5E4FA

The spring alpha-helix coordinates multiple modes of hcv ns3 helicase action
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease NS3
publication title The Spring alpha-Helix Coordinates Multiple Modes of HCV (Hepatitis C Virus) NS3 Helicase Action.
pubmed doi rcsb
source organism Hepatitis c virus genotype 1b (isolate con1)
total genus 150
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5e4fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA01
5EP4A 1FW6A 1T8TA 4IOJA 4HAUA 1II0A 3QNUA 3KKQA 1P2VA 3CNLA 3TQCA 1MRNA 1DBSA 4XOIA 4WIAA 1FUUA 2A30A 1Q1QA 2F1HA 2YWHA 4U00A 3WYFA 4BFSA 1W2GA 3GPLA 2OILA 1NIPA 4UQOA 4MGKR 2VSFA 2PEZA 3IQWA 3QENA 4EPYA 4AKGA 4LYJA 2VRWA 5L3SB 3B85A 2A9KA 2WSSA 3FKSD 4TSFA 4KFUA 1CLUA 3LY5A 2PZEA 5L8VA 3AVXA 3CIOA 5J4VA 2XZLA 1Z07A 1XTSA 2AK3A 1II8A 2YOGA 3NC1C 5GVRA 4ZV4A 1Z0JA 2Q21A 4A2PA 5B30A 4CRWB 3THWB 1B23P 3KL4A 2GAAA 4ESHA 3SHWA 1NG1A 2N42A 4DCUA 4URZR 1ZP6A 4ACBA 4PSAA 4UXIA 3U60B 2AKAB 1ZUNB 3WRXC 3GLGA 2ZANA 3TW4A 3UPUA 1NJGA 1YQTA 1YZGA 4QFMA 3U3MA 4R71A 1WB9A 2NZ8A 4RZ3A 3B60A 3DM9B 4BFXA 4KLZA 4QHYA 1CR4A 4KFTA 1GL9B 4C0SA 3AP1A 1FNMA 1SKYB 4XTRA 2VHQA 1PLKA 3CNOA 3FHOA 2F7SA 4JBWA 1ZD8A 3ZYCA 1RPZA 2Z83A 3K09A 4A15A 2ZYUX 1GZSA 2VHTA 2XB2A 1G8GA 1QVAA 4HLCA 2FA9A 2X2EA 2YWEA 3L0IB 4F4CA 4JT2A 2JLVA 1QHNA 4TYWA 1N0WA 1I4DD 2IXFA 3GJ6A 2ZRLA 2GK7A 2ZSEA 3EA5A 4MYHA 2JLSA 2GXAA 5F3WB 4F92B 2O8FA 1QF9A 1WDTA 3NDBB 4MUBA 1RYFA 1SXJC 4OQXA 4HAZA 1RRCA 1KI4A 3LLMA 1B0UA 2QQEA 5HCNA 1QHGA 2W6JA 1GL7A 2CLDX 2E1RA 4B43A 2ZVQX 5BYJA 3RS7A 1NMZA 5L3VA 2QPAA 5EE3A 4CT4B 2J5XA 4B73A 4ZDKA 4ZCMA 1SVIA 1E2HA 2BMEA 2BIFA 1R2QA 3K0AB 2YC4C 4A0HA 4PPFA 3GLHA 1E1RD 4KSBA 4EJSA 4TQUS 2PLFA 1GKYA 3D31A 3WBJA 2OZEA 4JLBA 2ATVA 3QKSA 1FPMA 5AJXA 1PJRA 1ZYUA 2GCNA 1U9IC 1GG2A 1SGWA 4LC0A 2IBMA 3BWDD 3EWSA 3F3YA 4C0BA 5JFGA 2QMUA 3TR0A 2LKDA 1N6IA 3ZJYA 4TWZA 1XBTA 2VP0A 4LK2A 1EFRA 1KJZA 1II9A 2XOKA 4RFSB 4O2LA 4Q47A 4RD0A 2AD1A 1SXJD 4JMPA 1MO4A 2KBEA 1X3SA 3OAAD 5JCPA 3ZS9A 3PEUA 1ZIOA 4HSEA 5TB5A 5IT5A 4PC7A 2E9SA 1KJYA 3MD0A 5CLLA 1JBKA 1NBME 2ANBA 2FMXA 2CHVA 2Q9BA 4TMZA 4MGZR 4P32A 5BYKA 5KHOC 4ZCLA 4YMTA 4NHOA 2G9NA 1F5NA 1UEIA 1GRRA 4ON9A 3OIWA 4BFWA 4TQAA 2BDTA 4P4UA 4KAXA 5AUPB 1G17A 2BM0A 2GK6A 2YYZA 4JKYA 3TVDA 2A7QA 2GZHA 1S3GA 2BBOA 3P26A 4KU4A 4CW7A 4C0AC 2IW3A 2QZ4A 2G83A 3QOFA 3BS4A 3SJBA 1W5TA 3VKGA 3EZ7A 1IBRA 2W2XA 2AWNA 3W90A 3THYB 2HUPA 4ZIRB 2GF0A 2RMKA 5DSZA 5DNYB 4XWAA 4DHEA 2QY9A 5CLQA 1YR9A 1OYYA 2D06A 4U5XA 3GJ0A 4HDCA 4HATA 1P2SA 4TYQA 2NPIA 2BC9A 2ZSFA 2VF7A 4JS0A 2OFOA 4YMWA 1YJ5A 4IVPA 4CYMA 1UKVY 4W5HA 4RJLA 1VCMA 2MMCA 2ORWA 1N5LA 2OV2A 4AI6A 2FEMA 3SOPA 4AWXA 3ZLJA 2WWXA 3LQRA 4TLBA 3PFIA 3PXGA 1G5RA 1P9WA 1GILA 1K5GA 3KXKA 1XZQA 3QG1A 4B74A 1P9NA 1TU4A 1E0JA 1KDOA 4N1AA 1OPXA 2IUTA 5ANRB 3PVSA 2UZ3A 1OXUA 1K8RA 4ZCIA 3EPKA 1TQDA 4D0GA 4BECA 1QDEA 1E0KA 2FPLA 4M53A 4ZPXA 5FTMA 1KO4A 3AUXA 3BORA 4B35A 1GOTA 5TDHA 4DB4A 2PX0A 4PANA 5E7MA 1E2KA 1RYHA 2C99A 2QU8A 4Q00A 2VP5A 4PHTA 2B7BA 4LHZA 4B76A 4Q5IA 4S2EA 1JJ7A 1S3SA 4GMXA 1JPJA 2GWHA 3QVVA 5H1YA 4OI1A 721PA 2QTFA 3C41J 4TZ0A 3K1JA 2HV8A 2GXSA 3R8CA 5CIQA 3N2EA 3VTKA 1S2MA 2V7QA 4L9SA 4O3MA 3W6PA 4TYNA 4GSYA 5TARA 4JSTA 5K8TA 2FF7A 1HUQA 4O25A 2WKRA 1DOAA 3EARA 3FHCB 4YQFA 2VP2A 1H8ED 2EYUA 3GLIB 521PA 3T1TA 3U7FB 1J70A 1C4OA 1T6NA 1YRBA 3SFZA 4I4LA 4L16A 1KK3A 3SFVA 3U7GA 3CRRA 1Z6XA 1T3HA 1F2UB 3AF4A 2IYXA 3Q85A 4R2IA 1RZ3A 2HLDD 2CMKA 2C78A 1VCIA 4W5WA 2BJWA 2WPDD 1TF2A 1EFUA 1NKSA 1RRPA 2EFDB 4P33A 3AGPA 1ZNWA 4DDTA 1IXSB 2GEDA 4RD2A 2NMVA 2ZROA 3LNCA 4MYTA 2X1VA 4KV9A 3VR6A 1G4AE 3KJIA 4PSVA 4QL3A 1R5NA 1K5DA 1P5ZB 3JVVA 3CWZA 4JJKA 1KNQA 3A1SA 2UKDA 3KXLA 3QE0A 1G3QA 3DL0A 5DIFA 5KUTA 1IY0A 4LPKA 1PLJA 3U2QA 421PA 2DR3A 3X1YA 3MWJA 5FI0B 2ZR0A 2JLQA 2EU8A 4E03A 4GDFA 3E1SA 2LKCA 2QMOA 2I3BA 1DEKA 3EA0A 4WXPA 2WSMA 1ELOA 2KB0A 5KPDA 2FFHA 3SBDA 3SBEA 4MRNA 3HP1A 2JDID 1F2TA 4TQ9A 3GP8A 1KSHA 4OQNA 3ICQB 2R65A 5E3HA 2X8AA 4TZ6A 5CJ2A 3F0TA 3DVLA 2QE7D 4H1UA 3MAAC 1ZNZA 3I1FA 4IOMA 4NONA 5FBVB 5SZKB 2R6FA 3N5CA 3K0SA 1KDTA 3FWYA 3KTAB 2QBYA 5C4MA 2F43A 3ZQ6A 4MYCA 1YE8A 2JIZD 4LYHA 4BLTA 3EZ2A 2JLYA 5C2JB 4E07A 5ELXA 5DE3A 2CVFA 1DPFA 4CGZA 1UBCA 3A8TA 1OB5A 4K81B 1BKDR 1ZW6A 1GRNA 1L4YA 2CJWA 3KJGA 3MGCA 4EAQA 2FPKA 2VTKA 1KTVA 3R9WA 1M1YE 1GNRA 3FB4A 4C0HA 2O8EB 3T35A 4M1KA 3W8NA 4UJ5A 1Q1EA 4MKIA 1FP6A 4X8HA 5EE5B 1Q44A 2ZRMA 4JLVA 2PEYA 3ONWA 1JJVA 3NEYA 2CL0X 4HZIA 4KYUA 3C5HA 2QT1A 2MSCB 2P0EA 1K6MA 3BH6A 4CVNA 4JYBA 4A4DA 4B3XA 3TW8B 4JZKA 2ZI5A 1BYIA 2IEZA 4QBGB 3FFAA 2WJYA 2F3TA 2ZQ5A 3PITA 1COWA 5FH9A 2ODWA 1ZUIA 2WICA 1WA5A 4TMTA 2GXQA 2VBCA 1HV8A 4KBGA 3VX4A 4JLAA 1HQYE 2HXYA 2JGNA 2F9LA 3BBPA 2HCBA 2G3YA 3I73A 1AJEA 3KQLA 4Y0AA 3X2SA 1XTKA 3FDIA 4V0ME 2ODNA 3KFVA 2ZS9A 2A5FA 4DKXA 1R0ZA 5E7JA 2OCPA 2AL7A 4IXNA 1S4QA 2RGNA 2ZU0C 4IEIA 3BB1A 2GDJA 2V3CC 3WRYC 1QG2A 2W6ID 1SVLA 5D3MA 1FX0A 4B34A 2YWFA 3BH7A 2Q3FA 4AK9A 4OYHA 1IM2A 2H57A 1LB1B 2NQ2C 3QF4B 1HE1C 3RRNA 1E94E 3KQKA 2QROA 5JWRA 2NZJA 4NCIA 2C96A 3CB4A 1JPNA 4Q19A 5KDOA 2V6IA 4FN5A 1T0JB 3L82B 2AHOA 3AM1A 1YZTA 2J9RA 3B1YA 1VTKA 2RHMA 3KDSE 3RDPA 3OE7A 3MWLA 1HQCA 1N3BA 1Z0IA 1G16A 1OKKA 2R9VA 4J0QA 1KI6B 2EWVA 4A0FA 2IS2A 3ASYA 3T5GA 1ZAKA 2YVUA 4Z8XA 5J4LA 2ZITA 5EZ5A 2IF0A 2R8RA 1VYVA 1T8UA 3ZIAA 4EPRA 4UNRA 3GLFB 2CLCX 3AVYA 2R6CA 3BGWA 2QENA 2ZJ2A 5K8IA 1XXHE 4Q7JB 5G3ZA 1N0UA 3SZRA 5FPSA 1AZTA 1L8QA 1X8KA 2ECKA 4A2WA 3FMFA 4CEHB 1N6HA 5FOWA 3ZVRA 2DWOA 4PX9A 1A2KC 1Z22A 3RLFA 1P73A 1BS1A 4URVR 4NDZA 1CP2A 4C0JA 2JLXA 4WZAE 4L8GA 1XMVA 1KYIA 2YV5A 5BQ5A 2C04A 2EW1A 2Z6VA 4GPTA 1KDPA 2VP9A 5B2ZA 3THXA 3A6PC 4QBFA 1U8AA 2ODEA 2IYVA 4BLPA 1TUIA 2JLWA 2HJGA 4DLTA 2ZAOA 1HY3A 2OESA 4U02A 5CJPA 5FUWA 5EP1A 1KI2A 2VQSA 2WHXA 2WTUA 3CPEA 1TNDA 3X1DA 3LX5A 1GSIA 4EFMA 3B1WA 3Q3JB 1ANKA 3CZPA 1KOFA 3LA6A 4UJ3A 4US0R 1T0HB 2BJVA 3NTUA 4MRRA 2VSOA 4O2RA 4CDGA 5DN6D 1LF0A 2DFLA 3CO5A 3NBZC 2B6HA 1N2CE 2QP9X 3CKLA 3GD7A 3PUWA 2ZR7A 2F1JA 3P4YA 2V54A 1MRSA 1FOEB 4HDQB 3GFTA 1OFIA 3VNVA 4YMVA 1G291 1N6KA 2XTNA 3W5IA 4OJQA 2CE2X 3HR7A 5FL3A 4PC2A 4DBLC 4B6EA 2NGRA 3MRSA 2ZI6A 1KO8A 1Z28A 4AIIA 5C4GB 2FSHA 5FOTA 4JJZA 1JEDA 2CCKA 3A4MA 2MMGA 4BRWA 2ZIAA 4FIDA 2BOVA 4OHZA 2ZE6A 4MH0R 4WVFA 4II7A 2BBTA 3K0FA 4XD7D 1AZSC 3PEYA 2P2LA 1NRJB 1WQ1R 3FGNA 3THOA 1E0SA 2OXCA 3ZZTA 1E1QD 1EK0A 3BJIC 1Q20A 1YZKA 2WWHA 3TE6A 3EIEA 5B57C 5JSZB 2ZETA 4OJKA 4W7SA 1R6BX 1XD2A 2H8KA 2IYUA 4GOXA 1W36C 2HT6A 3BFKA 5FPHA 4BFYA 2QRZA 3W8RA 3K70B 1KSGA 3TMKA 2KWIA 3LD9A 4URUR 4FMCF 4ZI2A 1MH1A 2YKGA 1JECA 1SULA 3A1TA 1R5OA 4B75A 3H2YA 4V03A 3SYLA 1H8HD 5FL7D 4IKEA 4P31A 1AKEA 3RS2A 2AD5A 2O0JA 1EFCA 5J4YA 1I4TD 3KZ1E 1E79A 2D2EA 1E96A 4PZYA 4Q4AB 1MABB 4PR0A 2JJ1D 821PA 2LWIA 3LWNA 2DFTA 4KHZA 3VKWA 1AGRA 1LVGA 1SXJE 3Q72A 3QF7A 1ZJ6A 4DLXA 2B7CA 2ZRKA 2IA5A 4IOKA 2SHKA 5DI3B 4RSGA 5BN4A 4P4SB 3FMOB 1UBEA 2GJAA 3K09C 5L3QB 4NYJQ 5FPKA 1NVVQ 4HUQA 2A5GA 4L4UA 1XCMA 4EDHA 2WSSD 3DKPA 1E2DA 3LQQA 4LZZA 4TSFD 1AS0A 1VECA 1XWIA 4MDEA 1DAIA 1EESA 5F2EA 2GCOA 5CIWA 1W36D 1ZD9A 1CULC 2OBLA 1CR0A 2FPMA 4Q4HA 2WAXA 4BLOA 2XAUA 2QAGB 2XITA 3QKRB 4URWR 3ZDQA 3PUXA 1G8YA 3T34A 4MQBA 1G6OA 3PG5A 5BWMA 4KBFA 4M1OA 2GZDA 5FPYA 4QJ3A 2IYYA 3L43A 4ASUA 3MJRA 4LJAA 3VNUA 1CJUC 3WMFA 4ZDIA 4FCVA 4UXHA 2V55B 1DS6A 4MGIR 4EJSC 1FP7A 1D5CA 3IIMA 4D0LB 3SI7A 1E98A 2ZUCA 4FCWA 5FR2A 1W0JA 1GIAA 1KK2A 4I1SA 4ARZB 4N3NA 4G5SA 3GQBA 4A2QA 4WOPA 1AM4D 1KO5A 2CDNA 2WM9B 3ZS8A 3B6EA 1GNQA 2J3EA 4CZ2A 1HE8B 1E9FA 3K0CC 2HCJB 3UG7A 2VLIA 2XJ9A 4ILEA 5FUYA 2OFWA 1P72A 1KY3A 1NMXA 2CL7X 5B64A 2QA5A 3HPRA 4G5QA 4JLNA 3R7WA 2PH1A 2C9CA 5CK4A 4JLKA 5KSPA 4CT5A 2W6JD 5FOVA 4TLCA 4URXR 1G1MA 3ZVLA 1S9HA 1ESNA 4N0EA 2OLKA 3IGFA 1GTVA 4MRVA 4BASA 3AGQA 4C7OB 1Q3HA 1TAGA 1VIYA 3AQ4A 4TL9A 3I92A 1FQJA 3CPHA 4EFNA 3AP2A 4K8OA 3RRMA 5TMPA 3QXXA 5H8WA 3EPHA 1G64A 1FUKA 2F6RA 2VH5R 2ZVPX 2ZRFA 1GRQA 1KI1A 2P67A 1DAHA 4LJ6A 1R5BA 1W46A 2J41A 1JR6A 4B47A 3I5YA 2NO6A 1EFRD 4M2LA 1W5SA 5JS7A 3M1IA 2XOKD 1P2UA 4LI0A 4B3DA 5HR5A 1NIJA 2WJJA 3U3RA 4A8JA 3G0HA 3WNBA 3ETLA 2G1KA 1H65A 2P6NA 2QL6A 3BB4A 5AJWA 3VFDA 5L3SA 1DELA 1E9BA 1IHUA 3QSYA 5EZ6B 1II8B 1OW3B 2OFXA 4RZXA 1US8A 3SHFA 2RCNA 2QPTA 4MDFA 2ZPTX 3AB3A 1CEEA 3BFXA 5DHFA 4U7DA 1SVOA 2FH5B 1XD9A 2PBRA 1MT0A 4V0KA 1N6LA 1HTWA 4Z1MA 4JBXA 3K9LA 3U5ZB 3OHMA 2EVWX 1KO1A 1XTRA 2KE5A 2B8WA 2ZUBA 3DMDA 4D81A 1KAGA 3A4NA 3H4MA 2VIIA 3GJ8A 4JL6A 3ZGXA 1Z83A 3K53A 2ZRDA 2O8CB 2OE2A 2YNMA 4AYWA 4BLRA 1Q1ZA 4FWTA 1TTTA 3AH8A 4G1UC 2VHCA 2IS6A 1UBGA 4JLMA 1E2FA 3CRMA 1AK2A 3PV0A 4F91B 4AKEA 1ZC3A 2C77A 4IDQA 1XZPA 1G18A 3AUYA 3QXJA 4XSGA 4EPWA 1KSFX 1A2BA 1TQ6A 3J81k 3RS3A 2O8FB 3NH9A 3TNFA 3W9YA 2W58A 5IHPA 4LX0A 3GEIA 5KDDA 2B21A 3GLFE 2ZRHA 3LBNA 4LUCA 2OAP1 4JSYA 4JBYA 2XNSA 1N0VC 1N5KA 4PQFA 2ZM5A 4EPVA 5LDDC 4C2TA 1VG0B 1G5TA 2I1QA 1QVRA 2PLRA 3LFUA 1OH6A 2JCSA 5M04A 3VAAA 1R8SA 1UF9A 3GLHB 1CKEA 4I81A 4QHTA 4EJSB 4Q4JA 1Z63A 4N0DA 3OIYA 4M21A 5EE9A 2FU5C 1E9RA 2QI9C 4QGGA 1D6JA 1IJFA 1XXHB 1P62B 3ND8A 3P27A 4RY2A 4V0NA 3RC3A 4NYJR 4G5RA 1X1SA 1KI3A 1TUEA 1NVVR 3K0CA 4I1VA 2D2FA 4OHWA 3MMPA 1QHHB 3N2IA 3LW7A 4NCJA 4URYR 1NVWQ 2J45A 3MJHA 3U4QB 4LV5B 3X1WA 5G40A 1X1RA 2BCJQ 5GJWC 3AKEA 4P3YA 4DWJA 2REBA 4FW9A 1M8PA 4L15A 1YKSA 2FFQA 4XIGS 5FTKA 2V7QD 1VG8A 3KQHA 1XEFA 2LCFA 3LRPA 3KXIA 2JJ2A 1JXMA 2B92A 1OIWA 3PUVA 4A36A 1MO5A 2QTVB 3MLEA 2Z0MA 2K5UA 3C14C 1MR3F 4Q9IA 2GBLA 2IUSA 2ZRGA 2RGAA 3U44B 2ZJAA 2ZE7A 2QSZA 2H5EA 1W7AA 1E2MA 3AKYA 3F5FA 2GXUA 3WXMA 4HB3A 3FE2A 3PIRA 4R98A 1WXQA 3QPVA 1G7TA 3SR0A 1JR3A 4PZLA 2VP4A 1ESMA 3E70C 4MRSA 4IVRA 3CR8A 2OG2A 3QG5A 4PFSA 1OYWA 3T1OA 4B3FX 2AXPA 1G8FA 2FEOA 2FGKA 3KFXA 3CM0A 4FMDF 1O87A 4PSKA 3CW2A 3UXMA 3DO6A 4DLSA 4TTQA 4PHHA 4Q7KA 4OBEA 3TR5A 4LY6A 5AUQA 2GETA 1IXRC 2O8BA 4D4KA 1BMFA 2GTPA 4WAUA 4AG5A 2OM2A 4G3XA 4X8LA 4A82A 4ZKDA 2D74A 1QHYA 2CK3A 2WWGA 2RB4A 1NLYA 1AS2A 3BD9A 2BEKA 3AV0B 3FPAA 2IHYA 3FMPB 3BERA 3RNLA 1G3MA 2I4IA 5FR1A 1E3MA 3JZMA 3TK1A 3I4LA 4BLSA 1ZCAA 1ZINA 4HLQB 4KCGA 2X19A 4NCNA 5AJZA 5JRZA 4G5GA 3DM5A 2YWGA 5FUVA 4F4IA 3UMFA 3KX2A 4MRPA 4Q1CA 2NO7A 2ORIA 3PENA 1EFTA 4LGMA 4LSGA 4V0LA 4OI0A 1GP2A 3EPJA 5DO9A 3B7GA 3T12A 4DT1B 2ZRPA 4B44A 4D4JA 3GJXC 1RFLA 4LHVA 4QBIA 2ZE5A 1P61B 5HPYB 2KI5A 3IHWA 1I2DA 1SXJB 4FCTA 4NCHA 2YHSA 4R9UC 3IKJA 4RZUA 4A6XA 1GM5A 4YMSA 4KITB 2RGNC 4IEEA 1ZBDA 4W5JA 3MUFA 1T5IA 4BFTA 1IQPA 4OHVA 1SHZA 4B6FA 2WIAA 1KZGB 4Z54A 1MKYA 1U8ZA 3BAFA 4OK5A 2FV8A 1W4BA 2OO7A 2QN6A 3AKDA 3C4JA 3CUEF 3QQ5A 4DDUA 3I5XA 2IF2A 2C03A 1S9DA 1XX6A 3QEJA 3WMEA 2ZEJA 4EQ6A 4B3BA 2W0MA 4D0NA 2E87A 4TYPA 3M6AA 5JS8A 2DWQA 4L9WA 3CX7A 4AKHA 2GF9A 3GLIA 5JBQA 1P2TA 2P6RA 1XMIA 3IPXA 2R62A 1COWD 1VYTA 1UFQA 1M34E 2O5VA 4PZZA 1BIFA 2ZS7A 1ZU5A 1F2UA 4Q4LA 1W0KA 4OI2A 1E99A 1R0WA 4OQMA 1NSTA 4WZ6A 3VU9A 3I62A 4Y0VA 3DZ8A 2PCJA 4TMVA 5EUMA 2P5SA 4PO8A 1XFAA 5EP3A 3T1QA 5FBWB 5CDFE 2G88A 4CEIA 3RABA 4Z8YA 2GHIA 3CRQA 2ONKA 4I99A 2KJQA 1DAMA 1N25A 4TT3A 1Z0DA 3EW9A 4IJMA 1EWQA 2ZI9A 1IN5A 5IDVA 1E32A 4XWOA 1M2OB 3RRYA 1E9CA 3ADBA 4TLDA 1OIVA 2FX3A 4JYCA 2O8DB 4MYUA 2IYZA 1ZCBA 2GA8A 2JJ8A 2OCBA 2OBMA 4NU0A 1ONBA 2JEOA 4Q7LA 2DY1A 2ASEA 4HYYA 4DSUA 1SQ5A 621PA 5EE0A 4XH9B 4G01B 2ERXA 3OE7D 4I1UA 3HWSA 2PMDA 1TQ2A 4EPXA 1QHSA 2PJRA 2FSGA 1OKKD 4HAVA 4KO8A 4DLUA 3QEOA 1J2JA 2XX3A 2Q3HA 3HU1A 3AF2A 2DB3A 3GEEA 4QXAA 4DXAA 3KQNA 2OT3B 3UIEA 3E5HA 1U99A 1NF3A 4PAQA 1MO6A 1YVDA 1E4VA 4LOAA 3ZIAD 2QBYB 3QPUA 1S96A 3U61B 1Q57A 1XEXB 3LBHA 2WBLC 4LBYA 1DAGA 1Z8FA 1ZM7A 2VHUA 4JVNA 1Z6GA 3QY0A 4M0LA 3O8BA 2PT5A 2IXGA 2VO1A 4EIWA 3TRFA 4QHSA 4O0MA 1Z29A 4ERNA 2R6DA 2W0SA 1G7CA 3TUJC 1NNEA 4JLPA 3U3OA 3LAWA 5HZHA 2J59A 1ZIPA 3TIFA 1TEVA 2QM7A 2RHDA 4LV6A 4TMXA 1DARA 1MV5A 3R8FA 2CJWB 4QM6A 3WYGA 1OSNA 4IXMA 4LYAA 4E22A 3AVVA 3B2EA 4A92A 4FMCB 4QKQA 2O8EA 1E4YA 2GVDC 2ONJA 4B2IA 1M7GA 4JL8A 1E2QA 1GDDA 3FHTA 4QBHA 5JZVA 4ACAA 3GLGE 5EUQB 5KNDA 4ABYA 3OEEA 4BQSA 2FG5A 4I1OA 1VKJA 4UKDA 3EZ9A 3CRW1 1W49A 1XNJA 1IONA 1WE2A 2OHFA 4UNQA 3ADKA 2EYQA 2GCPA 5C1BA 3V9PA 1TEXA 1Z06A 4IFBA 2H16A 1ODFA 1HA3A 2FN4A 4QRHA 5HTKA 4NMMA 2GILA 3W3ZB 4Q03A 5JI2E 2ZJ8A 2FJUA 3G82C 4RFVA 4ESVA 4HEJA 1P3JA 4QG7A 2VA8A 3NHAA 1R8QA 2QRNA 4YMUA 5JJKA 4YC7A 4F7WA 1OXSC 2WZQA 1E9EA 3OFNA 3D3QA 3LW8A 3NG1A 2WV9A 2VHJA 4EKDA 5A5GA 5D3MB 1D2NA 1JI0A 1FX0B 2REXB 2V6JA 1NLFA 4OHXA 3RSOA 2FOLA 1X6VA 5JMTA 1DG1G 2ZREA 3QF4A 4V02A 4OQFA 4QGFA 5AR1A 3TAHA 1HT1E 4BUJA 1KJWA 2ZE8A 2X77A 5TV2A 2OUKA 1VIAA 2XXAA 1YRAA 1MOZA 4GRAA 1OIXA 2BWJA 4RZ2A 5J4KA 5KYKA 1D2EA 1G3IA 2O0KA 1J99A 4Q9JA 3R9XA 3GLHE 3AVWA 3D7MA 1ZNYA 1KI6A 3B5JA 4LBZA 1YR8A 3AF3A 3KKOA 1R4AA 1E9AA 4OKSA 5HKKA 3TGPA 2RH5A 4Q1DA 1T3LA 3KJEA 3PEVA 4DIEA 3SQXA 3KKNA 4A0GA 5FBQB 3SE0A 1XD8A 3DOEA 3IDQA 2CLSA 4NTZA 2XNDA 3H0KA 1E79D 3NBXX 5F9HA 2CNWA 3RANA 2QGNA 4HLUA 4DIDA 3ECCA 4GMDA 2WJIA 2WOJA 2ZTSA 2ZYWX 4DEXA 3GCGA 1SVSA 1KMHA 1EFHA 5LB4A 4C30A 4PQRA 4JT4A 5LD2C 1I4LD 2XJ4A 1NJFA 4DRZA 1FMLA 1SVKA 1JNYA 3B9QA 2ZI3A 2D62A 1OH7A 2OAQ1 1UDXA 1UKZA 3BB3A 3G5UA 4ITRC 4K46A 4Q21A 3LVQE 3H1TA 5SZHB 4LJ8A 1Z6YA 2NG1A 3PEWA 4GOKA 4RD4A 2TMKA 5AK0A 2QM8A 5DH9A 1J7KA 5CYPA 4ZDJA 5KU1A 2J1LA 2FFBA 1X86B 4D2IA 4XVUA 1FZQA 5JWOA 5EXPA 1ETUA 3F8TA 1NBMA 3QBVA 4AYTA 1NKTA 2WJGA 2BBWA 3NKVA 4HZUA 4IOLA 3LXXA 1QHIA 4GL2A 4NPHA 2O0HA 3OEHA 2IYRA 4M1WA 4HB4A 2NIPA 3LX8A 5HE8A 4JVSB 3UMRA 2EFCB 3GFOA 4ASUD 3IIKA 4LRWA 1DAKA 4KXFB 1F60A 1M74A 1DG3A 2RAPA 2V1XA 2ZRNA 2YC2C 2J7PA 1I2MA 4TL8A 2AWOA 4JVMA 2H17A 1JAIA 1KAOA 2AFHE 5F9FA 2NO9A 4C3ZA 2F55A 1XEWX 2FNAA 1W0JD 2GJSA 1RJ9B 4TLAA 2P6UA 5C46F 3AVPA 2J0UB 5IK2A 2J0SA 3IILA 4XSHA 1DO2A 1VG9B 3AKCA 3C15C 4JLJA 3OIVA 1DAFA 1J8MF 4D4MA 2B8TA 2R6AA 2WWIA 4D82A 1G4UR 4A8JC 1KZ7B 2PX3A 3HU2A 2G1JA 2BMDA 1IOZA 2A2ZA 2MSDB 1QHXA 2RGDA 3CR7A 4LDJA 4NBSA 4PC1A 1OFTA 1TPZA 3VR3A 3PUZA 5JSZA 2EFGA 1Y3AA 3L8ZA 2ZS8A 3S1AB 4DLRA 2C95A 2N46A 3DOFA 2ZJ5A 1IN8A 1FTSA 4X8MA 3DKVA 3I61A 2GZAA 4B71A 1RRGA 3ND9A 5JHHB 3CWQA 4FINA 2HF8A 2OXRA 2YOHA 4PPGA 1NVXQ 4BZPA 2G0NA 4IVQA 1KSJA 2IWRA 1W2HA 1FTNA 4HLDA 3I32A 5FTNA 4C9BA 2H18A 4HAXA 1WBDA 3ZZ0A 1GITA 2R44A 3CF6R 1MABA 3H86A 3IEUA 2YZ2A 2C98A 3IHLA 4FWIB 4PHGA 1KMQA 3RS0A 1UADA 1XMJA 5BN3A 4OHYA 2AFIE 4PPQA 1OXVA 5DLQC 1WRBA 5FTJA 4NYIQ 4Q18A 2JLUA 4ZKEA 1JALA 1NLZA 4P4SA 3EZ6A 3P4XA 3VQTA 3VR2A 2V4ZA 5L3QA 4HUQB 1EX7A 2XGJA 1RIFA 2A5JA 2GJ9A 2ZJBA 2YJTD 4KFSA 4B3CA 3UANA 4MITA 3BC1A 1KI8A 4TMWA 3UG6A 4YDHB 3N70A 1G8PA 1DE0A 1ZU4A 4EUNA 5AWFC 3EIQA 2QQ0A 4DZZA 4FMBB 5AUOB 5TXGA 2BVNA 2D7DA 2IWHA 1D2MA 2QAGA 3EC1A 3MWYW 3KB2A 4IDHA 1J8YF 1FNNA 2ZU6A 4Z1MD 1NG9A 4TLEA 3HU3A 3Q7QA 1WMSA 1XB2A 1C9KA 2XSZA 1CRPA 4B32A 1GVNB 2ZRBA 4RVCA 4WZBE 3ZVMA 4DEYA 2EQBA 3KKPA 4P4TA 1W1WA 3P20A 3T5DA 2OSBA 1G8HA 2BHRA 3B78A 4AKIA 1WP9A 4JL5A 5LD2B 5DYIA 2R6GA 3A37A 3EASA 2IS1A 1C1YA 3QVUA 4IDPA 2QMEA 4CEJB 3TKLA 1OXXK 1PV4A 4ARZA 1BOFA 4M9SA 2Y8EA 2JATA 3ZH9B 4NL4H 2D3WA 2W2VA 1TADA 3NDPA 2A78A 5JEDA 1PVOA 4D80A 3IO3A 1OHHA 2ATXA 1W48A 2MSEB 3X1ZA 2BEJA 3V4FA 1TF5A 4QJ5A 4GNKA 1JB1A 2WKPA 4RKFA 8OHMA 1Z08A 3E2IA 1IAQA 4OI4A 3NXSA 2FSIA 4GZLA 4BE7B 2DBYA 1AN0A 1EGAA 3SJZA 1NL3A 3I8XA 3RVBA 4DC9A 2FWRA 2OLJA 4M9ZA 1PLLA 3R7WB 4Q1BA 5LBIA 2RGGA 3V4RA 3SC3A 2REOA 1F48A 2GBLC 1Q1BA 4NE2A 4FMDB 1QRAA 2HXSA 3B1XA 4C7OA 4PO9A 4QJ4A 2CXXA 5EXTA 1DVRA 2H1LA 4M9QA 2OCAA 4M1TA 4DSNA 5L3RA 3TUZC 3A1UA 3SEAA 1A4RA 5BN5A 2IYSA 2ZYVX 5DHAA 3RWMB 3AEZA 2NO0A 1N6OA 2ZXUA 3A4LA 3QXCA 1XTIA 1XP8A 2ZYTX 5KDLA 3IQXA 2F1IA 2IC5A 1JXOA 1XTQA 1N5JA 3B82A 1E2PA 3NH6A 2R2AA 4WW0A 3TAUA 1XDBA 2QT0A 1SVMA 3TBKA 1U90A 4UNSA 2J87A 2VP6A 1W36B 2IXEA 4KVGA 3CNNA 3AP3A 4A8JB 3KQUA 1EX6A 2JJ2D 5EXSA 5CM8B 4BZQA 2UVQA 3THWA 1WBBA 1T91A 2J7KA 2ZJZA 5KPJA 2WWYA 1X8JA 2IL1A 2BV3A 2GRJA 3EZFA 3VMFA 3NC0C 1G20E 3U6KA 1R0YA 2CVHA 4JLOA 4AY2A 1Z0FA 3CLVA 4BFVA 1US8B 2DFNA 2AR7A 3GLGB 1JQLB 3K0EA 1G3RA 3UWOA 2WMOB 2AX4A 1KGDA 1Q22A 3P1JA 1Z6TA 4Q9LA 4C0LA 1RC8A 1CJKC 1TL7C 2EFEB 1S1MA 3IUYA 3PJRA 5JEEA 1Q0UA 3B13B 1IN7A 3WHLA 1R10A 4DVGA 2C9YA 3REGA 3FTQA 1JR3D 2ZI7A 4PAMA 1GKUB 1GWNA 4HAWA 3LDAA 4TTRA 1OFUX 3HJNA 1Z0KA 3Q5EA 5G53C 1D8TA 3SQWA 3KKMA 4M1SA 4EFLA 2O8CA 2XB4A 1KNXA 1W47A 4V0MA 5FOXA 2X2FA 3CX6A 1LS1A 3NWJA 1FFHA 5J47A 2HEIA 1XMSA 5J40A 1N6NA 3CH5A 1XRJA 2Q9AA 5LPNA 2YOFA 3OESA 5FBLB 2RGCA 3R20A 1BMFD 1UPTA 3IBGA 1SHKA 3NEJA 3WNCA 2NOAA 2IUUA 3IIJA 1LTQA 4FD2A 2CK3D 2G0TA 4NCKA 2VL7A 1G41A 2BKUA 4D25A 3W5JA 2UZIR 4YXWA 3Q8XB 4M4SA 5JJLA 4DUGA 1XJQA 3K0AA 2L0XA 3I72A 4S35A 2XZOA 4IFEA 3QXSA 2ANCA 2P5TB 1S1CA 3QKSB 1UDWA 2KBFA 1A5TA 4PC6A 1VDZA 2WIBA 3RS5A 1TQ4A 2HYIC 5KSYA 1CIPA 4LHWA 2J0VA 1CS4C 4Q4JB 1NN3A 3Q7PA 1IXZA 3B1VA 4NYIR 4OK3A 2HYDA 1XXHA 3DPUA 1Z2CA 3PR1A 3KUDA 2FZ4A 4HB0A 4JKIA 4BZXA 4CF7A 1CF4A 1KO7A 3UKDA 3NIBA 4RFSA 1QHHA 4R7ZA 1RVDA 5DI9A 5G3YA 3U4QA 4Q1FA 3NBYC 3ASZA 2ZJOA 3FKSA 3T61A 1U2RA 1U0LA 4GOJA 1VYUA 1T9HA 3B8HA 2ZR9A 1R7RA 2DYKA 4DCNA 3H84A 2OBNA 4IRUB 5EE1A 5KTYA 2CBZA 2QORA 1RRFA 5TY0A 1ZRHA 3SJAA 4M22A 4Q48A 2WVJA 5JCZA 3KUCA 1P60A 2FSFA 2Z5FA 4Q9HA 1RW4A 1TX4B 4BWYA 3ADDA 3CF2A 3QKUA 4ZDWA 3O8RA 4WA7A 4RD6A 1IY2A 1S0UA 5FFMA 2QUZA 1ZMXA 4NP6A 3U44A 4Q02A 4OK6A 1KKMA 3TVTA 3I8SA 4GP6A 2GJKA 1PUJA 1Q21A 1QG4A 1U81A 2F9MA 3DEFA 1NN1A 4A6PA 3VKHA 1W0KD 2FE4A 5GJCA 3BIFA 2P3SA 1W4CA 3U3JA 4LCBA 5CYOA 3THYA 3WP0A 3FMIA 4ZIRA 1Z6AA 1NVUQ 2G6BA 4TT3D 4DLWA 1UEJA 4XVQA 3ZVNA 2DWPA 4IDNA 3DMNA 3MFYA 4MGYR 1U98A 1EWRA 3FYHA 4TMKA 5BXQC 2C2HA 1Z5ZA 1QZXA 1W44A 1D9XA 1Q12A 2JASA 1LFDB 1PUIA 2XTMA 1XEWY 1E2NA 1YZNA 4MKGA 2VYFA 5J5CA 2O8BB 1OLOA 2WAYA 3VX3A 221PA 3EPLA 3GJ4A 3SU8A 2NTYC 3AVQA 4XTCS 2IS4A 1L2TA 2FFAA 2QPOA 1UJ2A 3ZD7A 2RGBA 1M7HA 1XCPA 2WMNB 4LBWA 5EXXA 1UAAA 3OZXA 1OH8A 2QMHA 3W34A 3RRZA 4PAOA 2F3RA 4G0NA 4C4PA 3BE4A 4RD3A 3T1VA 1RE0A 2ERYA 2VSXA 5H70A 5SZJA 1CRQA 1HYQA 1E1RA 2WJHA 3C8UA 4EPTA 1NN0A 1P75A 5F98A 3OIUA 1Z47A 2CE7A 3MWKA 5FBRB 4RCYA 2PZGA 3RYTC 3FFBA 2GJ8A 1EXMA 4CIDA 3EX7C 3TSWA 3HPQA 3CONA 4RKEA 4DT1A 4KVAA 4RCZA 5DYGA 2PMKA 5JJIA 4MKFA 1LF5A 4M1YA 1SZPA 4NZYA 4XWKA 1OB2A 4BFUA 1SXJA 1G5PA 4Q9KA 1KI9A 2ZUDA 1BYUA 1ZD1A 3D6TB 3EIHA 3OAAA 3GEHA 2QP3A 3WNDA 3C5CA 1NY5A 3SYNA 2IYLD 4D4LA 5B58C 4LJ7A 1N6RA 4KSCA 5KSOA 2Z43A 2CCJA 1KKLA 4MA4A 2BMJA 2WJVA 4FXPA 5LB2A 5A4JA 5CB8A 3IBYA 3LXRA 1KDRA 4A0RA 1DADA 3TH5A 4KODA 1TF7A 1XPOA 1GFIA 3OEED 3QPWA 3BRWD 2BKEA 3HYTA 5C18A 4EQ6B 1NY6A 4LWZA 4BGDA 1E69A 3ICEA 4LC1A 1P9RA 1UKEA 4HI0E 3SJCA 3AVTA 1AIPA 4AYXA 1KI7A 4QNRA 2P65A 5CITA 4NKRA 5E4FA 1YZUA 1BO6A 1SVWA 1HEIA 1GUAA 2YINC 3C7KA 2XTZA 1U9IA 1P7CA 1VHLA 2GEUA 3UATA 5TVKA 1OF1A 3VU9B 2ZSBA 1OH5A 1G9XA 3CZQA 3EXAA 1AKYA 4LJ4A 5HZKA 4CEIB 3FKQA 1VPLA 2OEPA 1F6BA 4HLUC 2WKQA 3OFND 5DGXA 4KLNA 1CU1A 3QI2A 2A5DA 2QNRA 3D8BA 4BPBA 4BRUA 5CM9C 3SYKA 2W00A 2O8DA 3AVOA 3L0SA 4DSOA 3K9NA 1F2TB 1KY2A 3TQFA 3QXHA 2AN9A 2HDNB 2H7VA 4M8NE 3P32A 1DAEA 3R9IA 4QGAA 2GVZC 5GJBA 4B2PA 1OE0A 3VHXA 1L7VC 3KTAA 4L5BA 5E7IA 3UK6A 3EWAA 5D3QA 3V00A 2F43B 3K8YA 1CBUA 2WWFA 5K8LA 4A1FA 5J4HA 4H1VA 1XPRA 3O47A 1FL9A 3RAPR 5HKKD 3WHKA 2QTHA 1CJTC 2QGZA 1CJVC 5EQTA 3UWKA 2XNDD 1XEXA 3TSOA 2IK8A 2CNWD 3A1VA 3K9GA 3MSXA 3U7EB 3FVQA 2PL3A 3WBKA 4Q1EA 4QGHA 5DISB 2HT1A 3LO5A 5SZIA 2ZJYA 2D4HA 2BMFA 1A7JA 3W6NA 4V0OA 1U0HC 4C0QC 3QBTA 1G3UA 3DDCA 3PCRB 4DCTA 3GJ5A 1AQUA 5HCIA 5KNBA 1NP6A 1XJ0A 1G21E 2ZRCA 2GKSA 3KJHA 4Q01A 3O8DA 3SN6A 3IPYA 5AJVB 4C0KA 2ZSAA 5KSZA 1GNPA 1V5WA 2BCGY 3W6OA 4LYFA 3QJYA 3EG5A 3T06B 1KIMA 1H8EA 4F38A 5JHGB 4JVLA 5E95A 1A82A 1UM8A 4X8OA 4C2UA 4LJ9A 4HAYA 2W2TA 4UNPA 4TL6A 1XF9A 4LHXA 4E09A 2OCYC 1LW7A 2RGXA 3B9PA 1Q3TA 4G5OA 1NBMD 3EAQA 4W9MC 2HLDA 2CHQA 1NSFA 2EWWA 2HJVA 2Q9CA 4LJ5A 1CR1A 1GL6A 3IO5A 5GJVC 2WPDA 1JAHA 4B3GA 2CHGA 1M6NA 1VG1A 1O3YA 1Z3IX 2CEAA 3OEHD 4GFDA 3K70C 1LY1A 1SKYE 4Q1AA 5FOUA 4YLGA 2AXNA 1YU9A 2Q0HA 3LBIA 3U3KA 3BXZA 3QKTA 4QC2A 3IEVA 1L4UA 2CL6X 3PQCA 5H68A 4KJZA 3WP1B 5P21A 4KYIB 3HYRA 1TU3A 1W4RA 3TSZA 2J7PD 4TL7A 5JI3E 1P4SA 3T15A 1Z0AA 3I3SR 3L0OA 1KHTA 4BLQA 4UXJA 2QSYA 4R2HA 5IK2D 3BFVA 4NYMQ 1YHNA 2H92A 1IN6A 1XCGB 3PUYA 4YDSA 3RHFA 1YR6A 1ZM9A 2J46A 5JWHA 4GT1A 1ZUHA 2JA1A 2JLRA 2JDIA 2O52A 4MKHA 1NN5A 4TYYA 2V8OA 5FI1B 2XXAB 2QE7A 2ZI4A 1F3OA 3UMSA 1UBFA 3ZZUA 5GVSA 2IEYA 2IX3A 2XEXA 5UKDA 4DLZA 3K70D 2D7CA 1ZVQA 3GLFA 3BK7A 2QAGC 4KFRA 2JIZA 1E9DA 3GFPA 1A1VA 3AVUA 1GAJA 1VMAA 2V9PA 1XJCA 4POAA 2C9OA 3CX8A 4JIMA 1SKQA 2QEQA 4CEHA 2JAQA 2VF8A 3CBQA 5AUNB 1S8FA 1DTSA 4GZMA 5EP2A 3WY9A 2JLZA 2GEVA 2Q3MA 3AF1A 1KMHB 3K9HA 3LV8A 1T5LA 3TJZA 4BEJA 2ZRAA 1E6CA 2A3RA 2Z4SA 3THXB 1J90A 1RKBA 2HF9A 1YR7A 4JLDA 2ZRIA 2DFKB 4DLYA 5KOYA 1EG7A 1IJEA 1FQKA 1U8YA 3W3AA 3GJ3A 4OQLA 4A9AA 3ADCA 1T3SA 1DO0A 1JEEA 1PZNA 1YZQA 4NH0A 2JJ1A 1G7RA 2IYWA 4DDVA 4YONB 1U0JA 1HH4A 4M9XA 4E5UA 3LVRE 1R0XA 1E2JA 1JR3E 3JZAA 4FI3C 1AA9A 4US2R 3LH5A 5FUXA 3RS4A 2Z4RA 4HZUB 1QBKC 2RGEA 5JRJA 1BH2A 2VEDA 4KI0A 2XSZD 2IYQA 4DLVA 121PA 2KSQA 5BW8A 3O8CA 3DHWC 1ZNXA 5K8UA 2AK2A 3TUIC 5AJYA 4DB2A 3KB1A 3QUSA 3REFA 1AGPA 5GADl 3GMTA 3QIAA 3VHLB 4B2LA 2DHRA 5FPTA 1G19A 3AF0A 2W6IA 3M4YA 5KO2A 1AQYA 3LLUA 1N5IA 1W4AA 4QOSA 3K0FB 1RJ9A 4PPNA 5FOSA 5A0FA 4HDOB 2J0UA 4GP7A 1LV7A 1D9ZA 2AKYA 4ZO4A 4ZI3A 5IRCD 5FTLA 5JLJA 3U7HB 1WF3A 1OHHD 3A36A 4D6PA 3ZD6A 2W83A 3HDTA 1XD2B 5HE9A 3L2OB 4Q66C 4LJYA 3RSLA 4OL0A 2G77B 4GBMA 4GI7A 2N1BA 2WOOA 4BFZA 1T4GA 3RWOA 2NPFA 4IDOA 2XZPA 2PZFA 5CK5A 1UKYA 3S1AA 1HURA 4BEBA 2QG6A 1Y63A 4HUTA 2FZLA 1XPUA 4UNNA 1OXTA 4WXRA 1OT3A 4AURA 4DCVA 5KNCA 4Q4AA 2I1VB 2GESA 1HT2E 1E2LA 1KK1A 2GNOA 1E0AA 1MO3A 3B1ZA 4MUAA 3BOSA 1JQJC 2Q6TA 3FOZA 2F1RA 6Q21A 5DI3A 3CF0A 3RC8A 2BBSA 1OFHA 1ZM3A 1IN4A 3L0PA 3BH0A 3OF5A 5CB6A 4XVRA 2IHBA 4US1R 2GCOB 4LBVA 1CR2A 1G7SA 4TTPA 4PC3A 3MG9A 4Q4HB 2V1UA 1GKIA 3GLIE 1IY1A 4XJXA 1G6HA 2BM1A 3ZQJA 2QP4A 3QKRA 3Q9LA 2PT7A 5G41A 2EFHB 4D26A 1NMYA 4DJTA 3SNHA 3X1XA 1LS6A 2ODBA 1X8LA 1LNZA 4PQYA 2VPPA 4PO1A 4AC9A 5IF9A 3VR4A 3JVUA 1FMJA 3A1WA 2PCLA 5DN6A 4Z51A 1N6PA 4IW3B 4LPSA 1AS3A 3SDZA 1ZM2A 2C8VA 3L8YA 4PHFA 2RKOA 5EJEA 1U94A 1NI3A 4RD1A 3EC2A 4WBSA 1YZLA 4B33A 1OV4A 3A58B 2A5YB 2GAOA 2IT1A 3NVAA 3CH4B 1ZM4A 4F93B 2C5LA 2IYTA 1VCOA 4Q7MB 1M7BA 3SS8A 4NYMR 2ZAMA 2ZRJA 4M1MA 2WWWA 3Q5DA 3MCAA 1OJLA 5CDFA 1VHTA 2DCUA 4P0TA 1ZC4A 3NBFA 4LHYA 4PXAA 3U6BA 2FGJA 1V43A 4CEJA 4IHQA 4XD7A 4DCSA 4AD8A 3C16C 3DZDA 1E2IA 3HR8A 4H9GA 1TMKA 1E1QA 4PTLA 4AG6A 3VR1A 4QM7A 1E2GA 4LV8B 1E9SA 1KK0A 2NO1A 1E2EA 2ZSDA 4TN1A 3GJ7A 3NHBA 5JECA 3TLXA 3WMGA 3VR5A 4YXWD 1VCNA 1CXZA 4DUGD 1XTJA 1H8HA 1Z2AA 5FL7A 2J0QA 2DPXA 4HB2A 4QNMA 1CJMA 3CRVA 3M0EA 4DSTA 1CTQA 4B48A 3CPJB 3WYAA 2FDCA 1XU4A 2CCGA 2ORVA 2QAJA 2PJZA 4F4JA 1WCV1 1P6XA 4DDWA
chains in the Genus database with same CATH superfamily
2GN1A 1BWSA 2R7NA 3O83A 5EP4A 2Q5QA 4HAUA 3SSMA 5FWNA 4LN1A 3QNUA 1GTSA 3WADA 4M6WB 4QJBA 1DBSA 5EOVA 4E51A 4WIAA 2BLNA 2Y0DA 4BFSA 1V25A 3ETCA 2XT9A 3R1IA 3GPLA 4XW2A 3WLNA 1T5OA 3F71A 3PNMA 2PNJA 3SZGA 3T9FA 4MGKR 1LSJA 1KXZA 1ECBA 1TM4E 3ZWNA 2AR0A 2W6NA 3AERA 3WQSB 3C3CA 2A9KA 2WSSA 3FKSD 1UXOA 3S2ZA 3V2UA 4KFUA 5SYNA 4F5DA 1UFOA 3KSRA 4N3BA 3AVXA 1WHSB 3CIOA 3O1IC 1IWPB 1P4HA 1JAZA 1QYDA 2UZAA 3JQBA 1KH3A 1KAEA 4FNMA 1XA3A 2W2OA 5DB4A 1WXEA 3IEIA 2GAAA 2JRLA 3KL4A 2Q1UA 4KACA 4RXTA 1M2GA 1P4GA 2I22A 4N5DA 1U9JA 4URZR 3KUKA 3R0IA 1P0IA 5H4GA 2L2QA 2JHCA 1QH0A 4MPJA 2WJZB 1OX4B 1WXIA 3I76A 2BTQA 1CZRA 2AKAB 3D0RA 2F4VB 2KLBA 4RNCA 2O06A 2I7TA 4GMKA 2ZANA 2B36A 5AW1A 1NJGA 5JNUA 1P9OA 3AJDA 4PZDA 1YZGA 3N2KB 2RHTA 3OLVA 3NOXA 1L5RA 1I13A 3H9JA 1UKAA 2NZ8A 3B60A 3EFEA 4QIHA 1X1BA 4RZ3A 4Y0NA 2WAMA 3HN2A 4QHYA 5T4FA 3G2NA 2HDOA 3COSA 2FUCA 1GL9B 3WLOA 1WM1A 5JYEA 1FMTA 4HDNA 1NOJA 4XTRA 3H8SA 1PLKA 2J9XB 3FN4A 3E05A 3CNOA 4O4HB 2AHRA 2VDWB 3NEPX 3ZBTA 1RPZA 2HMTA 1WXHA 4EVQA 1P1FA 3QELA 2Z83A 3HVRA 5JNVA 3A4TA 4L0DA 2WB4A 4A15A 4C7MA 3JRWA 4KWHA 1UC5B 3M6LA 2XB2A 1SU7A 2WHPA 2GUWA 3K2BA 4HLCA 2YICA 5JXGA 2FRXA 1VJ0A 2Y1XA 3L0IB 3TAXA 2JLVA 5KX5A 2GCEA 1I4DD 2EZ4A 2FSSA 2H0RA 3GJ6A 4YR9A 5LOVB 2E4UA 1OXBB 2HSZA 3DTVD 3Q2IA 4F92B 5F3WB 1WDTA 4IILA 5F9MA 4MUBA 3K5IA 2VK2A 3V3KA 5ADHA 4QPZA 4O4LA 4BCBA 4HAZA 1IFXA 2QQEA 2DF8A 1QHGA 4MI1A 4OQEA 1ENPA 3WB9A 4B43A 2CF5A 1J49A 3C45A 2ZVQX 3DC7A 4E6PA 1SHTX 2VHWA 4IR7A 2QQ5A 5AW5A 5IARA 4DNPA 1Y6RA 3VVLA 4N82A 5C34B 1MAAA 1DNPA 2Q8NA 2FVYA 3K0AB 3KB8A 2YC4C 1ZDMA 1E1RD 2AB0A 1XU7A 5K9ZA 4PF1A 1RTKA 2IZ6A 2PLFA 4H7DA 1QP7A 2PH3A 3D31A 3WBJA 5C18A 3ETGA 5JBNA 2ATVA 4NMHA 1NHWA 4ZTZB 3LDHA 4E70A 1U9IC 1GG2A 1SGWA 3DQQA 5EZYA 2X1HA 4LC0A 1Z36A 1Q3KA 3R7NA 4EG4A 1VJDA 1GKKA 2OGUA 3F3YA 3JTMA 4C0BA 5JFGA 4BV9A 3PIIA 5ARBA 3DB1A 1GUFA 4LFCB 4TKVA 3KD2A 4A73A 4LK2A 1GN8A 1KJZA 3KSUA 2HSEA 3ZOZA 2W2MA 2HBZA 3IPRA 2I3GA 4X5OA 4Q47A 5TT1A 5AMXA 4WT7A 3C7AA 3DO5A 4Z7OB 5JO0A 3TG8A 3FI9A 3S6JA 3BL5A 2P4SA 5LR6A 4TV8A 4YAKA 4UULA 3DOHA 4JASB 2ANBA 2FMXA 1IPHA 5EMLA 2V3WA 1D1QA 4IDAA 3OBBA 4MI9A 1GTL1 2WUWE 5BYKA 4R8RA 1A50B 4ZCLA 4AZ3B 4YMTA 1SZJG 3ZHTA 4DV3B 1F5NA 2B8EA 4DR4B 1UEIA 2BFDB 2DG2A 2VYCA 1PK7A 3ZK7A 4QGSA 3GEDA 4HSGA 4GUAA 2I80A 4ITUA 1K98A 3I0ZA 1W0CA 3LG2A 4MINA 2BM0A 2GK6A 2YYZA 3BSFA 5AUPB 4BNMA 5ADVA 3AOEC 4O63O 2JEZA 1E58A 1ISMA 1L0BA 2P1ZA 1S3GA 4MW7A 1Y1QA 2RGRA 1W4ZA 4K9RA 3W5DA 5DYYA 4C0AC 4OAPA 3OE5A 3EOZA 4QVKA 2H4XA 3BS4A 1EEHA 1WD5A 1JA1A 3HCNA 5FBKA 3SJBA 1BVYF 1RE1A 3EZ7A 1JG4A 4HX2A 4M99A 1Q17A 3VKGA 4M46A 4IHJA 4PIMA 2QDKA 3JRNA 4RGYA 2WV7A 3T9DA 4DHEA 3IJ5A 2C7PA 1PTKA 5CLQA 1U0GA 1VP3A 1YR9A 3U7JA 4GEKA 3D2BA 3ZY4A 3HJBA 5FYQA 1JDVA 3GJ0A 1NR1A 5EIAA 3CLUD 4HATA 2NPIA 4BLWA 2BC9A 2VF4X 3NJ8A 2UYCA 4BAGA 3DOOA 1P7ZA 1UKVY 4TXJA 4WY2A 4I4CA 3ZE2B 1ODTC 1VCMA 4BJ5A 1N5LA 1UBJS 4OMFG 3HHPA 5ABPA 3H5LA 2FEMA 3FJ1A 1G8AA 4AS2A 3DVAB 4EARA 3ZLJA 2WWXA 3LQRA 4COKA 4LXHA 1FFAA 3O8NA 3G0BA 1ONSA 4JX8A 3PCXA 3PXGA 2FZEA 1P9WA 1K5GA 3KXKA 1AZWA 1XZQA 4B74A 2O2EA 3E5NA 2WU3A 3WGMA 1XCBA 4N1AA 2BFNA 2AN4A 4HQNA 3OZVA 4Y6QA 4LRTB 2PL1A 1NT2A 5PGMA 3RSZA 3ABIA 1Y8CA 2WZBA 1A8UA 1F4PA 1PJTA 1QIGA 2FPLA 3FW1A 3UGQA 1KO4A 3J7AC 1VBKA 4EB6A 3AUXA 1F2VA 1GOTA 5TDHA 2UYYA 1U1CA 2WHQA 1E2KA 1TLTA 2QU8A 1JWBB 2GBFA 3D59A 1JLLB 4KQEA 4URFA 2B7BA 2BR4A 4B76A 2FP4B 3IJRA 4LHZA 4Q5IA 5AXAA 1S3SA 3HSSA 1P1CA 2GWHA 3QVVA 4CN8A 3C41J 1ZITA 4O4HF 2WF8A 3N2EA 3BN3A 5C32A 4RM3A 3OY7A 3OJOA 3LUPA 2WF9A 4H27A 3HK2A 3ZW9A 5B1HA 3LWBA 1EP1B 2AIRA 3P0IA 4WUVA 4V0RA 4TYNA 4JSTA 2NVWA 1NONA 2D8AA 3IELA 1EU1A 4TLLB 4W1SA 3ZOKA 4MVJH 1BCRA 3SKYA 1YVRA 2OZLB 4O25A 3K8OE 3ZBUA 1BXGA 3HV2A 3OZEA 1QVWA 1JFVA 1H8ED 4KC0A 2DLCX 4XUEA 3HMKA 1EJ0A 1ST2A 4ICIA 5K3BA 5IFLA 3K5PA 4IXTA 521PA 3GLIB 1OVMA 5F5NA 4MAFA 3HGTA 3IDAA 1YRBA 4RWZA 4RC9A 3SFZA 1KK3A 4U1RA 4BO3A 3V7NA 3TIGA 3FUTA 3CRRA 3GOHA 3Q85A 4L76A 4R2IA 1R0CA 3BKXA 1CNFA 2ZBRA 2C78A 3DLAA 5K0SA 2M1XA 2BJWA 2FXIA 2OQ2A 2HLPA 5L7YA 1A8QA 1JHVA 2EFDB 2R5FA 4P33A 1ZNWA 3VVCA 1KYQA 3AIOA 1IXSB 4I5DA 5A4MS 1YS7A 3CVYA 3AR8A 3WLPA 3WYCA 2Z9DA 4KV9A 5AI6A 1IMOA 4HFMA 4QL3A 4RH1A 5J2TF 4N7MA 2ZT7A 3STXA 1ZD2P 3O0DA 3FGZA 5EWJB 4MUNA 1L5VA 5KUTA 5AQEA 1ZI9A 1H6CA 5SY4A 1IY0A 2Z2XA 3G8BA 4ETIA 4JLSA 4Q0MA 1U2ZA 3Q2OA 4B3IA 3K9FC 1OASA 2F8SA 1XJWA 3FSJX 3X1YA 1NDHA 3MWJA 1PJQA 1RZUA 4EAAA 1IRIA 1EDOA 3EA0A 4KVFA 2H1VA 2VNIA 2WSMA 3VXKA 2KB0A 5KPDA 1QIFA 1VJTA 3EVCA 1RQ7A 4G8CA 3CISA 1J09A 2YCLA 2PVSA 2Y1WA 4HDMA 4FKBA 4MRNA 1R0RE 3ETJA 1RFGE 2OXTA 2G5GX 1TVEA 1KSHA 4UFPA 3ICQB 1KEUA 2W90A 5E3HA 2X8AA 2NXCA 5CJ2A 1YU6A 3DVLA 4H1UA 2O07A 3MAAC 1S7GA 1ZNZA 4J3FA 4G24A 3KQPA 4IOMA 1YO6A 1Y3DE 1ZSVA 1I5OA 3E6AA 2GPJA 3VHXB 1KDTA 4JA0A 2ILVA 2P3OA 2FFJA 1S02A 3S2GA 4UTZA 5C4MA 2EX0A 1PGPA 1G66A 2JIZD 4LYHA 3STYA 4BLTA 3EZ2A 1YL5A 1ZQ9A 1LRKA 3KL2A 4JC4A 4U7GA 1UXJA 4CVNA 1V1MA 1TB4A 3VJKA 1XMXA 5E2AA 4JEUA 4AVYA 4BP1A 3A8TA 1P77A 1NLMA 3IMGA 4EA6A 4MJ3A 4NPCA 1PW5A 3M7IA 1L4YA 2CJWA 3KJGA 2HREA 1GLVA 4TN5A 5DGTA 1EDBA 5ECYA 1P4JA 3IA7A 4EAQA 3R9WA 4DFDA 5ES4B 1NQUA 3F74A 2X4DA 3T35A 3W04A 4MHTA 5U4XA 2GLUA 3I1JA 3SP1A 2WD8A 2QWXA 3ENZA 5AYVA 1NZJA 5D1HA 4PCAA 3ONWA 1JJVA 5AVSA 4O2AA 1DIBA 3W3AD 4HZIA 5B7NA 3P2EA 3NPMA 1KIFA 1C2YA 1JKMA 2YH2A 1K6MA 3BH6A 1P45A 3GLVA 3PUKA 3GO4A 4IICA 4O5AA 2IEDA 4O33A 4RELA 4DUPA 3OF3A 3TW8B 3FDFA 1YC2A 1XALA 3LYLA 2X0EA 3IMCA 4D9BA 5I7VA 2ZQ5A 4S1NA 5FH9A 2YBEA 3IH5A 2ODWA 5CB4B 2AH5A 2GXQA 5EJ6A 3DEIA 1Y7TA 5G1NA 2LVBA 1I1NA 4JOCA 5THXA 3IQEA 2QTRA 2Q6IA 1AKMA 4IYJA 1KORA 2DPGA 5H16A 3FNFA 2ENWA 4DL9A 1AJEA 2V0GA 4HO1X 3A28A 1YGPA 1RTTA 2O6LA 3C6ZA 3QEKA 3EZYA 3M6XA 3PI7A 4V0ME 5EFZA 2X2PA 1X9IA 2OP1A 4CV1A 1DTWB 1FFEA 2OCGA 2X14A 2OCPA 3M9LA 2K4MA 3PFWO 5ICFA 2IOHA 4AM8A 2Q0XA 4UUNA 2ZU0C 5LJLA 4W99A 4AJOA 2FN8A 3H3FA 1KJ8A 1T8WA 1UMBB 3SD7A 2YVAA 3DBOB 2W6ID 1SVLA 3ZQUA 4DC1A 2C8JA 4GXQA 1XZFA 2Q3FA 2H2FA 4E33A 1IM2A 5EIEA 3GIWA 2XRYA 2NQ2C 2VK8A 4WJKB 4U63A 3NJ4A 4CLOB 1RXWA 1E94E 3KQKA 2RHCA 5JWRA 1K7SN 2NZJA 2C96A 4NCIA 4DVJA 3CB4A 4IGFA 1IXKA 4E2XA 5KDOA 5KTRA 4FN5A 3L82B 3QWIA 3DFUA 4DY6A 3B1YA 2WM8A 1SZDA 3COPA 3ONEA 5ESDA 2D2XA 5FLYA 3A2NA 1VTKA 1FDIA 5F12A 2NU8B 4BVHA 5IM4F 3OQNA 1FSFA 2OV6A 3OE7A 5BW6B 3CCCA 3MWLA 2H2GA 1PKEA 1S6YA 1NC1A 1OKKA 2R9VA 4E13A 2W6PA 4LE2A 3ELBA 3DV9A 1U3FA 2PQ6A 4JMLA 2PH7A 5ALFA 4YV7A 3R4CA 3FNQA 1DPGA 5ALEA 2P2YA 4G0XA 4Y9SA 3TFWA 4RTMA 5ITZB 2ZITA 4JR0A 5EZ5A 1U8TA 5FBHA 1O03A 4IJ5A 4JSRA 2EZ9A 3ZE9A 1QLJA 3ZIAA 4UNRA 3GLFB 3SPXA 3N76A 3E8XA 2QTCA 2QENA 2ZJ2A 3ET4A 5L45A 1TCAA 4X1IA 3HZRA 5CAEA 3JASA 5KNCD 1FFSA 5FPSA 1X8KA 1L8QA 5EJ5A 5F5LA 2PUWA 4I6GA 3FMFA 4JUAA 3QMMA 3SF8A 5EI5A 2XCOA 1X0VA 1BROA 2XQIA 4P6VF 5F21A 4DYHA 5FOWA 1IHOA 3ZVRA 1B41A 4C01A 2DWOA 1NV9A 5JTTA 3D0KA 1SC6A 2CMDA 1VFNA 3KT8A 4I5IA 3ZHCA 2I6QA 3PRKE 4F3TA 3CU5A 3VKUA 3I0NA 1MGOA 3SOZA 3OKCA 3TM4A 4DZTA 5JASA 4G23A 5HIKA 2YV5A 1TMYA 4JT8A 5BQ5A 1XPUA 1X7HA 2OORA 2OP0A 2IPXA 3C85A 1HFKA 5A0TA 3IAM6 2ODEA 4DSAA 5FWYA 1ZMTA 1R0BA 3G1UA 3OETA 2AQ8A 1D07A 2D54A 3JTEA 3VO8A 5HQ3A 1HY3A 5K99A 1H2EA 2OESA 2RJOA 3CA8A 3HA2A 1J8VA 1A8IA 4TUYB 2RHBA 2A58A 1TIKA 1RQ2A 3FCSB 2FPGB 3SQLA 1QRDA 4NU6A 4LRXA 1TK2A 3CZPA 4US0R 3VR4D 3NTUA 2VSOA 4PX2A 1FEZA 1DQZA 1LF0A 4XYLA 5DN6D 3O4JA 4TM7A 3TJMA 2AOTA 3CKLA 4EB8A 2WSBA 2ZR7A 3L1IA 2F1JA 1XV5A 1F9EA 4HDQB 2QVZX 1Q7TA 4I50A 4WFKA 1N6KA 3RYIA 4AUEA 4YMVA 4ZT3A 4TWBA 5D51S 2G9UA 2CE2X 4AT1A 4OGWA 4PC2A 4ZQFA 5DPMA 3X2EA 2X8JA 4DBLC 5TMEA 1UOEA 1YB7A 3CZMA 1NI5A 1T6YA 3O3OB 3TQSA 4X6LA 4HT3B 2PDAA 2P41A 3IOEA 5CNIA 4CKEA 4LNUB 2G17A 2JIPA 5A7HA 5I9LA 2BH2A 2YHAA 4OHZA 3EW7A 3IT0A 5T4EA 3D4OA 2OPHA 3UGJA 3K6RA 4GI3A 3ZQ4A 2E1PA 5ALZA 2HN9A 3OT1B 1U04A 3HP7A 3EAGA 3K9BA 3Q0TA 3BMOB 1NRJB 1U7DA 2PXCA 4J1QA 4FT4A 4OFBA 3G7NA 4UU0A 3JVEA 1SBTA 4K40A 2O23A 4XJVA 1QDUA 3C7DB 3KQVA 1I2AA 3TE6A 3TIXB 1KYYA 3BSYA 1AK9A 4W7SA 4B46A 2H8KA 1UCFA 1EZZA 4GOXA 1W36C 3W2IA 3ZY3A 4BTVA 2Z08A 3CF4G 3TMKA 4LXTA 1V3VA 3AR2A 1AUOA 2ZYIA 1BN6A 4EECA 5BT8A 3BJEA 4GI5A 3WGHA 1MH1A 2YKGA 3W79A 1DU4A 2G1PA 3SYLA 1FRFS 4LY3A 1DQPA 4V03A 1H8HD 5FL7D 8GPBA 3M6UA 1QQTA 4Y2UA 5AD1A 3V2HA 1JRLA 1WUTA 1SG0A 2ZB8A 5J4YA 3AIKA 2D2EA 4D8YA 3GN1A 2CLEB 2JJ1D 4CKCB 1UT8A 2LWIA 3L41A 2WJPA 1Q2XA 5C8DA 2I4NA 3TD6A 4MYRA 2E18A 1HL3A 1ZJ6A 1E3WA 3ZU3A 4Z49A 2B7CA 2IA5A 5DI3B 2SHKA 5F1YA 4RSGA 1QZTA 3VVBA 2CLMB 4P4SB 3DFFA 5HMMA 3E3NA 4NYJQ 3JQ7B 3Q4GA 4BQPA 2QLMA 4HUQA 2A5GA 1IWBB 3BHNA 4RYDA 1RU3A 3I2IA 2CXNA 1NYLA 2OHHA 3LQQA 4TSFD 2IBTA 2LP4Y 2QY6A 1DAIA 4G4SO 4GX5A 4G1BA 4KO2S 3E3MA 2PFKA 1XRNA 1RQNA 2WABA 2XLCA 2OLEA 3BZUA 3EXEB 4GPAA 1DINA 1VSBA 1WWKA 2CLIB 4TXMA 3F7OA 3S5UA 2XCRB 4D9KA 4IDBA 2GFHA 5BWMA 1D0SA 3BFPA 2XVZA 3FETA 3O6VA 4QXPA 1I3CA 1F6DA 5AM2A 3TRDA 3CLTC 3NHLA 2LDBA 4QJ3A 3ZWDA 2CDAA 5LIRA 5ALMA 4ASUA 3QLVC 3OM9A 3VZDA 4XSVA 1RKQA 4OUDB 4FCVA 3CY6A 4MGIR 4O5OA 1M34B 1P18A 4EJSC 1D5CA 3IIMA 1E64A 3IT1A 4C6SA 1ZR2A 3DBVO 5E9QA 3F6PA 1Y8QA 3WKBA 2ZUCA 4FCWA 3AYXB 2G9QA 1W0JA 1SQGA 3YASA 1X7WB 3H65A 5FFNA 4ARZB 1EM8B 1IOLA 1ISSA 4Q9AA 5JYDA 2Y76A 1E3LA 2A4MA 3DV0A 4YRQA 1AM4D 2R96A 1YTLA 2CDNA 1FCJA 3N0WA 3NDJA 4HNSA 3ZS8A 5T6BA 3MGKA 4PNHA 3S2SA 3BBLA 5JCXA 1QV6A 4HNAA 1LLCA 3LGXA 1HE8B 1E9FA 1Z0SA 2HCJB 2A35A 3H7AA 5E8RA 3F7MA 2VLIA 5DEIA 1XO1A 3R3HA 3FD8A 2XJ9A 4AY6A 2FPUA 3IAM1 1P72A 1KY3A 2CL7X 1VI2A 3E3AA 4DQVA 1E61A 3K0KA 4OGGA 2FW7A 2MR5A 3HPRA 3E9QA 1MQ9A 4G5QA 4JLNA 4B85A 4DA0A 3KKKA 2C9CA 3L4BC 5CK4A 5KSPA 1NAHA 2W6JD 4CT5A 5IABA 5JVDA 2CV2A 3AI1A 3ETNA 4BZWA 2OO5C 1FSPA 3HDYA 2OLKA 1H0KA 3IGFA 3ZI0A 4MRVA 5BSVA 4PZUA 1FNSA 4TS9A 4BNWA 4DUYB 2YWJA 3EQ9A 3GB9A 2H5LA 3MUNA 3B1JA 1TAGA 1V6SA 3BUSA 3I92A 1QYCA 3D3WB 1PJCA 1GTJ1 1YQ9A 2B2XA 2OD7A 3LQFA 5GP1A 5FJJA 3SFTA 5C5CA 3IP8A 5TMPA 3GEMA 2JKZA 1Y1RA 1RYBA 2H1SA 2VQ6A 3FLMA 3IIIA 4FYXA 3ZX4A 4JP5A 2VH5R 1JKFA 2PSEA 2ZRFA 3M1AA 4G0YA 1DAHA 3ENQA 4LJ6A 4LA4A 3TQOA 5FWDA 2V3VA 1JR6A 1XELA 2B1GA 4I9FA 4Q4DA 4LFBB 4B47A 1T5BA 2X9NA 4UTXA 2FMFA 5TSDA 4M2LA 1EFRD 1T3TA 1X7YA 1Q5PA 3I5AA 4OB7A 1P2UA 3HM9A 2CFIA 3MRTA 4IIUA 4L5YA 3TMAA 1YHZA 1M1YB 3PU6A 3U3RA 3ETLA 2P6NA 3WNBA 2QL6A 2IPMA 4RAOA 1ZK4A 5AJWA 5GV8A 1GEGA 1GYRA 3U4IA 1E9BA 3AOGA 3QXGA 4HK4A 3VO2A 4BP3A 3OX2A 1C2TA 3L04A 3UXEA 4BQNA 2QR2A 3ND7A 1D6MA 3GT3A 4P38A 1X13A 2I91A 4RZXA 3SHFA 2RCNA 2QPTA 3F3SA 3LHDA 1JYEA 5JPIA 3JQGA 1GQ2A 3UKJA 5EQFA 2BE9A 3K2QA 3IP7A 3IRVA 1ONNA 3OP1A 4G25A 1XD9A 2VSQA 3BTOA 4ZMSA 1KEEA 1MT0A 2YYSA 4V0KA 1ZD3A 3LGAA 5CXXA 1N6LA 4JI6B 3W06A 1KU6A 4NF2A 4GNRA 4JBXA 4W1PA 1WABA 2VT3A 4H0CA 1GU1A 1SCAA 3X1KA 2EVWX 3EDCA 4ECAA 1KQGA 2RI0A 4E5KA 3NW9A 3QWBA 1DFHA 2QMYA 3DMDA 4D81A 1PR4A 2RI1A 3A4NA 5I7FA 3FPHA 5TJHA 4YJHB 1T34A 3H4TA 4NJMB 1O7JA 2FUEA 3LBAA 3IKLA 2OE2A 1HFEL 4AYWA 1WSDA 4ED9A 1XVAA 4K6GA 1TTTA 4NU5A 1PTJA 4CG1A 4UE3S 2BN4A 1C9JA 4JXZA 2YXNA 4O0LA 3JVDA 1LPPA 2C77A 2NQTA 3NMUF 3TQHA 1TQ6A 2YCBA 3E2MA 3ZCUA 5KX5B 5G2OA 3TNFA 1WY5A 4GYWA 4FX5A 4OB8A 4QUHA 4NFLA 2WWVD 5IHPA 3HNPA 3TDMA 3AHCA 1CW2B 2B21A 2GB4A 1T25A 2HXGA 2ZRHA 2OAP1 4NWIA 4UASA 4GQIA 1N0VC 3CINA 4XGKA 5D5PA 2G70A 5BYBA 2ZG6A 3GR6A 4NCAA 2PS9A 2CY0A 4C2TA 1VCHA 4AJKA 1KFKB 4DBZA 1QVRA 3KSMA 3W5AA 1EVEA 3GLQA 5K0LA 3AZQA 1WF6A 2VCYA 3VAAA 5M04A 1UF9A 5CVVA 3O3MB 2Q2QA 2Y0BA 1Z63A 4WFJA 3IVGA 1X7XB 1KA9H 1ZVMA 2FR1A 2PFSA 3EGWA 1CR6A 4FFRA 4FNOA 4KN9S 3BPSA 4PLTA 1IJFA 4KFCA 2J30A 1P62B 1PP4A 3NQ41 3DDWA 3FZGA 4M0MA 2EF0A 3RC3A 4G5RA 1M8GA 2JFWA 1NVVR 5EZYB 2D2FA 3ORQA 3PDIA 4DBVO 3IUQA 1G63A 2I3DA 2BHTA 2I6SA 4HX5A 4FW8A 4LQCA 4FYKA 4TS1A 4URYR 5DLPA 4D8XA 1ORHA 2AG0A 5GJWC 1DKMA 1PJBA 3AKEA 5HUQA 1GKLA 1QTIA 1V4NA 2REBA 4TKVB 2ISQA 3QU2A 1Z37A 3KZOA 3L4BA 4L15A 4P5DA 4B7UA 5FTKA 4C1BA 3KQHA 3UJDA 2V8BA 3PEEA 3RSHA 2LCFA 1GAQA 1J23A 4CKBB 4MUIA 3PYMA 2VJOA 3AUAA 2PAFA 1GLNA 2WE8A 2XUOA 5EHQA 2JC3A 2C2WA 3K32A 2K5UA 1OWNA 1DTEA 4B8YA 2OCIA 5AQ1A 5A2QA 2IUSA 3AV3A 4GX2A 5CCBA 3VV2A 3NP9A 3I6YA 1USUA 1PJ3A 1CQZA 3K4HA 3CEHA 3MLBA 3ZKWA 2VXBA 3VH3A 2QSZA 2B8JA 2H5EA 4GDMA 2CVQA 4KXQA 3F5FA 1EUCA 3R6LA 2WYUA 3LIPA 2RIRA 3BCRA 3MJFA 2GNAA 3FE2A 3IVRA 4R8SA 2M1ZA 3STHA 4L3WA 1PEAA 1YJ8A 2DWCA 4Q3LA 1GQOA 4GWKA 5DRYA 3ZCSA 4WDRA 1ESMA 1I94B 4B81A 3B3QA 3QG5A 4XPIB 2I1LA 5IHXA 3CUUA 1ZMOA 1QB7A 1IIRA 3EIUA 2AXPA 1G8FA 4YQZA 4X1YA 4FILA 4B3FX 4ZZ0A 2FK7A 2PKEA 4MULA 4Y2TA 3W7VA 2EDAA 4IIBA 4MARA 5C80A 1NVAA 3PTZA 2NX2A 3UXMA 5JNSA 1JU4A 3ZWOA 5LA6B 1XDZA 2D59A 4PHHA 1T8SA 4Q7KA 4KAFA 4OBEA 3V1MA 2YY5A 3RHTA 2VHXA 4LY6A 4JY7A 2CLHB 4G81A 2O8BA 4UZEA 1ZUWA 4WAUA 3R6DA 4G3XA 5LQNA 4ZKDA 3PHLA 1DRVA 2G9VA 1J0CA 3OPVA 4U9UA 2W42A 1QYWA 2JCGA 2NUAA 1RWOA 3NOQA 2BEKA 4JXKA 3FPAA 4EW6A 3TZBA 1PAUA 2CYAA 2NM0A 4OKIA 3GFBA 1E3MA 3KOMA 4G5FA 4JQYA 5AXCA 2XYQA 4BLSA 3KT6A 5KYUA 2V65A 3QM1A 5AVOA 3RM3A 5MFPA 3LNTA 2X19A 3AU9A 4NCNA 4N8EA 4RU1A 1O9BA 5C52B 2Z2KA 3AY0A 3K70C 3DUFB 3VBEA 5GTDA 2FEXA 5F1OA 5F2NA 3BEDA 5BW4A 4F4IA 1OLUA 5FBQB 2HIHA 3LS2A 4L95C 1CDZA 2EX1A 3PENA 4IIXA 4LGMA 3RK0A 1GP2A 3EPJA 3LPNA 5LZ7A 3B70A 1ZN2A 2Q29A 4YRSA 2NTEA 3A6FA 1Q74A 2XBMA 4QBIA 4EX7A 1L1EA 1MVOA 2ZE5A 2VZLA 3MGAA 3RUFA 4ZI7A 2KI5A 1I2DA 4R9UC 4EYKA 2D0PB 2QW1A 3N7AA 4K3VA 2RGNC 1JB9A 4UW9A 5DWVA 2C7BA 1TAQA 3PKJA 5JCOA 1U02A 2P9HA 5LXTB 1TLLA 1KHHA 1ZONA 2HMUA 3OTGA 3LI2A 3TRKA 4B6FA 1RNLA 1TM7E 5KWVA 4CQMD 5K09A 3AO0B 2QN6A 2FV8A 3CUEF 2AC7A 2BZSA 2C4VA 2Q1XA 2ZQYA 2NWQA 3CX4A 1BCRB 3WJAA 2C03A 3EUWA 1E0DA 1FRNA 5LNK6 2JFFA 3W5VA 3L7BA 1GR0A 2ZEJA 4EQ6A 5AVRA 2AEEA 5KX5F 3K9CA 4TYPA 4I1IA 5CJJA 1GU7A 2H48A 1N75A 2OV4A 3F2VA 3IB3A 5CGQB 3RTDA 1NHGA 3SSAA 1HNXB 1TFRA 1OZAA 1P2TA 3EPRA 3G5MA 4LSWA 4O4LF 1DCMA 5JBQA 1COWD 1BGWA 1A7KA 4KMRA 5GGYA 1GTG1 4NMLA 3N2NA 1F2UA 4KUHA 1W0KA 5NLLA 1H0SA 3BCHA 2EWMA 1C5KA 4ISCA 5CNKA 2JHGA 1NSTA 4GOOD 2AG6A 1NZDA 4OMDA 2HSJA 3UUFA 5T4HA 1YOVA 3N2YA 4NBTA 4R40A 4TRJA 5EUMA 1QZZA 1XFAA 3QU7A 2REQA 3NHWA 5EP3A 1NFFA 4F2WA 1XA0A 5B53A 2Y4OA 3CZCA 5HKLA 5HGJA 4I99A 3D4IA 4YCMA 4YJ3B 4EMUA 1JQBA 4BVGA 1EWQA 2ZI9A 5F76A 1BEZA 1T8YA 1GGMA 2CHEA 3C3PA 2CW5A 4ZMBA 1AC5A 2ZB7A 1OIVA 3LT1A 1DXQA 3TNJA 2PD3A 2HMYB 2H0AA 4I1RA 5EKTA 5EZYF 3VZSA 2ZYHA 4N6OA 1RAHA 2OB2A 1Q0TA 4BN4A 4ZCQA 3BJRA 2ZWAA 1X94A 4QQKA 4MJ7A 5H02A 4CHTA 3ZGZA 3OQJA 1ZOLA 1MPTA 4DSUA 1SQ5A 1Z4QA 2J5KA 2O8NA 4DLNA 4B4VA 5EE0A 1W76A 1J5XA 4OAQA 5AH0A 2Z58A 4QOGA 2WFAA 4RUKA 4EF6A 4HDMB 3OFSA 3RAEC 1TQ2A 4X3OA 1V3TA 4RGVA 4W1QA 2FSGA 4YUYA 4FQ7A 3CW9A 1J2JA 2XX3A 4TV8F 3WKAA 2Q3HA 3H9EO 4L6AA 2DB3A 4DXAA 3TQTA 1YDGA 4LZNA 1XAGA 2Y1GA 3M34A 3UAOA 1XTUA 3GUHA 2NVBA 3OPMA 4PAQA 3DEZA 1MO6A 4LOAA 4LXGA 2A0FA 1VJ5A 2WMYA 3QPUA 1S96A 2NXWA 3U61B 1NYRA 2X76A 2I3AA 3H19A 4DKJA 1Z8FA 2VHUA 1OI2A 2QTMA 3Q8KA 3GVIA 5HFNA 1KMIY 3QY0A 3R7SA 2XHEA 4F97A 4M9CA 5A3QA 1APBA 4CLRA 4I1PA 2IXGA 2VO1A 2ZTMA 1MJHA 2I7VA 5H4HA 4NBKA 1N9ZA 2XE4A 4MW1A 3UMVA 2Y0CA 1V1MB 2VSNA 4RJKA 2PMWB 3SX2A 1OBOA 4NBWA 4X1KB 3VI4B 1DQYA 2HQ1A 4N3AA 2NSDA 3TIFA 2QM7A 1NVMB 3ZBQA 2C2ZA 2HJRA 3QGMA 1TTPB 1MV5A 4ZZIA 3AF6A 3A1CA 2CJWB 4WCFC 1FU4A 2C4UA 3HYSA 4BS9A 3D6HA 4IXMA 2PN1A 4WX2B 4HH1A 4IHJF 3V7WA 4BL5A 1QFJA 1E89A 4QKQA 4FMCB 3JAMA 2O8EA 1E4YA 1YBFA 4CODB 4JGBA 4AZSA 1CSEE 3TBHA 1UR5A 4MUKA 5JZVA 2VBGA 1OWPA 1IUOA 4EA8A 3OEEA 4BQSA 4Z4IA 1VKJA 4QPJC 3A7DA 2XNHA 3EZ9A 2XCIA 2QUKA 2WR8A 1XNJA 3WQRA 4OOEA 2VCEA 1X7GA 1KJQA 4UNQA 1HM5A 3ADKA 2EYQA 3MOIA 5F4ZA 5JQWA 5K8CA 1GQSA 2GCPA 2GD0A 1P91A 4GRDA 3V9PA 3QFHA 3PC3A 1KZYC 1ODFA 1Y4SA 1HA3A 3D81A 3LE8A 4ZD6A 4NEHB 2FB9A 4QRHA 4WN9A 1JA9A 1K5HA 2PBFA 1OWMA 1XQVA 2FJUA 4XKJA 1U6IA 1E3JA 4MMXB 2IXAA 1OI3A 3AU8A 1H69A 3R76A 4HEJA 4LDNA 1P3JA 3QEAZ 2DZDA 2VA8A 3TW0A 3K72B 3NHAA 3ONDA 1A97A 4EBFA 4ZCSA 1F1JA 4YMUA 1NVEA 4F7WA 1E9EA 3D3QA 5DWDA 2XCLA 3LW8A 1Y80A 2DX7A 2WV9A 3AQIA 2PFGA 1Z8NA 2Q28A 4J9VA 1JI0A 4D3XA 3TPCA 2JW5A 5EIFA 5JZSA 3RSOA 5E6SA 4IKPA 3QF4A 4V02A 4QPCA 2C2BA 1JHMA 4C5BA 1RQPA 2FSVA 3RVLA 3O4VA 3UMGA 4GI2A 2X77A 5TV2A 2BGLA 1VIAA 1YRAA 1B14A 1JMYA 4YI3A 5LNK1 2BWJA 4GH5A 5KYKA 4PLCA 1FVXA 1D2EA 2FOIA 5CLHA 1J99A 1JLKA 1RCFA 4I4TA 5CB0A 4BIIA 4UTRA 4XYMA 4KGZA 1YI0A 1YDMA 5FXMA 3LZDA 4KR3A 5JO9A 1KI6A 4XGQA 5JFOA 5EKXA 2PYIA 2DETA 5C5IA 1OYOA 3AF3A 3TGPA 4OKSA 4WKCA 5D3ZA 1DC8A 3ZI7A 4BHTA 2JB9A 2FZ5A 2SNIE 1CQIB 1V45E 1O95C 2PZKA 3DOEA 4WKGA 5I5GA 3QFTA 4NTZA 2XNDA 2RK6A 4X1IB 1QZ3A 2IRWA 3IE1A 3CPSA 4MQMA 3RANA 3W4KA 1I2CA 2A0XA 3ECCA 2WOJA 1RBQA 2ZTSA 5AJUA 4N47A 4FYPA 4DEXA 5L53A 2NNLD 2PU5A 2QRVA 3ACBA 2Y1FA 3OZDA 4ITVA 4C30A 4ER3A 3WB1A 4PQRA 4B3MB 1I4LD 2XJ4A 4EELA 1RRMA 1SVKA 4OHPA 4N54A 2DHQA 2P69A 4LE1A 3HUUA 1FX1A 3O8OA 3QJGA 4K46A 3JQFA 2AUTA 4XR4A 4ITRC 1V7ZA 3H1TA 5EERA 2GM5A 4Y2PA 5ADWA 3PEWA 4IXWA 1CZOA 4KWEA 2FPPA 1B6SA 1EA5A 3VMMA 1WB6A 3QFRA 4RD4A 2TMKA 1YKGA 2QM8A 4GPBA 1ZGZA 3UMMA 5HQ3B 3HMQA 2BLLA 4WGFA 3F6CA 1XHEA 2XMZA 5FA6A 2WD7A 4XVUA 5BO5A 3H0EA 4A5SA 4CN9A 4MA5A 3DMRA 4RVUA 5JWOA 2RHOA 5EXPA 1NVFA 5CVEA 1OT5A 2X0JA 3PP8A 3I2JA 4K6CA 3LHKA 1RPAA 4IOLA 4B7AA 3VPXA 3SQMA 4H7JA 4MUMA 4J3NA 2Y3IA 3U4AA 4D3SA 1TZJA 3RK1A 1L5LA 1FJXA 1GNLA 3AEXA 3MXTA 4GL2A 4NPHA 5AW6A 1MJNA 3EMVA 1UJCA 4M1WA 1BDJA 1YJCA 2NIPA 3PHBE 1X1CA 4MMYB 5HE8A 3O8QA 4FZVA 4HPXB 2I4MA 4JVSB 3A10A 4A7PA 1MIHA 4FDTA 2OXEA 3IIKA 2A14A 2RGUA 3VI3B 3VUEA 1KR2A 2DRIA 3QYJA 5C9ZA 5ICGA 3IRUA 5EVCA 1M74A 1DG3A 4ZC8A 4O02B 4J16A 3QUBA 1I2MA 4OA8A 2P11A 1A4UA 3VYRB 1FDTA 1JAIA 2V7VA 4RWEA 3Q11A 2A4KA 2F55A 1XEWX 3L6EA 4NAUA 2Q5HA 4QYIA 3ZDRA 4CM4A 2E6KA 2RJNA 3SM9A 1T4DA 2A1IA 1FU8A 4QRDA 4TLAA 4AZVA 3QKIA 4B4DA 5EHZA 4TPKA 4CKEB 4F60A 3JQQA 2CVPA 3S1LA 3U3ZA 1V7CA <