4QYIB

1.95 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' with hepes molecule in the active site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
171
structure length
170
Chain Sequence
IEIKDTLISEEQLQEKVKELALQIERDFEGEEIVVIAVLKGSFVFAADLIRHIKNDVTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDAEKYRNLPFIASVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypoxanthine phosphoribosyltransferase
publication title 1.95 Angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from Bacillus anthracis str. 'Ames Ancestor' with HEPES molecule in the active site
rcsb
source organism Bacillus anthracis
total genus 56
structure length 170
sequence length 171
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qyiB00
2PRZA 3KB8A 3GGCA 2IGBA 1BD3A 1ECJA 1VSTA 4QYIA 1Y0BA 5BSKA 1QK3A 1I13A 1J7JA 3LRTA 4WN3A 3GEPA 3HVUA 2H06A 1TC2A 4OHCA 3EFHA 4TWBA 4RQAA 1A3CA 1XTTA 1VCHA 4X45A 4S2UA 2AEEA 1L1QA 1AO0A 1DKRA 5K51A 1DKUA 1ECBA 1OREA 2E55A 1XTUA 4P86A 4RAOA 1JLSA 1ZN7A 2DY0A 3H83A 2JBHA 4QYIB 4P80A 1UPFA 1JLRA 1A97A 4PAWA 2P1ZA 1G2PA 2JKZA 1ECGA 4X44A 3ACCA 1CJBA 1QK5A 1G2QA 4P83A 4RANA 5KAPA 4RABA 1GRVA 4P81A 4WMLA 1BZYA 1Z7GA 1ECFA 4RV4A 4JITA 4LZAA 4M0PA 4RHXA 5BRNA 3MBIA 3NAGA 1I0IA 4RHUA 3DEZA 1HMPA 4LZNA 1DQPA 1D6NA 1G9TA 1STOA 4RACA 1A4XA 1ECCA 2JI4A 1FSGA 3ACBA 1WD5A 1I0LA 4RQBA 1LH0A 1L1RA 5KAMA 4LYYA 1A95A 4RHYA 1XZNA 1UFRA 4P84A 3S5JA 2FXVA 4LZOA 2PS1A 2GEBA 1A96A 1OROA 1DBRA 4KN6A 3DAHA 1QB7A 4FYMA 1IBSA 4Z1OA 3G6WA 4M0KA 2PRYA 2HCRA 5IAOA 1I14A 1V9SA 3M3HA 1OPRA 1P4AA 1UPUA 1P18A 1HGXA 3ACDA 1I5EA 1W30A 4IJQA 4P82A 1R3UA 2EHJA 5JV5A 2JKYA 1O57A 2H07A 3MJDA 1A98A 2WNSA 5ESWA 1G9SA 1XTVA 1QB8A 1QK4A 3OHPA 4QRIA 3LPNA 4ZFNA 2XBUA 3N2LA 3GGJA 1U9YA 1NONA 5E38A 1VDMA 4MB6A 2YZKA 4RHTA 5ESXA 2H08A 3DMPA 5HKLA 4RAQA 4F8EA 1ZN8A 1QCCA 5JSQA 4LYGA 5IPFA 5BQOA 4P3KA 4JLSA 3OZGA 1O5OA 1PZMA 5BQPA 1XZ8A 4RADA 3O7MA 5HIAA 1GPH1 2VFAA 3QW4B 1P17A 1DQNA 4M0UA 5EUCA 1NULA 3OZFA 2C4KA 1TC1A 4PFQA 1BD4A 1P19A 1QCDA 1YFZA 1U9ZA 1MZVA 1ZN9A
chains in the Genus database with same CATH superfamily
1GLGA 1D6SA 2QRZA 3CKMA 1HO3A 3FNEA 4QATA 5EMNA 1KMHA 1K66A 1KYYA 2H85A 1QHGA 1Z0ZA 1SH7A 1KWGA 1DX9A 2AEEA 2B82A 4NMHA 4DLNA 2CVZA 5K51A 7REQB 1QTQA 1N4DA 4DNQA 2DUUA 4C7VA 2Q29A 3RQSA 1JN0A 4IAOA 3FZYA 1Z18A 5FI3A 4IKEA 1N5KA 1UMCA 3JD0A 3SEFA 3HZRA 5CW2A 1EDZA 1XRMA 4XJXA 4OK6A 2W2QA 1YC5A 5JS1A 1ZISA 5L3RA 3GAMA 1DWOA 1B14A 1CS0B 3DMGA 3FTDA 1XHLA 1PX2A 4IKOA 3M3DA 4MVCA 1EFUA 3NKLA 1Z0SA 3C1UA 1XNJA 4AKHA 1UUFA 1WMFA 3O4JA 2P9JA 3D4BA 3UMVA 4ZU1X 4HLDA 4OQPA 4GGOA 1Z4QA 2ZE8A 4PHFA 4R7GA 3SHVA 3PIIA 3IAEA 4QDTA 4PLCA 2WILA 1P6XA 1Q1QA 2Q4BA 1M8KA 4TXNA 3EISA 3RS9A 5IJ0A 3TR6A 4CQLA 3ZBPA 1FSGA 3DFIA 3PS9A 3BXEA 1E61A 3U4HA 1R0LA 3Q7EA 4NWIA 1P72A 1YDMA 4IX9A 4XQ0A 3I62A 5E9QA 4YJ2A 5BSWA 4BN0A 4B47A 3RREA 4MKZA 2GYYA 4W1QA 2JFGA 2FI1A 5KJ1A 1E59A 1Z15A 2JGNA 1Y1QA 3GARA 3EIUA 1HDGO 3EVDA 2QTLA 5KX5F 4XIGS 2PX0A 3NI2A 4U3JA 1CQIA 2WWGA 4A3SA 3UQYS 5KDOA 1U2QA 1I8TA 5E8JA 2AF3C 3FJOA 1HDCA 4G84A 4GNRA 1U8TA 1JR3D 2Z2ZA 4KDFA 5BVGB 3FR8A 1BW9B 3I53A 5AW1A 1FDTA 2ESRA 3N58A 3P94A 4LQCA 1MDFA 3NALA 2BM8A 4KMRA 2MOKA 4CKXA 3ZWMA 3BK2A 4I8XA 3OI7A 3RGWS 3MT0A 3Q7RA 3A1UA 4FM9A 3MLAA 2P27A 3T3OA 5AVJA 5EMLA 4B3GA 4OL0A 1CF9A 5EWMB 1FYDA 3S55A 3C97A 4L85A 2BONA 5JD5A 1QBGA 2HOQA 3PVCA 4O0LA 4WRRA 4L02A 4BNUA 1P4HA 1WM1A 4KFSA 4ZGWA 3VTAA 5IDQA 2VP3A 1OVMA 5AMXA 3A6ZA 3T35A 3GJ0A 1IVSA 3LO5A 7AT1A 2IPNA 4U6SA 1Z88A 2B2NA 3JQDA 3D6UA 1IB0A 4IIJB 3RT1A 2A1TS 1UZMA 3DV0A 2DBQA 4IFIA 5F52A 3TNFA 1YB4A 4M0UA 1FTQA 4D45A 2A5JA 2IUFA 4YDSA 2HDOA 1K4KA 2AWNA 5GADl 1Z36A 4TMFA 3QUQA 3DB2A 2G9QA 3AB3A 5SZJA 3EXHA 1WP4A 2YKGA 2CDBA 5CW1A 3T7EA 3STYA 2VLBA 4C4ZA 4DMHA 1PWHA 4WOBA 3WXBA 2OE2A 3VAAA 3BMQB 1B3RA 1JNYA 2ZBDA 3FPLA 3OTGA 3QNUA 4MGYR 4K88A 4OM7A 3E5HA 4PW0A 2JAQA 4UU1A 5CXXA 1TKBA 1VYTA 1Y3DE 1IBRA 3LWBA 3PX3A 2X4GA 1TECE 3H18A 1CJCA 3QLEA 2FOIA 3GT0A 1TI7A 1UJNA 2DPXA 1OOEA 1EFPB 1FFWA 3I4FA 2ZS9A 1L5NA 1EKXA 3NM4A 2BZGA 1IZZA 1R3DA 1NMQA 1W4ZA 3K6JA 3AY7A 4XLTA 4FQ5A 3VNRA 2B78A 1BNCA 2KX7A 4ZVQA 2PL1A 3E0XA 4LBZA 1JX6A 4M7PA 1TKCA 2IV2X 3SYNA 4MP8A 3K0SA 3KVOA 4UEOA 4KDEA 2XKAA 1XEXA 3QNWA 5BWNA 2HA3A 4RU1A 1GAWA 1VPEA 1XDGA 2V96A 3R4CA 4GC9A 1EVYA 1NLYA 1USUA 2PJDA 3ISTA 4GZLA 5DI3A 1X7DA 3O83A 5GJVC 2ILTA 4Q93A 6ADHA 3OOHA 3L2OB 4A03A 8LDHA 2QTVA 4BWFB 1ZJJA 4L76A 2RHOA 1ESEA 4MPJA 1W4LA 2F3RA 4IHQA 4H17A 4P7FA 2UZ1B 3G7SA 3K0FA 5BQFA 3LUJA 2XXBA 3G8CA 1S8NA 2ZJ5A 5HA5A 2NOAA 3LA8A 1NRXA 2CFOA 2J07A 3AB8A 1YR8A 3UAGA 2JFZA 5EKDA 4UEWA 3WGVA 1XCPA 4EGFA 2I91A 1KEWA 1URPA 3MTBA 3TKAA 5FL7A 5KX5A 3K0BA 5AVRA 4DV5B 1E89A 4ZEWA 1XPUA 1OBHA 1A8HA 1VG9B 1W581 1YS2X 1ZHHA 3L1JA 3SXPA 4GOXA 4YAGA 1AZTA 1D07A 3WS7A 1QAMA 3L01A 1J8QA 4U4AA 4GKJB 1Q7CA 3N53A 2GD2A 1XQYA 4ETIA 2CEAA 1FDIA 2ENUA 1W8IA 3UJNA 3KKPA 3NR2A 5ESRA 3SS7X 4DV7B 2OCXA 4LYJA 5HR5A 1X15A 5KYXB 1WHSB 3O9VA 4FKZA 3KX2A 1KYZA 4YV0A 3BQ9A 3QBDA 4XD7D 4FGLA 3MN1A 1YR7A 1QIFA 3ZWBA 4GM1A 5EPEA 2RB5A 4ZU6X 5TB5A 5A4JA 2BW0A 5K6AC 2BKEA 4QO7A 2Y67A 1FSPA 1DV2A 1QKKA 1V6CA 2B36A 4MQEA 2BFPA 1UT6A 4G5QA 4JVNA 5LBUA 3RT9A 1XZJA 3TTTA 4YRZA 4TS3A 1D4FA 3QXJA 1GEEA 3WWEA 3DCNA 3H7AA 5I4BA 4JVOA 5AJWA 2ZJ3A 3QBEA 4W9NC 3ZUPA 3WMXA 1JDNA 4IGEA 4ESVA 4CLXA 4JN6B 1X86B 1E6EA 2QN7A 3A36A 3LD9A 1TUBA 2NYRA 4HEQA 4UTPA 1NX6A 1TO1E 4YASA 4MMYB 2P69A 3KKLA 1NPYA 2C8JA 1GTVA 1XP5A 4QUJA 4F3YA 1KTVA 3Q5GA 4LXIA 4QBTA 2AR7A 1SKAA 3CNLA 4AUNA 4BLQA 3PUKA 5K09A 3MMPA 3REOA 3GA0A 3W6NA 3ILXA 2W6OA 2NT4A 1G7SA 1TKAA 1F14A 1QO7A 2WIJA 4H4EA 3DR3A 3W3AD 2JIMA 3G1WA 3IEXA 1E64A 2YNMC 1JQDA 3V8BA 4ZVLA 3ZBUA 3ZHZA 2HWUA 2I76A 1HDOA 1ZD8A 2QR5A 13PKA 5H8WA 1JLKA 3CVYA 4ZAWA 5HPYB 2FX3A 4C0BA 1T9HA 3M1IA 3DOUA 1HZJA 2ZUWA 1RYMA 2HREA 5LDDC 5AJVB 2GJ9A 2CNDA 3JQ9A 1C7ZA 5CA1B 3I8SA 3PC7A 1G7RA 5BOSA 1OX4A 4DR3B 3N07A 2UYQA 4RMIA 4X71A 3TSCA 5B1EA 3H3FA 1S8AA 2ODQA 4TVKA 3GO4A 1JHOA 2K7FA 1N2CE 1UF9A 4XAQA 2V7EA 2G4CA 4U7PB 4JI7B 3IMFA 1MLDA 2Q4RA 1GTG1 1KIMA 2AL7A 2HJVA 2QX4A 3H83A 3MYYA 3R5JA 1NHGA 4TM8A 4HH1A 4RF3A 2BZ1A 4JCCA 3IXMA 3KQPA 1OMOA 4H6PA 5FKJA 2DPMA 5BWMA 1PNRA 1G9XA 1LWOA 1B42A 4GT1A 4GX5A 3ZZNA 1Q0RA 4K5QA 4J0FA 1G0OA 1NQOA 1ONPA 2PY6A 4NMXB 4LCEA 1AKNA 1O8CA 1Q15A 2ZAIA 3QBJA 2EDCA 4JBLA 5ALWA 1WO8A 1X1BA 1IY2A 2P90A 4HADA 2I4OA 1A1SA 2L0XA 1UBFA 2YFQA 3BGWA 3R9WA 1W5EA 4KUGA 5LMNB 4TYPA 1YOVB 1SIOA 3B51X 3T1YB 3I2FA 1SBIA 4ZQIA 2BV3A 2V9CA 3ERCA 5HZKA 3PITA 2YNMD 1O6GA 1UADA 2FX2A 3D4LA 3MD0A 2HIHA 1H1DA 4D0RA 1KIFA 3M34A 2B1QA 3W1WA 1UDAA 3OJFA 2WF8A 3KVRA 1O87A 4JJIA 2FWIA 2IQ5A 2PUHA 2FPRA 1XTIA 4EUFA 4X1YA 1TYEB 1Z4NA 2VUUA 4DLZA 1WVIA 3WFIA 3A9WA 3P9CA 3JD2A 1WTAA 3GZTB 3VH3A 4S0ZA 1GKYA 4OQYA 2VQ6A 3BT7A 3SS9X 1GZDA 4P93A 4FFVA 2RGDA 2AI3A 1QGZA 3JQAD 3NFYA 4NK5A 3ROPA 1Z37A 3R8FA 3DM9B 3DTVA 1N8SA 5AXDA 4NJMA 3BXFA 4BBZA 1WU8A 3CF0A 2PWAA 4NICA 5E7QA 4DRXA 1CUUA 1UP6A 2MIIA 4BNWA 5AQ1A 2O5RA 1AV6A 4DCGA 2D3WA 3ESYA 2H8KA 4L78A 5CDTA 3JWPA 3R6GA 1EP1B 5D3MB 3INYA 2WTEA 5FNZA 5TJ9A 4CFSA 1H9CA 3JS5A 4HNHA 4I4LA 4A6PA 4ETNA 4D97A 3COYA 4WADA 1M1ZA 3F5DA 3WC4A 1THZA 3LCRA 1XTVA 3UJPA 5JLAA 1QIJA 4NCBA 2NVUA 1AM4D 2ICAA 3VO9A 1O95A 2BMAA 4M1EA 1LKZA 3THXA 5TMEA 3SK0A 1H85A 1WCWA 4G0OA 4E2XA 1B15A 1L7RA 5CA1F 3JQ7B 1RADA 1JHAA 3HHPA 4C1BA 3G1UA 2TS1A 4RMGA 1YS4A 2Z9BA 1I10A 1DBIA 1PR9A 1ZKDA 2CXSA 3KXKA 4Y0NA 5ALMA 3WG9A 2GERA 3LQRA 2VYNA 3DYIA 4HXGA 1W5SA 4AIRA 4P53A 4IICA 2AHOA 4JLDA 2IDZA 3OKPA 2P2NA 2GQ0A 3IDAA 3C3JA 1C9NA 3ESXA 2BH9A 4QEKA 4Y2RA 4CMIA 4EHHA 1OYVA 1TXGA 1M6WA 1L5SA 1L4EA 1VKNA 4JX8A 1DRUA 5HE9A 3ZEIA 1L5OA 3SX0A 1Y9AA 2Q0SA 2WIDA 4J0GA 4HEA1 2Z3ZA 1MUUA 2Y9MB 3DQPA 5REQA 5L6MB 2C9CA 1Y5NA 1ZN9A 3EVNA 3IDQA 5KVAA 2WWRA 4S12A 3JQRA 3EIEA 2AKAB 3F6SA 2DQ4A 4LSWA 3DLBA 1R64A 1VLHA 1JDTA 2JFWA 3IX7A 1XTKA 1K8YB 4TWRA 1AXEA 5L3ZA 4AB1A 3EQ2A 2GPTA 2Z57A 4EJ0A 3ER9A 4OGWA 4TM7A 3EFHA 3U49A 4QLBA 5LQAA 3KPVA 2JIQA 2ZIUB 1XE3A 2AW5A 3PGXA 4I50F 4MRRA 3R3VA 1J0EA 3IO3A 1Z22A 4G25A 2WF6A 1TJYA 2P35A 4M9RA 1H66A 2LIVA 2QJOA 2RJNA 3LF1A 4CLEA 2FOLA 4TPKA 2JJQA 2CL6X 4C2AA 1L2TA 2ZVJA 1NRWA 3COWA 3MS7A 1T1IA 1JG7A 4P36A 1KZ7B 4X1IA 4WA8A 4C0QC 1IM5A 1CFZA 3KQSA 4C4YA 1NZFA 5HKAA 1FMJA 1QDEA 3TIVA 3SYTA 3VBCA 2FZ4A 2LCFA 3P4YA 3DFZA 1R8XA 5AKEA 5JCJD 4LHXA 5KB3A 3EXIA 4IFBA 3K7EA 4WZZA 1Z4JA 5DHAA 2Z30A 4I99A 1R0XA 1XTPA 2FUNB 2ZFUA 2VHEA 4KAJA 1B23P 2IS2A 3IQIX 1AY0A 1G5TA 1VCMA 4C4RA 1TUEA 3DUFA 4EM6A 1T4GA 3IELA 1POXA 4F9FA 3P9NA 3LOPA 2ORWA 4XQCA 3FZEA 4KJZA 5BQXA 3DEYX 1VC2A 2F90A 2ZSAA 3F4LA 3O2SB 4NZOA 3UAOA 4RK0A 3R7BA 3WWDA 2J0SA 9MHTA 1QP0A 3HKBA 5IN4A 4GWKA 3AFIA 1UWKA 3CVUA 5G1PA 4H3VA 421PA 3LXRA 2F1HA 3BULA 3UXYA 2AUTA 4HWKA 4BO4A 3P2KA 2CV1A 5AKIA 1C2YA 3O31A 1U2PA 2A67A 3K73O 5D51S 4XJVA 4EJFA 4AP5A 2QPOA 5ALHA 3GJ7A 3ADBA 1LI5A 5JFOA 1KJWA 3R0VA 4D8XA 5EUBA 3DLIA 2WW8A 3FFAA 2G0AA 3OO0A 5K0BA 1ZJWA 4R40A 1I6MA 3R6TA 1QX4A 4C9BA 4JK3A 5JWHA 2A0XA 1RYZA 3IVXA 3W2HA 1A76A 2ODAA 3A1SA 3O4HA 4OU5A 2ID4A 4BNFA 4QJ5A 1KBOA 3OA0A 2HJ9A 5HHTA 5JG7A 2YASA 2YS6A 2DKOA 2P5YA 3MW8A 1HKHA 4AYWA 1Q11A 1V5FA 5DF1A 5KWIA 4YP0A 1TTQB 4B83A 3CISA 5DFAA 2XUAA 4OYYA 1GGHA 1I1OA 1M6VB 1ZL2A 5BYBA 2ZB8A 3B5IA 1KERA 4EG4A 3JYPA 4QVKA 3RSSA 2XQVA 2XCTB 3DDCA 4JS0A 5CJJA 5KYNA 3NDBB 4B80A 1RQGA 5E4FA 1QJ4A 4CL2A 1FNMA 3STUA 3QEKA 1BCRA 1OXSC 2B8TA 4XDYA 3RU9A 4KGXA 4EG5A 2J08A 3STXA 1AB6A 1SCIA 5DGTA 3RSZA 3QG5A 3W4IA 2BGJA 3K8QA 5G02A 4EA7A 2MTBA 4PZLA 4B45A 2C4TA 3F73A 2Z5VA 4GPAA 1DOAA 2VOEA 1NOJA 2FG6C 4P4SA 4UZEA 4I50A 3CM0A 3ROTA 2QBYA 4J29A 5G3ZA 3SXJA 1OFVA 2QTCA 1RRGA 4K6CA 3QPDA 4LXYA 4OHBA 4PC7A 5D5PA 2XRZA 4AY6A 2ZRNA 3LQ1A 1MIHA 4PHCA 1X7XB 1H2WA 3W5AA 4G0WA 1KRXA 3CNEA 1JFFB 3NPAA 4PO3X 3WDLA 3ZLUA 3D0KA 4NPHA 1XVIA 1KQGA 1U0JA 2XWJI 4PC3A 1MGPA 4QPCA 3O8RA 4S04A 5ALDA 3C3DA 3KJIA 3RKUA 4ZVTA 3OC0A 2ZUUA 3E5RA 4G4JA 5HIMA 3KE9A 1CVIA 3M3PA 3UMGA 3PNMA 3ZQJA 1XHEA 5KI6A 4EPWA 2M2IA 3HN2A 1E1DA 4R4JA 2POQX 3GY0A 2XRMA 3FHCB 3BIOA 3RG2A 4M9ZA 4MI9A 5TPWA 3UJBA 1YA8A 2CSXA 1N2GA 1LZLA 3I9LA 1X6VA 3B6KA 4RVDA 1A5BB 4CV2A 2PX2A 2Q6LA 5H70A 4OJQA 1G7CA 1AZWA 1HEUA 1SBQA 1XTJA 1ZCAA 2X5OA 2YWEA 1KQOA 2B98A 1QH8A 1YI8A 4RZHA 1YJQA 4XPZA 4DDMA 3GG9A 4DCTA 4Z9FA 4PQYA 4GM0A 3EWNA 2X6RA 4JR2A 2C31A 5A05A 1R0RE 1NI5A 2YVKA 1MW8X 2VRCD 3C8MA 1E2LA 1XQ1A 4G09A 1AVTA 1XD2B 3PPVA 4RQBA 2X3FA 2JA1A 1XA4A 3BFVA 1K5PA 2WKSA 1ZU4A 1NDQA 2B21A 3G82C 3LIIA 3R77A 4WOKA 1KZ6A 1WUKS 5KAMA 4QPDA 4EYGA 2ZRIA 3EMVA 4ZQFA 4B6GA 3LY5A 1YJCA 3VDXA 5FPTA 1NC1A 3L02A 1I2DA 4AJNA 1QP4A 4LV6A 3RJ5A 1XELA 4FMPA 3RS8A 2XDQA 1USIA 1HEIA 3DFUA 5C53B 4B3FX 5KTOA 1JZSA 2ERYA 1PJRA 4RC9A 3U1TA 3U0VA 1UIMA 2WT8A 1Z4IA 1R3UA 2OCAA 2KW5A 5B6JA 2ODNA 5AM1A 3BFXA 3PQ5A 3DZDA 3RRZA 1NZDA 2VZ9A 1DAHA 1C8LA 4M53A 3DL4A 2AHRA 1ACLA 2AUNA 3KZNA 4I1IA 4MHSA 2CCGA 4G5RA 2XYGA 5DISB 1MA3A 1KPHA 1P3JA 2R8XA 3QTTA 1EFRA 1LVUA 4JBIA 2O7QA 4JT8A 1S6YA 4N4AA 4R8RA 1DX4A 2CUKA 4IDAA 3GJXC 3PQ2A 5JZOA 3ZDEA 1AHIA 2DGDA 4RTMA 4JDPA 4PNPA 1PGJA 2QDXA 3NO4A 1WXQA 4FZVA 2CLEB 1MJNA 2FPSA 2JLUA 1N3YA 1SB8A 3O4GA 3C24A 4KXQA 4PC1A 2G83A 1VGVA 3A27A 4YAWA 5BSRA 2DX7A 1PP4A 4GOJA 5JAIA 4FEEA 2GN0A 1NI4B 2WBLC 2Y68A 2Y4NA 3DMDA 3EXAA 4XEUA 4MX8A 2AKEA 3GELA 3B9RA 1N8KA 3HGQA 1RRVA 2IZ0A 4UAVA 5EKTA 5L4LA 3TRJA 3VMFA 3KG2A 2ZJYA 1KP3A 4LF7B 5FWXB 2I54A 3UMFA 3M9WA 2R47A 4JB0A 1O94A 4R51A 2O23A 2ZI9A 3H3XA 2WD8A 1CDDA 2DHDA 1H8HD 2CF5A 2LW7A 3BORA 2IEBA 5EHQA 4BO1A 1BD3A 5GJBA 1BJRE 4Z0PA 4MPPA 1MTOA 4N65A 5CA0B 1AX9A 5B2ZA 3PDIA 3QM1A 3VR5A 2Z5GA 1SWVA 3CHYA 4N40A 4URXR 4P0PB 2IHTA 2W2TA 4MYDA 2PS3A 1A9ZA 2I4RA 1SUPA 5FQNA 1QZXA 3DZKA 1PG5A 5FOVA 3K16A 3TVTA 3IIMA 4YR7A 4YAEA 1RAFA 4CEIA 4BO7A 2WVAA 1W0KD 3HYLA 3BJMA 2GD6A 2XE6A 3ITKA 3E03A 1FY2A 3EWAA 2EJWA 1EIZA 2PA0A 1SOWA 3E9CA 4LDNA 6REQB 2QA5A 1E6UA 2BMVA 1P1IA 3D3NA 4GX2A 4JLNA 5JE8A 3SC2B 1SA0B 4DABA 1ITZA 3FMGA 1CBUA 4DFDA 3NIDB 2PLRA 1PR6A 3N59A 5E1MA 2K2QB 2IKSA 1VXOA 3GAAA 4CL0A 4LRXA 1G64A 1YZKA 3FGOA 1B8NA 3KWMA 3CLKA 1F8GA 3LQQA 3PHLA 1Z8FA 2G5TA 2CVFA 1FDOA 3A58B 4QUAA 3U0BA 4F4DA 4OLBA 2RAVA 1XDDA 3CLHA 4M0CA 2LKCA 3KTDA 1GYPA 4Z2AA 4IDPA 3L18A 3E05A 3OMXA 3CY6A 3OCZA 1RP1A 2PD6A 2EIXA 2CK3A 2NUAA 4G24A 5CK4A 4TT8A 1BGXT 1FMCA 3STTA 1NLUA 4OKNA 4ISBA 4AD8A 1WEHA 3EXG1 3FTNA 3GJ6A 3UXEA 4L5AA 3KL4A 4EELA 3H1FA 3T9AA 4GYKA 1DBRA 3WLOA 3DL0A 1XOIA 1OGIA 2Y8EA 4EJMA 4Y2GA 1XCOA 4FYYA 4RZSA 2AOUA 2BR3A 5TQVA 2AJBA 5LP6C 2LNDA 3COSA 3FN4A 1VBKA 2IPAB 3AERA 3IKJA 4X5OA 1NQTA 1TU3A 5CJPA 2ZRCA 3MTIA 3L0PA 2OGTA 3PXDA 1S4MA 1W0JD 4L7VA 3L7LA 3UWPA 1XZLA 1YZUA 1IXZA 2Z04A 2N1BA 4J0IA 4KIJA 1PUIA 2P5UA 4AZVA 2BSAA 5A02A 3NG1A 2FX5A 2JC3A 2PM8A 5CX4A 2ZCJA 3KTOA 4A73A 3H9QA 3NP7A 2QT0A 4R1NA 3UANA 3N39C 2GZMA 1MVNA 1N6OA 1ZGZA 3LFHA 3A1FA 4AMZA 4A8PA 4BFWA 3PUJA 2NXEA 1J0AA 4K6HA 3NPMA 1QMGA 3NQ41 3V33A 3W6UA 4IIFA 5KYWB 1QH9A 3H6HA 2C1XA 4RHTA 1TM2A 2NTYC 4FGZA 2EU8A 3QV2A 1U8AA 3M70A 2VDOB 2VF4X 3TLBA 1YZTA 1WCIB 5KJEA 3THSA 5LA6B 5EVJA 3WI7A 4PYJA 2H51A 5KTKA 2MINB 2WABA 2X19A 1C0KA 4M1KA 4ONEA 1RVDA 5A3VA 4MKRA 2WAYA 4X41A 1I9GA 4PYQA 4S1VA 2J3QA 2ZTLA 3DFKA 3L8DA 4HXFB 2E4AA 1KH3A 2O7NA 2RGBA 2AOTB 3NNNA 5F1OA 1OC4A 1QZ3A 4L74A 1AGYA 2MDTA 3RCBA 2QD1A 3BILA 4ZV7A 4XVUA 1LPSA 3MWDA 5THKA 1TAQA 1VSTA 2DSTA 2XH8A 1LSJA 2PKXA 1SJ9A 2CW5A 3N2YA 1WPRA 5B4TA 1TC2A 5JRZA 2PVCA 1IPEA 1E1QA 1PFUA 2I78A 4GOOD 5E9JA 3M2TA 2J32A 3OLWA 2KSQA 4RIIA 1AO0A 3PLAE 2FEOA 1LX6A 1CU1A 2PMBA 2A8YA 1TT7A 3T9FA 3VBEA 1IHXA 1ZN7A 4IEFB 1QHHA 2WIFA 4HAUA 5LBIA 1GKKA 1CZKA 2R11A 1QGED 4NX2A 5D7NA 1PL8A 1X1QA 3ZI4A 3I2IA 2QXTA 5EQFA 1JH9A 4QFCA 1NUUA 3X2EA 3ZXXA 1CUCA 3H8WA 1YJ8A 2XPCA 2QSJA 2QUHA 1UAAA 2XUIA 3TXAA 1SULA 4E3WA 1DE0A 1X7WA 2PWPA 2Q28A 4ZCPA 2BMDA 3F71A 4RVHA 4RYLA 3AEKB 4WXHA 2RH5A 1W88B 1CXZA 3CGWA 1XKQA 4H0FA 2YDXA 1IG3A 2Z8YM 5BRNA 5B36A 1GSHA 2J5BA 5G0UA 2IYEA 4RVOA 2CYBA 4C4PA 1NNUA 5LZ4A 4J6EA 2G88A 2TMGA 4QJIA 2V59A 2WVGA 1L1FA 3FROA 4NBUA 4UU7A 3W8NA 2GCIA 3F7OA 3T7IA 4KREA 3AEXA 1Z5OA 3H6GA 4W6QA 4L0DA 3ZS9A 2QYTA 5FLEX 8GPBA 1BMDA 3OQMA 4M1ZA 3D8NA 3E6AA 3LC7O 3TNLA 2BL4A 3PF9A 3QPAA 3HGMA 4YGXB 4BKOA 1H3NA 3PGKA 1L1RA 2XNDA 3E7DA 3X1ZA 1L5ZA 4L07A 1R8YA 1UFRA 1T29A 5JXHA 5K1ZA 1WHTB 1QU3A 4IGAA 1V48A 2XRYA 4K9MA 4W7IA 1H6AA 2RH8A 2ZUCA 4HEHA 5TXGA 2FW6A 3DDZX 4U7GA 1WDWB 3EXEB 1SC4A 3DAHA 3EN0A 1SVUA 4OCZA 2YOGA 3MS4A 1JA0A 3IDZA 4YACA 1CZOA 4E22A 3HJAA 1FP2A 2ZIFA 1ZA2A 2EX4A 4R3UC 4WFKA 5G3YA 3DT6A 3PPXA 2G06A 4WLOA 3WDMA 1P5FA 2IS6A 3NIFB 5LA6F 5TR9A 3M82A 2ZU6A 2GJAA 3KETA 4I9FA 5F1YA 1SXQA 3RUDA 3ND9A 4PZ0A 3CEPB 3W0LB 2CT8A 4FUTA 2IUYA 2WTXA 3JQAB 3K0CC 1AH2A 1A5ZA 1M72A 2WF9A 4N6GA 4CR7A 2Q99A 3L1UA 4FGKA 3ZY5A 3HBFA 4TLCA 1PT8A 4MNTA 2RKBA 2EOAA 2IU0A 1JR4A 4LJ5A 1RRPA 2N47A 3C45A 3HDHA 2Q2WA 1EHYA 3SXUB 1DQZA 2BFDB 3OX2A 4JNCA 4X9XA 2VXOA 1B8VA 1Y4DE 3A1WA 4DIMA 4UDYX 2LXNA 3Q12A 1REQA 2PZEA 4PAMA 1UEJA 2V3VA 1HNZB 2PSDA 4KGDA 3THYB 1EFAA 4KN8A 4OB7A 3BWBA 3BQNB 3W6PA 1Z75A 3AW8A 5AHOA 1H2FA 2FDRA 2JFVA 3FDZB 3OQIA 3CQ9A 2BFNA 4A0RA 4LIPD 4FQ8A 1ENZA 2CYCA 2I62A 4OGGA 1RYBA 1EK1A 4YCMA 3H16A 1FS4A 1YAJA 1XALA 2C7BA 1OAOC 3JQQA 3EZ7A 4OH7A 4DCSA 4L5BA 2JRCA 1G1AA 1YE8A 1XL0A 3UUGA 3MERA 1YTUA 3UATA 2PUFA 4Y2PA 1QKJA 1ORIA 1GN8A 1N2EA 1BQ4A 5AJUA 3SDSA 3BBPA 4J3FA 1F1BA 2ST1A 1UKBA 2O0JA 3B9QA 3G3EA 2DY0A 3DBVO 1W5TA 2C3PA 1SUBA 5DHUA 1J0CA 1NBEA 3D54D 3ZY6A 5JY6A 4Y9DA 1JT2A 1SOMA 3G89A 3QYPA 5DT2A 4DMFA 1OHHD 2P40A 4O4HB 1TYCA 2R1VA 3DFFA 4OQXA 4OK3A 3GGDA 1H3EA 4X60A 4JSYA 4F7WA 1QYDA 3L7IA 4UARA 2PU5A 1ZZGA 3UNXA 3WRVA 1H0RA 2W2KB 3OE4A 3QWFA 4QNMA 1DMRA 5D1HA 5EJFA 5CEFA 1K5DA 2YYYA 2O2YA 2ZTSA 1E3LA 1I0IA 4DT1A 3N9IA 2XXAA 3WLIA 4YMLA 2QP9X 1R12A 3HR4A 2IHVA 4LZNA 3GRAA 3VZRA 3AONB 1G9TA 1E0DA 5AI5A 3HDTA 2ZBRA 4U6NA 1N2IA 3V8PA 1OZAA 1LPNA 3A6HA 1J5EB 3EPRA 4G0UA 2WKWA 4RLHA 3WNDA 2H9YA 2LDBA 3O91A 3U3XA 4QVIA 1GT91 3M4XA 4IXMA 1BFDA 4MW9A 1UINA 2EJUA 1L3CA 2YWXA 3QLTA 2QPTA 3QTBA 3BGIA 4ZT2A 3VQTA 2W42A 4G9GA 5CFRA 3HXLA 2ORYA 2Z09A 4KFUA 3S2ZA 4PCAA 1QQAA 1DJOA 2ZUBA 2CB0A 5JSUA 4DR2B 4X97A 1V4NA 4MARA 1YT5A 2QL5A 1ARZA 1YE3A 5AK5A 1ML4A 1T34A 4UDOA 5E6UA 3AF4A 2JLVA 3FE2A 4PZYA 3X1XA 1SPBS 3OA2A 1X9IA 2HBZA 3R41A 4O5OA 5HMLA 4JOQA 4G65A 5AW4A 3B3QA 1XIVA 4GICA 5HM8A 1IEQA 3V8RA 1E94E 2L18A 1CQZA 3G59A 2QL6A 1B8UA 5DCUA 2QLTA 4CF6A 2JZCA 1TVKB 2G71A 1GD1O 4R68A 4QL3A 2QSYA 2WMOB 4MLCA 4PO1A 4UASA 5ALTA 2XYRA 1I30A 3B53X 5KOJB 1ZIPA 4MUMA 3DHWC 2HLDD 4EDHA 1NVWQ 3K9GA 1YNOA 4FCTA 5CT4A 1A1VA 4OA5A 3LWDA 2ZYWX 3FDFA 3K9CA 4O1HA 1UMBB 2AOWA 1OA0A 4J0JA 1D0VA 2F3QA 2ZRLA 4F04A 1N6PA 1CF2O 3D1VA 4ZVUA 3SMVA 2ZETA 3TZCA 1Y5LA 1UOQA 3H9BA 3L8MA 2BFBB 4GI2A 2BBTA 3OQJA 2G1UA 3RIGA 5F7XA 1XZFA 4TWAA 4W9NA 3WYFA 4NI5A 4WINA 5EE3A 5ES3A 4PHTA 3ZJTA 2WHRA 2BMJA 3G8YA 1FLNA 1HKUA 1QCDA 1XVUA 3A06A 3OHMA 4RM3A 4JJEA 4Q7QA 3EX7C 1YDFA 2TSYB 4JBXA 1NG9A 2A5YB 3KB8A 3DCIA 3LMKA 5A4MS 5LU9A 4EY5A 3ADDA 2JB9A 4PG4A 4ZZ2A 1R6TA 3OCVA 5FBVB 3DYVA 2YJGA 5A3SA 1XVVA 1EUQA 3O7WA 4I55A 4OEHA 4DCJA 3TQOA 3P4XA 1Z5GA 5ILQA 3BRWA 1QYIA 1ZFNA 2IYAA 4NTZA 4EBBA 2NO7A 1OXBB 3O8OA 2RHDA 1DUIA 2AR0A 1U9IC 2DPLA 1XA3A 3KAKA 2OO7A 1GM5A 1J70A 2VHUA 1YKSA 1U31A 3LUPA 1LU9A 1Z62A 2WE7A 3SOPA 4H31A 1GUAA 2QRKA 3BB4A 1HZZA 3ELYA 1HG1A 2N3ZA 1I51A 2GD0A 2R1TB 5CM9C 4BX8A 5BVHA 2FFJA 3RQIA 4UCQA 3X1YA 2A3NA 4AZ3A 3SFVA 3A6JA 1I2AA 2N1MA 2PUTA 3KR2A 5DMHA 1VL0A 3KSAC 2QZSA 1XJCA 3SR0A 1IBLB 2I6QA 4ISCA 2A0YA 3UWOA 1PFVA 2C61A 5I9MA 1KH1A 4XVCA 1ZCBA 4OP2A 4MICA 3SPXA 5JS6A 4FGWA 1Z2DA 4AJ9A 4PAQA 2XHEA 3OLVA 4LK3A 4URZR 2HXGA 1Q2XA 3BWMA 5F9MA 2VSYA 1KZGB 3GNTA 5GONA 4ZRDA 4FHEA 3FGPA 4YAUA 3I34X 1D5WA 4EWLA 1BFUA 3VYWA 1YRWA 2TMYA 2O8CB 5C3MA 1UDXA 5DBEX 1P75A 4O2AA 1T9CA 2P7IA 2XWBF 4N7JA 1SXJE 4NCXA 3RHFA 1RXYA 4F9GA 4NS4A 3G6WA 2VCYA 4XEHA 1DLJA 4WDRA 3QU2A 2O3UA 2WD7B 4WIAA 2EL7A 2RARA 2BGMA 1IHPA 3CA8A 1NUTA 1N0UA 1T36B 4RSGA 1P3DA 1O96A 2FR8C 2IEZA 5GQSA 1DEHA 4MPRA 2AA3A 1NXOA 3TLGA 5JWOA 1SXIA 3A31A 3SZLA 4ENPA 1RE1A 3SC6A 4I0WB 1V39A 2W2XA 5JAHA 5GM1A 3LHIA 5GWXA 2WF5A 4I9HA 3M7IA 2QZZA 2B4YA 1TJ5A 3GROA 4Z3KA 1DGQA 3ROFA 4AMUA 1CIVA 2W00A 4NBLA 3T99A 2J3DA 3GDWA 4TYMA 4P22A 2CUZA 2OUKA 5FULA 2IP2A 3E84A 3ENZA 3O1LA 1EFCA 2PGLA 5DIZA 2AMJA 5JCZA 3O5AA 5FLXA 3O8QA 3QKSB 3W5BA 5G53C 1QC5A 4E5NA 3MCZA 3AV0B 3ZHCA 4DR4B 1XZAA 2JFQA 3BIFA 3H0CA 4UBNA 4H3SA 2BKAA 3S0JA 1B8PA 1N3LA 1YDGA 3AEZA 2R5NA 3E15A 1WKCA 3DF9A 3IUBA 4PO8A 4B31A 2X8JB 5IZCC 3QQPA 4LJYA 2X9QA 5H02A 2FG5A 2HNAA 5E7JA 3SJUA 3MGKA 1NLMA 4RF2A 4EITA 2A57A 2PR7A 3D6AA 2DULA 4BU1A 4U0KA 5MN4A 5HIAA 4ZWNA 3TR5A 4IWNA 3FOBA 5BN3A 5BR8B 1NJ5A 3VSEA 1SC3A 4WKCA 4FYPA 2WAMA 1GPDG 1RM0A 1HL3A 1SCAA 3D8TA 3H7IA 4D9KA 4L4SA 4ESOA 5EFOA 1EESA 1BD4A 1S7GA 5I5EA 1QORA 1ID8A 3WHPA 2D5CA 4KRXA 1QRRA 1N2ZA 5FL3A 2IHYA 5CLJA 3ZX4A 1GWNA 5FR1A 3F9CA 3IAXA 2FZCA 3TTXA 1DO0A 3ZK7A 3I5XA 2X8WA 5LQNA 4YCNA 1Y4SA 4PZ9A 3SJAA 2X2EA 3S44A 1I3KA 4NAVA 1DT3A 2HFKA 3OT5A 2A78A 3G5TA 2X76A 2X15A 3EE6A 3QUBA 2XADA 4FOLA 2FPLA 3QLUC 3OT4A 2ZT7A 4HVAA 5KREA 2DT5A 2O0HA 2FN8A 3MS2A 1G2PA 1FFGA 5BT8A 1ZBQA 3DZIA 3R3WA 2O3TA 2VHXA 4N5MA 1FX0B 5FPQA 2FEWB 3KOUA 2PEYA 3NHKA 2L42A 3IP1A 5LLDA 1WU7A 4NARA 3OE7A 4Q15A 1Y4UA 3N3BC 4DIUA 1X19A 2C9MA 4GPBA 5F23A 1QYXA 4TLMB 2PLWA 4IEIA 2B2CA 2Y92A 2QAJA 3PSAA 3RYIB 5BWBA 2IHNA 1DDOA 3PIDA 3AO0B 3LLVA 4FQ7A 4V0OA 5M2QA 2ZYGA 4LV8B 3DDHA 1Z4MA 2W4QA 4LRWA 1T4CB 4HN9A 4OXQA 1VJRA 1E9DA 4YRSA 1UXOA 4QBHA 2CNNA 2SCUA 4FGJA 1F0KA 2QE6A 2COKA 1S2IA 1JU3A 1WBJB 1MC1A 5EJGA 4P92A 4HRXA 1GR1A 2YIJA 3C6KA 2QLLA 4REMA 1Z7EA 1RYYA 1WD5A 4KH0A 1VJ5A 3K5HA 1MO3A 4OBBA 4ZCLA 3V1KA 1AA9A 2WR8A 1VECA 5K3FA 3HS3A 4ZODA 1XZCA 3ZCQA 3ZWWA 2VKQA 1KJZA 3F47A 3QJ5A 4C21A 2I9KA 2B35A 5ILOA 1ISHA 1CLUA 5I4KA 4MW1A 4BPRA 1L7PA 4XM1A 1ADCA 2GH1A 4BVJA 3CUKA 2UUBB 4AS1A 3PA8A 1KOJA 4GE3A 3ND8A 5IRCD 3TD2A 3UOWA 1GZSA 4Y9UA 1N9GB 2XJ9A 2CUNA 4K03A 2QNBA 3QF4B 2J0QA 1P9NA 2C98A 4PR3A 1GVNB 4CT5A 1A4UA 5EIBC 1Z17A 5F21A 2Y1WA 4K2AA 4BZPA 1A7AA 4EFNA 2QM0A 1GQYA 3GLHA 1KZ9A 5K6RA 2XWQA 3F90A 4FLFA 4D9MA 721PA 3DSRA 1QU2A 3TQHA 1AGPA 3AJRA 2BHSA 4QRIA 2E4WA 3CSUA 3WMRA 3AXTA 3GFQA 4JMPA 2W37A 5JMOA 2C20A 2ZPTX 3HNRA 1EK6A 2HCBA 3WWZA 5L3SB 2PCLA 2LRHA 1PYDA 1TJNA 4KBFA 1H5QA 4EI8A 2OQIA 3X1MA 1Z34A 4OY3A 5AM5A 4CEJB 4RJLA 4DLLA 2V4UA 5CLGA 4TSFD 1AQUA 2NV6A 4YHHB 2FPIB 5F9HA 4NMLA 2W6JD 4UMDA 2DETA 4ARCA 4PY2A 5J5AA 1SBZA 1N9KA 1QRAA 4UTOA 1KVTA 4BZWA 4EDFA 4RVCA 4ZC8A 4DBVO 3IBYA 1TU4A 3ZCSA 3W78A 4LHVA 3UGQA 4EG6A 1HETA 1KY2A 4BNKA 5IU6A 3TECE 2FAXA 3AR3A 2NO9A 3BSYA 3VVBA 4C0LA 1Z7YA 2PZGA 4INAA 2NPFA 4U8HA 2F3UA 1C1DA 1G6HA 2E4ZA 2P67A 5DP2A 1Y0BA 4BO5A 3WKCA 4TL8A 1M67A 4RA6B 1K86A 5TT0A 2XHZA 4ARZA 2VNJA 3A7EA 3PDJA 4A26A 4JVLA 4J76A 2PSSA 1E3EA 4UQPA 5LP6B 1UFVA 5CLFA 3HJCA 1AG9A 3O4RA 4EGAA 5CEEA 4MRMA 4TKUB 5EXTA 4IHKA 4L73A 1FLDA 1U8FO 1ZUNB 2V7PA 3HNOA 3K8YA 5ICCA 5EQTA 1CF4A 1ZEMA 3EHDA 1ZITA 1PSWA 4FOOA 3UFXA 3BPSA 1B26A 4NPCA 1N1DA 4BNVA 5KNBH 2JCXA 2FW8A 4OTZA 2J4FA 4ZRMA 2I3BA 2QAIA 5JOQA 1ECFA 1GFIA 5G4KA 5TPZD 4TMZA 2YL2A 1SURA 1QHEA 3HACA 4M1TA 3OMLA 1ZRHA 1ESDA 3I39X 2W6ZA 1AIPA 4TQGA 2WB4A 1E2FA 1R9MA 3X2FA 1U1EA 4AUEA 1IHOA 1OI7A 1X94A 3UUEA 1NR1A 4CN9A 3OLZA 4DSAA 4DLRA 4WACA 1E4EA 1H65A 1OWLA 4DXHA 3OIVA 5KWSA 4AY4A 5F2KA 1TVCA 3MNFA 2NV2B 3JQ8A 2VJYA 4IYRA 3OZ7A 4M83A 1KE2A 5BW5A 2JJYA 1TF2A 1ZM9A 1KVUA 5JJCA 4G8DA 1OB2A 4MUEA 1QG6A 1YCHA 1A5AB 2P2CA 5ER9A 2VPPA 3WDKA 4Z53A 3MJ4A 2GN1A 1XDSA 1NYQA 1T4DA 3PYLA 3A1VA 2FLVA 4OAQA 1U8CB 1MXHA 3QGMA 1EG7A 2Z4TA 3NTXA 1HX7A 4P34A 4UHDA 3GLVA 4E70A 1VHQA 2BYTA 3WK6A 3AGPA 3ZQUA 3HCCA 2ZJ8A 5IK2A 3NHBA 2H7YA 3PICA 3PEWA 3GLRA 3H1AA 3NETA 4B4VA 2KQUA 5DYIA 4BLSA 4AZ0A 1YCGA 2VSQA 1CY1A 4Z86A 4AKSA 4AT1A 4DQLA 2XIQA 3F4KA 3GG2A 4V03A 1L7OA 1XDBA 1HWYA 4KE6A 2WSBA 2R6JA 3DUWA 5DVZA 4BZQA 4ZN6A 1QO0D 4BJ1A 4C88A 4QO8A 3H9CA 4ICIA 2AN1A 4TQ9A 1NBIA 3UYKA 3T54A 1MN6A 5TX7A 2H08A 5THQA 2EBFX 1AUOA 1Z2PX 2OOKA 5JBQA 4DV0B 5JSQA 1PT6A 4ZK2A 1TYBE 1T0UA 1IYZA 1J7KA 5IKXA 5FTWA 3ZGZA 3M1YA 2C7GA 5LP6F 3K30A 1U7XA 4W5OA 1OJLA 4XM0A 1Y8CA 2PKQP 1TVMA 2QW1A 4GD3Q 4UVEA 3WRYC 1O0CA 4DMCA 4Q1BA 3UJ9A 4LJSA 2XOKD 3M4ZA 5EUCA 1W4AA 2BJWA 3L46A 2EFJA 1ZD1A 3V00A 4AMVA 1Y1TA 1R8JA 3UMYA 1S2NA 4M38A 3Q7QA 5FUMA 1G21B 1PWZA 2GF9A 4FE7A 4KXNA 4RELA 2OCLA 3GLIA 3P9YA 2BRUA 1ZYUA 3V9PA 2O0KA 2C7RA 3K9WA 3EEBA 1EZZA 3EIOA 1T1SA 2QX6A 3D7RA 2DBRA 3L93A 3RD5A 1RWOA 3DEAA 1I4OA 3G7UA 1IK6A 4XFJA 4CXMA 2WWVD 4KWHA 3OJOA 2HO5A 1RTKA 1GQSA 2WC1A 4G4SO 4N0PA 4NBKA 1XN4A 4ZC1A 4DEYA 4HH4A 1DBWA 4QHYA 2BFCB 1H2YA 1G3RA 2AEMA 5IBPA 1UMDB 4TZ0A 3WO1A 1PR1A 1U8ZA 3I01M 4TT3A 1XZMA 1NQUA 4Z9YA 1C7FA 5DCYA 1FXWF 5EFZA 5DHPA 2GZDA 4MV9A 1ZD4A 4P81A 2JFBA 2QLBA 1R0YA 2FEKA 3OFSA 4WGGA 4ETMA 1OXUA 2JGLA 1FF9A 5K3SA 4FDTA 4JXKA 1Q1GA 4GFDA 4AL4A 5HXAA 4LTDA 2XOEA 1P7CA 2XI4A 1PJ2A 1EHCA 2DWQA 2WICA 2B8WA 1ZK0A 3LPDA 5FT9A 4KRFA 2ZJFA 4BU0A 4YA6A 2IRWA 2NTJA 3O3NB 4X92A 2ADMA 2AG6A 4IUBS 3TLYA 4HNTA 1SBYA 5A5DA 4UFPA 1S3GA 2JIZA 2P9ZA 1WB5A 2XVMA 4KXVA 5HSGA 2DKFA 1RXVA 4MUBA 1II8B 4GMKA 3SYKA 4DMUB 4PSDA 3ASUA 2V7TA 3L40A 2CWWA 3KT6A 2YRXA 3I6YA 5A6SA 1VSUA 3I6IA 4RK4A 4OSOA 2OGWA 1JB9A 1E6LA 3VOTA 2JH8A 4HCJA 3HWX1 5AK3A 4EY4A 4WBNF 5KU7A 2CHFA 3MAJA 2HJRA 4E5MA 1IDOA 2MR5A 1Y6GA 4EPVA 1K1EA 1XTQA 2Y1LA 1ZGCA 4CM8B 1M2WA 3FYUC 3LSTA 3KYDB 2JAHA 3Q9NA 3NVAA 2BM9A 1SBNE 121PA 2HSGA 3PR3A 4PFKA 2Y66A 1ZK3A 2YV3A 5CXUA 3WY9A 4BAZA 3RAFC 1UOOA 4NYJQ 1YS7A 1L8XA 3IE1A 1DWPA 2EX1A 2P2SA 3ELDA 3RHZA 1GZ5A 4IH9A 4ZYZA 2V9PA 2VXCA 4DJJA 5LOVB 2XCSB 4XGKA 4XVQA 3CXRA 1DAMA 1R66A 4UZSA 4B4UA 4GL2A 2OWEA 1O08A 3KQOA 5CDHA 2G1KA 2XBUA 3PWSA 3P7MA 1PE0A 1RPNA 2GXUA 2A5LA 3HXPA 4GMHA 3NT4A 1IAQA 4L0MA 4QU9A 4G41A 4TRJA 4V0QA 2HQRA 5GP1A 1RS0A 3I05A 5KQMA 4EJSC 3C87A 1XMJA 3GZNA 1IXRC 4KXMA 2R2GA 4OQDA 5J4KA 2VBCA 1GPWB 4WCFA 5KKAA 4DLXA 5IABA 3JWHA 5F35A 2Q1TA 3RG8A 2GZSA 3GEDA 3BRCA 4DZRA 2QHXA 4IRXA 3SF0A 1PWXA 2QRVA 2YHBA 2CE2X 2ZDQA 3VC1A 3RRBA 3ZWDA 2R25B 3DB1A 2BIFA 2HO4A 2QTTA 3P20A 2DFKB 4PQEA 2F8MA 3HJNA 3H5RA 2OFOA 5IAJA 2OHXA 4CG0A 3F97A 2ODPA 1V1RA 2GEFA 1LTQA 3INTA 1J1ZA 3H11B 4MI6A 2DG2A 1X38A 2NZYA 3P2IA 1QIGA 3QFSA 4OHOA 4LFAB 4YAJA 4Q00A 1DX6A 4MB0A 4AF8A 1KK3A 1PLJA 2OB1A 2BBOA 2JFNA 4HWPA 1UFQA 2H1WA 2ZSIA 5JFGA 5HX7A 1RQLA 4S2UA 4CEHB 4ZU3A 1NASA 4IXDA 2WJIA 2XEXA 1GTSA 4YFVA 3E9DA 4WKBA 3NT5A 3M5WA 3WGGA 3KZ1E 4DSNA 1G3UA 3ZDAA 1N5OX 4P83A 4DHEA 2A0WA 2Q5JA 3EG5A 3AEQA 1J09A 1F2TB 1B3BA 2C0QA 5DTQA 1T3LA 3KELA 3MCWA 1G59A 2AE2A 2JDIA 3DZHA 5AVKA 5MFPA 2EWMA 2O4CA 5D6OA 4ES6A 1RMTA 1K3FA 5I9NA 2V9ZA 4DADA 4WBNA 1NM5A 4YMGA 1FQOA 2JFOA 4II7A 5D1NA 1H9AA 4YCSA 2VZLA 2GK7A 1X1SA 3UK1A 2XGMA 4LUCA 2JLBA 4PGGA 4JKIA 5JBIA 3A4LA 4F1WA 2HHLA 1CDZA 5DWVA 2J67A 2C3MA 4JQSA 1JKJA 1L4NA 4WL0A 3BFKA 5HQ3B 4JC5A 3HCBA 4FHDA 2W6QA 5EWLA 5LOVF 2OQRA 3OLQA 4YQZA 4WZAA 3PEUA 5EZSA 3RI3A 4B3XA 1XNQB 5FBKA 4OYHA 1IOWA 2H63A 4LWOA 4OATA 3RASA 3E61A 4L75A 1T6ZA 3ETGA 5BRAA 3CMCO 3WLJA 1MV8A 3I3OA 4IRMA 5CFNA 2QPLA 3OOWA 4JI5B 3UO8B 4JAVC 1JIJA 2R6GA 4AJLA 2OAEA 2BISA 1I2ZA 1CJVC 1RAHA 3AQIA 3OCXA 3VPHA 4NG5A 1J22A 2WSMA 2P9TA 3HFRA 3IT3A 2VC2B 3DEKA 2P91A 3U3KA 2H4ZA 2JEOA 1XTSA 2NU9A 5LN1A 3DHEA 4YDRA 4ZDKA 2YC2C 3C85A 5EJEA 3MXOA 4D79A 2BTQB 2XF2A 1W6UA 3WWOA 1U2GC 2GPWA 3CKYA 2BFFB 2FZKA 3GHYA 3H2IA 3PEEA 3VC7A 4YECA 2ERXA 1H6DA 1IY9A 1T5SA 3ELBA 4C2UA 4LF8B 3OHPA 1E9SA 1J2JA 3C7TA 3UV7A 2I1WA 3EEOA 1L4GA 2X58A 1I24A 2WFLB 4DMLA 4JXJA 3IV9A 4DG5A 3NW9A 3IMEA 2WRZA 3OM9A 1N3IA 2HH9A 3CB2A 2I0FA 2YFYA 3E8XA 4BJHB 5DM2A 4J94A 2CE7A 2JH9A 4BMCA 3LWZA 1WQ4A 5BUZA 4CM9A 2B1GA 4HDRB 4LMPA 5JBNA 3B48A 5ICSA 4BWGA 9ABPA 3IAM6 2FPUA 4K9SA 1RMQA 1X7ZB 1DADA 1MGOA 3HEMA 5FTNA 1QZUA 1BRMA 2FPPB 1G8AA 4TMTA 3KDSE 5J2TF 4RK5A 1DQRA 3UV3A 3SYMA 5BMVB 2C84A 4BNIA 2RGAA 4HGYA 1EWRA 3D6JA 2O5CA 2YN0A 4YXWD 1DCKA 2B6NA 1L5LA 2BZ0A 1JDBC 3SKYA 1J0XO 2AZXA 1SELA 3KS9A 2M1XA 5FUXA 1NW5A 1Q83A 2EWVA 3RVKA 3AP3A 1B74A 4F1KA 5I4IA 4MIOA 3I3SR 3ICOA 5IVPA 1JFRA 4MUFA 3B6MA 4AY2A 3C1OA 1L4FA 1QF9A 3MWGA 5KTSA 2EZ9A 3G8BA 3QWIA 1V0JA 1E5XA 3C2QA 3HFSA 2VRWA 4B9EA 4FIZA 5JAPA 2CMGA 2F8LA 1I4DD 1V8BA 3LDAA 3GVCA 4YP1A 1IOLA 1CRLA 1RQXA 2Q8QA 3G9TA 4HDKB 8ABPA 2I8CA 4Y18A 4KL8S 5TMDA 3AILA 3PTZA 1BMTA 2VTKA 3FVQA 3GEGA 3K5IA 1ORVA 4PRKA 4XKJA 5FNVB 5F2NA 5FF9A 2EC5A 2IV3A 4E12A 5KQRA 3BWCA 2HMYB 4E1AA 3UAZA 2I1LA 3USCS 4P6VF 4LV5B 2P9BA 4B82A 2FPXA 3EGCA 3KOXA 3LWNA 4TWIA 1OAOA 3W05A 5IZ4A 1AUQA 4U7WA 4YJFA 4RZIA 5BYAA 2EGHA 3PXEA 1Z0KA 3ZW7A 1GA6A 1ISPA 2PH3A 3UAYA 3B6EA 2VI5A 1Q74A 2G7ZA 5FOXA 5U4XA 4DWVA 1XRNA 2SHKA 3I6BA 3MBIA 3FDJA 3N87A 3L4SO 4P31A 2R8RA 1RXUA 3FKSD 2Y71A 2HWYA 1ZIDA 5KHAA 2IS4A 2G80A 4Q4JB 3H17A 1J23A 3ZD7A 3H9UA 1U28C 4MWOA 3VPDA 3ANYB 4REQB 3NEJA 3IDOA 3OEEA 1FTSA 5HDBB 3PQ3A 2ODWA 3IEPA 3LYAA 4V3CA 2ES4A 2AI1A 4U0JA 3TIGA 1MABA 3EWIA 4NENA 4GMFA 2AMVA 3PLNA 4WEOA 1UJ5A 3H1BA 1XZNA 4L9AA 4MHOA 4EB8A 4F8YA 3K94A 1T5BA 2CNLA 2H5JA 4GDMA 1I4TD 1PS0A 4QDOA 3NUQA 5C37A 4IFTA 3JQEA 5J63A 3EQ6A 2OYRA 5AWFC 1ABEA 2OCPA 4LPSA 1HTBA 2YYSA 4YJGB 4LJ9A 2Q1SA 4FEYA 2GAFA 2A88A 3DOOA 1OPRA 5ER6A 3MQ2A 1H8ED 4CF4A 1AF4A 3U3JA 1BSVA 4RHFA 4ZAYA 3NOQA 5JSFA 2BE9A 5BMVF 5CCDA 4ZMBA 1NDHA 4W99A 1RR6A 3UG6A 3AOEC 3DVSX 4FW8A 4AKTA 3UM9A 3ZQKA 4DLKA 2PVSA 3A32A 4DYHA 3F6EX 4TYWA 2JK1A 1G8HA 3V4RA 3JX9A 3MWFA 1EGQA 4Q34A 5JAQA 1MH1A 1SWWA 1N4AA 5EJ8A 5J2TA 2ZR9A 4QUDA 4RJIA 2WY2D 2OENG 3M1LA 3ROQA 1CZLA 2INGX 4KAAA 3ZNOA 2UXBB 4ASUA 3CCBA 4TZTA 2HZ7A 1JEAA 1JDSA 2BEWB 4CKWB 2Z9DA 3DWFA 1ZOLA 4Y1RA 3B1YA 4OB8A 4HWOA 5FBZA 4J4TA 2NAPA 4LYGA 3JD1A 1PEAA 1DKPA 3OICA 2EYQA 4BV8A 2J33A 4C20A 1TK9A 3KZCA 2OK7A 3B36A 4UVGA 1GGJA 1LS1A 2BCGY 2PEZA 2XMZA 4LTMA 4ID9A 3E18A 4Q3AA 5FNVF 4E1VA 2OXTA 2F1OA 1MJGA 1ZH6A 4N9WA 4ZYXA 4BXOB 3D6NB 2VFAA 5AHXA 5TGDA 2YWGA 1IC6A 5KYUB 1L4MA 4AQ7A 2NTNA 5HF9A 3ASZA 3EZ6A 3HBJA 1FRNA 1PJAA 3M6XA 1HE8B 1D4AA 1HXHA 2ZPAA 1U0GA 5CBPA 4YBZA 4KXLA 1P9RA 5T41A 2I71A 4GW3A 4KLZA 3K6SB 3QEJA 4BN5A 1SZJG 3E9NA 3LBNA 2ZI5A 2A94A 4Q24A 3ZQ4A 3NVMB 4EQ6A 1U99A 3Q3VA 4M86A 4FUQA 4IXWA 5CG2A 1Q1BA 1GTJ1 3CLUC 3D64A 4OKIA 1BS2A 4O4IB 1R4NA 3R7SA 4YRIA 1KQNA 5KTYA 3MEQA 4KUHA 3O0TA 3FAKA 2CHUA 4KYVA 3VZBA 4MVJP 3VO2A 2XMGA 4XARA 3WLQA 4E15A 1QM5A 2IYRA 3KYCA 3L6DA 5EZYB 4E1BA 5HGXA 5HTOA 5DXJA 1VCNA 1PL0A 1MRSA 3FZGA 3OU7A 3FCCA 3ZTTA 4DSTA 1OASA 3HXMA 1U3VA 4DA9A 4KR9A 1Q1EA 4RTLA 1THMA 3LE8A 2JVIA 3V3TA 1J1IA 1JH8A 2F6RA 1LVGA 3HU3A 4JWTA 4RV4A 1PUJA 1NMZA 1O58A 3ILSA 3X1KA 1IQPA 1DRKA 1Q57A 3GDOA 3O9ZA 4P4GA 2VDUE 1GG2A 4ZALA 1U9IA 5C5DA 3TCKA 2ETVA 2ZTMA 2FQXA 4G85A 2B9EA 4LVCA 4RJTA 3EF0A 4G63A 3IUEA 3E2IA 3MOIA 4KZKA 3TVDA 1DO2A 1N0VC 4H16A 1K97A 5CLHA 1XCBA 5GTDA 4XE5A 5AYVA 3DBRB 2CXXA 3DZBA 4TLAA 3L6OO 3CW2A 1V8DA 4ZVPA 3TKYA 5FD8A 1YONA 1VHJA 3MUEA 3ZGXA 4B3MB 4BFSA 1G6KA 5EE0A 1YOVA 2OM6A 2V5VA 4OBXA 3UIEA 2E3JA 1CY8A 1E9RA 2P3QA 2QM7A 2RK6A 4OGLA 3CF6R 4X8OA 2XTJA 5LKAA 3C14C 5AVZA 1FFCA 1PFWA 2FR1A 2JGDA 1E9AA 1QHFA 1SVKA 3JATB 3Q4GA 4OF4A 3PGVA 3OWHA 4OFWA 2OORA 1I3NA 2NO1A 4M0KA 4UDNA 1Z7WA 5AM2A 3VHRA 4WV3A 1RPAA 3BG5A 2YJ3A 4G0QA 2WSIA 2IX3A 1P18A 3P2JA 3WA7A 5E1BA 2YX1A 2A84A 3ZS8A 2IGTA 2WSSA 4IMRA 4S1NA 1U63A 2AQHA 4BE9A 2C2OA 3AUTA 4GBGA 4E3ZA 4GSKA 5ESWA 3UXHA 4QGSA 2X0EA 2BT4A 5B58C 4NU5A 4LKOA 1J99A 3EZFA 4IDDA 1PQYA 5F1PA 3HVRA 1GL6A 1X7HA 2XWSA 1SKMA 2ZUEA 3N2IA 1MOPA 2AYYA 3II6X 2BKXA 1CR6A 1J2RA 1KI6A 3KR0A 2G82A 3EDYA 2ZIVB 4O4IF 1X87A 3A4YA 3OMWA 2UZ0A 4O4JF 3B89A 4PBTA 3QPUA 2POCA 3UHAA 3G0DA 3TEMA 2O2DA 3PJDA 4E2WA 1VIAA 1KY4A 1P0FA 3JQ7A 1CFJA 1NVVR 5EUMA 1ZC4A 3PFBA 1K4MA 3GVIA 3IQWA 2IF0A 1X7YA 3QJGA 3KEQA 1P19A 1N7JA 3PG5A 4J2HA 4BX2A 1GADO 2C2BA 1ONSA 2NUPB 2WYUA 5AK0A 1HFWA 3AL2A 4ZPJA 1IY0A 1U8EA 3IS3A 3QVTA 4PLGA 5IX8A 5IZCA 1F5NA 3AR9A 1G8GA 1KVRA 2DAPA 1HK7A 2A1UA 4J90A 1FDSA 2R8EA 5H3LA 3H2YA 3U2QA 1UM9B 5I48A 1IBMB 1G8PA 1M1XB 2XGOA 3V4ZA 3HKCB 3OZVA 5BNTA 4KO3S 1Y7PA 3TE6A 1VMAA 3UB4A 4Q9IA 2Y0EA 4QIHA 1PZGA 3LGXA 4F84A 2ZBUA 2CVQA 4RZ3A 3KSZO 1FP4A 1PT7A 1SBTA 2OECA 3K0AB 3MILA 4RV9A 3A14A 3JW8A 4MQFB 2JKZA 1WAMA 4F4UA 5IULC 5GJWC 5CB0A 3PC8C 1D2GA 1T2DA 3SU8A 4JODA 1SG9A 4MUIA 3QLVA 3NMUF 4FDAA 4EL0A 4Q21A 3D6VA 3TMAA 3RU3A 2I3ZA 3UPTA 1H2XA 3HUTA 3LZDA 2AXPA 2W2NA 2W90A 3ZGLA 1ODKA 1JFTA 4CLHA 2JARA 3DEZA 2GK4A 821PA 4IDEA 1HF3A 2MSDB 3ETHA 1XJ0A 1KP2A 1TJ3A 2ZRKA 2LWIA 3OZDA 2ETXA 2R7KA 1AQLA 2ZYUX 4CLRA 3O4VA 3GMSA 4ZXFA 5IDVA 3MTDA 5T4EA 1BAPA 4RY2A 1PGPA 2P8JA 4ANFA 4IDFA 1ZGAA 1CB7A 4MJ3A 1R6UA 2D1FA 3KZMA 2AR9A 2PAAA 2GPSA 3P9IA 3FOCA 2VVTA 5EPUA 3WQRA 3EW7A 4FDVA 1PQWA 1HY3A 2J9FA 3AU8A 2PL3A 4KP7A 3D4IA 5CVCA 4EPYA 4RW0A 3AGQA 4DJ5X 1U2DC 4J07A 2Q6VA 4W63A 2JI6A 4ECAA 4JGIA 3M3HA 3ISJA 3TMKA 1O7JA 2EWWA 2ZDGA 3LT4A 1UT8A 4M88A 4B71A 2AN3A 3KJFA 2OC4A 1M0SA 1VIDA 2YR0A 4C1NA 2GCOA 2IS1A 1E96A 3G23A 2WNIA 3V4VB 4BGUA 5JRJA 2OG1A 3S68A 2DTDA 1F2UA 1JR3E 1IXSB 1FSFA 5BOVA 1HMYA 1JDUA 4QSHA 2F9LA 3FNRA 1GPMA 1M34E 1J9ZA 3F7NA 1LK5A 1YNSA 3OIGA 3OZCA 1ZJ4A 1T2CA 5CVUA 3RSHA 1K7CA 3WJ7A 3GP8A 4TZ6A 3DD1A 2G9UA 2UZ3A 3T0GA 2GT1A 4CR6A 5IBCA 2XODA 1YFLA 2H1OA 3OZXA 4JZYA 4RA9B 4O2BB 1TT5B 2GKOA 1PTKA 3C7CB 4CKBA 3I72A 1YHNA 2NNWB 4U9IS 1R0CA 3CU5A 2PKCA 5K8CA 4UHEA 1G18A 1SIUA 4N6NA 1TF5A 1AMNA 3ZVRA 4DR7B 1CY6A 4WBXC 4R2WA 1UBHS 2P3OA 4TGLA 5EE9A 3CLRC 1PL6A 5CAEB 1E2UA 1ZR2A 3T3PB 1K6IA 3AF1A 1FJGB 5KYVA 4RVNA 1GSIA 4NFLA 1I4EB 1C7IA 2WPDD 3N8NA 3Q3JB 4C5BA 2QROA 3ZI7A 4C43A 3TI7A 3L84A 2XB4A 5KVCA 1CHNA 1KBZA 1LSUA 4QUKA 4B32A 5BORA 1HYBA 3U6BA 2B5WA 2HA7A 1XMOB 1U7ZA 1B7GO 1V5GA 4IDCA 3U31A 3DZJA 1PZXA 4FVTA 4QU5A 3IVCA 1GP2A 3PUXA 1FP6A 2VOJA 3R4VA 2H1RA 5IJXA 6AT1A 4KTTE 4Q0MA 1GYRA 1MAWA 4GPIB 4POAA 5JZMA 5H9WA 1OXVA 2XY4A 1ZHOA 2BR5A 1K0FA 3C74A 1KKUA 2PT5A 1UK7A 3VU9B 1G20B 1L7MA 1UWLA 1YGPA 2PBFA 4GX0A 1NFRA 4U7TB 1DPFA 3I37X 1DDGA 1MAVA 1AF7A 2AG5A 4AO8A 2PZKA 4QYTA 4DB4A 5DN6A 2Q3CA 2G9ZA 2JJ2A 5LSAA 3HA2A 3HWSA 4CW7A 3ETNA 3GNSA 4DY4A 4AFNA 3RJTA 1D3AA 4U6QA 4Y2JA 3RABA 2VSOA 2GETA 3QA3E 3QPBA 4W5NA 3PQEA 3AV3A 3LL4A 5F7OA 1V7PC 2RHJA 5JECA 1T91A 1KI2A 2F1KA 2HZBA 2ZIXB 3U5TA 4G01B 3L8GA 4UE3S 1KSHA 2XUOA 1CUHA 1V8ZA 3KUCA 1FFAA 1FUYB 1TFRA 4WMLA 5FEMA 1P33A 2VNSA 3UMJA 3V2UA 5L7YA 3HUUA 3R24A 4J1TC 4M1QA 4PTLA 2H16A 4P8RA 1K4YA 2ECQA 4OI1A 3ANNA 4CG3A 3GEMA 1TRHA 5KPDA 2XUHA 3EXFA 5A0TA 4OJYA 3TRFA 4D9FA 2BBWA 3SHWA 2PAFA 3WWPA 3UK6A 1FUUA 4EJSB 4K9DA 4KBGA 2V6BA 1A0OA 1AGNA 2H5LA 3AYXB 2PKRA 3H5OA 3IJ5A 5AOCA 1LDEA 4TV8F 1NE2A 2QMYA 4BFVA 4EKYA 2IJGX 1HNNA 1QRUA 1XVTA 3FUUA 1OXMA 4B4WA 1PRYA 1J6UA 2Y1CA 1MFPA 2W6CX 2YWFA 1SVNA 5BWOA 1II9A 4GU5A 2FJ0A 4PZEA 3V1LA 4CCYA 3GUYA 4EQZA 3PFKA 3Q0TA 2APJA 3D2CA 3WV4A 1CIPA 4HYEA 4O2BF 3CLSC 2VSFA 3IBFA 1KYQA 4V0LA 3T5AA 3LVBA 3CR8A 5K0LA 4CMEC 1NY6A 3M6WA 4YR9A 1TO2E 2BZSA 4WXPA 2YOFA 4M54A 3K32A 3AZPA 2DR2A 3G5MA 2G8LA 4YMVA 1R4MA 1MQAA 2JCGA 3V4FA 1UDWA 3R9KA 5JADA 3DQQA 4Y6OA 4R1MA 3OP1A 1JJ7A 1UFOA 1FFEA 3S8MA 1ULBA 3U3ZA 5JXIA 1T0PA 3B78A 4KE8A 3HRHA 4NKRA 5CIWA 4BQFA 2NTEA 4UCFA 2X9NA 4D5EA 4UMEA 1DC6A 4I6JA 1OKKA 5FOUA 1WQ3A 2Y3IA 4NBVA 3IURA 1PEDA 1MB9A 3G5UA 4BRSA 2WU8A 3RYTC 4B4DA 5HRAA 2IBTA 1C4KA 1N3BA 2RHMA 3RSOA 3IUQA 5EZ5A 1YQWA 5BPHA 4DANA 5HIJA 1TW3A 1NT2A 2C59A 2VSNA 1PR4A 2OV4A 4PZPA 5KNCH 1BDBA 1G8MA 3DL2A 3I4LA 4WCDA 1O5OA 3GGSA 2Q4DA 2XCIA 3U19A 1W1IA 1PK9A 1MC8A 2CEKA 2QRJA 4PGAA 4V2UA 3L4BC 1EG2A 3RK4A 1ZNWA 3LH5A 4IPTA 3OUUA 3LKZA 1MB4A 3ENWA 2GF2A 2RGEA 4WLFA 1E5TA 3WNVA 3GUVA 1DIAA 3C43A 5CFQA 4GI3A 4HDNB 1OLSB 3OZFA 4ID3A 2FE4A 2HYIC 4GSYA 1HLFA 2O2CA 3FB4A 3QXSA 2HBRA 2IUSA 2XWPA 2ZXFA 1FEZA 3D8RA 4KQFA 2VUIB 4YMWA 1M66A 2UDPA 2YMPA 4F1JA 5B7QA 5JCOA 3EGXA 4L6AA 2Q7DA 4BLVA 4CU2A 3X1JA 1DQSA 2HHAA 4QYIA 1CE8B 4H3HB 2YJTD 5LIPA 1Q95A 2VTBA 4KXYA 3WRYA 4L4RA 4TWBA 1NLZA 1YXMA 5CB6A 3W3AH 1ZOSA 4U00A 1UKEA 2IPXA 4AQYB 2AFHB 4RKYA 1YQXA 2HW8A 3HMQA 4H35A 3R3ZA 1JIKA 2EYUA 2WM8A 1UBTS 2TMDA 1T35A 3A6EA 3N1UA 5DSTA 3RC2A 3TW8A 3ZX5A 5BWCA 2P1ZA 2ISCA 1OZGA 2VTEA 4DN6A 2REOA 4UM5A 2D2FA 3EMDA 1G4HA 2XJ4A 1DTSA 4TV8A 3EFEA 3COJA 4DRZA 3CPEA 1U3DA 3KCNA 4BFTA 1IJEA 1CUZA 1HG0A 1RAIA 3BHJA 4GUDA 4F2PA 5DEOA 1EWVA 4X65B 5LP1A 4PX9A 5HZHA 1KI4A 1P60A 3K0EA 3Q41A 4XCXA 3RRMA 3EGDB 4MYCA 1VG8A 3UJAA 1FU7A 5C8VA 4K81B 3SX4A 4DLWA 1Q0TA 2CDAA 1C1XB 1LPPA 2O05A 4ON9A 2HGZA 4ZJZA 3SC2A 2GO7A 4XDHA 4F5ZA 5ALIA 5CM8B 3SFTA 1U6KA 2FFBA 2RB4A 4IVQA 4ZJPA 4FWTA 3IP7A 3TMYA 5B2EA 4CYMA 5C7IO 5EESA 1SUSA 3CN9A 1R2QA 2WWTA 3EVEA 3R5HA 4QNRA 2P2GA 4LZOA 1N7IA 4MVWA 2PS1A 1YULA 4WWHA 4YVFA 4G5HA 5KKCA 4CRWB 2ZCUA 2OP1A 4D8WA 2H1SA 1ICEA 4H7JA 4GC5A 3A05A 2FFQA 4YQFA 4UNQA 3PNSA 2Q0HA 3WICA 1MOQA 2D7CA 4CM4A 4S1OA 1SN7A 5DIFA 1IOZA 4I9GA 1NVBA 4NZMA 5FFNA 5AJZA 3B70A 2WDPA 2XEDA 3UTCA 1BYUA 1YUMA 3D7SA 2HWXA 3IQZA 3EARA 4C4TA 3URMA 1UXKA 4X1KA 3VDMA 2JGKA 3CNNA 3PLRA 2J0UB 3R3JA 3GCZA 1SR8A 1RHQA 4KWIA 3DOJA 4KACA 4JXXA 2PZBA 3KJZA 2YRWA 2O1XA 2ZJ0A 2FTKE 1T9KA 3D6FA 4FMCB 2YHIB 4EBFA 5BWLA 2HF9A 2HFJA 2Z8ZA 2IYNA 3P0RA 4KLCA 1VDMA 1SQ0A 4GEKA 5DM0A 5HKKA 6NULA 1SM4A 3EK2A 3LBAA 1HSZA 2H52A 1OFTA 2GPAA 2ZG6A 3CRMA 1W48A 4LX0A 1SU7A 4RAQA 5EL0A 3S2UA 1ZN8A 3B7PA 3LO8A 1N78A 5I6DA 1XN1A 4B7ZA 4BEJA 3PZRA 3MCUA 3DBIA 4PNZA 3JASB 3T4EA 1XZ8A 3N2KB 1ZXXA 1C14A 5KNCA 10MHA 3EDCA 1DC4A 3V4LA 3PFCA 5BV1A 5BYKA 1Z29A 3V8QA 1JF8A 3HO1A 5IXSA 3KZOA 4C7XA 3B85A 3CF4A 3GLTA 2DEUA 4XYBA 5JDCC 3TTUA 2FW7A 1RQRA 2EDAA 1SHZA 3A7DA 3LLSA 4PFQA 4GS5A 4JP2A 3T7SA 2RONA 2F62A 1VP3A 4MGEA 4EAQA 2PXXA 3KJXA 3W2FA 4MA4A 1H3FA 1H69A 4CU5A 2MWMA 2I87A 4UXJA 2GOYA 4BCDA 1BH2A 3HY4A 1VCHA 2ZBGA 2AOTA 1M1YA 4QXRA 3OEHD 1GV0A 4IWXA 3PHJA 4J6FA 1MB3A 1PSZA 2GZ2A 2FRVA 5L7TA 3W3AA 4BEBA 4F60A 2DTXA 1J20A 2JBHA 2WJGA 4QRDA 4B6SA 1YHYA 4QBKA 3CH6A 1CP2A 1Y5MA 3WV5A 1N1GA 1KAEA 3BWXA 4WEQA 4MR9B 1ORHA 4NZPA 4YJ3B 2AMLA 2ZWPA 3I9V6 1PR2A 3Q1KA 3BJIC 1I0ZA 1DTWA 3A3OA 1EH5A 3TR0A 2W6ID 4B87A 1XPRA 4MYUA 1C9DB 1P2BA 1PBNA 4DC0A 4XR9A 1V7QA 2YC4C 4UVHA 3E2MA 1KC3A 2OFFA 1NN5A 2H0AA 3FOEC 4P7JA 4PN3A 4ZZIA 2V3WA 5GZ1A 1SHKA 2D7DA 4NC9A 3CUUA 2YW9A 3KLOA 4HLQB 2BWJA 1AV7A 1H2RS 4HJXA 1KSFX 2OGSA 2R44A 1HURA 3KJHA 1J2YA 3B1WA 3BFPA 1RYFA 1HE1C 1WLSA 1DAPA 2VPXA 3K09C 4HFNA 5AIAA 2R5WA 2PRIA 1UK9A 4G37A 2CN1A 2FN4A 5JCXA 1M1UA 2NQ8A 4PRLA 3UT5A 1RFLA 3W4JA 3ZHUA 1XQVA 1F2DA 3QVVA 3UTDA 2XCOA 4JI2B 4I6EA 3KXIA 3UJDA 1JG3A 3W9UA 3AC0A 4E5UA 5A4KA 3MK31 4FFMA 4TTJA 5KYYB 2D6FA 1OGYA 4HAZA 5I7HA 4D2IA 4V1CB 2PWYA 3OTWA 4DG9A 1GXSA 3CEAA 3SMQA 2Z2KA 5SZKB 2REQA 4AY5A 4IJ5A 2JAWA 3PXAA 3H1PA 2CXRA 4Q9AA 1SNYA 3EXEA 1RMYA 5KSOA 1U5BB 4WECA 3ZYZA 1NN1A 1TKRA 3GEIA 1CHDA 4Q47A 5BN1A 1O0BA 2GA8A 2C4HA 4S2EA 2FDCA 2O07A 5IAKA 1RXIA 1XCGB 4X63A 5CH8A 3GFFA 1W85B 2AFIB 2FSVA 3PGLA 4B84A 4FNMA 4UREA 5E4JA 4Z7OB 1JIUA 1LBQA 1XJWA 4OD0A 1A9TA 5KMGB 4G2NA 2PFGA 1VA5A 1XZGA 4YJHB 5ECGC 4NONA 1XAHA 1DXQA 1HYQA 1ZO8A 3BHNA 4G8BA 4HD8A 4J0KA 5E6RB 5G41A 2DWPA 2GJSA 1V43A 2CSUA 5FFFA 1GA4A 2DPYA 3VNBA 1RLUA 2OLEA 1PGQA 4QGHA 5FORA 4ZKEA 1FMFA 3DAYA 1NIPA 1YBVA 4E07A 5TIIA 1DU4A 2PD3A 1G66A 2WHEA 3VI4B 3SQWA 2O59A 5FOQA 1JG4A 4DDKA 5IH7A 4J43A 4K2HA 5ITVA 3OPVA 3FNFA 4IJKA 5B37A 4PBSA 2I03A 3SVLA 3L7NA 1PV4A 4YX9A 2O8BA 4G1BA 4H4DA 4Y9RA 3BIWA 1RI2A 3IULA 3KJNA 1WB4A 3NAZA 4WZBB 4Y2TA 3W5DA 3O94A 1ZH2A 3ADPA 1VFPA 3AR7A 1EA7A 2H3EA 1BX3A 1N5DA 3AHIA 1T3TA 3GJ3A 4LJ6A 4AN1A 5HUQA 1CB0A 1MNAA 1Z6YA 2GI4A 3P5SA 3U81A 1NRIA 5TJHA 2X77A 1XTTA 4G4GA 4M9CA 3TSWA 4ARVA 3RC9A 1GL9B 2QGZA 2JK0A 2A6PA 4W7HA 1DKRA 1MJ5A 4R81A 1K7XB 2R6CA 1GRCA 2JLCA 4BKRA 1ECLA 3NHMA 2AXQA 1OBFO 2NO6A 4C05A 2ZSHA 2YZMA 5TQ2B 2ZU0C 4GQIA 3CF4G 2JHAA 2HB6A 3KJQA 4PG6A 4ZXPA 4AECA 5FTJA 5T6BA 3ZVLA 5K03A 3OQPA 1G2QA 4X0EA 2HJSA 1ILWA 2G8NA 2PYIA 2XLCA 4K40A 5I7EA 4OLJA 1TMGE 2NU7A 1BKYA 3KOMA 2NUTB 2PVPA 4FFWA 2R8OA 3IJEB 4D43A 1I2MA 2GYWA 4UUBA 1XTBA 1CR1A 2NSDA 1NUPA 2Q49A 1YRLA 3KEFA 3TLEA 1QRTA 3IESA 1FUIA 3IB3A 1US8A 3RS3A 3FNGA 2ZSUA 4ZKDA 3VNQA 4AP6A 3ZLVA 2QI9C 4LDJA 4JUBA 4I3HA 3TLJA 1G6Q1 4G0PA 2UVPB 1EVZA 1EAMA 4ND8A 2Q3FA 2I65A 2IHBA 1ZLYA 4IIGA 1XB2A 4ZCSA 3VPCA 2W2KA 3I52A 3EZXA 3U4MA 2OHVA 2QT1A 3TCXB 3DJFA 3HR7A 3LUKA 4UEJA 3WA6A 4DR6B 2LP4Y 4ZREA 5JQGF 1L9XA 4UNIA 5LLTA 1OYWA 2ZIZA 1JALA 3HV0A 4D4GA 4QYXA 1VPWA 5A9SB 4FYWA 1XZDA 4JVSB 3BWEA 1V1MB 1GRQA 3AESB 3TQRA 4C7JA 5C5IA 1MH9A 1XQWA 3WIVA 1QB7A 1EXMA 2R1UA 2VDVE 3GJYA 4HAXA 2GBLA 4QDZA 4RJJA 3ZDYB 3I12A 4DMKA 5FBLB 4DWJA 4D3SA 2ZT5A 1JFVA 1Z3IX 4ALJA 3JRWA 3RVMA 4EK9A 2HHJA 4ENVA 2ORIA 1L7QA 3AI2A 2QD4A 1XZQA 1PD1A 4N0DA 4R2HA 4M1OA 3UYLA 3VR4H 2JKYA 3WLPA 5DYWA 1CUAA 3GBPA 3ER8A 4ZHSA 3C1TA 3FBGA 2HLNA 4CV1A 3FHOA 3LAWA 4C3UA 3R9XA 4ITRC 1PJ8A 5IAAA 1Z5VA 1ZOOA 2O6LA 4AO7A 1T5IA 3B5JA 4RXMA 1IY1A 1PTJA 1Z6GA 1IN6A 3K71B 4DMMA 4IO0A 5ULLA 4CKCA 4XIIA 2XD9A 2JLSA 4N3NA 2YOHA 3ANMA 3QVSA 5K3CA 3K70D 4Y6QA 2JIRA 2CC2A 4D98A 2P75A 2QTAA 4EVSA 3D5EA 1MIOB 1KPGA 1W25A 1W7AA 4FNGA 4PF1A 3U4GA 4BWYA 4N41A 1XA0A 2PV0A 5IXYA 1TVKA 3QELB 3GLGB 1KRHA 1XEAA 4LK2A 1QPBA 3SF8B 2OUIA 5DO9A 4OQZA 4MGZR 3OFND 3DXZA 2FUKA 1AKQA 3N8GA 3OLXA 3PDWA 4WY2A 3A1NA 4HYTA 5C1DA 1C0IA 1DZIA 5GAJA 5AKZA 4GXTA 1TC1A 1M8JA 2MSEB 3AJEA 1JVSA 4KQ6A 1PSDA 3Q5EA 3WHIA 2AH5A 7YASA 4YY3B 4EHNA 1GZ4A 1HLGA 1WA5A 3ESQA 4L5YA 4UATA 4X6XA 5CDUA 3E3OA 4IJ6A 1XTRA 2PG3A 1XPJA 3TRIA 1FNCA 4HQRA 3HVKA 3D7KA 3Q10A 4JJ7A 3CTPA 3QMWA 4YCAA 4IHJF 5AESA 1SCJA 4EHKA 1C30B 5CT8A 3FOFC 3OZBA 5CR9A 2VP6A 2D1SA 3LBIA 4N82A 1FYWA 1QDLB 2HTFA 3JPWA 5CCEA 4CM1A 4E31A 3UXMA 2B8EA 1WPQA 3K5WA 2EFEB 2BEJA 3TW6A 4CIBA 5CCXA 3PD0A 2BUBA 3MWEB 1UBNA 2V7GA 3D7MA 4JQOA 5E9AA 1A97A 2JFYA 3RIXA 2PSFA 4QUGA 4IJMA 3IT0A 4Y7DA 1FS6A 2FW1A 2OFPA 3EVZA 4HMPA 4V0ME 3QXHA 3I23A 1ODSA 2XYQA 1DKQA 2ZAYA 3FUVA 3VPSA 2NXJA 4FR5A 1UZAA 3DTNA 5JQGA 4G0XA 2OLKA 3N75A 3DC2A 1PHRA 3IRUA 5ADWA 2WFZA 4K9KA 5GPBA 3WBBA 4E03A 4YGYA 3P4UA 4DDTA 1BXZA 3DMNA 4K9QA 2X86A 3T52A 3SDZA 5EOVA 2PV7A 1EUDB 2IKQA 3FI9A 5AJTA 1TQ8A 3OQ6A 4Q18A 4MVJI 1ECCA 2DC1A 4MR7B 2LDXA 1UDCA 1TCCA 3UGJA 3KYJB 2YRFA 2BGKA 1JU4A 4JUFA 3HVJA 4W5HA 4Q5IA 3PT5A 4JYZA 3T0FA 1Z4OA 2R86A 2ZRQA 3GCXA 3FWKA 2HCTA 4J16A 3GFBA 4JEMA 2C9YA 3WYBA 4JU9A 1E6MA 4RIEA 1VHLA 3MZ0A 3S1AA 1E2JA 3RBVA 3NDPA 3SZMA 2QKYA 2R6HA 2I7DA 4PQFA 3I30X 2SBTA 1P6UA 3K1AA 4A8JC 1J25A 1YVDA 2P5SA 2XUZA 4X6UA 2NGRA 2JI9A 4D26A 1KEEA 1BH6A 3Q88A 2OCIA 3ZGYA 1OJ7A 3U13A 1G41A 3IKVA 2WD7A 3BIXA 3DBLB 3G9ZA 3H97A 3VR4A 4HUQA 1O9GA 4JI3B 2D0OB 1QHYA 2DUMA 4G5XA 4ZI5A 4P0TA 4LYHA 1VJ0A 4KWEA 3MXTA 2XT9A 3KALA 1WZCA 1N5LA 5JYBA 4NJOA 3G2LA 5DT9A 2AFVA 4V0KA 5F3RA 1EDDA 4K87A 1XROA 5FA8A 3HVIA 4URFA 3TUZC 3FR7A 4B3SB 3E7XA 1DAFA 1V11A 3DMPA 2GNPA 4HAIA 1KU6A 4JEHA 4TUYA 3VHLB 3L7OA 3P0FA 3RUFA 4Z9XA 1M1NB 1TM1E 4RZQA 5L53A