5E4FA

The spring alpha-helix coordinates multiple modes of hcv ns3 helicase action
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Spring alpha-Helix Coordinates Multiple Modes of HCV (Hepatitis C Virus) NS3 Helicase Action.
pubmed doi rcsb
source organism Hepatitis c virus genotype 1b (isolate con1)
molecule tags Hydrolase
molecule keywords Serine protease NS3
total genus 150
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5e4fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5e4fA01
1T3HA 4PPFA 4D4JA 1WB9A 4LBZA 3CX8A 3I1FA 3O8RA 1UBEA 2NGRA 1IN7A 3DKVA 1NJGA 3I72A 4XWAA 3A37A 4QBIA 5TDHA 3WHKA 1Z06A 4B43A 1Z6YA 2OESA 3NG1A 1KZGB 2YVUA 1ZUIA 3QXSA 2FFQA 3P4YA 4NYMR 2GAOA 2IHYA 4FN5A 5E3HA 3LLMA 2O8CA 3HR7A 1XCGB 4HAXA 3FVQA 3GLFB 1KDRA 2F1IA 2KB0A 2ZI4A 1RKBA 3WYFA 5JSZA 2BBSA 2ZJ5A 5EP3A 3ICEA 5DO9A 2IA5A 3VU9B 4C0JA 4JSTA 1XTIA 2XGJA 1ANKA 1IQPA 1NRJB 4N3NA 1GOTA 1XMJA 4TZ6A 2JATA 5BN3A 4TMZA 4JYBA 2IF2A 2GJSA 4I1SA 3BFVA 3C5CA 4NHOA 4DLSA 5FPKA 2W00A 4M1OA 3BS4A 4JL6A 4ESHA 2OFWA 2XB2A 1A5TA 1P61B 1FQJA 2CBZA 2R6CA 3EAQA 1FMLA 3QKRB 3L8ZA 4QGGA 2IS4A 1XPOA 4IOJA 4UXJA 1GUAA 2GTPA 4R9UC 3O8DA 2IS6A 4B3GA 1CTQA 3G0HA 1KI8A 2ZSFA 3PEUA 1T0HB 4GDFA 1QVAA 4LGMA 1ZNZA 3RAPR 5IDVA 3UWOA 4GP7A 2GVZC 3SJAA 5AK0A 4S35A 1JQJC 2A5FA 5GVRA 3RDPA 3VX4A 5JWOA 2ZAMA 4PSAA 1W46A 1NY6A 2F1RA 2ZRFA 4NL4H 1NJFA 4JVMA 3Q72A 4C0HA 1W0KA 4D4KA 1NBME 3FYHA 4MH0R 4TQUS 1T8TA 3EWAA 2VHQA 1KAGA 2EWVA 4UNRA 2H5EA 3K0FA 1UKZA 4PO9A 2O8BB 2C9YA 2ZE5A 1GRQA 3MLEA 4GP6A 2F43B 1JEDA 1FTSA 4RD1A 1GAJA 1XB2A 1CF4A 2VLIA 4TYWA 3WP0A 3CRW1 4AK9A 3ZGXA 4GZMA 4Q9IA 5G41A 3ZS8A 1JPJA 3EASA 4XVUA 1H8HD 3IEUA 1QHYA 3O8BA 3RRNA 3CRMA 4NYJR 2ONKA 4CEIA 4JLMA 4DEXA 2IYVA 5CK4A 4D0GA 2JDID 1W4BA 4GT1A 4JJKA 1DAMA 2X77A 4BRWA 3CF2A 2GCOA 2ZSEA 4LDJA 2V3CC 3L0OA 1HT2E 1G7CA 1DAIA 1K5DA 4JLDA 2VP2A 5DLQC 4FCWA 3ZVLA 4D2IA 4MA4A 5TARA 4ZIRB 1E96A 2XNDD 4Q66C 1XEFA 1RYFA 3THWB 3RABA 4WOPA 4JBWA 2X2FA 1W4AA 5FTNA 3I5YA 4Q1AA 1YVDA 2J3EA 5FBQB 1L8QA 2FJUA 5KYKA 4XD7D 2P5TB 1KHTA 2J41A 1Q20A 2FNAA 4TMKA 3EPKA 4FW9A 1SXJA 3PR1A 2A9KA 2G88A 1PVOA 1E2EA 2QPTA 4BLSA 4TT3D 4CEJA 2CXXA 1HEIA 4QGFA 2WZQA 3TSOA 4OHYA 2IW3A 3JVVA 1U8YA 3IDQA 1HTWA 4GRAA 4KCGA 3THXB 1UJ2A 4B3BA 3O8CA 4MUAA 2H16A 2CMKA 2R6GA 1FPMA 2Z4SA 3LRPA 3LY5A 4DBLC 3R7WA 5JECA 3KXKA 3NBFA 3OHMA 2XSZA 4IDHA 3RVBA 1CJVC 4PAQA 4B75A 2QAGA 4LYFA 1E9FA 1G3RA 1SKQA 4TMXA 4BLOA 1C9KA 4D26A 4E07A 4Q1EA 4B47A 2QG6A 2QM7A 3VNVA 2CLDX 1XTQA 3CIOA 1H8ED 4O25A 4GMDA 4QG7A 5KUTA 5KDOA 1XXHA 2IC5A 1NVUQ 2VPPA 3QKSB 4RZUA 4WAUA 5CDFA 4GBMA 4YDSA 3KUDA 1R5OA 5KDLA 3HPRA 3PEVA 4JT2A 4AIIA 2IUUA 1JBKA 2NQ2C 121PA 4B6FA 2GBLA 3L0SA 2KBEA 4OQXA 3E2IA 621PA 1UAAA 3T06B 1SGWA 3IBYA 4FMDB 1OKKA 1NSFA 1E9SA 1NVWQ 1LS6A 1DBSA 4AC9A 1CJUC 1T4GA 1P73A 3PFIA 4QXAA 1X8LA 1ZM7A 1OFTA 2BWJA 4BUJA 1R8QA 4LJ6A 3R9WA 4QHYA 1R6BX 2HCJB 1X86B 2FZ4A 2GDJA 2O0JA 2ZVQX 3A36A 3ZZUA 4OI0A 2PX3A 2Q3MA 3SR0A 3KKOA 1PLKA 1ZNYA 5KO2A 1KZ7B 3OAAD 4DSUA 2VL7A 1KSHA 3SN6A 1PLLA 4OQNA 5FI0B 4E09A 2O52A 3ASYA 1G7RA 2WJGA 1J2JA 3RHFA 1CJTC 3LLUA 2FE4A 3QXXA 4AURA 1KO4A 2FGKA 1J90A 2JLVA 1TQ6A 1Q12A 3K0CA 4Q4LA 2IXGA 4Q02A 3RS2A 4IDOA 1ZM3A 2CE2X 1CIPA 2GNOA 3MD0A 4JVLA 1QZXA 2P2LA 3ZQJA 3Q7QA 4BRUA 1N6KA 4NCJA 4A92A 4US1R 4DT1A 2NO0A 2ODEA 5FUYA 2H18A 4QC2A 3MMPA 2K5UA 2Q0HA 3BB3A 4ZIRA 4IVQA 1QBKC 2EWWA 1G64A 3BK7A 3KX2A 4FINA 2WKQA 3IILA 2TMKA 2AWNA 4LBVA 4Z54A 4MGYR 3T12A 1GM5A 4F91B 5JHGB 4EFMA 1G9XA 2ZI6A 2C03A 4JLAA 2J0UA 1RIFA 1XJQA 4YC7A 1OE0A 2ZEJA 5B57C 2YINC 1S0UA 1JR6A 3P1JA 1F2TA 2WV9A 5JCZA 2OZEA 4MYHA 2ZETA 4KSBA 4PQYA 2IS1A 2D4HA 2FSFA 2OBLA 4DDVA 2O8BA 4DCVA 4LWZA 2WAYA 1N0UA 1OF1A 5KSPA 1Q22A 2XOKA 1MH1A 2G77B 4DLRA 2GXUA 1N6NA 4GFDA 4DC9A 1BMFD 3CUEF 3AVYA 6Q21A 4Q4JB 4OI1A 1E9BA 4ZDJA 4KXFB 5JJLA 4M0LA 2RGNC 1X1RA 3K0EA 5LD2B 1Q3HA 1SVKA 1W47A 1M7HA 2BCJQ 2W6JA 3ECCA 1Z2CA 4FMBB 4EFNA 1UBGA 2FU5C 2P65A 3HDTA 4O2LA 3EWSA 2V55B 3K70D 3IHLA 1NY5A 1VCOA 1UKYA 1DE0A 2RGEA 1RRFA 3Q7PA 1LTQA 1QVRA 4P4SA 1QF9A 4YQFA 2D62A 1XCMA 4BZXA 2ZYVX 2ZJOA 4I1OA 4B34A 4LJ9A 2P6UA 3LQQA 3HU1A 5CB8A 1BMFA 1LS1A 2GEDA 2VHCA 4BFXA 3AM1A 2CHVA 1NN3A 2JA1A 1QHIA 1ZNXA 1Q57A 4GI7A 1Z6XA 5JS7A 1G5TA 3NVAA 1F2UA 2XZOA 2BEKA 4Q7MB 3VQTA 1AQUA 5AR1A 1Z0IA 2WWIA 3WNDA 4G0NA 2ZU6A 1G5PA 1N6IA 3WP1B 1SXJE 3FHCB 4AYXA 4DLTA 3F5FA 5F9HA 3A1WA 2QBYA 4AG6A 1G8HA 1OH5A 3FHTA 4XVQA 4K8OA 1W5SA 1JECA 2HEIA 1OHHA 2ZRDA 5J40A 4ABYA 1VG8A 4P4SB 3B1WA 3DM5A 4ZI3A 1CJKC 1E79D 2QT1A 4A1FA 4C30A 1JJVA 4ZPXA 3RS4A 3WXMA 4EPYA 5G3YA 2N42A 3NWJA 1E69A 4RZ2A 3H0KA 3LXRA 3CZPA 1XZQA 1YR8A 5AUNB 4AKEA 2GF0A 3GLHA 2ZSAA 4XH9B 4XWKA 1X1SA 1BO6A 2HLDA 2ZS8A 3MRSA 1KY2A 4Z8YA 2RGXA 3V4FA 2REXB 1T3LA 4NDZA 4TYYA 4MGKR 2Q3FA 3KQUA 1R0YA 3ADDA 1KYIA 1O3YA 3B6EA 1A1VA 2QRNA 3DMNA 4LV6A 3GFOA 4A6XA 2P6NA 5EE9A 2GK6A 3QG5A 4A8JA 4M1WA 2PX0A 4LYJA 1TUEA 2O5VA 1XMVA 2HDNB 2WOOA 4BLTA 4UQOA 1VIAA 3HU3A 1PUIA 4M9ZA 5E4FA 3R9IA 1L4YA 1DELA 1JXOA 3TH5A 2P5SA 2NO9A 4P0TA 1KJZA 4KLNA 4LX0A 3TQFA 3WYAA 4EPTA 4A2PA 1MABA 521PA 2EYUA 3GJXC 3KJIA 3DEFA 1P7CA 1OXXK 4QBGB 2ORIA 4G5OA 4WZBE 2JLUA 5KDDA 3LAWA 3W6PA 3NDPA 2QSYA 1GSIA 4XTCS 3ZQ6A 2EYQA 4CEHB 3PG5A 1ZNWA 3GLHB 4GOKA 5DE3A 2PLRA 4Q47A 1XRJA 3W8RA 4ZKDA 5KSZA 3ZZTA 3V00A 1NG9A 2ZUDA 2J1LA 3DMDA 4TMVA 4DLXA 4M21A 4DXAA 4IVRA 1VMAA 4HDQB 2ODNA 4URXR 5EE1A 4F4IA 3CZQA 3QPWA 1T91A 2A78A 2NTYC 3TUIC 3IBGA 3I8SA 4B76A 4LV5B 4RD4A 3GCGA 4ZO4A 4EJSC 1E2NA 2BM0A 3FKSD 3CONA 2YZ2A 2F43A 1BYUA 3GEIA 3U3OA 3U44B 3TUZC 1OYWA 1R0XA 2V7QA 1DOAA 2JAQA 1JAIA 3KQLA 1U9IC 2XSZD 3SI7A 1GNPA 3BD9A 3I92A 4RJLA 2ZRHA 3PCRB 5JLJA 5KPJA 1QRAA 3DHWC 4KFRA 3U4QA 2PT7A 2NZ8A 4Q00A 5FBRB 3L43A 2QAJA 4BLPA 1XP8A 1XD9A 3PUYA 4Z8XA 1IN5A 4LC1A 4BQSA 1D2MA 5L3VA 2PEZA 2WMOB 2UVQA 1RRPA 3A58B 1ZBDA 4W5WA 2YKGA 3MCAA 2ZR9A 1U94A 2F3TA 5CYPA 4G5GA 2FFAA 2HCBA 1COWD 2YWEA 4YDHB 4B3CA 1ZU5A 2LWIA 4ON9A 1LF0A 4H1UA 1AK2A 2WKPA 3AH8A 4QFMA 3SJZA 3DVLA 3I3SR 1UBCA 4NZYA 2YC4C 3BC1A 1E0KA 1BYIA 1YZKA 4I1VA 1KI2A 3QVVA 1VHLA 1E94E 2WIBA 4TYPA 2AWOA 2QMEA 4WVFA 1CRQA 1IOZA 1IY2A 3U7FB 2BHRA 2IYZA 3RWMB 1S8FA 3LX5A 2JLXA 4DUGD 4IEEA 4TYNA 3EIHA 1WP9A 3D6TB 1R10A 1TNDA 1W49A 4UXIA 4Q1CA 3KFXA 4D6PA 1M34E 1FX0A 1M7BA 5BYJA 1AJEA 4B3XA 3LV8A 3B1ZA 1XX6A 4M1KA 4RKEA 4DDUA 2CLCX 2WPDA 2GESA 1DAHA 3QKTA 4A82A 1E2HA 4L16A 2XTZA 2SHKA 2ZJZA 2MSCB 1WBDA 4NP6A 2BBOA 1E0SA 1L2TA 2V8OA 3RRMA 4P31A 3BBPA 2J0QA 1Q21A 5DHFA 4IJMA 2NPFA 4NCNA 2FV8A 5FPTA 5DYGA 221PA 2ZI3A 3IO3A 3LO5A 3H84A 2GCOB 3RANA 3AVUA 1T8UA 2VYFA 4DLVA 1A7JA 1MO5A 4AKHA 4UKDA 2FSHA 1XD8A 2OILA 4HYYA 1R5NA 5GJVC 4R71A 1YRAA 2RHMA 4MGZR 2P0EA 1R8SA 2VSXA 4UNPA 2JLWA 5E7IA 1OB2A 4QL3A 2ATVA 2CHGA 2UZIR 2VHJA 2IEYA 1G6OA 4RFSB 4R2IA 3IKJA 5DHAA 4CEIB 2JJ1A 2UZ3A 2WWHA 3IHWA 3G82C 1GKUB 4JKIA 1ZC4A 1ESMA 4LJ8A 4NMMA 4V03A 4Q9JA 1KSJA 2XEXA 4LRWA 4TL9A 4BFZA 2BJWA 2XJ9A 3FGNA 3FB4A 4PZLA 2R8RA 2C9CA 2ODWA 5EZ5A 1YZUA 3CH4B 2XOKD 3LVQE 5FPHA 3WBKA 5H8WA 1AGPA 5KSYA 2RGDA 1B23P 1P9WA 3KDSE 1E2KA 2CEAA 1XJ0A 1UFQA 1SXJB 3D31A 5BXQC 3SQWA 3U5ZB 1US8A 4S2EA 5HR5A 5IT5A 4PFSA 4O0MA 1GRNA 3CNLA 1IONA 1G8GA 2QQEA 2GCNA 4V0KA 2HXSA 4OL0A 3VR4A 2KI5A 2QTVB 2G1KA 1W2HA 1N5KA 2GF9A 4QGAA 1G17A 3BRWD 2B6HA 3N2IA 4TYQA 5D3MB 3T1QA 5JHHB 1KAOA 1W0JD 1AKEA 3AP1A 4M8NE 1LNZA 2J46A 2XNSA 2OLKA 4PHFA 3FKQA 4DB4A 1DEKA 3LBHA 4Q4HA 3U3KA 1CEEA 1VG1A 4V0ME 2H1LA 5LD2C 3OE7D 1PLJA 1E2PA 1EESA 3CPJB 3QY0A 2D2EA 4ZCIA 1VPLA 1W36B 4B73A 2V1UA 2DR3A 3U2QA 4TL7A 3U3JA 3Q8XB 3ZYCA 4DLWA 2KJQA 4KVGA 3LDAA 4F7WA 3VHXA 2V6IA 1XFAA 1G18A 1UM8A 4KYIB 4QM7A 4DJTA 4EQ6A 1S96A 5KTYA 3W90A 1G41A 5LB4A 3LVRE 1Q1EA 3EPLA 2W58A 2FFBA 4EPXA 4US0R 3NHAA 1S1CA 2ASEA 2IYRA 1ZM9A 1KOFA 2WM9B 2RGGA 1N0WA 4NH0A 4ZKEA 3S1AB 3N2EA 1U8AA 1Z8FA 5E7MA 5FOVA 4NCHA 2JASA 2RMKA 2QE7A 2VRWA 3W8NA 2QMHA 5J4HA 2WVJA 3GPLA 4L15A 4L4UA 3AVWA 1SVMA 3KXIA 1EFUA 2ZRAA 3VR3A 4PO1A 3HYTA 4BZQA 4LBWA 4E5UA 3EZ7A 4LHXA 2QRZA 3T1OA 4RZXA 4WXPA 1RE0A 2VSOA 3CR7A 1G3MA 3WMEA 3L82B 2G9NA 2WWFA 4DKXA 2GETA 4KV9A 5EXXA 4D0NA 3BOSA 1BH2A 3U60B 3H4MA 1G3UA 3QUSA 3NC1C 3SNHA 2ZYTX 4JS0A 3SOPA 3WNCA 3CRQA 1Q1BA 3D8BA 1XXHB 1AZSC 1VDZA 3K9HA 4V0MA 3FE2A 3KL4A 3MJHA 4OHWA 5SZIA 3UG6A 1R4AA 3N70A 2JIZA 4JL8A 3HWSA 2JLYA 1ZCBA 4HB3A 3I62A 4UNQA 1J99A 4C0AC 2H17A 1KMQA 1KI1A 4B32A 3K53A 3A6PC 4BFYA 2GXQA 3LWNA 5KNCA 2LKCA 1Z28A 4QJ5A 3BXZA 3SJCA 2NOAA 5H1YA 3W6OA 5FPSA 1F5NA 3TAHA 1UDXA 3EC1A 3K0FB 3FOZA 3M6AA 4HAUA 1G19A 4XSGA 3OIWA 3RNLA 2VSFA 4NYIR 1A2BA 2ZR7A 2BOVA 4PSVA 4A2QA 5JSZB 3KQHA 2VQSA 3GEEA 1VG0B 3ADCA 1Z07A 2BC9A 1F6BA 2R2AA 2GA8A 3LH5A 4MYTA 2A7QA 4HAYA 4W5HA 2VF7A 4BECA 4M22A 1G8PA 2FGJA 3THWA 2ZRBA 2ZRNA 2ZM5A 4LJAA 3AUYA 1W7AA 2ZTSA 3KQKA 4M53A 3W5JA 3Q85A 1P2TA 4B44A 2W6IA 5J4VA 4Q4AB 1W2GA 4X8LA 1VKJA 2NO6A 5EQTA 2R65A 5LDDC 3DM9B 3C5HA 4FMCF 2EFHB 2OCPA 4QNRA 4JLPA 4HAWA 1MABB 2Q9AA 3BH0A 1A82A 3CPEA 1YZGA 4YMTA 4QGHA 1G16A 3NBXX 1X8KA 2ZYWX 3FKSA 1CR0A 3QPVA 1E2JA 1U90A 2GEUA 1E2MA 1W1WA 2ZSBA 3K0SA 3C14C 5TV2A 4GPTA 5JRJA 1XEXB 3AB3A 4BWYA 1LY1A 4N1AA 3K9NA 4RKFA 2IUTA 4AYTA 5EE5B 2ANCA 5J4LA 3NBZC 3PEYA 1FP6A 1NP6A 1XD2A 2A30A 2W0SA 3GQBA 2QGNA 3SC3A 3VKWA 4EQ6B 3U3MA 2V1XA 3QI2A 3TIFA 3VR2A 1G1MA 2IEZA 2CE7A 2F1HA 3AF0A 5CB6A 3I5XA 5A4JA 2G83A 1GZSA 4LV8B 4C7OA 1KI9A 2ZAOA 2J5XA 4Y0VA 1WRBA 4TZ0A 3I4LA 4P32A 3BE4A 3BORA 1U81A 3K1JA 4KU4A 2O8DA 2QM8A 3JZAA 4A9AA 1WCV1 4F4CA 2AX4A 2EU8A 4PAOA 3QE0A 1QG4A 2VA8A 3NHBA 1PJRA 3TQCA 4BEJA 5BN5A 1FNNA 4OJKA 1G7SA 2F55A 4GNKA 1EFRA 4TLBA 2FEMA 4URWR 4EIWA 5DGXA 3AVOA 2IXEA 1IJEA 1HH4A 1LFDB 1YE8A 2WBLC 4HUQB 1F3OA 1E4VA 2QORA 3HPQA 4JVSB 5FR1A 1GVNB 4G5QA 3C15C 2NO7A 3SE0A 1Z0FA 1X3SA 2XTNA 3KXLA 3QNUA 5FTLA 2OCBA 4OKSA 4CIDA 2JLSA 2YYZA 4FWIB 4NE2A 4A8JC 2AKYA 5HPYB 5C46F 2CDNA 4URVR 1RW4A 4IOKA 3RRYA 1N3BA 1OV4A 4OK5A 1Q0UA 4KODA 5FFMA 1OW3B 3ZH9B 1EFRD 4ZV4A 4D25A 1M74A 2HT6A 4PHTA 4I99A 2L0XA 1SVSA 2D2FA 3BAFA 2ZROA 1PV4A 2B8WA 3U7GA 2AFIE 4DCUA 3CH5A 1HA3A 4G01B 1NNEA 2DWOA 3ZIAA 1YZTA 2CL7X 2QEQA 5K8UA 4UJ5A 3HR8A 4PHGA 3FHOA 4NCIA 3OIVA 3A4MA 4AG5A 1GRRA 1EX7A 3PVSA 4AWXA 1II9A 4XSHA 2GXSA 2ZRLA 3E5HA 1FOEB 2ZE6A 3TW8B 3X1DA 5L3QA 1ZIPA 1Q3TA 5CLQA 1ZINA 3SHFA 1K6MA 2QY9A 5IK2A 4Z1MD 1NLFA 1V5WA 4DVGA 4FI3C 3RS0A 1MO6A 4MDEA 5BYKA 2DFLA 3VU9A 4OK6A 1P72A 2YV5A 4HI0E 4I81A 4MQBA 3IQXA 2GBLC 1W0KD 3WMGA 3HP1A 3PITA 3KZ1E 2BMFA 3AVXA 1KK3A 2O8EA 1NBMA 1TU4A 4PO8A 1ZYUA 1KNQA 4LJ4A 4JLNA 4CT5A 2Z4RA 1NLYA 1OPXA 3X1ZA 3CB4A 2CNWA 1OH7A 1QG2A 1P9NA 2NG1A 2ZRCA 3GD7A 4L9WA 4URZR 2ZUBA 3IUYA 2ZI5A 4TSFD 4B48A 3THYB 1JXMA 1KIMA 2W6ID 2W2TA 4DIDA 1SQ5A 1QHSA 4F93B 4AKIA 2OXRA 3UWKA 5D3QA 2B92A 2E87A 2BMEA 2ZRIA 4BZPA 1HUQA 4PHHA 4CEJB 4FWTA 3P26A 1FW6A 1S9DA 4GSYA 1OXTA 1FP7A 4F92B 4WXRA 3U6KA 3LQRA 3ZZ0A 3QKUA 4I1UA 2Y8EA 4B35A 3IQWA 4DWJA 1AS2A 1NVVQ 2F3RA 3GJ3A 2BCGY 3W6NA 1II8A 4PC6A 3PENA 4MKHA 5A5GA 1C1YA 4RD2A 1XMIA 4RSGA 2FZLA 3QXJA 3AVVA 4TSFA 2DB3A 3I8XA 2A5GA 3GLGB 1V43A 5JZVA 1W4CA 3OE7A 2VTKA 2G0NA 1ONBA 4Q9HA 4XD7A 3GJ0A 4Q19A 2OUKA 4Q01A 4B2LA 2OBNA 3M0EA 4HLDA 4F4JA 1KDPA 2BKEA 2BKUA 1FMJA 3THOA 3C16C 4B71A 3DZ8A 4JMPA 3RRZA 3D7MA 4OI4A 2AXPA 2H7VA 1VHTA 4U00A 3LXXA 1PZNA 2H8KA 2WHXA 3EPJA 1ELOA 1TL7C 4LCBA 3QVUA 2O8FA 2Q6TA 1E9DA 4XTRA 4Q1BA 4Z1MA 5BW8A 1OJLA 1Q44A 1ZUHA 4KFUA 1ZMXA 4WZAE 2GHIA 4B74A 2AD5A 2QU8A 3AUXA 4LK2A 1QHGA 2J7KA 3B78A 4Q4HB 5FBVB 3VKGA 4N0DA 3QIAA 4TMTA 1ZD9A 2ZQ5A 5EP4A 3ZVRA 2QPOA 3B2EA 3P32A 5EUMA 4OHVA 4BFTA 2PZFA 2C78A 1K8RA 2IYXA 3C4JA 2YOGA 2VO1A 3FWYA 2CJWA 4V02A 4C7OB 2ZS7A 2YWHA 3SJBA 3B13B 2PJZA 2ONJA 2J7PA 2JJ2D 5IF9A 5TB5A 2YC2C 4GMXA 1JPNA 1NIPA 2O0HA 1IM2A 1RFLA 3GP8A 3I61A 1GFIA 1G4AE 1YR6A 3AF1A 3THYA 3IIJA 1EGAA 5AJYA 2IYSA 1XEXA 2W83A 3AKDA 3CF6R 3ZD6A 5C1BA 4B2PA 1YR7A 5F9FA 4LJ5A 4NCKA 2Z0MA 4IHQA 4X8MA 2CL6X 1O87A 3IPXA 5TMPA 5DI3B 3QG1A 2ANBA 1I4DD 2GJKA 2ORWA 2QZ4A 2DFNA 4HLQB 3RS5A 4ESVA 1WMSA 1J8MF 1E0JA 5HZHA 2XX3A 3OEHD 4M1YA 4YLGA 1NN1A 3SYLA 4JL5A 4GOXA 5EE0A 2IXFA 4GZLA 4A0RA 1MOZA 4WZ6A 2OO7A 1SVOA 1XBTA 5AJVB 3CW2A 3FTQA 1OHHD 2ZS9A 1NIJA 2A2ZA 4KJZA 1AA9A 3C41J 3KTAB 2YOFA 2QP3A 4FCVA 3QF4B 1FFHA 4BGDA 4YXWA 1E98A 2D3WA 4EPRA 3V9PA 1AS3A 2C99A 3GFPA 2YOHA 2A3RA 1QHHB 3TJZA 2WSMA 5HTKA 1NMXA 2F9MA 2FF7A 1P62B 1G291 4II7A 3EX7C 4QNMA 1E2FA 2X1VA 5DSZA 4ARZA 3QBVA 4RY2A 1I2DA 3AVQA 1E4YA 2QTHA 5EXPA 3TAUA 2XZLA 5M04A 2JLZA 1S1MA 1U0LA 4OYHA 2B8TA 5FTMA 1P2UA 2CCKA 3CWZA 4TLEA 4CF7A 2KE5A 1LVGA 2ZJAA 5HKKD 1P2VA 5F3WB 1UEJA 3TVDA 2OXCA 2PH1A 1E1RD 3MGCA 3PUXA 4TLCA 1S2MA 1IHUA 4MYUA 1SXJC 4MYCA 1E1QD 4TWZA 2I1QA 3SS8A 5AUOB 2ERXA 1XEWY 2ZXUA 2QN6A 4WW0A 4A36A 3SBEA 5FTKA 4CGZA 3L2OB 3U7HB 5L3SB 4NYMQ 3T1VA 4HZUA 2AFHE 3T35A 1KGDA 5B2ZA 1G3IA 5BN4A 4E03A 2AK2A 1UBFA 2ZRPA 1NBMD 4JLVA 4B33A 1YU9A 1QDEA 1R0ZA 3U44A 2KBFA 5DH9A 1A2KC 4DLUA 2Z83A 4W7SA 2CHQA 1W5TA 2VHTA 1RZ3A 5G3ZA 1AGRA 4B3DA 1XJCA 3PUZA 1GDDA 1GTVA 5G40A 4ARZB 1KJWA 4HB4A 4B2IA 4UNSA 5TXGA 3H1TA 3SZRA 4EJSB 3EA5A 4G1UC 2XTMA 3EZ6A 4JLJA 1Z63A 1FNMA 3B85A 4PQRA 1J8YF 3TE6A 1H8HA 2NIPA 1D9XA 1G4UR 4MRNA 2DCUA 1A4RA 1T5LA 2OT3B 3PIRA 3KJGA 5HCNA 2WSSA 1K5GA 1Z0DA 2QT0A 4LZZA 4HZUB 4JBXA 4KBGA 1YHNA 1IXZA 3AKCA 3FMOB 4DSNA 1KDOA 2PMKA 4C0QC 1IXRC 4X8OA 2IK8A 2WWWA 5TVKA 4QHSA 1HE8B 3PJRA 2VH5R 2XB4A 3PXGA 3ZD7A 5L3RA 2Z6VA 3P27A 4C0KA 3OFND 5BWMA 1NKSA 1D8TA 2FX3A 5KU1A 1JALA 4AKGA 4OQLA 1ZRHA 1ZD8A 1OKKD 4D82A 3R9XA 5JS8A 2EFEB 2O8FB 2OBMA 4OI2A 2GVDC 4EJSA 2Q21A 3GJ7A 5P21A 4HDOB 4PPNA 3CNNA 1KMHA 2OCYC 2IWHA 1Z47A 2D74A 3GLIE 1FUUA 1W48A 4EPVA 2NO1A 2RGCA 4KFSA 1U8ZA 5JFGA 2IYYA 2IWRA 3FMFA 4DZZA 4PC7A 4TTRA 2G6BA 3RWOA 1S3SA 2WJHA 3X2SA 2DY1A 1KSFX 3QQ5A 1GL9B 1BS1A 1ZIOA 1DARA 1E9AA 5DN6A 5KNDA 1UADA 3W5IA 3UG7A 4MUBA 4URYR 4KSCA 1GKIA 2DWPA 1D2EA 2F7SA 3AF2A 2IYLD 4QM6A 1N2CE 1ZJ6A 1Z0KA 2V4ZA 1FTNA 3GLIA 2PEYA 4YMWA 3KJHA 3TSZA 2AXNA 4IRUB 4D80A 3FFAA 4HUQA 4HZIA 2HT1A 3K09A 3IIMA 1XZPA 3E1SA 3B82A 1MKYA 3R7WB 2GJAA 5FL3A 2WJJA 3ND9A 4TN1A 4BLRA 4IDPA 5FPYA 4ITRC 1N5JA 5G53C 3MUFA 3WRXC 4XWOA 5J5CA 1IBRA 1DO2A 1H65A 5JCPA 4U7DA 1IY0A 1WF3A 4Q9LA 2EVWX 1ESNA 3BERA 2CCJA 5JWHA 3CX6A 2ECKA 4BFWA 4TTPA 3NBYC 3WRYC 1E2LA 1KTVA 3KKMA 4V0NA 1E9RA 5K8TA 5EXSA 1F2TB 3F0TA 2OEPA 4RVCA 2ZJ2A 2W6JD 2AL7A 2C9OA 2FMXA 3GJ6A 5FOXA 1JR3D 4LC0A 3OEHA 4BFSA 4CVNA 1I2MA 5D3MA 4A2WA 2ZYUX 2I3BA 2NZJA 4ZDKA 2JJ8A 5HZKA 4DLZA 1NVVR 3RSOA 1GL7A 2OHFA 3RSLA 1S9HA 2ZI9A 4W9MC 1KK0A 2WJYA 1SKYE 3QENA 721PA 3X1YA 2OFOA 5HE9A 1CR4A 4PAMA 4HLUC 4QBHA 4YXWD 3ZJYA 3MG9A 1RRCA 4D4LA 5CITA 2FWRA 1YZNA 3JZMA 2JEOA 2JJ1D 3SYKA 3QKSA 2A5JA 3A1VA 5EP2A 3BH6A 4Q4AA 3EA0A 1KI6B 3KKNA 4DCNA 1EG7A 2HJVA 2I4IA 2ZJ8A 3S1AA 1VYTA 1S4QA 3QEOA 3W3ZB 4LUCA 2G3YA 1M8PA 3CM0A 2EFDB 1VCNA 1TQDA 1DO0A 2BMJA 2OM2A 2IYTA 4XIGS 4RCZA 1XMSA 4J0QA 1SVWA 3W9YA 4JIMA 3B9PA 4H9GA 4PTLA 2HF9A 1I4LD 4KFTA 4Q03A 1BKDR 1UKVY 1ZW6A 1WQ1R 2FSGA 1HY3A 3NH6A 1M2OB 1UPTA 3TR5A 5EZ6B 2HLDD 2J0SA 4A0HA 1QHNA 3OFNA 5IK2D 3QBTA 3DO6A 1COWA 1XTKA 1L7VC 4YMUA 4NKRA 2OSBA 1XNJA 2UKDA 2WPDD 1E2GA 3C7KA 4G5RA 4Q1FA 3VR1A 3PV0A 4ZCMA 3VNUA 1N6PA 2GEVA 2V9PA 3LBIA 1G8FA 3BFKA 3ADKA 3VR6A 5E7JA 2V6JA 4DSOA 5GVSA 3QF4A 5AUQA 1EWQA 4M2LA 3AVPA 2VP6A 2FA9A 4LHVA 1F48A 1B0UA 3R20A 4N0EA 4BFUA 4DDWA 2ZRGA 1SVLA 3VMFA 2BJVA 2G1JA 2XITA 1G5RA 3QEJA 3O47A 5L3QB 1E32A 5CJ2A 4AD8A 2Z5FA 3C8UA 1CU1A 3NIBA 2X8AA 2WWGA 5FBWB 3V4RA 1S3GA 4ACBA 2C95A 2C77A 2ZR0A 4EDHA 1VYVA 1IJFA 8OHMA 1T0JB 4MITA 1CS4C 1HURA 4NTZA 3EZ9A 4LJYA 5B58C 1JAHA 3QSYA 3SQXA 3HJNA 4DCTA 2KSQA 1KO7A 2CL0X 3IO5A 3SBDA 1VTKA 3L8YA 3AGQA 3GJ8A 3E70C 2BEJA 3EZ2A 4M1TA 4JLKA 4MKIA 3VKHA 3FPAA 4M1SA 4JYCA 1N5LA 1TEXA 1YZLA 2VEDA 1W36D 3RC8A 1TX4B 2FG5A 4L9SA 5CIQA 2MSDB 2IT1A 1TAGA 3FDIA 1TF5A 2WWYA 2HV8A 1E9CA 4JKYA 3K0CC 3SEAA 4DDTA 4C2UA 1IXSB 4IXNA 1EFCA 3AF4A 5TY0A 4A15A 2D06A 4PC2A 1W44A 5SZKB 1KMHB 3MWYW 5J4KA 3NC0C 3T5DA 1VCMA 3B9QA 4NONA 4NPHA 1AZTA 1KSGA 1C4OA 1Z29A 2Q3HA 2F1JA 5C4GB 1M1YE 1DVRA 2J0UB 3NEYA 4P4TA 1DADA 3B60A 5KOYA 1CULC 1E99A 4WBSA 1EX6A 1Z5ZA 2DHRA 4HATA 2BBTA 4DSTA 3TKLA 1TQ2A 2CCGA 4QJ3A 4DB2A 3SFZA 2ZVPX 5SZHB 3U3RA 4HUTA 4MRVA 4PZYA 3NTUA 4BPBA 5JBQA 1GG2A 2ZE7A 4B3FX 3CBQA 3UATA 5EJEA 1Q1ZA 1X8JA 1J70A 1TPZA 3TUJC 1I4TD 2YNMA 4HAVA 1XPRA 5JJKA 2R9VA 2WJVA 5K8IA 1JEEA 3T15A 2FFHA 3QOFA 1R5BA 4M1MA 3ZS9A 2JJ2A 3B1YA 2LCFA 2J7PD 2P3SA 3F3YA 3GFTA 1QHHA 4QOSA 3MJRA 3I32A 2C2HA 3EIQA 2BM1A 5B64A 4URUR 3A1SA 1TMKA 5J47A 1U2RA 1FL9A 4KI0A 2V54A 3AP3A 4PC3A 4HB2A 1ZM2A 3UIEA 1II0A 4X8HA 1CJMA 4R7ZA 2HF8A 3BJIC 1OFUX 4JVNA 4C9BA 1FUKA 2D7DA 1JI0A 1Z6GA 2Q9CA 2RH5A 5DYIA 2QAGC 3GLFE 2OFXA 3TR0A 3GJ5A 3R8FA 5JRZA 1DAFA 4DLYA 4FCTA 4MRSA 4CYMA 5LPNA 4NU0A 3VTKA 4C3ZA 2XZPA 2VP4A 3OZXA 4LOAA 5FUWA 2ZSDA 3ZVMA 1ZP6A 3UANA 1YRBA 3PUWA 2P67A 3DL0A 3BH7A 1E2QA 2GRJA 3SDZA 3TGPA 2CK3A 3GJ4A 2H57A 2XAUA 3OEEA 4PX9A 3D3QA 2R6DA 4LPKA 5AJXA 3LNCA 4LHWA 2XXAB 421PA 4TTQA 3QXCA 3G5UA 1SVIA 2WAXA 3EC2A 1VECA 2NMVA 5AJZA 5FOTA 4RFVA 4DUGA 3CLVA 5JMTA 4TQAA 3VHLB 4F38A 2AHOA 4M9XA 3UXMA 1LW7A 3KQNA 3BWDD 3MSXA 2GK7A 1KKLA 2FPLA 1ZD1A 2MMGA 1R2QA 4RD3A 2V7QD 1XD2B 5C18A 2QUZA 1DAGA 1G20E 3KB2A 3CRRA 2LKDA 2VHUA 2PCLA 3EIEA 3AKEA 1CBUA 3UMSA 1NLZA 2GJ9A 4A4DA 4LJ7A 2FOLA 4RD6A 1U0HC 5H70A 4R2HA 4BASA 4YMSA 5DNYB 4GOJA 3QF7A 4LYHA 1YZQA 4IFEA 2B21A 3NXSA 3F8TA 5FL7A 3U6BA 1IAQA 1N0VC 2HYDA 1P3JA 1XEWX 3QXHA 1W4RA 4PR0A 1G6HA 1UDWA 4HLCA 2CLSA 1XXHE 2X2EA 2OE2A 2PJRA 3K8YA 3BIFA 2XXAA 1SULA 1ZM4A 4PZZA 1EK0A 1IN4A 1Z6TA 1GILA 3LD9A 5CLLA 1Z3IX 2AN9A 1RJ9B 2OLJA 5L3SA 1AM4D 4JLBA 2O8EB 2VP5A 1ODFA 4RCYA 1SXJD 1ZUNB 1P5ZB 3GMTA 2J59A 2J9RA 2IBMA 2DWQA 3X1WA 4EFLA 5CJPA 2EFCB 2IUSA 2QMOA 4HSEA 1G8YA 5FUVA 1GP2A 2FPMA 5FOUA 5H68A 3VFDA 3B8HA 3HYRA 1P60A 1DS6A 1D5CA 1EFTA 3AV0B 2GZAA 3NEJA 4FXPA 4Q9KA 2ZRJA 3SU8A 3SYNA 5DIFA 1II8B 3A1TA 1Y63A 3A1UA 3ASZA 5JJIA 1TU3A 5FOSA 2HYIC 3PQCA 4JZKA 1Z0JA 2ZRKA 5F2EA 4BE7B 5CDFE 1OLOA 2FN4A 3KKPA 4AY2A 1CR1A 3AF3A 2N1BA 4KHZA 1MO3A 3DOFA 4Q7JB 2QP9X 5EUQB 1JJ7A 3CPHA 5F98A 1KI4A 2HXYA 1PUJA 2YWFA 2DFTA 4JBYA 3DOEA 2YWGA 1EXMA 1CXZA 2QGZA 1XTRA 4OQFA 2ERYA 5FBLB 5GJCA 4KBFA 3N5CA 1IY1A 5AWFC 1XDBA 2QQ0A 4A0GA 3PEWA 2AK3A 5CYOA 4G3XA 5K8LA 1HYQA 1RC8A 3GLHE 4K46A 4TL6A 3H86A 4ZI2A 1WXQA 5LB2A 2VP0A 3WHLA 4TL8A 5EXTA 3RLFA 5HE8A 2FDCA 4PQFA 1M6NA 3M4YA 1RVDA 2H92A 4Q18A 1BOFA 1OH6A 1GITA 3W3AA 3T1TA 821PA 1N6LA 3UKDA 4U5XA 1ZAKA 2GAAA 1YR9A 2QP4A 2PL3A 1SHZA 3TRFA 1JR3E 4MRPA 1SHKA 2ATXA 3A8TA 5AUPB 3EZFA 1XF9A 4XJXA 3K70C 1EFHA 2O0KA 5KNBA 1RYHA 4AI6A 4OQMA 3REFA 3BGWA 1KI6A 1XTSA 1DTSA 1CLUA 4DEYA 1KK2A 3CWQA 5L8VA 1ZU4A 2ORVA 4DT1B 3K70B 1XU4A 4CZ2A 3DPUA 2QE7D 4C2TA 4POAA 5CIWA 1NMZA 1OT3A 4Q4JA 2PZGA 1GKYA 4Q5IA 3VX3A 4PPGA 1GNRA 2ZIAA 5KPDA 2N46A 4QBFA 4D81A 4M9SA 3KKQA 4FD2A 5FH9A 1E1QA 1NL3A 3OESA 3CX7A 1OIXA 3ETLA 1T6NA 1R7RA 1W0JA 1P2SA 1DG3A 1W36C 4OBEA 3AEZA 1Z83A 2BMDA 4IDQA 3QPUA 3TK1A 1SZPA 3EXAA 5JWRA 1OFHA 2DBYA 4XOIA 1F60A 4ZDIA 3B7GA 3ZLJA 5GADl 3GLFA 4WIAA 3KTAA 2FEOA 3CRVA 3TSWA 4JLOA 3UK6A 1E9EA 4C4PA 2GXAA 3OF5A 4MDFA 3W34A 1ZVQA 3FMIA 5DI3A 2EQBA 3M1IA 4RD0A 2BBWA 4IVPA 4LYAA 4BLQA 2VIIA 3NDBB 3EG5A 3Q3JB 4LHZA 4TLAA 1KNXA 3CO5A 2PZEA 1T3SA 1Z22A 3OIYA 4UXHA 4C0BA 4CW7A 4UJ3A 4C0SA 2WTUA 5HCIA 5AJWA 3LA6A 1NSTA 1U99A 1JR3A 2RCNA 2PT5A 2REBA 4EUNA 4DHEA 1U98A 2WKRA 1G21E 1JQLB 1OFIA 5JI3E 4Q1DA 2CVHA 3KB1A 4PC1A 2ZJBA 3U61B 4ILEA 1KI3A 4CDGA 3TW4A 2QSZA 3UPUA 1KO5A 4TLDA 4MKFA 1CKEA 2PMDA 2C04A 2FPKA 2NPIA 5EP1A 1VG9B 2RGAA 2ZRMA 2QTFA 2J45A 1IN8A 3U4QB 1AIPA 4B6EA 3LX8A 4G5SA 2P6RA 1D2NA 1SKYB 2YHSA 4P3YA 2R44A 2I1VB 1YKSA 4YMVA 1YQTA 3KFVA 5LBIA 3I73A 2W2XA 3TBKA 2HUPA 2IX3A 4D0LB 4EAQA 4U02A 4IFBA 3B1VA 3A4LA 1FX0B 2X19A 1P9RA 1CP2A 2J0VA 4LPSA 5CM9C 2F9LA 3AKYA 4HLUA 3SFVA 1KO8A 1KJYA 1N6RA 4A0FA 4KLZA 3ADBA 5HKKA 3KUCA 1R0WA 1L4UA 2R62A 5DN6D 3GLGA 1OSNA 3T34A 1NN0A 1XPUA 1M7GA 1MO4A 2GWHA 1KDTA 3HU2A 3WBJA 1TQ4A 3QKRA 1Q1QA 1NI3A 4IDNA 4QKQA 5J4YA 3ZVNA 1DPFA 2JCSA 2QL6A 1TF2A 3T5GA 1OB5A 1N5IA 1OYYA 2QENA 4RZ3A 5IRCD 4XVRA 5SZJA 2PLFA 3K0AA 2O8DB 4AYWA 3B5JA 3RYTC 3WY9A 1MT0A 1WA5A 4FMCB 3ZIAD 2CJWB 3P20A 2W2VA 2BV3A 1MV5A 4EPWA 3CR8A 4P33A 3CKLA 2DPXA 5UKDA 2QNRA 3VAAA 5GJWC 5FR2A 4UNNA 4EKDA 4ASUD 3GLGE 1CR2A 2IYWA 1GL6A 1UKEA 2RHDA 3OAAA 1HE1C 3QJYA 1E2DA 4I4LA 5EE3A 4A8JB 4P4UA 5JEEA 5KHOC 1GWNA 3L0IB 2IL1A 2PCJA 4QJ4A 5A0FA 3LBNA 4WA7A 3IEVA 4GL2A 2ZUCA 1AS0A 5FOWA 1FZQA 4Q7LA 1LB1B 3K9LA 1ZC3A 3DZDA 3SHWA 2WIAA 3NH9A 2AKAB 2VP9A 3IPYA 2QA5A 3PUVA 2WOJA 4OJQA 1E79A 2OCAA 3K09C 2W0MA 2ZREA 3IIKA 2QROA 4HB0A 4CEHA 2WSSD 1OXUA 2RB4A 2WMNB 5CK5A 4BEBA 1UF9A 2WICA 3B1XA 4US2R 2GJ8A 2A5YB 3K0AB 4CT4B 1E1RA 1JB1A 5DI9A 4A6PA 4ERNA 2JLQA 1TTTA 4MRRA 2E1RA 1D9ZA 1KO1A 2FSIA 4NBSA 2PBRA 1D6JA 2KWIA 1VCIA 3AP2A 5FTJA 1WE2A 2AD1A 3BB4A 4MKGA 2GZHA 4H1VA 3TLXA 2E9SA 1Y3AA 2WJIA 1LF5A 2ODBA 1N25A 2GZDA 2RAPA 4TQ9A 2QBYB 2XJ4A 4Q21A 3MWKA 1RJ9A 1MRNA 2IF0A 3Q9LA 2ZITA 4Y0AA 1EWRA 1US8B 4O3MA 4ZCLA 2IHBA 1QHXA 1P75A 3CF0A 1MRSA 4PANA 2VBCA 1WDTA 1Z0AA 3IGFA 4KITB 2CNWD 1E6CA 2J87A 2WWXA 2XNDA 5KSOA 3AGPA 1GIAA 2R6FA 4IXMA 4DRZA 1NG1A 4KAXA 4BFVA 1TADA 2F6RA 1VIYA 2BDTA 2BIFA 2OAQ1 3EW9A 1JNYA 4V0LA 1KK1A 2ZANA 1P6XA 1F2UB 5JEDA 4FIDA 5C4MA 1WBBA 1HT1E 2ZJYA 4HDCA 3TVTA 4IOMA 5CM8B 3P4XA 4TT3A 2IS2A 3A4NA 2ZI7A 4Q7KA 3LFUA 3OIUA 1G7TA 2C8VA 5FL7D 4RFSA 1LV7A 1NF3A 3R8CA 1NKTA 3K9GA 1X6VA 3ND8A 3EARA 3Q5EA 4DIEA 1YJ5A 1UEIA 1TEVA 4W5JA 2MMCA 4OHZA 2B7BA 3BFXA 4IEIA 3FMPB 1KKMA 5E95A 1DAKA 4Q48A 1Z6AA 1ZCAA 4M9QA 2QI9C 4QRHA 3REGA 4OK3A 2JGNA 3H2YA 2CVFA 4NYJQ 4E22A 3MWLA 1DAEA 2C98A 2OAP1 3FFBA 1OIVA 3LW7A 1N6OA 3L0PA 2FH5B 3EPHA 2JDIA 1P4SA 3WMFA 1VYUA 2RGBA 4CRWB 3U7EB 1AQYA 3TMKA 5ELXA 4IKEA 1OXVA 4JT4A 1BIFA 4DCSA 2MSEB 1NVXQ 1OXSC 5ANRB 4D4MA 5C2JB 1TUIA 4YONB 3UMFA 3ONWA 4NYIQ 4LSGA 3GLIB 1DG1G 4LY6A 1CRPA 1E0AA 2VF8A 2D7CA 1XWIA 2Q9BA 4JJZA 4KVAA 4QHTA 2C96A 2EW1A 3OEED 3CNOA 1RRGA 1U0JA 2A5DA 2JIZD 2ZU0C 2IYUA 4L8GA 2G0TA 5FUXA 1XCPA 3THXA 1Z2AA 2IYQA 1U9IA 3MFYA 4M4SA 2BVNA 3BB1A 2Z43A 3J81k 2RGNA 3WNBA 4IOLA 4JSYA 5FI1B 1E3MA 4LBYA 4MGIR 2QAGB 1MR3F 1XTJA 2B7CA 1RPZA 5DISB 1OIWA 1NN5A 2AR7A 1Z08A 2GILA 1FQKA 3RS3A 3DDCA 2QMUA 1G3QA 3LW8A 5B30A 2CK3D 4TMWA 4O2RA 2RKOA 4LHYA 1NMYA 3NKVA 3TNFA 4OHXA 2EFGA 4C0LA 4V0OA 4ACAA 3GEHA 3Q5DA 4IW3B 2ZPTX 5GJBA 1AKYA 3JVUA 2DYKA 4KO8A 1AN0A 2OV2A 1T9HA 2QPAA 4PXAA 1E2IA 4ASUA 1HQYE 1KY3A 2OG2A 2R6AA 3T61A 4LI0A 2C5LA 3ZDQA 1N6HA 4PSKA 3WYGA 4KYUA 2HJGA 1KI7A 3MWJA 1T5IA 3AQ4A 4HEJA 4L5BA 3UMRA 4ZDWA 3RC3A 1OH8A 2O8CB 5BQ5A 1GNQA 3ICQB 1IN6A 2GKSA 3VR5A 3AVTA 1ETUA 3MAAC 3DKPA 2YJTD 3KJEA 2JLRA 3RS7A 4HAZA 2GCPA 2ZE8A 4K81B 4Z51A 1H8EA 5JI2E 1J7KA 5IHPA 3X1XA 1HV8A 4FMDF 1TF7A 4PPQA 4R98A 2REOA 2DFKB 1HQCA
chains in the Genus database with same CATH superfamily
2HA0A 5ER6A 4D3FA 3X2FA 2VJLA 4PWZA 3I4CA 3PSHA 2OZKA 4X66B 3U40A 1Y8AA 3IP7A 3T99A 4D4JA 4LBZA 2BFEA 4RNCA 4BTEA 4J0EA 3I1FA 3SYTA 1UBEA 2A6PA 2NGRA 3HI4A 4B43A 2JCBA 4D56A 3NCHA 1Z06A 3SIWA 3NM5A 3RUPA 3FPBA 4F1KA 4FOOA 1JZTA 3TG2A 3F3KA 1KZGB 3VNBA 1JG2A 4KRGA 2YVUA 3SLKA 4FOTA 1YONA 2G07A 2FFQA 1PIWA 3GRUA 3P4YA 4NF2A 2FE1A 4E3WA 4EKIA 4EMUA 3LLMA 1W1IA 1PDWA 3HR7A 4L57A 4HAXA 3S8MA 3PFHA 2C5FA 3CLUD 5ALRA 2KB0A 4WXYB 1RKBA 3R7DA 3WYFA 2GKGA 1FRFS 2D59A 4GE3A 2ODAA 5EJGA 3ICEA 3BMQA 3O2SB 2HWUA 1MORA 4FJ1A 5IDWA 1ESCA 3CZ5A 1XTIA 4AUNA 1OBHA 3VA7A 2XGJA 4II2A 1CYEA 1CS0A 4IDDA 1XMJA 1MXHA 2SKCA 4N3NA 4EY8A 2YZ7A 1M0EA 4TMZA 2V7EA 4I1SA 3L0ZA 4IIUA 4OB6A 4ZZ3A 1A3CA 4MAFA 4KFCA 2DPGA 4F46A 2H08A 5KYUA 4J16A 2W00A 4IJ6A 1ESDA 3ZBPA 1TECE 3PC3A 4CNBA 4ESHA 4Q3LA 1GPUA 2CBZA 5F1OA 3QKRB 4LVOA 1SUSA 2HLHA 4QGGA 1PFYA 1H2WA 3EDMA 3FUCA 4IOJA 1L0BA 3B6MA 4DLBA 1BXRB 2VOJA 4WKGA 2CVZA 3A9RA 3D0KA 1QIFA 3O8DA 2IS6A 1K9SA 3IT0A 1EXDA 4J1TA 3WK8A 3JX9A 1GKLA 2IIBA 2ZSFA 4KN6A 3PEUA 1W94A 1WD5A 4L6IA 1QVAA 2EG5A 1ZNZA 4RORA 3RU3A 3CVWA 4K0RA 5IDVA 4GP7A 3EZGA 3S4YA 1JMKC 3NHJA 2O8EB 1W6UA 4RK0A 2DFDA 1H5UA 1U4NA 3ONDA 4ARUA 4MRMB 3EGDB 4F3KA 3RDPA 1PCXA 1TM7E 5GVRA 3VX4A 4LW8A 2FPGB 4GGOA 2XWSA 3TE7A 2H00A 2RHGB 1KEPA 3U7RA 2F1RA 1GDTA 3HGTA 2OV1A 4F6LA 3UMYA 1NJFA 1NUSA 1PWXA 4JVMA 4GEKA 1OR8A 1Q7TA 4WI1A 5F2KA 4QQNA 3AG6A 1NBME 3FYHA 4CQMA 5CVVA 3K1AA 1ZQ9A 3W5CA 2VHQA 1Y9DA 2V59A 1PNOA 4G5HA 1E3IA 2CUTA 3VTFA 3JQGB 3K0FA 2O8BB 2ZE5A 3MLEA 1V6SA 5IYZF 4F86A 1Y1PA 2F43B 3DDSA 5EYPB 3ROZA 1FTSA 3WNZA 1MCZA 2I6SA 2KYRA 5F5XA 4C2BA 1DAPA 1GCUA 3B89A 4KXUA 5LFAA 1QR2A 4RIIA 4W8HA 4WY5A 2XYGA 2BH9A 2C59A 4A6DA 2O6LA 2R8XA 1OTHA 5EERA 1QCYA 4B1FA 3D6MA 5EJ4A 3IV7A 1EE2A 4BDTA 3PQEA 1PL6A 1SXHA 3TD9A 4FSXA 4PG4A 2DETA 1FFAA 4U7WA 1HE3A 2IYVA 4INJA 3Q8WA 4OXXA 2A0KA 3SHVA 1CF9A 1YCFA 3BD6A 4L8WB 1W4BA 4MR9A 5CT9A 3E9MA 4J0FA 2X77A 5E1OA 1WMFA 1R12A 4LDJA 4OHPA 1YJ8A 2V3CC 1FY2A 1DT3A 1HT2E 3E3MA 2R84A 3HJGA 5EJMA 5K3CA 4NMLA 4FCWA 4D2IA 1G2QA 1QGUA 4ISBA 4GGMX 4LYYA 4ZIRB 1E96A 1RYFA 4TMFA 3L40A 2XMBA 4HNSA 3RABA 3ZLBA 2VBFA 3E8SA 3CEMA 4JBWA 1I5OA 3SX2A 3IOYA 1FJGB 4XUGB 1HLDA 1YVDA 2J3EA 5GP1A 5FBQB 2X15A 4X7RA 5KYKA 3H9QA 2PM8A 4TMKA 1NBIA 3EPKA 5C52B 2XGOA 3ICPA 4DXDA 4P80A 4H7IA 4HGPA 1V7ZA 1Y3BE 2LW7A 4KIJA 2OBFA 2QPTA 3KDPA 2C3OA 4BLSA 2HA4A 4CEJA 3EZLA 1PT9A 1TYZA 1X1DA 1VLMA 2CXXA 2F48A 2JKVA 4JEHA 3TSOA 4OUDB 4GX2A 2C5GA 4MPDA 4GEGA 1EVYA 1V48A 3DMGA 4H27A 1UJ2A 5DCYA 5FJIA 4B3BA 2H16A 5CNIA 1UPXA 3I6MA 3UUFA 3WGLA 1TC1A 2ILTA 4TS4A 3NBFA 3URMA 3L7YA 2PBFA 4CR8A 3EFOA 4YCJA 2BDUA 1E9FA 1G3RA 2YL2A 3GGOA 3SHOA 4E07A 1HFWA 2QW0X 4Y9UA 2XGMA 4S2UA 4Q1EA 2R79A 5IDXA 2QM7A 1JIIA 5ARCA 4REQB 2IC5A 3QKSB 2VPPA 4OHKA 2H1IA 3UJDA 3V4VB 4LNAA 5A6SB 1FB5A 2H9IA 2AMYA 2Y66A 4JT2A 2A9PA 4RHCA 1A0OA 4FE3A 4P84A 3HMKA 3V7NA 3TZQA 2N1MA 1NNI1 4MLZA 4RLFA 2W70A 3U0VA 1M66A 2QLBA 1B0AA 4B6FA 3AUUA 4MQMA 4F5EA 2KBEA 4C2AA 3D3WB 5KJFA 1BXZA 3PPWA 3DV9A 3T06B 2PL1A 3IBYA 1SVUA 2H4FA 1JFFA 1EVEA 2XCUA 2W93A 1SC6A 3UTCA 1SM4A 3GROA 1CJUC 2GBCA 2JL1A 3PFIA 1ZM7A 3HCNA 3NHPA 3N3BC 4HQKA 2XUDA 5BSKA 3JYPA 5HS4A 3DBLB 2FY8A 4BUJA 1I2ZA 1RS0A 1PFWA 3AZPA 2O0JA 1P81A 1DWQA 5AKZA 1ZEJA 3RYIA 4RK5A 3PFBA 1JIXA 2HK6A 2H3HA 2XOEA 2Q3MA 2XOXA 2P2NA 4GR5A 4ITVA 3KKOA 1YZHA 4KGXA 4KXMA 1GQSA 1XLTC 1AE1A 1KZ7B 1ZNYA 2WAAA 4GKVA 4OHCA 5CT8A 3V48A 1WBJB 1KZ1A 1EM8B 3N8IA 3S99A 2X5JO 3IYLW 3NT4A 5FI0B 4FKZA 2WHYA 2RG1A 2O52A 1UT6A 3IQHX 1F9AA 2DU8A 1G7RA 1GPDG 2QD5A 1CJTC 5DTIA 4PE5B 1W30A 4A27A 2LCIA 3TGWA 3GVHA 2H1VA 5EIHA 2JVIA 2XCSB 4UVEA 2I2FA 3AEUB 1K06A 1VXRA 1YC2A 3A6HA 4DY4A 5J43A 2YXBA 4Y2QA 3VFDA 5AW3A 3MD0A 4JVLA 1Z13A 2BMAA 3K20A 2P2LA 3FWHA 2DGDA 3BJZA 3ABOB 3WO0A 2Z2JA 5CA1A 2I34A 3O95A 1Z6ZA 4QGBA 2AGVA 4KR9A 4YFVA 3V4PB 2XUKA 1SRQA 5FUYA 1FQWA 4CNQA 2BGIA 1Z2NX 4FZ3A 2CJXA 3EXFA 3HH8A 4OXIA 5JS2A 3V7UA 1TW2A 4LMPA 3PF8A 4UBMA 5T64A 5GZ6A 1R16A 4M9CA 2RGWA 2QN9A 4RY9A 4L4YA 1Z4MA 4MUGA 2V0CA 3UMJA 3WDSA 4FINA 3IILA 2H5LA 5ELLA 3AM3A 4LBVA 1NYTA 4F91B 1H2AS 1Y7HA 1GM5A 4UC0A 1WCYA 2WAMA 4JLAA 1K97A 3MVEA 1NBHA 1RIFA 4PRYA 1WUHS 3WZ2A 3RAFC 2EAUA 5F2OA 4MQ4A 2CXPA 4AMBA 1WDLA 4QSMA 5I7EA 1QYIA 3WFJA 2X76A 2YINC 3P1JA 3DQPA 4MYHA 2ZETA 2AI3A 2RB5A 1E59A 4PNHA 2APJA 4DDVA 4DMMA 4DCVA 3IUMA 1N0UA 4NK5A 1NZFA 1WHTA 2AFVA 1NQWA 4F3CA 4FEYA 3I28A 4L8LA 4RY0A 2PXHA 5EIEA 1MH1A 2DH5A 2VZ8A 1N6NA 2P5YA 5A3RA 1N77A 3LNTA 4Q4JB 5JE8A 2I7TA 4F6RB 1G21A 4OI1A 2R3SA 1GZHB 3L02A 4M0LA 1C1HA 1CCWA 3K0EA 4KQXA 1Q3HA 1W47A 1ABBA 2DERA 3GGJA 1KRHA 2C8JA 2FCAA 3BRWA 4EFNA 3IEMA 3RPEA 1T9BA 1XQYA 1JX6A 1XRNA 2P65A 2Q6IA 3HDTA 1O8BA 4BWGA 2ZJ0A 3N2ZB 1KMNA 3EWSA 5JW6A 2DHCA 2V55B 5JS6A 2P62A 1TIPA 3IHLA 5C3UA 1NY5A 3ZC3A 1VCOA 1FFXA 1RQXA 3P0FA 3Q7PA 1LTQA 1QVRA 2IELA 3FD8A 3PHIA 2BISA 5FNZA 3SQDA 1QTQA 2ZJOA 4CHTA 2ZCUA 2ZSHA 3RSQA 3LQQA 3HU1A 4C29A 3ISJA 3E3AA 2P78A 5AKYA 1E4EA 4ZCLA 1FUYB 1WL8A 2E18A 4RKRA 5KTKA 2NU6A 4A91A 2CFIA 5JS7A 3DFMA 5FWNA 1LRJA 2AC4A 2OHOA 5AMXA 2IOQA 4UAJA 3RD5A 5HP4A 4HN9A 5TR9A 3O3CA 3OPYI 5A9SA 2HMSA 1Z0IA 2EKBA 4G0NA 1ONSA 2ZU6A 1NURA 2DX7A 5AW2A 3WP1B 1VGRA 4DMUB 2GN6A 1XQ9A 3GVCA 3KZXA 1YL6A 1TGVA 3D3KA 3F5FA 4F6RA 3A1WA 5ED4A 3SY8A 3WL5A 3R0IA 1W5SA 4ONEA 1JECA 2VXOA 2C7QA 3ZBTA 4BYMA 1AY0A 1Y8QB 3LQ4A 1V8BA 1VG8A 2EKLA 5DXFA 4F3TA 2Q0SA 4EK9A 3INYA 2CMDA 4ZT7A 1E79D 3DBRB 1F3LA 4ZI3A 2OK8A 2QT1A 2PU7A 1SC1A 1QCDA 2G25A 3FUTA 4FSHA 3VHQA 2XA9A 4CCWA 4GZ3A 4W5OA 4RZ2A 4I3GA 1CQWA 4ZRNA 1RQLA 3H0KA 2Q8PA 2RHOA 3IUEA 1D04A 2FW0A 2PDAA 3KIPA 3X1KA 1CUIA 2ZSAA 1V5FA 2P2GA 1X1SA 3L5OA 1BO6A 2HLDA 3MRSA 1J0XO 4PSCA 4AO7A 2YW2A 4P4GA 1OU4A 4UQPA 1ST2A 4GOND 4LRUA 3G5TA 5L40A 3H11A 3IOBA 3KR0A 3O0TA 4MW0A 4O29A 3TW0A 3Q87B 3KQUA 3QYFA 1KYIA 3C2QA 5HEKA 2O7QA 1A1VA 4PQEA 1LJ8A 3DMNA 4F1JA 5KOHB 3NKLA 2WUEA 3V7WA 5H5JA 2X0KA 2I4NA 1FZTA 4IWXA 4A8JA 2ZBEA 5CPFA 1JEQB 1L7BA 1DV1A 3KQTA 3RU2A 1RRVA 1LI7A 1DFIA 5TPZA 3HU3A 4B80A 2FP3A 4I2VA 4UCWA 5KKNB 3AHHA 4G6ZA 3K16A 5KVAA 3FA2A 1E60A 1L4YA 1DELA 1ZW1A 2NW6A 5B53A 3NUZA 3RKRA 3TQFA 1JDTA 2QJOA 4JQSA 4EPTA 2JEYA 2P9FA 4KIFA 2G0AA 5DGDA 4ZEMA 3GJXC 3FUXA 4LE0A 1ULAA 3DEFA 4MIEA 3HJHA 4D6XA 3WKAA 5I7UA 5M2QA 2VUTA 3K0BA 2IXBA 2X42A 1U0BB 4CTNA 2W2MA 4DLAA 2GB4A 1V7QA 4MJ3A 5ESDA 4L4RA 1NQAO 4OKIA 4QU0A 1POWA 1U2DC 3CUWA 4XDZA 3OZVA 5TQ0B 3PD7A 2Z30A 4Q7QA 2Q2WA 5KC9A 4E5KA 4UVIA 2WMYA 3IT3A 2Z5LA 1KRXA 4DJJA 3ZZMA 2CXOA 4HDQB 4IXWA 4MPRA 2ODNA 3GR6A 1JG7A 3KG2A 3STTA 1DXOA 2B36A 5CGQB 3LUCA 2LGJA 5TQ2A 1BVYF 3AOEA 3BTUA 2BHNA 4IP0A 2A78A 5CFPA 3B6KA 4G85A 3DAHA 4B76A 1QKKA 4LV5B 4RD4A 3EY9A 3I9OA 1NUQA 1DC4A 1N2CB 3FOWA 4KLAA 1JKJA 4LMRA 3JYOA 3ZK8A 3FKSD 3ZWDA 3UPTA 3EOAI 2AFHA 3SS9X 4Y6LA 1QV7A 5LUAA 4I1RA 3WLKX 3GEIA 3U44B 2C57A 1THTA 3KHTA 2BRUC 3CRNA 4HDAA 1OYWA 1R0XA 3AL0C 1OXKB 2V7QA 5EUBA 1SWWA 2XUIA 1FYFA 1MRZA 2EX1A 5LDGA 2N0SA 1D6MA 4X85A 2W6PA 4YLEA 2I66A 1IZ7A 1GNPA 5JCOC 1J2TA 3VU3A 4M6WA 4TTAA 4JI6B 2WLSA 5JLJA 1KFCB 3I5MA 4ATNA 4UD2A 5REQB 1Q7CA 3UJ9A 5A0VA 5E6UA 4L51A 2QAJA 4GMFA 3WK9A 4DSZA 1DUVG 4K6OA 3E4CA 4CF5A 3UK2A 1XP8A 4BLOA 3QVOA 1PZMA 2BHSA 3DFIA 4Z8XA 2V6GA 3L4EA 3SICE 4CM8B 4AJNA 5JD5A 1E4OA 3B52X 3D6UA 4KWTA 3STYA 2X9NA 1O97D 2UVQA 3BBLA 5DLYA 5NLLA 2IYOA 2X1MA 1R15A 1ZBDA 3V97A 5HK8A 3MCAA 3WWOA 1OD6A 3EHEA 3GGPA 1TAQA 1U94A 5CYPA 1CYDA 4JQOA 4HL6A 4G5GA 3ZK9A 1KWGA 3KUXA 4DYDA 2W2QA 3GYGA 1JEOA 1X92A 4NY1A 4ON9A 1JR2A 4H1UA 4FYYA 2PGAA 3LRTA 1NHGA 2P6PA 2VJBA 1CNFA 3DVLA 3A9SA 1XXLA 2JHGA 2H1SA 3GUYA 3BC1A 2HHHB 4XD2A 5E8RA 4G4SP 4KL8S 4B4UA 1BYIA 3PC6A 4DA8A 4Z2AA 4CKCA 1CC1S 3FGPA 1VB3A 4TYPA 1RBZA 4LS3A 1RAGA 2JFZA 1CRQA 1IY2A 1Z37A 2BHRA 4LOKA 4C4OA 1BXRA 4IEEA 2HJSA 4PFJA 3EIHA 3T38A 4YRKA 2X4GA 3D6TB 5K3BA 4AY5A 1R10A 3PGMA 1GD1O 4BO7A 3D8RA 5D1HA 1KJJA 4WNIA 2OYCA 2AX3A 4EO4A 3MCUA 2R86A 2Y1WA 5EMMA 1M5RA 1M7BA 5DNCA 1NE2A 4M1KA 4RKEA 1U3TA 2H1HA 2CLCX 3FSRA 1BQ3A 3H0CA 1QFSA 1GTJ1 3CF4A 1E2HA 4IIDA 1RWMA 2BLLA 1IQUA 3MQ2A 2ZJZA 2OUIA 3WL8A 2JAHA 3CEHA 4UMFA 1WBDA 2DEUA 1T5OA 3U1TA 3T3GA 4XDHA 1E0SA 1YMQA 3UY4A 3CISA 1D1SA 1JDBC 4P31A 1XKTA 3RJZA 3RRMA 3BBPA 3AYZB 2R7KA 5DHFA 3VGPA 4TPKA 4IJMA 2NPFA 2WU8A 4ED9A 4QFCA 1UK6A 5DM0A 5DYGA 221PA 4YQYA 2ZI3A 3U4CA 2WMDA 3TSAA 1TYBE 3AVUA 3LBFA 3GO4A 1A7JA 2D8MA 2KLHA 2I2DA 2AOVA 3PXXA 1FXWF 2VDRB 2XVMA 3WLNA 4AKHA 5E2IA 2A57A 3BZWA 2OILA 2HO4A 1R5NA 4F4DA 4A2CA 2MWMA 4DCGA 4S05A 2PPVA 4PS0A 3MQ4A 4UEQA 3R3YA 2CW5A 1P39A 2NUPA 3M3HA 1A8HA 3K0HA 5AK4A 5TT1A 2A88A 3F73A 1P2BA 3H2BA 3D3JA 2YUTA 4K9SA 1G6OA 2YVKA 3AYXB 3N8KA 4K8RB 3WIOA 4D92A 16PKA 5A4FS 2AVDA 5EVCA 2JJ1A 1CJSA 1YNSA 1XAJA 2VK1A 3AJRA 3EF1A 3IHWA 2CLLB 1ZC4A 3PUIA 4LJ8A 1OWMA 4J91A 4Q9JA 1JWBB 3I09A 2OKCA 1SFRA 3WFZA 1SBCA 1X2EA 4H4CA 3WB0A 1DRUA 3RYIB 2Q3BA 2JD0A 4HVTA 3HBAA 4TL9A 3NKFA 3H5VA 2XJ9A 3FGNA 3IP6A 1O8CA 2ODWA 2IOHA 3GAZA 3IVAA 2XOKD 3S7ZA 1AGPA 2UDPA 2B6NA 4EB6B 4PZCA 1KRWA 5BXQC 1SXJB 1CE8A 3D31A 4MVJP 1RP1A 2Y0DA 1LTKA 1JH9A 2X8WA 1VMEA 5IT5A 1KOJA 3W77A 1M2HA 1XYVA 1GRNA 1U11A 3IA2A 2GCNA 1Q1NA 3HSKA 4V0KA 4B5LA 5C53B 1MN6A 4JJGA 4BFLA 4ZHSA 2HXSA 5MF6A 2JA2A 1N8NA 3G9ZA 5HQ3A 4V2IA 2B6HA 3T1QA 3IDZA 1BCSA 1TM3E 4JJAA 3DLAA 4M8NE 2OR3A 1LNZA 4NS4A 3ZKWA 1W93A 1NYRA 2OLKA 4IG9A 4PHFA 3BJRA 2LPMA 4P5EA 4RVDA 4G8BA 3T9AA 4F2PA 5A4DA 2VDWB 3K72B 3LLSA 4OD0A 1UJBA 3IBFA 3ICWA 3LBHA 2YS7A 4Q4HA 1CQXA 1CEEA 2VRCD 1HLPA 1UZNA 4OAQA 3VZSA 1ZH6A 1XLTA 3RSSA 4DUZB 3H16A 3PRHA 5HUHA 2C7OA 1EESA 5DM1A 4RPJA 1E7SA 1VPLA 2BFAA 2E4YA 3IP8A 4QPZA 1HE4A 5CMLA 2CXUA 3VYVA 4BKQA 5IEJA 4B73A 2V1UA 2DR3A 3GH3A 3FCCA 4CM9D 2X40A 3HKCB 2IXAA 3HCDA 4J0DA 2PTGA 4KVGA 1JS1X 2V6IA 2YQ5A 3FCEA 5HIJA 3N8HA 4GZ6A 3RSHA 5HRAA 1CS0B 5L53A 3ND5A 1ZD5A 4ER0A 1A95A 1HQDA 1IHYA 4OYRA 4MPJA 1E1MA 2QRVB 5JZBA 1S96A 2HWKA 3IESA 1GA6A 3IMKA 1G41A 2XADA 3FF4A 1Q1EA 2JFXA 3HB5X 3KQSA 2W90A 5DNUA 4MR8B 4R9VA 3NHAA 2VUIB 1S1CA 4PGMA 4BBPA 3S1AB 1KOFA 3H2SA 4DLWA 1HYEA 1N0WA 4ERXA 1CZUA 2NV2B 3N2EA 3U4IA 4RWZA 5E7MA 2CDRA 1XVUA 3D7NA 4K6FA 2RMKA 4PO3X 3RKSA 4TMYA 4BEVA 4EJ6A 2VQFB 2QMHA 5JUWA 3TJMA 2WVJA 3LO8A 3OCYA 3OT4A 3PNPA 4BP1A 3K71B 2PTHA 2QV0A 3QQPA 3R5HA 1O6BA 2XF2A 2XB9A 3HYTA 3AEQA 3OTHA 1H3FA 2QRZA 4RZXA 3L7KA 4WXPA 1RE0A 1SWVA 3CR7A 3EIFA 1G3MA 3K15A 4LXYA 1Y6RA 3MWDA 4MVWA 1OX6A 3L82B 1XZFA 1QJCA 1IQ0A 3F71A 3H4IA 5I9IA 1G3UA 1ZGAA 2VSQA 3I76A 4QLAA 1JLLB 2Z3ZA 4JS0A 1FNDA 3SOPA 2XRYA 1QYCA 5HFAA 2ZYAA 2Q45A 4OHWA 3UG6A 4B82A 3H5TA 3NYQA 2H7CA 3RV4A 1W85B 3WQRA 2CXQA 5TMEA 1H2BA 2JIZA 3HWSA 3I62A 1ZCBA 4UFPA 1V5IA 1U1FA 2PMBA 3E5RA 1J99A 4NENB 4Q12A 5DASA 1DKNA 5JV5A 1KI1A 4B32A 3K53A 2EP7A 4IIJA 3A6PC 2GXQA 1MENA 2QTTA 3BL8A 2V58A 4NESA 4O1IA 2WAOA 3JD3A 2B34A 1FYWA 2YMPA 3CLHA 2NYRA 3NUQA 4MW5A 5FPSA 1KVUA 3BMXA 3GBPA 4HH1A 2BF4A 2RHRA 3RRBA 3WHIA 4F97A 3K0FB 3QYJA 4O4JB 5F4BA 5KTSA 1V3QE 5LA6F 3FTEA 1G19A 4BX2A 1T8YA 1E3JA 1NBEA 4YQZA 5B3KA 2MOKA 3N7TA 3RNLA 2A1UB 1SXQA 1A2BA 4I6GA 3M5DA 1PGOA 2LCQA 4JCOA 3SF8A 1EP1B 4PSVA 2TMDA 2GBPA 2J3HA 1K5PA 1C1DA 3N7UA 1RVV1 4XRGA 4YR7A 2FN9A 3GEEA 1VG0B 3RK4A 1IZ8A 5IJ0A 1Z07A 4LOIA 1IRIA 1CB7A 4IL5A 2BC9A 2R2AA 2ZBRA 1MFPA 2PY6A 3NO4A 4MYTA 3Q3HA 5LCXA 3ZGOA 4JGBA 3LTNC 4R5MA 3W5BA 3HFGA 1G8PA 1K8QA 3EOBI 4G24A 4U1RA 5H80A 1NVFA 2FGJA 1QAMA 4YRPA 3VYWA 3THWA 3L04A 4LJAA 3P0RA 4PYOA 3LCJA 1QF7A 3CLKA 3M4XA 2Y93A 3W5JA 1GQRA 3O73A 3C1UA 3F4BA 3E3NA 3P2IA 1ZOLA 3EXHA 2H6EA 2QOEA 2NO6A 2VK4A 3LPLA 4WDRA 5BV2P 1T9GS 4UUOA 1XQXA 4KAAA 4JI3B 5JNVA 1TCVA 2BFWA 2J3KA 2NPOA 3MTEA 2EFHB 4QNRA 1QC5A 2WNIA 2CLFB 3KLBA 1GHTA 4HAWA 2NXJA 5DBHX 1GGEA 1JWAB 1E66A 1QHFA 4RDIA 1JVBA 2I2WA 4OVKA 4GUAA 2HDHA 2PV0A 1A9XA 3NFYA 4ID3A 3AHEA 4QJIA 3WL7A 1RKUA 1ZIDA 4JVOA 1U90A 1OUMA 1ODTC 2GEUA 1E2MA 4ZI7F 1W1WA 2ZSBA 2VJMB 3O4IA 1RR6A 3C14C 4KQ6A 5J63A 1TZMA 1U2TA 1FDOA 2QB5A 2E55A 3HG7A 1XEXB 4JDUA 2YUIA 5F1PA 4ZN6A 3SQMA 5K8VA 1S01A 3K9NA 2IUTA 3AZOA 1VYHA 4P3NA 2A33A 4AYTA 2I3GA 2FLWA 4GI5A 2C94A 3EUEA 3GQBA 4KIGA 4TUYF 4EQ6B 5A7FA 2PRZA 4HHEA 4AIRA 3HV0A 3RHSA 4QYSA 3IR5A 2IEZA 3AF0A 2J9ZB 2NT3A 3U37A 4WLUA 4EEKA 5BMOA 1AUXA 1KI9A 4MVJD 4XX0B 1QIKA 1M6WA 4FX5A 4Y0VA 5E6RB 1JSZA 3I4LA 2O8DA 3EGEA 1P2GA 4ZT4A 1C14A 2JIOA 1E6EA 2EU8A 4P34A 4QYTA 4N7BA 2FVXA 1JG1A 1PJRA 2HMTA 4EEXA 1LDBA 1JSLA 3DZIA 3EVZA 4C78A 1WPRA 3ZDFA 4BNHA 1ZK4A 2P41A 4JI7B 2JH9A 3L4BA 1PNTA 1QCZA 1BVRA 2OV8A 3O8QA 4URWR 4XVHA 5EGSA 4BJ3A 3KR1A 5KQMA 1XNGA 2VYVA 4DKJA 1Q0HA 3DLIA 1GT91 1OLXB 4H7HA 4WL0A 2JCGA 2WBLC 4B3JA 3J81A 1E4VA 2R1TB 4EYKA 4M6WB 4JYAB 3KXLA 1DKLA 1ATIA 2XUFA 2QRGA 3LK6A 4H0NA 4BVHA 4D5EA 3LLCA 2VKQA 5DGIA 4RQAA 4EL0A 5D00A 3TWOA 4K2HA 2B99A 3KOYA 1IOVA 1PZFA 4TOIA 3F1KA 4EDFA 3BE5A 1A9PA 3RRYA 2WT8A 4EJMA 1W5EA 2YIVX 3CYFA 1OGYA 3RR2A 2AFHB 3QVMA 3MMNA 3GMSA 4KWHA 4ENRA 1CQIB 2E7ZA 2XNCA 3N28A 4QUDA 4B7ZA 4P2GA 3WV5A 4X54A 1M74A 4B45A 4EGAA 5CDYA 1KEKA 5EOVA 1P17A 5DTRA 2B8WA 5EJ5A 3U7GA 4PQGA 4C6SA 3FLAA 2GRUA 3A4YA 3CH5A 4XIFA 5BUCA 3KP1A 4NMHA 5F3DA 5AXDA 2SNIE 3ZIAA 4NJOA 5IMBA 5DTMA 1X94A 3RTEA 5K8UA 1N9GA 2UVDA 2GI4A 3AK4A 3I2IA 1OWLA 2G82A 4UJ5A 1JE1A 3OIVA 2XXBA 2PD4A 4DJ5X 3TO5A 8GPBA 1WQ4A 4AWXA 1D07A 3C7AA 4DQUA 4LDAA 4XSHA 2GXSA 4AY4A 3P5BA 3LSYA 1TUBB 3NVMB 3T3EA 4F96A 1CY7A 2ODPA 3X1DA 5KCMA 3TZKA 2AJDA 3JQCA 3LPNA 1ZD3A 1R8XA 2QY9A 4INOA 5KEIA 4L0QA 4BJ1A 4W5NA 4KJXA 4Z1MD 1GTRA 1V5WA 3ZJVA 3HB0A 2AUNA 1QS0A 1H6BA 5I7AA 3P5SA 1MX9A 2VYVD 3Q8LA 5T8KC 1YQXA 5JJ5A 3IUJA 2CFSA 4RHEA 4HI0E 4I81A 4MQBA 4UTOA 1WB6A 2OZPA 4CQLB 1WB4A 4CODB 1W0KD 3WMGA 1YRQA 1T0PA 2IP4A 3KZ1E 3PITA 4EG6A 1W19A 5DM2A 3OKCA 1NBMA 1TU4A 2OBXA 4MYSA 5IG2A 2O8EA 1ZYUA 4OLBA 1VBMA 1PNVA 4LJ4A 4JLNA 4CT5A 1NLYA 2OOKA 3KJXA 3JQRA 5H3LA 3X1ZA 3DE0X 1I7DA 1WVIA 4K9NA 3GD7A 1VA5A 4URZR 3R0ZA 5I6DA 3RYFB 2J3MA 5K5EA 1P0MA 4TSFD 2UZ1B 4Y2HA 1CIVA 1N2ZA 2HTEA 3A4IA 1QHSA 3VR5D 4AKIA 2XH8A 3QPAA 1C2TA 1RFGE 1UMBB 1VJTA 1F5SA 1G60A 4KV7A 5D3QA 1SBNE 2BMEA 2ZRIA 3LCMA 5LQMA 2HK9A 4LJLA 1UBUS 1JU3A 1S9DA 5LYJA 1C81A 1OXTA 4BO1A 3N87A 3ZDCA 1M2VB 4CE6A 4WXRA 3LQRA 3QKUA 2Q5FA 3LUPA 3EULA 4MO2A 3MT8A 5HJ5A 3I30X 2HPAA 4MDFA 4PC6A 4M0PA 4NU5A 3B6JA 4LSMA 1GUDA 4MNTA 4RSGA 2FZLA 5AKJA 3LC0A 1DRJA 4GKAA 1NNLA 4INZA 2PGOA 2A58A 2QG9A 3FPCA 3VH1A 3IR7A 2G0NA 1ONBA 2BTOA 3HDVA 3UJ8A 1WDWB 2DQSA 4TZKA 2OUKA 4XD7A 4B2LA 3UAOA 5AQEA 4EKNB 4ENSA 1N5MA 1MNQA 2B30A 4HLDA 4EUFA 5JO0A 5H4HA 4XVCA 1MZPA 1FMJA 3N1UA 3GD5A 4BGIA 3C16C 4B71A 1VMIA 4XFKA 4H6PA 1NSYA 5F77A 3DEYX 4DLNA 4U6QA 1EZ1A 1O7JA 3RRZA 4UPEA 7ADHA 2AXPA 1CUGA 1V8FA 1VHTA 1YCHA 3OSUA 5E6UB 3TOXA 1PZNA 2PD3A 1L7OA 3T54A 4ANFA 1ELOA 3LQFA 3IMCA 3QVUA 4P7JA 3HJFA 2XCRB 1FMFA 3KUKA 3OA0A 3C6YA 1SOAA 1QYRA 3R4CA 3RO7A 2YNMC 4TV9B 5CA0F 1QRDA 1IHDA 1RAHA 5BSMA 3FBGA 4NAUA 2AD5A 1WUTA 2DBVO 2QU8A 3AUXA 4KEAA 4ODIA 5DYWA 5HQTA 4LF6B 2E21A 4Q4HB 2FSVA 3MHPA 3QIAA 4TMTA 1MF7A 3ZVRA 4RBNA 1SD5A 1XR3A 3B2EA 3NFRA 1EVIA 1L5MA 1M2FA 4ZAVA 4RULA 4OHVA 4AN0A 2I78A 4BKUA 2PZFA 1GV0A 1AGNA 1K8RA 2C78A 2YVAA 3C4JA 4CM5A 2VO1A 3DEKA 5FT9A 3KLMX 2CJWA 2VHXA 4V02A 2LIVA 3LHIA 1BCRA 4RE6A 2YWDA 2ZYSA 3CXUA 4WOJA 5I9TA 1R4NB 3BSWA 3SXUA 1DZIA 1NR5A 1ID8A 4YRTA 2NU8A 1Z4NA 3DMFA 3CN7A 3EF0A 1JPNA 3F6CA 1BEZA 2O0HA 1GZ5A 1RFLA 1DDOA 2R97A 3SZGA 5D86A 1B6GA 1IFXA 1EQUA 1XEXA 2RGYA 3AKDA 3FPLA 4I4TA 3UK7A 4DAOA 4YCNA 4U6SA 4XQCA 4S0XA 1MT3A 3LRXA 3PP8A 5H9VA 4B2PA 3NIDB 3ZJTA 5F9FA 4O4IF 4NCKA 2Z0MA 4X8MA 3S1SA 1PD0A 4E4RA 3PCTA 3OO0A 3RQIA 5DI3B 1T9DA 1TLTA 1U8FO 3VO2A 4O4LB 2JFUA 4YB8A 4XPZA 4O1HA 5CH5A 4HLQB 1E0JA 2C4TA 1G63A 5I7FA 2HFKA 3FVWA 1OA1A 4E08A 3WGGA 2BE9A 4D9NA 4JL5A 4GOXA 3GB9A 1QDUA 2WQ6A 2EZ4A 1PK8A 1WHSB 1EGHA 1YTLA 2KS6A 4GZLA 2W5UA 3MBOA 4KWCA 4DQLA 1CQIA 1DQRA 1JTFA 3OCWA 1SVOA 3RT1A 3IX7A 5CJJA 2JGDB 3EXEB 5KX5B 1G5IA 3U4HA 1MGOA 1YBAA 5IW8A 1GZUA 1P1KA 2QIOA 1I3MA 2ZBGA 3KTAB 2QP3A 2BGMA 2GN8A 2Q4EA 3QF4B 4RHFA 4N65A 5LNK1 5LBTA 3GLSA 1BJRE 2Q0XA 8ABPA 1TYEB 1LVUA 1AS3A 4Y9SA 2C99A 3ZK7A 3EC7A 1JLKA 5AFSA 3EVDA 5SV2A 1QHHB 5IC6A 3ZE9A 4F2DA 1YASA 4UULA 4YAUA 3PDIA 4Y6OA 4XEUA 1FFBA 2FF7A 3CJTA 4N5HX 1F6DA 3ETGA 3LJKA 4HXEB 1G55A 1QO0D 3UPDA 1E2FA 2EFYA 4TROA 1U5BB 4BATA 3AW9A 2VHWA 1QM5A 3FBTA 5FNVF 5KYGA 2XZLA 1DFHA 1U0LA 4WBXC 1UOPA 3CSUA 4KRFA 2B8TA 1O6FA 5FTMA 1FP4A 2DWUA 3L7DA 1UKBA 2CCKA 2WFZA 5HKKD 3T1YB 1JGTA 3MN1A 3G8YA 4LDRA 4LN1A 3WB9A 3TVDA 3ML1A 4JEMA 2OXCA 2PH1A 1E1RD 1L4HA 5CGZA 5KREA 3A1DA 3VKVA 3TX6A 4ENQA 2O1SA 1SXJC 2DSNA 3R5TA 1E1QD 4MYCA 4AXXA 5JDIA 1SPXA 5ALMA 5AUOB 2HPZA 1JA0A 5BWCA 3K05A 3EGWA 4YCCA 3PT5A 2QN6A 3USES 5D7BA 3O1IC 1M6EX 3ETHA 4ZVKA 2DLCX 3OLYA 3DSRA 1YIDA 3PB3A 5FTKA 4UATA 4OA8A 4CKWA 1HDCA 5DX1A 2G8LA 2Z1MA 4UHBA 2NUTB 1Y6GA 5HHTA 1I9GA 1XCLA 5AI6A 3KUUA 4JY7A 3I53A 1NAHA 4REMA 3RB8A 3E3LA 1OAOC 4P08A 2WFMA 1KXZA 1V0JA 3TEMA 1TO6A 1JTVA 1R0ZA 2KBFA 3U44A 1A2KC 3C0KA 2VHTA 4A15A 1ENZA 4YIKA 4I4TF 1QNFA 2XCQA 5TPWA 2I80A 1XJCA 3QMWA 5AI8A 3OTWA 3HO1A 4F2GA 1IBCA 2BKXA 2JI9A 5TXGA 3RUDA 1LJLA 4R0NA 1RM3A 4U7PB 3EA5A 4KQJA 2H29A 1WETA 5FO0A 4E6EA 4JXZA 4KN9S 3C5EA 1J8YF 2Q5EA 4CQMB 2CNOA 4EI8A 1Y33E 1BHQ1 3GT3A 2DCUA 3EUAA 3PF9A 6REQB 1QVVA 1LQUA 2HD4A 2ALJA 4ZOQI 5LU8A 1QQ7A 3DXYA 4DMGA 3D4PA 1K5GA 4HZUB 3DHEA 4KMOA 2A94A 3A1NA 1IXZA 2XAAA 3AKCA 1W25A 1KDOA 1RRMA 2OAGA 4IIGA 2PGNA 1T8RA 1DSSG 2W6MA 2Y6VA 3EIWA 4PLYA 4RV4A 3OBIA 5TMDA 3D2LA 4C0QC 1UP4A 1PNQA 1Y4UA 3DB1A 5TVKA 5KJCA 2CNLA 1F12A 4OL9A 4C0XA 4GDMA 1ZRNA 5EMNA 2YBDA 3T3MB 4PX2A 2AC2A 2IEDA 2DUMA 3IAS6 2CSXA 3P27A 3OFND 5BWMA 3EAFA 1NKSA 5KU1A 1PGJA 5CB4B 4OQLA 1ZRHA 2VJMA 2YRFA 4YY3B 3QFRA 4D82A 3R9XA 5JS8A 5D1NA 2AEFA 1SUWA 1U9YA 1JYEA 1NRXA 3WR5A 3WZMA 1VL8A 1OREA 4HNQA