3IT1A

Crystal structure francisella tularensis histidine acid phosphatase complexed with l(+)-tartrate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
328
Chain Sequence
SKLIFVSMITRHGDRAPFANIENANYSWGTELSELTPIGMNQEYNLGLQLRKRYIDKFGLLPEHYVDQSIYVLSSHTNRTVVSAQSLLMGLYPAGTGPLIDGDPAIKDRFQPIPIMTLSADSRLIQFPYEQYLAVLKKYVYNSPEWQNKTKEAAPNFAKWQQILGNRISGLNDVITVGDVLIVAQAHGKPLPKGLSQEDADQIIALTDWGLAQQFKSQKVSYIMGGKLTNRMIEDLNNAVNGKSKYKMTYYSGHDLTLLEVMGTLGVPLDTAPGYASNLEMELYKDGDIYTVKLRYNGKYVKLPIMDKNNSCSLDALNKYMQSINEKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the histidine acid phosphatase from Francisella tularensis provide insight into substrate recognition.
pubmed doi rcsb
source organism Francisella tularensis subsp. holarctica
molecule tags Hydrolase
molecule keywords Acid phosphatase
total genus 112
structure length 328
sequence length 329
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2009-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3it1A00
5CX4A 2H4ZA 3GP3A 1DKMA 2DWPA 2IKQA 1UJBA 4FDUA 1RPTA 3BIFA 4D4MA 2WNHA 4IJ6A 5CU7A 4PGMA 3MXOA 1FZTA 1BQ3A 1E58A 1XQ9A 1YJXA 2WU0A 2P75A 1DKQA 1H2EA 1DKLA 2EKBA 3D8HA 2YN2A 2AXNA 2P77A 3LL4A 2HHJA 5AJXA 3R7AA 4GPIB 4IJ5A 4PZAA 3F3KA 1ND5A 1QHFA 3NFYA 4MA4A 5AJWA 2P2YA 5CDHA 5AJVB 3O0TA 2OWDA 2H52A 1SK8A 2QNIA 3HJGA 2EOAA 4D4LA 2P30A 3QPVA 4EMBA 1BQ4A 2YN0A 1SKAA 3QPUA 1DKOA 4D4JA 3K4QA 4ODIA 2DWOA 2RFLA 2P6OA 5HR5A 2P78A 4E3WA 2HIAA 1C81A 2P6MA 3GP5A 2P2ZA 1IHPA 2BIFA 4PZ9A 4GPZA 3E9EA 1BIFA 4EO9A 3E9DA 4TSRA 1SKBA 3F2IA 3FDZA 1DKNA 1RIIA 1QWOA 3KKKA 5AJZA 1V37A 4JOBA 3D4IA 3LG2A 4ARSA 1FBTA 2P9FA 3FDZB 5PGMA 3IT1A 2P79A 3K4PA 3OI7A 2HPAA 2H0QA 1E59A 1C80A 4FDTA 1ND6A 2P9YA 2H4XA 1CVIA 4D4KA 3E9CA 2I1VB 1TIPA 4HBZA 3IT3A 2EKZA 3IT2A 1H2FA 3ZHCA 3GW8A 5AJYA 5HTKA 2P9ZA 1C7ZA 3DCYA 2OWEA 1UJCA 4ARUA 4ARVA 3MBKA 5AK0A 3NTLA 3FJYA 2WNIA 4AROA 3PGMA 3C7TA 3QPWA 3IT0A 1EBBA 3EOZA 1YFKA 3EZNA 3D6AA 1V7QA 2F90A 3DB1A 2ENUA 1NT4A 1T8PA 2PA0A 1DKPA 2GFIA 2A6PA 1RPAA 4QIHA 1QFXA 1SK9A 1K6MA 3LNTA 4JOCA 2ENWA 4JODA 2A9JA
chains in the Genus database with same CATH superfamily
4EENA 1ECBA 3KSZO 4ZOQI 3EY4A 2XUDA 1X7YB 4IW3B 5K0LA 1RRPA 3R6LA 1VJGA 2WSIA 2A9RA 1TUIA 1KBZA 4CM9A 2IBSA 2AD1A 1Y4ZA 1XQ9A 1BU5A 4XQCA 5CK4A 1EDDA 2V7PA 1G3MA 3SC6A 1WV0A 2OBBA 2I54A 2XX3A 2OV8A 3K9WA 5DX8A 5IT5A 5FBKA 3GRKA 3AG5A 4M9ZA 1TJ4A 4DLXA 1E3TA 4XD7A 2QGZA 4TLCA 4LBVA 4ZDIA 4A2PA 2G36A 4UUBA 2EC5A 1V8BA 5G1NA 5BXQC 2IIVA 4O4HB 1P3JA 1LQUA 2FR0A 1UKVY 2WIKA 4NZNA 3IIJA 4QU5A 1RPJA 5LJLA 3V32A 3LSTA 4R51A 2AR0A 1Y3BE 4I55B 4M1TA 5JVDF 1GNTA 3A6DA 4EUHA 3QBTA 1E8NA 5JYEA 1IBKB 4YDSA 3M82A 4QG7A 3OLZA 2GMWA 4C89A 1KSGA 3B1XA 5ALGA 4H1VA 2XMZA 1OLXA 2XBUA 4P4TA 4EB0A 1N3YA 4JBWA 4CBVA 4MQ5A 1KVRA 5E2AA 2CZCA 5FYDA 2VDPB 2J46A 1K4MA 1YQTA 4QOGA 4BJ5A 2HW8A 3GXOA 3WLTA 3A0RB 1PDOA 4TMTA 3R76A 3KJIA 5KVCA 4DLRA 5KX5A 1GWNA 4IJWA 4C4SA 2AWOA 5COBA 4X95A 1TAHA 1BXZA 2B83A 4ZT2A 1L5YA 2CHEA 4OAOA 4ZVOA 4JI8B 3FNQA 2W2TA 3T3PB 1HXHA 4HDRA 4ZTBA 3TAHA 1QIGA 2VWPA 3FHOA 4QUGA 2ZSAA 1V9LA 2A3NA 5BSRA 4QHSA 2CFSA 3QMWA 1VI6A 3IEUA 1W0JD 3L92A 4BO3A 3D43A 3JTMA 2I6XA 3KB8A 1RMYA 1RTKA 5ITZB 4R2JA 3RU3A 1I4TD 1RWPA 3OKPA 4IIGA 2H06A 1L7VC 3FF4A 4OREX 4HRAA 1WRBA 4F4IA 4JSRA 3E2MA 4YAFA 5JDCC 4KFTA 3LVQE 2HOQA 5EJFA 1VGQA 1GHTA 4P5PA 4K26A 4Q47A 5TX7A 5K3FA 3ZK9A 4EY5A 4LF5B 3E0QA 1EVIA 4H2DA 3V80A 2BZSA 2O2IA 2QT9A 4LOKA 4MV1A 2O14A 5CJPA 5TIIA 4WXPA 1PW7A 2YWGA 1U2TA 1KEPA 2BFMA 4DNFA 2X8WA 4XB1A 1JH9A 3QWIA 4LJKA 2NNLD 4LG1A 4NNJA 2GN1A 5KIAA 5COAA 5IXSA 1SKUA 1XT6A 2GASA 2JH8A 2XZDA 1FRVA 2GRJA 3WICA 2O07A 4AVYA 5BNFA 3AUUA 5ENDA 2O8NA 3K1AB 3NXKA 1G7TA 4GW3A 3DTTA 3GFQA 1U7TA 3MLAA 3QY0A 3RE1A 2GD2A 2PA0A 3LHDA 3SZRA 3ZJ5A 4DWWA 3C5VA 1X8XA 4TVBA 3N2KA 1QQTA 1V9SA 3KUKA 3NAGA 2RGGA 3HEMA 5JMTA 1IY1A 5SY9A 4PV7A 4I3GA 3CO5A 4CETA 3P9RA 5L3VA 2QTVA 1GY8A 2ZT6A 3WIDA 2F55A 2LP4Y 4QRIA 3V4OA 4R9SA 3VVLA 3H83A 2IKQA 4W9NA 5LQNA 3VR5D 4LXGA 4KXVA 1J99A 4ZJYA 4YCJA 1YBVA 3UBTA 1BCRB 3RRBA 1ZIOA 4C7OB 5DWVA 1FLAA 1ZSVA 3EQZA 4U2CA 4IIJF 4FMCF 3RDPA 2Q46A 1J9ZA 2E89A 1U0EA 2IU4A 3GWZA 3T7IA 1NVXQ 2EAUA 2ZYHA 4AB1A 5GONA 2ATIA 2XZPA 3TR6A 2HHJA 2ZTSA 1E3MA 4NOKA 4BU0A 1SIOA 1HQDA 2PD3A 4DR1B 3LF2A 1OJ7A 4FCCA 3M81A 4NCHA 1PP4A 3CNBA 4X1KB 3GZTB 1NI4A 3A1SA 4Z9YA 2ZUVA 4OHFA 1H0SA 3UJ3X 1GCIA 1C7QA 1MUUA 2FK7A 2Z0MA 5AHKA 4ZODA 5EJ4A 1USUA 5MN6A 2XUOA 2CXPA 1X2BA 1P1HA 2HIGA 2AOXA 4K6MA 1ELOA 4C1NA 2GM5A 4M0KA 4HSEA 1M10A 3RC3A 1TFUA 1ZGHA 2ODTX 4R5MA 4MGKR 1TVCA 2G0AA 4KFRA 4M0PA 1H5UA 2ZIAA 3PX2A 4IHJF 3LCVB 4ZQGA 3HI6A 3PFHA 1XNQB 3LRTA 4ZHSA 1OLUB 1RFGE 2B1RA 3MAJA 1C1XB 1IDN1 5BMVB 5HR5A 2JAUA 4OQDA 2P1DA 2W90A 1SHUX 3AB7A 4TLMB 1RMQA 4LJ9A 1DBQA 2QW1A 2CDAA 4NONA 1BIFA 4I1UA 3EMVA 4OSPA 4QECA 5KVQA 1M8PA 4GX0A 4JJ6A 3PC6A 5JSKA 4JELA 3B1KA 3EMBA 3ADKA 1NXQA 2F8MA 4WHMA 1GRVA 4P7KA 2EJCA 3OETA 1VRVA 2FX2A 1Z9BA 3PUKA 4LFAB 5KCZA 4DV6B 1VE7A 2EZUA 3JQDA 3EOAI 5FWXA 3K8OE 2FGJA 4PSUA 1OTHA 3ZCTA 4BO4A 1ZCFA 3AHJA 5AXBA 2PPVA 2HUNA 4U7GA 1YUBA 1FSGA 5F64A 2D8MA 3B48A 4BIIA 4N49A 4U6SA 4V0QA 2TSYB 3AT1A 2FZGA 3MBOA 3UHPA 3FSGD 3AUTA 1JPVA 3V33A 3MJVA 4X54A 1EFVA 1ORTA 2DQ4A 2PMKA 5IG2A 5TS3A 2FPLA 2P9CA 1CUJA 1GCOA 2BMVA 4PPFA 3C8MA 3ZY6A 4L8VA 4ZVRA 2P6UA 4BFVA 1IJFA 3JTEA 2QN1A 5KOYA 3PUYA 4C05A 3H5VA 4TRJA 5JXWA 4P2BA 5AI0A 4DUYB 3ONFA 1P8AA 2E4VA 1ZXBA 4G9BA 4NZ9A 2JCSA 4CG3A 3O31A 1BN6A 1ZVKA 2BRUA 2WKWA 1HE3A 4BQIA 2AEMA 1ADYA 1T0BA 3PD0A 3RVRA 1OILA 4J0GA 3D7RA 1AJEA 4FFOA 3ZIDA 3UJBA 2H1LA 4NFYA 1E6UA 1KRXA 2O3TA 3R8XA 1Z28A 1Q7CA 1XMPA 4ZANA 2DG2A 1R8JA 4JBIA 4EDFA 1BW9B 5FOQA 1XDUA 1XZFA 3NEYA 4B2YA 1IXYA 2PKQO 4B9AA 1I1QB 4K81B 1FQJA 2PCLA 4KR2A 1KZ9A 5CM8B 2JBAB 2PJUA 2ZBPA 3JYNA 1A8UA 3Q7RA 2GVZC 3COPA 1WKCA 2P2DA 4KSYA 1OE0A 4U39A 5TJ9A 4UBKA 4WK0B 5ALHA 4DSUA 4AJ9A 3Q87B 3ZWBA 2ZIUB 4MVJA 2I7VA 2JK0A 3A6JA 3OCCA 3LUDA 1VPLA 1QZ3A 4JU9A 5ALUA 1CZUA 3HCEA 3JVVA 5ER6A 1Y8RA 1ADFA 1RAAA 2VNHA 4UZSA 4PHGA 1K3FA 2V9CA 2N3ZA 5JZVA 2OZVA 1EESA 3M4YA 2P5YA 5CCDA 4C30A 1Y7PA 2CXQA 4FKZA 3ZNOA 1DC6A 2WYOA 4DSTA 2XCTB 2ILTA 2VDKB 1Z5VA 1T35A 2VZ8A 2X2OA 3PKZA 1NKTA 4MEAA 2Q3CA 4UNQA 4EVSA 1M1NB 2B30A 4YMHA 1LKZA 4N7BA 2O3QA 3SIPA 2XXAB 3GZ4A 3VPCA 4LRSB 1I4EB 1VJDA 2XB9A 3P4UA 1ZAYA 4R01A 1Z07A 2D3TA 1EJ2A 1XMIA 1NC3A 4JIGA 5BWCA 5U1PA 3ASZA 3DV2A 4BVJA 2XYRA 3M6LA 3HR8A 5ICSA 2F17A 3HYSA 3QF4A 1X42A 4S24A 4OG2A 2NO5A 4WNCA 1NLMA 1L5RA 4FC6A 3Q7EA 3KKZA 3EEQA 4N5DA 4AO6A 3P2IA 3QE9Y 4NLLA 5K4HA 5IUKC 4PSAA 4UBJA 5HF5A 1NV8A 2HLNA 3A9WA 4GWLA 4B4WA 5JSFA 3UPTA 3CO0S 2QTRA 4QVIA 3Q0EA 4F38A 5JW6A 1QYIA 2CMHA 4C3ZA 3MHTA 4YV1A 1BD3A 4F56A 1NUPA 3L7CA 1QO7A 3GGSA 5IU6A 2AOVA 3GUZA 3J7AC 4S35A 1MDBA 4MUNA 1MQSA 1M2OB 4L95C 1W0JA 1PGQA 3E5RA 4I6EA 1ZUHA 4UVDA 4N7JA 4X1YA 2V3VA 3I6QA 3EASA 4O0MA 3U7HB 2H5EA 3B13B 4I2VA 4ZHQB 4HLDA 2CK3D 1AO3A 3DMNA 4ZVKA 3ZWVA 3CH5A 2G40A 3IE2A 3IOBA 4OL0A 5C1IA 3HE3A 4J9UE 3KZNA 4Z7NB 2FG7C 1JIIA 1VCHA 2I6TA 4LXIA 3DHVA 3MWEB 4G24A 5BQOA 4M1MA 3E53A 2IUYA 1OZAA 1IM8A 3H2YA 4G25A 4K7JA 2OQ2A 1N6IA 5DI3A 1X2EA 1USGA 1GGJA 2QQEA 2CEKA 4PGFA 4I9UA 4A0FA 4ALJA 1GSIA 1QLHA 2O2ZA 3G89A 3ESQA 4KO2S 3WLOA 6REQA 3KZKA 2GBPA 4EG5A 2C2GA 2VZLA 4W9NC 1AGXA 2ORED 3HLYA 3ZDAA 4CM5A 3WDLA 3EBOA 2PKQP 3M6MD 3R0JA 4EUSA 1QKJA 5DHPA 3ITDA 5KREA 3OZSA 1D7AA 4ZARA 1EAYA 3BGDA 1DINA 3VPHA 3ER8A 1O8CA 5AQ1A 2Q2OA 4YI3A 4Y0AA 4MDHA 5D3MA 4FOOA 4B6OA 2N46A 2ZCVA 4LQCA 1AKWA 3WYFA 3ZYZA 2B37A 1EBBA 4DEYA 4PGGA 4AL4A 2C2HA 3H9CA 5EUQB 3IJPA 3A6HA 3QOFA 5JISA 5AKYA 2EP7A 1TXGA 1ZZGA 1SBQA 5FR2A 1DADA 2FPIB 4L72A 3U48A 3EVCA 2CDCA 1A4XA 1NG1A 4NMMA 3G49A 3BX1A 4O4IF 3RLIA 5LD2B 3ABZA 4DQUA 2GX6A 4AW9A 1SCBA 2Q50A 2JPDA 2OCPA 5C0OE 4CM9D 1VP3A 3CYFA 3N07A 3ZE9A 4NCBA 4ZI7B 3W2FA 1LDEA 2HFKA 1LTHR 3WZ2A 3DDSA 2QBYA 5E9WA 4E5NA 4IWXA 4O1MA 3W5UA 4NPAA 1THZA 4KPFC 4R9UC 2XGSA 2WI8A 3KHKA 1PR2A 1E5XA 2EP5A 4AYXA 4YLYA 1Y6JA 3KSAC 4EJMA 2PRYA 2V0GA 4M8IA 3ILVA 1XP8A 1DFHA 3TBFA 2PTGA 3OU7A 3TO5A 3NFRA 3D8NA 4TOIA 1Q84A 1YRHA 2X5NA 3R0VA 4NBVA 5EN4A 2NNWB 1V6SA 2BCGY 2F48A 1ZUIA 2E48A 4IILA 4GMXA 3T4EA 5BR8B 1TUBB 3OHMA 6ADHA 2OHIA 1NPDA 5H0IA 1HNZB 1BHQ1 2JGRA 3HWWA 1BROA 4WXYB 1H8HA 2BEKA 2VQSA 3LFHA 2ZE8A 2UZIR 1YDGA 1QIHA 4ARZA 3JYHA 2PG3A 5DFAA 1E64A 2AE1A 3ZX4A 3JPWA 3NHZA 3LY7A 1B00A 4JLNA 2P6NA 1BC5A 3C70A 3UK6A 1QGUA 2B8TA 2VSNA 3M9LA 4B31A 4KR3A 1MHPA 1SD5A 1G7RA 1QG0A 3H4TA 4NZOA 3NOQA 3G0IA 4FHCA 3TD2A 4TMFA 1AS0A 4HAZA 5AK4A 2JBHA 3RF6A 5BOVA 3BCSA 3STYA 4BKOA 3HXLA 3F5MA 3ZS8A 1JDJA 3EF0A 4QNRA 3T7AA 4QHTA 3LUCA 4JUAA 2K7FA 1JVBA 4CM3A 1M34E 1EBFA 2ZCUA 4WEOA 3HBMA 5H82A 3EBPA 3PGLA 2FPPB 2VDUE 3LCJA 4E4RA 2QBYB 4QDUA 2XZLA 1HURA 4V24A 2PQ2A 2VP3A 3LBIA 1BU8A 3C3JA 4WXMA 3NCHA 3FSEA 3NHSA 2H11A 2R66A 5KWIA 4RMNA 1YI0A 1Z0AA 1AC5A 1VGVA 2XCOA 2H0AA 2CJWA 1QFMA 2XNKA 2WHYA 3UW1A 1J0DA 1JQ3A 3KVOA 3RW9A 3PJGA 3VNQA 5KTYA 2XYVA 1SIBE 2CD9A 2K7ZA 3ORHA 2WTXA 1E3DA 4WFKA 3KTAA 1AHPA 3DBLB 3PL5A 2DEUA 3O3MB 2IEGA 3RVQA 1HT0A 3U1VA 4F9TA 4R1SA 1UPBA 3I09A 4OATA 1KBOA 5KKCA 1KFKB 2UKDA 3KJXA 1EYZA 1KKLA 2SNIE 1S2LA 2HYDA 1FPQA 2R6R1 1H5QA 2IYEA 1VRWA 1K68A 2BL4A 3MBKA 1WZNA 4GI2A 4IWNA 5LXTA 3S8EA 3KKEA 3RFVA 3ZU6A 1BWSA 1U31A 3USZA 1XJCA 5F1PA 4GECA 2GPSA 2J33A 1M6VA 3OKCA 1Y4UA 3ANMA 4BNKA 3RK4A 1XSEA 4ZZIA 4MWBA 7YASA 5C46F 3R6GA 5JSZA 1JXOA 1NBOA 2ZYGA 3BOSA 1L4KA 3QBEA 5HJ2A 5KU7A 3JSAA 2QTTA 3TPZA 5F1YA 2P3OA 4B40A 1JXQA 4UXIA 3MTBA 2ZBGA 2PH5A 2E37A 4NHOA 5DRYA 2W6OA 3A4YA 1Q15A 5TQVA 1D9XA 2VFAA 3C3PA 1I94B 3QGMA 2CBGA 3RS2A 3M6IA 3UAVA 2O7SA 3W7VA 2FSIA 1HZZA 2WK1A 3ZWDA 5JHGB 1J2YA 4A03A 5DNUA 2C2KA 1ZNZA 3A2KA 3TPCA 1JYFA 1KI1A 2PK3A 5SY6A 5TEWA 4XOUA 1SBHA 3PQEA 3G17A 4K5QA 4EG4A 3FMGA 3I9MA 4RIGA 1K98A 1RC0A 4KQXA 1DKLA 1ZU4A 1NOKA 5AOAA 4D80A 5BUSA 2VYNA 3BE4A 2EEZA 1P19A 1KAGA 1YBHA 3RBAA 1WEHA 3K05A 2A9OA 3QBDA 5CPFA 3FG9A 4AUMA 2QI9C 4TMVA 2R6DA 1KMCA 2EKLA 1AO0A 3R1IA 3STUA 4O3MA 3KOMA 5A5EA 1MX1A 3GLHA 2O8DA 1U7XA 3O73A 4X8OA 3R7BA 4Z1OA 1GCUA 1PZFA 1TD9A 3FYUC 3BTVA 4AAYA 2KYRA 4U2BA 4JLBA 3WLAA 4DDTA 3I2YX 1OH8A 5EEGA 4BN4A 4LTDA 4W63A 1U02A 4YO8A 2Y0EA 4QDZA 2C8JA 3GH3A 4NNOA 5HF9A 4N01A 3FPBA 3S2YA 2PE5A 4L4ZA 3T9CA 2AHOA 4WOCA 4LZOA 3RWMB 5LVAA 2H1SA 3EWSA 4KNWA 1R16A 1IMOA 1HYHA 3OD1A 1BTOA 1SQ6A 2GEVA 4D3DA 4TVSA 1WMEA 2VYFA 2B7LA 4YGYA 3K32A 3PXUA 2Y4NA 4AQDA 1AMOA 1RLTA 1Z5WA 3T3OA 1JEEA 4IIYA 4IAOA 2YL2A 4BKPA 3UTDA 1YQGA 2XB4A 4P54A 4B5LA 1Q1NA 2PU7A 2QTZA 1DRKA 1N9KA 4WPGA 1EJ0A 3G8BA 3IEMA 1ATZA 3CUYA 5EUBA 4OOFA 1HQYE 1XALA 2NTNA 5HZHA 1FTGA 1P7CA 2YASA 2OM2A 4QOIA 4NCIA 1YHYA 4CEJA 4AZ3B 1C30A 4D4KA 2ZTHA 3O4FA 4M7PA 3L7NA 3U44A 3PR2B 4X45A 2ATCA 2J6IA 2XCRB 1WF3A 4IDCA 2R1VB 4TMXA 3BTUA 3FROA 3NTVA 5G3YA 2I4RA 1XRRA 3DL7A 3L06A 3GA5A 3TDKA 1M54A 2HD4A 2H2HA 2HF8A 3JRXA 4A73A 2KHZA 3E6AA 3WKBA 4PIPA 4X9XA 4E7OA 2I76A 5KYXB 2VDLB 4IV5A 3CZ5A 1UJCA 2NXEA 5LA6A 5U4QA 2F3TA 1KKMA 4HS9A 5PNTA 2R8OA 1TCBA 1F8UA 1L7AA 1NT2A 5I4KA 4R8VA 1KJ8A 5JAOA 2E82A 1QFSA 4CIBA 1IN8A 4NDNE 1NKSA 2YXDA 2GVNA 3OTQA 1R8QA 4HMQA 3S2EA 1Y8RB 3VO1A 4WT7A 2PQMA 2P8SA 3AZQA 1O0BA 3ICCA 3IP5A 4OMUA 4KN6A 5BXYA 3ASYA 2FKAA 2WJZB 1RPZA 1E60A 1KPHA 1N57A 3LYUA 3CZMA 3B60A 2VHTA 1LV8A 1XTIA 1F2UA 3V8NA 1DXHA 1MQ8B 3JRNA 1QGYA 4P7FA 1T8UA 1R4NB 2IPLA 3K3PA 3C16C 4H59A 4JAVC 5EVJA 4EEKA 1JMVA 4UDXX 2VWGA 4HTFA 4XLZA 4EW3A 1DKUA 1U6JA 4JBHA 2AN1A 5CA1F 4KYTA 3WJ1A 3QKTA 4HLCA 3OMLA 1KZYC 2IC5A 3BCHA 5H3HA 5D8DA 2F1HA 2RARA 1PR9A 1Q22A 4GMGA 1TEZA 4F5WA 1GM5A 4PQEA 2O9JA 1CVLA 3RASA 4CM4B 3PQ4A 4M49A 2PH1A 4Q00A 4QBFA 4RE6A 4YA6A 2PZKA 2TMDA 3VYVA 2ZCJA 2BBWA 2AXNA 3FFAA 3SD7A 2PZJA 3Q1KA 4UJ3A 4C5CA 3NH9A 1FQWA 4HXYA 1RW4A 4M1KA 1DBVO 4NNPA 3LSYA 2X8JB 2OCDA 3K0KA 2G9VA 2OP1A 4GEKA 4QASA 3U61B 2HRQA 4UHEA 1PEDA 5FTNA 3TM4A 1N6NA 2VYVD 2JLQA 3F6EX 1GKLA 5JD4A 3C8DA 4BAZA 2GCPA 4QBTA 3W3AA 3DBIA 3KWLA 4WMLA 2W2LA 4R2IA 1JG6A 2P90A 4C7KA 2OHFA 2HA6A 3ROMA 1QGZA 1CTQA 1KDOA 3HP7A 2QVZX 4RELA 2NXWA 2JAWA 3VUEA 1V11B 2AFVA 4MKRA 3LDUA 3FR8A 4PIVA 4QRDA 1PZMA 2C29D 2IQIA 1RKUA 5JNVA 1JDVA 5F5LA 3V1YA 5B7PA 1ZVQA 2P2NA 1EX9A 2WJYA 5DTJA 1IVYA 1JDUA 1NW3A 4NL4H 4E1VA 3UHJA 2DE0X 2JGDA 2PBLA 1L1RA 1GZ5A 1FDTA 3AX6A 2GXQA 3BDVA 2AJBA 2FLWA 3L7AA 1MV5A 4OCZA 4YAOA 1JEYA 3HVUA 1P2SA 5BO5A 2ADFA 2BCEA 1E7QA 1T6BY 3K6KA 3H1TA 3HYCA 3KTDA 1DAOA 4LSZA 2QTBA 4KTTE 1XDDA 2J07A 2Q4TA 1XLUA 4H1TA 1C9DB 1E1MA 1Q21A 2Z83A 4H6XA 2CLEB 5HUQA 5IAAA 1PWEA 4L3VA 2BGWA 4BNWA 4L22A 4KSBA 4V0LA 1A76A 1A2BA 2HF2A 4GX1A 4NH0A 4XTCS 3QFRA 1JDZA 4F7WA 3SHOA 3E5HA 4F6RB 3CUSA 1KZGB 4YDHB 3IUQA 3IHTA 3NEPX 4GZMA 3AKDA 4QBGB 2D2VA 3K0EA 1L5LA 3DF9A 5FNVF 1ZNYA 2GHQA 4LCBA 2UDPA 2EX0A 3P0EA 4ZO8A 3U7GA 3N0WA 1OBVA 2QVCA 1FJXA 5CAEB 2JIMA 1TB4A 1J2RA 2QV7A 3BAZA 4ZDWA 4GWKA 3NRCA 2PX4A 1IB0A 2AKYA 2UV8A 4ZVLA 3R5XA 4RZSA 3RIEA 1HFKA 4Q4AB 1FDOA 2GH1A 1QHNA 1S8NA 1G17A 1UZAA 4W7HA 4QBKA 2ZI9A 3Q8MA 3T15A 4FFVA 3PHJA 1ZM4A 4K05A 4R68A 2PXAA 1N0WA 3GRVA 1FFXB 2BGKA 2EFHB 3B1VA 1M67A 3UYKA 1OMOA 3MGAA 2Y93A 4H7JA 3H9QA 4X0EA 4BQOA 3N8GA 1OH5A 5DGIA 2B6NA 3BTOA 3F5DA 3C3KA 3H4MA 4LY3A 3ST7A 1XYVA 3HFGA 4JUBA 5K3OA 3GPBA 3Q8KA 1SVUA 1B7GO 2YV1A 3LX5A 1X1TA 2CE7A 4IOKA 1CC1S 3KEQA 4S1NA 1IH8A 1EK2A 1KK0A 3A70A 3U9SA 5AW1A 5JRDS 4FNMA 4QFBA 1XEAA 3BWBA 2JLXA 2O5EA 1HYQA 1NW6A 3FPCA 1LLQA 4LHVA 4OK6A 1GPYA 2GBFA 1COZA 2J6CA 1HE2A 3LIIA 4UBNA 5KNBA 3W5AA 1C3OB 2NQTA 2DAPA 3EXIB 4BV9A 3ZHUA 4HN4B 1L5GB 3UGJA 4HQKA 3R8FA 4KQMA 5FNZA 1C4KA 3R41A 1TLLA 2ZSFA 3L07A 4FE4A 1TM7E 2PZLA 1VB5A 3DSRA 2FA9A 1K5HA 4RC9A 2VDRB 2E4XA 3K96A 3BB4A 3E7WA 1VCOA 4EKGA 1QP0A 1ZH2A 2HSJA 1VE6A 2H0RA 4DNPA 2ZVJA 1YJBA 3LZ6A 2ETXA 2B4QA 2FUG6 4JLUA 1GTVA 4FUQA 4U2EA 5EC8A 4UQOA 4IDNA 1CQZA 3NIWA 3OICA 3PR3A 4BLUA 4RCVA 3PPIA 1Z4KA 1QH8B 4QUHA 2G09A 5E1MA 4ND4A 1S0UA 3A11A 4MDYA 3WNBA 1X7ZA 3X1WA 5MHTA 4R16A 3CRVA 3GZNA 2ZSBA 1WUJS 4JR2A 3ZWKA 1G38A 3C3EA 5ARCA 3D9QX 4EA6A 1N2HA 5ICMA 2EOAA 3JASA 4AF6A 2FGKA 3BD8A 4YHHB 2OLKA 3AR7A 3FAZA 1C7IA 4LYGA 2SECE 4Q34A 5GOTA 4A7PA 5JAIA 1C3XA 2BKVA 1Q91A 5CIWA 5ELMA 1MAVA 2NXNA 4P98A 1ZVMA 1X3LA 4XH9B 3HM9A 5LM3A 2HIHA 1RE0A 4LAFA 4AKGA 3K5IA 1J56A 1ZH8A 1I32A 2BJVA 1WDLA 3EGEA 4HXEB 3I9OA 1V5EA 3OZAA 4RKQA 3OQOA 2WT8A 3EARA 4JI5B 4S0ZA 2BIFA 5TE9A 2W70A 2ZRIA 1F2DA 3BL8A 2ACEA 1AURA 4RPGA 5LP6F 1LX6A 2ID9A 3OVMA 1SULA 2YMPA 3VJKA 5LB2A 3HDGA 2ZRKA 16PKA 3RIMA 4I19A 4NBRA 3KYDB 3Q40A 4H7EA 5K8JB 2HH9A 5AOBA 4LXQA 4BVGA 4CQMD 5I3ZA 4OP3A 1JLSA 3M49A 3H8SA 2P9YA 4LOHA 4HH1A 2E9SA 3BG5A 5AVZA 1B76A 1D6JA 4KBYA 2FSGA 3ONDA 3LKVA 1D6SA 1DMSA 1NGSA 5EIEA 1JI3A 4R1LA 1RAEA 3SHTA 3IT2A 1P6UA 3WL7A 3BTSA 5AXAA 4WZAE 1K9SA 4JBNA 1SCJA 5ALFA 2ZZNA 2GO7A 3JZIA 3H18A 1VHTA 4EQZA 3QU5A 4MJLA 4ERXA 5IFKA 4BNGA 1VSVA 2V6GA 1DC8A 1K75A 4N7RA 1KWKA 4BX8A 4BQQA 3UKOA 4D9MA 4YASA 3HU2A 3UOWA 1A88A 1E8MA 4RQBA 1W34A 2AK3A 2P6PA 3PRHA 2XOKA 3VSCA 1N2SA 1VCMA 2ZVPX 1OCEA 3IR5A 1D0VA 1Y82A 2C20A 4PG7A 1BHSA 4D57A 2RHTA 7REQB 1E98A 3O1LA 4M6WB 1V7QA 2BELA 1E0AA 4D9KA 4HDSA 5J1SB 5G0TA 1T8PA 3MC1A 5B30A 2Q27A 1G20B 4MR8B 1WIWA 4ZO9A 1G5IA 5F7ZA 1XAIA 5EMHA 1IHDA 1V26A 3ENZA 3GJ3A 4HNAA 3ON5A 4FD3A 1K6MA 4PX9A 5D01A 5DSZA 5LQAA 5LQKA 3IVAA 2WHPA 2AOTB 2QG9A 3JATA 1ZH6A 2ZUTA 5KSYA 2QQ5A 2P27A 2WDZA 4UBOA 1QWSA 3PENA 2KPOA 2W0SA 4HLNA 1M6HA 4UKDA 4DEVA 1LDNA 3LBNA 3QUAA 3EXIA 4BFZA 3QUSA 4Q7QA 3KSMA 1PS8A 3DTNA 5BN1A 4WNIA 5BNTA 3G13A 2VF2A 1CF9A 4B6RA 2FNAA 3EEFA 3ZGNA 4DCVA 4DOMA 2I8AA 1GGHA 3VZPA 4E09A 4E6EA 1DGQA 1IVNA 2O8CB 4RV5A 1DWOA 4UTPA 2C7OA 3DWFA 3LT4A 4PC1A 3DE2X 4BLOA 1UMDB 3FPGA 4J9VA 2Q1XA 3H2SA 4IKOA 2HK8A 2XV1A 1GGVA 3VSDA 3I9NA 5BRJA 4KWIA 1YZHA 2PVCA 3K9FC 3LZDA 1VLJA 3SM3A 1P81A 3E61A 4FJ1A 1V1MA 1PUIA 3O2JA 1U3UA 4EUNA 2W5UA 3KNZA 3KKOA 3CZCA 4F8JA 4MW6A 2CVZA 3GG2A 4ID9A 2RKBA 3TRDA 3WGTA 1GUZA 1WU7A 3C8UA 4Q4HA 1PYDA 4MB6A 3EQ6A 3OM9A 3F4KA 1AGRA 1LBIA 4N3CA 2Q3FA 4G5YA 4OHOA 1TVKA 1LK0A 1CUSA 1IEXA 1NWHA 2WAAA 1U9IA 3QG1A 1FP7A 3N2GA 4OUDB 3AFMA 3A8TA 4FYXA 5JSUA 5KPDA 5I7VA 2AR7A 1LXCA 1YH3A 2XH8A 2XWQA 3MFQA 4L08A 2J5BA 3HC7A 2GBLA 4AF8A 1Z13A 2IHBA 3JVUA 4U1RA 3EZ7A 3WFZA 4IP0A 1NBAA 3QXJA 4B48A 5T64A 1GITA 2YHAA 3QU4A 3ANNA 4BNMA 2WZBA 3PZRA 1HYEA 3G9ZA 1J0AA 4RE5A 2VAVA 3ZCVA 1UR5A 3GFFA 1CRWG 2VSYA 4DMRA 1J8YF 5DH9A 3BRWD 3ZXXA 1FYWA 3KD2A 5AM2A 2DWCA 3QPBA 4JUCA 4C2BA 2VQFB 4PY2A 3WGVA 3MINB 3G0BA 1BKDR 1ICEA 4HLUC 3W5JA 1X1RA 1KMQA 3K1AA 3IP9A 2ZPTX 3L7DA 4RS3A 1M8FA 4X65B 5JCPA 3CH7A 1DEAA 1E62A 1EGHA 2CJPA 1XQ1A 2TECE 4AYWA 3B1YA 2Q29A 3KZXA 5E6SA 3NBFA 3TKYA 1JAZA 1IUNA 3WNDA 4HBGA 3OUUA 2DGDA 4ZVSA 3UXMA 1VLMA 3DT9A 4DV7B 1FFWA 4RJTA 1SVMA 3B8EA 4CL8A 1N8TA 2Z9BA 2AJ8A 1TTTA 2IHZA 4N5NA 3B78A 1G0NA 1AOXA 2EZ4A 2BBOA 3RCBA 4LWZA 4FI3F 1TJ5A 3FZQA 4G1EB 4Y6QA 1JA0A 1T9HA 4KWHA 2EU8A 2PY6A 4FGSA 3UVEA 5A05A 5CT4A 4BJ6A 1P18A 3FNBA 2OG2A 2NXCA 2SKEA 4KDCA 3H6HA 5LB4A 4N3NA 2GKSA 2C3PA 1YS9A 1CFZA 4UJ5A 4G4SP 2AG0A 3V8PA 4BX2A 1M9NA 2NTJA 3MTIA 2HAEA 3D5EA 2QMQA 3IEXA 5KQLA 2I33A 1YDFA 3I72A 3BGSA 2VDOB 3U5ZB 2NAFA 1TAUA 1DC5A 2HY7A 4HDRB 3OZ7A 1OXTA 4I1SA 2BY4A 3WQBA 1VMEA 2PUVA 3P2MA 5HGJA 3H6GA 1I3MA 5KHLB 5I7EA 1NAIA 2G5PA 4FHDA 4MPTA 1MH1A 3IDFA 4NWIA 2O3SA 5L40A 4NY1A 4ZOLA 3D7LA 3ROTA 1RT9A 3V55A 3DZKA 4BMSA 1SBYA 2JW5A 4X64B 3ORSA 2C4VA 4P36A 4BKMA 5CG1A 4HO1X 3V34A 1FSFA 1JSRA 2IDJA 3LHFA 1IULA 4RQAA 4QFDA 5JH7A 2AUNA 5EXSA 1JKIA 5F2EA 3SBXA 4UCXA 3PLNA 3ME5A 1NBWB 2PLFA 2XQVA 4J76A 4LOIA 5BQ3A 1L5QA 1JBKA 3NHAA 4AULA 1B2LA 2R8XA 4ETWA 2Q5JA 2R60A 3SHWA 1N2EA 4D3YA 4E13A 3NPMA 4OH7A 4DWOA 4NR0A 5HIJA 1XVVA 5HX7A 2W2QA 4HG2A 2O20A 2QRVA 3A0UA 1U11A 4ODIA 4IKPA 4RH0A 3QJYA 4V39A 4CR6A 1ZGJA 3I30X 4EVIA 2V6FA 1C9MA 1G21A 1RDFA 4DLBA 2ECFA 3JR3A 4AIIA 4YAKA 3INRA 3IP8A 1KMNA 1MNQA 1U4NA 2C0QA 2D7JA 1C9YA 4MVXA 3NTXA 3SPXA 1GGMA 4P4NA 4QTTB 3BILA 1NBHA 5E8JA 1AE1A 4KP7A 4B7AA 4WN9A 4ZCQA 2GEDA 1T9CA 5SYAA 3LDGA 1ZXLA 4YMLA 1I9GA 1UAYA 2VDWA 1B8PA 2PWAA 3P96A 3Q6NA 2PZMA 1H2YA 3KALA 2Q6VA 5HGXA 4JLOA 4ZU3A 4KGZA 4OLFA 4GQIA 2GAOA 3I0NA 1U2PA 4Q9IA 4B7ZA 5FLYA 3EODA 5JROA 3A6PC 1E5QA 2FFBA 4II7A 4CEIB 1CFJA 1MD9A 1SUCA 1IPFA 1X0XA 2R47A 4FQ5A 4OXNA 3DMTC 2XUPA 3MQ2A 3DDUA 3ZTYA 1MOSA 5LKAA 5KQPA 2JCGA 2GN9A 4JVOA 5BSMA 3VO8A 3AEUB 3VPDA 1ISSA 2I67A 4DCNA 5EHGA 5K2MA 5KU1A 1EQ2A 3UK7A 3THYA 5AJYA 5T8KC 4PSDA 4G01B 4GF5A 4HH0A 5BV0A 2I4TA 1KP9A 2EFJA 1I8TA 3FMIA 1EWQA 2JL1A 4NG5A 5CH3A 3CJTA 1P5HA 4YNBA 1NL3A 3LWNA 4TTPA 3MOSA 5AW4A 4CLRA 1NBMD 1TM4E 3TZKA 3W05A 3U31A 2JCBA 4FT2A 3OJOA 1KYQA 3VDQA 4ARAA 4IJMA 4GSYA 2G9QA 4M0MA 5CLLA 5GTDA 3DLTA 3D4BA 4BE7B 1GXSA 1ZVJA 3AI2A 1YL5A 2PNFA 2HRZA 4XYBA 1NR1A 5DNDA 2DLCX 2W48A 4G56A 5JFTA 4RQTA 1J0CA 5K5EA 3GROA 2VTBB 4NOMA 1NVAA 3DB2A 4UNSA 5DM2A 3B20A 3R77A 2EG9A 5C18A 5I8PA 2FN4A 1LGYA 4UDNA 4EL0A 1EXWA 1GPDG 2XKBA 2IV3A 1T2UA 3TX6A 3OQVA 1J7KA 2PXCA 3PKIA 1O6CA 3IIEA 4YLGA 4LPSA 3O74A 1J21A 3H5NA 3IRVA 3B38A 4PLCA 4MRMB 2JJMA 4MRPA 4KDRA 3SDSA 2PA3A 1MJNA 3NKVA 2I9PA 3MCZA 1W76A 3DFFA 3NT5A 2FXIA 1J8QA 1UC4B 2QVBA 3DAPA 1PR3A 1JPNA 1M2GA 1PS9A 1CP2A 1XFAA 2XOEA 2FY8A 2Z5FA 4P31A 2M6LA 1MN6A 3W34A 3QMMA 4MVYA 1ZG3A 3KS9A 3NMUF 1PR6A 2SKDA 3UWSA 4BOYA 3NO4A 2ICAA 1IUPA 1EP2B 3NYWA 3KB1A 1Q20A 4INOA 3ZZNA 5C8YB 1SRRA 2Q8PA 2HDHA 3MUEA 3ICPA 4RL6A 4C5AA 4R1PA 5JSQA 4QDKA 3M4NA 4IUYA 3LL4A 6Q21A 2C0PA 3R7AA 4EP1A 4EFLA 3J80A 5HE8A 2HREA 4ARIA 3OX2A 1XMOB 1F60A 3KL4A 3PUVA 1Y7TA 1US8A 4DNQA 5TMEA 2FEKA 4Z9BA 3WMXA 4EPXA 1LFDB 1II8A 3P4XA 4LRUA 1O2DA 1UWCA 4JLPA 3K0SA 1GG5A 3BMNB 4I1VA 4CIWA 2HJWA 4YQFA 3OQPA 2Z6AA 5MN5A 3VZSA 3U26A 3R6DA 1L3BA 3OU2A 3NCTA 4RADA 3BREA 5ILQA 1R0ZA 3TM5A 4ZCIA 1SOUA 2C1XA 4CLXA 1G8GA 1QFJA 1WB5A 2QSUA 3AHGA 3LP8A 3PFBA 2YFHA 4NG4A 4YDRA 4DIBA 3E81A 2H3EA 4JN6B 3RVLA 5DLQC 3E03A 5HPYB 1Z45A 4GLBA 3M1YA 3F1LA 3SU8A 1OFUA 2Q4RA 5JBIA 5HBGA 4BAUA 3JAKB 4CCWA 1IZ8A 2AHRA 4AUNA 3L1JA 1XEFA 4EF4A 1DQZA 2E0IA 3FSGA 5EWJB 1ZRHA 1WHSA 1R4NA 4MCJA 1XZGA 3KYCA 2XUHA 5F35A 5A9SB 2M1XA 1JHYA 4A8JA 5DBGA 1XZMA 2D06A 4ETNA 2HDNB 2J9RA 2CNKA 2PQ0A 3I1JA 4HYQA 1WA5A 4KEAA 4PAOA 4WY5A 1VMKA 2GT1A 5LMNB 3HQ4O 3RWOA 1EFKA 1TYAE 3QOYA 2YWDA 1HKHA 1SUDA 3MS7A 3TYXA 3WHIA 1QDUA 3NIBA 4FFDA 2OXTA 3VR5H 1GVNB 2Y0BA 1V5WA 2IJGX 3ACBA 3T1HB 2I34A 1JT9A 5JHHB 3QX8A 1UT8A 1VHQA 4MI1A 1K6XA 3RYFB 1Y9AA 5IDWA 2F43A 4NARA 5B6PA 3PICA 1VSQA 4LYYA 4P38A 3RC1A 1RLJA 2XGMA 4G63A 1NFQA 2QDXA 4XX0B 4DLAA 1CDEA 3GFRA 2P35A 1HG1A 2GKOA 2YW9A 5UKDA 2H00A 4BNNA 3QXHA 5IPFA 3C43A 4GNKA 2ADMA 2QGNA 4U2FA 3A6GA 5BW5A 2BTEA 2YICA 1SIUA 1E3EA 3LV8A 3ORRA 3SIWA 3PC4A 1WJGA 3OP1A 3GJ4A 4XGNA 5EWMB 1YTLA 1B93A 3HP1A 5TGZA 3VVCA 5AFSA 1SVNA 2UZ4A 4IF4A 1PQ4A 3BD6A 4U5QA 2AYXA 1TLTA 2XF8A 1UBJS 5JAHA 3Q5EA 2LE0A 1NIPA 1X38A 4IJQA 1EG2A 1IIRA 3G0CA 4DCGA 4HLUA 3JQQA 4W5NA 1TO2E 5LBUA 1WCWA 4ZYLA 1JDPA 4N5IX 3I39X 2IZZA 5IW8A 4H60A 3F47A 3EQ7A 3AIMA 1TF2A 1ULUA 4HTFB 2NUTA 1XWWA 2XMBA 2FJUA 1R9NA 2V7WA 2Z57A 4H3SA 1ZPDA 2EFGA 3H5LA 1E7SA 1NLZA 3AEXA 3O2SB 4OLJA 4EKIA 4KQEA 5CBPA 1JJFA 2I2WA 3ADOA 4K46A 2Q0QA 4B80A 3GJXC 4F92B 2I6GA 2FSUA 3EZXA 5EL0A 4JFAA 3RRNA 2Y76A 1B6TA 1UMCB 2YVLA 2ZTUA 4MUAA 1E32A 4CJXA 3R3HA 3I28A 1A96A 1N7GA 1RI5A 1SXJC 3DO8A 1E6EA 3GEGA 1PQPA 1I51A 4LYHA 4DMGA 4LF4B 2JLVA 2X40A 1GFZA 4I46A 2XD9A 4LJ4A 1OIVA 1IEVA 4N0DA 5FR1A 3WV5A 3OPNA 1XELA 2HMSA 4BWYA 1ADGA 1S9HA 1RJEA 4I08A 1AN0A 2Z08A 2V6IA 4J2HA 4EO7A 2BHRA 3QIVA 3UEOA 1ZFNA 5FWYB 3LCCA 5EZQA 1K6JA 2JIQA 5LQDA 3GH1A 5K8IA 2WJ3A 1KJNA 1V39A 4N8SA 4EMBA 1KJJA 5FWXB 5FBZA 3OE4A 5DGCA 2HPZA 3UT5B 4M22A 4EX6A 4OKNA 3ZNNA 5JATA 4XUCA 3K6SA 2JCXA 4O2RA 4J0EA 2GPYA 3LMKA 3O26A 4JC4A 2B4AA 3T1NA 4L57A 3ZC3A 5DYIA 2AT1A 2YRWA 1R7RA 2J0QA 1SVLA 3UUFA 3QVVA 5ELLA 4R83A 2Q3BA 2XHZA 4GRIA 4R2LA 4TMZA 4HY3A 2Q9CA 5C7LO 4TTTS 1TJNA 4D92A 4QULA 2CMGA 4RGBA 3VZBA 5KYKA 1XG5A 2GF0A 1J9EA 1YBFA 2GCOA 5C32A 1T29A 1NVUQ 4P83A 1H2XA 1NFRA 2JDIA 4UARA 4WZAB 3ELDA 4ZXFA 3CU5A 2A9VA 1B26A 5FTWA 1ND6A 1X6VA 1M6VB 1KIMA 3HJUA 3Q6MA 5FUWA 4B73A 4PS1A 4UMFA 3TIIA 3TRIA 3WTCA 3P94A 1O58A 2G1AA 3DCJA 1EWVA 4PAGA 1GG9A 1GLGA 1WCIA 1OF1A 2VDMB 1WE2A 5D6NA 1S2NA 1FFYA 4Q1VA 3WNVA 3F9RA 1TC2A 2X3YA 2GA9A 3LO8A 2EIXA 1GGEA 2ZYTX 4YWHA 4D0LB 1TCUA 2O52A 2XOKD 3KTAB 3Q3GE 4NBTA 3Q3HA 4CRWB 2EL7A 3JZMA 5J23A 4XQ0A 3QYAA 1Y8ZA 5CRIA 4C88A 2C58A 2HCBA 3AETB 5FHQA 4JYZA 2UXBB 1NXTA 3R0QA 5E1DA 5AOVA 3U62A 3ZUPA 3DXFA 4F2DA 2H7YA 2Y1OA 4CQLA 1NYTA 3CVXA 4FI3C 2ZWVA 3SKYA 1ZMXA 4P92A 5CVUA 1I6KA 4FFLA 1ATIA 2L2QA 1PGOA 4A6EA 4LWQA 1CQPA 2UUBB 3ND8A 2XYPA 3TFQA 3I4CA 3ILHA 2YJZA 1OY1A 2QE6A 1T5BA 1MGOA 2P3QA 2R8PA 2I4NA 4NRDA 3SXJA 3QJ5A 2FN8A 3T5GA 3WA6A 3ZR4B 2OGWA 2ZM6B 2RB4A 3OSZA 1M0SA 2IW3A 4C4TA 3HWX1 5LWQA 1G5RA 1LRLA 3T3HA 3BYZA 5G0UA 1UKZA 1UPFA 3SC4A 5B12A 3ESAA 3MJDA 4RA9B 1X7WA 2NV0A 1MH9A 2VYQA 3O75A 4Q19A 3TTVA 4E2FA 2P75A 4HNTA 4JXXA 2Z5LA 2RBGA 2PHZA 3OT1B 1D2NA 3CLTD 4NZMA 1FW6A 3FHJA 1Z18A 1JAHA 3HWSA 4JJEA 4QPJC 3FZYA 2G82A 4L5IA 3B51X 4E11A 3DVAA 3N8HA 2AZXA 1FXSA 4DAOA 1KIFA 4RZ3A 3WRXA 4DR5B 4MV0A 1WHTB 2E87A 3VXKA 3A27A 3M9XA 1CPYA 2QIOA 1GDHA 3CZQA 1N25A 2BTQB 3IXMA 1JMKC 2W2KB 2DMRA 4LV6A 2EVWX 3L02A 3RQSA 4KPYA 4L4XA 1UC8A 3IILA 1OGIA 4A10A 4POOA 3HNPA 2X1HA 3I83A 1CUUA 4GZLA 1F7VA 2GZMA 3WKEA 3U3KA 1AZTA 1SKAA 3R5SA 1KFBB 1XWFA 4W1SA 2PR7A 5HCNA 3RTEA 3RSFA 1VKOA 2C4KA 4AZ3A 2P65A 4S1OA 4L6CA 4PSKA 3W90A 2HIAA 3GLIB 3EIEA 3FFWA 3KPYA 1FDVA 3EIWA 4ADSG 2YHSA 1RACA 3FMVA 3GLFE 4FGZA 1R3UA 2XLCA 2YRFA 4KO4S 1K27A 1XO1A 2IYPA 2PGIA 4V1CI 2G17A 4FNOA 3WFIA 2CT8A 3LCMA 4ESHA 5KOJB 2ZULA 1HKUA 1QUFA 3PXGA 3GJYA 3ZLVA 2JAPA 4CU2A 2B8JA 5CYFA 5H68A 1PD0A 3TE6A 4INPA 5G40A 4HLQB 3SIXA 4FNGA 1BMQA 1YV9A 5JJCA 1S4MA 2P79A 2W2XA 4W82A 1F5SA 3OI7A 1Q74A 2ZDQA 5E6RA 1SAYA 1WP9A 2OCBA 4GX2A 3KCNA 4HGYA 4RD1A 4WUVA 3SVZA 3E3LA 1Z06A 2B6HA 3QI2A 3RS8A 4RETA 3W8FA 5FBVB 3A1NA 1YGPA 4OI1A 1DTSA 3DXXA 3FIJA 2ZLBA 5LPNA 3PNYA 5KSOA 5FTJA 4BDSA 1ONPA 1NVEA 2FFAA 2QTFA 1TQHA 3CLUC 3GT3A 4XB6B 5I8ZA 3U7QA 4DLKA 1OOEA 4FFNA 1G1MA 2R8BA 1A98A 2ACVA 2B98A 2ZUBA 5JCXA 5K4GA 4V38A 2HF7A 2ZZMA 4UMEA 3BSFA 3CPHA 4KH0A 3TIFA 3FCAA 5JXHA 4IVRA 4D42A 5HVNA 3NS7A 2FFHA 3CCBA 1L7NA 1TCAA 1G5HA 1VECA 2VIIA 3ESRA 4LYJA 3N2IA 2NO6A 5D2CA 1EFDN 1JFLA 1LC0A 1EA7A 1TQDA 1YJ5A 3GC6A 1KFCB 4RA9A 2CFTA 2QJTA 1JTEA 1DUSA 3UAYA 3SJCA 2PVPA 3SFVA 3QVGA 1YVEI 3AKCA 3DD5A 3RABA 3PTAA 3AR3A 2JJ8A 3C2QA 3R6TA 5ECGC 2AI2A 3CLUD 4FSXA 3TJMA 2RG1A 3DMPA 3M5DA 5ALTA 3A9RA 3ZS9A 1O96B 1Z36A 2BFDB 3AEKB 4UM8B 3SHQA 2ZJBA 3SJBA 3TEJA 1ZGZA 2QKYA 2BM1A 1W8IA 2QMOA 2Z8XA 3UT0A 3ENNA 3GJTA 4E15A 3ZU2A 5FBQB 3PI6A 1Z34A 1LZKA 3BIFA 3P7MA 4I50B 2VHCA 4W5OA 4C7OA 2YMQA 1KQFA 3KZ1E 1KJQA 1TJPB 1SXGA 1JS1X 3D8UA 1JJVA 2HBYA 4LOLA 5JCJA 2Y99A 5DM0A 1ZH0A 4D4HA 4GDFA 4YN3A 1SBIA 4K6OA 4N48A 3OT5A 5JXJA 1PT9A 1BA3A 3BK7A 4H1UA 4UW9A 1CVRA 3VR2D 3DEAA 3QVOA 1XRNA 4KQJA 3BT7A 1YONA 1NVFA 2QAIA 3B9QA 4O33A 2HUPA 1W25A 1HDRA 1GARA 3RYTC 2BUCA 5LP6C 4I3HA 4L3WA 3H8WA 3AEQB 4K1XA 3ZY2A 4NMWA 5DCWA 4JYPA 2CNDA 2F4VB 3BSWA 2YQ5A 3D3KA 3H1GA 1XLTC 3EPRA 3QVUA 4O59O 4BTEA 1RSZA 1E79D 1XU9A 1BVYF 4FEYA 1WUIS 2HEIA 3V9PA 3TAXA 2OAGA 3QG5A 4FZJA 4E0BA 1UFKA 1EG7A 4BGIA 1HZZC 2CL6X 1AXRA 1BG6A 2PZFA 4OHKA 1ECGA 3QPUA 4BLWA 1QHHA 1J5PA 4K6GA 1FBNA 2HPHA 4YUAA 3K4QA 3RHSA 1NM5C 1Z5UA 3M0EA 3N0XA 1NE2A 2XBLA 3CE9A 3MTJA 1FTQA 2CXRA 4YCAA 3THYB 2FFRA 1TTQB 3E3OA 2EEPA 5HJEA 5C51B 3T8YA 4MGYR 2OXEA 3G59A 2I87A 1E2UA 3MAAC 3VH2A 1MPXA 3KQPA 4YREA 1D1QA 3SXUB 4CM6A 1APBA 4HFMA 2PGOA 4JJFA 5E38A 3T5BA 2R97A 5L8VA 1YTUA 3HJRA 1V37A 3ANTA 2VPIA 4LWOA 1ENZA 2GHIA 1RADA 1W59A 2GJSA 3RFUA 2FVYA 4WKGA 4ERNA 4E7PA 1AZWA 2PRZA 4GSLA 1UUFA 1GUYA 1NAHA 3ZCSA 4R81A 3H4IA 1H6BA 5L53A 5EZ6B 1XP5A 3VAAA 5EKXA 3BXGA 3FB1A 4CQMA 2BE7A 4LZAA 1PKEA 3CZPA 2XB2A 2XTMA 3PGKA 1F12A 3AUFA 4D44A 2VPXA 4ML3A 3AVXA 3L01A 1KOGA 1X1AA 2ERYA 3CEJA 1UAGA 4I50F 5FT9A 2EKZA 4P0QB 3BWVA 1H3EA 2QT1A 4V3CA 1RHRA 1O6FA 1Z56C 2GARA 2Z4SA 2LDXA 4IGEA 5JALA 5F51A 1SOAA 2H2AA 2CZGA 1B3BA 2F43B 1WXQA 1YQEA 1TM2A 1LX7A 1RHMA 1FX0A 2PYDA 5TRTA 5FLKA 4FFPA 4NBLA 1UZUA 1VKJA 5KB3A 4PZEA 1NX6A 3BWMA 4RFVA 3X0DA 2ZW9A 4EVQA 3DBLA 1QIIA 4LDRA 2LV8A 4M86A 4ZVQA 4DBLC 5AK0A 1U2QA 4XM1A 3H87A 4NOJA 1SVKA 4WAUA 5B3JC 1RXIA 3GGJA 3WJAA 1T9KA 2CV2A 1E4EB 3HCPA 3O7MA 4CMEA 4MARA 3C3BA 4XEHA 2Q5EA 1AD2A 1KVSA 2IITA 2BDUA 4HC4A 1VA4A 4IVNA 1JV2B 1C3VA 2B5OA 3FKSA 3IPCA 2ZYIA 4GT1A 5E6SB 4M0LA 3MG9A 4ETIA 1I2AA 2B8EA 4WIAA 5H83A 5M3BA 1NI5A 2QAGC 1OZHA 2AQKA 2UZ3A 2IU6A 4QXRA 1LSSA 2R4UA 1OI2A 3BZBA 5AI8A 5IDQA 1BH6A 3GP3A 4HRXA 4FDVA 4Y2VA 2VDNB 4TWAA 1UJBA 1JU9A 1P39A 3F49S 1QVRA 1EFUA 3KYDA 1ZD5A 3Q6IA 3LY8A 1QPGA 4I66A 4NYIQ 1T2VA 2DJIA 5KTRA 2VCYA 3PXXA 3JQFA 4Y0VA 3JZFA 4MS3B 4BRUA 5DK6A 5JS7A 1XPUA 2JZNA 1HRKA 5AHOA 3KEOA 1P1CA 1LEHA 1IXSB 1I7SB 5IJAA 1ZSYA 1J90A 3GRRA 1MHTA 2NTVA 3UXYA 4D99A 2CXOA 4B3HA 4V2UA 4CMEC 4G41A 3EFOA 1G8JA 4DQVA 3WBFA 1BYIA 3JD4A 3MS4A 1E9FA 2CVHA 2WPDA 2W4IA 1RFLA 3B9BA 3KBBA 4GOKA 3QKWA 5IULC 3RVNA 4YFVA 3C7CB 2JEOA 4U0JA 4UREA 2BDEA 1E9DA 5ERGB 5H80A 2G9NA 2I91A 2O4UX 1T8RA 3G6KA 2CYAA 1SJ9A 1U80A 1PSZA 2PS0A 3FTCA 4Z9XA 3STWA 5DT2A 3UZUA 2QTGA 2IRWA 4WZAA 5DVZA 5HS4A 1NA5A 1R64A 1VL8A 1RRCA 1QX4A 2BBTA 2JFNA 4B7CA 1T8YA 2JFYA 2NVOA 2VTEA 3BWYA 4JLKA 3RYFA 2YWHA 1J23A 4LOJA 3FFBA 1EUDA 4EYQA 1GL6A 3HYRA 4NIMA 4ISBA 4MW5A 2I9KA 1JDBC 2FPWA 1K2VN 4Y30A 1M74A 4YROA 3QW2A 1E94E 3CV3A 3TOXA 2VTDA 3JARA 4XWYA 1M2OA 2M9MA 3FDZA 5EIWA 1L5ZA 3OEEA 1WDTA 3AF0A 5AKLA 4MV9A 1EWYA 4NYIR 3W5CA 4JBYA 2CLOB 4RZHA 4UNIA 4YBRA 4CUKA 5AVOA 1FBTA 5BV2P 2JLUA 2O1EA 2WMDA 4NABA 1T36B 2GN2A 3OZTA 1DIGA 2AR9A 2P4EA 4YJFB 3RV4A 4F5DA 3THWA 3LIPA 1PK9A 1T2CA 2VCEA 2PPLA 2OCIA 3IQHX 5EFZA 4XYGA 2HBZA 4BBZA 4RK5A 4DA8A 2PBFA 1X14A 4AKTA 4BLQA 5I48A 5CT8A 2E6KA 3CX7A 3MB8A 1A9SA 2X3UA 4ECAA 4XEUA 1E0SA 2X8LA 1C30B 1JQBA 3P5SA 1G20A 4TUYB 1C0KA 2Z9CA 3IRUA 2GZ2A 1P4JA 4NHEA 2J31A 1W87A 2H1RA 5AM0A 3GNTA 2A35A 4RHCA 4BO5A 5IUJC 1ZI8A 2G4VA 3OCUA 2RIPA 4MAMA 1UANA 4YAIA 3KXPA 5CVDA 5JAPA 3RAEC 2Y1GA 4LGYA 2XGGA 4D2IA 1ODJA 3C8HA 2AG5A 3OJXA 1L5WA 2JNWA 2XWBF 1BWRA 5F12A 1Z2DA 1USWA 2G06A 3P9ZA 3DFIA 1X94A 4O6VA 1LPPA 4HUJA 1E7WA 2GBCA 1OWMA 2AFIA 3I12A 2FR8A 4ILEA 4F2HA 2EKQA 2BWJA 1L4HA 3KDAA 1NYQA 1NZDA 4Q9AA 3TB4A 1WZCA 4JA2A 4FOPA 4K1LA 4NCJA 5CVJA 4WVFA 1POXA 4H77A 3RFTA 3MK31 5HFNA 3TG8A 4JI7B 3A2NA 2VJLA 2W4MA 5T41A 3L9XA 3ZXIA 5D3ZA 1M6YA 1MP0A 3TNJA 3IA2A 4D41A 4F5EA 1PWYE 5CVEA 5CXSA 3THWB 1O77A 2OAP1 5L7TA 2F1KA 1BVUA 1LY1A 5JJKA 1EFRD 3U0VA 1BYUA 4TLAA 1X8JA 2FEPA 1DKQA 3ETEA 4CKEB 3CNEA 5JCOC 1S8OA 1SCDA 4IHJB 4KPUB 3C3YA 1Z0ZA 4AECA 3W6UA 2JFBA 2NU7A 2YN2A 1ZITA 1XZNA 1EWKA 3CT6A 4RIFA 2H29A 4YRMA 4CKWB 1J0BA 2O0HA 3MW8A 4D9EA 1MO6A 4BJ3A 3TLGA 1U65A 4MYDA 1O4VA 4Y2SA 4L0DA 1COWA 2GN4A 4DMUB 1P6XA 3M9WA 4ENTA 3WJ2A 2BFOA 3ESCA 1ZK4A 4ZGBA 4B8YA 1JR3A 4OHBA 4CT0A 3EGXA 3B5EA 4UFNA 4YRQA 2BHTA 3W4JA 1RHUA 1RYHA 2RGDA 3FPAA 5DMHA 5J2TA 4M8LA 3FY4A 2J1LA 3N53A 1E1LA 3FLMA 3LBFA 3A31A 3MLEA 3DEKA 3UMMA 2NZVG 4GR4A 2HIMA 4GYYA 1F8YA 4Y9UA 3ZJVA 4HNQA 5JSZB 3FZNA 4ND7A 1DL5A 5CNKA 2JFQA 3LQYA 3GAMA 4PN3A 5CA1B 3E23A 1N3BA 1XCMA 1TUEA 1QG2A 2IZOA 2GDZA 1JQAA 1XMJA 5ALJA 4CQNA 2YJTD 4KREA 2APJA 1TRKA 3DZJA 3EZ2A 3LFTA 1FNNA 5FLXA 5AJZA 4NE7A 1VBFA 1VSUA 1E9CA 2OECA 5AKEA 5HW0A 3ZXYA 5TSDA 4UTVA 4O2AF 4P7BA 4QFMA 1V8PA 4XDGA 3LF1A 1NU6A 3B12A 2WLSA 4F3YA 4FK8A 4OKSA 3EFHA 2XNDA 3IPLA 4EPRA 4WDRA 5I7OA 3JD0A 4EY6A 5EKTA 4QQNA 5KDDA 3VTZA 4AG3A 1Z6AA 4FBGA 2HU7A 2VQ3A 3YASA 1DP4A 1RWOA 4XWAA 3CR3C 5LP1A 1S02A 2D4HA 2PLWA 4EA9A 4YUYA 3LKZA 1GGFA 3ZEAA 2QMYA 2A7QA 4P4UA 1O95D 1TMOA 2AEFA 2BOVA 4U7TB 1AKYA 2GPAA 1AXGA 3BQNB 2OHHA 3PE3A 4ND6A 3UGQA 2D1TA 4QARA 1XD2B 4RF3A 3QQ5A 1F0KA 3W5SA 4WLVA 2O2EA 1UXHA 5BSFA 1I14A 1ZGCA 2OZLA 4LCEA 4U2GA 2WD9A 2W6ID 1Y3DE 3DGFC 4MPDA 4GX5A 2KW5A 4FHZA 4U7DA 1H6AA 5BSEA 1C1YA 3KO8A 1HNWB 3V7NA 3P0RA 5A1JA 1BXGB 1O3YA 2X7HA 2XVMA 3NP9A 4HX5A 3A1EA 4IRUB 3UN1A 4E4TA 4J49A 3RROA 1EQUA 1PQUA 3VVBA 5AW7A 1XMSA 1DBSA 3K4HA 4FSDA 3DBHA 4LC0A 5HG0A 1NRXA 5K2OA 1I3CA 4ZO6A 5HJ5A 3QSYA 1O57A 1OWLA 2IUFA 4NQRA 4DA7A 1RBQA 3UG6A 1XRJA 1FMTA 3CQ9A 2R6JA 3RLFA 3LT0A 5IMSA 1A4IA 1KJ9A 2FW6A 4ZRNA 3TR0A 2XE7A 2ZRQA 2OL4A 3U4QA 3U4MA 3ZWYA 3FE2A 3HY4A 2ZRHA 1JYSA 4LDAA 1J39A 3S2ZA 3BPSA 3G82C 5IXYA 1UPTA 3IPAA 2VYND 2XKKA 4QTUB 3RIHA 3W2HA 5J2UF 1WETA 1ZIPA 3SY8A 3A32A 3TXYA 3TF5A 3E35A 2XUZA 3FOWA 1ZD2P 1I33A 2ZXUA 1KVQA 4HB0A 4YQEA 1YBAA 2OB2A 3ZHVA 1T9AA 4DL9A 1EXVA 4Y1EA 3ILSA 4G0PA 1D2HA 2BM0A 5KYNA 1QZTA 1KK1A 1Z38A 2DRIA 4KLRA 1OASA 1EI9A 3L6EA 4WVLA 4BECA 3U5TA 4ICIA 2PMDA 3FYUA 4X41A 1WCXA 3IULA 2DHRA 1PG0A 1D1TA 3ZDEA 1JRLA 3OEHD 5BQPA 2H4FA 3BEOA 5CXUA 5K0GA 5L45A 3ONWA 1PJ2A 3VSEA 4TMYA 4PX2A 4G81A 3OQ1A 3ZGVA 2WJIA 3FFTA 3PD7A 4Y6GB 4TM7A 3R9XA 2HGZA 2H1IA 4QXMA 2FAXA 1SOVA 1MRNA 2Z6VA 1NVKA 4NOLA 4JX9A 1UMKA 4KRYA 1IBCA 3CX6A 5FWNA 3R9KA 1A5SB 1N6KA 1YJCA 4WK2B 1CZHA 3IS3A 4IOLA 2F1IA 2WV9A 2I62A 5K6AC 2G0NA 4IQ0A 4MS3A 3BXPA 5EIBD 3HRIA 3Q7QA 2B1IA 4I6GA 4JSYA 3R3SA 1ESDA 3H8JA 3RAPR 5KWEA 3W9SA 1FLVA 1ZMTA 1NUSA 5D6OA 4YDQA 2AZMA 2ZRBA 5EMJA 4BNLA 2C8LA 4JOBA 3HWRA 3TL3A 1E89A 3ADCA 2YVUA 1VZ3A 3JV7A 3BWXA 1MENA 1V4NA 4QXOA 4DDHA 2FF7A 4ZI3A 5KJFA 1R50A 1GKUB 2Z2IA 1A5BB 2FPRA 4I4IA 4MR9A 1JSCA 4LK3A 4LSMA 4FDTA 5JQGB 2BF7A 1EHIA 1S2DA 1V1MB 1K89A 1YR3A 3WY9A 4TZ0A 4OHMA 2QUZA 1NSYA 4ZICA 3E9CA 1MLDA 4F4UA 3WB9A 3NIGB 2YY7A 5TDHA 3C24A 4EABA 4LHYA 1NNUA 3B3JA 3TJZA 4B44A 4NTZA 4RVOA 1U0JA 2DR2A 2PSJA 3S0JA 2I4LA 3WXMA 5FI0B 1CEYA 1E3SA 3L6DA 2R62A 1P7VA 1XUOA 4M1EA 3OPYA 4Q16A 2PKWA 1O54A 1CG6A 3GLKA 1QC5A 2JZCA 1JJAA 1W9HA 1DBIA 1KRHA 4Z51A 4MQFA 2EFCB 2EATA 4UM7A 2EBUA 2WP8J 4I4LA 3D6NB 4FSHA 1E2FA 1KMHB 2OPHA 2GK6A 5K0EA 1IOZA 3L1VA 1RHJA 1SC6A 4Z4QA 3LS2A 5CJJA 5H7XA 5AVRA 1G4HA 4X97A 5FJIA 1WNTA 1GR1A 4QC2A 3TIGA 1PT5A 2BEWB 1ZA1A 3KQLA 1CNEA 1SGWA 3K0FA 1ZDMA 3WHKA 2WKSA 3LBHA 3NHMA 5TGTA 1G6OA 2QRLA 2R1VA 4X91A 4ZD6A 4UFOA 2VAXA 3RJTA 4AUKA 1I2CA 4ZEOA 1EE9A 1A7KA 3UB3A 2AEJA 4XW2A 4MR8A 4OFZA 1CF4A 3H7AA 2ZR8A 2RJOA 3CX8A 4GOXA 2PWYA 3KKLA 3X43A 1W5BA 1F4PA 3NTOA 2BR5A 3DQPA 1ENPA 1ODTC 2V9ZA 4U63A 1SQFA 4EW2A 2GGSA 1ECLA 3KHSA 4MULA 4RA6B 3VPSA 5HQ3A 4G4JA 5E6RB 1DWUA 2O7NA 3BA6A 4LDQA 1E3LA 5K0SA 2XQFA 2X6QA 3I04A 5LUBA 3COYA 4BNUA 4KNVA 5DHQA 1R0SA 1RQXA 3C6KA 3F6YA 4JV5B 2CDRA 2QZZA 3N59A 1N6PA 1WD7A 1FCJA 1RKBA 3QLUC 3KAKA 3KKMA 3VR3D 2C42A 3DP9A 1EFAA 3RKUA 3QELA 1Z08A 3EJ6A 4G9GA 5B7NA 4HZUA 2UZ1B 4RKEA 1DTWA 3T1TA 1WHSB 3I9KA 4RMJA 4DDUA 2QQFA 2ZIVB 2QLNA 1FRNA 2J3KA 3B9PA 1RMTA 3LT5A 4C87A 1J25A 5J3JA 1D03A 3GZJA 1C2YA 5D84A 5DXJA 1CY8A 1GPAA 1RAFA 3DL4A 5FLEX 2Q2QA 3HACA 4NK5A 2YCBA 4RYDA 4O4LB 2ZJYA 2IH4A 4P8RA 2JGAA 3BMXA 5F21A 4O4LF 5ALRA 1L1FA 3X1JA 1ISIA 1FYDA 3SG0A 4CYMA 2FETA 1NDHA 1ZNWA 1Y1SA 2FDXA 2RHHA 2ZXFA 3D7KA 4PC6A 3CRNA 1ZONA 4LMBA 4PYNA 1EHCA 3WGZA 1QK4A 1V3VA 1FX0B 1URPA 4UATA 1WHTA 1QR2A 4H08A 3HZHA 3K9CA 3B5JA 4MKFA 4WNAB 4MYHA 3HB5X 2FI1A 3G1UA 5AVVA 4F6CA 3H16A 3HDHA 1UBHS 1GPMA 4L8GA 1CIJA 2J6BA 1T4GA 3CC8A 3LX8A 2AZ4A 2OY0A 3GBVA 3DZCA 3O4IA 4RHEA 3AESA 1NW4A 1YOVB 3D6JA 3LBYA 3NT4A 5EFOA 3Q10A 3U6BA 2XW6A 2QG6A 1YRAA 4Y6OA 3RT7A 3UFXB 4QUJA 3VZQA 3VHXA 1K97A 3PC7A 2ZT5A 1PCXA 3GJQA 4Z0PA 7ABPA 1Z5OA 2RGNC 5GP1A 3U3MA 3ZWXA 5CB8A 1AMUA 4DMCA 1P1BA 1YHZA 2QAJA 4FZVA 4Y7DA 2YHIB 4BV8A 2GCIA 1TZKA 1HLFA 2M2IA 2PMFA 2BGMA 1G19A 2FB9A 1H66A 5KYYB 2V0CA 3ZV6A 3DLPX 3DE1X 3DE7X 3IOYA 4QD3A 3L7YA 4L8LA 1JPJA 4MP8A 4F85A 2MYNA 3ML1A 1XTZA 4NEHB 5AUOB 1IQPA 1KOFA 2BGJA 1TO6A 3G0OA 3KAPA 4GGOA 4N8DA 2PV0A 1ZGBA 4TV9A 4YRTA 3ZQKA 2AN5A 4L0MA 4ARVA 4D79A 5DCLA 5CDFE 5JXIA 2N1BA 2NO0A 4N0PA 4LXYA 3I1IA 3IT0A 4GR5A 2P4HX 2XUQA 1BDIA 1MVOA 1A4RA 1TZBA 4GUAA 1PSDA 4W6ZA 2VZ0A 1ZQ9A 3TAUA 3CE6A 5I4BA 4I9NA 5I7RA 3PHCA 2YV5A 1HWYA 1N92A 1N5LA 2QVLA 4U9HS 3K30A 4HPXB 1HBJA 3QWAA 3UNXA 3F78A 2Z8YA 4FXPA 2Y2UA 4UTZA 4YT5A 1W93A 4O5AA 4TV9F 3ZVKA 2FMFA 3QXGA 1TEHA 1YRYE 1KEUA 2O7VA 4KO1S 3MMNA 3HBFA 4DV3B 4I9FA 4AMGA 5CIYA 3B2NA 1XR3A 3KJFA 4CTKA 1V48A 2VN8A 3HFRA 3IXLA 3DHNA 3QLVC 5AJTA 2COUA 1SXQA 1WY7A 2CLFB 1XJ0A 2MMGA 4NS4A 1RNLA 1I0LA 5K7SA 5K45A 1YMQA 1ZJ5A 4XASA 1SHTX 1PU2A 2EJWA 1BXRB 2ZWAA 1HL3A 3M2PA 3R0ZA 4OQMA 1Y1PA 1UEIA 3PDCA 2OYRA 3FOAA 2NU9A 1CIPA 2JLSA 1D1SA 1R8XA 4PFKA 4FIZA 4JLMA 5DN9A 1W6UA 3GEMA 2VF8A 2ZE5A 1DKRA 3W3ZB 4M7OA 5BW8A 5LJIA 5B4UA 4UAVA 2O2JA 2GNOA 2JJ1A 1ORIA 4JITA 3N75A 1KY3A 5JDIA 4L4YA 4Q93A 4A8TA 1O94D 1WM1A 3AOGA 4WCFC 3P27A 3PFKA 2MSEB 4BX9A 2GLTA 1GA1A 2D5AA 3R09A 2W98A 4PQRA 4B4UA 5T4EA 3RPEA 1EP3B 4K0RA 1LBEA 3C4JA 2FFJA 1QLJA 4YV0A 1PFGA 3PXBA 4NE9A 4PXAA 4F5YA 4LUCA 4EJ2A 1CRLA 1E4VA 1FUIA 4DDVA 3AQ4A 4TMWA 1SHLA 4CLHA 3A1FA 5EAIA 5CDFA 3DR3A 4QJIA 1Q7EA 2YHIA 3CNLA 4KAXA 4Y9SA 4S1VA 1R0LA 2B3DA 3B2EA 3I5XA 1BN7A 3N2ZB 5BYBA 4NVRA 2ONJA 4UTOA 2JFOA 1MX3A 3ZY3A 4DRXA 5EIOA 4GHWA 2UVPB 5H8WA 1FDSA 4WOKA 4YRBA 1N6RA 1WVGA 3ORYA 1PLKA 3GCWA 4MUEA 5BN5A 4KQHA 3B8HA 5L51A 5BYKA 4OXKA 3LXRA 5CM9C 4PICA 4RF2A 5JDIC 3IVXA 3AESB 3FWPA 3GPDG 3L05A 4JR1A 1NW7A 5LZ8A 4ETMA 3LA8A 2Q45A 3NBKA 4W1PA 3CX4A 2C2XA 4EPTA 5BUQA 4HAWA 9ABPA 9MHTA 2VF4X 5K0FA 4B84A 2D0PB 1PNVA 1D2EA 2AYYA 1XYYA 4YCCA 3FPKA 2GPJA 3M5PA 2I7CA 2JRLA 4I4TF 1LNSA 1D5WA 3STTA 3X2SA 3O0DA 1P5RA 5KAMA 4MUFA 4TXMA 2YXEA 1S4QA 1Z6YA 3O4HA 1E7RA 1QZZA 2H48A 1F9AA 4QOHA 4YX9A 4INJA 4EW6A 2RHRA 3AF1A 3OQIA 4PC7A 1JDNA 4JT8A 3FOZA 3RU7A 3JQ9A 3ESYA 1LD3A 4Q48A 3FWHA 2RAVA 4BQNA 4JDPA 2JANA 1ZINA 1IM5A 3ELUA 1PE0A 2IPNA 3FFXA 2PNJA 2IXTA 4F9FA 3KK0A 2VAWA 4WKBA 2YXBA 5TQ2A 4EB6B 3GEDA 4PZPA 1L9XA 5IJ0B 3U49A 2GZ3A 4WESB 2PLNA 5E1OA 3AKEA 4YAWA 1N2OA 5F52A 2LCFA 3SF8A 3GBSA 4AYTA 3T5DA 1L4GA 5KQRA 3D6MA 1H0RA 1KTIA 1UWKA 3KSUA 5EKUA 5EZ5A 5A4FS 5KEIA 4PWYA 1CBUA 4BMOB 1EK5A 3IR6A 5F78A 4YP9A 2D00A 1XN1A 2I3ZA 2QLFA 2AOUA 2JLYA 3AI1A 2VAMA 3PPYA 3OC0A 1TUBA 5JEDA 4LX0A 4W8OA 3DT6A 3RYHA 4ARBA 1KPIA 3Q72A 4E3ZA 1M1YA 2RHBA 4FYWA 3E5NA 4DCUA 2CBZA 3T1OA 3U2QA 3WQRA 1M0TA 1N7JA 4ZI7A 3ANYB 1HDZA 4MIEA 2ZKIA 4MO9A 1PDVA 1FRFS 1L5NA 3VH3A 4MHTA 2IXGA 1QOZA 3OEWA 4HL6A 3P0FA 5CB4A 1IBLB 3B36A 4ZYYA 3U7RA 3JQAA 4XIYA 5AJUA 3VAZA 3ZIUA 2OORA 4YJDA 4A2WA 2ZREA 4JR0A 1C8LA 2Y1FA 1EBUA 4OMFG 2ZRGA 4C0JA 3BK2A 5CAEA 3F6PA 3WL8A 4G5HA 2I3BA 2F8SA 1JLHA 1RM4A 1GA4A 1VBMA 1JDTA 2XRYA 5K0JA 2HWUA 2J4CA 3S6JA 1P9LA 4TL7A 1GAQA 5FPPA 3VR4D 4BWVA 3I01M 1KWGA 2K6GA 2Z8ZA 3D8TA 3U1BA 2Q5LA 4MV7A 1UF9A 2VJMA 4J7AA 1BWQA 2Q4EA 4GS5A 4MQLA 5EINA 3JZDA 4YGXB 3PC2A 2XMGA 2VVTA 1CWUA 1PVVA 2A5LA 1Z33A 1QO9A 2GK3A 5KTNA 4KMMA 4X60A 1GA6A 5IH3A 3UCEA 4CN9A 3DD1A 3ID6C 1IXZA 1YJ8A 2NW6A 2C4HA 3OFKA 2KWIA 3Q8WA 2D3WA 3O8OB 4CNBA 2IS4A 1ZJ6A 1XKTA 2V7UA 1NOJA 1V25A 3UAXA 3VTKA 4BNXA 1G3IA 2CL0X 3V1TC 4BN5A 1PFWA 4QAJA 5CDYA 4WJLA 2JH9A 1TTHA 1NNI1 2WFLA 3N1UA 2MSLA 2PGNA 1O6BA 3PB3A 3AB8A 3CEAA 3Q3JB 3UHOA 2C9CA 4RFLA 4AUEA 3HSKA 1JHUA 4F1JA 2M98A 5EJ8A 5HIMA 2HXSA 4JQCA 2DBYA 3L6OO 5ULLA 3I9JA 5E1BA 5LXTB 3P0JA 4GBMA 4R1NA 5LFAA 2QP9X 2X77A 3ZDXB 3UTCA 2WJPA 1WXIA 4CN8A 3Q12A 1DOHA 2NU7B 4YAUA 1S3GA 3STVA 2G4LA 2Q9UA 2AVNA 4BO7A 1KS2A 3QU2A 5KTOA 1M1YE 2RHJA 4ZT3A 5HBRA 3PA6A 2BLNA 1HORA 3H86A 2AVDA 3HJBA 2VJNA 1VI2A 2I8CA 3M6UA 3B53X 3I5MA 4QO8A 1YUNA 2Y27A 3PDWA 4RENA 2PMEA 1HA3A 2C4TA 2HWKA 1YA6A 5ED4A 3H11A 4DLZA 1UXJA 4GM4A 4PRZA 1NQ5A 1II9A 2JJQA 4KWEA 3RRXA 4B3CA 1D4AA 1HYBA 2HBRA 3AP3A 3MVEA 3EAQA 1YKFA 3OT4A 1PD1A 5LYYA 4PVDA 4W1RA 1BDJA 2Y1WA 1N2BA 3AF4A 1RZRA 2PT5A 1G98A 2ZJFA 4X7MA 3ICQB 2IYNA 4PCVA 1I2BA 4Q1CA 3KRTA 2E4UA 3R3YA 5CB4F 4YV2A 2JAQA 4EKYA 5FUYA 3P9YA 1G18A 2CCGA 1N5JA 3E9RA 2DKFA 1E3WA 4IIUA 4IIDA 1T1RA 1ISPA 1H0KA 1P7ZA 3NLLA 3IV6A 2Y71A 4I8XA 4MVJF 3H1BA 4KAFA 1JQEA 4D9HA 4R71A 1U2GA 5HCIA 1QF9A 4C2AA 4F2WA 5K05A 4Q18A 3OOYA 1YFJA 2XUFA 2H31A 3TR5A 1QFYA 3AFHA 3HRKA 2QLMA 1VKRA 4JL5A 5JRZA 3R9XB 2VL7A 1Y7HA 3EUEA 4K40A 4ZDJA 2R48A 4UBMA 3EY9A 1DWQA 4HDKB 2NZYA 3W5HA 2C9BA 1OIXA 4D6YA 2ZYAA 1PT6A 2INGX 3A6ZA 3I0MA 2IHTA 3P45A 5DIFA 3TZBA 2OSBA 3ESDA 2A4KA 4WY2A 3DHWC 3EDYA 4OJNA 2RD2A 2CWWA 4PLWA 4UFPA 5CH5A 3SMQA 4KJZA 2KLHA 1SXIA 1QK3A 4FJ2A 3NGMA 2LR0A 1EJ6A 5AIBA 2XXBA 1Y63A 4NE2A 3IQGX 2G8NA 1TKCA 5J5VA 1L5OA 1WXHA 1ZNQO 2ODWA 2GZRA 2Q3EA 2NV2B 4FYKA 4G65A 5HS6A 5CPBA 2WKRA 3QOWA 4C03A 1I4WA 5FA5A 3MOGA 1UQUA 3AVOA 3UAWA 3WGQA 2M1ZA 3OCJA 5CEFA 2PUFA 1USVA 2MT9A 1D7OA 4JXZA 1IBMB 4CWAA 3FMPB 3KKPA 3TSAA 1DARA 3AERA 3IJ5A 3PV0A 4BZQA 3NAZA 1KU6A 4YJ2B 3AGPA 1E9BA 2JLAA 5ILOA 4XWGA 2WRZA 1NPTO 3NKLA 5B2EA 1L4BA 4GG1A 3TOZA 3GMDA 2OFPA 1KO5A 3DNMA 3WKDA 2HWWA 5EHZA 3F97A 4R05A 1ZP6A 3NWBA 1ZHHA 1BE8A 2YC4C 3SQLA 3HDTA 4YRJA 4DSNA 1JXAA 1D07A 2H2DA 2PGLA 3BH7A 3GRCA 3JQGB 2UVQA 3G9QA 4MW9A 3LUFA 4IDHA 4RNDB 5DN6D 4AS1A 2C5AA 1DAIA 3DA8A 3DUFB 3D6HA 1YACA 3IKJA 3K73O 1UMBB 1J7JA 1AK9A 4KR9A 3UJHA 3ZW8A 5F5XA 2ADOA 2V54A 2VKTA 4R8LA 1JWLA 1E1CB 2DQKA 4JNCA 3VR4H 3OPVA 1KQNA 3WMRA 2WQ7A 1RP7A 2UYOA 4PNEA 2GK4A 3MUNA 1U0LA 2FOXA 4HDOB 4ZQCB 4A91A 1T6NA 4RACA 4ZJPA 3AV3A 4RFSA 5AI5A 3COSA 1B8UA 1I4DD 2JJ2A 1Q19A 1YR6A 3AETA 3C87A 1PGJA 1O97C 1ETHA 3CW2A 4NFLA 4P22A 1T26A 1ISJA 2AXEA 1MB4A 1I0ZA 4FINA 3HKCA 5AM4A 3U80A 1YB6A 3VUFA 3WISA 4PYIA 4W9MC 1MB3A 3PWTA 3T3NA 3HLKA 3QA9A 4YRSA 1L8XA 3I5UA 1OB2A 1FPMA 2EWVA 2IYSA 3DWGA 5G02A 3HS3A 3UB2A 1WUHS 6AT1A 4RTRA 1S2IA 1G9SA 1SCKA 1JFRA 4PZZA 1E1QD 3CVWA 1QRDA 4IO1A 4TZTA 1C9JA 3JVIA 1YB4A 5ALZA 1BSVA 4CMKA 4ED9A 2RG7A 3OTOB 5EXTA 3EA5A 1Z6GA 2FYTA 5JWHA 3W2IA 3TD6A 4MWSA 3C1OA 1U5BA 3F90A 1Z0SA 2OO3A 1JHQA 3DFMA 1NY5A 1U2ZA 4C07A 2VSFA 2ZBVA 4Q3KA 1FP4B 2YINC 3NWOA 2DPMA 1W19A 3G7NA 3PUIA 3QWHA 4HQLA 1TW2A 2JGMA 4KMSA 4EL5A 2CF5A 3NBXX 4M1YA 3H8VA 4WXEA 1YB7A 3CLKA 2G77B 4RTMA 1HNNA 4FZ3A 2ZKLA 3KR9A 1SU4A 2KS6A 1ZO8A 4HYEA 4JHLA 4YWJA 4CM7A 4XPIB 2MINA 1I3OA 3HL4A 5TV2A 4D56A 1V0JA 1ZOOA 4F1WA 2QSYA 5BNZA 4G1BA 2VG8A 5DTIA 3UOAB 3T5CA 5EJAA 4WZ6A 5DLYA 4XLLA 1KEZA 2N1MA 3EQ8A 2YS7A 4LNHA 1T9DA 3UUEA 1TA0A 3I3SR 5JY6A 1TYZA 3ZV7A 3C5WP 4DPLA 5K0CA 4LBYA 1ZCZA 3A4LA 4FC7A 1L7RA 2IVZA 3GLVA 5KYUA 2P1ZA 4YV7A 1IWOA 1KHTA 3PFGA 3SHFA 4UPEA 2I6QA 2JD2A 3UT5A 1EVLA 2B34A 2G70A 4RFSB 3ECAA 4IS2A 3M70A 5DLEA 4P84A 1BWPA 4KGDA 5JTUA 2CUZA 1KEEA 1UP7A 1E5TA 2GEBA 2Y05A 3NETA 3R5JA 5EVCA 1ESEA 3AL3A 3QU9A 3VNRA 2PIDA 4X8LA 1EFRA 1M73E 2PSFA 4GXRA 421PA 5ESWA 4RZ2A 4QPZA 3N05A 1Z8FA 2PH3A 4R0MA 1C9EA 3ZLJA 1HT3A 2FRDA 2K2WA 3N6XA 2NUPA 4U7PB 3NJRA 3EN0A 4G4GA 5HFAA 5BT9A 3CRRA 1K08A 4MS4A 4RDHA 1G2PA 1TIKA 3TTYA 3HYNA 3D3WB 2ZE6A 1Q0PA 3UKJA 1JI0A 2BR3A 4ZGGA 4X1IA 2XYHA 3AF6A 1F8XA 3UFXA 2YY6A 4BFXA 3PDIB 1RAHA 4MIKA 4TLLB 2QX6A 2E18A 3MJTA 3DOUA 1SD2A 3PCTA 1QKIA 4LRWA 1M1YB 2EDCA 2PKEA 1TA4A 4M99A 3V8QA 3ZD6A 2ZSHA 2MTBA 1TQ6A 3RVOA 4LOAA 1ZH4A 5KVVA 1TC1A 4IHAA 2BFBA 3GP5A 3FYUB 1S8AA 3QOXA 3N76A 4MA0A 4FMPA 2RGYA 2XHEA 1ZK1A 1GSOA 2C4UA 4FVTA 2RB5A 4JOSA 1REQA 3GD5A 3OQ6A 4O4JF 5DM4A 3QBVA 4H7DA 3SKVA 2VUSA 2FRDC 2QXTA 3L8EA 2H2IA 4HAXA 3KC2A 1W0CA 3M6WA 2ZJZA 3MTAA 3B3QA 5AVQA 2DY1A 1B42A 2RGEA 2QR3A 4BUJA 4D74A 5KX5F 1DPFA 1QE0A 3EGCA