1EBBA

Bacillus stearothermophilus yhfr
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
202
Chain Sequence
b'ATTLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAEIVRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAAFKDTPLDHLWSPPYMYGTSVTIIEVDGGTFHVAVEGDVSHIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATASE
molecule tags Hydrolase
source organism Bacillus stearothermophilus
publication title Structure and Mechanism of Action of a Cofactor-Dependent Phosphoglycerate Mutase Homolog from Bacillus Stearothermophilus with Broad Specificity Phosphatase Activity.
pubmed doi rcsb
total genus 68
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ebbA00
1DKLA 3IT3A 1SKBA 5CU7A 5PGMA 2H52A 2ENWA 1YJXA 3LG2A 3O0TA 3HJGA 1T8PA 4GPZA 2YN2A 3ZHCA 2A6PA 1DKPA 4ARUA 1RPAA 1RPTA 4PGMA 2P2ZA 1QFXA 2P77A 1C80A 3DB1A 1UJCA 3GW8A 3C7TA 2HHJA 4EMBA 1EBBA 2WU0A 3DCYA 2P30A 1BQ3A 4MA4A 2H0QA 4HBZA 4AROA 3MBKA 4E3WA 4FDUA 1FBTA 5AJYA 3FJYA 4ARVA 3EOZA 1H2FA 2YN0A 3EZNA 2GFIA 3K4PA 2DWPA 1TIPA 1E58A 5AJXA 2EOAA 3LNTA 2HPAA 1BQ4A 1C7ZA 3E9DA 2P78A 2QNIA 1V37A 3IT0A 4D4JA 1SK9A 1SKAA 4ARSA 3D8HA 2P6MA 1C81A 3FDZA 4ODIA 3NTLA 2WNIA 3BIFA 3NFYA 1DKMA 3D6AA 2HIAA 3GP5A 5HTKA 1DKOA 1H2EA 1V7QA 4PZAA 2ENUA 5AK0A 1E59A 5CX4A 4EO9A 2WNHA 3IT1A 2F90A 4FDTA 3PGMA 3FDZB 2PA0A 2P79A 4PZ9A 3K4QA 1DKNA 4D4MA 1CVIA 1RIIA 4GPIB 1QWOA 1DKQA 2BIFA 1ND5A 3KKKA 3F2IA 2IKQA 2DWOA 3QPWA 3OI7A 2P9YA 1ND6A 2OWEA 1UJBA 3E9CA 4IJ6A 2EKBA 2P9FA 3QPVA 5CDHA 5HR5A 1XQ9A 2P2YA 3F3KA 2P9ZA 4JOCA 1K6MA 2EKZA 1SK8A 5AJWA 3MXOA 2A9JA 2P6OA 4JODA 3IT2A 2H4ZA 4JOBA 2AXNA 2H4XA 2OWDA 1NT4A 3E9EA 2RFLA 3LL4A 4IJ5A 3D4IA 4D4LA 3GP3A 4QIHA 2I1VB 1IHPA 2P75A 5AJVB 3QPUA 3R7AA 4D4KA 1FZTA 1QHFA 4TSRA 1YFKA 5AJZA 1BIFA
chains in the Genus database with same CATH superfamily
2N3ZA 4PSVA 1TT5A 4MA0A 2GARA 2FZ4A 3OT4A 5ESWA 3C41J 1LBTA 3PUHA 3G79A 4H0NA 2O3SA 1K7XB 1MVLA 3F7MA 2FOLA 2R8XA 4AURA 5TC4A 3SJBA 3KJQA 1XBTA 1QWSA 1UKVY 3WBBA 4AWXA 1ZHOA 1GD1O 1UJMA 3GLSA 5EOVA 2V1UA 2WKQA 2J07A 1Z12A 7MDHA 2J3IA 3GFTA 2IC5A 3QLTA 3R9XB 3AM3A 3PE4A 3WA6A 4X0EA 2ZT5A 4ERNA 1YI1A 2YW9A 1QR6A 4JH0A 4BWVA 4C6TB 3STTA 4RIHA 3K05A 2JFFA 2JGMA 3O73A 5D3MA 1KI6B 4RHFA 4ZO7A 4GX2A 1NP7A 2D1YA 1T5IA 4EBFA 3KJHA 2E2WA 2Z4RA 1AZTA 1CQWA 2B35A 2B92A 2CXUA 1WAMA 2EIXA 3FIUA 1QVZA 3UV6A 2BFBB 3THWA 1QNLA 1A69A 1HDYA 2A9VA 3OQOA 3ZGYA 3TR6A 3UT5A 3WGKA 4EG7A 3DW3X 4HEA6 1V35A 2UYYA 3IQZA 1DRJA 1QOPB 4X65B 2UYOA 4OHFA 5BNIA 5MDHA 1WKCA 4ZIRB 1REQA 4MVCA 3UNXA 3WWZA 2FZEA 2HU2A 2ZZKA 4IWNA 4K9LA 4OO3A 5EFZA 3ONVA 3IJEB 4UCQA 4KVAA 1SVKA 5FO0A 1RBMA 3I9KA 4RJKA 1M2VB 3WB9A 2J6CA 3WQRA 4OHUA 3R0ZA 4D25A 4R8MA 1R00A 3PXEA 4RKFA 3R4CA 1E59A 2JZOA 1L7EA 1J0CA 1KSFX 2VH2A 4MRRA 3DBLA 2DLNA 2NZ2A 2A9QA 3Q7QA 3BWCA 4QD3A 3MWEB 3O31A 4Y1RB 4ZC1A 3VR6D 1WZIA 1RRCA 2BM0A 2AFRA 1DJOA 1HNNA 3HUEA 3KC2A 1FQKA 2PKXA 3BPSA 1XMPA 3RSLA 1TJ3A 1FBNA 4N6OA 1E3TA 2WJAA 4XPZA 2OORA 3QE4A 4HPJB 2IHJA 4DA0A 4CPDA 4UHKA 3NMUF 4GL2A 1FVFA 2WNSA 3EAFA 1D8AA 3C1OA 3IP6A 3MT7A 1KK1A 4C29A 2OCDA 3K5HA 2C03A 3HUDA 3ZU3A 2O0MA 4BV9A 2CL5A 1LC0A 3FIJA 1Z4QA 2AKEA 5J4YA 4PC6A 4F04A 1WB9A 3FHTA 1P4HA 3AEKA 3I4CA 3KSRA 3UOAB 4NKRA 5CGZA 5DYTA 3QPVA 1KO1A 3EVDA 2WZCA 3VRHA 3WMWA 2DPGA 1FSGA 5F77A 3UC9A 1D04A 1FFSA 2I3ZA 2NTJA 3TTTA 2OBXA 4EAAA 3F3KA 2JIRA 4LYFA 3DEAA 2QT1A 3ADKA 3ANNA 3CZAA 2G8LA 5EKUA 4HS9A 3AF4A 4P6VF 3RUEA 1YHYA 5GTDA 4I66A 3LF1A 1NC3A 1QMGA 1TK3A 4JJZA 5EUQB 2ZRFA 1BEEA 1FNCA 5KWEA 3N0XA 2TMKA 1JPNA 1KNXA 2H00A 1JG4A 2V8BA 1A95A 1ZK2A 3B1KA 1Q3TA 3HJCA 1GUFA 3GDWA 3GBSA 3QLVA 4M0DA 2JJ1A 4C7XA 3P2KA 4HATA 1KJIA 4H3SA 3LBIA 3O3MB 1E99A 1B26A 1YZYA 4MW4A 2VXOA 3BTOA 4DUPA 1SM4A 4BFSA 3SZMA 2CMHA 2C99A 2XR1A 3N8GA 3CTPA 4R9RA 4CM4A 4G85A 1GT91 3MFQA 4WT7A 4MGHA 4CDRA 4O0LA 4A5OA 9LDBA 3RYCA 2BCGY 5ELXA 4CMKA 3FD8A 4B17A 3RC9A 2O1EA 3NIGB 4BLRA 3JQ8A 4DC1A 3AESA 1MRSA 1RJWA 3UUGA 4DYHA 5JQGF 2PWAA 2XYPA 3B1JA 3DO6A 3OZDA 3DFKA 3SICE 1DPFA 1T6YA 4HEJA 3K09A 5HF8A 3M1IA 5LZ2A 2ETVA 3NJ4A 1HF3A 3GT4A 4MKZA 3REOA 1ZY2A 2FMHA 3CRW1 1P2TA 1N2HA 2C2HA 2JASA 5DM4A 2B61A 5TE9A 3GJXC 1O89A 4YV1A 3W1VA 1ILEA 2ODTX 1T2DA 1CY8A 4NG4A 4ZI7B 3L0ZA 4MQEB 4DYDA 1KJYA 1WB6A 4YUWA 2F6RA 1RCTE 3U0VA 3MMNA 1YAHA 2H16A 3FCXA 1Y1LA 1G19A 2Q7DA 3ZV4A 5G3YA 3T7JA 1CB0A 3IHWA 4EPVA 1MHTA 1G20B 2RGDA 1V16A 3KHTA 5C1PA 3LZCA 3VR3D 3WRYA 1UPAA 1IC6A 3IA2A 1AM4D 1PGNA 4IXTA 3G2QA 5E95A 2EXXA 2I99A 4GLLA 4J4HA 4HCJA 3VPGA 5E7IA 3ZXXA 4JC0A 4CJXA 3Q8MA 2Z1MA 4QG7A 4Y2HA 1VBNA 3QYPA 1JKIA 2R6AA 4TKVA 5GIOE 4JLSA 3U19A 3ZLVA 1UH5A 5BN1A 2V98A 4JVMA 4FJ0A 4QICA 5AK3A 1DCTA 2HU5A 1HYQA 4RJ2A 2F67A 1IZ8A 3NBMA 3OKAA 1MUUA 5B4VA 1ZK0A 4LC0A 1BNCA 4PZUA 5F2OA 3QJ5A 4QUAA 3SFTA 1JDVA 5G0WA 3FTDA 1ZM4A 3UK6A 3WA7A 4AYXA 2ZUBA 2HMAA 5EY5B 3R40A 5JQGB 4EENA 1JYEA 4AU1A 3Q88A 2XUQA 4G5OA 5DRYA 2UVPA 1E0AA 1QP8A 2O8EB 1SC6A 4KKVA 3UOWA 4CMGA 2LUOA 5K4HA 1VIVA 2JIPA 1PEKE 4OQMA 3PEUA 1AGNA 4GUDA 3FI0A 2OGUA 1I2AA 3GAZA 1O96B 3M4NA 1TEHA 4ZDWA 3TIVA 4D5GA 1A97A 1I9GA 3TZQA 3PB3A 4WKPA 3RVJA 3U44A 5JZBA 3OF2A 1MABA 2BJWA 2EKQA 2Q8NA 1XKQA 2AD5A 1E18A 2BEUB 3LYUA 4HLNA 1JGTA 3MRVA 3QA9A 3RIMA 1AQJA 4WN9B 4KMRA 5DN6A 1ACMA 3PTZA 1BGWA 1K9VF 4Y2XA 1Z6AA 3HB9A 1GZVA 5EIBC 4BVKA 4L4XA 3CV3A 1CS4C 4TV9B 4X84A 2D6FA 1SG9A 2W0SA 1LV8A 3FLAA 1PFWA 4G9BA 4B34A 4CV3A 4MJ3A 3E2MA 1EMDA 4A8JB 1SCBA 2GETA 1MJ5A 3RV4A 5DCLA 1CS0A 1GQYA 2IZ7A 3KQOA 1QVWA 1M0SA 5HK8A 3ZY6A 4WOPA 5EE9A 4IDHA 4QIHA 2VK8A 2MSDB 2RGBA 1F60A 4HAZA 5AJVB 4EG0A 2ZEJA 4RW0A 1BH6A 2E7ZA 2R00A 2VHQA 1Z6QA 3ZYCA 4P3YA 1TA9A 1GPYA 1YFKA 2D62A 2PXCA 2EFYA 3DOIA 3JPYA 3L8HA 3OA0A 4GRIA 5AJZA 5HXAA 1SKBA 3I09A 1IQRA 4KKXB 3K70D 1QP7A 1K1EA 4BNVA 3CF6R 4M53A 3GBVA 4QOJA 1NBOA 2EJTA 1EXWA 3AV3A 3P97A 2BKVA 4IHAA 3R9KA 3UHFA 1XLTA 2H51A 1Q3HA 3HDGA 3PICA 3IVXA 1XCJA 1O5IA 2UAGA 5ADHA 1FY2A 4I4LA 3M3DA 4NG5A 3FTCA 4O2BA 4XM2A 4LVOA 4ZVMA 4GEKA 3LBHA 1JW9B 1OV4A 5DJ5A 4OTZA 1P74A 4XGQA 2B1QA 2CLFB 1IHYA 2X2OA 2UUBB 4WUVA 4NBWA 4UQOA 3EXEB 4Z3DA 3V33A 4IDFA 1V45E 2HU8A 2HXYA 1Z47A 4GOMD 5EJEA 2O8CA 1SH7A 2H07A 4OBBA 4X1KB 1ZIOA 5BSRA 1II8A 1STOA 4KO8A 1YHNA 5IN4A 1MQAA 4MIKA 3ZDEA 4A16A 2CSXA 1VYTA 2Y92A 4G24A 4BNHA 3A37A 4KXMA 4QPZA 4LHEA 3FG9A 3C24A 3I0ZA 1M2GA 4IQ4A 4B1FA 5FWYA 5AIAA 1E2JA 1ECLA 1Y3AA 3HVKA 2X3YA 1ODLA 1I14A 4Z2AA 1AIPA 4ZCLA 1XMJA 4CL3A 4GMKA 2PPVA 1Y7PA 3IIIA 3QFFA 4DA8A 1SXJD 5JH7F 2DRIA 2VYNA 2HXGA 3JTMA 2PYZA 2ONZA 4WKCA 4J0HA 4MLZA 2VZ9A 1CY6A 4JEIA 2QX9A 2H8KA 4PQRA 4ZGBA 4CT5A 2OZKA 3C6MA 1GPJA 2VZLA 5DYWA 3NWPA 3KDAA 3QHQA 1ZC3A 2IDZA 1XDBA 1KI1A 4UM8B 2G9VA 5JASA 3TEMA 3NIFB 4ERXA 1T9HA 1JVBA 3MT0A 1I24A 3KEMA 2NPOA 4OQNA 5D3ZA 1LQTA 2GCPA 4J3FA 4M0MA 4UFPA 3NTOA 2V3CC 1ZI6A 5JAQA 1GNVA 3QW2A 1Z28A 4UM9D 2WPDD 3H11A 2O6LA 3ZHTA 4L8LA 3GPLA 1K4KA 1UFVA 2HEIA 2WA2A 3P9IA 4N0DA 3ZZMA 1WKVA 1JEEA 3I4FA 2FK8A 3QWBA 4OH1A 4FFNA 2W2NA 4IOKA 4WFIA 4I5GA 3BMOB 2XGGA 4OOEA 3HB4X 3H2HA 5EWLB 4ZD6A 3VU0A 5SZJA 4FYPA 1U3GA 1J0AA 1GGJA 3BBLA 4R31A 3THXB 3F47A 3FNEA 3IAHA 5HIJA 1SU8A 2E1RA 2X4GA 2FSHA 5HQ3B 3H4VA 3LQKA 5JOQA 1MOQA 4P3KA 4L73A 3VI3B 2I6TA 3BHJA 3M6XA 4KO4S 4NMLA 4CTMA 1AQIA 3R23A 4FMDB 4JT4A 3BE8A 3DP7A 4KBFA 4P4GA 4ZQFA 3UMJA 4Z5XA 3FDFA 1GNPA 3ICQB 2FFRA 1E5QA 3H13A 1G20E 3U4HA 4CQNA 3GC6A 1XDDA 3V97A 2FNAA 1EUCA 3IKMB 3CX6A 5IT9A 4F4JA 3ZZ1A 1KNQA 1V5IA 4KDCA 5IU6A 2E18A 1XZHA 4QREA 4RV5A 3OCJA 4OYHA 2OYRA 1NM5C 4XR4A 1EVJA 3QUAA 4MULA 2C5HA 1C41A 1VZ3A 5DGTA 2IIPA 2A9KA 3EXFB 4NK5A 1S2OA 2AV6A 2AG8A 4C4AA 4NBKA 3I6ZA 4W5HA 1KJNA 2PZJA 4JV5B 4NU8X 5CVDA 1KHHA 1AURA 3ACCA 3NBAA 3TQSA 1O7JA 1G5RA 1F38A 3ZXYA 4JIGA 3GJQA 1XCLA 4RPKA 4AICA 2CFIA 4BCCA 4DCUA 1TUEA 4RK7A 1TECE 2B4YA 3AUJB 4OI1A 1RCFA 1WQ4A 2DFPA 2OUIA 4BN5A 4BBPA 1ZNQO 2H2HA 3RG2A 1E9FA 2IYUA 1EZZA 2G6TA 4CTKA 1U3UA 1WUJS 2KB0A 2QUBA 1NA5A 1CUWA 1ZUWA 1KO4A 2JAQA 4FWBA 3WWYA 3FKQA 4LMPA 3OZEA 1CU1A 3QWHA 3HNPA 4HNVA 1EGMB 2NWQA 1FRVA 3CRVA 1F8FA 4LOKA 2RARA 1GN8A 1DEKA 5EXPA 1ZSNA 2P2CA 3GGGA 3BRQA 1WZUA 4PR3A 3ZBQA 5BOSB 5I7HA 3FAKA 2GR9A 4IYJA 5E38A 4F4HA 3GLVA 4ROTA 2YXDA 5B3JA 1O03A 1C1DA 4G86A 4K03A 2JFQA 4X97A 4GIBA 1HE2A 3HRKA 4TSFA 4HXFB 3TD9A 5E9WA 3LVRE 2P11A 3E4CA 3EVNA 5NLLA 4PANA 2J6BA 3BGWA 2FZLA 4ZT3A 4G25A 1AN9A 3E53A 3SG0A 2HA2A 1RTKA 1OMOA 2JI7A 2EQBA 1YVRA 5B7NA 2E4YA 5E1OA 3SHTA 2ZRKA 5K0FA 1ZHFA 2O8DB 1X1QA 2FPXA 2WNHA 4HF7A 4CI9A 3VO1A 2NZ8A 1USWA 1Y8RA 2EX0A 4IGKA 1BWRA 1NLUA 3D2AA 1Y6JA 5JR3A 3M6AA 3RKSA 1M34E 2I4RA 1B8NA 4OL0A 1J42A 1CEXA 3R6TA 1FVHA 1EEXB 1VTKA 4WBNB 1AVTA 1QHNA 2GHTA 1U1IA 1ACJA 3EFBA 1C0LA 4GPIB 1USGA 1C1XA 4LCJA 5TQVA 3CB2A 1Q84A 1L8LA 4PLFA 4QOHA 3EVTA 4GOKA 1N2BA 2PHZA 5DNVA 1Z5WA 3IMFA 1C3EA 3K71B 4FFDA 2BONA 4B9AA 2O06A 1X7ZA 2HCFA 4YQZA 2Q1WA 2Z43A 3OOHA 1LPPA 3QPBA 2FSIA 1XVTA 1C3XA 2EKZA 4UEKA 3WYAA 2X9GA 3FH0A 1XV5A 5JHHB 1OU4A 2D5LA 1PQUA 1VL1A 2H4ZA 1E9BA 1OZAA 1XZLA 3ND6A 4NE9A 5TQ0A 2ZGVA 1G18A 4C3UA 3IBCA 4ENPA 5TS2A 3VC1A 4E2XA 5A3RA 2PUBA 1T10A 1EA7A 2I7CA 2BI4A 2ONCA 1LPSA 4QVKA 5BNWA 5JPCA 2JK1A 3F49S 4R4JA 2ZAIA 3DOCA 1CEEA 4M1QA 4C22A 2B0JA 3JYLA 3KJEA 3F3YA 3LRXA 3LK7A 2DUMA 4N8EA 4ES6A 1JDTA 1RHJA 4RFLA 5K45A 1TZ2A 4HMQA 5KREA 5ISMA 2CT8A 3ENKA 2N46A 3NT5A 3HEMA 3GN1A 4M0KA 2R97A 4MKIA 4MDFA 2FPRA 4X54A 1ZJYA 1HDEA 5ALTA 1PWEA 1ISGA 3JCZA 3N7TA 2ZWVA 1QTRA 2GCOA 2R4QA 5CDSA 2X14A 3A9SA 1YK0A 3U5ZB 1Z4PX 3DZDA 3AC0A 1FDRA 4JUIA 1U0TA 1UM9A 4L78A 3LDHA 2Q5EA 5DNUA 1RHMA 1ZEMA 1PKXA 5G1OA 1G5PA 1GUBA 2B3TA 2I62A 3QBJA 3TW6A 1LLFA 1XC7A 2FZ5A 2QVBA 3OQIA 4NCXA 2AG6A 1AZSC 3DEKA 2R9VA 2SCUA 3WJAA 3ZWVA 3PDWA 2QL6A 1NQOA 1QZTA 2WW8A 1DL5A 4RESA 1ZXLA 3O1IC 3O84A 5IP5A 2XNHA 2JJ8A 2OAP1 4YY3B 2N47A 1PFYA 3IILA 4BPBA 3C16C 3LY7A 1V3TA 3L8GA 1GUZA 4ZGGA 3SQMA 4D6XA 4WZBA 2AC4A 3MWEA 4Y1RA 4NU6A 1H9BA 5EHGA 1H2AS 5K3OA 5SY9A 5L9AA 1JFSA 4YIKA 2PSDA 621PA 1A4IA 1Q15A 4LNHA 3VHRA 4YUAA 1ISHA 3BEOA 3TLYA 3JQFC 1US8A 4UTVA 2IP2A 4RY0A 3VDRA 1J5XA 3HPQA 1G7CA 4DBZA 2XLCA 5IUNC 1DVRA 1E32A 2E48A 4U1RA 4RK5A 1NOKA 2XMCA 1KPIA 1S1CA 2FZGA 1YKGA 2PKRA 3CNHA 4KN5A 3VC3A 1U2QA 3U3KA 1RKQA 1ZKDA 3VYWA 1DJNA 1OIXA 3VDMA 4DLAA 4XJTA 4CM7A 1M7HA 1KPHA 3GJ4A 3G2KA 3GLIE 4O4IB 4ZPXA 1R0BA 5H83A 5KCMA 1KY3A 2GLTA 2HSJA 3EIXA 3SHFA 4JQZA 4Y2JA 4EHAA 3KG2A 1KIMA 4O2AA 4V0LA 1MX9A 3UBTA 1IZZA 4L02A 5ALPA 3BL6A 1H6AA 3AHIA 3QRWA 2XNDD 4C7OB 3EW9A 3FX2A 3IODA 2YYYA 3GRRA 2H9IA 2BHRA 2IYPA 1ZXXA 3NWOA 3FHCB 5EYPB 1NF9A 1B0AA 1B43A 3PQ8A 3STVA 2GA8A 2G0NA 5AK5A 3KPYA 2EKBA 2Z56A 3EODA 2JS7A 3K0AA 2R6R1 1Q0SA 3C98A 3HHPA 3DD1A 4LZNA 1J0DA 2F8LA 4ZMRA 2FW1A 3QKSA 4Q1AA 4KR6A 3TTUA 1LNSA 1XWWA 5JMOA 1QGUA 4BP3A 4K2AA 1DT5A 2P6OA 3GNQA 4POAA 4I9HA 4ND8A 1YF3A 3STYA 5DNDA 5TSDA 1GNLA 2C7VA 4CMCA 3LT4A 2EFEB 1F20A 4IEFB 4O1IA 3FYCA 4HVCA 3KPUA 2WKPA 1E3WA 4FUQA 5BUCA 3P45A 2PUAA 2AXQA 1YZQA 1MAHA 1NQUA 2O8BB 5A4KA 5F9FA 4WECA 2OQ2A 3W4IA 4CMBA 2JGDA 5F4ZA 5B3AA 1NMSA 1R8XA 4G5QA 1ISIA 4YRNA 1VSTA 1Y8ZA 1ZR2A 2XB8A 1ONPA 2HGSA 2KHZA 2Q6TA 1FS6A 3CRNA 2XVXA 3BXHA 2VT2A 4M60A 3WGYA 1VPVA 1YFZA 2WFAA 4PG7A 2BKEA 2IH4A 1F48A 1T1IA 3ENWA 2BZ1A 3ACDA 3BIJA 1I3NA 3MWDB 2RAPA 1FF9A 2QE7A 1YZLA 1IOVA 2V3VA 2X0KA 3OC6A 5FI1B 5K3FA 1ESCA 4EMTA 1QE3A 2AWOA 2B20A 1BXGB 3ORQA 4RD0A 4BNNA 1CJUC 4EYGA 5BVHB 5BN3B 2WU8A 1CCWA 1DRKA 2JFWA 2E85A 1L7BA 3O8OA 1YQEA 3MLEA 4PSAA 2MR6A 4KBYA 1E1CB 4TRJA 2NZXA 1KEEB 4P1ZA 2B7CA 4TV8A 2AYYA 4PX5A 1FFAA 4JLJA 2WTEA 2KWIA 2GESA 4D9BA 3BC1A 3L0SA 2AD1A 2VBCA 2DPYA 1ZXBA 2VTEA 2C3YA 1GY8A 1OUMA 4KXYA 4OJNA 5EMJA 3CE9A 3LPMA 3H5OA 4DMHA 3FWKA 5JQGA 3E84A 5HE8A 4MH0R 5L7YA 4EJ6A 4DANA 4GI2A 2VSNA 2PX4A 3EFOB 4Z6KA 5B2FA 2ATXA 1Z0DA 1TYDE 3EVCA 3MTIA 3PPWA 1OZGA 3HXTA 2F3SA 4X41A 4B6OA 3FNFA 4EJSB 2HMWA 4ZYYA 3L46A 4FJ1A 2L2QA 2CJFA 1JDNA 3D5EA 3EW7A 1K6XA 3O8NA 4JSRA 4ZOAA 5EUBA 3ELBA 1FXWF 1TL7C 1U2EA 2R6JA 4CEHB 2WAYA 4ENVA 2XZTA 3P9PA 4ARZB 3DZGA 5LFAA 1J23A 3R3JA 1DG3A 5DTJA 4YQEA 5JZVA 3P9RA 1M2HA 2JIDA 3T9AA 2VP4A 4GMXA 1A2OA 1B0UA 1EWRA 3FKJA 4QYSA 1EVQA 3CY6A 3KL2A 3GRUA 3EPPA 4CIDA 1QRAA 4TMWA 4BNDA 3CLRC 3R5TA 3KUUA 4RGQA 1WZNA 2YOGA 2ZJYA 4DXDA 3Q1LA 3A9CA 4AZTA 5B3JC 3NONA 1IEWA 2D00A 3CNOA 3H17A 5G1PA 3SHQA 3ESXA 5JXIA 5IVIA 3TSAA 2Z6AA 1O6ZA 2GHRA 3PEFA 1ADFA 3M8KA 4LNUB 1OASA 4D02A 3MVEA 3BXZA 1MP0A 4HEA1 4A0HA 2I8LA 4QU0A 3OOEA 5LJLA 1Z83A 2YWBA 3QHAA 4P31A 1QHXA 2DUJA 2P2YA 3N5CA 3OCCA 1L3CA 3A1DA 3JQ9C 3MJTA 4H08A 3QKUA 5AKEA 3AFOA 5TQJA 2WMOB 5C7LO 1SC1A 1JQEA 1DEOA 3LCUA 4F8YA 3I62A 1I3OA 1Z0FA 1CVLA 2NU6B 3W6OA 2YY7A 1K06A 2BBSA 4B47A 1M1NA 1H3FA 2PBRA 3L9WA 2ILVA 2BBOA 5SYAA 1SQGA 4N39A 4OLFA 2MYUA 4R2IA 2DVMA 1FA9A 5DX0A 4ZVRA 1XUOA 4MIYA 1A2KC 3WNVA 4AY4A 5HIKA 3KKLA 2VHXA 3N0WA 5FT9A 4AJJA 1ZRNA 2BWJA 4XWWA 1VP9A 3S5UA 3O7MA 2C2ZA 3TCXB 4Q48A 2FE1A 3JYHA 4RLQA 3T5DA 5KOJA 4HX5A 3T1YB 3L6UA 3ZNNA 2HXSA 4E21A 2X4LA 3O2SB 4MGZR 4ZKDA 4EG5A 2XF8A 3AWIA 3M1YA 1MJFA 1RYHA 2VJQA 1JSRA 3LCRA 4UUMA 4LF9B 1GP2A 3VR4H 1MD9A 3WHKA 1D0IA 1NBMA 2ZTMA 3L0OA 3JQ7A 2Q5FA 4H9GA 5GADl 1L3BA 3T9DA 1JWAB 1AS3A 4LA4A 1EJ2A 1GLGA 1T8SA 4YWHA 2H2GA 3V8NA 4ZCIA 5FH9A 5ALQA 4YHBA 3PTLA 3LCJA 2WM2A 5H5JA 4BV3A 2BGRA 4YJ2F 2BAGA 3H16A 4FGKA 1YVEI 1OV6A 4B76A 5CH8A 3OT5A 5EZSA 4FDUA 4ZVLA 3L18A 4BZQA 1FUKA 2VF8A 4DDHA 4H7KA 1U1EA 1XPUA 1V1MB 4TS1A 3GBPA 4GP6A 3FNGA 2EERA 5F7JA 4TS9A 3QUCA 4AYWA 4NFLA 1BJTA 2HMSA 5LYJA 1A2BA 2Q2WA 3GCGA 4AMBA 1M34B 4B84A 1YVPA 1ZM3A 3TGPA 2I71A 1FYXA 3GHYA 1SC4A 3PJDA 3R3ZA 4HNHA 3QXGA 5DHRA 5EJAA 1DIOB 1L6RA 3GDGA 5EZYA 3PC6A 1ZMXA 2BTQA 3HBJA 2ZYSA 2C2BA 1HDGO 2AJLI 4RK6A 3PFIA 2Q6OA 4HH1A 4KYIB 3S28A 3WGNA 3OT1B 1ONSA 2WVGA 5KJ1A 3ZJUA 1BVRA 3FSRA 2JGRA 3V8RA 2DT5A 4H6XA 4BU0A 2YJNA 1XTUA 1Y6ZA 3K16A 1N5RA 4HP8A 4I6GA 3LW8A 4FOPA 3R6WA 4RCZA 1VGRA 4HX9A 1VLVA 5CLQA 1L5GB 3RYIA 1XXHA 3VOAA 1WMDA 3Q3VA 4A1FA 3ND9A 1CZLA 1VJCA 2CBGA 3R77A 2XI4A 1QYDA 1Q16A 3K2BA 3QELB 4IMRA 5ECDA 4ESEA 2VTBB 1TTPB 2REXB 1XKTA 2W6JD 3P5BA 1C9YA 2G77B 3D43A 5EWMB 1NG1A 2WMYA 3Q8WA 5HS6A 4D79A 3G17A 4FMBB 3UJDA 2O8FB 4OJTA 2QRJA 2KPOA 4G0MA 1QPBA 5B64A 3PNSA 4REQA 1I4DD 3RSFA 2XIJA 4I1UA 2H31A 5HRCA 2EW1A 2G72A 4C4TA 2OP1A 1MB3A 2R6CA 4WASA 3W3AA 1VRWA 1D2RA 2HYDA 4FDVA 3K9GA 4GKAA 3UCFA 2O2DA 1N2XA 4LV5B 2WEKA 3FOBA 1NN5A 1SHTX 3E03A 1PE0A 5JLJA 2PKEA 3I37X 3CVJA 2XMZA 3IDFA 4ZOCA 1RWNA 1DBSA 5DOVA 3RF7A 1A7JA 4M7PA 4HMOA 3VSDA 4ER0A 2I3DA 1G17A 4RAQA 2OMEA 1CBUA 5LMCA 3HBFA 3C3YA 1SC9A 1BG6A 1HE4A 4F56A 2YS7A 4Q1VA 3IXMA 1A5BB 3OHSX 3P9ZA 1RC0A 5EEHA 1WHTB 3BTSA 3MHPA 3NETA 4PLPA 2RAFA 4W5TA 3U3JA 4ND1A 3N6RA 1IE3A 2UYQA 4MVJE 4YJDA 3WJ1A 2P5YA 3SHWA 2W37A 4XWAA 4E22A 3ZIDA 2F8SA 1Y8QB 1IZ0A 1LTKA 2YMQA 2GF9A 3ONNA 2B4KA 3JQGB 3BSWA 1JSXA 4A3SA 1Q44A 4BNMA 5KPJA 1CNEA 2QD5A 3B5EA 5EE0A 1TEZA 3NWBA 4J3NA 3MOIA 3RW9A 1SKYB 3AOEC 5LZ4A 2G4VA 5ALLA 4TN5A 5HKKD 3TRDA 5BYBA 5E4YA 1VPTA 1A4XA 1KYVA 2F9LA 5CG2A 3JRXA 5CBPB 4AKHA 3ZI4A 1C9DB 1R10A 4QTTB 3PF9A 4RZUA 2GCEA 3SX0A 1CVRA 3LWDA 2O8CB 1G5FA 3L4EA 4BZWA 5KOYA 3PEVA 4Y3UA 2WV9A 4XDGA 4PRLA 4KVFA 1HYHA 3GLTA 1XF9A 4AT1A 5IF9A 2JIZA 2YV5A 2Y76A 2A3NA 2AJCA 1C30A 1OH8A 3U6KA 4LBWA 4TMXA 1HM5A 3DQZA 1VB3A 4LJLA 1H2FA 2ZRCA 2FI1A 4CCAA 3AM1A 2HLPA 5JJKA 1SVOA 1MIOB 4W8HA 4TL9A 1FMJA 1CQZA 2VJYA 3J81A 2AVDA 5ERXA 1YB1A 2OCBA 3QMWA 1L1EA 1EQ2A 4E08A 2OUKA 4V0ME 2FPMA 5IDVA 1H2RS 2PLNA 1FSPA 3RFUA 2YV4A 2OENG 3DMYA 4Q7KA 2OE2A 5HJ2A 1AK2A 1RWMA 5BVHA 3ACBA 2OZPA 2F8MA 1FTSA 4YPFA 4O25A 2BSAA 3SLKA 5F12A 1XDZA 4BE7B 2P4SA 4AZ3A 1GV1A 3L8YA 1T25A 4JP2A 2PCLA 2PUWA 1HO3A 1EESA 3KWFA 3LY8A 1QV7A 3WGIA 1PTKA 5ECWA 4NU0A 2B25A 2ZBRA 1NXSA 3OIDA 4CKBA 4IHJA 3KR9A 5ALWA 3C14C 1E2DA 2F1HA 3VDXA 2JBHA 3PQDA 1QYCA 3JQRA 1CZNA 1UFKA 3KR2A 4CI0B 4L8VA 1XDGA 1OH5A 1L5OA 4INJA 5JBIA 2YOHA 3IPYA 1YNSA 2NV2B 4QOFA 2C29D 3IOCA 3VR6H 4DBVO 2XWQA 2PA0A 4PRYA 1QF6A 1YA6A 2WM3A 4KMMA 4EWLA 1IN8A 1E2BA 4D2IA 2QJTA 3KV1A 3AERA 2WDPA 1O54A 4MGYR 5IT4A 4I99A 5A71A 4J7AA 5CVVA 4M7WA 5FR2A 3UFXA 3Q2OA 2PLAA 1WF6A 1Z2OX 4PCAA 3F2IA 2LBPA 4ZQEA 4R9NA 4NONA 1W93A 3THRA 3HJHA 1XGKA 4G1BA 4N5DA 3U4CA 2BHNA 3THSA 2V7UA 4Q4AB 5IH7A 2H2IA 2XQIA 3ZDAA 4P3OA 3DZJA 1BMTA 1C7QA 3IUBA 4QUGA 3LK6A 4TXJA 5B12A 5F2KA 4FCCA 4XUGB 2I2CA 1SZPA 4BX3A 3MHTA 3L43A 4A1OA 5ALFA 1BA3A 1KDVA 4FOTA 5C5EA 4BMXA 3BILA 2C58A 1EB9A 5ULLA 3OECA 1NT4A 1XAHA 3UKJA 2XCUA 5JI2E 1SELA 2GO7A 4B6PA 2Z2JA 1DG1G 5K0ZA 2WU1A 4BQSA 13PKA 1GPH1 3K92A 4YQYA 1YQ9A 3JQCA 2BGJA 4HEQA 3GXOA 1JPJA 2XUFA 2QW8A 3K0FB 3ZZNA 1EGQA 1Y4UA 2PMDA 5FYDA 1ZM9A 3IT3A 3PUZA 2UZ3A 1R88A 4QFCA 4EUKA 2CF5A 2VUSA 4WH0A 3PQ6A 5IN5A 1M8JA 1I3MA 1L9KA 3LX5A 1T0PA 1Q1BA 2C2XA 2VK2A 2PX0A 2B36A 3LO5A 1QZXA 5P8WA 1IBCA 1SOUA 3DE5X 1IPHA 2HCTA 3PI7A 2MINA 3A4VA 3IYLW 3UK2A 3B2QA 1EFTA 2Q46A 4XPIB 2R6HA 3G2LA 2DFVA 2FSVC 2L0XA 1BE8A 1QHGA 3WWCA 3Q3IA 5IKOA 5JAPA 2GVNA 1L4HA 2DX7A 5IAEA 5BY2A 3KO8A 5A6SA 3EIQA 1FSZA 2CC2A 3GLHA 1GN9A 2FP4B 1KOJA 1EDEA 2XUPA 4UVGA 5DEOA 2QZZA 3TW0A 3WWDA 3FMFA 2IZOA 3EGDB 3NIDB 5AJYA 4DAEA 3AHJA 1SB8A 5EMKA 4PBTA 1Z7EA 1R64A 2OXIA 4DPKA 2VT3A 4M6WB 5IBCA 3HG7A 2XJ9A 1UKAA 3F3MA 4NOJA 1B8PA 2B98A 4GBED 3BMNA 1VKZA 1LDBA 3VHLB 5B1DA 4N47A 4KVGA 2GZAA 4LYAA 5I7EA 2CN1A 1W0JD 3CU5A 1SHLA 4LXUA 4JENA 4EW6A 3T1OA 5HDBB 1YBMA 1JQLB 2P4EA 4KXNA 2N42A 4DNOA 1DLJA 3IAM1 4OPMA 1FUYB 1QE0A 5DWDA 1YGYA 4C20A 1H4SA 3MWJA 3MMPA 3VKVA 1G4AE 3CZPA 4H1TA 4C7OA 1UBOS 1FS5A 3L1KA 3OEEA 1NWHA 1D1QA 4R05A 4FE7A 3VR2D 2V8OA 3VAYA 3TINA 3I5MA 3TG2A 4Y6PA 4RDCA 1E1QA 1XROA 3H83A 2Z1NA 3N2IA 4IWXA 4AS1A 1V47A 1MGPA 1KO7A 3ZN2A 4EGSA 5IUJC 4DW8A 1ISJA 2BTEA 1AU9A 4U7HA 1X87A 5D7NA 1N1EA 1BU5A 2ZM5A 1OBFO 4ZI3A 4L9RA 1VPDA 1JEYB 3PPIA 4BFWA 5I5EA 2M1ZA 4W1RA 4CU2A 4ND8B 4A7PA 5F5LA 3OWXA 4CQMB 2AOUB 3K2IA 1QLWA 2ZSFA 2Q3BA 2Y66A 2W48A 2D8AA 4NOMA 5EWJB 3VZSA 3QWFA 4RK1A 5AKZA 3U81A 3W1WA 4FIDA 2WZBA 1JLKA 2PS9A 4YECA 2PL9A 4Z4CA 4B3TB 4OLHA 3M9LA 1YQQA 5EIXA 1J6UA 4WLOA 2D0DA 2XYGA 4GDFA 3O2QB 2GPJA 3J7TA 1V9LA 1ZOSA 5FUYA 5SZHB 2Q45A 5EKXA 3ZWPA 4R71A 2F3QA 1X1EA 2PQ0A 1KAGA 4K9QA 1SUSA 3AHDA 4QBIA 4JWKA 5CX1B 2PV0A 2QTFA 2ZS9A 3NDRA 3A3PA 1B8UA 5AJTA 2ZP1A 2FR0A 2PU5A 3GGDA 3DQQA 2WIKA 4E5SA 3LRTA 1N3IA 4CE6A 4GYKA 4LBYA 4RUKA 3ODGA 3TH5A 1QV9A 1Z33A 1XCGB 4NYJR 1AGYA 2IELA 4X63A 1Z37A 1YRHA 4P38A 2P6RA 4WLNA 3HY6A 1BGXT 3ENNA 5FTKA 4KWIA 3L02A 1KTVA 1U5BA 1IJFA 1GKKA 5K5EA 2NNLD 2Y1DA 2YCBA 4NEHB 1E64A 1TQ6A 2ZI5A 4R0MA 2A33A 4MW5A 5EIHA 1YMVA 5A1TA 5ECYA 5J47A 1ZWKA 4GUAA 1IZ9A 1PFVA 2IOFK 3A1SA 2YV2A 4US1R 5MFZA 2Q9BA 1XFDA 2PGNA 3N0TA 1WHTA 3MAAC 3UWSA 1UAAA 3ROFA 4AJ4A 1PTJC 3MFYA 2Y4OA 1K2WA 3BCUA 4PW0A 2FSGA 1L5HB 3EEQA 1G2OA 1K86A 1DIBA 1PNOA 4IVNA 4WDRA 1RMYA 5EKSA 5EZQA 3RBVA 3WL4A 5G40A 4EKDA 1LJLA 1JR2A 3LUBA 2Y4NA 2ID8A 3NLLA 1LDGA 2H4YA 1G8KA 1A76A 4UMFA 1ZX1A 2FPIB 3K0HA 2JFYA 2XCIA 1UBSB 5AXBA 4P8RA 2FU5C 2HIHA 3D6FA 3DZHA 3IP1A 1FBTA 4UNRA 4NFSA 2FX5A 2AOTB 2XUOA 3W2GA 3OCVA 1P72A 3BCRA 1RJ9A 3QVLA 2ODAA 4IIJB 2YMLA 4R6XA 4IFTA 3T3DA 3ZWWA 1NNEA 4G0ZA 3T3HA 1YB5A 4ND4A 2R8OA 2JIOA 3AL2A 3LHKA 1A8SA 3LU1A 3OKFA 4PZEA 1FRNA 3C43A 2JLCA 2BPOA 5DV9A 4I5EA 1ZRMA 2OXCA 2EEZA 3TNJA 4FDMA 4YXWD 5I7OA 3AY3A 4BMOB 1Y3DE 3IEIA 4YMHA 5FA6A 5KCZA 2MYNA 3IDOA 1JIKA 2AG1A 4UMVA 2IS1A 2FUCA 1RZ3A 3COPA 1GAEO 4CG3A 4X1IA 2R1VA 4PLTA 4L5IA 3E15A 2HK7A 3T9BA 2G6BA 4YRSA 2BL4A 1LKZA 3FUXA 1TO2E 3KT3A 5AK0A 4AI6A 3M4JA 1JDJA 4LXTA 1XRSB 4OB7A 2C0QA 2IXBA 2EWVA 3D2CA 1ZKMA 3Q3HA 4KK4A 5ALXA 3PIIA 2ZE8A 3CRZA 3IOYA 2OFOA 2H2DA 3AJRA 5DGXA 3CJTA 3CNBA 3DNMA 3EOAI 4C07A 2WUDA 3I05A 4B73A 1YMQA 1D4OA 4IY1A 4DWWA 3UJ8A 4QJ5A 4TXNA 1N4AA 4E5KA 2ZPUA 3IQFA 5ALRA 5FPYA 1F8UA 3UJCA 1CNFA 4TVOA 4HB3A 4P0TA 2JAPA 2Y1CA 3PKJA 2C2MA 4L15A 4BQPA 4GQBA 2E87A 3F4LA 3K5WA 3RLFA 1W94A 3OE7D 4CFSA 5H7XA 1JEQB 5FA8A 3TLZA 2D5IA 2PQMA 5IDQA 3NRBA 4HGPA 1AK9A 1LWOA 3NU1A 3JRNA 2JGAA 4WZBB 3B3FA 3P26A 1MTZA 3Q6MA 3SIPA 4JBLA 1NR5A 4DABA 4COKA 3C7AA 5B58C 5EIWA 3ZU6A 2ZRLA 1GCUA 1E3MA 4C3VA 1BE1A 5IWCA 1R27A 1WXHA 3R09A 2AL7A 4RVHA 1G59A 4IKPA 1QQ5A 3L7YA 1A5SB 4Y2PA 5HIIA 3ZZTA 2W4QA 5HRAA 3DDHA 3RAFC 2EBHX 3EXIB 4EG4A 4AY6A 3MWGA 1N2EA 1L4BA 4KPFC 4OYLA 4ZQIA 1NNSA 3DEHA 3KKMA 4NVRA 1L7PA 1YDGA 4DNQA 3DFMA 4RL6A 4Q3KA 5FQNA 1PW7A 2YHIB 3REFA 3KIPA 3KM0A 4NDZA 1E3SA 2QZPA 2YH2A 2WIDA 4PQFA 5F3DA 5CB0A 5CNMA 4LXHA 3ETHA 4KQ1A 4DA9A 1S89A 1U2DA 2DSNA 3RS5A 4DDUA 3V1KA 4LV8B 3TNFA 1BCSA 2A35A 2ID7A 4ZT4A 1FYWA 2FKNA 2H2WA 1LFDB 1K66A 1WDTA 4W7IA 3SF8A 4BASA 1ZVVA 4H4EA 4YFVA 1H2XA 1NHWA 3L8EA 3EGXA 4QUBA 4UEJA 2GBIA 4TPKA 2H8GA 5MN6A 2DQ4A 1V3QE 5DSXA 5K8UA 5HKKA 2TMDA 1E9CA 2VHJA 4XFKA 4MI3A 4GO1A 4IOLA 4TL6A 1M2WA 3KZ1E 4HGQA 2JW5A 3FSEA 4JI4B 2ZLBA 2IVZA 1OJ7A 1W49A 3P2EA 3IOBA 4QU9A 3D4OA 3KVYA 3TM4A 2B8EA 2GOYA 3GVCA 3GCZA 3QVTA 2F1OA 5M3BA 2PSSA 3ZY2A 4EQZA 5BNFA 2IODA 4KQHA 4PHGA 3ZHXA 4OMDA 1LQ2A 3LECA 4DPLA 2GHQA 1SXHA 5GM1A 5LMUB 4FC7A 2VTBA 5AW1A 2VG8A 1F8GA 1SOAA 2J46A 4YJ3A 1NVKA 1UMBB 1QH8B 5IC4A 2HCBA 1I6WA 3FNBA 2ZXUA 3WK6A 1N6IA 4KL8S 4NS4A 1X70A 5FFFA 2ZSIA 3PHBE 5AJHA 1ADBA 5ALZA 3WAKA 4C01A 1PUXA 1RXIA 2WNIA 3ES9A 3NPAA 4ZVSA 4B09A 4EJMA 5AM1A 3QX8A 1E9DA 1CY7A 5D51S 1ZW6A 2ZTLA 1IWOA 4ZANA 5A3VA 1JT2A 5DTIA 1SIOA 4XRRA 3A1CA 3SBEA 1GO2A 3DL0A 4UCXA 4Q4CA 1QUFA 2Q28A 1I5OA 4M2LA 5I45A 3L7CA 2YIJA 3TL3A 3JWPA 4MVJD 2FRDA 1EWQA 1W75A 3D1JA 1X8XA 2IRWA 5J3JA 3SQOA 3GPDG 1VA5A 4R9VA 1P1JA 2ORED 4MLPA 4JI2B 3KXKA 2HT1A 1U6JA 1YL7A 2MSEB 4TZTA 3KTAA 3INNA 1XD2A 4P92A 4G0YA 4BUZA 5HIAA 5AD1A 2QUAA 2XBUA 3IAAA 1EFPA 1UXOA 1W4RA 4U3JB 3H6HA 2YC2C 1MOSA 1O95D 4AF6A 4CL8A 2P5SA 2B4RO 2ONJA 3RR2A 4FKMA 3KOWA 4YLGA 5L4NA 2JFZA 3GVPA 1ND6A 3MJCA 4KLCA 1K9SA 2QTTA 1KZ9A 1Y4ZA 4DWOA 1Y33E 2RGWA 2ID4A 3H99A 4C7VA 1VSBA 2AOXA 5CYGA 1PR2A 2NQ2C 2V1XA 3RVMA 2Z6VA 5DBOA 4D5EA 1SU6A 1PZMA 4HGNA 1KI9A 3GD7A 2UZ0A 4JODA 3W5AA 2GASA 4NX2A 3ENQA 2BTOA 5E2AA 3E8XA 3OU2A 4Y30A 1H9AA 5K4AA 4TTAA 4KFUA 4ENQA 3QXHA 3KD3A 1OX6A 1ECGA 1QORA 2NYUA 1GTG1 2WJWA 3E7DA 3MD9A 3KEOA 4TYQA 1T91A 4FZVA 4LGYA 5J5CA 1QRSA 3VKGA 4YP5A 1OY1A 1WD5A 5BSVA 4HFMA 4TUYA 5F21A 1A96A 2Z98A 5IANA 3VO9A 3DEFA 5ENDA 2NO0A 1NMYA 2HI0A 2O0JA 3CEPB 2Z4SA 3SXJA 2JIBA 5F1OA 2J0VA 2GBPA 1U0RA 4A73A 5BUQA 2FWNA 3DULA 1Y1TA 4IS2A 2P0AA 4DY4A 5BYKA 1HC7A 1OXSC 3M0EA 2IEAA 3UC5A 2HDOA 2AFVA 4ALMA 1KORA 4BL5A 4G9GA 1TVCA 4UE3S 3SZGA 1ES9A 1Z88A 2ZJ6A 2ZBQA 3PFBA 4RJJA 1CR2A 1NRWA 3ZCSA 2XA9A 3T1NA 2EHJA 3QM1A 3R5KA 1APBA 1SXPA 4BY9E 2NU8A 2I55A 2Q41A 4JVSB 4M1WA 2GZ1A 2F1KA 3FB4A 3LA8A 4P4SA 3U48A 2EBFX 4H6PA 5FUVA 3RFCA 1LLUA 3F8TA 3HA7A 3TOXA 3GI1A 5D7BA 3BIOA 4W8GA 5TQ2A 1HI9A 1Z07A 2ACKA 3GUZA 2ETXA 5CDFA 2GTHA 5AVKA 1XYGA 4DPMA 4JU8A 1RFGE 4Z7OB 1J22A 5ECGC 2EHDA 4UFOA 4UTRA 2CDAA 5GV7A 4CLXA 2PAFA 1PYGA 1U8CB 3PFHA 1S8AA 3F74A 2YFQA 2Y1OA 1FP6A 2CKDA 4U9IS 4ESHA 1A72A 3F2VA 4B3XA 4ZCTA 1DEHA 1I8TA 3IDAA 2ZDQA 1WKBA 4N0MA 4Y0AA 3E61A 4KR0A 3H2YA 3OEED 3E81A 5E7MA 3RKUA 1F0YA 2EFDB 4Q47A 1M5UA 2FRDC 3OCXA 2B34A 1E92A 3MINA 4KXWA 1XVIA 1PWHA 2HM7A 4EG8A 3AFIA 2LDXA 4OQXA 5BOSA 1WCIA 4NCBA 1KDRA 2FWMX 3CKYA 4RKEA 3CUUA 4W1SA 3RDPA 3UH0A 5L8VA 3WMFA 1E66A 2VRCD 4DMKA 3VJKA 4UMEA 2RSLA 5D3KA 2NO1A 3COJA 5JECA 3AUYA 2GDZA 4LSZA 2APJA 4JEUA 2C1XA 2F43A 5F3RA 4FS8A 3AY6A 5D3MB 1PD0A 1R1DA 2CVPA 5ETJA 3WYGA 1UPXA 4ZICA 5IJ0A 1ZN2A 4JLKA 1XZPA 2FMTA 1T0JB 4PY2A 4LMBA 3L0PA 3UHAA 1TF5A 3EGOA 3C4QA 2NO5A 1NQTA 2PZLA 2A8YA 3PR2B 2HDHA 2BMVA 4HJXA 2GJ9A 5HKBA 2VTKA 2NSLA 2FN8A 1M8KA 4ZT5A 3PUWA 3DAYA 4ZQBA 5I7FA 4MARA 3I1IA 1NV8A 4ALLA 5HZHA 2B69A 4KMSA 3PX7A 1CRPA 1D2NA 3IPXA 3O4FA 2O5EA 5IXJA 2E21A 3UG7A 3HJFA 4H77A 5JWHA 3ZD9A 1TF7A 1U4SA 3O7WA 3HL0A 1TPYA 4BQIA 4C6RA 1ZR4A 3DKKA 2IZ0A 4FFSA 5TEWA 3U4QA 2YJ6A 3CGWA 4MHOA 1NXTA 4OQQA 5C32A 4RVNA 4D9FA 1QKJA 5CT8A 2NUPB 3NWEA 1VB5A 5JQWA 1AKVA 5F7XA 2Z8XA 1OILA 3ADBA 1II0A 4R5MA 4TQUS 4RY8A 5AM3A 2H52A 4V3BA 1Y9EA 3BM5A 4REQB 3NNDA 3VFDA 2XWBF 1T8PA 3OIFA 1XTRA 4YJHA 5TV2A 1O94A 2J85A 3ZQJA 5LD2C 2DBVO 4GPZA 4TT3D 3AGQA 3ROZA 3QU5A 1F0PA 4DOMA 3GARA 1HLPA 2WD9A 3GVIA 4DLXA 3UOGA 3HP4A 3GJTA 2P2ZA 1A77A 1H5UA 3X1MA 1RAHA 1JKMA 1SWWA 2VDKB 1OGIA 2YHBA 3DUFB 1RT9A 4QJ3A 1UMDB 3W5DA 1R9JA 4MPRA 4R01A 5IYZB 4WD3A 2HMTA 3CG4A 3DBIA 1NUSA 4RD1A 2CHQA 2YWCA 3J81k 3REGA 4NARA 4J3JA 5IVDA 3SMVA 1JB9A 1M1ZA 2G9NA 1XEAA 2F62A 4YTEA 3VXKA 1L5FA 4OI0A 1GRCA 3AF2A 2J3KA 3LUCA 3M3HA 2RI1A 5JEDA 3GDFA 2FH5B 1XG5A 3DF9A 3JD2A 4EY8A 3OFSA 1JAZA 3SQWA 2HWWA 1SIBE 5IXYA 2EDAA 1K8RA 1UIRA 2P40A 4HDNA 3UWMA 5C5DA 4L74A 1SIWA 3LW7A 2XUKA 4Q19A 4R3NA 1P2SA 4UHFA 1PEAA 4MRVA 4D4HA 1CUSA 3H8WA 3FFXA 2VCHA 3GFFA 2X6RA 4Y6SA 4CMAA 1NVDA 1R74A 5J2TA 5AVQA 4HLDA 1CPYA 4BV2A 2YDXA 3EIFA 4L5YA 1HFJA 4KJXA 4WCFC 3L4BA 3S99A 3TSCA 3U7IA 3Q9NA 1LVUA 2G1KA 4JI6B 3VMMA 2W6ZA 4LN1A 3TDKA 4AJKA 2QI9C 5DISB 1ZK4A 4G0UA 5AHKA 1TQ4A 3TIIA 2QTVA 2GYYA 2F90A 1T4DA 4CWAA 2A1IA 3QUBA 4OQYA 2XUIA 3M83A 1Z5ZA 2RGNA 2LCFA 3GXBA 1N2CB 3HCCA 3MTEA 4UZSA 3TI7A 3GT7A 4S1WA 4EMUA 2HR1A 1BHO1 2C5GA 1UC8A 1L4MA 5E0KB 1F1JA 4AJ2A 3FPLA 2RH5A 3FETA 1VLHA 2IJGX 3GEIA 1WMSA 4RANA 4X24A 3R7SA 4HAWA 3RUFA 3ZK7A 4XWKA 4X5OA 3T15A 1EHYA 2PWBA 1C30B 4I0WB 1GPKA 1BFUA 1NE2A 2A94A 2W6CX 1L2TA 2EIHA 4URVR 4ZVQA 1QS0A 4ENUA 4MQFA 1T1JA 3CCFA 2DXIA 2JFNA 1QJ4A 1ATIA 2GA9A 4CG1A 1U2DC 4RXTA 3HZZA 3AVUA 1VSQA 3F8WA 1J20A 1ONOA 3N76A 1PL7A 4Q9KA 4BEVA 2XTAA 1W36D 1PX2A 1IXKA 1ECJA 2Y9MB 4X62B 2Y1GA 1XQ9A 3FUUA 1O1YA 3MC1A 2XECA 4I4CA 4KQXA 1HZZA 1BFDA 3AF0A 1F9AA 2W8ZA 3C1TA 3DCNA 3GPCA 4URHA 4AM8A 2P41A 3C5WP 4ZYVA 6PFKA 4CETA 2QMEA 5J4HA 2GEVA 2VF5X 1XQ6A 2YJ5A 5FOTA 4U3JA 4ARAA 1JKXA 3H1GA 2W8BA 1B23P 5M04A 4WNAA 5A4JA 3V2GA 1U2TA 2A0YA 1FDUA 3ADPA 3CLSC 3QMVA 3UGKA 1PK7A 3QPAA 5LDHA 2OMKA 3NALA 1VE3A 4OHBA 3QOXA 4JQCA 3IMEA 5GIPE 2RGRA 4PO9A 5GP1A 2QOEA 4NESA 5G0SA 4FGZA 3HXPA 2AQKA 5KX5A 2R84A 4GFDA 5PGMA 3ER8A 2GBLA 2FN4A 4Q4HB 4EVQA 3EFEA 2K7FA 4RAOA 4QVGA 3O0TA 3OZVA 1ML3A 1Y3BE 4UC0A 1TM7E 3EIWA 4IIJA 4J4BA 4M1ZA 3K09C 3V8QA 4Z2YA 2NYVA 2WIBA 3MTDA 5JXWA 1KQNA 3OLWA 1XLTC 4KXUA 4DV7B 5JCPA 2JC3A 4K05A 5KSPA 3DB1A 3EXAA 4BPRA 3BZWA 3N8IA 4FHFA 3TQFA 5C5IA 1NF2A 3EEIA 3N59A 3T7AA 5IX8A 4I1IA 2Q0QA 3B3QA 1YR3A 3G6WA 4FFPA 3TL2A 2CXQA 4EZEA 1EHCA 3JAKA 3MPUA 1YU6A 1USKA 2BFPA 2ZYDA 3VR5D 1NC1A 1NJ8A 2OZLB 3PDHA 5WRFA 4GKKB 2C83A 1LRLA 2CVOA 1FDOA 5A9RA 2I9PA 1X1DA 3A10A 3H6GA 3I5XA 1SRRA 4FE4A 4TTQA 2B4AA 4TKUA 1KO5A 2OOSA 4EGJA 5LD2B 1CJCA 4J2HA 3UIEA 4U9UA 2ZZNA 1J5PA 1U0SY 2VYCA 4E7OA 4EELA 1A9OA 1YC2A 2EKDA 1UK9A 4PO3X 3P1JA 5DX8A 5KNDD 5BMVF 3VYVA 4P80A 2B5VA 4G81A 2XOKA 4KVZA 4NCHA 3RRFA 4PNZA 2B2NA 4QLOA 3D8HA 2VBIA 3NIBA 3FDZA 4JCCA 1RQGA 4LJ4A 3WLPA 2JI4A 1L9XA 1SHUX 1Z4OA 4BC0A 2COKA 4FUTA 3F5SA 1E1CA 2VF2A 3RO7A 4GKJB 1X9IA 3D7KA 5ESRA 2W2QA 1WQ3A 2YHUA 1YR2A 3PXAA 2Q4BA 3IELA 1NT2A 1R37A 3K9LA 3FR8A 3V8VA 4Z7QB 2L17A 3CPHA 3KZXA 2C2OA 2IU6A 3PKZA 1T4BA 2YFKA 1P7VA 2H5EA 2FR8A 2F1RA 2VSXA 2BJHA 2HHCA 2HWYA 4U00A 2WICA 3O83A 3OZ7A 5IAGA 5KHAA 4D8XA 2HRDA 3K0CA 1Y1QA 3WYCA 5B2EA 4JKOA 2P90A 4L9AA 3LBAA 5F4BA 4UXJA 3LUHA 5D5QA 3WVNA 5AW7A 3LFTA 5EI5A 3GLHB 3PPVA 4AUEA 5CM9C 4IRUB 4N41A 1WSBA 3IE2A 4EFLA 4MRMB 1RWXA 4W82A 3WL8A 2PEZA 1B2LA 2UDPA 3FYHA 4X6YA 4CM9D 4DCJA 3CW9A 3UV7A 2IDKA 4KIWA 4X1KA 2QW0X 3EMDA 4GBGA 5BNTA 2W4MA 4PC1A 1UOOA 2QL9A 3L9XA 4IF4A 4RCVA 2Q3MA 4C03A 4HMPA 1VL8A 4ACAA 1PVDA 1PJAA 1F2TA 4W9RA 1J00A 4XYGA 3SQXA 1Z68A 4H17A 5FOXA 1YDFA 4FFVA 4YO7A 4A0GA 1LEHA 2QRKA 2CHUA 3JD3A 3C6BA 4F3KA 3OWOA 5JEEA 1H6DA 3DE4X 3FZQA 3SF8B 3KEGA 2AK3A 3EXG1 4NNOA 2W6IA 4HWTA 1B00A 4RZ3A 2ZREA 3EGXB 1IXSB 2XW6A 3D0RA 3WY9A 2CL0X 1JAYA 4RD2A 1NM5A 2EV9A 1SHJA 3P5SA 2I7DA 3DV2A 1MH1A 5KI6A 2TECE 2WKWA 4XVHA 1DJLA 2PT7A 4TTVA 2CXOA 1CETA 1O5TA 2RHRA 3FSGD 3ILHA 3PSHA 3ZK8A 5HHTA 4YUXA 4I2VA 4PYOA 1P5HA 4O4HA 1JB1A 4UREA 1M7GA 5IAAA 1RM3A 2OD9A 4FYJA 2XDQB 4PFJA 2H7XA 2NU6A 2BZ0A 3S2FA 2ZG6A 3DPSA 3OQHA 4JA0A 5C18A 3ZU2A 1R15A 3AQIA 5BSFA 1RWOA 4LF4B 1KJWA 1N4DA 3C97A 2QVXX 4AJ9A 3MT8A 5KJ6A 3QKRA 4JVLA 2J32A 1QYWA 1QH8A 3B36A 3NT4A 2CNBA 1UBMS 2BISA 1TKRA 5A3SA 1QU3A 4JBHA 3HA2A 1F6BA 4GZLA 1LS1A 3P71T 2E0IA 2GAIA 1DCKA 1U0JA 1NPDA 1HPLA 2ZSDA 1EXDA 4DBLC 1R4MB 4PNEA 4ZN6A 3AFNA 5A4AA 3WAGA 1LW6E 4B32A 4YJHB 3JY6A 1EP9A 1E1MA 3TPCA 3V34A 1LDMA 1D6NA 3G13A 2VNIA 3GGCA 2W2LA 3UKDA 1Q7CA 5LOVA 4HNSA 3DG9A 4J0IA 2Y8EA 1FMLA 4H7PA 3SBDA 3W2HA 3OIGA 5LQCA 1RMQA 4H1HA 1GFSA 3KAPA 4JXZA 5EN4A 1GPMA 1CZRA 3TWOA 1GQOA 3X2SA 3UN1A 1D1PA 7REQA 4NCAA 4F1JA 2WJ4A 4HNAB 4NAUA 4P93A 1Q19A 2BEWB 5BR7A 3MGAA 2WG2A 1PZGA 1HE5A 3HBNA 5IZCC 1S2MA 3ZUGA 4K28A 2YXLA 2FR1A 2QMUA 1GKLA 3O8BA 5LQUA 5M2QA 3I1JA 3X43A 3K5PA 1YR7A 4WFKA 4AJNA 1VE9A 2PLFA 4W7SA 3IDSA 3Q72A 1C50A 1I7NA 5AHWA 5TT1A 4B7ZA 3PUXA 4BVFA 1VHQA 1MRNA 2XZPA 3I2GA 2FSSA 2P9QA 3VX4A 3OP1A 1DAKA 2VXBA 4IHJF 4QYTA 1O0SA 2WJZB 2ZIVB 1N3LA 4GBJA 2RHTA 4MUAA 4O8ZA 4YEDA 5BRNA 1UBJS 2WSYB 5KYKA 1A7KA 2JRLA 3A04A 1IY2A 4N3NA 2REOA 4Z9FA 4OLBA 2WQZA 1VKNA 1DWOA 3G9QA 2X7HA 1U0GA 1V48A 4WE3A 2A78A 1DDOA 1THTA 4RTPA 4ALJA 1NQ5A 4HAUA 3T9FA 5I9MA 3VOTA 4K6CA 3RD5A 3WGJA 4BMZA 5C8YB 1L6IA 3IX7A 1UKBA 3NV7A 4YB8A 5ICCA 3AVOA 5JNVA 2RHDA 3COZA 2J5RA 3AETA 3VSBA 2WTBA 4JJFA 2AG5A 1T15A 4G0VA 1RTTA 1TKCA 1JDBC 1D0SA 2SKDA 1TT7A 4OXQA 4GMDA 1N78A 4LOHA 4CT0A 1IXRC 1JHOA 2BM1A 1HGXA 1SBCA 1R7RA 1VE1A 1X92A 2QA5A 3EVBA 4PSUA 3STUA 4QPJC 5JJ5A 4L5JA 4EP1A 2DB3A 4C7BA 1SGWA 4HNTA 5JANA 1F0NA 3S1LA 2FCRA 3SKVA 3H6KA 2QQGA 3OPYB 4OU5A 3FROA 1XALA 2P5TB 4E51A 1ZN9A 2KS6A 3L4SO 1SUCA 2AE2A 4R40A 4U39A 1GL6A 2PUHA 1J07A 3IQDB 4UJ5A 1LQUA 1LDYA 4G67A 1NRJB 4L57A 4FEEA 3EEBA 3BE6A 3BJIC 4IDQA 5T3YA 5C51B 1T6BY 1VKJA 3PNBA 1COWA 2BGMA 3C8ZA 3FMPB 4CM5A 3ZVMA 4QU8A 1YZVA 3UHPA 2HRZA 2FPSA 4H3VA 2BFEA 1YJXA 3LG2A 2ON6A 1U2GC 4R1MA 4HVTA 1NPTO 4IDEA 3D0QA 4PQGA 3N58A 3SOZA 1XEXB 4DF3A 2RONA 1EM8B 2GVDC 2CB9A 2IGBA 1Z8NA 2RG1A 5AOCA 1U7TA 1SXIA 3IV6A 4YWJA 5I9BA 2AEJA 3T1VA 3ROQA 3QI7A 3LJKA 4G1VA 1M7BA 5BN5B 3COWA 1V11B 5A4IS 2H0AA 2NV6A 2EARA 2RJOA 2BFNA 2FY8A 3OTGA 1RXSA 2QR2A 4FZ3A 4CIWA 4JI5B 1EM6A 1OZFA 1X7ZB 1UQTA 4LYYA 5K3CA 2Q99A 1E1LA 1D9ZA 1WE2A 3UB3A 1YFLA 1XVLA 3EQZA 1CDEA 2GNPA 1A0OA 3B9BA 3AT1A 2IX3A 4JLBA 4FLEA 2AUMA 2H1HA 1K8YB 1H2WA 1L8AA 4OHZA 3S2UA 4WZBE 2IV3A 4BJ3A 3CSSA 4O4JF 4EJSC 5LB2A 4AKEA 1R0ZA 3G0DA 3MLBA 4NP6A 3AUUA 4Y1FA 4JJ4A 1QQBA 1X1RA 2X6QA 4OQEA 1IMOA 2BY4A 3KPJA 3UMMA 1QG4A 2Q50A 2BW0A 2HPHA 4JB2A 4NFHA 2Q2QA 1MRZA 1CIJA 1HOTA 3PXGA 4AN0A 4B0PA 4O4LF 3OM9A 4XVQA 5CW1A 4V0NA 1PHPA 1BC5A 2QG9A 3D8RA 2AQ8A 3IKJA 3LX4A 5FBHA 5FUMA 5JC8A 5CEFA 3K1AB 1EP1B 3ND8A 4K26A 1JQJC 4FDAA 1NVUQ 1U2SA 2DKFA 1HKHA 1UADA 2P2NA 2XE6A 2R7LA 3Q98A 3R3YA 4RC9A 2FJUA 1X9HA 2P68A 4WKBA 2VAWA 2DBRA 4HWRA 3BFKA 3SSAA 4O29A 3U3DA 3VZQA 4AJOA 5CLFA 1CUEA 3OE1A 4WESA 3FR7A 3OOYA 2CW5A 4EUHA 3KPVA 2R47A 2P1RA 1M75A 4HWGA 4Y9DA 5DYYA 3SU8A 2FPGB 4ALKA 5K05A 3P0HA 2R6FA 4IRMA 5HMLA 2ECQA 4YRRA 4HQ0A 3KQVA 2IYQA 1KVTA 2FW9A 4GNRA 3TW8B 2CUKA 3DE2X 1GITA 3OM0A 4LAFA 4WZAB 2QHXA 2Q8QA 3BB3A 1G3MA 2Z2YA 3EIUA 3HP7A 1F2UB 3IR6A 2JI8A 4PHHA 1DO0A 1X7WA 3C6XA 3MYYA 1GG5A 4M99A 5SV2A 4KMOA 2OPHA 4BMNA 3E3LA 3TFOA 1EFDN 4LY9A 3GFPA 4L07A 4MW1A 5A1JA 5KZMB 1V5GA 2EW2A 2VT6A 1JU9A 5B1IA 4I4NA 5CLJA 3FMIA 1OH6A 1NVTA 1HKUA 1ZUNA 2QR5A 1WZCA 3TB4A 3NQ41 3FFWA 1YBVA 5E8RA 2QD1A 4NR0A 5IK2D 4R7GA 3LYAA 1QFZA 3HP1A 3MXOA 1DBWA 3IBTA 4KX5A 1W96A 3A6LA 3DOUA 3G49A 1W4BA 3RU7A 1LDNA 3RC2A 3GYBA 1FEZA 5ERGB 3HLTA 1WXWA 3VV3A 1XCOA 4DJFC 4AJLA 1ODIA 4XDZA 2FZWA 2A9OA 1RHUA 4Q4LA 1JHDA 1AOXA 4D4LA 2XXAB 3P0EA 1RLOA 4WKOA 5B1SA 1CP2A 3KYBA 2G5PA 4KQ9A 1P2DA 1VJDA 4KAFA 1WMEA 1RSZA 5J23A 4A2PA 5TPWA 1QHFA 4OM8A 5KQLA 1V8BA 1YGPA 4HTFB 5J9FA 1TADA 4IDOA 3D9QX 5SICE 4ZHQF 1G5TA 5DI9A 4LOIA 5EMNA 4XSVA 1JBEA 1VIMA 4JFRA 3PGJA 4Z8XA 3PC8C 5EKDA 5THQA 2IUUA 3R24A 3I9FA 4C0HA 1TMOA 5H3HA 3G3EA 3D1LA 4ZJPA 1YBAA 3AUXA 1VECA 1XZJA 2QU8A 1DKPA 2Y0PA 3EGIA 4EUEA 1TVKA 2O48X 2W6ID 5EQTA 4LZOA 5JYCA 4AUNA 1OYYA 3AONB 2LVBA 1OQAA 2I6QA 1JU3A 1QC5A 1WCXA 3SSMA 4C04A 1D4ZA 1N2OA 2E4ZA 2CYAA 2H9YA 5AUQA 1OFGA 3SJ7A 1E1RA 1Q7RA 3DB2A 2WIFA 4FNOA 3SR0A 2ZUCA 3TFWA 2V7PA 3M6VA 1DDIA 4FI3C 4QXQA 3FKSA 1W1UA 1WX1A 2AI3A 1KIAA 4MWDA 4KO3S 5H80A 1TJPB 3HLYA 4TUYF 4BX2A 8GPBA 1YZTA 4CQJA 1W4LA 3S7TA 3CX7A 3FF1A 2AXPA 2WAAA 3NHPA 3V1MA 2WF5A 3D3WA 2H08A 3AVYA 5JS1A 3M6FA 1A88A 1VCOA 2GPSA 3OZTA 1JIXA 2FMIA 2M98A 3DBLB 3QVUA 3MK31 5E1BA 3D3NA 1TQDA 3GNLA 2Q5HA 1X14A 5D01A 2C1ZA 1WPXA 2XGOA 1PVVA 3NVMB 2HK9A 3OF3A 4P5EA 1PJRA 1XL0A 1Q0PA 3BAFA 3ETCA 3AUSA 3K9FC 3I9MA 4NI5A 5D00A 5T5QA 3LPLA 4IVPA 4RMJA 5CK5A 3MTJA 3QSYA 3FGNA 1GAQA 5FI3A 2QF7A 3T94A 2H9AA 4AIIA 5C9ZA 5LMZA 4ABTA 5JXGA 4PM4A 3VOBA 3W5JA 2G9ZA 2NU7B 4LHYA 3SQDA 1BH2A 2XDWA 3G7UA 2EG9A 3IP5A 3EF0A 1U6IA 3ZDRA 3TJRA 2HMYB 3GH3A 4JA2A 5LZ8A 2PRSA 1GA6A 1LBIA 1X7XA 2H4JA 2GKGA 4Z0NA 4DZTA 3M2PA 3CX4A 4MGKR 2PE5A 1GUYA 4ICIA 1MA3A 3ZS9A 2KI5A 4YXWA 4PX2A 2OD7A 4MV4A 3DHYA 3ZHOA 3U4IA 1MIHA 2A4KA 4K8RB 4BP1A 3LOPA 3BH0A 1R4NB 3B7GA 2FXIA 4K5QA 4LRQA 2MIIA 2HRRA 2QN1A 1SKYE 3HCFA 4M3NA 4OHPA 4J0JA 5KKAA 3A26A 1N1GA 2CUZA 4JI7B 4B8WA 4C5AA 1BW9A 2AC7A 3TE7A 1GPLA 1E6KA 1P75A 4WXEA 5ES3A 3ZHYA 3HH8A 3ISVA 4IRXA 4I1YA 3EBLA 3F4BA 4DGSA 2P9EA 4PTLA 2QXYA 2WQ6A 2JNWA 2OV8A 4L5AA 4AY3A 4LZZA 1AKRA 5JAHA 1N92A 1G8MA 4M8LA 2QSYA 3DOJA 1HTWA 1RRKA 4JSTA 1D6JA 1SHKA 4BAZA 2J3JA 3AJEA 2WR8A 3L7MA 3NYRA 4CR8A 5FBVB 3DV0A 1F6WA 2M1XA 2RK4A 3PGA1 4HDRA 1EX7A 4KOAA 3EZ6A 1BGVA 1AUPA 3OD5A 3O8DA 3I6BA 3I0NA 1MJGM 3DBRA 4NYIR 2D0OB 3GFVA 4O4JB 1I2BA 4BB0A 4HUTA 1NUUA 2B4QA 2NZWA 1LPOA 2X23A 3A1FA 3AVPA 2ZYHA 4TQGA 4RH3A 3TIXB 4BNXA 5KTPA 3KUXA 2VBGA 4OQLA 1IIBA 1T9GR 1UDXA 3DZCA 1KKMA 1E2NA 1HDZA 2CXPA 2JRCA 5JE8A 1DTWB 2ZE6A 1L3IA 3E58A 3EHDA 3FYSA 2GD1O 3OX4A 3B8HA 4U2DA 3HY3A 3HCAA 3KQWA 4A4DA 1JFFB 1E0JA 1IM2A 4JJIA 4LTDA 4R1OA 2GN9A 3OPYI 4AMGA 1L5WA 3Q6IA 1DMRA 1RQ7A 5DLPA 3BRWA 3I2IA 5A5DA 3K5IA 2JKYA 4RFSA 4Q9IA 1SKUA 3JS5A 4IXNA 1EWTA 1G6Q1 3C7TA 1DWUA 3HWSA 2A1UA 821PA 2V6BA 4OV6B 1OAOA 2JFBA 2VHEA 2G0AA 2P8JA 3HB7A 2RH4A 3MWLA 2W2KA 1KH2A 3OLCX 4Q12A 3EXFA 3P94A 4Y7CA 3A7EA 4BQEA 5CYOA 2O1XA 1TPZA 2BHLA 4WCFB 2XF2A 3F1KA 2O7NA 1YRQA 4DSUA 2WAXA 4KAXA 4UASA 3KT0A 4KCGA 3ZC3A 5JADA 3AHHA 1RXCA 3ZDBA 1ZMBA 3IQIX 4KFTA 5DRTA 1AF7A 1TJ5A 3PUKA 5C1IA 4UBIA 2JD2A 2Q3FA 2II6A 1NNI1 4RQTA 1U65A 5H8WA 1JLSA 1QPGA 2WG0A 1AY0A 1BOFA 3GNTA 3V4PB 2ZJ3A 3CFYA 3R5XA 1OZHA 5E8JA 1I9CA 4AMYA 1C0IA 1QANA 2FJPA 2R44A 3E5MA 1ZCJA 3LT0A 4IKOA 1XLVA 1Q7GA 3KL4A 4ETWA 4KXQA 5ICMA 3JRWA 3L92A 3DLBA 4CTOA 1DJMA 3BWEA 2TS1A 2VYVA 5JDIC 3BHIA 3BWVA 3KEFA 2Y9PB 4OX9B 4BS9A 5LBUA 2J3LA 4IH1A 2JBAA 1HE3A 2PYIA 5P21A 1FXUA 2YFHA 2EU8A 4D42A 2Y1LA 2HSWA 4G3XA 4Y2QA 1UWCA 4RVGA 2HJ9A 1FFWA 2PL3A 2ZRGA 3A6GA 4PF1A 3SXUB 5BWOA 1KMCA 1F5SA 1P9OA 2GN4A 1SQSA 1OXBB 1UBUS 2GJSA 3QIAA 4C4PA 4JYZA 4TRRA 1PL8A 1U2ZA 2PO7A 1T35A 2G7ZA 2QN7A 3U2QA 4A26A 3EVZA 3QU4A 4L16A 4WNCA 5EJ6A 4FQ8A 1CR1A 1LX7A 4HDSA 1NW6A 3OTOB 1USUA 2ATIA 1E1YA 2F1JA 3Q9LA 4YMUA 4BATA 1FX1A 1Q2XA 4BUCA 5KNDH 1N9KA 1OT5A 3GFOA 1QH1B 3LUKA 4NYJQ 3SBXA 4WUTA 1QWOA 1JHXA 3HJUA 1AQNA 3K8QA 2VQEB 1CR6A 2B3DA 5A0FA 1GTL1 3WOVA 2O2HA 3ITEA 3B7WA 4RE6A 1OTYA 4LGVA 4KR2A 4RKYA 5CK4A 1TZBA 2VBFA 3PA8A 3ITKA 3CNLA 1OXMA 1C29B 3LWZA 3MCAA 4DMRA 1ESZA 3PR1A 3Q8XB 1ZRHA 3KQPA 4MUMA 2XDQA 4AB1A 1F2UA 2GZMA 3DTYA 4RTNA 4B2PA 1PFUA 3G0CA 3AEUB 1BDHA 4IZOA 3T5BA 3LY9A 5BT8A 4I3FA 1CT9A 1KYIA 2A5LA 1AUOA 1A98A 1IOZA 2QM8A 3WBKA 4B2LA 1QGAA 1ST3A 1YQTA 1ZVJA 2JFXA 4X6LA 4YNBA 2DGDA 3TLEA 4AS2A 4C1NA 3L04A 1M6VA 4QG3A 4L7QA 4N18A 1GM5A 4I5IA 4F8EA 1U0NA 3U4MA 1FDIA 3GA7A 4PLZA 2H92A 3CH4B 4WLEA 1E60A 1TCCA 1XJ5A 1QCYA 4ZALA 1NXPA 4PG4A 5DT2A 4UOEA 3TUIC 2B1RA 4GXNA 4J7XA 1QV6A 1XWIA 1RW4A 1V3UA 1SUFA 3EAQA 3H1TA 2MSLA 2I2BA 4KDEA 1PV2A 1SUEA 1LD3A 2W6JA 4P82A 2CDNA 3TDMA 4I4TF 5A4FS 1T8RA 4XGNA 1CDOA 1NI4B 2OG1A 3TZCA 5ILGA 5HUHA 3WDMA 2GWRA 1R0YA 4GR4A 1RJGA 3USES 4IUCS 2A2ZA 4B7AA 4TTJA 3RYTC 4MV6A 4CCYA 4OKSA 1QFMA 4GC5A 1QNFA 4Y0NA 3OZGA 2EP8A 3ZG6A 1L4UA 3C3BA 1SCDA 3NM5A 1KQPA 1WULS 1T9CA 3TEJA 1PUIA 4H2DA 2VAVA 1GRQA 3LAWA 5H70A 3AR8A 1FXSA 1JHMA 1ZJ5A 3VGJA 5HQJA 4TMFA 5JZOA 1TM1E 2ROQA 1LVHA 4QQRA 5BO5A 4YIHA 5GONB 3ADOA 4JB8A 3KTOA 3I8XA 1XQXA 4N8SA 4RPJA 4QODA 1GXSA 3GLGE 3V00A 2IYZA 4BJ1A 2H4WA 1B2RA 4UHDA 1BMDA 4B3GA 1CERA 5IF3A 5DPMA 3PDUA 1DV2A 1UM9B 2DFNA 3PDJA 1FYEA 2JHAA 3G7SA 3P9KA 2N0SA 1GTMA 1C7FA 1CX9B 1E8MA 2Z2ZA 2WB4A 3H86A 2YTZA 1XP8A 1CW2B 2JVKA 3D4NA 1VL5A 2R8BA 4IOJA 3OCYA 5IUKC 3PQ3A 1N5DA 1OFIA 3NTUA 1IBMB 4INOA 3A1WA 4Y18A 3K8OE 1W5FA 1KMHA 1GL3A 3DZIA 3N0RA 2Z5GA 5AW4A 1MH9A 2ZCVA 2GZDA 2HA3A 3NM6B 4K6OA 2CDRA 4LHSA 3UJ6A 2DECA 5BQ5A 1ENZA 1U3CA 2G63A 4ZEOA 3WWEA 5U4XA 2HF2A 1Z0KA 1RRPA 1VKRA 1XK6A 1Z22A 1WTAA 4FCWA 2DT8A 3AZOA 4WWHA 4IM7A 3BE4A 2VZ0A 3AIOA 4I50F 1ZG3A 4FS3A 4YJ3B 5DNCA 1P5ZB 1WY7A 2QVLA 3RRNA 3EDYA 2HNBA 2WVJA 5AICA 1FL9A 3T7CA 5HF9A 4LXIA 2FRVA 3GEEA 3WJ7A 1NN0A 3C7KA 2E55A 1A9XB 4HX2A 2PFGA 4J1TC 4ZP1A 1Q92A 4QGBA 4U9HS 3K4QA 4G0NA 5EGSA 4MYUA 2RE8A 3KOMA 1KI4A 2BC9A 5JDCA 4NYMR 1P33A 4L4RA 1ZD2P 3U7EB 3KXPA 4IX9A 4QYIA 5ER6A 4C0BA 4URZR 4OUDA 5F5XA 1DV1A 2RI0A 3KVRA 1ABBA 5GVRA 4WK6A 1Y6QA 2HY7A 2WD7A 1R5BA 1EYZA 1KVUA 5I5GA 2C5SA 2B0CA 4WLUA 4G5YA 3LM8A 2I7TA 2ZETA 3QQ5A 2FPOA 4XX1A 1H4VB 2B2CA 2PS1A 4TX1A 2IU0A 3M2TA 3ZIAA 4DDTA 3PEYA 1JS1X 4MS1A 1JLLA 4X8LA 2X5OA 1XTKA 1CRZA 1RI1A 5FI0B 4ZHSA 4LE0A 4DDWA 4RHTA 2Q6VA 3UW1A 4AZ3B 3THYA 4Y2SA 4FB5A 4UPVA 3ICOA 4FN4A 3E1KA 4UBLA 3TNYA 4ZVKA 1LDEA 2H2AA 3IEMA 3U1BA 3WLJA 2DCUA 4CKBB 5AW8A 2ZUWA 5KDDA 1E61A 2GAAA 3TTWA 1L4KA 2PR2A 5KTSA 3RTEA 4K9DA 4DIDA 2ODBA 4IGFA 1YS7A 3UGQA 5GZ1A 3HKDB 1GGKA 4AYTA 5F7OA 1ZI9A 1G3IA 4LPSA 2R1TA 3JV7A 4YRCA 1KZ4A 5DHPA 2YINC 2A92A 6REQA 5LR6A 2GN8A 3A3OA 4K6HA 4Z0HO 5HTOA 4RD6A 4RA6A 4BTLA 1JH8A 2F1IA 2F3UA 2B1GA 2BLLA 4FGLA 5K2OA 2A6PA 3LP6A 3MM4A 2VHCA 2JF0A 3T7IA 3A11A 5IW8A 3U13A 1G55A 1MEJA 2C8VA 4P7JA 4ETMA 4ZTBA 1BVYF 2CNLA 3F6YA 3OY2A 3QA3E 4MWSA 4RDIA 4EMBA 3D5TA 1ITZA 4DJTA 5KTKA 1UBLS 3IPAA 2OO5A 5GMOA 3W3AD 2HB6A 2H5IA 2DY1A 2ZT7A 4FMPA 4I3GA 4QSHA 5CYPA 3W04A 1HY3A 2QD3A 4CG0A 4DIMA 2FDCA 1J2YA 1ZD8A 2YRWA 2XXJA 3QXSA 5DBGA 1NYRA 2H4HA 1JKJB 1Z35A 2WHQA 4R8VA 5FIUA 1Y7HA 4PEVA 3S2GA 5FUBA 3VHXB 5DN6D 1E9RA 3GFSA 1VYUA 3A32A 1G60A 5AJXA 3LYHA 4EBBA 1G7RA 1SCIA 4U0JA 4R1LA 4BKUA 1M2KA 2PKQO 2X41A 4Q3BA 2BVNA 1SUWA 4RFSB 1KVSA 4YCSA 1MW8X 1DHRA 3IJ5A 3RJTA 1LS6A 3EZXA 2AOWA 3D6UA 4JHXA 3TB6A 2FPPA 2YJGA 5PNTA 2E4VA 2IBSA 1GZ3A 4LRTB 5A04A 3E18A 1IHOA 4U63A 3WFZA 5IKXA 3N2KA 3MCUA 4EI8A 5HEKA 4UOQA 1P73A 2GXSA 1ORRA 3HSSA 4HL6A 3OIUA 4XX0B 2XCSB 3RNLA 3WGHA 1JZQA 1T2EA 2CNWD 2I3GA 1O58A 3V1TC 1W34A 1GVHA 3WQHA 3I30X 1FK8A 3NAQA 2QVYX 3WLEA 2QGZA 4KQCA 3ZHRA 4G0PA 2NPFA 4C6HA 4BBJA 3CLVA 5TVKA 5IXSA 1HXHA 3ISTA 1YJ8A 3BORA 1XZBA 4LF5B 3CLTD 4YBRA 1SOVA 1TRHA 2WZDA 3COVA 5LN1A 1N8SA 3GOQA 1P7YA 4ITVA 3TXAA 4B0OA 2Y99A 1UJ2A 2BHTA 5A7FA 4URXR 4KHPB 4XD7D 3B6ZA 1ZH0A 2CK3A 3M6LA 4DLBA 5KYWA 3L07A 1XJQA 2AKAB 1LLDA 3L93A 4WPGA 1W5TA 3HCDA 3QU9A 1Z36A 4NBNA 4PNPA 2Z5FA 1GV0A 5TNXA 5HGJA 1GYQA 2IL1A 5TPZA 1ZQ1A 2QAIA 2G36A 5K20A 1T8YA 1XQ1A 2C0PA 2X2FA 3WLTA 3F3SA 5TGDA 2O3TA 3AF3A 4MVJM 4MR7A 1CY4A 1D6SA 5L7TA 5LQAA 1DBVO 4FHZA 1A9TA 3AR2A 3G5UA 4FR0A 4R68A 1PD1A 4IDPA 4RMHA 4Y2UA 4OBXA 5CDTA 2ZSUA 4IZ6A 3ZTTA 1U8AA 5IJ0B 1FMTA 4HUQB 1HYEA 4GRDA 2BT4A 1LPBB 3NEPX 4GE3A 1SEPA 2DE0X 2CXRA 2H18A 2QY9A 4OQPA 5CVCA 1TFUA 2P9CA 4Q7QA 5FYQA 1RFLA 1JAHA 2AQHA 4MUBA 5LLTA 1Z4MA 4BNJA 1YUBA 4Q3LA 2WYOA 5E2IA 1ORHA 2Y1EA 5B6JA 4UHJA 2FDXA 1G98A 5LVAA 5DM2A 1U7XA 3IRUA 1NR1A 5C8YF 5FR1A 1R5OA 3WL6A 1UMCA 4BIMA 2V0CA 3CCBA 4IL5A 1WS6A 3W7BA 5KU1A 2IYSA 1E6UA 1AE1A 1R9GA 1W88B 3O75A 3SI7A 3ZCQA 1NJ2A 4YXFA 1S8OA 3ML1A 1EE9A 3DPIA 1WW8A 2GKSA 2XOXA 1I3CA 2EZTA 3AF1A 4ARUA 4ZEVA 3ED1A 2NX2A 1TLFA 4B6JA 4E5UA 4D4GA 4YLYA 1M6VB 3ND5A 2ZVPX 3LSTA 1WXQA 4FNMA 1Z16A 2NSHA 3LYLA 4G36A 2LZ0A 5FPKA 1FLNA 3WZMA 4RVFA 3COSA 2XVYA 3AEQA 1XFAA 3OU6A 2JLSA 4PLCA 4WCDA 4G5FA 2CNNA 3LZ6A 5TX7A 2ASVA 4C6SA 1O6CA 5LBTA 1W2GA 4Y1GA 1UOPA 1VJ0A 2CE7A 3QBTA 4UTXA 2NUTB 4RHXA 5KNCD 1FMCA 1B1CA 3CUKA 3HB0A 3SE7A 1HTTA 3TNLA 2O8NA 4E88A 3VKFA 1A9SA 2HPAA 2JKVA 3E0QA 4JB3A 4ROSA 1C7ZA 2IEGA 3EVFA 5FTMA 1I7DA 3ESDA 5AXDA 5EP4A 1SURA 2BM9A 2YJ4A 1OW3B 3BYZA 3PQCA 5EGNA 4CF5A 4PU0A 4RHYA 4LJSA 2UYCA 1C4KA 3I83A 2PNFA 3CYFA 4IJQA 3NG1A 5ER9A 1U9CA 2CBXA 1K7EB 1VIAA 3K6JA 5I9NA 1DQPA 3IQXA 3KSMA 1ZWLA 4P58A 2PBLA 4RJTA 4INPA 4TRNA 1PL6A 2Q49A 3EZ2A 5AOVA 3KETA 3MN1A 2ZQYA 3QFSA 4ZCPA 4HK4A 1BXZA 3WDKA 4ON9A 2E89A 1P3Y1 1U7OA 4A6PA 3TCNA 2VDRB 3CUVA 3B6MA 3CVWA 1KYYA 3I0MA 2YWEA 4X8HA 4FDLA 1KZGB 1DHTA 5JISA 3FYUA 5KNCH 3PGMA 4FCVA 5JMTA 4MW7A 4BFVA 3VPFA 1OHHD 4DLUA 4GPBA 3ESBA 1FDTA 4DCNA 3C6KA 3QVMA 5K0JA 1L5VA