5E4FA

The spring alpha-helix coordinates multiple modes of hcv ns3 helicase action
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
437
structure length
437
Chain Sequence
b'SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title The Spring alpha-Helix Coordinates Multiple Modes of HCV (Hepatitis C Virus) NS3 Helicase Action.
pubmed doi rcsb
source organism Hepatitis c virus genotype 1b (isolate con1)
molecule tags Hydrolase
total genus 150
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5e4fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA01
4XVUA 3RNLA 3S1AA 5KPDA 3T12A 4JVMA 2J9RA 3CWQA 2CJWA 2QROA 1K6MA 4KYUA 3O8BA 2QSZA 3RS7A 5EJEA 3IKJA 2E1RA 2V1UA 1VKJA 4TSFA 4LYJA 4JBYA 2B7BA 3HR8A 4V0LA 2VP0A 3QKSB 1ZM3A 5FR2A 1M7HA 1LB1B 1EFTA 3EZ2A 4JLPA 2RKOA 3X1XA 3LRPA 4NYIR 5KSYA 3HJNA 1OF1A 3E70C 3SJCA 5LD2C 3GCGA 4FMDF 1Z83A 2DFLA 4FIDA 5L3QA 1LF0A 4IVPA 1OFUX 3U61B 2XTZA 3V00A 2IYLD 1P75A 2E87A 4LYHA 4G1UC 1VPLA 2A5FA 3GPLA 2ZI7A 3HU3A 2H92A 2H8KA 4BFSA 5TVKA 1XRJA 4GRAA 4Q9JA 2NOAA 6Q21A 4ZCMA 5J4YA 2A5DA 2QSYA 2GAOA 2JCSA 3UATA 4EPWA 1P2SA 5TXGA 2UVQA 1Z6AA 4QGGA 1MR3F 2OM2A 3OIUA 3T1TA 1OJLA 1KI4A 3LA6A 1C1YA 5JRZA 1GG2A 4WVFA 3CNNA 3TIFA 5B58C 2XB2A 1UEIA 1WB9A 4E03A 1TF2A 2I4IA 4AC9A 3K8YA 4Y0VA 4LV8B 2IS2A 5HE8A 4CEIA 3EASA 3DL0A 1QVRA 1YZGA 2VO1A 4M9SA 2ANCA 1N6IA 1AN0A 1SVLA 1D9XA 2CK3D 2GCOA 2NO7A 4HB4A 4LV6A 2OE2A 4NDZA 4QM7A 1E2PA 3QXSA 2IXEA 2OZEA 1NSFA 1FPMA 4OKSA 1Q1EA 3JVUA 1NSTA 4WW0A 1XCMA 2HF9A 2MSDB 4F38A 3N2IA 2QUZA 3P4YA 2VSFA 2RH5A 1EWRA 3LH5A 2G0NA 4ZCIA 5DIFA 4Q21A 3RYTC 2WIAA 3FHTA 3M4YA 1QDEA 4JS0A 2W2TA 4D4KA 1GL7A 1W49A 5E7JA 3UG7A 1HY3A 1XD9A 5E95A 3IO3A 4L9WA 2QNRA 1GRQA 1UFQA 2F3TA 2WSSD 3PUZA 4AK9A 2ZJ5A 2YHSA 1CR2A 1NY6A 4JBWA 4S2EA 3EIHA 3R8CA 2QE7A 5E4FA 3CZQA 2WWXA 1KYIA 5EP4A 4M0LA 4A0HA 3EIQA 5LD2B 4KXFB 3SQWA 5JBQA 5FTMA 1XMVA 5KSPA 4KFSA 2VP4A 3B78A 4Q7KA 1KMHB 3ZS9A 4NCNA 3HU1A 3KQLA 4LYFA 5GVSA 3AVPA 3MRSA 2ZS7A 1V5WA 1Z2CA 3NG1A 2G1KA 4KAXA 4MRRA 3AVXA 4Q01A 2I3BA 3FMIA 3Q85A 3T34A 3UWKA 2VBCA 2JLXA 1NKTA 4JYBA 4DCTA 4QGFA 2GK6A 2OUKA 1YZUA 3VNVA 2ZS9A 5J47A 2FPKA 4P0TA 1YR8A 2OCAA 4URWR 1Z0DA 3I73A 2CBZA 1XJCA 1XPOA 1RYHA 1KO7A 3REFA 2NO1A 1W36B 1TTTA 1UJ2A 4EJSC 1YZTA 4P4SA 4O2RA 1P2VA 2EW1A 4Q19A 1T91A 4ZDWA 2ATVA 4PFSA 2QI9C 2NQ2C 4A0RA 2CVFA 4C7OB 3DEFA 3FPAA 4DLYA 3I8SA 3EIEA 3UXMA 5B64A 3CNLA 2OFWA 3CF2A 1N5JA 3THWA 2IYZA 4HLUC 1G5TA 1J8MF 2ZETA 1KMQA 4PAQA 1HTWA 5G3ZA 4XVQA 3W3AA 3PEVA 3OFNA 4LHZA 3ADCA 4RY2A 3ZQ6A 4X8MA 2IL1A 4HDOB 4OYHA 2R8RA 3RHFA 1IN8A 4DDWA 2VA8A 4RCZA 4ZDIA 3DM5A 1QRAA 3ZIAD 4FWIB 1K8RA 3GJ6A 2WJYA 4HYYA 4LWZA 1RC8A 3RVBA 3LO5A 3QF4A 1JXOA 4IDQA 4NH0A 4QL3A 4V0MA 4TMKA 5G3YA 2EWWA 1ANKA 4LJYA 2VYFA 3BFXA 4EFNA 2VH5R 2XGJA 4N1AA 1SKYB 1R8QA 2FGJA 3B8HA 3W8RA 3G0HA 3AVWA 1RFLA 1IN5A 5FI0B 2F6RA 2MSEB 1FFHA 1G3IA 4RD0A 3FWYA 1JAIA 2ZI6A 3MG9A 1W7AA 1II9A 4DWJA 1UBCA 2A78A 2O0JA 1JAHA 3QVVA 4MUBA 3TSZA 1G7SA 4TQAA 3EWAA 2BM1A 4BRWA 1G3MA 3U3JA 1KDRA 1T0JB 2JLQA 2ZJ8A 2D7CA 2VRWA 4ZIRA 1HA3A 2QP4A 2X1VA 3THYA 1OXSC 1P2TA 4LBYA 1WQ1R 1D2MA 4ACBA 3BK7A 2PLFA 3PUWA 2W0SA 2ZE8A 1EXMA 1P9RA 4LHVA 4PZYA 3V9PA 5CLQA 2FH5B 2V54A 1AGPA 1GZSA 1KDOA 2H57A 1E9FA 4I1VA 5DI9A 5LB2A 1Z06A 4DT1B 5JEEA 4CGZA 1E9BA 3ADKA 2PT7A 4QBHA 1E6CA 5B30A 3U7EB 5C1BA 5HZKA 1PUJA 3U7HB 1NRJB 3W3ZB 5D3MB 1SXJA 1R5BA 4LRWA 2EQBA 4W9MC 3CONA 4C0AC 3QEOA 2WHXA 5EXTA 4EJSB 3IHLA 1OYYA 2KB0A 4LC0A 4LBZA 2P5SA 4ESVA 4NPHA 3K0CC 1DE0A 4XSGA 1Z3IX 1QHYA 1N5KA 3AB3A 4FXPA 2P6NA 1E98A 4L5BA 1IJFA 4ZV4A 2O8CA 5H70A 1GL9B 2WZQA 4LHWA 1E9CA 1Z6YA 2GDJA 2ZE7A 2ZI4A 2GXUA 5CDFE 3BWDD 1M8PA 1G7TA 3GP8A 2UZ3A 3QBVA 4OK6A 1TF7A 3EZFA 3P4XA 3EA0A 3OESA 1E2QA 3W6NA 5DO9A 4YONB 1MH1A 1WMSA 4OI4A 3EC2A 1XTRA 2WOOA 3I8XA 1E3MA 2PJZA 3LVQE 2ZREA 1E1RD 1KNQA 4PPQA 3GEHA 1PJRA 2HLDA 3PQCA 3WRXC 2QTVB 5AWFC 3NC0C 2XOKD 1DAFA 5AK0A 3NBXX 3C41J 1FNNA 4B6EA 4NYMR 1Q1BA 4L4UA 2JLSA 2IYXA 3WNDA 2GKSA 1T9HA 1E2HA 3W34A 1ZW6A 4LGMA 1EFUA 2R6AA 1NN3A 2ZSBA 5CDFA 5JHHB 4YDSA 1S3GA 3W9YA 1H8EA 1FTNA 5B57C 1CLUA 1GNPA 1A1VA 2RCNA 1YZQA 3F8TA 2N1BA 2WKQA 5TDHA 1OH8A 5JSZA 1NVVR 5EUQB 2QGNA 1X1RA 4G5RA 3RRYA 1NMYA 3TQCA 2ONJA 1MABB 2PCJA 2BMDA 2CNWA 4CYMA 1Q20A 4M1MA 5EP1A 3BJIC 4IVRA 2GEDA 4JYCA 1Z63A 2QG6A 3NHAA 2ZUDA 3O47A 1UKVY 4CEHA 2AD5A 2O8BB 1Z29A 1NNEA 3TE6A 3T5DA 4TN1A 3EC1A 4HLCA 2XSZA 2AD1A 4M1KA 4DLTA 1VG1A 3LBHA 1KJYA 2YOFA 2HEIA 2XTMA 3AVQA 2JLYA 4M9QA 4OL0A 5CM9C 5FL7A 4XH9B 4JJKA 1VCMA 1HURA 2FE4A 2V6IA 3M0EA 3P20A 2CCKA 1J7KA 2WAXA 1CU1A 3K0FB 1Q1ZA 4EDHA 4Q66C 5AR1A 1CR0A 4AKGA 2ZAMA 2IYVA 2VPPA 3QKTA 5P21A 3AGPA 3GJ3A 2VP2A 2ZU0C 1ESNA 4L15A 3UG6A 2PEZA 4A8JB 3SZRA 4Z1MD 2Z43A 3SBDA 4PTLA 1E79A 1AK2A 1S1CA 3CUEF 4URVR 2DY1A 4MITA 3ZYCA 4DDTA 3DO6A 1Z0IA 3V4RA 3K09A 1XXHB 2JLUA 2XZLA 3GLIA 2JAQA 5ANRB 3QXHA 1YZNA 5SZKB 4URUR 1GOTA 3QXCA 3CF6R 1US8A 5GVRA 3PJRA 3SQXA 3QOFA 2ZSEA 3OIVA 5J4LA 4JLBA 3ASZA 5FPHA 1I4TD 3LV8A 2QQEA 4HUTA 3RS3A 4LY6A 3W6PA 2NPFA 4KFUA 3KTAA 4M4SA 3NH6A 4Q1CA 1OXVA 3ZD6A 1LY1A 2WWHA 2YWGA 4YQFA 2LKDA 1XD8A 1DAEA 1ZD8A 4I1UA 3UMSA 4MDFA 4K8OA 1N6PA 3L82B 3LNCA 3Q5EA 4JBXA 3O8RA 3WBJA 2FZ4A 1MV5A 3MWYW 5KO2A 4DIEA 2C98A 2V7QD 1T8TA 2XTNA 2OAP1 2R6GA 4TLBA 4BZXA 3MFYA 1VCNA 5GJVC 2P67A 4DRZA 3TVDA 4A9AA 4D0NA 5JS8A 3U6BA 1VHLA 1FQKA 3IBGA 5DSZA 4TYPA 1DAKA 1KSHA 2X2EA 4PC2A 1JEEA 4PAOA 4Q4AB 4M1TA 4CZ2A 1OH7A 1FP7A 4LI0A 2FEOA 2IHYA 4C9BA 2CVHA 1AS0A 3VR1A 3NC1C 4BECA 2IUSA 1RJ9B 4TTRA 4IDOA 1G41A 4POAA 5FPTA 2QPTA 3PIRA 2LCFA 2QORA 4JL8A 4M9ZA 5DI3A 3K0EA 5TV2A 3SHFA 1II8A 4Q02A 2IUTA 1OE0A 2VEDA 4HATA 3LAWA 4GP6A 4ZPXA 3VKHA 3FKSD 4PXAA 3B85A 4NZYA 5EE9A 2B92A 1W46A 4B2PA 1GRNA 1Z47A 3EZ6A 1S9HA 3U3KA 1N5IA 1ZIPA 2RHMA 3UWOA 2J7KA 3RRNA 5AJVB 1R5OA 2BBOA 3SE0A 4LHXA 4LC1A 4CW7A 4GOJA 1FZQA 3EPJA 4JZKA 4PC7A 4EPRA 3PEWA 2YV5A 5JEDA 2FWRA 4HAVA 4EPXA 1AJEA 2ZYTX 2YINC 2UZIR 2BEJA 5C4MA 4HDCA 1FTSA 2WKRA 2W83A 4Z8YA 3C14C 4CRWB 3LD9A 1LF5A 1BH2A 1Z07A 2GJ8A 3LW7A 4PSVA 1ZM2A 1G7RA 4LBVA 2CHGA 5IK2A 4EUNA 1UADA 2O52A 2VQSA 5KOYA 1EFRD 1I2DA 3BC1A 4QGAA 3TQFA 1G6OA 2CMKA 4I4LA 1N6HA 2C9OA 5L8VA 4CF7A 3AVYA 1CJMA 3THXA 3AKEA 1IY0A 2ZYVX 2KI5A 3DMDA 1W0JA 4F92B 3RC8A 4F4JA 3RANA 3WMGA 3OEHA 4GBMA 3C8UA 4MYUA 3M6AA 3U2QA 3R9WA 4XTCS 1A2KC 4C2UA 2QRNA 1N6KA 1OT3A 4V0KA 3CPEA 1XEXA 4L9SA 2FX3A 3PXGA 1HT2E 1VIYA 2FV8A 3B7GA 3AUXA 1TEXA 3OE7A 1GWNA 1G3QA 1U0HC 3B2EA 1WDTA 4UXIA 4AD8A 4UJ3A 2QT1A 4GMXA 2VP5A 1HH4A 3RDPA 3CR8A 5F98A 1M34E 1Q21A 1ZP6A 3ZQJA 1JXMA 4BFZA 2C5LA 2F7SA 4FD2A 3U3MA 2NO9A 4ARZB 3QKUA 1FNMA 2ZAOA 1P60A 2ZRPA 1BMFD 4F4CA 2GXSA 1COWA 2Z4RA 4BWYA 4RFSA 1U0LA 2W0MA 1XD2A 3R8FA 4XWAA 3GLFE 1DADA 3B9QA 4WXRA 1E4VA 1VMAA 1G20E 4AURA 4WXPA 4PQRA 2GWHA 3ECCA 2ZR0A 3L0IB 3VQTA 2P5TB 4HDQB 3BB4A 2DWPA 2Q6TA 3AV0B 4BGDA 2WMOB 4EKDA 4F7WA 1KO1A 3LW8A 1U8ZA 2DFNA 2WBLC 1E2IA 2JJ1A 1E9DA 3KQHA 3FYHA 2R6CA 1ZC4A 3LX8A 2FPLA 4A36A 5CJPA 2J5XA 4PHTA 1V43A 1E2FA 4J0QA 1YR7A 2YWFA 2R6FA 2OBLA 4HUQB 1JB1A 4V0NA 4C30A 3GLGE 2XJ9A 3OAAD 4DCVA 4DC9A 4N0EA 3GLFA 2LWIA 2WWGA 4M1WA 1ZCAA 1E96A 3A58B 5DHAA 1XTKA 5FBQB 4NYJQ 1G5PA 1NIPA 4R71A 2IUUA 2AKYA 4M1YA 2FMXA 821PA 4AKHA 4MDEA 2WV9A 2QENA 3U44A 4TZ6A 1E2LA 2OSBA 4BLPA 3QXXA 3TRFA 4ASUD 4PO8A 4B3CA 3QKRB 2IEYA 1XPRA 3IEVA 5JJLA 2HJGA 1JR3E 3H2YA 1R4AA 4TL6A 4QC2A 4LJ9A 2ERXA 4O25A 2ZS8A 1CR1A 5EXSA 1DEKA 2BBTA 4FCWA 3GLGA 4B32A 1OHHD 1MT0A 4PANA 1W47A 3MMPA 4KCGA 1LVGA 4GSYA 1UDXA 3TNFA 4H9GA 1HE1C 3R7WB 4A1FA 2ZRIA 1ZYUA 1KZ7B 1GM5A 4DKXA 1W1WA 3VR2A 2O8EA 2WIBA 4DXAA 1XZPA 1OPXA 2Z0MA 3ETLA 2GHIA 4A92A 1PV4A 1J90A 2QMEA 2RMKA 5HCIA 3PENA 2AX4A 1T0HB 2AKAB 5DNYB 1XPUA 2IA5A 1W0KD 3FGNA 2NZ8A 1PUIA 2VF8A 3OZXA 5HKKA 4YMSA 3REGA 3BH6A 1T4GA 4LOAA 3NDBB 3ADBA 3KUDA 4MRNA 1IXRC 2GJ9A 4UNSA 1BKDR 1HYQA 2C95A 2F43B 2OCPA 4WOPA 1GNQA 1T5IA 1OYWA 1TF5A 3N70A 3S1AB 2QN6A 3DOEA 3THOA 4TYQA 1CRPA 5KHOC 4PR0A 2OAQ1 3CZPA 4DBLC 1N6NA 3KFXA 2QTFA 1E2GA 1YU9A 3EAQA 4D6PA 5TMPA 1TUIA 1DO2A 1GITA 1BYUA 2IT1A 4KFRA 3U3OA 4DCNA 1G8FA 3KQUA 4HZUA 4HSEA 4QNRA 1TQ2A 1DBSA 3WNCA 1DVRA 2OT3B 3UK6A 1ZD9A 3KDSE 4ZKDA 1MO3A 3SYKA 2WWIA 5JLJA 3QI2A 1KSGA 3LLMA 2H1LA 3CNOA 3QE0A 4RVCA 1TAGA 3B9PA 5FOWA 3AKYA 5EUMA 5A4JA 2JLZA 3PCRB 3IQXA 4MGKR 3RRZA 2ORIA 5JS7A 4TLCA 3TLXA 2QRZA 5JECA 1W2GA 5FPSA 2IWHA 4EPTA 5FPKA 4IDHA 1Q3TA 4R7ZA 2IYUA 3QKSA 3EARA 3RC3A 4B2IA 3QY0A 3VX3A 1OB5A 1KI6A 4FINA 5GJCA 5FOUA 1NJFA 5LPNA 2J7PA 1WBDA 2JJ2D 4NE2A 1OH6A 1W36C 1LTQA 1AS3A 4W5JA 1CJVC 1Z0KA 2BJVA 2CLDX 2Z4SA 4FMCF 4B3BA 3WHLA 1N6OA 3KXKA 4QJ3A 2Q3FA 3NXSA 4UNNA 3W6OA 1H8HD 5KDLA 4PC3A 3A1TA 4OQFA 4U7DA 1XEFA 1W36D 1TU3A 1G1MA 2RGNA 2RHDA 3H86A 3K9LA 4D82A 4LDJA 3QIAA 4UXJA 1QHSA 3B5JA 5EE3A 3IEUA 1XMSA 1M7GA 2GRJA 4QBFA 4TL9A 4PSAA 3E1SA 4MA4A 1N6RA 2RGXA 1KDTA 2W6IA 4CEIB 2DCUA 1XFAA 1GFIA 4GT1A 4URZR 3IPYA 1BOFA 3LWNA 1HQCA 5J40A 3TH5A 1CXZA 1EG7A 1MO4A 1KAGA 4IFEA 3BD9A 4JMPA 5C46F 1CBUA 1RRPA 2GCOB 3U7GA 4B6FA 4KV9A 4ACAA 3CRMA 4M1OA 2R6DA 2FFBA 2O8DB 2C77A 2WTUA 4OK5A 1E0SA 2HYDA 3WYAA 3TR5A 3DZ8A 2CE7A 4XD7A 4A2PA 2B8TA 4P4TA 1DS6A 1G291 2GJKA 3GEIA 4II7A 4DB2A 2ZE5A 5FTNA 3B1XA 1Q22A 3FE2A 3VHLB 4C2TA 4KITB 4Q1FA 3QF7A 1WF3A 4M21A 5ELXA 2JIZA 1Z6TA 2NGRA 1AZTA 3FHCB 3TUIC 1Z5ZA 2GEVA 4K46A 5C4GB 1CJTC 2ORWA 3AF4A 2ZUBA 1OFHA 3BRWD 3IBYA 3AVTA 1SKQA 3DDCA 4V03A 4GFDA 2GBLC 2YJTD 1JR6A 2EFGA 3BBPA 4B47A 4MUAA 4C0QC 3TSOA 2PL3A 2RGCA 5FUYA 2OXCA 4B73A 1WP9A 3FOZA 1QF9A 1BYIA 5K8UA 3D8BA 1KY3A 1CR4A 2ZRLA 5JHGB 3R9XA 4IXNA 1R8SA 3IIJA 4RD3A 4GPTA 5KSZA 4QHYA 2P65A 2GA8A 2VP9A 3K0AA 3LXRA 221PA 4IOKA 3SNHA 2D74A 2ZRJA 1E1QD 1MOZA 1ZRHA 5FUWA 2GETA 1EK0A 2CLSA 4ESHA 4P4SB 4P3YA 2QAGA 3OEED 4V0ME 1NLZA 1S9DA 3ZZUA 3ZH9B 4DCUA 1G21E 4JLKA 1M6NA 5L3VA 3THWB 1OXTA 5EE5B 4UNPA 1N5LA 2XX3A 2BKEA 2WPDD 2IS6A 4A4DA 1CIPA 1Z8FA 2LKCA 3RLFA 1E2DA 4BLSA 3SJZA 4OQMA 3BGWA 2EU8A 2XNDD 2PBRA 1K5DA 2NPIA 4RKEA 1GKYA 1Z28A 4YC7A 3ZLJA 4MGZR 3C16C 4BEJA 1OB2A 3SBEA 3TBKA 4TLEA 2ASEA 2YNMA 4JVSB 1JJ7A 1I2MA 3WYFA 4NU0A 1P7CA 1MRNA 3QF4B 5BN5A 4JLDA 5JWHA 4AY2A 1ZUHA 3AP1A 5FR1A 1GKIA 4P31A 2JDID 5FOXA 2CK3A 2W58A 2C99A 3BB3A 3T5GA 4AG6A 1FMJA 2JEOA 2PJRA 1Z2AA 3OF5A 4TTPA 3SFZA 1K5GA 3GJ5A 2HCJB 3MLEA 4M2LA 1UAAA 1XWIA 4BLRA 4FI3C 1WA5A 1ETUA 4EAQA 3GQBA 3PUXA 1UBFA 2PX0A 1SXJE 3GLHE 4ZIRB 1NJGA 2F1JA 2OXRA 2IYSA 1OKKD 1KO4A 2R65A 1R0YA 3THYB 1OH5A 1I4DD 4E09A 2JLWA 1RRCA 2QBYA 2AN9A 1R6BX 2WSSA 1E32A 2KJQA 2GNOA 2FZLA 2ZRCA 4XOIA 1KNXA 2ZSDA 3VR4A 2ONKA 4PHHA 2WJIA 5CIWA 5DYIA 4YDHB 2FOLA 3OIYA 2WICA 2QMOA 3DZDA 1GTVA 1RW4A 4BFXA 1J2JA 1ZAKA 2YC2C 3TMKA 3B13B 4Q9KA 1QG2A 1Q12A 1IJEA 2V6JA 3AKDA 3RS5A 3MCAA 1YRAA 1QHHB 1TEVA 3GLHA 5HCNA 1UEJA 1SVIA 4A8JC 2JASA 2CXXA 2B8WA 2ZPTX 3FMPB 4US2R 4C0JA 1VG9B 4UXHA 3RWMB 3QENA 4LJ5A 3WNBA 5EZ5A 3W5IA 1CRQA 5DGXA 1WBBA 2R44A 2IYRA 2AXNA 2ZRMA 3X2SA 5H68A 3RAPR 3EPKA 1UKEA 2O8CB 2V3CC 1L2TA 1JEDA 2XXAA 4P32A 4Q4JA 3BAFA 2OO7A 1GUAA 2DWOA 5DYGA 5HR5A 1J99A 1ZNWA 2QY9A 5FOSA 3P27A 3DPUA 3I72A 1MRSA 2QEQA 4C4PA 3QBTA 4IHQA 2GVZC 1MO5A 4GOXA 1E2JA 1N25A 2ERYA 4IFBA 4A6XA 4ZDJA 5HZHA 3I61A 2FPMA 2F3RA 1IN6A 5EE1A 4EJSA 5EQTA 4D0LB 3A4MA 3JVVA 1JBKA 2J0QA 3BS4A 1U8AA 1PLJA 2BDTA 1EFHA 4E22A 2ZYUX 2B21A 2ZRFA 2Q3MA 2FJUA 4EFMA 4FMDB 1CJUC 1YQTA 3L8ZA 5TARA 4G5QA 4HLUA 4HI0E 2E9SA 4D4LA 2WAYA 4G5OA 5CB8A 1LW7A 4M22A 5KNDA 4I1SA 5FI1B 1S1MA 5FFMA 3R9IA 3RS4A 2A30A 2C8VA 3ZIAA 4MKIA 1JQJC 2ZI3A 3NEJA 2FA9A 4NMMA 4TL8A 3AEZA 3NBYC 1H65A 4AYTA 2J45A 2G0TA 2GJSA 3EWSA 4BLOA 2JGNA 4IKEA 4TLAA 1EESA 1KI3A 2O8FB 2WJHA 2OHFA 2W2VA 3H84A 1KJWA 1N3BA 1P4SA 1E2EA 2ZQ5A 1C9KA 3HPQA 1LV7A 1RE0A 4TTQA 3KJEA 5CYPA 4CT4B 1YR9A 4BASA 3T06B 4BLQA 3CPJB 2CCJA 1VHTA 2WMNB 1ZIOA 4MYHA 1NLFA 3WMEA 721PA 3KX2A 4CEHB 3AF0A 3H1TA 4QHSA 4TMZA 3W5JA 3CW2A 3FFAA 4HAXA 4W5WA 1DOAA 2SHKA 5DLQC 5FBWB 2F1IA 3ZGXA 4JLVA 2H5EA 1X8LA 4B2LA 2HUPA 2WWFA 2BIFA 1N2CE 4JVNA 3VR3A 1XX6A 2I1QA 2QM8A 3GLIE 4PHGA 1SULA 1MABA 3KJHA 4MKHA 5DN6D 2AL7A 1G9XA 3DHWC 1XJ0A 1L8QA 1NBMD 1XMIA 2GZAA 3NVAA 3IQWA 4UKDA 4HLQB 2GXAA 1NMXA 2O8BA 2DWQA 3LFUA 3N2EA 4BE7B 4GZMA 1SVOA 2KSQA 3O8CA 4XTRA 4XWKA 4DUGD 1A2BA 2F9MA 5FBLB 1GAJA 3KKMA 4EPVA 1G16A 4OI1A 3L0PA 5CLLA 1P73A 2A9KA 1RZ3A 3CLVA 4RSGA 2ECKA 3EX7C 3ZVRA 4Q4HA 4Q7MB 1Y3AA 1KDPA 2X2FA 4EQ6A 1US8B 4PO1A 3UANA 4ABYA 4QNMA 1E2KA 3VU9A 3CBQA 1XEWX 5IK2D 2CL0X 2DYKA 3HWSA 5L3SA 3K0CA 4DB4A 4N3NA 1YHNA 1N0UA 3QQ5A 1J8YF 2VTKA 1NF3A 1Z6GA 3KTAB 4RD6A 4ZO4A 3EPHA 4IRUB 3CX7A 5A5GA 5C18A 1KHTA 2ZJZA 5CK5A 4IVQA 2K5UA 1T5LA 4D4JA 1CULC 4TT3D 1XXHA 4TMXA 4BUJA 4B43A 4KVGA 3QJYA 2XZOA 2QGZA 1ZBDA 3HR7A 5F9FA 4H1UA 1OFTA 3NWJA 1E1RA 1ZU5A 1FX0A 2X77A 1IY1A 4GNKA 1QG4A 4QG7A 2XOKA 4L16A 1G7CA 3FKQA 4JJZA 1AQYA 3SR0A 1KO5A 4V02A 1KY2A 4PZZA 4BFYA 4MKFA 3CM0A 4CDGA 1O87A 4B3XA 4YXWD 3ZJYA 2OBMA 1JI0A 1ODFA 1CS4C 2YOHA 3VKWA 2C2HA 2A5JA 1D9ZA 2DHRA 1F2UA 2BM0A 2CHVA 3CX6A 5BYJA 3LDAA 4A2WA 3TGPA 2OLKA 1ZUNB 4X8OA 3P32A 4Q4LA 3ADDA 1OLOA 2AK3A 3AH8A 1FP6A 4F93B 1II8B 1YR6A 2QAJA 4JKYA 3DMNA 1F60A 2TMKA 3SHWA 2ZSAA 1KAOA 2BJWA 1FMLA 1DAMA 2GF0A 2G6BA 3CF0A 3IUYA 1W4RA 521PA 3SFVA 4IXMA 4Q9HA 5EP2A 5FPYA 1IN4A 2EFCB 3TVTA 3U7FB 1FL9A 3NIBA 2ZITA 3G5UA 2AXPA 3B1VA 4PAMA 3TK1A 3U4QA 4P33A 1SHKA 2HXYA 4URYR 3L0OA 3OIWA 1HT1E 3ZVMA 2ATXA 2ZYWX 4JL6A 3U5ZB 4D4MA 5IRCD 1OIXA 2ZRDA 1Z0JA 4BRUA 2P3SA 1ZU4A 3FHOA 2AR7A 4LUCA 1DO0A 4M1SA 4Z1MA 1E9RA 1X86B 2CCGA 2ZRAA 1HE8B 2FN4A 4MKGA 5JFGA 2N46A 3I4LA 2D3WA 3QPUA 3THXB 1GVNB 2UKDA 4JVLA 3ONWA 4OHVA 5DE3A 5EZ6B 1FQJA 4NL4H 1KI9A 2FEMA 3PUYA 4AIIA 1UKYA 1ZNYA 2W6JA 5IT5A 2QZ4A 1IBRA 3LBIA 2QMUA 2Q21A 1E9EA 1KI1A 1UM8A 1O3YA 2ZE6A 3DKPA 3MUFA 4MRVA 5CYOA 1XEXB 5BWMA 4JLJA 4QBGB 1LFDB 1LNZA 2KWIA 5G41A 1S96A 3I5YA 1IONA 1GSIA 3EXAA 1XP8A 3B82A 2CL7X 4NCHA 1EWQA 3RRMA 4NHOA 3C7KA 3RWOA 3KXLA 4JT2A 4XJXA 4B34A 2FGKA 5EE0A 3WYGA 4QOSA 1CKEA 1UKZA 2CLCX 3UKDA 5J4KA 1VECA 3BORA 1ZVQA 3ND9A 4OQLA 4WZAE 1ZNZA 3IGFA 1JR3D 4LJ8A 1P3JA 2PEYA 2CL6X 1ZCBA 3PEUA 2EVWX 3A4LA 2V7QA 4P4UA 4RFSB 2G1JA 1XD2B 4JLMA 1NVXQ 4Q1AA 4V0OA 3B6EA 3A6PC 4PPFA 3MWLA 4MRPA 1NN5A 1S2MA 5A0FA 1BIFA 2J0UB 4HAYA 1QHNA 3LX5A 1VCOA 4OI0A 3RS2A 4LX0A 3T15A 4B74A 3PUVA 4DSUA 1P5ZB 4C0KA 3U6KA 1XTQA 5FOVA 1AQUA 3QUSA 5AUPB 5KDDA 2J0SA 1YKSA 1M7BA 4LHYA 3KXIA 2J59A 1Z0FA 2Q9CA 4N0DA 5AUNB 1AS2A 1KGDA 2RB4A 4EFLA 4DSNA 3GFPA 4Q1BA 4Q9IA 3FMFA 121PA 1NP6A 2GVDC 2ZRKA 3AVVA 1P6XA 1IM2A 5GADl 5EP3A 3FKSA 2GZHA 4IOMA 1L4UA 3GLFB 2B6HA 4TSFD 5JI2E 4NP6A 3U60B 1NMZA 2OILA 1IOZA 4G5SA 1ZC3A 3B1YA 1W5SA 2GEUA 2C9YA 3DVLA 3BH0A 1JNYA 1PLLA 4TMTA 4TZ0A 4Q1EA 4KI0A 4Q48A 2YWEA 3SN6A 4B3DA 1WCV1 2QPAA 4HUQA 4AWXA 1YJ5A 5DHFA 4JT4A 2ZIAA 3X1YA 2FSGA 3GLGB 1S0UA 1IXSB 2R9VA 5AJYA 1EFRA 4DVGA 2OBNA 1TUEA 3KB1A 3UMFA 3ICQB 4QGHA 1NG1A 5SZIA 3KKNA 3SS8A 5KSOA 1XMJA 4RZUA 3F5FA 2RGNC 1UPTA 3MSXA 3QKRA 2BOVA 1F2TB 4ZI2A 2FDCA 5JCPA 2XAUA 2C9CA 1G5RA 4CEJA 1XJQA 5K8TA 1F3OA 4LCBA 1R0ZA 5DISB 1DTSA 1C4OA 4KHZA 4DLXA 3ZVNA 3NDPA 2YVUA 2BKUA 1EX7A 1R0XA 2BVNA 2NG1A 1E2NA 1E94E 4AI6A 421PA 1IN7A 3CB4A 3KB2A 2WJVA 5BN4A 3LVRE 2GXQA 4LPKA 2JATA 3Q9LA 1IY2A 2OFXA 3CRW1 4TMVA 4HZIA 3T1QA 4KVAA 2ZJYA 2IC5A 3HDTA 4NCIA 4OHXA 5CM8B 3TUZC 1FW6A 3I62A 4DLRA 5JMTA 4A82A 1QHXA 5HTKA 1BMFA 3AUYA 3DKVA 1Q44A 1WXQA 3CKLA 2RGGA 4G01B 2V9PA 1U9IA 2BMJA 2CJWB 3Q7PA 4LJ4A 3RABA 4YMUA 2NO0A 621PA 2G88A 5L3RA 1I4LD 2DFKB 4KFTA 3PVSA 2ZR7A 4QKQA 4UNQA 5GJWC 1HEIA 1G4UR 3UIEA 1T6NA 4NBSA 4HZUB 1RRGA 3AVOA 3KKQA 2DBYA 3SC3A 1XF9A 5KNBA 2AHOA 2V55B 5D3QA 4Q1DA 4FW9A 2QQ0A 4ILEA 2F43A 2IWRA 3LY5A 3E2IA 4FCTA 1YVDA 1VYUA 3GJ0A 1Q3HA 5FBRB 5JCZA 3SYLA 5L3QB 2GCPA 2QE7D 5J4VA 2O0HA 3I1FA 4MH0R 4NYMQ 2IS4A 3OAAA 4CVNA 1RIFA 3BERA 1EX6A 1VIAA 2ODWA 3E5HA 3CPHA 1MO6A 3M1IA 4B3FX 1R2QA 4ON9A 2GJAA 1QHIA 1KI6B 3NHBA 5IHPA 1G6HA 4PX9A 4AKEA 4FWTA 3AVUA 4B48A 2RGEA 4DEXA 1NVVQ 2NTYC 4D81A 1IQPA 2QPOA 4WBSA 4ASUA 1LS1A 1ZJ6A 4F4IA 3FVQA 5J5CA 2QAGC 2ORVA 1E69A 2X8AA 2ZJOA 2ZRBA 1OV4A 1T3LA 4AG5A 3ZZTA 3ASYA 4WAUA 4DLSA 3X1DA 4URXR 5K8IA 2QU8A 1DAHA 1NLYA 1OHHA 5G40A 3LQQA 1QZXA 3TR0A 2F1HA 5C2JB 4Q7JB 3P26A 4ZDKA 1A5TA 3AP2A 2VLIA 3L0SA 2BV3A 2CEAA 2GESA 1EGAA 5B2ZA 1NY5A 4GZLA 1GP2A 1GKUB 3W90A 2JJ8A 4DIDA 1G8YA 3UMRA 3HU2A 3OFND 1N0VC 3AF2A 1P61B 3VTKA 4BFUA 3KUCA 2PX3A 5BW8A 2KBFA 2G3YA 4KSBA 4WIAA 3A1WA 5AJZA 3AKCA 3CX8A 2V4ZA 4ZKEA 1SGWA 1W0KA 4C0BA 5BQ5A 2J3EA 5KNCA 1E0KA 2FSHA 3C15C 3C5HA 5E7IA 4BLTA 1TL7C 1U0JA 1G3UA 1U8YA 4Q9LA 3MWKA 1KSJA 3AQ4A 4DSOA 2P2LA 1U81A 3TAHA 4A2QA 1NKSA 3K0SA 3KL4A 2ODNA 1D8TA 1AIPA 1UDWA 2WVJA 1XEWY 1NG9A 5BXQC 1M1YE 1D2EA 2O8DA 2BCGY 1YRBA 2OCBA 4KODA 2N42A 1LS6A 2VL7A 4ERNA 1UBGA 1TQ6A 5JRJA 1VYTA 4D0GA 3CO5A 5J4HA 4FCVA 2XNSA 4WZ6A 5TY0A 1U90A 1IAQA 2V8OA 3VX4A 1AGRA 3CRQA 4XVRA 3GMTA 4OQNA 2J87A 4IEEA 1F48A 3VR6A 2NIPA 5H1YA 1PLKA 3KKOA 1QBKC 2Y8EA 4CIDA 3HP1A 2BC9A 4DDVA 3WP0A 2REOA 3K0AB 2J1LA 4OHYA 4AYWA 1SXJC 4H1VA 1SZPA 1ZINA 2ZI9A 1DARA 2Q9AA 3BXZA 3Q7QA 4Q03A 1M2OB 4BQSA 2Q9BA 2R62A 2QAGB 1KMHA 2DR3A 2D62A 1AM4D 1DG1G 2ZJBA 3K1JA 1W4BA 1SXJD 1HUQA 1CEEA 3VNUA 2JA1A 1D2NA 2JJ2A 4A6PA 4R2IA 2XITA 2QP9X 4NONA 3O8DA 4HAZA 2MMGA 4B76A 3NBZC 2WWYA 5M04A 4FN5A 1H8HA 3EZ7A 3GEEA 1J70A 1U2RA 2BEKA 5KU1A 3IIMA 3SI7A 2FNAA 5K8LA 1TQDA 4Y0AA 5F2EA 4RZ2A 5H8WA 1JALA 4O0MA 1F6BA 1Q1QA 4UQOA 4C7OA 1W4CA 4XWOA 1KKLA 2ZEJA 1XCPA 3F0TA 3VHXA 3I32A 2HDNB 4XIGS 1SKYE 2IXFA 4RZ3A 4PPGA 2ZRNA 5KDOA 3FB4A 1RRFA 1WRBA 3DM9B 2ZROA 4B3GA 3WMFA 2VHCA 1AKEA 3HYRA 4M9XA 2HLDD 1KI7A 3IO5A 3NEYA 1E99A 1OIWA 2D2EA 4Q00A 3KJGA 1OW3B 1S3SA 1KOFA 1VG8A 2AWOA 3ZD7A 2IYTA 2RGDA 3PFIA 5UKDA 1JPNA 1G19A 4Q18A 4QRHA 4DCSA 1EFCA 2YC4C 4KSCA 2AFIE 1H8ED 3L8YA 4NYJR 4RCYA 4US1R 3CIOA 4QFMA 1DAIA 3GD7A 2CE2X 1Z6XA 5HE9A 1G3RA 3T1VA 3WRYC 4PQYA 5KUTA 1ZM9A 2QBYB 2CNWD 5BN3A 1G4AE 4MGYR 1KI2A 2ODEA 4U5XA 1A82A 3GFTA 5HPYB 4GL2A 2JLVA 2VF7A 1HV8A 5FL3A 3BE4A 4NKRA 5FUVA 1X8KA 2XSZD 4HB2A 4KO8A 4Q47A 4W5HA 4WZBE 4B44A 5JWRA 2G9NA 3WHKA 1GDDA 4GMDA 1BS1A 2GILA 1KKMA 5FL7D 2MMCA 5JJKA 1SXJB 1X6VA 1X3SA 4BZPA 3GLHB 2GBLA 3AF1A 5JI3E 4KBFA 1OSNA 1R0WA 4QJ5A 4GOKA 3EPLA 1OFIA 4OJKA 5AJWA 1R5NA 3MJHA 1IXZA 5JWOA 1KK2A 4RD1A 4LZZA 2HT1A 1CTQA 2X19A 3GFOA 1TNDA 1KZGB 3K9NA 4RD4A 5CIQA 4Z51A 4RJLA 2YKGA 1E1QA 2I1VB 2P6RA 2XXAB 1GRRA 4Q4JB 1CF4A 4AKIA 1T8UA 2CDNA 3K09C 2BMFA 1CJKC 2NO6A 4US0R 2HT6A 4RZXA 4BEBA 4YMTA 1W48A 4DT1A 2IX3A 4D26A 3BB1A 2EFHB 3OEEA 3I3SR 3SDZA 1XTSA 4TYNA 3NKVA 4QXAA 1E79D 3JZMA 2FFHA 1Z08A 3BOSA 3SOPA 1Q0UA 5D3MA 1YE8A 1QHHA 2GK7A 2HCBA 5KYKA 2WPDA 1L7VC 1S8FA 2ZJAA 3QNUA 2OG2A 4OHWA 2QL6A 4PO9A 3FFBA 4KJZA 2QA5A 3X1WA 2XNDA 3MGCA 4DEYA 3JZAA 2PLRA 2ZUCA 1DPFA 3SYNA 3HYTA 2OFOA 4KYIB 3C4JA 3GJ4A 4D80A 3BFVA 3QPWA 2QM7A 3MD0A 2QTHA 3SJBA 3PEYA 4G0NA 1W44A 4DLWA 3KQKA 5JSZB 4KLNA 1JECA 1G64A 2JDIA 2XZPA 4E07A 4OHZA 3CH5A 4LJ7A 2WWWA 3IDQA 1VTKA 3D3QA 3T35A 4KLZA 1GILA 4FMCB 3ZVLA 2ZM5A 3AGQA 1G17A 1G18A 2FSFA 2YWHA 2C96A 2J46A 3MWJA 1ONBA 2KBEA 4BFWA 5LDDC 5E3HA 2WJGA 4D25A 3QVUA 1SVMA 1W5TA 2ZI5A 4B35A 5FUXA 1B23P 2ZRGA 2QT0A 4Q5IA 4G3XA 2EFDB 2H18A 4NCKA 4CT5A 1OKKA 1VCIA 4ZI3A 3MAAC 2O8FA 4MGIR 3KZ1E 2PZEA 3PR1A 1N0WA 2HV8A 4BFVA 4C3ZA 2ZJ2A 2RAPA 3ZS8A 5AUOB 1KK0A 2HF8A 2FSIA 2REBA 5FTKA 1F5NA 1MKYA 2VHTA 3WY9A 1OXXK 1SHZA 3SEAA 5FH9A 2O0KA 4ITRC 2WSMA 4LV5B 3R20A 4HEJA 3PITA 4TWZA 4QM6A 4QJ4A 4JKIA 2FF7A 1FOEB 4I99A 5KTYA 4HAUA 3VFDA 2PZFA 3OHMA 1SVKA 4I1OA 4PC6A 1XXHE 1TADA 3EZ9A 3QEJA 3TW4A 1VDZA 3K0FA 3GLIB 3I5XA 3K53A 5IF9A 3A37A 4I81A 4Q4HB 3WXMA 2Q3HA 4Z8XA 3RS0A 2YZ2A 1XZQA 2C04A 1PZNA 4EQ6B 4FMBB 2B7CA 2PMKA 2C03A 3K9GA 4O2LA 3VU9B 3CWZA 1P2UA 4PHFA 4TLDA 3MJRA 4S35A 2ZANA 4A8JA 3IILA 3IHWA 5L3SB 4A0FA 1AKYA 5LBIA 3H4MA 5SZJA 1JJVA 4IJMA 4XSHA 2V1XA 3W8NA 5BYKA 4LK2A 3QXJA 3GJ8A 3B60A 3C5CA 4PZLA 1NI3A 1TQ4A 2GAAA 3EA5A 4NYIQ 2O5VA 4PPNA 2IYQA 1W0JD 4WA7A 4PQFA 1NN1A 3X1ZA 1G8GA 2W6JD 1FX0B 3LQRA 3OEHD 2D4HA 2P6UA 4R9UC 3TW8B 3TAUA 1AZSC 5FBVB 1T3SA 2VIIA 4B33A 1QVAA 1P9WA 2EYUA 2H16A 3D7MA 1XCGB 1YZKA 3BFKA 3WBKA 3KKPA 1GL6A 2H7VA 4IOJA 4YLGA 4X8LA 1JPJA 3OE7D 2L0XA 3FDIA 4IOLA 4JLOA 2G77B 2W2XA 2AWNA 4DHEA 2BMEA 1VYVA 1RVDA 1TMKA 5CJ2A 4DJTA 1E0AA 2XB4A 1F2UB 2BHRA 2ZVPX 2ZVQX 3G82C 1P62B 2ZSFA 1RKBA 4B71A 5AUQA 1OIVA 2EWVA 4JLAA 3K9HA 1JQLB 1NBME 4D2IA 2G83A 3CRRA 1KIMA 3PV0A 1COWD 3A1SA 1W4AA 5DI3B 4OK3A 1RYFA 3HPRA 4BZQA 1KO8A 2VSOA 2YOGA 5TB5A 2ANBA 1XU4A 3D6TB 1CP2A 1ZMXA 3LBNA 2IS1A 1YZLA 4LYAA 3U3RA 2WKPA 2R2AA 1NVUQ 1ZUIA 2P0EA 4IW3B 4K81B 4Q4AA 2VSXA 4LPSA 1NL3A 3TKLA 2IYYA 1XTIA 2XJ4A 4TMWA 2IEZA 5JZVA 1U99A 2JJ1D 4JIMA 3U4QB 2AK2A 3B1ZA 3RSLA 1HQYE 3KQNA 5DN6A 1RJ9A 1ESMA 1P72A 5LB4A 1DG3A 2IHBA 1UF9A 4GI7A 4UNRA 1NBMA 1SVSA 1Q57A 4RFVA 2A5GA 2ZXUA 4W7SA 3Q8XB 3H0KA 2IF2A 2WM9B 4LJAA 4BPBA 3L43A 4U00A 4UJ5A 5FOTA 2EFEB 2Q0HA 4PC1A 1E9SA 1N6LA 2PZGA 2VHUA 1A7JA 4O3MA 1XTJA 4JL5A 3UPUA 1P9NA 2WOJA 4R2HA 4OI2A 4DUGA 4A15A 4A0GA 2GTPA 3ND8A 2GCNA 3B1WA 4AYXA 4OJQA 1KI8A 1W2HA 1ZNXA 3KJIA 4HLDA 1D6JA 2IYWA 3K70C 3GJXC 3EW9A 3ZDQA 2AFHE 5JJIA 2WJJA 2ZU6A 3LLUA 2ODBA 1QHGA 3QPVA 1IHUA 1U98A 4GP7A 3K70D 3SU8A 4JSTA 4RD2A 4KBGA 2PH1A 1Z0AA 4M8NE 5AJXA 3D31A 4OQXA 3CH4B 4TT3A 3TSWA 1SVWA 4F91B 2FU5C 1FUKA 1T3HA 5EXPA 3TJZA 3L2OB 1R10A 3VAAA 2FG5A 1X1SA 4TYYA 4GDFA 3T1OA 3QSYA 4LJ6A 2VP6A 5HKKD 2ZTSA 2CHQA 2RGAA 2FFQA 2DFTA 3ICEA 4YXWA 2NZJA 3J81k 1DELA 3Q3JB 2PCLA 5CK4A 3BH7A 2Z5FA 3VMFA 4EPYA 2OV2A 2ZRHA 1E2MA 2BBWA 1U9IC 4C0SA 2ZR9A 2IBMA 1NN0A 2IXGA 4IDPA 2XEXA 3SJAA 1L4YA 2QMHA 1XNJA 3AP3A 3VR5A 4PSKA 1KSFX 4ARZA 3VKGA 2VHQA 3PG5A 3Q72A 4IDNA 3DOFA 5IDVA 3T61A 4RKFA 1S4QA 2OLJA 5GJBA 2BWJA 2F9LA 4C0HA 3CR7A 4LBWA 2J0UA 2H17A 2HXSA 3A8TA 2PT5A 1R7RA 3NH9A 3IIKA 1E9AA 2A5YB 2RGBA 3AF3A 4BFTA 1DAGA 1NVWQ 2C78A 4L8GA 4G5GA 4R98A 2D2FA 3U44B 1G8PA 3KFVA 4YMWA 2EYQA 4E5UA 1KJZA 2JLRA 2QP3A 2BBSA 3A4NA 4DLUA 3ZZ0A 5E7MA 1M74A 1ZM7A 1WE2A 2GZDA 3QG1A 4DLVA 3FMOB 1E4YA 2D06A 4HB0A 4JSYA 3Q5DA 2A7QA 3N5CA 4DSTA 1TU4A 2A2ZA 5CB6A 4C0LA 2REXB 2OESA 5F9HA 2OCYC 3K70B 3NTUA 2F55A 2J7PD 4Z54A 3BIFA 4TQUS 2IW3A 4HB3A 3WP1B 3A1VA 4DLZA 4QBIA 2KE5A 1BO6A 2DPXA 3GJ7A 1E0JA 3A36A 5EXXA 3RSOA 2O8EB 3LXXA 2VHJA 2MSCB 1ELOA 2YYZA 1FUUA 4KU4A 4CEJB 1XB2A 4TQ9A 3CRVA 1ZM4A 5G53C 4TL7A 5F3WB 4X8HA 5DH9A 1VG0B 2GF9A 2J41A 4IEIA 4B75A 4MYTA 4EIWA 4YMVA 2W6ID 2PMDA 2Z83A 3IPXA 1KTVA 4DDUA 2IF0A 5FTJA 1UBEA 4OBEA 3R7WA 2HYIC 2A3RA 1TPZA 2F1RA 2Z6VA 1XDBA 4ZCLA 1XBTA 2J0VA 4MYCA 1AA9A 2FFAA 3FTQA 1F2TA 3EG5A 5KPJA 1TX4B 2NMVA 1G8HA 3QG5A 1II0A 1NIJA 1JR3A 1X8JA 1GNRA 4DZZA 3A1UA 4QHTA 1PVOA 4M53A 1OXUA 1Z22A 4XD7D 5SZHB 2BCJQ 4TYWA 3NBFA 1Y63A 4JLNA 1SQ5A 2IK8A 3P1JA 4NCJA 4HAWA 3F3YA 4MRSA 1U94A 4NTZA 3I92A 2D7DA 2W00A 1ZD1A 1KK1A 3TUJC 2JIZD 4Q7LA 1GIAA 3V4FA 8OHMA 5CITA 4MQBA 5FTLA 4U02A 1B0UA 3AM1A 1A4RA 1KK3A 4LSGA 1D5CA 2DB3A 2OEPA 1RPZA 2HJVA
chains in the Genus database with same CATH superfamily
3ZJTA 4F96A 1R4NA 4RETA 2F3UA 4DJ5X 3KEOA 3T12A 2ATIA 1JZQA 5ITZB 2QROA 1SRRA 1ULSA 4KYUA 4ZQBA 2QSZA 1QIEA 3B8EA 4PR3A 1QB8A 5AXAA 3G0GA 4D8WA 1KRXA 2RGUA 3S2ZA 4P53A 4YJGA 2GSWA 1XNRB 3O26A 3ZQKA 5AVUA 5FR2A 4RYLA 1ECGA 1FRNA 4LC9A 1ZM3A 4OO3A 3PDCA 5JIBA 2YW2A 4TV9B 1OWPA 2Y6UA 4X1IA 4JLPA 1EFTA 1VB5A 5U4XA 3RJZA 1SBTA 3KEMA 3I2HA 1D09A 4M99A 4BWFB 1JMKC 4K3UA 1OF1A 1EA7A 1QYRA 3E70C 2I3GA 4AWBA 1F7VA 3S29A 2CLKB 2VK8A 3OM1A 1NNLA 4R6WA 2XZTA 5KSWB 1NUSA 2DFLA 4DRYA 3GQVA 4HQOA 1P4JA 1EWVA 1OLUA 3GUVA 1NF2A 4Q24A 3SKYA 4AUEA 1I6KA 1LF0A 4IVPA 5AESA 2ET6A 1O5OA 1CUVA 1ULZA 1Y8RB 2ATEA 2GX6A 2JVIA 3D1VA 5DTIA 4UTVA 4CM9A 5E1BA 1E9VA 4G1UC 1V7PC 1VPLA 3Q15C 3D3WB 1RYYA 3QFTA 5KQPA 2R4QA 4QYIB 4B7AA 3QYAA 3ONDA 4NLLA 5DP1A 3BF7A 4ZO6A 1UFKA 3VISA 4BFSA 4GRAA 4H2DA 2CLMB 2RH9B 3DBHB 4S1NA 4NOMA 5JXGA 1TCAA 2XBLA 3NDIA 3T5TA 4L57A 1WQ3A 3PB3A 2QSYA 4D6XA 2GAOA 1VSTA 4IINA 4WRRA 1P2SA 3UATA 4EPWA 5I7RA 2CFSA 4XXHA 3RIHA 2R5NA 4HY3A 3V1YA 1YB4A 3OIUA 5IH3A 1JHPA 3QWBA 4DL9A 5H4GA 4ZTZB 2AUMA 5KZMB 2AZXA 1PW5A 1X7DA 4WVFA 4XE5A 3CNNA 1E1MA 3INYA 3TIFA 1NJ1A 2WC1A 5JV5A 1TKCA 3BYZA 1BWRA 2RKWA 4C0WA 2VYVA 2OGSA 4E03A 5FBKA 3HYLA 5EJ7A 3OZWA 1H2YA 3K8YA 1T0BA 5ALZA 1IAVA 3C3JA 4LV8B 4OIFA 5HE8A 5K3DA 2IS2A 3EASA 2OC9A 2OPHA 3DL0A 3G1TA 1ZGAA 3QWAA 1YZGA 2H5JA 2VO1A 4WKGA 4RDCA 4M9SA 1ZN7A 3UBMA 1JHAA 4GUAA 4BGUA 4KUEA 4D9NA 5K51A 1K8QA 3F74A 4MW5A 2CK3D 2GCOA 1LI7A 4J3JA 4H7FA 3ROQA 3T8YA 3F6YA 1J06A 2VAWA 3FN4A 3KEFA 1BNCA 4RHTA 5BY2A 1VLJA 2XE4A 3R3SA 4ND1A 2Y3IA 1UANA 1ZS9A 2P1RA 1ST2A 3G0IA 1G9SA 1AKNA 1NSFA 3DXZA 3GRVA 3OCXA 4FEEA 4GPEA 2ODQA 4LAFA 3VTFA 4B6JA 1E1CB 4PM4A 3FBTA 1FPMA 1VMEA 3FYTA 3K9QO 3OFVA 5DNVA 5JOQA 2W93A 4WW0A 1XCMA 2GLTA 3WO1A 4FT2A 1MC1A 3FUUA 4HR7A 4MMYB 2VSFA 4TXLA 3RIGA 5AVTA 3LH5A 2I0FA 3LGAA 2DAPA 3QELA 1HYGA 4KQGA 4ZCIA 2DUUA 1QGED 3CTMA 5L7TA 5KAPA 1PQYA 1W49A 1P4GA 1NWCA 5E95A 3ZZMA 4ZPJA 1YJXA 2BEUA 2QNRA 1T34A 1GRQA 3E58A 3MCVA 1ZOOA 4L9WA 1PEYA 4LSZA 4YRDA 5FBZA 2J48A 2D1QA 4EI9A 2HJRA 3CLRD 1XG5A 2HA7A 5JS2A 4NMLA 1NY6A 2FTKE 3BXHA 1N2HA 2OLEA 3TRHA 3TLMA 5K3FB 4M0LA 4OHOA 2R11A 5HKBA 2XKJE 4JJEA 5LD2B 3G23A 3A2LA 1QRRA 4YCBA 5FTMA 1XMVA 1I7SB 4JYZA 2PGDA 3Q7IA 1DUSA 2GVNA 1KMHB 2XOXA 3DVRX 3R6WA 4ROSA 4E5NA 1Z5UA 4CXMA 4GI3A 3TZEA 1UM9B 2B5VA 1XN4A 1V5WA 4MRRA 4D9FA 3H2HA 4KAXA 5FCDA 3TCXB 1YACA 1QHFA 3OT4A 1GFSA 1SHUX 4NI5A 2CUZA 1P2BA 3KWMA 4Q01A 2HLPA 5ADVA 1OU4A 3F97A 3HCPA 3CX4A 1H6BA 1JIKA 1I80A 4FCCA 4FYPA 4JUBA 4QGFA 2GK6A 3RG2A 2QRQA 1TRHA 3WTCA 4KSYA 4P0TA 1JV2B 2WHPA 1Z0DA 3DQQA 3I73A 4KBYA 1V3QE 4UHKA 1MQAA 2Z4TA 1RYHA 1YDMA 1K2WA 5JG7A 2NO1A 4HEHA 1TTTA 2NNWB 2UAGA 1YZTA 4EJSC 2P9YA 2IKSA 1JVNA 4HQFA 4BUCA 1V8BA 1Y1RA 1FTWA 4BO7A 4Q19A 4M9CA 5M3BA 4PFSA 1ABBA 1J56A 2NQ2C 4C7OB 3DEFA 2O2YA 4DLYA 3KOZA 1PFYA 4R1TA 3KAJA 3UXMA 5BXYA 4HVAA 2J4FA 3THWA 2WJWA 2HMUA 4HLUC 4IG9A 2H1IA 1KIAA 1KMQA 1QCCA 3U0BA 5G3ZA 1JHQA 3BE5A 1QO9A 5CX1B 3EF0A 3LXMA 3V4LA 4RMJA 2R60A 1XPJA 3JCZA 3T54A 3W3AA 4LHZA 3OFNA 4PONA 4YLYA 1F0YA 1CZHA 3VZCA 4PYRA 2JBHA 1Z9BA 4UHDA 2C1XA 3FYSA 4PXSA 4HDOB 1SOUA 1IN8A 5H5JA 1FP4B 4CMAA 5KNDD 3QMMA 4FWIB 4QDZA 1AUPA 4UAJA 4B4DA 4LWZA 3V1KA 4WADA 1JXOA 1POXA 5BSUA 2J9ZB 4TMKA 1JTFA 2IH2A 2Y1DA 2Y2UA 4TUYA 4XARA 1G21A 5A7FA 4NV1A 3PNYA 2A0UA 2PL5A 2G4CA 1GTL1 1Z38A 1IN5A 2BZ1A 1ZLXA 2JAOA 4RD0A 3FWYA 4XQ9A 3E81A 3VYUB 3ZGLA 2G1UA 5AW4A 2GPBA 4MARA 5TS3A 1TJ3A 3OPYB 1EFDN 4R31A 3UCXA 4NJMB 4YAFA 1UBCA 2FVXA 4CMCA 1ZXLA 1GQOA 3Q2OA 1C0PA 3F73A 2NT3A 4J3NA 1G3MA 5TVGA 4CUJA 3KT3A 4FYVA 3FVVA 3TPCA 1TDJA 5KI6A 1FBNA 2AFIB 2QP4A 1CEXA 2Z3VA 4R05A 3TOSA 4EMSA 1C9NA 1C4KA 3C87A 4EKGA 4YI3A 4LBYA 2XWBF 1WQ1R 1BH6A 3GUHA 2Y67A 3N74A 4PLWA 1Q5PA 2BFEB 2PLFA 1Q7GA 2W0SA 2W22A 3I6ZA 2Y9PB 4KPUA 4R68A 3QEKA 1CZNA 2PKYX 3V9PA 3ZD9A 4FDLA 4GYKA 4IIGA 4ALKA 1ULUA 1Z0SA 1JKJA 5C1PA 1KDOA 2CXNA 2H57A 2HK6A 1XJWA 3FCCA 4DT1B 2GCEA 4GC9A 3V2UA 2W2LD 4AP6A 2G07A 3GGPA 2VCYA 5J2UA 5DSXA 4LF8B 5B30A 3U7EB 4RJJA 3UMJA 5C1BA 1G42A 3MS4A 3DMTC 1NI5A 5DM0A 5D3MB 2IU3A 3MMSA 1DHRA 3PVCA 4D9GA 2QGFA 2FMHA 3MTBA 2WHXA 1PEKE 1WP4A 1OYYA 4RTKA 4LC0A 5T4EA 4ESVA 3KR1A 4QU9A 4PNZA 4I50F 3SS7X 1DE0A 1SU8A 2VZ8A 3T7AA 1Z3IX 3AB3A 3SQLA 3HDGA 1CJBA 3K8QA 3DV0B 4UUNA 4QUHA 4ZV4A 3WB9A 3HLYA 5CGQB 4LHWA 3RVMA 5HS6A 1QIIA 1E9CA 1SELA 2G7MC 2OVBA 2ZE7A 4G6ZA 2ZI4A 4PBSA 3FCSB 2AJ8A 2WZBA 4BO1A 3L8MA 5A4MS 1M8KA 3CRZA 2ZJ3A 3BWDD 3JQ9A 3LKDA 3FWKA 4CR6A 5A03A 3CLHA 4TN5A 4J16C 2UZ3A 3D5QA 4U3JB 4RWZA 2CV0A 4OK6A 2G04A 3OOJA 3JR3A 3TWOA 2PS1A 3NW9A 3EA0A 4Q4CA 1BRMA 3R9KA 1MB2A 3W6NA 4OFXA 1WXDA 3J80A 2ZWMA 3K71B 1WHTB 3AOEC 3GCWA 5DMXA 3LVQE 1V95A 5THKA 1TAQA 5DJ5A 5IKEA 2Y6VA 3HCRA 4KPFC 1M10A 2QTVB 1NQ5A 1NOKA 3NC0C 5AWFC 2XOKD 1Z4OA 1UPBA 3E5RA 3F9RA 3FFTA 5TQ2A 2MSKA 2J08A 1CUUA 3UYKA 5EEGA 4YCNA 4AICA 3HJHA 1QK3A 4M7RA 4P92A 3QVLA 1ND6A 1Q1BA 4WGFA 1YF3A 4G1VA 1V1JA 2H7CA 2NV6A 1T9HA 4J7UA 2NVUB 1OC4A 1EFUA 2G6TA 5E6UB 4KHPB 1JJAA 3BREA 1TE2A 5EN4A 1JDNA 1CLUA 2A57A 1GNPA 5B53A 1YZQA 1XVIA 3LU1A 4U2EA 1OH8A 5KC8A 2WSIA 1W85A 3W1WA 3X2EA 5C9ZA 3LT5A 4R9RA 2WT8A 4L78A 2PCJA 3PHHA 2HBQA 4ZQCB 2QJTA 5JLAA 5JNSA 1DEHA 3AHIA 1V2HE 1NI4B 1EVKA 4QUDA 4IVRA 2I8LA 2Z2XA 5WRFA 4D9BA 1UKVY 2J8ZA 2HCRA 2AD5A 3MWEB 4G1CA 5CVDA 4CEHA 2O8BB 3TE6A 1SUSA 1D6MA 2N75A 4HLCA 5GONF 1GUBA 2UZ0A 1Y34E 2JLYA 2YOFA 3NGXA 4BQPA 4H60A 1JVSA 4JJKA 4M0MA 4XH9B 1GY8A 2FE4A 3ZCRA 1BX0A 1N77A 2X0JA 1PT6A 3K0FB 4QO7A 1Q1ZA 3RFXA 1BVHA 4Q66C 3ROEA 5AR1A 2IP1A 4RDIA 2IYVA 1CETA 2QXTA 2ZVJA 3L6OO 3G2IA 5P21A 3UENA 1C2TA 3B2QA 4R1PA 5ESXA 1B6RA 4QLBA 2VP2A 3MOGA 1ESNA 4L15A 2ZAIA 3EAFA 1B1AA 1YHZA 4NU6A 5LOVA 2VR1A 4TM7A 1COZA 1K98A 5CA1F 3RYIB 4Z1MD 3RK0A 1CSEE 5KNLA 2PD3A 3PX3A 4FSXA 3DTYA 5EFOA 2K7ZA 1BQ3A 3T3PB 1AK2A 3OICA 1O95D 3ZYCA 4DDTA 1CJSA 3DVAB 3EVFA 3QEMA 4RNCA 4Z9FA 3AKZA 5HDBB 1XXHB 1TFRA 1RQNA 2DBZA 4U2DA 2EXXA 4CKBA 1LW6E 3EGVA 3JD4A 4DCJA 3D1JA 2O07A 1N2SA 4MQEB 1KEKA 1YZNA 3MN1A 2KPOA 4URUR 3UN1A 4CIBA 3IC5A 3QXCA 3I45A 4N7MA 5TMDA 3JWGA 4E2FA 4Z1OA 2B37A 3H5RA 4BVGA 4MV7A 5LN1A 1VA5A 3OIVA 3PNVA 5TT0A 3OLZA 2HJ9A 4DJJA 5AW7A 2IH5A 1RM5A 3ZHCA 2W2KB 1ZBQA 1EFPA 2QQEA 4HUTA 4LY6A 1BDBA 3AUJB 4BU0A 5C31A 5F52A 4ETIA 1QIJA 2XB9A 2X7JA 1UOOA 3P5SA 4Q1CA 5I7VA 5KMGB 4B3MB 3KAKA 1F8UA 5BWBA 4D4IA 4FP9A 4W5OA 4YQFA 4BYMA 2QAIA 1VGQA 4HPWA 2P68A 1XD8A 3ZWMA 2E6KA 3HA2A 1C14A 1DAEA 1L6IA 2O6HA 4ZJPA 4MDFA 4FHEA 2HD4A 3LNCA 2FSUA 2XUQA 2JFYA 4ZODA 1L7OA 2FZ4A 1QAOA 2GHRA 4TWJA 5MN6A 1PNVA 1CS0A 1AO0A 1MV5A 3MWYW 4H4DA 3Q8MA 2XTNA 4RJ2A 2OAP1 4TLBA 5I7EA 4CCAA 5A4IS 4X3OA 1VCNA 3K73O 4QQNA 2XT9A 4B46A 1FDVA 2MYTA 4CL2A 1Q17A 3E8SA 4RTOA 3HUFA 5JS8A 1QGDA 1IEVA 3TZQA 3KPVA 4PLTA 3F98A 3LHSA 3U13A 2UVPA 3IBGA 3KQSA 5DSZA 4CHGA 2P5YA 3GAAA 4TS9A 2ZSUA 4PC2A 3VPDA 3D4LA 1UXGA 1M54A 3OY2A 4M1TA 4PAOA 2X41A 4LI0A 5AYVA 3WWOA 2H8GA 1E3SA 2IHYA 3D8HA 1KQOA 4WOJA 5F3DA 4C9BA 2CFRA 2EERA 4MR9B 5BRAA 3JD3A 1QO0D 4RPJA 5FBVB 2XGJA 1J25A 5LP6F 2IUSA 4BNTA 1UWLA 3NJ4A 4DV1B 1EB8A 4POAA 1O6BA 5FPTA 3N58A 2QTBA 3P9NA 4M9ZA 1QVVA 3LRTA 3SHFA 4OP2A 3MQ2A 2XF8A 2IUTA 1SB9A 2OO5C 3D4NA 3HHPA 4LXTA 1KMIY 3WLPA 1QB7A 3LAWA 3R41A 2H1SA 1W88A 4IMRA 2ERCA 1WQ4A 4FD3A 4MUHA 4B2PA 2R4TA 1GRNA 3DTVD 1R74A 1O89A 1S9HA 3R0ZA 1N5IA 3OA0A 2J7KA 2PUJA 3SKXA 2P9JA 1TCVA 2A0KA 5AJVB 5SICE 1THZA 4UHFA 2GRAA 2PSFA 1IEWA 1O96B 4FFBB 3TL2A 2BEWA 4QSHA 2GBCA 3DT6A 4LXIA 3WLOA 2XVZA 4WY5A 3PEWA 2GNAA 3DKKA 2FWRA 5KREA 3COYA 4DLAA 4MUGA 3EIUA 2Q6VA 4P86A 2YINC 4B4KA 4QZVA 2BEJA 4HDCA 4MQLA 2GM5A 5SY9A 3LD9A 1LF5A 1Z07A 3LW7A 2IXTA 2H1FA 1NJ2A 2CDAA 2PX2A 1VKOA 2XUPA 1J22A 5EWLB 4RZIA 3VPFA 1HR0B 2VQSA 2QJRA 3PFCA 1L4EA 1JAXA 2WUVA 1ZZGA 1CV2A 2A94A 4L95C 1I2DA 4WK4B 4PLCA 4MCAA 4MQ4A 1G6OA 1FLAA 5I4IA 3CG4A 1P0CA 3DFUA 4OU5A 2E6UX 4I9NA 2UYHA 4G8JA 1IY0A 2ZYVX 2KI5A 3V3TA 2RHHA 4F92B 4DV4B 4F4JA 4M98A 3WMGA 1GARA 4MOWA 2X0NA 3M6AA 4FQ5A 3R9WA 1A2KC 3A3NA 3VV3A 1RWWA 5IUNC 1N6KA 3ZCUA 4BFLA 4V0KA 3R3HA 4PCAA 2ASVA 2WTNA 1ZWKA 4QULA 2VPQA 4Z7JA 5BV8A 5AVWA 4AB1A 5LJLA 3F5SA 1YHYA 2FV8A 4H6VA 4MWGA 4WBXC 4FPXA 2ADOA 2VT3A 2VYQA 4EJ2A 3ZE0B 2BKVA 1FNSA 1U0HC 4BAUA 4UXIA 1LRLA 1SXGA 2IXBA 3DPSA 4AD8A 3R6DA 3DZHA 4FTWA 4Z7OB 2FPGB 3ENKA 5TPZA 4C3VA 1I0IA 4Y9TA 5KNBH 3KJFA 1M34E 1Q21A 2JGIA 2SECE 6NULA 1ZIXA 3VGPA 1IXKA 3ZGYA 1BXGB 2GCGA 3FYUB 3QVMA 3UQYS 4FJ0A 5ITZA 2Q9UA 5HJ2A 5KQSA 2Z4RA 1COWA 2GT1A 4CIWA 3A3PA 4TMFA 2W11A 4XWAA 3V55A 4BMYA 2Z09A 3B89A 2XGMA 3R44A 3R8FA 2Q45A 3IP5A 2RK4A 1YZHA 3OCCA 3UB2A 2ZR0A 2J9FA 4ZAGA 4LE2A 1QOQB 3U1TA 2P5TB 2Z3ZA 1U0OC 4QTYA 3DDNA 3RUIA 5FUQA 3D02A 4BGDA 3CQ9A 1BD3A 4IS2A 2VTBB 4OBXA 3TGWA 3IAM6 2GN1A 2JJ1A 4HFNA 1E9DA 2WVGA 3FCYA 4FUTA 4KMRA 4LRQA 5AM4A 2R6CA 3GFRA 4AN1A 3LUDA 5D8DA 1Y1TA 1TTHA 1V43A 1VI6A 1GXSB 2DFPA 1YR7A 3KE8A 2R6FA 3H4TA 4WNIA 4V0NA 4C30A 4YT2A 1V8ZA 5GOTA 3LUCA 1U9CA 4HFJA 4LRUA 4AVYA 3BEOA 4M1WA 4ZCPA 5EMLA 4F4UA 5TLSA 2CVOA 2V6MA 3D6UA 3I04M 1ATZA 2COEA 3AETA 4NYJQ 2FXVA 5TMEA 2XVXA 4A26A 4R71A 3LRXA 2FMXA 3CHYA 4AKHA 3C48A 2WV9A 3QVJA 3U44A 4IXWA 4F71A 3GF4A 3MB8A 4YQEA 4CI0B 1GZ4A 1NU8A 4BNLA 5JJLA 4ZEMA 4EWLA 3MZ0A 1JR3E 2B1GA 4CKEB 5FWYB 5C52B 4CV0A 4AQYB 3H2YA 1FIUA 4ALLA 4FFOA 4ER6A 1O97C 1GQSA 1HDZA 3EJ6A 1GGKA 5BSHA 4MB2A 1I13A 5KYVA 4FCWA 1NT2A 2V97A 1RLMA 3D1LA 1GPKA 1VIDA 1ZMOA 3MMPA 1RD4A 3E2PA 2QM3A 5JAQA 1JHMA 2NXEA 1F20A 3FPCA 5I5EA 4YO8A 4N0MA 5GONB 2XECA 2I66A 3MUNA 1GN9A 1KH1A 4K6KA 3SMVA 4XSVA 2Y1KA 4G63A 4B4OA 3OT1B 1W9MA 4WEQA 4OOFA 5CVCA 2EG9A 4CMBA 3WYBA 1PK9A 1C3VA 4KUGA 2PRIA 1K6EA 2AE1A 3K05A 4K9QA 1PV4A 3RE1A 4Y2GA 1J90A 2QMEA 1C1DB 1VP3A 1RYMA 1FNCA 3AR9A 3HP7A 3H87A 2EP8A 4XWTA 3WICA 5DNYB 1XPUA 5HKKA 2HJWA 3JWEA 3O92A 3ONVA 4TV8F 4YMSA 1G0NA 5CA1B 1T4GA 1NAIA 4QYXA 3V97A 3WR5A 2AGVA 3KUDA 4M9RA 1GTZA 2YXLA 2ZWVA 4O02B 5DASA 5FWDA 5J63A 1L5FA 3VR6H 5L95A 2RBEA 4BYGA 1MJGA 2D5IA 1BKDR 1OWOA 4C87A 3Q7EA 4DYVA 1ZPDA 5JPDA 1JDUA 4K5QA 1XZEA 1ZI6A 2ZQZA 1C7RA 4WOPA 1GNQA 1T5IA 1G60A 1TF5A 5KWEA 3KOMA 1CQJB 2C5AA 1E8MA 4S1TA 3THOA 1M8FA 3CT4A 1P81A 3ZU2A 5KHOC 3NGMA 1QO7A 4OUDB 4XPZA 4E51A 4Z3OA 2Z6QA 2QTFA 1E2GA 3EAQA 4EVRA 3RAGA 2BHLA 4MVJF 5TMPA 1LVUA 2X76A 3U3OA 2QW0X 4NVRA 1Y9AA 4C1NA 1Q7RA 2QUIA 3JAKA 4B83A 1RZRD 1N5RA 4XZ3A 1EXDA 1T43A 3HACA 2A84A 2DSNA 3LPDA 1SG6A 4N0PA 1P5HA 2JANA 3UK6A 1ISGA 3SYKA 4XKJA 3L4SO 1Y1SA 2FPUA 3CLTD 1V5GA 1X1BA 3NYIA 1E6KA 4H08A 4XR9A 1KSGA 5JLJA 3PYLA 3NIWA 5ALPA 3QVTA 4RVCA 4CDNA 2JI6A 5EHZA 4FGJA 5A4JA 3ESCA 2CBGA 4B0OA 4EX6A 3MC1A 2WB2A 2ORIA 4OXXA 1WCYA 2LE0A 5U1PA 2H6EA 4BZZA 4S24A 1W2GA 5FPSA 2IWHA 2R7MA 1QFSA 2X8JB 1E6UA 4E14A 3FTCA 3QZUA 5EKXA 1L5ZA 1X70A 4LYEA 5HSGA 1ECCA 1K06A 3VX3A 4CFYA 1OB5A 5FOUA 5BSRA 5LPNA 1TZJA 3C7TA 3CVJA 2FX5A 2J7PA 3OQVA 1O94C 1WBDA 2JJ2D 2PV7A 2QJOA 4NE2A 5IC4A 5K6AC 4WCFB 1CJVC 4HLNA 5AKHA 5CNMA 4G9BA 3RLIA 2WTMA 4PSCA 3E7PA 1N6OA 1R18A 5EWJA 2J85A 2Q3FA 4UVDA 4UNNA 3W6OA 2WDZA 5LP6B 5KDLA 3VSCA 4CV2A 4Z4IA 1EDEA 3R74A 4JYPA 2VPZA 4IX9A 3BDAA 4ZAFA 3N8NA 5K3SA 1G1MA 4R1UA 3QIAA 5EE3A 1QHSA 1EJBA 2GYYA 1M7GA 2GRJA 3V1UA 4TL9A 3KBBA 2HRRA 4MA4A 1L7QA 2GPTA 3IBCA 4FQ7A 1ONPA 1DC4A 1QOPB 2DCUA 1XFAA 4PNEA 1GLGA 1W52X 4GT1A 3LTNC 2XDYA 1I9CA 2MYPA 4ZVNA 4ETNA 2FRVA 4M6WB 3LWNA 1TD1A 3BMCA 1Z5NA 5J40A 1KAGA 1RRPA 3CV3A 2V7TA 4ACAA 3S99A 3EEFA 1QGUB 2R6DA 2FFBA 1A4UA 2HYDA 1E0SA 4JH0A 3GRYA 3TR5A 3JSAA 1TJ5A 2DTEA 3KJQA 3EQ8A 1R4MA 3NRJA 3UC5A 4E7OA 2B8TA 3OJEA 1H9CA 3GARA 5BUSA 2VZLA 5TC4A 2GM9A 4DIFA 1G291 2GJKA 3SVZA 4EVSA 1GDTA 4DB2A 1ISJA 1XGKA 3V46A 1OPRA 1R8JA 4ZARA 4C2TA 4KITB 1KFJB 2HRDA 3AR3A 4AP5A 5ALLA 1GCIA 1JIUA 1OFGA 1Z13A 5ELXA 3F1KA 1A1SA 1Z6TA 2NGRA 3E0QA 1AZTA 4GUDA 4N39A 2OCGA 3TUIC 4I1YA 5A7HA 1ML4A 3S55A 5C4GB 1UPUA 2XMPA 3A05A 2WYIA 5EZYB 4AULA 2J6IA 2ZUBA 3MINB 5EPOA 1APBA 1X74A 4ZANA 4ARIA 2R96A 4V03A 5DPMA 4I9GA 3P19A 1JAYA 3NHWA 4C0QC 4MVJP 4XM0A 1TMOA 1T10A 1JT2A 4K87A 2RGCA 3CX3A 3TSYA 1GN8A 1TFUA 2N47A 5DNWA 1J8QA 5TGTA 3FOZA 2XWJI 1NLUA 1Z0UA 2IFTA 5K8UA 4J0HA 1N78A 4EHAA 4IXNA 4I6GA 3W4IA 1PZHA 1V1MB 2E4AA 1RDFA 1Q0LA 3BQ9A 1ODTC 4HMPA 4RD3A 5E38A 4ZI5A 3WIBA 3TMAA 3TFOA 1CZOA 4QJBA 3K0AA 4UTXA 1H2HA 1NZJA 4J0FA 2ZRJA 2VDWB 2WLSA 5ED0A 1VSBA 2GETA 4OMFG 1W76A 4ESHA 3GNSA 5LJIA 2QMYA 1OBCA 4AF8A 2QAGA 3OEED 2JLBA 1IY8A 2A4MA 1NLZA 1V37A 2UZ1A 3DF9A 3L77A 4CKCB 2I91A 4C7JA 3UNXA 2P4QA 4LZLA 4BGVA 3HA5A 4JLKA 2P4UA 4PGAA 1NU6A 1VDMA 1IM8A 2JFQA 1L8OA 4WFJA 3U48A 5L3VA 4URHA 1PU2A 4M60A 3NOVA 3PYXA 2XX3A 4UNPA 3S5UA 2VNAA 4YCLA 1CIPA 3G7NA 4FHDA 4Y67A 1DTEA 1JQEA 1I0LA 3DXFA 1K8YB 3BGWA 4QYWA 4RK4A 4L3OA 4UEQA 1MAAA 1Z4LA 2EU8A 3EVDA 1L7AA 5CBKA 5JISA 3RYFA 1O6CA 1NQXA 3M5WA 3WWCA 3C16C 2WU8A 3SLGA 1XZHA 2R8BA 1ZUD1 3SBEA 3USCS 3TBKA 4OMUA 5LZ2A 4H6PA 4BDTA 1HM5A 3L6CA 4C78A 4EG4A 3Q9UA 4EUEA 1JJ7A 1I2MA 4QYSA 3HE3A 4HH4A 3O2NA 1MRNA 1SY7A 4LNAA 3J7TA 4UBLA 3MT9A 1U0EA 1ZUHA 2FZEA 3IR6A 4G1BA 3WJAA 3PTZA 3BCRA 3SF8A 4X7RA 2XHEA 4H6WA 3I3OA 5L4NA 1KAQA 1HTTA 4X1YB 5EGNA 3LF2A 5FOXA 2C99A 5DTMA 3IDSA 4P83A 2ZPAA 1Z2AA 3LT2A 4I8IA 3GJ5A 1AHPA 5EMKA 3KUXA 3O5AA 4D41A 1Z8DA 4BCCA 4L75A 3L04A 5B1HA 5ESWA 3CTPA 3ITKA 1WA5A 1XRMA 1A9SA 4EAQA 3E22B 3P0EA 3EZLA 1HDXA 4DZTA 3H9EO 2PX0A 4WOCA 1RHRA 2HSWA 2QN1A 5KQGA 3GLHE 4ZIRB 3K2BA 5LXTF 1YRHA 2DCMA 1RXVA 1V0JA 1W1IA 1R0YA 2W6NA 4Z0TA 4UU1A 2P3QA 3EZYA 3PHLA 4QYMA 4WERA 4EGFA 4BX8A 2G4VA 1X15A 2JLWA 1YIOA 3EZNA 4A0SA 4XRRA 5FLYA 3HB5X 3N59A 4P7JA 2EFJA 1OX5A 1QYIA 1B14A 4PZDA 5EJFA 5EI5A 4DBZA 4BQIA 4O2BF 2Q6OA 1GSOA 5IH7A 1A7AA 5D1NA 1NLMA 3KSUA 1NSYA 3NAGA 4OXRA 4PHHA 3KZKA 3WAGA 2AR0A 4YDHB 3QP9A 3OIYA 1VIMA 5A9TA 1YVUA 1XE3A 1RW4A 4R40A 2JAUA 1J2JA 1UJ6A 3PQ7A 5IAGA 4MVJE 4MP6A 1ZFNA 1IHXA 2VI5A 3ITDA 2YWBA 4HVCA 4MICA 5EIBD 5IXYA 2VATA 3HMKA 4Q9NA 4TV8B 3RS5A 4TTAA 2V6JA 3X43A 5KX5A 2AMJA 4RTJA 1I5OA 2E4XA 2EIHA 4X0EA 1M2VA 4JGGA 5HCNA 2EZ4A 3FMPB 5HEKA 4XYBA 3WNBA 3W5IA 4F9FA 4DQ0A 4C7XA 2Q1SA 2ZRMA 3EPKA 2O8CB 1UKEA 3B7PA 1L2TA 4XPIA 2IPXA 1ODJA 3MA0A 3QPBA 4GKAA 4P32A 2DWOA 1BEEA 5IAKA 5B3JC 1ZNWA 5AJTA 1ZK1A 4XEHA 3KYDA 3AEXA 4X6LA 1SB8A 3DPUA 3I72A 1LA2A 1MRSA 4PLPA 2WM8A 1RP7A 5JPIA 3SYTA 1YKGA 4BJ3A 1SXHA 4GOXA 4EMBA 2NZUG 2Z6AA 3SWWA 1A9OA 1QZTA 2P9HA 1R27A 2PAAA 3B2NA 2EW2A 3RS8A 4B31A 4EJSA 5FOQA 1GZ3A 3A4MA 3OETA 3Q3EA 1ISSA 2IYOA 2EAUA 3BS4A 3D8RA 3OZUA 5DRTA 2BDTA 1EFHA 1JDVA 4UEWA 4X5OA 2CXOA 4E22A 2B21A 2YQZA 2Q3MA 2FJUA 4RPKA 5L45A 1NNUA 1V11A 1Y6FA 3L8ZA 2ZTVA 1NHWA 4JP3A 4HLUA 4M7OA 5CB8A 1LW7A 1JU4A 1UK7A 4I1SA 2J07A 1S1MA 1JF8A 4KUHA 3R9IA 3FKJA 3JYHA 4EHFA 2UYGA 4W82A 4WNAA 3QRWA 4CMHA 5JAPA 2XYRA 3UAXA 3D43A 3JATA 1WY5A 2WA2A 2C5GA 3DE4X 2YCLA 4ILKA 4WXEA 1RSZA 4XUEA 2XT0A 4BLOA 3JAMA 3TAXA 1BJRE 1QWSA 4NESA 3C3DA 1KI3A 1ODLA 4CCSA 1A71A 2OHFA 2W2VA 3H84A 1SEVA 1WUYA 1C9KA 4H7KA 1RE0A 3TXAA 4CT4B 1UWCA 2PX5A 3DE6X 3T06B 1ZITA 3IDOA 3WMEA 721PA 5EL0A 1HX7A 4QHSA 3FWZA 2JARA 3ESXA 5FBWB 2SHKA 1KAMA 3O84A 4B2LA 4IGAA 3DOIA 4R69A 2CLIB 1BWQA 3C3XA 4JVNA 4QXQA 1XX6A 4B1FA 3CH7A 3E3OA 1Q6YA 1Q1GA 1B0ZA 1ZN8A 2I2DA 3FPKA 3GLIE 2JGDB 1ZEMA 4GBGA 3Q1KA 4JA2A 4YIHA 1MABA 1KZ4A 4JWKA 4MKHA 1TZ2A 1UBRS 2AL7A 1VRWA 2UZAA 3BVPA 4U7WA 4UUMA 2XV1A 4BMOB 5CDHA 2A0XA 3DHWC 3N6VA 2DC1A 1I94B 3AESB 2DP4E 4OLHA 2PFSA 3IULA 1R6AA 2GXAA 4U1RA 1TYBE 1UPAA 3LFUA 3MEQA 4P2BA 1EFVA 4Y8VA 3WI7A 1MAUA 2QVYX 4CF5A 1I24A 1Q1AA 4KQKA 1QH1A 4ZZ2A 2AB0A 1LDGA 1Z4KA 2X5JO 1C1XA 4RE5A 4XCQA 1J0BA 3T3EA 2O3JA 2EF0A 3FSGD 4DY4A 5JASA 3WLIA 2OD2A 4EARA 5AH0A 1WSDA 3URKA 3G02A 3ZWAA 2H4HA 1P73A 2A9KA 1RZ3A 1GU1A 2JD1A 3CLVA 1BHSA 4H4CA 2BE7A 1KDPA 3Q7RA 4KNVA 1IWOA 3DMTA 3UANA 3WLEA 4EQ6A 5IS2A 1HYEA 2BFMA 3BTSA 1XMQB 3B70A 2JA2A 4E3WA 1ZN2A 1VE7A 1XEWX 2YRXA 1RHMA 2Z95A 4IZ6A 3LK7A 2BW0A 2D0IA 3PRJA 2BP7A 3GGSA 5TX7A 3G9UA 3UOAB 1FNDA 1D3AA 4EYSA 5L3SA 5HFJA 4RWEA 4DB4A 1M6VB 1A8QA 2RHLA 4FEYA 4ND2A 4E2ZA 2JGKA 2VTKA 3EIXA 4RD6A 1SM4A 4IRUB 2EKBA 1GKKA 2HBYA 1WR8A 1KHTA 4QU0A 3HJFA 1Y1QA 3T3MB 1SCDA 2E7ZA 4HNGA 4RW0A 5IJ0A 1BMQA 2WA1A 5GPBA 2I7XA 4F2WA 1FMCA 4GLLA 3VR5H 2Z3WA 2XZOA 4UBJA 4KXQA 1OFTA 3C24A 3N2GB 1ZU5A 4GNKA 4J16A 4XASA 5F9MA 5C51B 2PKCA 1QG4A 3MCZA 3ETGA 3U4MA 2GZ3A 1IUKA 4L16A 5AVYA 2YTZA 1XU7A 3FKQA 3FRHA 3MPOA 1FFAA 1KO5A 5K2OA 3ZE8A 1Q83A 1UQUA 3E9QA 3TQQA 4HGRA 2FFJA 2ZB3A 3AOEA 4EGAA 8AT1A 4F8EA 2FPIB 4MKFA 4Q0MA 3CB2A 3KCQA 2PSJA 4KG7A 5TGDA 1U0NA 3A4YA 2OB2A 1ODFA 3FPHA 1X7HA 5K3BA 1Q14A 5TPZD 3JASA 1D9ZA 3BGIA 3R6TA 2BM0A 2RG7A 3L0BA 3CX6A 4GYWA 4BGIA 2FYTA 2WFLB 4M7PA 3I53A 1KARA 1UWKA 4A2WA 4E3ZA 5J1TB 4G8CA 3I09A 4EW3A 1SH7A 2YMMA 5L51A 3P32A 4ZT3A 3KRTA 4Q4LA 3ADDA 2DETA 1SMKA 3G6KA 4UVEA 4IWXA 3SLKA 1OGYA 1E3WA 4NG4A 1UZLA 2ZTMA 4KLRA 2PZKA 3QLTA 1D2CA 3MJCA 3DMNA 1F60A 3NOQA 5BMVA 1GFZA 4I9FA 3T9EA 5CG1A 3BRCA 1NUAA 2YXPX 1P31A 3EGXB 3O4VA 5EPEA 3SHWA 2BJWA 4E94A 4LN1A 1Z74A 2G6BA 2CNNA 3G2JA 5LUAA 4IXMA 4Q9HA 1G5HA 1N3LA 2XYHA 3LA8A 3EXHB 5BQFA 4WXYB 2QSUA 1U3TA 3MAGA 2CFTA 1N1GA 1VE9A 2ZITA 1A5SB 2ECQA 5TE9A 1BXRB 1BWPA 2AN3A 1UJNA 2HXYA 3B5EA 1M3SA 3PQ5A 3RYCA 2ATXA 1Z26A 2B2CA 4AXBA 4BY9E 2OORA 5D51S 3ST7A 5I8PA 3CY6A 1ISMA 3PJFA 1ZU4A 5JC1A 1FFDA 3E35A 2AR7A 1WUJS 4G0QA 4LUCA 4HX2A 1N1MA 4IDCA 5BVGB 3JZIA 3GJSA 1KZ9A 1B8OA 1N7IA 1X86B 2LVBA 2O3UA 2QRPA 2YCBA 3FBWA 4HN4B 4XM2A 5FNZA 5BYBA 2P77A 1AGNA 4AX8A 3CUSA 3ECSA 1U3CA 2XDWA 2FN4A 3EQ9A 1WG8A 1OLSA 4MKGA 2IPLA 2W2PA 4AN0A 4OB8A 4IJUA 2Y05A 1TVKA 3I4LA 5FWNA 2D3WA 3QPUA 1XNQB 1GVNB 4JVLA 3UGTA 3V2IA 1MOPA 5LXTB 3RFFA 4OHVA 5DE3A 4NE9A 1E8NA 3UAVA 2AEEA 1V6AA 4BIIA 3UH0A 3OOYA 4ENPA 2FEMA 2AFVA 3PUYA 1GNTA 4CFSA 3EUFA 3PZBA 3CKMA 2P9BA 3RHZA 5JQWA 4BXOB 2D5CA 2VN8A 1UM8A 3I6MA 4MRVA 3RUAA 4J0EA 3Q8KA 1XEXB