A 1GTL1 1U3FA 2DFDA 4LZNA 3GLRA 2BZGA 4I66A 2NQTA 4BNFA 4DV2B 2AOXA 3V1MA 2B9VA 3EC1A 4HQLA 4MRMA 1ZUHA 2FPKA 3BMQB 3I6YA 1QFJA 2I76A 3N3BC 4JXJA 5EIFA 5K8TA 1KRWA 4NICA 1GPBA 2PX4A 4O2AF 4U7PB 3WK4A 2FPPA 2CNLA 2JFYA 2PR7A 3BWYA 3NYQA 3USES 1XMOB 3H18A 1NW6A 1P61B 2HLHA 3P9QA 4LOJA 4MUXA 1NV9A 1QR2A 4CF4A 5JXWA 3GBVA 4M22A 3F4BA 4I6EA 3K0AB 4M1ZA 3R40A 2ATVA 2HH9A 2YMMA 1D0SA 1NT2A 5EXXA 4M8SA 3BMCA 2ZATA 1YUNA 1F17A 2G08A 4GH5A 1CZHA 5DYNA 2H1SA 4Q00A 3K2EA 1J1ZA 3LYHA 5D3MA 8ADHA 2VAVA 1Q1QA 4BO2A 1RHUA 3RFCA 5A2GA 4Y9TA 2VQEB 1C7IA 2MTBA 5B4UA 1YBHA 2FVXA 3CLRC 1LDBA 3ODGA 5TMBA 1Q19A 3EIUA 4MUEA 4YO8A 3ZU2A 3RYFB 4EJ0A 1YR9A 1SB9A 2ZAOA 2IH4A 5DT2A 1ZRMA 3NDJA 4Y1FA 1ZU5A 2BSQA 4N48A 3U1VA 4M89A 4NJEA 4UHFA 3NC4A 4YJGB 1THTA 3FCAA 4DR1B 5G1PA 3ABIA 5DI3B 1TI7A 5U4QA 3D8NA 3MSXA 3HY4A 1RWPA 1SU6A 4J16C 5JCOC 4PC1A 2FN3A 1EQ2A 2CCJA 2OBBA 3QVTA 3P2OA 3ZE9A 2X4LA 3C6YA 5IAGA 2PSEA 3OEED 2QSUA 2PNFA 2IP2A 2NQ8A 4O29A 4D8YA 2IU0A 5ISMA 2ZB2A 2O8FA 4XE5A 5KX5F 1ZGZA 2DAPA 1RTKA 1JBQA 3C3AA 1XVLA 1ZHHA 4RJLA 3UYKA 3X1ZA 4ZGGA 3AIMA 5EEGA 2NTJA 2PQ2A 4G9BA 4C7KA 4NYJR 2O2SA 2QAGC 3FSGA 2XUIA 2PGOA 3TVTA 3S44A 4EPVA 3L7IA 1TAHA 5AHRA 3CZQA 3ZKAA 1ZJWA 1GUYA 2B30A 4D0NA 1EQAA 4PG5A 1PGJA 1OMOA 1UJ2A 2H11A 3TQTA 2GLXA 3I28A 3JVIA 3EW9A 4U3JA 1FYDA 4A82A 5KQLA 2C7OA 2C31A 5H80A 2I4IA 1P5JA 5ALSA 5THXA 2F4VB 3KHUA 5JI2E 1OH8A 2QXTA 4P83A 1Q95A 4I9GA 1S2GA 2OXCA 3P0RA 4H3KB 4O08A 4W6QA 4A2WA 4AP6A 3HXLA 1BFKA 1JN0A 1RI3A 4B3DA 4EGQA 4AQYB 4J90A 5E4FA 1FVFA 1P8JA 3IDOA 3IQDB 2ZBEA 4O4JB 4MP3A 1AOXA 5JCXA 2RBGA 1D4AA 2O3QA 4AFNA 4C5CA 2X3FA 2WWWA 3GI1A 1FUEA 1UBEA 1PFKA 1LJUA 3MYRA 3V8NA 4WWHA 1BHSA 4DTCA 1GRQA 2XVAA 3IT3A 3NS7A 2CMFA 4TRMA 1I7SB 1Q17A 3D5EA 3DCJA 2GTHA 2AN3A 3I12A 4C4YA 5I5GA 1Z63A 3SZLA 1Z22A 3JQBA 1AA6A 5M34A 2Z8YA 1DOHA 4WMLA 1HDZA 4TYNA 2R5WA 4NH4A 2ZIVB 1BQ3A 1RPJA 2WVAA 3CPSA 4L0DA 5I3CA 1ZONA 1GP2A 1YB5A 2FZVA 2ZITA 3IVAA 3FIJA 5LQKA 5ICCA 2KWIA 1SVIA 4Y6SA 1E4YA 4H7DA 4WRRA 1KMMA 3R6DA 4PO9A 1FP6A 4RV9A 4H7IA 3GLGE 1QP4A 4GZLA 3ICQB 2I54A 5I9IA 2YHIA 3RRJA 5LNK1 3F2VA 1KY2A 1MAUA 1PR2A 1QGAA 2X4GA 2AJDA 4NCJA 4DC9A 1E0KA 1QCCA 2O9JA 3PPVA 5CXQA 2F1OA 2PUTA 4K1LA 4XDHA 1NMZA 4I8DA 4KGVA 4QWMA 2YHBA 1UPXA 2ZKIA 3DHVA 1NDHA 3KKKA 5TGDA 2BFDB 4KIWA 3MUNA 4ZI7F 4GP7A 3KZKA 5F2EA 4CF5A 1G21B 2CLKB 2EU8A 3GZNA 2ZB3A 5D00A 2Z3ZA 1XCGB 2BBWA 2GI4A 1RCTE 3A2MA 3O9ZA 3GY0A 4C7BA 2BYTA 2O8EA 4F45A 2YDYA 1NM5C 4BDSA 4IOLA 1H2XA 1TECE 5HFNA 1LPAB 3N75A 4IUDS 2A1TS 3V8PA 5BV0A 1GSAA 3KKZA 4IX9A 1ZLXA 2KBFA 4KPGA 3FYTA 3BK2A 4Q3EA 1X1BA 4YGYA 4WCFC 1E6CA 3TQSA 4DDVA 3U4MA 1JDZA 1KQFA 4KPEC 4QRHA 3JAMA 3CY6A 3B89A 4CCAA 1RBZA 2Z3VA 5A3QA 5L3SB 2D0IA 5AVUA 4IGAA 1IAQA 5EZSA 1TD1A 3T5DA 1TU4A 1I33A 2CL5A 3HDJA 4QTZA 5HRUA 1GZ5A 1FYWA 1ZGHA 2XMZA 3L18A 1THZA 3LKZA 4N76A 1NAHA 1Z6YA 5KMGB 4KFCA 5CA1B 4BBAA 2VUIB 1EK6A 2I87A 3OKFA 1OBHA 4O3FA 5TQ2B 3VBCA 4BJ6A 4RF5A 4FWIB 4E11A 4ECEA 4YUXA 2I03A 3EDQA 3O3MB 3MJDA 1DBRA 1ISSA 1LDNA 1ZUWA 1GG5A 2YY7A 3B3FA 3OFSA 3JQDA 3KD3A 4PSKA 3ZW9A 5JD5A 1UK8A 2UXBB 3H9JA 1QOPB 1SA0A 1YOVB 1E7WA 1CZOA 2AKAB 4IZOA 2V3VA 2HREA 3B1FA 1W0JA 3DM9B 2XT0A 5IKPA 3A26A 2W90A 3EXEA 2A0KA 4BL5A 5EWMA 1N0HA 4FX2A 3RRZA 3UAWA 2JBHA 1AS3A 3CTPA 4H1HA 4O4IF 2GAFA 3ZZ0A 5LDHA 5K3OA 4MH0R 3N76A 1XZMA 4RJ2A 4JJFA 4EMBA 5FOSA 1D2GA 2C7PA 121PA 3ZJTA 3EPPA 2GESA 4RVCA 2G9ZA 4HDMA 4DIKA 1XX6A 5B3JA 4BGDA 3WHIA 3O73A 3SF0A 1OB5A 3UAXA 1EG2A 4ZREA 3K15A 4XFDA 4BVGA 3E84A 4PCAA 5FOTA 1Z7YA 4AW9A 4LHVA 1N6PA 2O2DA 3ZU6A 2GJ9A 4QQKA 5CLIA 2CFSA 1VPTA 1YBFA 4W7SA 3U81A 3VV3A 4LF9B 3AHGA 4KTVE 1YB7A 4Z9BA 3CPEA 2W5UA 3DMPA 2NYUA 3GG2A 3QOXA 5F5NA 1IIRA 5TF4A 3SZOA 2IW3A 3VR6A 3R3ZA 2NZ8A 1OFIA 2PX8A 3WYEA 5CFZA 3EUWA 1P1HA 1JDPA 3BSFA 1I5EA 3EGOA 3WLLA 4Z1MA 1IXZA 1GYRA 2FY8A 5JXGA 2B0CA 4DMHA 1L8OA 1D1SA 3O8QB 1S8AA 3ES9A 3NHBA 4QYSA 4C0KA 2UVPB 2J9FB 1EA7A 5LZ8A 4QAQA 2IZZA 4JDPA 2AZ4A 3Q8XB 2G63A 1JTVA 2OGZA 4FFNA 4FZRA 4Q12A 1EMDA 4W5TA 4EECA 4OBXA 2QJWA 1Y5NA 2Z43A 1A7JA 4GBGA 4AP5A 1VPLA 1LCIA 2EJCA 2UYOA 4B4OA 4NBTA 3EEFA 1T2UA 1DG9A 4OGFA 4X1KB 4J1TA 3FDIA 1U0EA 1TU0A 2D8AA 4R1TA 1QO0D 2KE5A 3SSNA 5E4YA 1CHNA 1N34B 5D85A 3EVBA 2HWUA 3G3EA 1GXSB 3IESA 4AKTA 3K94A 1M8FA 4IX1A 1DBIA 5CFPA 5REQA 1VHQA 2R8YA 1QYDA 5EMHA 3ZV3A 1I24A 1T36A 4J0KA 1B2LA 3DGFC 3FNBA 4MDHA 3IIIA 4G5SA 4EB6B 3Q8WA 1IBCA 4O1HA 4O2LA 4XSVA 1ODTC 1XTRA 5EWLB 3VZDA 3N0XA 4TN1A 1BHJA 1LU9A 1OJLA 2Q28A 4JUAA 4R9VA 4RHFA 2FZ4A 3MGBA 5FLXA 2B21A 2C7BA 2ZYIA 2D2IA 3OPVA 4GZMA 3HCFA 1A8SA 2J3IA 2N75A 2A35A 4R9UC 2GXSA 4U2KA 3NV7A 4X71A 4YDRA 5FWNA 5L4SA 4DWJA 3IKMB 5JY6A 2YN0A 4HOYA 1N2HA 1PJ2A 4D4MA 3W7AA 4D5EA 3R5HA 2QVGA 2VFAA 1QYRA 1R9NA 2PS0A 2Z2KA 1HT2E 2IVZA 2ZWMA 3EWAA 2FRDC 3QFRA 1B00A 4AIRA 4UJ5A 1JWAB 4EUFA 3ITNA 1IPHA 4M4SA 1NMEA 4JI8B 2BELA 1EVEA 4JKIA 2F67A 1HSZA 2HMUA 2UZ1B 3IVCA 1JG1A 3WLEA 1T1EA 1QH1B 3IT0A 1VXRA 4GX0A 1MU0A 4AF7A 2CXSA 4AO8A 4C4RA 5A1TA 5JRJA 1TLFA 4ZJUA 2Q3HA 3PHIA 3EPLA 1EGHA 4YRZA 2R2AA 5FB3A 1QQ6A 3RC1A 1J0BA 4J8PA 2OXRA 4D4LA 2QTWB 3AGQA 3H2GA 3PQ6A 3RYTC 3JQPA 3ZLJA 1KFBB 1A9PA 1Z0KA 5FWYB 1P7WA 4PXSA 4EH1A 2XE7A 2PD6A 4U63A 3W5JA 4EKYA 3ETJA 4E0BA 4OGGA 1QDUA 3GEGA 3INGA 4EHKA 4RKEA 1MO4A 5DE3A 4UE6A 5G02A 5EVJA 4BQQA 4R98A 3WNQA 1NVUQ 2BCJQ 2I8CA 2N0SA 4KXFB 4PAMA 1QHFA 2HSWA 4RPHA 5A02A 3TG2A 1NBME 3RANA 2PX0A 1YRAA 2G77B 2AFIA 4LHEA 4TT3A 2IS4A 1E59A 1YGYA 4RVHA 1FNBA 3D3QA 5KVSA 4FNMA 3RAEC 3OKPA 4UM9B 4JX9A 4U2EA 4EFLA 1EHCA 1MH1A 4NJMA 1XRNA 3IBSA 3NDPA 4UUAA 5CB6A 5T67A 4C5BA 4WCFB 4DJ5X 3NBFA 2Q62A 3K3PA 1NZDA 2ZBFA 1OFUA 2ZE6A 2OOSA 1RVDA 3JD1A 2H5IA 4HAUA 3ZIDA 4H6VA 3OQ1A 4YLYA 3I0NA 5CDSA 1N3YA 3UJNA 3AVWA 1XDSA 4E5DA 3R3UA 4XDYA 3DLCA 5KTRA 3HO1A 3EC2A 3FMVA 4MV4A 1E89A 3D8TA 2VHYA 2HA6A 2CZCA 1RWWA 2QVXX 3GYBA 4BWFB 3NJRA 3I1YA 5JSUA 2YUTA 1DO2A 3FZNA 4DR4B 2AK2A 1WB5A 4QU8A 4NE9A 2QRVB 4PNPA 4B3MB 2GD2A 2HD4A 3RWMB 3W9UA 1EFRD 3UMRA 1GUAA 3OD1A 4QQRA 2ENUA 2C94A 4G5OA 4ML3A 1OOEA 1P0PA 2ECFA 4UFOA 3DO5A 1V1MA 3VVMA 5CR9A 1Z6TA 3OSUA 4IBOA 3IT1A 1QIIA 2RHBA 4KN8A 4YP6A 1S2OA 1OUMA 5G0WA 1RQLA 3L1HA 5A05A 5EESA 2XQJA 3CF6R 4P4SA 2NUPB 3S70A 3TSCA 3O7WA 3N28A 3EQ8A 3JYOA 3OT5A 4HGZA 1JB1A 4R31A 4U2FA 3UJPA 4BV9A 4DDHA 3K53A 4J3JA 5L3ZA 5DCUA 4MYTA 3HDHA 1I3NA 3ZTTA 1F0YA 2G71A 2SCUA 1OI2A 1S8OA 2QORA 2XLBA 3O8OB 1JU4A 1V25A 2RDMA 4BGVA 4ZJPA 2C9YA 1LRJA 4DLWA 1KTIA 5IBCA 2R87A 3OY7A 5TQJA 2CD9A 3GPBA 1CETA 1FPQA 1UDCA 5IFKA 3JVEA 3O7MA 1N2CA 2YJ5A 3G0BA 3NIBA 3ZI4A 2DBZA 4UNNA 2O2JA 4R1MA 5HF5A 1H9AA 1NSTA 5EZYA 4DJDC 4ARUA 2AHOA 4L3VA 3GGGA 5DTMA 4X85A 1EXWA 3L0DA 3EXAA 4F2PA 4ZCRA 4AJEA 3T9BA 4E5UA 1PDOA 2PMFA 4OM8A 1ZC4A 3MTBA 2X8JB 1NYRA 3NVKI 2BFBA 3WP1B 3EF0A 4MV6A 1IXRC 1FFXB 4QYWA 2QS9A 4BN0A 3J7AC 3GLGA 3JQ7A 2R79A 2P6NA 2QK4A 1YRWA 4OGKA 1QGUA 3DBLB 3IEUA 1WMSA 1VJ1A 5KTSA 2WE8A 2GJSA 1MB0A 3TZCA 3CR3C 1EGQA 2BLLA 1MC5A 1GPMA 1U8UA 1HYBA 3NBYC 2CV2A 1R6TA 2QTHA 3F78A 4MULA 2O7SA 1RW4A 3D0OA 2NTYC 1OJ7A 3FRJA 3DXXA 5AHWA 3RS8A 3M5PA 3I09A 3KYCB 1V71A 4PZZA 5JH7A 1RJWA 5DISB 4PAGA 3E9ZA 3TIIA 5HTOA 1R6XA 2V7TA 4RVOA 4DRZA 4YAFA 5DX1A 1A76A 4C87A 4D9GA 4CI9A 1ZX1A 2OPBA 3V8QA 1XCBA 3DJFA 4I1UA 3TRFA 3EPRA 2JGFA 5TQ0A 3UGQA 2CDNA 3WWCA 1DVRA 1NHGA 1WVIA 5HOEA 3OJFA 2JFXA 1UP6A 1F48A 2WMOB 3D3KA 5A4KA 2IBTA 1D09A 3KE9A 5SZHB 3U40A 4KMOA 2XT9A 4IWXA 4ZVKA 4YCCA 1MKYA 1SEVA 3AFOA 3OZCA 2QLNA 3TSOA 2F9FA 4DCPA 3ETGA 2PX5A 3WGZA 4F4JA 1CIJA 2VBFA 1BWSA 3AEZA 2LXNA 1Z3CA 3LQRA 3NIGB 4Y67A 2AYYA 4AJPA 3KSBC 3FKQA 4X92A 3JD4A 3TW6A 1Z8DA 4HSGA 4JI2B 3PRHA 5F4BA 2ANBA 2IEDA 4JNKA 1SCKA 4BFYA 3I5UA 4D8UA 1O08A 1AMUA 1MV5A 5IM4F 3CUWA 4PHFA 2NTNA 4BNXA 1K4YA 1UL1X 1TT7A 3UMVA 4ER7A 4RTQA 4Q3LA 4M0KA 5EJGA 2ZRNA 3OCXA 2NV0A 3QFCA 2VA9A 1Z34A 2AN9A 3I2FA 1HYGA 4DHEA 4IIEA 4ROSA 3V97A 5HR5A 1LBHA 1T0IA 3OX2A 2RI0A 4J4HA 3QPAA 4C3OB 3OJXA 3UNXA 1TO6A 3DM5A 1OI4A 3U9TA 2FUG1 3LQ2A 2Z98A 3NEPX 3O31A 4O6VA 5CPFA 5DDIP 4EF4A 1W0KD 3WIDA 4D42A 4HNVA 2VXOA 4J9VA 3F0TA 4CDGA 2VEOA 3TINA 3OJLA 1G42A 2AC4A 4IO1A 4E51A 2QUIA 5DNWA 4KQWA 4RGYA 3PWZA 3RQSA 1G18A 3D7SA 5ADHA 4ARSA 3G7SA 3G5LA 2WFAA 3RG8A 3QHPA 3WWDA 5BN3B 3VNVA 1LS1A 5LQJA 3QHQA 1Q11A 3GEIA 4JJIA 4CTMA 5IFLA 1JR3A 4MV8A 1EYZA 4XLZA 2AYXA 2K87A 4G5GA 2CV1A 2VF7A 1W85B 4RA9B 2VTKA 1YTLA 4M7RA 3D2CA 4Q7JB 4RVUA 5D6NA 3SI7A 3WADA 4D3XA 2XCTB 3M4JA 3BSYA 1GLVA 2DUWA 2H1WA 1W2WB 1Z17A 1B15A 3L8ZA 1WMBA 1W47A 3CUVA 4JSRA 1F9EA 3PC8C 3ZBPA 3O0TA 1F06A 1EU1A 1Q92A 1SKYE 1ZIXA 2IZ1A 2ZYVX 4L27A 3D4BA 3A7EA 5ALVA 3U7JA 1YA8A 2PU7A 1NAIA 4P5DA 1V8DA 2CV0A 2IEZA 2CUNA 1Y5IA 2OK7A 1KMCA 4UMEA 3D4PA 1GHTA 2JFBA 1PF7E 2JJ8A 4J4TA 2J6HA 1JF8A 4BLPA 3EXG1 4Y1GA 4EGSA 2X9NA 4DWVA 1GZ6A 4E07A 1SHUX 2I55A 3DVAB 2DUJA 1FMCA 1I4OA 1QRAA 1GZHB 2GAOA 3WOHA 3DOUA 4H27A 5J5CA 1Z83A 5E6SA 2AXQA 4PZ0A 1OVMA 5ENVA 3K96A 5LSAA 1VMEA 2PL1A 3EULA 2SICE 1IATA 2FZGA 4QNNA 1FLAA 4B7AA 2GERA 2NYRA 4YC7A 3ER9A 5JNRA 2QZ4A 4IEIA 4XFKA 1L5QA 2JI6A 3DMYA 3BDIA 3GT4A 4MROA 4RIIA 1ODSA 3W8FA 2JFQA 3FCEA 2LVBA 2QMOA 1U28C 4N40A 4I36A 3D5QA 4WOKA 3ELYA 1MB4A 1SA0B 1YOVA 3OAAA 5C4IA 1SCNE 4M1QA 1AF4A 5ALMA 3AU8A 1KRHA 1ZD1A 4CKEB 1G8GA 1OAKA 4R8SA 3RARA 1P4GA 3P27A 2I1VB 2Z56A 4ZCMA 2GPSA 1P1FA 3DZJA 2PSSA 4IOMA 3GNSA 3P0HA 2QT1A 1MN6A 2V7XA 4Q7MB 5EHQA 4DLZA 1H22A 3N74A 3AWIA 1ZI8A 8GPBA 2YTZA 4CL8A 5BPHA 1I6KA 4OMUA 5KYWA 1YRYE 5E2AA 2IX9A 2I6TA 3BWEA 4IJ6A 5FUWA 2H7CA 4OJTA 3JWHA 3GIWA 1WZUA 1XTSA 1ZK1A 3GLVA 4ZTZB 3ZPXA 4YRFA 3HCRA 2PKQP 1HLPA 3HKDB 4MEJA 1JDVA 5FOVA 3J7TA 3LPDA 2HEIA 3V6MA 1JA1A 2HSDA 3KZ1E 1UC8A 4IM7A 4HB0A 4V0LA 1OH6A 1U2GA 1R9GA 4GVLA 1QVAA 1VIMA 4D9HA 3RUEA 3X44A 3HGQA 5BYAA 4A36A 1SXJC 5TGTA 1DLIA 2A94A 4G5QA 5LMZA 2E1RA 3D1LA 4K86A 1PJZA 3OETA 3MFQA 2WSIA 1WUYA 3VO2A 4RHEA 3DVQX 1LJ8A 2B6HA 3H2IA 2BEWA 4UHHA 5D51S 3MJEA 2E87A 1Z8FA 5WRFA 1KYIA 1EKXA 2DWPA 1N9KA 2A84A 3JQAB 1ADCA 4Q9AA 3ZD6A 2ZYRA 4JCOA 5LBUA 3ADKA 2YICA 3KYBA 1OAAA 1XDBA 1U8TA 4PLPA 2OFFA 4PNZA