5E4FA

The spring alpha-helix coordinates multiple modes of hcv ns3 helicase action
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Spring alpha-Helix Coordinates Multiple Modes of HCV (Hepatitis C Virus) NS3 Helicase Action.
pubmed doi rcsb
source organism Hepatitis c virus genotype 1b (isolate con1)
molecule tags Hydrolase
molecule keywords Serine protease NS3
total genus 150
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5e4fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA01
3A58B 4S35A 3SDZA 3IUYA 2OBLA 4RCYA 1XP8A 4PQYA 4PQRA 3TSZA 4AG6A 3KUCA 4NL4H 4F4IA 2F3RA 3BFVA 3LY5A 4RZUA 3HPQA 3ZS8A 2J45A 4WBSA 2LWIA 4LHVA 4TL9A 5FUYA 4GL2A 3O8DA 3U3JA 4DVGA 2R62A 1MO6A 3SC3A 3REGA 5HE9A 2QN6A 4B34A 2G6BA 1TL7C 3HWSA 2H7VA 1OH8A 1SVKA 1AIPA 1H8EA 4V0OA 4Z51A 1Q1EA 2FNAA 2X77A 1SXJB 4QHYA 4R2IA 3L82B 4PHTA 4ARZA 5AK0A 3KFXA 1XJ0A 4LJ7A 1CTQA 3KKQA 4O25A 4A8JC 4EFLA 2WJVA 1SKYB 2X1VA 2GZDA 3QE0A 4D80A 2D7DA 4BFZA 4GOJA 5EJEA 3T06B 1COWA 1PUJA 1OIVA 1ZD8A 3RS0A 1DE0A 2EFCB 5H68A 4KVAA 2V54A 3K0FB 4PO1A 2QM7A 1NG9A 1MOZA 2D4HA 5DYIA 1TUIA 1QHHB 2JLQA 4QGHA 1P5ZB 3UG7A 4LV5B 1LS1A 2HCBA 4C2UA 3VAAA 1J90A 2DFNA 3MWYW 2BOVA 5IK2D 4P4SB 2PMDA 2SHKA 1G18A 5JEDA 3KL4A 1XPRA 1ZCAA 2QE7A 1GNPA 1IY2A 1TF2A 4HAYA 3EASA 4IW3B 3K0AA 1DS6A 3LDAA 1WB9A 2XSZD 2HLDA 4C0HA 4QL3A 4TQUS 2C5LA 3SE0A 3JVUA 3HP1A 1RJ9B 2W2VA 5K8LA 4D4LA 4A82A 2BDTA 3NC1C 3R9IA 4ZI3A 1N5LA 4DLUA 1ELOA 1FL9A 2OT3B 4TQ9A 5E7IA 2MMGA 1QZXA 1OKKA 2AWOA 4ESHA 1XXHE 1XMSA 2XNDD 1YVDA 3AUXA 3U7FB 5FPSA 3AUYA 2HF8A 3BFXA 3CX6A 4NMMA 4O0MA 4B2LA 5SZHB 3EZ2A 2C9YA 3D7MA 4LBVA 1KI1A 3CUEF 2ODBA 2OCPA 2YC4C 2CL7X 2DB3A 1KSHA 2IF2A 2QI9C 3K70C 1W0JD 2HYDA 3EPHA 5FBLB 3ZS9A 2WIAA 4CIDA 2BM1A 3RS5A 3W8NA 3H0KA 3Q5EA 2N42A 2V9PA 2YYZA 4CGZA 4M22A 4URUR 4WZAE 3CBQA 4IDNA 2GVDC 3PENA 3VHXA 1SVOA 4NTZA 5D3MA 4JT4A 3MMPA 5EXXA 1DAFA 5HCNA 1CJUC 1U0LA 1GUAA 1OSNA 2QMEA 1KAOA 3CF0A 3DVLA 4AK9A 2OESA 2PEZA 4XSGA 3AV0B 1IN8A 2AHOA 2WKPA 1UBGA 4A6XA 1DTSA 2D06A 3PV0A 4QM7A 4YLGA 1I4DD 3OIYA 2ZI6A 4Q4JA 1OLOA 2F43A 4KYUA 3KKPA 1ANKA 3FKSA 4BFTA 3VR1A 4AY2A 1E2LA 2O0HA 4U02A 3KJIA 4YMSA 2A30A 2CCJA 1U81A 3SJAA 4R71A 5KHOC 1XNJA 3AVTA 1R0YA 2QTFA 4KYIB 3LQRA 2G9NA 3AVUA 4U7DA 1P6XA 1ODFA 1VIYA 4NBSA 3VQTA 1GKYA 1IXZA 3NBFA 3UKDA 2W6ID 4MGIR 1A1VA 5C46F 4OQMA 1QHGA 1W49A 1XTRA 1YZLA 3L8YA 3SI7A 4P4UA 3OFNA 5SZJA 5CB8A 1KIMA 3KKOA 5SZIA 4DZZA 2ZRNA 1CLUA 1DAMA 1S4QA 1SXJE 4M1TA 4TN1A 1DPFA 3J81k 1P75A 2O8CB 4DCSA 3VHLB 4QRHA 4DB2A 3K8YA 4Q19A 4EUNA 3GLGE 4B74A 3PUVA 4C0AC 4ACBA 1SKQA 2GEVA 1IHUA 5CYPA 1WBDA 2PJRA 1XBTA 3PJRA 1HQYE 2ZRCA 5C18A 1Z0DA 1PVOA 4ACAA 4PZZA 5LPNA 3K70D 2CLSA 1W2GA 3OAAA 4B33A 4BFWA 3BGWA 4WXPA 2JDIA 1QHXA 1SZPA 1WP9A 5A0FA 2A2ZA 2G1JA 4MITA 1XXHA 5AJYA 1DARA 1W46A 1OV4A 2ZSEA 4HLDA 1JQJC 4JYCA 4Q7JB 2GRJA 1JR6A 3SFZA 4URXR 3SFVA 4A2PA 1A5TA 1KMHA 4LYJA 5EE0A 4E09A 3ECCA 3ZYCA 4LHXA 3AF2A 2IUTA 2J9RA 2WPDD 3GJ0A 4D6PA 2QAGA 1BS1A 2FGKA 5DE3A 3CPEA 5AUNB 3LXRA 4LI0A 3D8BA 4TSFD 2Q3FA 4C0LA 3GLGA 2ZJ5A 4TYQA 1Z2AA 2V1UA 1L2TA 3H2YA 4JJZA 1IN5A 4LBZA 2A3RA 2GKSA 3ASZA 4F91B 5DH9A 1UM8A 2O8BA 1PZNA 1Q3HA 4TLBA 3T1TA 4Y0VA 1JR3D 1WE2A 2AFHE 3MD0A 2A5YB 3AB3A 2AXPA 4CDGA 1M1YE 2ORVA 4IVQA 2JIZD 2CL0X 1CF4A 4JKYA 5CM9C 1QHSA 2E1RA 3W5IA 4Q01A 4G0NA 3C7KA 1XRJA 2FZ4A 2XJ9A 4H1VA 3O8CA 2ZE8A 5EXPA 1G8FA 1GAJA 1K6MA 2YVUA 4XTRA 4EJSC 5DISB 4ZCIA 2VP0A 3K9HA 4QBFA 4D25A 1SHKA 3B8HA 1E1QA 2X19A 5E95A 5TXGA 4R9UC 4AKIA 3QG1A 4JZKA 3B2EA 5KPDA 3I92A 2H17A 1NVWQ 4QM6A 4OJQA 1JI0A 2GJ8A 1HT1E 1RKBA 4JVMA 2O8FA 5KPJA 4PSKA 3CX8A 2IEZA 4KFTA 4LDJA 3PEUA 4YXWD 4KODA 3LLUA 1S96A 2OO7A 3IBGA 3VU9A 4Q4JB 1MRNA 3QPVA 4B73A 5JS7A 3QXCA 4HAUA 4AI6A 3P27A 1RYFA 1XMIA 2OCYC 2V6JA 4RD3A 2EWVA 4NZYA 1AN0A 1US8B 4KITB 3IIKA 2ZQ5A 1HE8B 3PG5A 2GWHA 4DXAA 2ZYWX 1ZM3A 1G8HA 1XD2A 3T1OA 3K09C 2GXSA 1VMAA 2D62A 4MYTA 4Z1MA 4JL5A 3P4YA 1J8YF 5FOSA 4UXHA 3GEEA 3GQBA 1KI6A 5AWFC 1KOFA 1XTIA 2RGDA 2IT1A 1IN7A 1D8TA 3BB4A 1CBUA 1F60A 4YDHB 4PZLA 4NHOA 2OBNA 2D2FA 721PA 3P32A 1FTSA 1E69A 2UVQA 4PAQA 2ZS8A 2PLRA 2ZRHA 1ZW6A 2JLUA 3AGPA 3P26A 2CLDX 4MRVA 2XITA 4DUGA 1FPMA 1VYUA 2QPTA 5TDHA 2OEPA 2AN9A 1Q44A 1FMLA 1GG2A 3UWOA 4DIDA 3U6BA 2EYQA 2Q9AA 5L8VA 3L8ZA 2CK3A 1SVIA 4FCWA 5CJ2A 1D9ZA 3A4MA 4AKGA 2WBLC 4DSNA 2C78A 1XD9A 4DIEA 4LJ8A 3F3YA 3FDIA 3A6PC 3AVQA 2KJQA 3LWNA 4LGMA 2ZYTX 4FMDF 2NZ8A 4P0TA 2JAQA 5JHGB 3NXSA 2YJTD 1LW7A 3GJ5A 1KJZA 2KBFA 4QHSA 5EZ6B 2JASA 2OCAA 2ZU0C 3K0AB 4QGAA 5M04A 1JNYA 1H8HA 4P4TA 1P60A 1E9RA 1U90A 1ZM4A 2QP9X 4PPGA 2Q0HA 4QXAA 3WMEA 2RGNC 4PAMA 3RRNA 5D3MB 5JJKA 2HCJB 2F55A 1XCPA 1Z0FA 1E9FA 3CB4A 3CRRA 3PUYA 2ZJ2A 2BEKA 2NQ2C 5EE5B 1KTVA 3UXMA 1G64A 4B6FA 2BC9A 2FJUA 1U98A 3QPUA 4TT3D 1OXUA 2RGGA 3Q9LA 1T3HA 1ZIOA 3B6EA 1X8LA 4KBFA 2JJ2D 2J7PA 4MH0R 2DWOA 2CXXA 3F8TA 5B58C 3UATA 1LVGA 4CYMA 4D26A 4PPQA 1N0VC 2QQEA 3QEJA 2VA8A 2ZREA 4UJ5A 1ZU5A 3DPUA 1E79A 4DSTA 3PEYA 4DCVA 3ICQB 1T0HB 2RGCA 2P5TB 4IJMA 2F1HA 3GLIE 2ECKA 4UNRA 2FA9A 2Z0MA 4QGGA 3RSLA 1JPJA 4OK3A 1Z6YA 4CEIA 1OF1A 2FOLA 2I4IA 1FX0A 3K0CC 3ND8A 5KDLA 1RC8A 4IXNA 3O8BA 3OZXA 3UANA 3U6KA 1RJ9A 4H9GA 3K9NA 1GP2A 4NYIQ 3VX4A 1PV4A 4ERNA 1NKTA 3BXZA 1E99A 4MYCA 5HTKA 2VP2A 2MSDB 3MAAC 5IT5A 5E3HA 5GJBA 2CVFA 4BLTA 1SVLA 1NRJB 1HEIA 2BJVA 3OIUA 1DAGA 2O5VA 4ZKEA 3ZVNA 2QT1A 1E2QA 3TUZC 2DY1A 5JHHB 1G7RA 4TLEA 1D6JA 4I1VA 4URWR 2D74A 3DM9B 2F7SA 3CIOA 2Q9CA 3P20A 3VNVA 2A5GA 1B0UA 3WHKA 4KLNA 1W7AA 4Q9LA 5IRCD 5F9HA 2WSSA 4Q4AB 5EQTA 4EPWA 5EXSA 3VTKA 1EGAA 4V0ME 3P4XA 3HU3A 4HUQA 5BWMA 1CR2A 3ZJYA 3RRYA 2J0SA 3MG9A 1XMVA 1HT2E 3EWSA 4F7WA 2J0VA 1V43A 4RCZA 1W1WA 2LCFA 4O2LA 1OB2A 2J59A 3QY0A 1W0KA 3AF1A 2DFKB 2TMKA 3TGPA 4IVRA 3TR0A 1YZUA 1MABA 2FG5A 3EIHA 1YZQA 1UJ2A 2QL6A 3K1JA 3T12A 1QHNA 1T91A 2WWYA 3BWDD 1E9SA 4A9AA 4ASUD 3C5CA 4JLPA 3FTQA 1Q3TA 3B78A 4PFSA 1XTKA 1G9XA 3A37A 5HPYB 3DOFA 2FMXA 4B48A 1IY0A 1CJKC 2WWGA 4XWKA 3IILA 4I1UA 1TEVA 5JRJA 4B2PA 4Q4AA 3QKRA 1OYYA 2R44A 4C0BA 3LBHA 1UKYA 1G7SA 4RZ2A 1DG3A 3VNUA 3KQNA 1FUUA 2VL7A 3TK1A 1A7JA 1IBRA 2Y8EA 4EKDA 4LHWA 1AKEA 1JPNA 1XFAA 1UBEA 3LX5A 4L8GA 4HSEA 4PR0A 3AKCA 4UNPA 1Q1BA 2H5EA 3BERA 3QJYA 1US8A 2EFHB 5L3VA 2BMDA 3RDPA 2H8KA 2AR7A 3GCGA 3KTAB 2NO1A 1G4AE 2GF9A 3QQ5A 2DPXA 4HLCA 1NIJA 4UNNA 5EZ5A 1TU3A 4RD4A 1G5TA 3OIVA 3Q5DA 4ZDKA 3S1AA 5TARA 3BH6A 1Z6GA 3VR3A 2IS2A 5KUTA 5LDDC 1U2RA 1NJFA 2O0JA 2OZEA 2QA5A 4PHFA 5CDFE 5JSZB 1VECA 3Q85A 1CEEA 2R6FA 5EXTA 3AP3A 1VKJA 1W4CA 5DIFA 2OFOA 1Z0JA 1ZNXA 4V03A 3SU8A 421PA 4TZ6A 3B1WA 4II7A 1PJRA 1UEIA 4TL6A 2ZXUA 4OQFA 1D9XA 3UWKA 5JI2E 2QP4A 1J8MF 4OI1A 4C0SA 2O52A 1XWIA 1QHYA 3A1UA 4B3CA 3PQCA 5L3QA 1P9NA 3KFVA 2DCUA 1ZM7A 4A2QA 4HUTA 3IO5A 5G40A 3OF5A 4XVRA 4JS0A 1KHTA 2OFWA 1A82A 4IOKA 1B23P 4NYJQ 5LD2B 1IY1A 1GL9B 4Q18A 2R9VA 3HU2A 2RGBA 3KQUA 1OFTA 3CWQA 4XD7A 3ZVLA 5FPKA 4NYIR 2CHQA 1QHIA 2XB4A 2VH5R 4KU4A 1XDBA 2F1RA 1R5OA 4DLWA 4JJKA 1F5NA 2YINC 2PT5A 1E2HA 4HZUB 4EFMA 1BYIA 1EX6A 1Y63A 1SXJC 3QKSA 4BGDA 3HDTA 4PPFA 4MUAA 2ZPTX 4GZLA 4LJ5A 1SXJA 3UIEA 2QAJA 2EWWA 3CWZA 3C5HA 4EPRA 1C1YA 1BO6A 5GADl 3GMTA 1BH2A 4B35A 3WRXC 5L3SB 1EFRA 1KI7A 1XZPA 3RWMB 3KQLA 5E7JA 1S1CA 2IL1A 1EFHA 2IUUA 2QMUA 4FD2A 4LRWA 1X1SA 3RVBA 5TMPA 1M74A 2QMHA 3T1QA 1TF5A 3U60B 2O8DB 2ZI3A 4DCTA 4P32A 1R6BX 2R8RA 1CJMA 4C0KA 2P2LA 4NH0A 2PMKA 4IRUB 1L7VC 4RD6A 2GBLC 3LBIA 4JBYA 3OEED 4AKEA 4POAA 5F3WB 3T34A 5J4LA 3ADCA 1HH4A 3NDBB 3VR6A 4EPYA 4Q1FA 1N6OA 3TVDA 3VX3A 2ANCA 1K8RA 2FN4A 1W2HA 4LYFA 4M21A 5EE1A 2PCLA 2GK7A 1ETUA 2OBMA 2OHFA 5G53C 1E1RD 1OHHD 2F9MA 4OK6A 2ZRAA 5FFMA 3VFDA 1HTWA 4HI0E 2HJVA 1JR3E 1KNXA 4Q4LA 5FR2A 5CM8B 1AQYA 1TPZA 4DDVA 2R65A 4YMTA 1VG1A 1KO7A 2FGJA 2GETA 2R6GA 3FMOB 3ZGXA 1R0WA 3WHLA 1AS0A 5KNBA 1MR3F 2ONKA 3B60A 1CRQA 3FE2A 1XX6A 1SGWA 5DO9A 4HAZA 1FP6A 2BMJA 4MYHA 3VMFA 5C1BA 4HAVA 4E5UA 3GJ4A 5GVRA 3A36A 1Z8FA 2CLCX 2GZAA 1D5CA 1YKSA 2WVJA 1UFQA 2AXNA 1OJLA 3E2IA 2WM9B 4QKQA 2DFTA 3CRMA 1Z5ZA 4PHHA 3W3AA 2QSYA 4XH9B 4IFBA 1NLYA 2QORA 1ZCBA 5GJVC 3EWAA 1E2PA 4Q1DA 5FOWA 2ZI4A 3SQWA 1KI9A 2JJ1D 2ZJBA 2RB4A 3L2OB 3LBNA 4TYYA 3FOZA 4FMDB 3QXHA 521PA 4GDFA 3U3KA 4E03A 1CU1A 3SZRA 1Z0KA 1FTNA 1D2EA 1OW3B 1GITA 2PX0A 1UKEA 2RCNA 3B1ZA 4QG7A 4V0KA 1X6VA 4LZZA 3C14C 1R5NA 1W36C 2EYUA 1Z2CA 3KJHA 4PTLA 4A92A 3GEIA 3UMFA 4GRAA 4WZ6A 5D3QA 3EZ9A 3WYAA 1JEDA 4ZKDA 4MYUA 3N70A 4RSGA 2B21A 1J70A 2XNDA 3OESA 3G5UA 1MO5A 4AYWA 2YWEA 3BJIC 3LVQE 1E2KA 4NYMR 5TVKA 2QBYB 2GILA 3U4QB 1XTQA 1E9CA 3PEVA 2C95A 1PLLA 4DDUA 3WBJA 3CX7A 1II0A 2G1KA 2QGNA 1NY5A 2VF8A 4R2HA 2IXGA 3GLFA 3QEOA 2WSMA 4NU0A 5JRZA 3X1WA 2IYXA 1WMSA 2I1VB 2CJWB 3RS2A 1WDTA 2J0QA 2VQSA 3Q72A 1YR8A 4TTQA 4YMWA 2BMFA 2QEQA 4O2RA 5DNYB 3QXSA 1RFLA 3M6AA 1XF9A 4J0QA 5A5GA 2GNOA 2IS6A 1Q1QA 4C0JA 3GLIB 2F1JA 4D4JA 2ZI9A 4XWOA 1S1MA 3PCRB 5EP2A 2Z83A 2VP9A 1F6BA 5JMTA 1II8B 1ZC4A 2QAGB 5EUQB 1E6CA 1HYQA 3AVXA 4M8NE 5CIWA 4LUCA 2WWWA 2O8DA 1GWNA 1LY1A 2CCGA 3TE6A 3FWYA 4NCNA 2FPLA 5FTMA 4W5WA 2QM8A 4KLZA 2HYIC 5CYOA 5J40A 2QP3A 2FX3A 1NSFA 2UZ3A 3BIFA 3I73A 1ZUHA 3QKUA 4K46A 2XXAB 5JWOA 2FU5C 2VSOA 1HV8A 2VP5A 3WMGA 1G21E 1NIPA 3ZZUA 1KI3A 2ZITA 2ZJZA 3CPJB 3HU1A 4JLVA 3W8RA 1YR9A 4QOSA 1KK3A 1TEXA 1Q22A 1X8KA 2QMOA 3U3OA 5KSOA 2ZE6A 4A0GA 4OYHA 2VPPA 3ONWA 1D2MA 3QI2A 2CVHA 3NC0C 4MGYR 5KNDA 3U7GA 4TMTA 3JZAA 4L16A 3E70C 4CEHA 5FOTA 3TUIC 5J4YA 2KE5A 2GAOA 1WCV1 5EUMA 2CE2X 2V55B 4YMVA 4C7OB 2HT6A 4A4DA 1EESA 4Y0AA 3SN6A 2GDJA 5AJZA 3VR4A 2J3EA 2ERXA 1ZC3A 3TJZA 4F38A 4BRUA 1IONA 2ATVA 3QPWA 3I61A 2ASEA 2JDID 1KO4A 4Q1EA 4BLQA 3FFBA 1D2NA 2J5XA 2HUPA 4FWTA 2P3SA 3BC1A 2PX3A 4BECA 4PC1A 4CRWB 3W90A 2Q3MA 1XTSA 3TW4A 3NEYA 5CK4A 3T5DA 4KXFB 4Q00A 3V4FA 1W4RA 3IBYA 1RRGA 1YHNA 4BLPA 3IIMA 3C41J 2F6RA 5LD2C 1AK2A 1G7TA 1COWD 3IIJA 4AURA 1QVAA 3QF4B 4EJSB 3LW8A 4TLDA 3A1WA 5E7MA 4Q9IA 1DO2A 3TKLA 2JJ8A 4AWXA 5CK5A 4RD2A 4BFSA 2WAXA 1NKSA 3IPYA 1RRPA 2V6IA 4DLYA 1KSJA 4GMDA 4GZMA 4JIMA 2P67A 2BBTA 1FX0B 2FZLA 4OQLA 2VBCA 3EZFA 1CULC 5K8IA 4OQXA 1EFUA 3QIAA 4V0LA 3MJRA 1SKYE 3PVSA 1OB5A 3R9XA 1M34E 1VCNA 3VR5A 2QE7D 1N25A 1YZGA 2HXYA 1Q20A 1VG9B 3BB1A 4GFDA 4XVQA 4BFYA 4M1KA 5JJLA 2PZEA 2ZR0A 4R98A 4A2WA 1KY2A 3WMFA 2I1QA 1UKVY 4DLXA 1RYHA 5FH9A 5KSZA 3DOEA 3EPKA 4EPVA 1G3QA 3AH8A 1E2MA 1G17A 2VIIA 2FSIA 3QKRB 5LBIA 3SS8A 1Z22A 4NE2A 3QENA 4WOPA 2ZVQX 4MA4A 3EG5A 4OI0A 2NO7A 4B6EA 2LKDA 2VF7A 5FL7A 2RMKA 2UKDA 1RRCA 2NMVA 2BBOA 4LJAA 4CF7A 4MKIA 2FH5B 4PC6A 1MKYA 1XCMA 2IUSA 5BN3A 5BQ5A 5BYKA 2HT1A 3EX7C 1P73A 2GVZC 2Q9BA 4FW9A 4ZCMA 4PO8A 2RAPA 1EWQA 4DB4A 4P31A 2GJAA 1N6LA 1G41A 2AWNA 2IYRA 1XB2A 5FTLA 5EP3A 5F98A 2YOFA 2ZR7A 2G77B 2YNMA 2YKGA 2J0UB 1OFHA 2YZ2A 1AKYA 1SQ5A 3EA0A 3KTAA 4Z1MD 3CNLA 3NDPA 1AZSC 1DAEA 4FCVA 3R9WA 4U00A 1C4OA 2NGRA 2V7QA 4JYBA 4EPTA 2IA5A 2DHRA 3EIQA 4L4UA 5F2EA 3GJ6A 5J47A 4KFSA 4B47A 2NO6A 4BLSA 4M9XA 4L5BA 1Q57A 2YWHA 4ESVA 1JXMA 2ZYVX 3I3SR 5C4GB 4MRRA 2HF9A 3KJEA 2BEJA 2ODEA 5HKKA 4V02A 2ZRBA 5BN5A 2GHIA 2VHQA 3DMDA 4JVSB 2C03A 4NKRA 1ZAKA 3AVYA 1TQ6A 2AFIE 2FV8A 2J7KA 2KSQA 4M4SA 2OM2A 4IKEA 1XTJA 1OIWA 3L0OA 2Z4SA 3B5JA 3CH4B 4PZYA 2IWRA 3X1DA 3U7HB 1ESNA 4D0LB 3FHOA 3ZIAD 1TQDA 3WNDA 4Z54A 1S3GA 4KV9A 2G83A 3B9QA 4DEXA 2CBZA 1R4AA 1W36D 3SJZA 4LJYA 1R7RA 2ZI5A 2QT0A 3NKVA 2XJ4A 4B2IA 4BEJA 4PC3A 2OUKA 2ZVPX 2O8EA 1Z47A 1Z29A 4P33A 3ZQ6A 4ZIRA 2XZLA 1E96A 1MO4A 4AC9A 4CEJB 3DZDA 4G01B 3BORA 3TVTA 4JL6A 3D6TB 2O8FB 4HUQB 1G3UA 2ZJAA 4HB4A 2WTUA 2VLIA 3G82C 3F5FA 3THWB 1ZM9A 3IQWA 2ZIAA 2R6DA 1E2JA 2NZJA 2N46A 3GLFE 2ODWA 3F0TA 3DZ8A 3X1ZA 3T15A 1P9WA 5ELXA 5KSPA 2FF7A 3MFYA 1FP7A 1WXQA 4W5HA 3WNBA 4N1AA 2ZRMA 1VG8A 2PZGA 4TMXA 2IYQA 1IM2A 3QNUA 1ZIPA 2WKRA 3U5ZB 2WWIA 3SBEA 1ZD1A 2ZRDA 3I1FA 4N0EA 1NVVR 3EA5A 4I99A 4I1OA 4Q47A 1T5LA 1KO5A 2ANBA 1KY3A 4FINA 2A5FA 1SHZA 3Q7PA 3A1TA 3PXGA 4DKXA 5KU1A 1YZKA 1NVVQ 1VDZA 3CNOA 3NHAA 3AM1A 4Q02A 1MH1A 2ZAOA 4NCIA 4WA7A 4K8OA 3IO3A 3CZPA 4CEHB 4ZO4A 5HR5A 1KDOA 2QTVB 2KBEA 3EAQA 3ND9A 4WW0A 4NPHA 4V0NA 5H70A 2C9OA 1R2QA 5KDOA 2VYFA 2FSFA 3EW9A 4C0QC 4X8LA 4HB2A 3B9PA 4JLMA 4MRSA 3CONA 5FOVA 4WZBE 4C9BA 4IOJA 2FFBA 2H16A 3GLFB 1L8QA 4BFXA 3TH5A 5HZKA 2C2HA 2W58A 2ZANA 3GLHE 2GJ9A 4YC7A 1E9BA 2ZRLA 3NBYC 1E0AA 1WF3A 2IC5A 4DT1B 5IK2A 5JWRA 1JXOA 1DVRA 2RKOA 5EE3A 1W4BA 1RE0A 1S9DA 1E0SA 2WWXA 1F48A 2W83A 4D4MA 1KI6B 2VSFA 1W48A 2FFQA 1CR0A 5HZHA 5A4JA 4Q5IA 1U9IA 1NLFA 4BQSA 4H1UA 4AG5A 1XD2B 3DEFA 2F1IA 3SHFA 1YR7A 1ZMXA 4A6PA 4ZPXA 4GP6A 2AKAB 2HDNB 2GK6A 5AJXA 1NN0A 1NLZA 4HAWA 5CJPA 4X8OA 4M53A 1DEKA 1CRPA 3REFA 1TQ2A 2PBRA 4M1MA 1LTQA 5K8UA 1UKZA 4B75A 2MSCB 3RAPR 1OKKD 1VIAA 1BMFA 2BIFA 2CNWD 3H1TA 3ZLJA 4JMPA 3HYTA 4G5RA 4US1R 3TIFA 1E4VA 2WWHA 3RSOA 3QBVA 4Q03A 1T8TA 1UPTA 1W0JA 2D2EA 2W2TA 3ZDQA 1IQPA 1G5RA 221PA 3ZD6A 1XJCA 2O0KA 2ZS7A 1RRFA 4FMCF 4Q21A 4JLNA 2L0XA 4B3GA 3O8RA 1G16A 1KZGB 5FI1B 4A8JA 4DHEA 1R0ZA 4QGFA 1DBSA 1SVWA 3U7EB 5KTYA 1KK1A 5DN6D 4DDTA 5FTNA 4Q1CA 5GJWC 3I4LA 1XXHB 2VEDA 3GLHB 4OHVA 5FUWA 4GOXA 3NH6A 5DI9A 3MUFA 4LC0A 1V5WA 4KFRA 2CL6X 2GCOB 4TYPA 3QVUA 5G3YA 5CLQA 5C2JB 1SVMA 3W6PA 1ZU4A 1TAGA 4GI7A 1G8GA 2BHRA 1NMXA 2RGNA 2BJWA 1J2JA 1S2MA 1ZUNB 4OHXA 4HB0A 4ZI2A 2WOJA 3ZD7A 1GDDA 1ONBA 2VHUA 4B32A 1U99A 2Q3HA 1KJWA 4M1YA 2AD5A 1M7HA 2A78A 1X8JA 1ZD9A 1IAQA 1MT0A 2W6IA 2IWHA 1WQ1R 5H1YA 5FBQB 1ESMA 2ZSDA 3T5GA 2ZUBA 3R8CA 3OEHD 1F2TA 2IHYA 4G5OA 1GRQA 1XEXA 2GJSA 4A0FA 3CF2A 4TLAA 2XAUA 4YMUA 2ZUCA 4CZ2A 3MSXA 3FMIA 2QROA 2FSHA 4TT3A 4HLQB 4DLZA 3C4JA 5B64A 1OFIA 3LV8A 2IYWA 1MABB 4MUBA 1G8YA 3I72A 1EK0A 2MMCA 4IOMA 5AUPB 3PFIA 3I5YA 4N0DA 1NVUQ 2ZJ8A 3AF4A 3K0EA 1U8ZA 1S3SA 3CKLA 1I2DA 1KDRA 2JATA 3LNCA 3N2EA 3WRYC 1EX7A 2PJZA 3KB1A 2EFGA 5EE9A 5FTJA 4PAOA 4XD7D 1TADA 1IN4A 4B43A 3FMPB 4ITRC 2N1BA 2BCGY 3MWKA 2CHGA 4P4SA 3C16C 1N5KA 5P21A 2JLYA 1U0HC 4RKEA 4BASA 4EQ6A 3HR7A 2B7CA 2H18A 4LHZA 4TYNA 2OXRA 2FDCA 3L0IB 3PUZA 1LV7A 2GEDA 1NY6A 2PCJA 2K5UA 2BVNA 2V3CC 3C8UA 3GLGB 3Q7QA 3C15C 1NJGA 2XOKA 2VO1A 4HAXA 4JLAA 4XSHA 1AA9A 4MRPA 3U61B 4OHZA 3GD7A 1GL7A 1OPXA 3BH7A 3IEUA 4DT1A 4Q7KA 2ODNA 2ZRFA 1ZP6A 2JLWA 1M8PA 1YZTA 2ERYA 5HE8A 1RPZA 1CR4A 5CITA 3K70B 1K5DA 1L4YA 2IYTA 5DGXA 3HR8A 5J4KA 5JEEA 5JCPA 2C77A 4DWJA 4X8MA 4GPTA 5FBVB 4MDEA 1N6HA 1YE8A 2W00A 4Q4HA 4UQOA 2QENA 3CNNA 3TMKA 1NMYA 2WHXA 1LNZA 3BD9A 2ONJA 3S1AB 2CHVA 1GOTA 4TMVA 4OI2A 4B44A 2A9KA 4R7ZA 4FMCB 4XOIA 3OEEA 5JECA 1OH6A 2C96A 3AEZA 4K81B 5IF9A 3K0CA 3TAHA 4DLVA 4W9MC 1QRAA 2DR3A 4PXAA 3AF3A 2OCBA 3AKEA 4F4JA 2B6HA 1XD8A 2VSXA 3DKPA 3TR5A 5DYGA 4IDQA 4DDWA 1KDPA 5FBWB 2ZYUX 1EFTA 1GFIA 1OHHA 3ZZTA 4OJKA 4D0GA 1VCOA 2ZR9A 4JLBA 1E0KA 2NG1A 2PT7A 1RVDA 5FOXA 1NMZA 3TBKA 4OK5A 2VRWA 2XB2A 4WVFA 4RZ3A 4KCGA 3TQCA 2IYSA 1PLKA 1EWRA 2AK2A 2W2XA 2QNRA 4D4KA 2YHSA 4BEBA 1S0UA 3QXXA 5L3QB 2FFHA 4Q9HA 1N5IA 4JVLA 4LOAA 4NCJA 5AJWA 3B7GA 821PA 1IXRC 5BN4A 2ZAMA 3FPAA 4V0MA 5FR1A 1LF0A 2NIPA 1BOFA 3GP8A 3AGQA 3D31A 1W4AA 2YV5A 3ETLA 3CH5A 4US0R 3CLVA 1GILA 3KKMA 1M7GA 3AVWA 4OL0A 1G6OA 1N6IA 1JAIA 2EVWX 4GOKA 1F2UB 4TL7A 1TMKA 2DWPA 3I62A 2VHCA 1CXZA 1VPLA 3B82A 4M0LA 4UNSA 3EC2A 4QFMA 5F9FA 4TMWA 1E98A 1R8SA 2G0TA 4RFSB 2R6AA 1NBMA 5KSYA 4ILEA 2YOGA 2WJJA 1KI2A 3BH0A 4RZXA 2G0NA 2O8EB 2A5DA 3MGCA 1OH5A 4NCHA 4PO9A 3AP2A 4Q7MB 4UKDA 3W6OA 1KZ7B 2F9LA 3W34A 5DI3B 3SOPA 1E3MA 5FL7D 4L15A 3WBKA 1Q1ZA 3SYLA 4OI4A 3B13B 3K0SA 4QJ5A 4I4LA 1E9EA 1HQCA 5JJIA 2W6JD 4MKGA 3HJNA 3U44A 2ZSFA 1U0JA 1G1MA 2WZQA 3BOSA 2ZM5A 1XU4A 1N3BA 5AUOB 1G5PA 2GZHA 4MGZR 4JLJA 4OHWA 2WJIA 2G88A 1IN6A 3E5HA 3NIBA 4PHGA 2BWJA 4PQFA 3GPLA 3N2IA 5B2ZA 5KO2A 1U9IC 2CK3D 3M1IA 3RLFA 2FPMA 3AP1A 4C7OA 4Q7LA 3THOA 1H8HD 2IW3A 1N5JA 4HLUC 1H65A 1N6KA 1UADA 2R2AA 2JLRA 3A4NA 4GBMA 4UNQA 3LVRE 3BAFA 2XTZA 2NOAA 2OXCA 4QC2A 3THYA 3R7WA 1CS4C 4ZV4A 3NH9A 1P61B 2QSZA 4G5SA 4ARZB 3AKDA 5FPTA 5AR1A 1O87A 3K9GA 1UAAA 2IXEA 2FWRA 2NO0A 5L3RA 4EDHA 1J99A 3CF6R 4MRNA 5DLQC 2YOHA 1MRSA 4D82A 2J7PD 4EJSA 3OE7A 4RD1A 2P6NA 2A5JA 3SBDA 4XVUA 2QPAA 1KI4A 2AX4A 1ZJ6A 1II9A 1XEWY 4YQFA 1KNQA 3KDSE 2WJGA 4AYTA 2MSEB 2ZI7A 2HEIA 1CP2A 1QHHA 2QG6A 3UMRA 1P4SA 2RGAA 2V8OA 4LY6A 4HATA 1P72A 1Z06A 5FTKA 5FI0B 3K0FA 3G0HA 1F2TB 4DEYA 5SZKB 1T5IA 2BCJQ 4IDOA 4XJXA 4FIDA 4PC7A 2IYVA 2WJHA 2Z43A 4LYAA 4IDHA 1N6PA 2YWGA 3A8TA 3A1SA 1BIFA 1UDXA 1EFRD 2FPKA 1IXSB 2LKCA 3CRQA 2HV8A 2JLSA 3PITA 4G1UC 1NNEA 1A4RA 2OLKA 2C99A 2VHJA 5AUQA 3KB2A 4NP6A 5IDVA 2ATXA 3AF0A 2ZETA 4EIWA 5FBRB 5CB6A 4S2EA 4A15A 3SJCA 3VKGA 4KJZA 1EG7A 4IFEA 1EXMA 4Q1BA 3RS7A 1LF5A 2AL7A 2IS1A 1JBKA 4MQBA 2ZSBA 1Z07A 5ANRB 5HCIA 1RZ3A 4PC2A 4ABYA 1E2DA 2XXAA 4F93B 3CM0A 1GRRA 2XEXA 2WSSD 2FE4A 3SJBA 2OFXA 2ZJOA 1QVRA 4EFNA 4KSCA 4A8JB 3ADBA 3P1JA 4AIIA 3RRMA 2CE7A 3CW2A 4HZUA 1PLJA 4MGKR 4KSBA 1S9HA 3MRSA 3UMSA 2WV9A 3EPJA 3TLXA 1XJQA 4B3DA 1YQTA 4DLRA 2OG2A 1RIFA 2HLDD 4ZCLA 3FKQA 4JBXA 5J5CA 1J7KA 4A1FA 1Y3AA 2QQ0A 4GP7A 1TU4A 4NONA 4ZDIA 1FQKA 1VYTA 2GBLA 3KUDA 3FMFA 2D7CA 2P65A 4BPBA 4OKSA 3L0PA 5JS8A 4Q9KA 2RGXA 2WJYA 4YXWA 4JBWA 4X8HA 1E2GA 1LS6A 4XIGS 2WICA 3GLHA 2AD1A 2BBSA 1NN1A 2C9CA 1KMHB 1Z0IA 2GA8A 1KGDA 1CJVC 1YR6A 1KO1A 2H57A 4RFVA 4DSOA 2WKQA 4D81A 2VTKA 5GJCA 3FHCB 1Z6XA 4AYXA 3QKSB 3SNHA 5FUXA 1XCGB 4W5JA 5K8TA 4KVGA 5JSZA 3WNCA 1I2MA 1E94E 3VU9B 2H1LA 4CW7A 2IEYA 2RHMA 4FN5A 3KXLA 4CEJA 2IYLD 1FQJA 3GFOA 4BFUA 2B8TA 2RGEA 2WMNB 3AVPA 3B1YA 2REXB 4B71A 1N6NA 1QG4A 2BKUA 1N0UA 3NWJA 2ZTSA 2ZU6A 3N5CA 2ORIA 5C4MA 1M7BA 3DKVA 4QBIA 5H8WA 2QZ4A 1KKMA 4HLUA 1OE0A 2O8BB 5AJVB 5B57C 4DC9A 3OIWA 1I4LD 5E4FA 3AQ4A 2V4ZA 3R20A 4LX0A 2XGJA 4JVNA 3E1SA 1VYVA 4DCNA 1FNMA 2C8VA 4JT2A 2Q6TA 3QF7A 4M9ZA 4LPKA 5EP4A 1VHTA 3U2QA 1OXTA 3VR2A 3SYKA 1RW4A 4TTRA 3A4LA 3HPRA 3SEAA 2YWFA 3GJXC 1ZBDA 3VKWA 4RFSA 2ZROA 4JL8A 4EPXA 2ZRPA 2GF0A 3DDCA 3FGNA 2QUZA 1P2TA 4URYR 1T9HA 3FFAA 3GJ8A 3IPXA 4LJ4A 2CDNA 4BZQA 3FB4A 4M1SA 2QU8A 1G7CA 2ZEJA 2XZOA 4M9SA 1DAIA 1G6HA 3M0EA 4QBGB 3WYGA 1HURA 1CR1A 5FL3A 4BLOA 4AKHA 1YU9A 3NBZC 4RJLA 3EIEA 4IEEA 3GJ3A 3MLEA 1TX4B 2F43B 4KHZA 1Z6AA 4LJ6A 1FZQA 1Z28A 1FNNA 2JGNA 2XZPA 3VKHA 5CLLA 1JQLB 4N3NA 3U3RA 2GXAA 3QXJA 1ZNZA 5B30A 3LAWA 4C3ZA 3BS4A 2GCNA 1E2IA 1TNDA 4BLRA 3LX8A 3NVAA 3R7WB 3RWOA 1H8ED 1E79D 4D2IA 1P7CA 5JCZA 1UDWA 2WWFA 1DAKA 1AS3A 3OHMA 3T35A 1OT3A 4TYWA 1LFDB 3OEHA 1P2VA 1A2BA 2IX3A 4TWZA 2B92A 4TQAA 4TLCA 1SXJD 2IYYA 1GKUB 3GLIA 2WPDA 2KB0A 4IXMA 4JSTA 3UK6A 3QSYA 5DI3A 1ZM2A 1NVXQ 5KNCA 1BKDR 1ZVQA 1GVNB 3RC3A 1UEJA 1XEFA 2ZE5A 1Z83A 4ZDJA 3IEVA 3W9YA 1QBKC 1VHLA 4DLSA 1G8PA 1Z3IX 2Z6VA 1JECA 2DBYA 3LW7A 3KKNA 4QJ4A 4Q9JA 5IHPA 3CR7A 2H92A 3EXAA 4JKIA 1FOEB 3RABA 4Q4HB 2B7BA 2Z4RA 2F3TA 3H4MA 1KSFX 3ZZ0A 1E2EA 1TF7A 3CR8A 3BB3A 3EARA 1W36B 1E1RA 1AZTA 3L0SA 3AVOA 4NYMQ 2JIZA 2J1LA 4HEJA 2ZS9A 1JB1A 2ZRJA 4CEIB 2A7QA 4Z8YA 4XWAA 5FPHA 1G19A 5CIQA 3TQFA 1ZNWA 2VHTA 1YZNA 3MJHA 2OILA 2P0EA 2P6RA 4JLKA 5BYJA 4EAQA 1N6RA 2XSZA 1YRAA 1GSIA 3QVVA 1E0JA 1CKEA 3V4RA 1ZUIA 4FXPA 1XPOA 3FVQA 5TY0A 1E1QD 3GEHA 4DCUA 1G4UR 3H86A 1XPUA 1F3OA 2VP6A 4TTPA 3W6NA 3LLMA 1ZINA 3KZ1E 1W0KD 4UXJA 4C30A 4US2R 4BWYA 2FSGA 4F92B 2IBMA 3IDQA 3IQXA 5DSZA 1JAHA 5JWHA 5TV2A 2IHBA 3CPHA 3IGFA 4URZR 4W7SA 3WY9A 4A0RA 4D0NA 4WIAA 2W0MA 1GIAA 2XNSA 4BE7B 3LXXA 1SVSA 2WAYA 3JVVA 3GJ7A 2CEAA 5G3ZA 2GESA 3SR0A 1TQ4A 2AKYA 1Q0UA 4CT5A 3IHLA 2WMOB 1HY3A 3BFKA 1P2UA 2ORWA 1Q12A 3RYTC 2QAGC 4G5GA 2B8WA 3QF4A 4YONB 3W5JA 4KO8A 1HUQA 4LBWA 2NPIA 1JALA 1N2CE 5LB2A 2GTPA 2JJ1A 5JFGA 1TTTA 1T0JB 4QJ3A 2HJGA 3ASYA 1E9DA 1K5GA 1OXXK 4AD8A 4DBLC 1GL6A 4I1SA 5JI3E 4HYYA 3QG5A 4G3XA 4B3FX 2XTNA 2GAAA 3U4QA 1AQUA 1XZQA 5BXQC 2X8AA 4PPNA 4IHQA 4DUGD 3PUWA 2VP4A 2IXFA 2OSBA 1ZYUA 2C04A 2PZFA 3RRZA 4HDCA 1X86B 1DAHA 3SQXA 1G20E 3KXIA 2QRZA 5BW8A 1BMFD 2CNWA 2ZSAA 2NTYC 1GM5A 3FKSD 2Q21A 4O3MA 5J4VA 3EZ7A 5FPYA 4C4PA 1UBFA 5KDDA 2GCOA 4MKHA 1UF9A 4BZXA 4DLTA 1P3JA 3FHTA 3GFTA 5JLJA 4NDZA 3EZ6A 1CIPA 2EQBA 1NSTA 2JEOA 5JZVA 4BUJA 2CCKA 4IDPA 2FFAA 4LBYA 1VCMA 1YJ5A 5CDFA 4IOLA 4IVPA 3OFND 2OAQ1 5LB4A 5TB5A 4LJ9A 1E32A 4CT4B 4QHTA 5HKKD 1DADA 3H84A 4TL8A 2C98A 1G3MA 4Q66C 4LYHA 3THXA 3LA6A 2E9SA 3RC8A 621PA 1G291 2KWIA 1EFCA 2BKEA 2NO9A 2CJWA 1OH7A 1X1RA 1KJYA 4FCTA 3TRFA 2EFDB 4KFUA 1M2OB 1XEXB 2JJ2A 1FUKA 2W6JA 4WAUA 4BFVA 3K53A 5EP1A 1WBBA 1HA3A 3ADDA 4L9SA 3KQKA 1P62B 2UZIR 3DM5A 4JSYA 1M6NA 2FEOA 3I8SA 2QBYA 1XEWX 3OAAD 4URVR 3AVVA 1ZRHA 1FW6A 2XX3A 4E07A 4TZ0A 1E4YA 2FEMA 3QUSA 4TMKA 1UBCA 1GZSA 3U3MA 1Z08A 4LPSA 3EPLA 2IS4A 1E2NA 1U8AA 1WRBA 2GCPA 2JLXA 3A1VA 4EQ6B 2AK3A 1KI8A 2JLVA 2J87A 3X2SA 4GMXA 2HXSA 1OXSC 2IYZA 3BE4A 3K09A 4JLDA 5KOYA 1PUIA 1AM4D 3B1VA 3KXKA 5FUVA 1GTVA 1HE1C 4MDFA 1NG1A 2REBA 1JEEA 3X1YA 1KKLA 2PL3A 2PLFA 2QY9A 4TSFA 5DHAA 2QRNA 3B1XA 1II8A 1NBME 1GRNA 4ON9A 5FOUA 1ZNYA 3PIRA 3B85A 2EU8A 3T1VA 3TNFA 1DELA 3PUXA 4P3YA 3D3QA 2DYKA 3T61A 4PSVA 1AGRA 2IK8A 1NN3A 1U94A 3QOFA 4IEIA 3SHWA 2GXUA 2ZRGA 4M2LA 1E9AA 3SYNA 1JR3A 1QF9A 4RY2A 1G3RA 2GEUA 4RVCA 2JA1A 2QGZA 3TSOA 3CO5A 3DHWC 4E22A 3TW8B 1MO3A 4U5XA 4LHYA 5J4HA 4DSUA 3I5XA 3R8FA 1U8YA 4Q1AA 4CVNA 3ZVMA 2X2FA 1OIXA 4FI3C 8OHMA 2XOKD 3RNLA 6Q21A 1VG0B 1VCIA 4UXIA 4GT1A 2X2EA 2BBWA 4OBEA 2E87A 3FYHA 1I4TD 2RHDA 3HYRA 3WP0A 1OYWA 2W0SA 1G3IA 3CRW1 3NHBA 4FWIB 2WOOA 3AKYA 3QBTA 1AGPA 3KJGA 1DOAA 1GNQA 4G5QA 3WYFA 1R8QA 3ICEA 3ZH9B 1NF3A 1AS2A 3KX2A 1C9KA 4LC1A 4BZPA 2ZRIA 3UG6A 1KMQA 1FMJA 2IF0A 2XTMA 2BM0A 4RD0A 3DMNA 1T6NA 121PA 2BMEA 4ASUA 1R10A 1GKIA 4HDQB 1R5BA 1T3SA 4QNMA 3RS4A 4B3XA 1KO8A 2KI5A 2G3YA 4C2TA 2PEYA 1CJTC 3U44B 4MKFA 3X1XA 1SULA 3TUJC 2ZRKA 2JCSA 3ZQJA 4LWZA 1JJ7A 2V1XA 1YRBA 3RANA 3V00A 2GXQA 3TAUA 4M1WA 1TUEA 2P5SA 3EC1A 2J0UA 4KAXA 2QTHA 3KQHA 1OXVA 3LH5A 1QDEA 3DL0A 3BK7A 1GNRA 3L43A 1NI3A 3QKTA 3WXMA 1QG2A 5GVSA 3NG1A 1Z0AA 1NN5A 2YC2C 4BRWA 4HDOB 1F2UA 4ZDWA 4DRZA 1W5TA 3THYB 3LQQA 5DHFA 4OQNA 1MV5A 4DJTA 2O8CA 4RKFA 1S8FA 3RS3A 1XMJA 3JZMA 2GJKA 5JBQA 4KBGA 4LSGA 4TMZA 2OLJA 4B76A 2R6CA 3GFPA 4HB3A 2DFLA 4M1OA 1KK0A 3IKJA 2RH5A 2WIBA 4PSAA 4XTCS 3BBPA 1DO0A 3CZQA 2PH1A 5DN6A 2JLZA 2ZUDA 3Q3JB 1P9RA 4A0HA 1NBMD 1NL3A 2IYUA 2DWQA 4Q48A 4QNRA 1IOZA 3CRVA 5L3SA 4UJ3A 5UKDA 3V9PA 3WP1B 1L4UA 2V7QD 4B3BA 3PEWA 2ZJYA 3ADKA 1R0XA 2J46A 3NBXX 1A2KC 2OE2A 3ZVRA 3RHFA 1T4GA 1JJVA 2OAP1 1IJEA 4F4CA 3I8XA 4GSYA 3PR1A 4KI0A 1X3SA 3LD9A 4LV6A 3MWLA 2P6UA 3DO6A 1LB1B 1W44A 2I3BA 4LCBA 5KYKA 3THWA 4WXRA 4LK2A 1KSGA 1E2FA 1KDTA 2REOA 4FMBB 4JLOA 1VTKA 1AJEA 1T3LA 4HZIA 1Z63A 2D3WA 5G41A 1T8UA 3BRWD 3NTUA 4NYJR 1O3YA 4ZIRB 4OHYA 2CMKA 4QBHA 3ZIAA 1W47A 3THXB 1WA5A 1W5SA 4PANA 2Z5FA 4A36A 4L9WA 3UPUA 3TSWA 4GNKA 3LRPA 4PX9A 1NP6A 1IJFA 2EW1A 2J41A 3M4YA 1Q21A 2OV2A 1Z6TA 3LO5A 3IHWA 4LV8B 1KYIA 3K9LA 4Z8XA 1N0WA 4YDSA 4NCKA 2NPFA 3W3ZB 2QPOA 1FFHA 3MWJA 1KAGA 1KK2A 3I32A 2EFEB 3MCAA 4M9QA 1DG1G 2ZE7A 1P2SA 1BYUA 3LFUA 3OE7D 4I81A 3Q8XB 2BV3A 3NEJA 3O47A 1OFUX
chains in the Genus database with same CATH superfamily
4S35A 5AM1A 3ZEAA 3SDZA 3HN6A 1NVBA 2QTAA 2OBLA 1FVXA 4AG6A 4C87A 4KTTE 4F4IA 2V9ZA 4B80A 3BFVA 4U3JB 3ZN2A 4AS2A 4D8WA 1VRCA 3ZS8A 4NWIA 2OGWA 3SX4A 4MVJD 1NVTA 3B5IA 1MO6A 4HO1X 3PGKA 2G6BA 3HWSA 4B4VA 3QTBA 2TMYA 1AIPA 1XWFA 4V0OA 4BNFA 3HEMA 5AVSA 2FNAA 3LSYA 3OZWA 2H29A 2WVGA 2BMWA 3SBOA 3UWPA 5IAGA 2HHCA 1TTHA 1BE1A 1AUPA 1NYQA 3QVJA 4WV3A 4Z7NB 3NT2A 3H0CA 1CTQA 4JC4A 1TZJA 2VTVA 2FE1A 3RTAA 4A8JC 2C07A 2YWXA 5BSUA 4OQQA 2OENG 3D2CA 5CFOA 8ATCA 1COZA 3C8ZA 5C7IO 4V2IA 3ROKA 2W5UA 3MBKA 2H1SA 2C3YA 4R8SA 1OXMA 1W9HA 5HIAA 4D3XA 2JGMA 1DBWA 1WX1A 4L74A 4EAAA 1H94A 3WDSA 5J9FA 4NU5A 3RS0A 1EUDA 4DYVA 4UOZA 1DE0A 2EFCB 3TTTA 4KVAA 2OY0A 4J4HA 1ZOLA 1ECCA 5C31A 3ROMA 1BDBA 1NG9A 1QYXA 4U0JA 1WZEA 4U2CA 5DYIA 1RXSA 3PL5A 5KQLA 1AXGA 5BOSB 5EJ8A 3KL2A 2CLIB 2C8KA 3MMNA 3OIDA 1B93A 3OLXA 3M3HA 1DC7A 1P91A 1PE0A 4YIHA 1T13A 2DFNA 4EY6A 4F97A 1MGOA 5EN4A 1A88A 1OFVA 2JHFA 2PGDA 2PFSA 4XW2A 3RT9A 4W9NA 3S55A 5GPBA 3PWTA 1FLAA 4F12A 3D2BA 1W87A 4CIVA 2C1EA 1BH6A 1IY2A 1GNPA 4ZOLA 1TF2A 2A9QA 1GR0A 1U0SY 4GOOD 3OTQA 3WLJA 1KVQA 2PKWA 3P2YA 3LDAA 1WB9A 3SIXA 4KMOA 3H9UA 2W6MA 2XSZD 4O4HB 4K1LA 3K71B 2R6HA 4TQUS 4RBNA 2C5LA 3IRUA 2HU8A 3JWGA 1PN3A 2B98A 3FMVA 1IJKA 1YNOA 5FA8A 5GINE 4HDMA 2F4NA 4KL8S 3T95A 3R9IA 4YN3A 4G07A 3IQEA 4ZI3A 5EKXA 3RKUA 3E9CA 1ELOA 1FL9A 2OT3B 3Q2OA 2MMGA 2AC7A 2XIJA 4KAJA 3TTWA 2C7QA 4JYPA 1KYWA 2HIAA 3ETEA 4QWWA 3BREA 3SS7X 1Y8RB 2FK8A 1F06A 5EZSA 4ESHA 3T9DA 2IHVA 4G4IA 2HFJA 5FNVB 1T24A 1YRWA 3AUXA 3LPLA 1E4EA 1CX9B 4OJNA 1DAPA 4O4JB 1AUVA 4TTJA 4QUGA 1XTVA 5KVSA 5SZHB 1QAQA 1BWSA 4G25A 2C9YA 1DKMA 3D7MA 5FULA 2OCPA 1H2ZA 1OX5A 3PL1A 4QAJA 4YB8A 3PLAE 4Z4HA 1ODLA 4KR0A 4MR8A 5JYEA 1Z6ZA 1W0JD 1PCXA 3PQFA 4L4RA 5IYZF 1W8IA 4LSZA 3U31A 4CETA 4HH1A 3ECSA 2BM1A 3EB9A 4LKRA 4W1RA 3W8NA 2I99A 1RHRA 2V9PA 4B46A 1SELA 2NP6A 4URUR 3L5OA 3I6BA 2AQKA 4IDNA 4WZAE 4DPKA 3T0GA 3DVAA 3TPCA 4EABA 3WGOA 1ZGBA 3CVYA 2VRNA 3MT8A 4ZAXA 2NXWA 2JAHA 2POQX 4OHBA 5DLPA 4YDQA 4DGSA 3CF0A 5KWEA 4XQ9A 4YDRA 3UN1A 3EY9A 3ZE2B 3SR4A 3OKCA 3F67A 1PR4A 2WKPA 5I01A 2EQ5A 4L0MA 1A7AA 4AJ1A 1I94B 1WTCA 5GM1A 4OHPA 3QE3A 1CUZA 3TM5A 2FLWA 4YLGA 3OIYA 1KXZA 2HHLA 3FOFC 2PVCA 4NICA 2ZI6A 4WT7A 1K0FA 1LW6E 1OLOA 3R24A 4FR5A 2HWXA 1PX0A 1Y3BE 1JEJA 3B3QA 3UYKA 1LX7A 3DOCA 3ZGNA 3FKSA 4BFTA 2C4TA 4RK6A 1DQZA 1CVIA 4NARA 2FX2A 2O0HA 3R76A 2VK2A 2XV1A 4J2OA 5DMHA 1VI5A 4EKEA 1XNJA 1R0YA 4KYIB 3LQRA 5I7UA 1OVGA 5A4MS 4R81A 5FEUA 1KS9A 1VBFA 3II6X 1P6XA 1GNLA 4KN9S 4U7DA 4D6YA 5H80A 1NKVA 1YZFA 3G0CA 5A3SA 5CX4A 4YGYA 3VQTA 3V97A 2X0RA 3P0JA 4RK1A 3UKDA 3ENVA 3WLMA 1TRKA 1QHGA 2Q07A 2VUIB 2BM9A 2WWTA 4CXMA 4MQLA 3F47A 4ITUA 1LX6A 3L1VA 4FFPA 2Z57A 4B40A 4IHJB 2H1HA 4LHSA 3D2AA 1S4QA 1DAMA 5C32A 4WOBA 1A5AB 1RP1A 3PNMA 1N7HA 3IESA 4L28A 2O8CB 2YQZA 1K63A 1SBCA 4D3SA 3B51X 3KKEA 3B3AA 1NA5A 3PUVA 4DV0B 4ZOEA 3EDQA 5IXSA 1EDOA 2WYOA 3S2YA 4IGEA 2QVXX 2UUAB 3C0KA 1N5OX 4PRYA 1RRVA 2WJAA 4UBOA 4Y2QA 3PJRA 1HQYE 3BWVA 1DZIA 2A88A 1AKMA 1G8SA 1HE2A 4MDHA 3K70D 2RHHA 4N6NA 2KQUA 2LP4Y 2KM1A 4M89A 5F7JA 1W2GA 3OAAA 4O4IF 4PGHA 4CF5A 1MA0A 3BGWA 4Y67A 3RHZA 4L07A 4P3XA 2OPHA 3KYIB 3UV6A 5KX5A 3ET5A 4K6HA 4JZYA 2WP0A 2PM8A 4X92A 3WWOA 4BO8A 4HLDA 1JR6A 3RF6A 3QY9A 2GRJA 1I2BA 1A4XA 4JT9A 3HYCA 2QK4A 2I9PA 3IV6A 4MINA 4X9XA 4E09A 5AI0A 3NHMA 3OPYB 5HGJA 4D9GA 2WD7B 4ND3A 1R4MA 3TZHA 4R2WA 4NZOA 3GJ0A 3PHHA 4HH0A 4I8DA 1JJIA 3CPEA 2C9DA 3EMDA 5DFAA 1ORTA 3LXRA 1F51E 3LUCA 2RHOA 1F2DA 1H5NA 3D81A 3OSUA 4ZOAA 5TJ9A 5JDCC 1Q1AA 4CMKA 2ZJ5A 5F5XA 3I9NA 2EGHA 2VR1A 1UOEA 2A1IA 4HOYA 3DP9A 4PZEA 3AUSA 4QOFA 4B3HA 1FSPA 1Z2AA 1IIRA 4QYWA 2ODTX 3H2YA 1OX4B 4YWHA 2A3RA 2GKSA 4N3BA 5JG7A 1Q3HA 4HNTA 3KEGA 4Y0VA 2NZVG 4FUQA 1HSZA 5F76A 1WE2A 2O48X 3MD0A 2A5YB 3AB3A 3OE5A 4L8YA 1M1YE 4H6VA 4BAZA 5LIPA 2ORVA 3N86A 3LDGA 3ELYA 3HO6A 1PDOA 1SOWA 5JJCA 5LQJA 2VAXA 1I4EB 1L4BA 2A33A 2E1RA 1FDRA 2QD2A 4O4JF 5CM9C 3TTXA 4G0NA 1XRJA 2FZ4A 3MRVA 3DC2A 2AT1A 1JKMA 5EXPA 3SEZA 3AHGA 1T8YA 4X66B 1JAZA 4P7JA 3Q8LA 4U2DA 2KX7A 2YNMC 3D3KA 4EJSC 3OFKA 4WJLA 3TMAA 1O57A 3EDMA 3KKZA 5DISB 4ZCIA 1WZ2A 2VP0A 3E2PA 1AK1A 2P4QA 2VQ3A 2YV4A 3K9HA 3QTLA 3GGDA 5LWQA 1R37A 1ZR4A 2MYUA 2LBPA 2SCUB 1MIOB 4R9UC 4Y2YA 5TQJA 3QG1A 2CUTA 5I9IA 1IG0A 3WK7A 2W37A 1JYFA 4QM6A 2QR3A 1EFDN 4I1YA 2GJ8A 1HT1E 2O8FA 1NRWA 5KINB 3ER8A 5BR4A 3IVCA 3CX8A 2BFFA 2IEZA 2NSJA 2FWIA 4KFTA 4ZTZB 4U7HA 1ZA1A 2AF3C 1LK7A 5EESA 3CX3A 3OQ6A 4Q4JB 4WN9B 4DBZA 3PEEA 1NBWB 3AYZB 5ETJA 5B7GA 4AI6A 3NHWA 3IQFA 1O5IA 1RYFA 1XMXA 4MR9B 3UTDA 4NZYA 3HXOA 1JFLA 4AJLA 4MHTA 1UC9A 1A72A 1D04A 2ZQ5A 1HE8B 4G0OA 2HDOA 3ILSA 3KTDA 2GWHA 4H0FA 5D86A 4QT4A 3HRHA 1G8HA 2IEIA 5E8RA 2B94A 4ISBA 5DHRA 3ABRB 2ODQA 5DVZA 1AHIA 1QIDA 3I6YA 4WLNA 5J2UA 2R8EA 2PRZA 1B43A 1JEYB 1ZCJA 1I2ZA 3ZV6A 1MU0A 2IT1A 3FFWA 1RZRD 4KAFA 2X9VA 1F60A 3MTIA 1R4MB 1Q17A 5JSKA 2OBNA 2JGIA 721PA 1FTSA 4ZHQB 4OFBA 4KB5A 1XYGA 5ECGC 4BL5A 2ZS8A 2XE6A 4Y2GA 1E9VA 2R00C 4XZ3A 4TVBA 1PL0A 1SA0B 3AGPA 1L6IA 4MLPA 1JNXX 2CLDX 4PIMA 2QPTA 2I2XB 4O08A 3Q0IA 2AN9A 4YHHB 1GG2A 1B8OA 3UWOA 4ZO8A 3AEXA 13PKA 2OD7A 2Q9AA 1POXA 3U48A 1XZDA 2ESRA 4RDHA 2P2CA 4FCWA 1A76A 1XLUA 5EIAA 1HE5A 2C78A 5IULC 4G0PA 3A6PC 1PYGA 2JGLA 3AVQA 5JAZA 3DOOA 3LWNA 5EQFA 1Q5PA 1PT7A 4F3RA 2NZ8A 3BILA 3TSCA 3L7MA 4P0TA 3ETGA 2O14A 2YXBA 3HK2A 1LPSA 1U3CA 5ALQA 3TWOA 4JROA 3HC7A 4XI9A 1KJZA 3DHNA 2CXOA 2O3TA 3K0AB 4KZPA 5K0JA 1QH8B 1P60A 4MIKA 4ZVLA 4CM7A 2WUDA 1L5NA 4EB6A 1VMEA 3RRNA 1AMUA 1Z0FA 1E9FA 3TS1A 1G21A 2QJWA 1X1BA 3TN7A 3JU3A 1IHOA 4NBWA 1BNCA 3AOEA 3DT6A 3D8RA 3IEIA 1KTVA 2H63A 4OQEA 4BQOA 4OQZA 1KP9A 1QE5A 3UXMA 3H7IA 4BUCA 4DNFA 3KQQA 1V1JA 1YJXA 3N28A 1U98A 2XGGA 2RGGA 4Q3BA 2HH9A 4V1CA 4MWGA 3QUTA 1VPEA 3N74A 1ESZA 2GUGA 1UFVA 2J7PA 1Y9EA 4UDOA 3EEFA 3F46A 4FEAA 5EIHA 3AHIA 3WYDA 3LHKA 4PPQA 3E82A 5DGHA 3VDMA 4X71A 5LR6A 2ZREA 1ILWA 1JLMA 2Z04A 1U2GA 1RBYA 1ZU5A 1E79A 5I7VA 3ZTTA 4A7PA 1WUJS 1G55A 1ZJZA 1MX3A 1YB5A 2QXTA 3DZCA 4JB0A 4UCWA 3QMPA 5LYYA 2RGCA 2P5TB 1UEXC 4E2YA 2BFEB 1QRTA 3TTSA 1UJ4A 2FEPA 5JSFA 1NI4B 2FA9A 4IJ5A 3R7AA 3RSLA 1JPJA 4E15A 5FRDA 4F6RA 5BNZA 5JCOA 4CEIA 2FOLA 3KB8A 3CW8X 3N07A 3K6JA 2VWGA 5KDLA 3VR0A 1OD6A 4IXNA 7GPBA 2PMFA 3I6ZA 3UANA 1KAHA 1C3LA 4TX1A 2C7GA 4W1QA 5HGXA 4RYDA 3BXZA 1RABA 1VIMA 3C3AA 4Q9AA 3F98A 4QRIA 4ZT5A 4F56A 3T1YB 2MYNA 5EWJA 4MYCA 5HTKA 2YMMA 2QPLA 2ZIZA 2MSDB 2OQVA 2JGKA 1QZUA 3IBTA 3T5AA 1UT5A 4P34A 1NRJB 3KFLA 1HEIA 2FHSA 4WWHA 4D99A 1R3DA 1T2UA 1DAGA 1EI9A 2O5VA 3WL6A 3ZVNA 1CB0A 1QKIA 1YMUA 1YUBA 4MA5A 2J5KA 3QA3E 1DXHA 2PGXA 3M6WA 1GPYA 1G7RA 3ER9A 2C9BA 4J29A 5ENDA 5BO5A 2F7SA 2ZB8A 4DZRA 1ND5A 1JVSA 3WHKA 2DLCX 5KSWB 3AEYA 3CBGA 1N2EA 4RTSA 5GGXA 5F9HA 4FYVA 2WSSA 4Q4AB 4QGBA 1X1EA 4TSKA 2CVOA 3KK0A 4JV5B 1JXQA 1EGAA 3DCYA 5KVQA 1T4MA 5H81A 2ECOA 1ATZA 2BTQA 3P52A 2NYRA 1PKXA 2VT6A 5B4TA 2C94A 1ZJYA 3KCQA 4BJ6A 2J0SA 2ZLBA 3GGJA 4NESA 4W4TA 2GYUA 1PK9A 4BMXA 3IKTA 3K6SA 4RNDB 2JAXA 2Q5OA 3WGJA 2LCFA 4O2LA 3RU7A 2YUIA 1OB2A 1K8ZB 4R9VA 4CL0A 4C03A 4KXMA 4PXYA 4CFZA 4K40A 2TMKA 2PMBA 1WETA 4JJFA 1WZIA 4IVRA 4IIJB 2NXEA 1YZUA 3GA7A 5HZMA 4G5YA 2V6FA 4IF4A 1TTPB 1HG1A 4MB2A 4EKGA 1YZQA 2QL6A 4JT8A 4X7PA 3WSVA 1T91A 2QQGA 1G2OA 3C5CA 1N9GB 1YGYA 4BQNA 3MRTA 3GFRA 1M6WA 1Q3TA 1EWKA 1R6AA 4M86A 3A37A 5FQNA 2XQVA 4F1WA 3EVZA 1KWKA 1O77A 3DOFA 1SKUA 3KR1A 2V0NA 4B48A 1IY0A 1CJKC 4C6RA 4I1UA 4B2PA 2Q50A 3ABIA 2DTEA 3FRHA 3QKRA 1OYYA 4EGJA 4EUKA 1KZYC 1NXOA 2ZSJA 3GR6A 2VL7A 1MHTA 3E9NA 3TK1A 1GV1A 3L6EA 3S4YA 3OBIA 4MKRA 4CGYA 4HSEA 2JIBA 4C7BA 4ILKA 3MZ0A 4UNPA 5FQOA 4IYRA 3LXUX 3AIOA 5IMSA 3I2JA 4M8KA 1U02A 2X22A 4HYTA 3BERA 1IMOA 2EFHB 2BMDA 2BLLA 2DQ4A 3D43A 3FVWA 4O02B 3F6RA 5HBGA 4J4TA 2Z95A 2YFYA 1Y4AE 2A9OA 2H3EA 3MELA 2DPXA 1N8NA 1NIJA 1LVUA 2IGTA 2J3MA 3HWX1 3C3MA 4RD4A 3JALB 3Q5DA 4ANFA 1XJWA 2RH9B 3Q41A 4IINA 4NI5A 3MJCA 1LEHA 1Z6GA 2G28A 3BWMA 2VHYA 4N6GA 2IS2A 3IPAA 1U2RA 1K4MA 3H11A 2O0JA 4O2BF 4LRQA 1LPBB 1VJCA 3L77A 3S28A 3H5TA 1WVMA 4H7HA 2H2GA 1ONNA 3JSAA 3P19A 3VYRB 3FY4A 1QAOA 1JHUA 4UOQA 2O57A 3D9QX 3NNDA 1VKJA 1YE3A 1YULA 2YJ3A 4FHCA 3RJ9A 1XI2A 2R60A 5DIFA 5HF6A 3UK0A 5A9RA 1NFQA 1TAHA 1QH1B 3M1AA 2FMIA 3NTLA 4II7A 4OOEA 1PJRA 4TXNA 4TL6A 3SLKA 2Z9BA 4OQFA 1CF9A 3NALA 4RHXA 5JI2E 1WMFA 5IJ0A 1RLOA 2XQKA 1ZLXA 4NH4A 1KDZA 3T3GA 3ZU6A 2J9FA 4IGAA 2O52A 3O5AA 4BGEA 1VSQA 3PQCA 4XJVA 3V42A 3KZXA 5L3QA 2AMVA 1JWLA 3BT7A 3L8HA 4CU5A 1RPAA 3HJTA 2DCUA 5EWMB 4A2QA 1D6NA 3IO5A 5FWYB 5AW3A 3EEBA 5CT9A 4YRPA 1SC1A 4LHEA 4JS0A 3WISA 4NY1A 4WN9A 1M76A 1A82A 5DLDA 3G5MA 5KMGB 3BEOA 3ZWXA 5LD2B 1OILA 1GL9B 2RGBA 3F7OA 3QVWA 3ICCA 4XYLA 4IDAA 2G8NA 2GN8A 2GEFA 2WG0A 4CM8A 4KU4A 4RPLA 4ZAVA 1XDBA 4ND8A 1Q7CA 2F1RA 5CGQB 3KD2A 2X0EA 1JSRA 4H7EA 5LMCA 2ONYA 2P9TA 1BYIA 1LUAA 1Y63A 1Z2EA 2IXBA 2QTWB 3ICPA 2OGSA 1KKUA 4C22A 1UK7A 2PD3A 3M70A 3QVGA 3O90A 5IBCA 2XTAA 1C1YA 4UUQA 1WSBA 2Y1GA 4F5ZA 2C2BA 4ZN6A 2CXRA 3ORQA 1DKUA 4OHFA 1PJZA 1ZRSA 1EFRA 1ABBA 3RWMB 3H4VA 1E3WA 2XCOA 3UK1A 4QQRA 4ARAA 1S1CA 1GT91 3A6EA 1EFHA 4RTLA 3RE1A 3A7DA 1U3FA 3U60B 2QVLA 2ZI3A 4FHZA 4GXQA 3RGWS 1DCFA 2AMJA 4FQ7A 1AKNA 3C3JA 2X9LA 5CT5A 1R6BX 2QU7A 2R8RA 4AZ3B 2ZYDA 5BSTA 2CXTA 2P2LA 2FB9A 2PMKA 1CUFA 1RWVA 4NQZA 3HLKA 5EXDA 4C78A 4MUEA 5IN4A 3GN1A 2GZ3A 1TGVA 4Y8VA 1B00A 1OXKB 1WCWA 4POAA 4QYSA 1AQ6A 5F1PA 1R4NA 2R68A 3LP8A 4MWTA 4AMGA 3NDBB 3VR6A 2A1UA 2R4UA 1L5HA 4Q1FA 3TVDA 4H7JA 3EBOA 2ANCA 1K8RA 4M21A 5E2IA 2PCLA 1YJAA 2GK7A 4WNCA 1IZ7A 3DF7A 4MS3A 1OHHD 2F9MA 2QRVA 3S81A 2YY5A 5FFMA 1FRVA 3VFDA 2B34A 3HVUA 1HTWA 3LQKA 5BOVA 5CVDA 4EM6A 3NATA 3QPAA 2G72A 3LY8A 4MUXA 3V1MA 4G8DA 2EW2A 1H5QA 2WIDA 1TK9A 1A27A 2J85A 4RPIA 5FTWA 1JLHA 1RADA 4F4DA 1YB1A 2FGJA 1YOVB 4M7PA 3FLMA 3S2ZA 3OPNA 2UUBB 4CV3A 2BR5A 4D92A 1UANA 3UHAA 3W05A 1AS0A 1GAXA 4KN6A 1CRQA 4AY4A 5CJJA 5IAOA 2W2PA 1QQ6A 2VZ9A 3WWEA 1MVNA 3N0VA 5JE8A 5C1BA 3NGMA 4KUEA 3KEFA 3A36A 3GAFA 5TQVA 1A9OA 4A1OA 1O08A 4M6WA 1OWNA 2YIJA 3BRSA 4JI8B 5ER6A 2WVJA 5F77A 2PY6A 3EGXB 2AXNA 4QXOA 3GGOA 1RC1A 2X0JA 3JALA 4MJLA 3MIIA 3NEPX 4LRYA 3ZKAA 4QKQA 5HW0A 4YP5A 5LZ7A 1KOGA 2UV8A 5E0KB 2QORA 4L85A 1PTJC 1ZCBA 3TL6A 3EWAA 4B45A 2L18A 3ZGZA 2A57A 4MPPA 3CYFA 3INGA 1JG6A 2F8LA 2OV3A 3MT9A 3JQ8B 3R4VA 1Z13A 1KY4A 4AN1A 4CQMA 4EX6A 3O9MA 4FMDB 3RIHA 5IKPA 3PXUA 521PA 4ETIA 1QTQA 5K0NA 1GCIA 3CRZA 1L4LA 4E03A 2GBPA 3W8EA 2PX0A 1OW3B 1M2GA 2FG6C 1UKEA 1YI8A 4YR9A 3N87A 4FGKA 3C14C 1MUUA 2QGFA 3G8BA 4N49A 2K7ZA 4XB2A 1BTOA 4XWYA 3GEIA 5LMZA 4KQHA 1G2IA 2BFBB 2JLBA 1UQRA 2WZCA 1KFCB 5D3QA 3WL5A 1T4DA 5FWXB 3W6ZA 3RYHA 1E7WA 3NHPA 2I7TA 1A04A 5F2OA 3V2HA 1AG9A 2D6FA 5LLSA 4QIHA 1RXUA 3OESA 1QF6A 1MO5A 3OQBA 4B6RA 6YASA 1E2KA 2QRUA 2JGRA 4R8MA 2GILA 5KQRA 5LN1A 3CURA 1XTQA 3G8CA 3QW4B 2FR8A 2NNWB 2C4VA 1SC3A 1P1FA 1YCFA 4DDUA 3TXXA 3CX7A 1II0A 1ADCA 1NY5A 5JY1A 1WHSB 1DMSA 2VF8A 2ZBRA 5HM6A 1W5AA 3QEOA 4K0KB 3SYRA 3WVNA 2BP7B 5KTOA 3X1WA 3WLRA 3H8VA 2B9EA 1H6BA 2BGKA 2J08A 1I10A 3K5WA 5IC5A 3BDVA 1WDTA 4ZANA 2J0QA 2VQSA 4YMWA 2VNIA 3TEFA 3WNQA 3E3AA 5AKXA 5IDWA 2VT3A 3I52A 3QXSA 4HEHA 5DXAA 5DYWA 1R15A 2VP3A 3DE0X 3M6AA 4CM4A 4F4FA 2R6ZA 2CLOB 3LC0A 4REMA 2B8EA 4KR2A 3BJEA 1V9SA 3GLIB 4HFJA 2ZTUA 4R54A 5DCYA 4D4JA 3WIDA 1J0AA 1S1MA 1Y9ZA 2JFNA 2P2NA 5KAPA 2FZKA 2PFKA 1ISRA 2XMBA 4PCVA 3VH2A 4H35A 1II8B 1N1MA 2QTNA 3NYRA 4X95A 2GZ2A 4FBLA 2VK4A 2CJPA 3AVXA 4M8NE 3DYVA 1P18A 1U2DA 1SG6A 2O2JA 4OAPA 1ZPDA 3GIWA 5AH0A 1GWNA 1BCRA 4AWBA 4LZJA 5JH7F 3FWYA 4FNGA 2FPLA 4WX2B 4XEUA 1BVRA 4W5WA 2PGOA 4F6LA 3JXEA 3UB4A 1TMYA 1TKBA 2IHTA 3HCRA 5ALKA 3VR5H 4EHKA 1TM4E 4U9UA 3MFQA 2NUTA 5J59A 3WGMA 3ND5A 1WUYA 3N2KA 4Q9DA 2EP5A 3U9SA 3CLRC 4CLRA 3H1PA 2ZITA 3D7KA 1JVBA 3W8RA 1M0SA 3KRTA 3QYPA 4E5NA 3JQAD 4G81A 1KK3A 4X93A 4EYSA 1PR6A 5DNDA 4HVCA 3HA2A 4N7RA 1YHZA 4J1TA 5BN1A 1BDIA 2P9GA 1HSOA 1S02A 2QMOA 2QJOA 3M6MD 3DV0B 2ZE6A 1BDMA 3JQ7A 2VPPA 3GRFA 1D2MA 3QI2A 2DQKA 3TBHA 2V5VA 3E70C 1VBKA 4C3VA 1VE9A 4R2JA 5J4YA 2K2WA 3I9KA 4B87A 3EF1A 3AR6A 2UZ4A 2NXJA 1NI4A 4XFKA 3GG2A 4C7OB 1O95A 3LBYA 3BDAA 1EWYA 4PX3A 4A4DA 3HS3A 3JQGA 2Q4DA 2Y1OA 1UMCB 3COYA 4Y0AA 3RGGA 2H4JA 4HWSA 4C20A 3KTFA 2GDJA 5AJZA 3WLLA 4IUCS 5GIPE 4GVPA 3CX4A 4ERXA 1ZC3A 3TJZA 4F38A 2XIQA 3CN9A 3K1YA 3U39A 3I61A 3JCZA 2RI0A 2ASEA 1U63A 1KO4A 1ZEJA 4UEJA 1LH0A 1M2HA 4BLQA 1O0CA 4TM7A 2DH6A 3LOQA 3N2YA 3UKOA 2ZT7A 4YO8A 3G0GA 4PC1A 1DAOA 4WRRA 5BOSA 3TW4A 2CJXA 2OBYA 5IWCA 5CK4A 3V55A 3V4FA 4Q00A 3H9QA 1NZDA 1YBVA 4ODIA 4ONEA 3IBYA 1YHNA 3I1IA 5COBA 4B3MB 1W85B 3IIMA 2V3VA 3C41J 1CDEA 1P4HA 2F6RA 5JAUA 1STOA 2X7HA 4WK4B 3IALA 4DV7B 4HXYA 3I2KA 2QKYA 1E1MA 1MW9X 3DO5A 5ITSA 3A1WA 3Q2IA 2GPNA 5HKOA 1KEKA 4PYMA 2X8BA 1IZYA 4QREA 5H3HA 5CK5A 1FP1D 4RQAA 5IAEA 1WMBA 1QO9A 2LZ0A 3NTVA 4HRXA 1GTRA 4GMDA 2ENWA 4Z9XA 3MT0A 1ST3A 1WEKA 1RJEA 2AQIA 3O2NA 4UUAA 1J0EA 3NB0A 3NYQA 4FLMA 4CM8B 2H5JA 4IQ4A 2PZMA 1NWCA 5BQXA 3EZFA 4FQ5A 3LPDA 4RM2A 5K8IA 1EFUA 3HB5X 1HI9A 1SKYE 1OB5A 1HNXB 1M34E 3RVRA 3VPSA 2QE7D 1N25A 4QTTB 1ZR2A 4EG3A 1Q20A 1B8NA 1VG9B 1WXWA 2P9YA 2VWHA 3CLKA 2GK3A 5T67A 5BVHB 3LZ6A 2H59A 4QU5A 4U63A 3M5DA 4E30A 4DLXA 2VJKA 2C54A 4WNYA 3DOEA 5JTUA 3QVLA 4EPVA 1GUYA 2CZGA 2VIIA 4OM7A 4QXQA 1QYWA 1Z22A 5E6RB 2GVNA 3QENA 1MNQA 3O2SB 3TLZA 2ZVQX 1Z9BA 3O84A 4CMEC 4BKOA 1FYXA 4AZTA 1OAKA 5JROA 4JJ7A 3AUUA 2LKDA 3CVWA 1A8SA 4FN4A 4A6EA 4RDCA 5A4KA 4LJAA 1U4NA 4F1KA 4G26A 3NKLA 4NRDA 3OQIA 5A62A 2R8XA 4PC6A 4PONA 1V5FA 2HT1A 1T5TA 2X1MA 1XZJA 2RK4A 3HCWA 1L5RA 2NADA 1DPGA 2Q9BA 3IQIX 1L8OA 2YW2A 2AR9A 4ICIA 3V6LA 2RAPA 3X44A 4ZCMA 1YFJA 1R6UA 4P31A 1YHYA 2OHGA 2AWNA 1KEZA 1N6LA 2ICAA 3SMQA 5JCOC 1AMNA 1BX1A 2X2OA 2NTNA 2O1XA 1ULBA 5C1PA 3PHIA 1RQGA 2J0UB 2YZ2A 3K4PA 1AKYA 4X24A 3ZHQA 5E4JA 3ND7A 1AZSC 1DAEA 4HLNA 3VOBA 1AGXA 2XCQA 3P0EA 4U00A 3R9WA 4G63A 1D0SA 1OTYA 1C9DB 3N8NA 2I4TA 2YY7A 5KREA 4L4UA 4Q6WA 4I08A 1MA3A 5J47A 2COKA 1U31A 3KQSA 2EHJA 3GB9A 4TROA 1KQFA 1Q57A 2VCHA 3DFFA 1VIDA 3E61A 3KJEA 1NONA 4V02A 4L50A 4M49A 1CY0A 1KH1A 2VHQA 3DMDA 4FKZA 1IWPB 2EG9A 1H66A 2D7JA 4NKRA 5FO0A 3I8OA 4BVEA 1TQ6A 5C8DA 2FV8A 4D02A 2WU8A 1Q0LA 2X5OA 1E5VA 4M4SA 2OA0A 3AOEC 1XTJA 1MXFA 3C3XA 1V11A 1FE8A 2W6OA 3H17A 5AXAA 3W1VA 3CH4B 1TM1E 3CVXA 2Y1FA 1AGYA 1GZ4A 3RS9A 1IWBB 2AXEA 4BP3A 2R48A 4E5SA 4BX2A 5KCZA 1TQDA 1GARA 3TRKA 4RHEA 3A6FA 3DW1X 2G83A 1ULUA 3RT7A 1NXWA 1N3YA 8LDHA 3SJZA 4GF5A 2ZI5A 3O2JA 4JLWA 4PC3A 1NW3A 2X6RA 2HJHA 4G56A 1Z47A 5AIBA 5B7QA 1DFGA 1QZ3A 2MINB 4R1NA 1O5TA 4DDHA 3D4LA 2XZLA 4C14A 1E96A 2IQIA 1Z6QA 4ZT4A 5G0SA 4JB2A 1QJCA 1TQ8A 5KKNB 3NM5A 3Q87B 3QFCA 2PYZA 1G3UA 2ZJAA 4RPKA 5ICCA 2WTUA 2VLIA 3Q3HA 1YVUA 3THWB 4ARIA 1UAGA 2O6HA 3IQWA 1PEDA 5FWAA 2R6DA 2NZJA 1VB3A 1TA9A 4K0RA 2ZWMA 2A5LA 5EZ6B 2ODWA 3DBOB 3DZ8A 3F0TA 4QO7A 3T15A 4DR3B 2LE0A 8GPBA 3PHGA 1FP7A 5JMOA 2RAUA 3A9RA 1XN1A 1MT3A 5B1HA 1IBMB 3AONB 2EERA 3CUYA 4IH9A 4F21A 3FNGA 1VG8A 2WJ3A 3JQQA 3CO0S 2YIVX 1H3EA 5T5QA 5FWDA 1IM2A 1XTPA 1DT5A 3WLKX 4FM9A 1T2EA 4AJ2A 4FXOA 1QPGA 3A7EA 1MVLA 1ZD1A 3BCRA 2OHIA 4IDDA 4R05A 4TVKA 4DMUB 2JFYA 2NQ8A 2TYSB 2X8LA 2EZ4A 4YYZA 3J81A 3MPOA 4DXDA 1KO5A 3WGGA 4UD6A 1FFYA 4IMJB 1PVVA 2ANBA 1DRWA 3NANA 4FINA 9LDTA 3FTCA 1PR1A 3DMTC 1L7AA 3A1TA 3TZCA 2O05A 2V7GA 4FYJA 5ES3A 2AYZA 3PWZA 4DKXA 3WK5A 3GRPA 2PZBA 3NHAA 4EHDA 4CG1A 1C1XB 5AJUA 3DT9A 3DBLB 3FUUA 2B20A 3Q1KA 3SHTA 1Y4SA 1HYGA 1VP3A 2Y9PB 4WA7A 3IO3A 1RYZA 1NR5A 1MFZA 1IUPA 1KDOA 2C9ZA 1T4CA 2ECQA 1G38A 1EQUA 5AIAA 2AJDA 4NPHA 1XCLA 4V0NA 5H70A 1JAXA 2P75A 4D4IA 1NBEA 1T6XA 1YAHA 2VYFA 1YRQA 2AMFA 3BL8A 3OSZA 4FIZA 2JAWA 4QD3A 3WJ2A 5AM5A 5H4HA 1JG1A 4C0QC 4EL0A 3U3ZA 4FR2A 3QJ5A 1ZQ9A 3OM0A 1FNBA 1DCKA 2VJNA 3LYHA 3CONA 3FX2A 4YMIA 5D51S 2DBQA 4Z9AA 4CN8A 3MS2A 4IIFA 1H2BA 1LGYA 1RCTE 4GPAA 2AQHA 3DHYA 3ISTA 4IOJA 4R68A 5FEMA 5J1SB 2ZSHA 2SKEA 3G49A 1L8QA 2I2CA 1JPVA 4NLLA 3TH5A 3WB1A 2W58A 2ZANA 3UJNA 2CLKB 4OM8A 4YUVA 1E6LA 1WF3A 4L0CA 2XMCA 3KTOA 2WHEA 4DT1B 1JXOA 3H6GA 1XGKA 2O06A 1RE0A 4G8CA 4BO2A 3F9CA 1E0SA 1VKRA 2FTKE 3TLGB 3ZWPA 3WAJA 4OP3A 4P54A 3CF4A 4EWLA 1W48A 5IUJC 1T36B 1CR0A 3BICA 5A4JA 1V1RB 3S5UA 1SCBA 4MWCA 1NLFA 4BQSA 2EJVA 4OREX 1C9YA 4AIRA 2EX4A 1Q0QA 3LI2A 2PX6A 5I9LA 2HSDA 4QTUB 1G9SA 3U62A 3G9QA 2P1ZA 1OA0A 4GP6A 2JLAA 1B3RA 4YT8A 4P2GA 2H2DA 2B1IA 3HDJA 1VL6A 1NN0A 5CJPA 5KNCH 1CRPA 4CR8A 4B6GA 1TQ2A 2Z2IA 2B5WA 4QXPA 1X7WA 1LBIA 4BMNA 5K8UA 1ZUD1 4B75A 1K92A 5TPZD 1SFRA 1A1SA 2MSCB 3OP1A 1VIAA 2BI7A 3F5DA 3H1TA 4BKUA 2IH5A 3DYIA 4US1R 4DR5B 2WWHA 3EISA 2Y92A 3QBVA 1PR9A 1UPTA 1THMA 3TE7A 4FK8A 3ZDQA 4ZK6A 3Q3VA 1BXRB 2EC5A 2O0KA 5JV5A 4XB1A 2XWBF 3W3AD 3HBFA 4JLNA 2AG1A 5KYGA 2Q4BA 3HB4X 4M76B 4RA9A 4ZQCB 4L78A 2VJPA 3O8RA 4GLBA 4A8JA 2FRVA 5JUWA 4QDKA 3G13A 4O4LB 3U7EB 5KTYA 4K9PA 4A8HA 2PUEA 1UXKA 3NHSA 4KQIA 4XUEA 3ZJTA 1FS5A 3H04A 4TTVA 4BFCA 1NI5A 4MTCA 4FFMA 1NJSA 3EH2A 2VEDA 2EZ8A 3GA0A 1YA4A 3FSJX 1OYOA 5BURA 5HQ3A 3NH6A 5ITWA 4OUKX 3MUFA 3DVRX 3OU7A 4LC0A 2GCOB 2YWJA 3PHJA 1DLIA 3QVUA 5G3YA 4NCAA 3VDXA 1YQUA 1JWAB 1SVMA 4AG3A 4RVUA 3CG0A 1YZ3A 4KLCA 4BDTA 1TAGA 1QO0A 5BQFA 1FDIA 1FTQA 5IP5A 4QGSA 2RGNA 2NN3C 2BJWA 5A71A 2LNDA 2J6HA 1ZUNB 2YX1A 3D6MA 4YT4A 1HDEA 2WOJA 3AOGA 3JQ8A 2J5RA 5J5AA 1U99A 2Q7XA 4MR9A 1HBJA 2FW8A 1GGKA 3HEAA 4EHFA 2WAAA 1JHDA 3ANYB 3LBAA 4RV4A 4RMNA 3EA4A 1WD5A 1ODCA 1IAQA 1V11B 4O63O 3CSDA 4IZIA 3TL2A 1ULZA 4V24A 1EINA 2VEOA 4UM5A 2XGOA 5BV8A 2OVFA 2ZDQA 5KOJA 4KKVA 5I9NA 3DR3A 2ZUBA 3ROGA 2ROQA 4I9UA 1B0PA 4G5OA 4QJIA 1HDYA 3OJWA 4OKIA 2P9QA 1JJFA 3R1IA 1FU8A 1O9BA 4F4UA 4A0FA 2B0CA 3UT5B 2XAUA 3COPA 4TTAA 5LM3A 4NSNA 2BW0A 4CZ2A 2PUAA 1UPBA 4UMDA 1ZXBA 4LXTA 2FSHA 1DBRA 4TTIA 4Z49A 4HLQB 4JJ4A 3C4JA 4YJFB 1UKAA 3QW2A 1PJ4A 2IYWA 1MABB 2QLTA 1RXVA 3LNTA 3GRYA