1EBBA

Bacillus stearothermophilus yhfr
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
202
Chain Sequence
ATTLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAEIVRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAAFKDTPLDHLWSPPYMYGTSVTIIEVDGGTFHVAVEGDVSHIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHOSPHATASE
publication title Structure and Mechanism of Action of a Cofactor-Dependent Phosphoglycerate Mutase Homolog from Bacillus Stearothermophilus with Broad Specificity Phosphatase Activity.
pubmed doi rcsb
source organism Bacillus stearothermophilus
total genus 68
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ebbA00
4AROA 1DKQA 4FDUA 3D6AA 5AJXA 3FJYA 5HR5A 2P2ZA 1RPTA 4D4LA 4GPIB 1E58A 4ARVA 2A6PA 2HPAA 2ENUA 1FZTA 2IKQA 1SK9A 1K6MA 4EMBA 4D4KA 4MA4A 1E59A 1RIIA 1C81A 2P77A 5CX4A 4JOCA 3OI7A 3MBKA 3E9CA 1IHPA 4E3WA 1BIFA 3GP5A 5AJYA 1QHFA 1QFXA 1ND5A 2P78A 4EO9A 3D8HA 3E9EA 2HIAA 2OWDA 3IT0A 3EZNA 3FDZA 4HBZA 2P6OA 1FBTA 1QWOA 1NT4A 3D4IA 1SKBA 4D4MA 3NTLA 5CU7A 3LNTA 2P79A 2P9YA 2P9ZA 2BIFA 3DB1A 3HJGA 4PGMA 3R7AA 2WNIA 1CVIA 2EOAA 2A9JA 4FDTA 2YN2A 3NFYA 4ODIA 4QIHA 1XQ9A 5AJWA 4ARUA 1T8PA 2ENWA 3LL4A 3F2IA 3DCYA 2H4ZA 4D4JA 3GW8A 2DWPA 2P30A 2WNHA 4IJ5A 1EBBA 1H2FA 3EOZA 5CDHA 1SKAA 2QNIA 3BIFA 3PGMA 2P9FA 2P6MA 1YFKA 3C7TA 3IT2A 2YN0A 3K4PA 2F90A 2H52A 4GPZA 1DKLA 1RPAA 2I1VB 1V7QA 2P2YA 1DKPA 3IT1A 3QPWA 1C7ZA 1DKNA 1TIPA 1UJBA 4PZ9A 3F3KA 3QPUA 3LG2A 1C80A 2P75A 1DKMA 4ARSA 4JODA 2GFIA 2RFLA 3K4QA 2H0QA 5HTKA 1V37A 3QPVA 3O0TA 4JOBA 1H2EA 5AJVB 5AK0A 3KKKA 2AXNA 1SK8A 1ND6A 2WU0A 1BQ4A 3MXOA 4TSRA 2EKBA 1YJXA 1BQ3A 3FDZB 4IJ6A 2EKZA 2OWEA 3GP3A 5PGMA 2DWOA 3E9DA 2PA0A 3ZHCA 5AJZA 2H4XA 1UJCA 3IT3A 1DKOA 2HHJA 4PZAA
chains in the Genus database with same CATH superfamily
1KMHA 2XECA 2RHRA 2OEPA 4UU7A 5KWSA 1YFJA 3Q8LA 1Y4SA 2I71A 3KDAA 2XY4A 1Z7GA 3LOUA 4URXR 5EIXA 2JRCA 2PZFA 2OC4A 5FUVA 3IEPA 2H7XA 4I50F 5E4TA 1FFYA 1K4MA 2JIRA 3G6WA 2W6PA 3I32A 5EKUA 5DNUA 1CF9A 1PYGA 3HCWA 5FFNA 3EHEA 2XVMA 3SZLA 3DG9A 1QAMA 1KMNA 4K26A 5CDFA 5IJ9A 2ADOA 5AKLA 4RWZA 4YAWA 3RLIA 3O1JC 3L7CA 4I4NA 3ZHBA 1ZA1A 3DE7X 4LDAA 2DWUA 4M1ZA 2XMBA 4QGFA 4X41A 3TRFA 1SBNE 2VWQA 1R0KA 5IDQA 4WI1A 3A6KA 3OD5A 2ZJ6A 3FPSA 4PYIA 3CNHA 5I3CA 4OO3A 3K30A 3WYEA 4AIRA 3PUYA 1IXSB 2VDVE 3SIRA 5FWDA 1L3IA 2WI8A 5JS6A 1ABEA 1TU0A 4JOQA 3ZQ6A 5L95A 4IRMA 4TWJA 5C5DA 5A4KA 4CEIA 2FPIB 2JJ1A 4PZZA 4LJ9A 1M6NA 1RYNA 4DL9A 2OBXA 3K0AA 5FI1B 2EGHA 4YI3A 1ZVQA 1A9XA 3CB4A 4KXYA 4CKEB 2C5EA 2W0SA 4FYVA 3W8EA 4ZEWA 4JXKA 5B7GA 4G25A 3V2IA 4YMVA 2A9OA 4WQMA 5AIAA 5FT9A 1OXVA 1ES9A 3LPCA 4DC1A 1XHLA 2CUKA 2B7LA 3AQIA 3BXOA 3TUJC 2J08A 1E61A 5DP2A 2GO1A 4DMCA 1UBNA 2NN3C 4BTLA 3IFSA 2KPOA 3B5IA 3HXQA 4X8OA 4WGGA 2RKOA 1FTWA 1HL3A 2AFIA 3HK2A 1H2FA 1OFGA 1X1DA 3R3JA 3EF3A 1GO2A 2QSJA 5IT5A 1GGEA 3KVYA 3ABOB 5EHXA 4RMNA 2OENG 2X4LA 2YINC 4TXMA 4O02B 3BMOB 4CLDA 4TRNA 1NTRA 5EY5B 4IYRA 3Q3VA 4B34A 4X91A 5JADA 2GXQA 4YAJA 1KP2A 2FSVC 2NO1A 1TM4E 4BCBA 4CQMB 2RI0A 3U1BA 3LPAA 4N8SA 1DXOA 1DTSA 4MHOA 2Q7XA 1QB8A 3EUEA 1UZUA 5FDFA 4CDNA 3DEJA 4W63A 3R6WA 2EGGA 4R1PA 2J31A 2QLFA 2QQEA 3H3JA 2HU5A 3MSCA 1TA9A 3NHLA 3T1OA 5FV4A 4KX5A 3RVOA 2EFHB 3AI3A 1X3SA 1JLLA 1RABA 3WR5A 1ECCA 3BGVA 1INLA 3NQ41 1RZ3A 3F5SA 5DHUA 5FORA 3CRW1 4V0KA 4Z1MA 3REOA 1US8A 1CRPA 4CMEC 2BFNA 4B3FX 2HR1A 1Y6RA 1YI1A 4YJKA 4AP9A 1OLXB 1YZNA 4A0FA 4K7JA 3FOWA 1BXRA 4HQOA 4OLHA 4B0PA 4O4JF 1XP5A 4C7KA 4H27A 3TNLA 2XQFA 4N6OA 5AD1A 1KVTA 2XUIA 5I7UA 1USIA 4UM9D 5HNKA 3CVWA 2BOVA 4NTZA 3IMKA 3CZAA 1E5QA 3W90A 1G3MA 4D81A 4RF4A 1E0JA 1AIPA 1DKOA 2YV1A 1VI5A 1L4BA 5MGNA 3ZGVA 2QTMA 4RQAA 3I2HA 1WU8A 2F3PA 5KTYA 4Q4LA 1Y89A 2P3LA 1PBTA 2AC4A 5IVKA 2QT9A 3QBDA 4B3XA 4DV6B 1Q15A 2CFOA 2WYHA 1UEXC 4B2YA 5FHRA 2XGJA 2GBGA 2IS6A 3EVEA 2OG1A 4II2A 1XB2A 1M1UA 2X8WA 3KXDA 4RLFA 3RLFA 1GL9B 2J30A 3RVSA 4D4LA 5J4LA 4W6ZA 5L3RA 4CL3A 1VG8A 3AP2A 3ETCA 3G17A 1P4HA 4PLCA 3FOCA 4CDMA 1TUBA 4NMHA 3F9CA 5IUJC 5MFPA 5BXQC 1OI3A 4LC1A 3EUWA 2A9FA 3C43A 3PUVA 2FMKA 1IVSA 1PZMA 4DUPA 3DQZA 3T4UA 2O0LA 3LK6A 1W4LA 1PD0A 1NXSA 1GKLA 3NNNA 1Y9AA 4PQRA 4ETNA 4HRXA 2W71A 2D3TA 3ELDA 1Z63A 4A92A 3UW1A 4FN4A 1O2DA 2QTTA 1H65A 3C1TA 4P3PA 1KDZA 3KFLA 3N59A 4HSGA 4G41A 3C74A 3FR8A 2B4TO 3ND9A 4AECA 4BUCA 2OK8A 1IY2A 4PAGA 4QECA 2HJSA 3B48A 1VMDA 2GESA 4TLDA 4Q18A 3I2YX 1LI4A 3OLZA 2XOEA 5JZ9A 4DPMA 4EATA 1OV4A 1MDBA 4X93A 1RYBA 1D1TA 5IWCA 3U7JA 1UMDB 1CR4A 1SEVA 2V7BA 2IYPA 2YHBA 4I99A 5CH5A 5C5EA 1H2XA 4V38A 4Q7JB 2GCOA 8GPBA 2M32A 2ZT5A 2DG2A 3PFCA 2Y67A 2FSVA 1QPGA 2PO7A 2X3UA 4R3WA 3ZWQA 3QXCA 1EXNA 2I4NA 1HZJA 1J25A 4F92B 2BEVA 4DR2B 3E1GA 5IT4A 2PSEA 4OXIA 4YACA 5JNRA 4RM3A 2B61A 4MO2A 4ZU6X 2E9SA 1XD8A 4DDHA 3SDSA 2ZRBA 2C94A 4KQWA 3G3EA 5J5VA 3R7LA 1OROA 2XBMA 1ADJA 1DG9A 1RIFA 1TT5B 2RIRA 4P4LA 3DD1A 4ZREA 3ODPA 4CMEA 2GN8A 1CJMA 2IKSA 3NTRA 2VL7A 3RGGA 2N75A 3QVTA 4FBMA 4Y2RA 3W2GA 2WOJA 1DIAA 5DYGA 5AOBA 3RUPA 4E5KA 2VVTA 2A0XA 1A4RA 2FF5A 3GZTB 4QFMA 3RSOA 4LKOA 4ZC1A 3SHQA 3PJEA 4KSBA 2GHIA 3G5UA 1ZD2P 4V0ME 4BNGA 1U0BB 1CRWG 1YKFA 3N8GA 4GOLD 4YDSA 3RI3A 5AXAA 1FX1A 4MRVA 2ID4A 5F78A 3OFND 2HDHA 4MUHA 3DC7A 3NBYC 3LYLA 3OJ0A 3I5XA 3QPBA 4LCBA 3WGMA 1T6YA 3A28A 3UHPA 5EWJB 2ZYTX 2HFKA 1C7QA 3U81A 3V1MA 1M8FA 5ECGC 2ONZA 4JJGA 3EMDA 3N2EA 4FZVA 3TLGA 4ZYXA 2QLJA 2X22A 3U1TA 1KHHA 1XTKA 4G0YA 4LRUA 4GKVA 2KI5A 1MB2A 2JAPA 3FBTA 3V3TA 2AZDA 3OHMA 1OGJA 4TMFA 4ZOLF 4JOSA 1Q7TA 4PO3X 4FDVA 4KBGA 4DKJA 4L3VA 2Z9DA 1T91A 5IJZA 1A8QA 3DEZA 3TQSA 2YTZA 2JZOA 5IDWA 1EWRA 3T5PA 2QUJA 5F12A 3IEUA 3OJCA 3GJZA 3D2BA 4L08A 2WE8A 1IAVA 1TZBA 4FGLA 2IU0A 2ZE5A 1HG0A 4D97A 1DBSA 2JKZA 4ZO4A 5ESWA 5ALMA 2VZ9A 4GXQA 3TOXA 4I4LA 3SY8A 3ZS8A 3WNZA 5CFMA 4NARA 3SMVA 2QENA 2V0CA 4IX9A 5FJIA 4D9CA 5T8KC 4PLGA 1Z4NA 5TMEA 3P2KA 1BRTA 5AJYA 1Z6GA 1W75A 1YAHA 2I6UA 4EY6A 3QKSB 3UCXA 2ZQYA 1UBOS 2J0UB 4PAMA 3CNQS 2GZ3A 4H4DA 4TYQA 1DIOB 1HK7A 4DY4A 3LUFA 2HTEA 3GGCA 3F67A 3JARA 4JJ7A 1PK8A 4M21A 3RK1A 2G77B 3UOAB 3WYNA 3W5JA 3QV1A 3OZGA 4CTKA 1X39A 2FW6A 3BORA 3ZHXA 4PC7A 4DM3A 1MV8A 3E5RA 3B3AA 3GCZA 4CIWA 4JCCA 4JU8A 1HNZB 3EC2A 2CMHA 4MHSA 3UATA 3VYWA 3RYFA 5F9HA 1P0MA 3LI2A 3X3HA 3BERA 3VZSA 4BKUA 4U7DA 4MJXA 3RUFA 5KNCA 1NMXA 1W2WB 3SXPA 1TQ2A 2P4UA 1CU1A 5EEGA 4EBBA 3EVGA 1PL8A 1J33A 1GWNA 1UEIA 2J45A 3UMMA 4X8MA 4IIXA 4Z4QA 2Z8ZA 2FAXA 2IW1A 2JGDB 4AWBA 3R6GA 2C2YA 1RAEA 4DXHA 3PGMA 4D0SA 4IZIA 2LVBA 3IPRA 4FQ8A 4WEQA 1THZA 3VR1A 2YCBA 1KEUA 5LL6P 3WGIA 3NOQA 4I4IA 3GAZA 4CQLA 2W8BB 4IGFA 4J4BA 2FEKA 1W85B 4FU0A 3P2MA 3AIMA 2RHWA 1E96A 1PDWA 2XB8A 1SVOA 3PVCA 2R86A 4YFVA 3P27A 2CDBA 1GU0A 5JQGB 1AVTA 3FPGA 3RYTC 4E30A 3T3GA 1N2GA 3E15A 2BKXA 4C3OB 3DHNA 2Y8EA 1X9GA 9LDTA 4B3SB 2QUAA 5CP8A 3SFVA 4ZYYA 2HMAA 2H5JA 4A91A 5CBKA 2A5JA 1PR3A 2Z5FA 3GFPA 5L3SA 4WFQA 1OIWA 2FR0A 5DRYA 3GYGA 3NOVA 4JI2B 1JAHA 2CDNA 3FRIA 1KY5A 3GG2A 1PS8A 4F7DA 2B78A 2Y1FA 4TWIA 1JQKA 5KS2A 5K3DA 2RHGB 1P18A 1E6EA 3FDZB 4WERA 1GKYA 3FAZA 1FL9A 3B53X 3BRWD 3CH6A 3TR5A 1X0VA 4URHA 2GDJA 1ESDA 3RRZA 4C0KA 2V7EA 2WAAA 4BQFA 2R6FA 2H1VA 2E49A 1DXHA 4J1SA 1CZKA 2VOEA 2V7GA 2UVDA 3SZOA 2CCJA 3QVJA 1LZKA 2Q7DA 1Y8CA 4MKZA 4DKXA 2PKQO 4JLWA 4H7FA 2UXCB 2RC6A 3B60A 5GONF 4PAOA 1A50B 5H70A 2AUTA 3C85A 1BCRB 1HFEL 2YQ5A 2PRZA 3DBHB 3VC7A 4AF6A 3RC8A 2HXYA 5IN5A 3DTYA 1GKIA 4WLVA 3ZXYA 1ZUHA 4E4TA 3Q15C 4RD0A 5BV1A 3I8XA 5FA8A 1G8SA 2JAOA 3RQIA 3W0LB 1NN1A 2SHKA 4GMXA 2JBWA 4TXLA 2PYDA 3L6BA 4YAIA 4L9SA 1XRLA 3URMA 3TE7A 5CLHA 4KQ9A 2FTKE 3WGNA 3VGJA 4L0CA 3KDSE 5C1BA 4E51A 3TLXA 1AKTA 2JCYA 1WBBA 2FPPB 1JZSA 4KHZA 3KK0A 1U0GA 5FPKA 4XFJA 3CSDA 5JZSA 1JBKA 3EIWA 1Y1PA 4GU5A 4MDFA 3ZCSA 3ELYA 1NW8A 3NP9A 4WBNA 3HDYA 1RHKA 2RGCA 2X77A 3QKUA 3FETA 5DGIA 4A8JA 4CIYA 4DUZB 1V8FA 4I46A 3LBHA 3RYCB 1OREA 2XUGA 4OFXA 2GRUA 1U0NA 5CCBA 3BAFA 4D79A 1E3QA 5HHTA 5K45A 4RFSB 4BFYA 1NONA 2JIZA 2ZRDA 2PXAA 3NG1A 3K6JA 4MWTA 5TJ9A 4TS1A 1ULUA 3MAAC 3RNLA 3K71B 4CF7A 1NG9A 3U4MA 4R3NA 2E55A 3CRRA 1MT0A 1UOPA 3IVRA 5GV8A 3GBSA 3ITKA 1F9EA 2J9RA 4WDQA 4HDNB 1R0XA 1Z3CA 1N3YA 4WE3A 4Y2HA 5CURA 3V9AA 3D4BA 4BCDA 3DGEC 2MOKA 3U3MA 3GI1A 4AP6A 1HQDA 2NO4A 3O3MB 3ITNA 4JMPA 2C78A 2DQ4A 2ATIA 4IDGA 4MV1A 5ALGA 4IVRA 3MUOA 4AZVA 4NCKA 2HXGA 5DT2A 3FGPA 2I67A 2XNKA 2AJLI 2YV3A 4Q4AA 4PYOA 1RYEA 2WYVA 5DTJA 4JQZA 3OOWA 4WOKA 1X2EA 2W00A 5DW0A 1V43A 4MH0R 3EGWA 1EGMB 1R0LA 4ZAWA 4IHJA 1N5JA 1SC3A 3M4YA 2R6JA 4MMZB 4BOYA 2FH5B 4F8EA 3UJBA 3LFHA 3VV3A 4LZWA 1ACLA 1N7IA 2EL9A 1PJLA 4Q6WA 5CDUA 4B3CA 4BMPB 3MMSA 3WWYA 3VPAA 3PFBA 1HH4A 4CTNA 4PQFA 1VE7A 2JFGA 4F2WA 4M83A 4CZ2A 1CK4A 1R9GA 4WL0A 1MX9A 1ZSYA 2XSZA 3GT0A 3O83A 3ZN2A 4B47A 3K9CA 5ALOA 1MHTA 1P75A 3VPXA 1CJTC 2DVMA 2WJWA 3G02A 4M9RA 1T9GR 2JIOA 5CFNA 4NSNA 5ED4A 4B1FA 4KREA 1K5HA 3UAVA 2I8CA 4UNRA 2ZRLA 4M1QA 5ITVA 5TIIA 3SEAA 1N6IA 1QRRA 1F3LA 4F0JA 1P45A 4J3FA 4RKYA 4N1AA 2D7CA 1PX0A 3PC8C 2H1SA 2Q21A 1YF3A 4XD7A 2X1MA 4JKOA 5IWAB 4BC1A 2CUNA 3SVZA 2K6GA 4OJYA 2XOKA 1GPH1 2IJGX 4BMXA 5JBIA 4LYYA 5JNLA 1TJ4A 2FX2A 3HCOA 1GYRA 2UYCA 1JKMA 4JJIA 3LGXA 4ZQEA 1GZVA 3LYAA 3R75A 4XW2A 1XBTA 2QUKA 3HA5A 2QS9A 2G5PA 3GRFA 3W2FA 3UJPA 3MCZA 4DWJA 4MTLA 1SZDA 1L1EA 3H84A 4YCDA 3ADDA 2JFUA 1QAQA 3GBPA 3HUEA 3TVTA 2HTFA 3NWBA 2H29A 3CRMA 4HNGA 4WXPA 4DM4A 1FZTA 2J1LA 2EHDA 4R69A 1B1AA 3ANLA 1Q0QA 3LGAA 2VQSA 5L9AA 4LVOA 4NJOA 5IDXA 3ZTTA 5KYNA 1E0SA 1U6IA 3H9UA 2LV8A 1PSWA 2IYTA 3NHUA 2DF8A 3AM4A 4W9NA 5H16A 4C0BA 1OXMA 3LQFA 2PLFA 5E9QA 3WIDA 1DJLA 2X7JA 4C7VA 3WLPA 2CF5A 2WE7A 2AQ8A 2VN8A 1J09A 2HSZA 2B2XA 3OU6A 4RMJA 4QFBA 2G3YA 4N41A 1G5IA 1FBNA 3T5DA 4Y3UA 1KS9A 3NI2A 3DW1X 3W3AD 4A2QA 3PF9A 1STOA 2ZBQA 3SZRA 3L8HA 2RHTA 2W2TA 1IE3A 1KGSA 3B36A 3JQ9C 4PY2A 5K8TA 4LYJA 3U6BA 1M54A 1DC3A 2ZUTA 3SC2B 1G38A 1S8OA 2FN8A 1G5FA 1L7PA 4ALNA 4P38A 3GR6A 4XUCA 4BMYA 1B6SA 3D4PA 1G3RA 3UO8B 5GJBA 1ILEA 1ADCA 4XVHA 1WHSA 4ZI7F 1T5HX 1SVUA 5K09A 1XO1A 3LPNA 2C2GA 4E2YA 1M6WA 4MPJA 1PJCA 2GA9A 3EYWA 2WTUA 2YJTD 3B2QA 3RVBA 3FI0A 2R8PA 3DE6X 4X97A 5EEHA 3TGLA 1RXVA 3C8UA 1G2OA 3ABIA 3NJ4A 4I19A 3IELA 4AULA 2H1WA 2A1UA 2ORED 1W0JD 1AGNA 3ZTYA 1G3QA 4DCSA 2ZBRA 4OQYA 4PIPA 3GVCA 2WJJA 4TKLA 5I51A 2JGRA 1M6VB 2ZIFA 2HNBA 4HP8A 5IZCC 5K0BA 1L7OA 3GRYA 4Z0HO 2YJZA 2H2WA 3K0KA 4IXNA 1KGDA 2V1XA 3ENNA 1KI8A 1ZRSA 2C07A 3ZX5A 1TK3A 4M1TA 2QHXA 3MAGA 3KB1A 5ADWA 3MTAA 1VL1A 3MOIA 2XMPA 3E7DA 3LV8A 4KK3A 5ALLA 1HDEA 4NYMR 4RTOA 3I4FA 2WMOB 2A88A 3CH4B 1G4UR 1Q2XA 2G28A 1WW2A 3P7MA 3GH1A 3I52A 3SYRA 4U3JA 2D4HA 1GILA 1P0IA 2C7RA 2AOVA 1R37A 2Q0HA 1T1IA 3PHCA 2AJBA 2C99A 2ZBEA 1XNGA 4IFIA 2HRDA 4JU9A 3A6LA 4YV2A 1ZAKA 1J2RA 1U5AA 1NX6A 5CYFA 1X3LA 4FOOA 3ZE7A 1XKLA 1ZM2A 3GB9A 3GY0A 4LZAA 3I53A 3F6CA 5I7VA 1OVMA 4N01A 3ICEA 2ZJ2A 5D5PA 3VSEA 4RLHA 2W6MA 4JXZA 1R15A 2LGJA 4BN0A 3KEGA 3MTJA 5K3SA 3AJRA 3HGMA 5FUYA 3VR0A 1JEYA 1T4CA 4YR7A 3ZEIA 4RDIA 3OTOB 3ZU3A 3U3RA 1XJWA 1A76A 1AQYA 4HDRB 3CRNA 2BFFB 2Q7OE 1JLMA 2BI7A 1V16B 4XQCA 4J76A 1B6TA 3AVVA 3I92A 3ZIUA 4RELA 2PUVA 3IV7A 2V59A 5LKAA 3SHVA 1CEXA 4PCLA 3LT5A 1KJ9A 2YMMA 1A2OA 2OCIA 4U8GA 1KH3A 2B2NA 3AH8A 3NRCA 1R16A 2IYQA 3CONA 4J7AA 2OV4A 2BLLA 2V7PA 2Y2UA 2Z43A 2NV2B 2VT6A 4K0RA 4OOEA 2V3WA 1YJ5A 3NVKI 1CLUA 2ECKA 4TMXA 3W4KA 5C1IA 2OYCA 5J43A 3F4BA 4BMZA 4ZMSA 2GAIA 2EAUA 1OI7A 3UYKA 1F2TA 3WQQA 4Q3AA 5HBGA 3OOYA 1M2NA 4B4OA 4PTLA 1W35A 3M70A 4NBTA 3SF8A 3DNFA 3JS5A 3FYHA 1T0PA 2Q3HA 3QA9A 4WZBA 5DMXA 3WIVA 3QEOA 4B33A 3PD7A 2GK6A 5ARBA 4C14A 5AESA 1QF6A 1GA1A 2X9NA 3KOUA 1HMPA 1P7YA 4F5YA 1QO0A 1NQVA 4R01A 2JI6A 3QEAZ 3A1SA 3SZUA 1H0HA 1IOWA 2D74A 1WMBA 3M34A 4GXRA 4WINA 3TG8A 3MOSA 2Q9BA 1EWTA 1ST3A 4PGHA 5COQA 2FPSA 1E1CA 3PDIB 1EFVA 3CSUA 5A2GA 4XZ3A 5IAGA 3LC0A 1N5MA 1IDN1 2JS7A 4TMZA 3S2SA 4ARIA 4DB2A 5EWMA 2QDKA 1YIAA 4G4GA 1KERA 3EB9A 3FPCA 4IIEA 4OD0A 5JRJA 1JR4A 3COJA 2WD9A 5IN4A 2OXTA 3PNVA 4YTEA 3CHYA 3RC3A 1XE3A 2NADA 2HDOA 2NSYA 1CIJA 1J7KA 4M0DA 3Q1LA 3U7RA 4EDFA 1SXGA 2QD4A 3IKMB 2ODTX 4ZCLA 2IRWA 3TQFA 1Q3KA 2W4QA 1Z0SA 1IQ0A 3SIPA 3T3OA 3NDIA 4KGXA 5I9BA 4Y98A 4BGDA 1MBZA 3RSFA 1QCYA 3IP7A 4AO6A 4TL6A 2VNIA 3ZJVA 2ZJ1A 3JYPA 3UY4A 1H9BA 2XUOA 2MSWA 2Z98A 1KKLA 3OT5A 4KQ6A 4AKTA 4TN1A 4OL0A 3LCJA 1P0FA 1DBPA 4JB8A 4XASA 3RD5A 1ULTA 2RI1A 4NH4A 2AXNA 4QYXA 1C0LA 4BCCA 3KYCA 5EESA 3ZW7A 1UBLS 1Y42X 5DX1A 1LCIA 4X62B 4GMFA 4M49A 4CM4B 5IFKA 2YFQA 1C30B 3CGWA 3V1NA 1Y98A 1AY0A 2MMGA 4DCNA 2JDID 3RU7A 1ZMXA 3AW8A 3WRWA 4YRKA 5JH7F 2XDYA 3RT9A 2XA9A 1UFRA 1WA5A 3FH0A 3FNIA 3H2GA 4HH4A 5GM1A 3ERCA 1PJRA 3QKIA 3IHWA 2C54A 4RXMA 1YDWA 4NENA 1DKUA 3H2YA 1GTL1 3F96A 3B85A 2JCSA 2VJBA 4UHEA 3PTAA 1ZGAA 1KAOA 4DJ5X 5JUWA 3CEJA 4MQFA 1QIFA 1VI6A 4OSEA 5E1BA 1JUDA 4OQDA 5BT9A 3JQAA 2Y92A 2JIQA 1DBIA 1WE2A 2CYAA 3JTMA 4NS4A 1EU1A 3H16A 4G1UC 4P58A 1G41A 2BJWA 4HSEA 4GT1A 3NIGB 4AYXA 1RM4A 4BB0A 4YDQA 1A9SA 3R09A 2FWRA 1WD5A 1IRXA 3EC1A 3UB3A 1VBFA 4RESA 3U7HB 2Q3EA 3EY9A 1O58A 1ZL2A 4CTJA 4CTOA 1O6CA 4YASA 2WIKA 1QVZA 2CFSA 2F3RA 4ND8A 3DLPX 3R23A 1TUIA 4HN2A 4IMPA 4YDRA 1MABB 3DP7A 3QH4A 4JVLA 3BBPA 3ZJ5A 3K9NA 4EI9A 3MERA 3F0TA 3GN1A 1QYXA 4N0PA 4QBKA 3EZNA 5HG0A 1IUPA 1ABFA 4R54A 4BX9A 3V7NA 2AZXA 3R0IA 2VLIA 3FFTA 4FHCA 4YCLA 4OBEA 3N5KA 2C5HA 5TB5A 1U1GA 5FF9A 4ZMBA 3E1SA 3HRIA 1OX4A 2A3NA 3DWFA 4TYPA 1L7EA 1TRHA 2CYCA 3HJGA 5EERA 1TMOA 2EU8A 4Q82A 5FWYB 4HUJA 3UJ7A 2P62A 2HK6A 5ALRA 3UC9A 2M98A 4NOLA 4OXYA 3IUSA 5A2QA 2ERXA 2WAXA 1XCMA 4YJHA 2B35A 2YDYA 1PQYA 4HDKA 4YJ2F 1Z5ZA 3OPXA 4MWZA 1ETUA 4GOJA 2XB4A 1Y3FE 1Z25A 3MJCA 4ZU1X 3DBLA 5DXFA 1C4OA 1WCXA 5AQ1A 1TO1E 1W7AA 4BEVA 1IB6A 2WG0A 3K70C 3BK2A 1VI2A 3DKPA 1FLAA 3X44A 2R25B 1O87A 2J59A 1YS2X 1ZN8A 1Y8RA 3FD8A 3KB8A 3PGKA 5FHQA 4GQAA 5CG1A 5TNXA 5KX5B 5L4NA 4DLTA 3BUSA 5G1OA 4TTJA 5CEFA 3PCRB 2Q62A 3SSOA 3HJTA 3NR2A 5B6JA 1BXKA 1GGVA 4WZZA 4FFDA 2IU3A 4M0LA 5TT0A 1H2RS 1GAXA 1SU6A 2PJUA 4L4UA 1CRLA 5L8VA 2R48A 4IO1A 2QZ9A 5LQNA 1D07A 3GP8A 1HKHA 2R5FA 1PSDA 2I76A 2FMFA 4IX1A 4JT4A 3DONA 4W1QA 1RXYA 5CT5A 2LDBA 4NJEA 2CNKA 5A5DA 5KVSA 1QSGA 1OXUA 1SCDA 1N9GB 5KB3A 2R8ZA 1CB7A 4BKPA 1XJCA 2DXIA 1GDTA 5LLTA 3ZWYA 1QV6A 3FUVA 4RO0A 4FPXA 3THWA 1JDJA 3IR6A 3U4QA 5ALJA 2DY1A 1R8XA 2WU0A 3IUJA 4IV5A 4M1YA 3U3ZA 5A6SA 5ISMA 1D4AA 4UM5A 3AP3A 2Q4DA 3QI2A 2TMYA 3ZDFA 5FWNA 3AG5A 3I8SA 2XTNA 3G5TA 3G8AA 4QOFA 3W5UA 2CUTA 4WRRA 3TE6A 2NVUB 1NBAA 4ZOAA 1P5ZB 4S24A 4EW3A 4HYQA 4WKNA 4C4ZA 1IHOA 3CPSA 2BFBB 2HBQA 3EJ6A 1E6LA 1HYQA 2WB4A 1H2WA 2X9QA 1SN7A 3CF2A 4L75A 2CXUA 1LXCA 2KX7A 5BN5B 2H4XA 3HO8A 2VDUE 1J1ZA 1UJCA 2C4KA 2XLBA 3QE4A 1L8OA 2XVXA 2QVCA 4KTVE 3ONNA 2ZJYA 4ZN6A 1S2NA 2R00C 1JVBA 1PYOA 3EPRA 4MV5A 1TX4B 5CYOA 1DV2A 4DIDA 4EFDA 4YMUA 5CA1A 2O4UX 2AQIA 3K05A 3D2CA 4CG2A 3Q3EA 2ZRFA 3KE9A 4ZIRB 3IBYA 3ZQJA 2CZQA 5CCEA 2GJ8A 4ANFA 3QXHA 4ZI5A 4EQ6A 1TTQB 1X9HA 4IJVA 4MYDA 3VR3A 5CAEB 1AH2A 1J8FA 2YWBA 3ZUPA 2GHRA 1T5TA 2NT3A 2O2YA 3C87A 5TMBA 4B81A 4BP3A 4D9EA 5HZMA 1RFLA 3OJWA 1E9RA 1Y6QA 3O5AA 2YJNA 3AHGA 2DLCX 1N33B 2PBLA 5B1EA 2IDKA 3L93A 2HUPA 2WA2A 2XNHA 5DHPA 3KCQA 3ROMA 3L0SA 1XMIA 2Z2YA 2Z1DA 2BI8A 1NJ1A 4EG6A 2WDPA 1CYEA 3PQ8A 5M34A 3JX9A 4HN9A 1QFXA 5AUQA 4BNVA 2QTGA 5KOHB 2PWPA 5IKOA 5E2BA 3DE4X 5AJTA 5BN4B 3IURA 1AHPA 4PV7A 4XCVA 3EGXA 1TCBA 4ZAXA 2FQ1A 4WFJA 4OYHA 1OC2A 3ML1A 2YKGA 1AF7A 2EWWA 4F12A 2BP7B 1RXCA 4NX2A 5CNIA 3UFXB 3V8EA 3OKPA 1I1HA 4FOPA 2IOYA 3K09A 3TQOA 4D0NA 1HE5A 1BG6A 1RWKA 2C9DA 4F56A 2ID8A 4P5EA 2EBUA 1IEWA 2OLKA 4OPMA 3TDNA 4FDTA 3N2GA 1HLFA 4FIDA 4FGWA 4M36A 2VAMA 1WJGA 2BGRA 1N6PA 1SC1A 2IHJA 4YFYA 1UAYA 2V96A 4MVJH 3WK7A 4B17A 3DEIA 2WYWA 3K6RA 4MP6A 4RXTA 3S1SA 3JD0A 4JP1A 4MQ4A 3RTDA 4JUAA 3EAGA 1MAWA 1V0JA 4MUNA 1G4AE 1ESZA 1ZH6A 4B44A 5B6IA 1DELA 6PFKA 2IEIA 1KMHB 3QXSA 1QVWA 4S0ZA 3FSRA 5K1ZA 4RA9A 1YRWA 2WKWA 1VKHA 3G89A 3OA2A 1T6ZA 1W44A 4GKBA 4I4TF 4NPCA 421PA 1LS6A 3JXEA 1N77A 4UC0A 5UKDA 2RCYA 4LYHA 5BNIA 1AO3A 2WIGA 3UOGA 3EA5A 4LQ4A 1ODFA 2GD0A 2CGEA 3DHWC 4KW7A 3LCVB 5IT0A 5EJ2A 4AC9A 4KO8A 1WB4A 4CM7A 5GQSA 5IJ9B 3PXGA 4PNZA 2P11A 1IQRA 1EP1B 1P74A 4D3SA 1TA4A 4MYHA 4OJTA 4OH1A 3L1JA 3JD2A 2WYOA 2PL3A 1FP6A 3R5SA 4AD8A 2FUG6 3E3LA 3O0TA 1P61B 4EUHA 1K3UB 4URZR 3HV2A 3A36A 4G1CA 2VZEA 4W5HA 2ZIAA 4P0PB 1ELOA 2JLCA 2YICA 5E3JA 1BDJA 4ZK2A 1JZTA 5D86A 1NI4B 1EHYA 3TKLA 3HXMA 1EDOA 2OK7A 3L9XA 2DU8A 1ENPA 3K0AB 3ZHOA 3UTDA 5B30A 4XDHA 1PRYA 2WWWA 1A9XB 1VP3A 4X3PA 2FEOA 1QG4A 1JJAA 2EG9A 4B6FA 1LVGA 2HLHA 1P29A 5CLGA 2XUHA 5IANA 5KC9A 3BH0A 3ISJA 4YJ3A 4QYSA 1HTWA 4RVOA 4G0UA 1DHTA 2VDJA 3G2OA 1SXJD 4JLPA 4XWYA 1SVIA 5DNDA 1NE7A 4E7OA 1LD3A 2W6NA 1MF7A 2H18A 1XOIA 3IIIA 2QG9A 2G6BA 3I9JA 4Y6QA 5JNTA 2H0AA 2NOAA 2Q4TA 2WU1A 5LZ8A 2YV5A 5L51A 5IMSA 3JQDA 4UM7A 5DBHX 1F2DA 4UFPA 5JMTA 2AFIB 4CM8A 4C21A 3UM9A 1OFUX 2BUCA 4B3JA 1DG3A 2NSJA 1J0XO 4EARA 4FDLA 2X2FA 4TTPA 5DF1A 3WL4A 1YB5A 221PA 4R9RA 5JI3E 5ANRB 5CHEA 1MAAA 3WSWA 4AZSA 3ASZA 2XZTA 1CRQA 2G9VA 3WWEA 3GCWA 4ETMA 1FLNA 1GNSA 2ZG6A 4HB2A 5JLAA 4E46A 1CF4A 3OTGA 3U4IA 2GD2A 4OI4A 4QQFA 2ZROA 1G19A 2C31A 3TSCA 3K8OE 4CN8A 1CUCA 3KNZA 1M34E 4PPFA 1ZGGA 2JGNA 3I23A 3L6OO 3VZPA 4QRIA 1M5TA 5D1HA 3MJHA 1UJMA 3D3JA 4C88A 1Q0SA 3N2ZB 1ORVA 1IBLB 3V5NA 4F9FA 1G2QA 4G8JA 4LTNA 5ED0A 2IA5A 5F1YA 2BEJA 3KXIA 4FTWA 5HRUA 3ESZA 3GXBA 1IJFA 1UDAA 3HXTA 4AICA 2QBYB 2R6DA 4OQNA 1YQDA 1V11A 3MTBA 1JLLB 5M29A 4HWSA 2QN8A 4H7DA 4NMXB 3GFRA 3I8OA 4ON9A 5BN3A 5ADHA 1JB1A 2BM9A 1US8B 2ECFA 5F3WB 4DLPA 4NH0A 3S3TA 3U9TA 1RKXA 2O1EA 1KXJA 4C43A 5BWLA 3SI7A 1I14A 1ZD1A 4I55A 4RKWA 3ZXSA 1BJRE 3EMVA 3WZ2A 4ARUA 1BVRA 4IDCA 3GFVA 2BCGY 3OJXA 2QG4A 1Q57A 1I9CA 1XQ1A 2W6JD 1XK7A 5EJ4A 3TIGA 4ZZ0A 5JISA 3WJ1A 2RHCA 3H6KA 1FYXA 1FFSA 4HC4A 2XRZA 4F97A 3SQDA 1PGOA 4FFPA 5KQPA 1KETA 2CLCX 1ZK2A 2O14A 1KMIY 1B3BA 2QRJA 2OP0A 2Y68A 3MWDB 3BXEA 5I7AA 3ETDA 4GSLA 3R7WB 2WF9A 1LWOA 4OHKA 3R20A 5EJAA 3ZDRA 3QZUA 4BASA 4ZVOA 3LBNA 3AUYA 3TSWA 2RGNC 4ZRDA 1HYEA 1ZMRA 4FMCB 4OHCA 2UAGA 3TNFA 2P75A 4IWNA 4KRYA 5B57C 1ABBA 1YHZA 3B1VA 4K8RB 5KYGA 4KQIA 3ZDCA 1MGOA 3CQ9A 3DULA 1CUXA 3FNRA 4OGLA 1LDNA 4TLMB 1F0NA 13PKA 2Q1SA 3FCCA 4WAUA 4HEHA 4CCSA 4D9FA 3D5EA 5A06A 2BFMA 1YQ9A 3QK7A 2P6UA 2WV7A 1XF9A 1ITZA 1QO9A 1ZUWA 3OCUA 1PGPA 3EQ7A 4QGAA 2RCNA 2Q1WA 5JMPA 2O0MA 5DLPA 1YMQA 4RC9A 4PSCA 5EQFA 2C83A 1GGHA 4UTPA 3PXAA 2UYQA 4LPSA 4HD8A 1BS9A 1NW6A 4IICA 3L04A 3GA7A 1A0OA 1IN7A 4JS0A 1IN5A 3D3QA 3NDPA 3RIXA 1AB6A 1RBMA 4IQ4A 2JHFA 3OX3A 4K6GA 4ABYA 1PJZA 2EJBA 2ZI4A 3C2QA 4HDMA 2Q2NA 1QLHA 3OP1A 1OI2A 2BEWB 3U17A 4J94A 3RJ9A 3ZWMA 2DR0A 4AJ1A 3AVWA 2Z58A 4FUTA 4P7JA 2CLSA 3B6KA 1NN0A 3ZCRA 4LF4B 5K3OA 3CZCA 4PAWA 4UU1A 4ZWNA 4EG0A 2PZGA 3T7CA 3WWPA 5JMWA 4HAXA 3R5XA 4R1TA 1FLVA 2X9VA 3LT4A 3N5CA 1HNNA 3TTXA 3W1EA 4K1LA 4MO9A 2B36A 4WUVA 3WISA 3DMFA 2P9JA 3SSMA 2RGGA 5JNVA 5MN6A 1EUYA 4J43A 4MP3A 4CF5A 2FLKA 3SKXA 5B4UA 2FHSA 3O4RA 3J81A 1W2HA 2FDXA 2GCOB 3D43A 2HNKA 4FFLA 4E07A 1KJJA 3FKSD 2QR2A 1HZZA 1RBZA 3IKJA 3QWFA 4HZGA 2YXNA 2B9EA 1K66A 3X2FA 1HYBA 4MARA 3DUFA 1QZTA 1GCGA 4R0VA 2XJ9A 2A84A 1SUSA 2BEVB 3QUQA 3HJFA 1XROA 1MC1A 4BB5A 4KPFC 3PP8A 5EJ7A 4ZDKA 1P19A 4M0EA 2WTAA 3CLTD 5IC4A 4NZYA 2Y99A 4QBIA 4HEQA 4YWHA 3I9V1 2P9CA 3DFIA 4HLCA 3ESXA 2WWVD 1PFKA 3D6HA 4EPXA 1L7RA 2EJWA 3PITA 1ZJYA 3I9KA 4IV8A 4F1JA 5KNBH 3CRQA 1BHJA 4UHFA 2REQA 1X7ZA 4S3MA 5ETJA 2IZ6A 3CUSA 3NTLA 3LNTA 3O7MA 2IS4A 3HKEA 2YRFA 4RTLA 1T4MA 2OFXA 1FUEA 3OETA 5DNWA 1RRVA 5G3ZA 4L0QA 4HXGA 1BS1A 4TSFD 2FG5A 2W6OA 1Z4JA 4IGAA 5JDCA 1UPTA 4CL0A 5DI9A 2DFKB 3D3NA 4N40A 4ZQHA 4TWZA 1W4ZA 1ODSA 2GHQA 1TF2A 2Q28A 4PLVA 4TL9A 3HXOA 3Q12A 1KI1A 1TB4A 2GZHA 1WS6A 1IPEA 1I3CA 3MIIA 1KOGA 1D1SA 4D41A 3TGPA 3ZHZA 2DRIA 5CW1A 2QL6A 4LC0A 4P82A 2HWXA 1VPVA 4QQRA 2CDRA 3D0QA 3OFNA 2ZI9A 4WFKA 1YBVA 3TLGB 1KARA 3GGGA 5LWHA 1QIEA 3IS3A 1T8UA 1J56A 2AFHA 4FT2A 4G9BA 1EEXB 1W581 4OK5A 2IYUA 4M1MA 1MTZA 2VTVA 1NNSA 4MW6A 1R6AA 2FRVA 4S2UA 1FVXA 3X1JA 3O3CA 5GIPE 4UU8A 4UMDA 4L0MA 4BQOA 5LWQA 1U9JA 4O2AA 4GKJB 2QRQA 4FBLA 5CK5A 5CR9A 1ZHOA 4NXNB 1IWBB 1OXTA 3CKKA 3RRYA 4ZEMA 1KFCB 4X6LA 1P8JA 4JLBA 1JDVA 2WSIA 3BJIC 2JFXA 4RJKA 3PT5A 1QBGA 4BE7B 2LIVA 2RH9B 4F3NA 2F64A 4JKIA 1FRQA 1FS4A 4E03A 1VKZA 1QZXA 3AEXA 3E8SA 3L41A 2VHEA 4JOBA 4R7GA 3QG5A 2DCMA 1NV9A 3Q85A 1L7BA 5B2ZA 4DSTA 4XX0B 3KV3O 4GKAA 4KE9A 1U2PA 4YALA 3WLNA 1A8HA 3UJ8A 3KQMA 1AGYA 4YY3B 1HEIA 1BWRA 2DQYA 2WT8A 2E4AA 1UFOA 2ZDGA 1NVVR 3CLVA 5CCDA 1HPLA 3S70A 3T7IA 1UPBA 1ZUNA 3B1FA 3JARB 2G7MC 4O0MA 3TW8A 4FB4A 4YUWA 1T9BA 1AHHA 2ZIXB 3HY3A 4PX3A 4DM7A 4DVGA 1CY8A 2V6BA 3PPVA 3QVOA 1LRKA 3NORA 3V6MA 3VKGA 3K5IA 1A9QA 5CNMA 3D8RA 1YVPA 2JLQA 4C0HA 4ERXA 1PJ4A 3KKEA 4Z51A 2P6PA 1DUSA 4MINA 4KXFB 4NCHA 4WDRA 3MPOA 3MWYW 3O3NB 3FUWA 5BR1A 5LP6F 2ES4A 2H4HA 2PS9A 2J5QA 3DT6A 3N3AC 5DLDA 1K8RA 3MGBA 3TN7A 3C41J 4R2MA 1ZRNA 4G1BA 4TQUS 1E7WA 1BU5A 1USKA 2WSBA 1D0VA 3W8RA 3BWXA 3OO1A 1EXWA 4H60A 3K0SA 2IHYA 5CUQA 2D2VA 5JXGA 5AVRA 3TECE 2ODNA 5DBIA 4R2HA 1YONA 3LSYA 4KYTA 1MZPA 2WYUA 2GLTA 1JQJC 3MUFA 1NN3A 5HF8A 2N42A 1E2UA 5KKCA 2OESA 1XEAA 4NE9A 3E3MA 4NNPA 3LD9A 1QONA 1ZD5A 2O6LA 1LX7A 3IODA 4J9VA 1V9CA 1Z2CA 1Z83A 4ZVKA 3TK1A 2C7QA 1RADA 3I09A 3V33A 3CNOA 2NV0A 3D7RA 2HJRA 1SAYA 2C4HA 1P9LA 4D02A 1IRIA 1JJVA 3FOZA 3HRHA 1NR7A 4TWBA 2B1JA 3ADCA 4FS8A 1GP2A 5A4JA 2YMLA 4BN5A 5JD4A 1U98A 2LDXA 1CDDA 3BHIA 4BV2A 1ZICA 3RSLA 1MNAA 1QTRA 4PXAA 3FMPB 3HKCB 1E2KA 1M1YA 4HQ0A 5DPMA 2FN4A 5D7NA 1ZUD1 1TQDA 5HCUA 1IHDA 2NM0A 3N7TA 1U94A 5TRTA 1FFXB 4P0QB 3C7TA 2ZRIA 3IT2A 4HNSA 4F3CA 4C7BA 3LOQA 4Y0VA 2DJ5A 4MCIA 1Z5PA 1LZLA 4GPZA 2IUEA 3BRWA 2R6AA 2VYQA 4BFXA 1BWQA 4FYJA 2HA2A 1FLDA 1L5ZA 2HA3A 3H8WA 3G7SA 4IM7A 3L0PA 3Q1KA 1N8NA 3B6JA 4WADA 1VJ1A 3DAFA 4JMLA 1OSNA 4NMMA 5E1OA 4DA8A 5IKPA 3UMBA 1QVRA 1ISMA 1HT3A 2XUJA 2PVPA 2W2KA 1PR5A 1QMPA 2G8LA 3FWPA 3WLJA 1UBSB 1ODTC 1UANA 1XA3A 1J8QA 3ET4A 5E0KB 3R74A 2FFJA 5JCJD 5U9CA 1ZLYA 3HVJA 1YOVB 2XUPA 3DM5A 1YVEI 4D1YA 4R16A 4OUDA 1UBCA 2WHPB 2VWPA 3FVVA 2ZR8A 3RODA 2ZWIA 2IOHA 5CK4A 4TGLA 3IOYA 4B35A 3WGUA 1JQBA 1Z62A 3N7UA 4MRSA 3RJMA 2EJCA 3UCEA 1P0QA 4AT1A 1WSBA 2IYWA 1D1PA 3M6FA 2HYDA 2G07A 3PEUA 2FXIA 3BM5A 4BNTA 4EPTA 2EQAA 4YT2A 1OBOA 1SWWA 4IUYA 4UHCA 5D6NA 1L3BA 4A8JB 4B87A 3FM9A 3ZV4A 2MYNA 3VDQA 2H9YA 1BDHA 1U3FA 3USES 3C3JA 1AMUA 3AJ9A 3HCCA 3MWKA 1OZAA 1FDIA 2PUCA 2ZRPA 3G1WA 5HQ3B 2FKAA 4XJSA 3LWDA 5DGDA 1JMKC 3PNPA 1ZVKA 2WZQA 1OXBB 4WA7A 2AZTA 3BL6A 2EKDA 2IHUA 1Z4LA 1ZIOA 3K0FA 3GLVA 5CA0A 3ZBQA 1A69A 5DBOA 2ZSUA 1T2EA 1G21E 2DE0X 2W4IA 1I24A 1W1WA 3W5HA 4YAKA 4YV0A 2ZI7A 1LX6A 3CE6A 3KXLA 2LKCA 1P17A 1ZIXA 2YNMC 3OKCA 4CIAA 1NP7A 4RD4A 2PSFA 1B42A 3WGQA 4DG5A 3G5MA 1YWGO 3AR3A 2F43A 3TD9A 1EGQA 2V6FA 4H1VA 2JKVA 1RXWA 4GL2A 3FMIA 1FVHA 1GAJA 4Q4AB 4TTAA 1HYHA 4LVCA 2ZR9A 4WK6A 4JOCA 1X2BA 4X71A 3TJMA 8ADHA 2FPMA 1H6BA 1H66A 2W2XA 5FO1A 4B4KA 4FGZA 1C3OB 1Z08A 4MKFA 1LTQA 2QP4A 2JNWA 2VJMB 4C4SA 4WNCA 1FSGA 4IHJB 2E21A 3IBCA 3OTQA 4JGGA 4O5AA 1QOPB 3COZA 3ZE1B 1YZKA 3ZWDA 1ZY2A 4ML3A 4FFVA 5AKEA 5FQOA 3LUKA 4QSMA 4PYNA 1QWOA 2G4VA 1QIIA 1NYRA 3KQHA 3WKEA 1Q0LA 1U2GA 3T6KA 4YP1A 1F0YA 4NY1A 4YAOA 1L8AA 1EE2A 1KU6A 3IKVA 5KAPA 1MW9X 4LRQA 1VPEA 3EXAA 3MT7A 4O63O 1WDWB 5ADUS 2CV1A 3H19A 2Q27A 1QH1A 1RJ9A 2VEDA 2VP9A 3GLGE 3AYXB 4GH5A 2F4NA 4IKOA 3DE5X 4E11A 5EIAA 1G9XA 2A5LA 4HEJA 4TV9B 3VHRA 4FDMA 5EIFA 5L3QB 5HQTA 3ZHQA 2OMEA 3ZHRA 2A9QA 4QYIA 3SG0A 4I3FA 1W6UA 3A1EA 4R0NA 3RJ5A 3A3KA 1ESCA 5IUKC 2Q2WA 1GQOA 4MVJP 2NU9A 5DKFA 4EZEA 1F3OA 1O94D 4KWCA 3BJRA 4AZWA 4BFTA 4XUEA 3HPQA 2PFSA 1GKKA 1DJMA 3QLEA 3LA6A 1OLUB 2J6CA 3K5WA 4OHWA 4XB2A 1C1YA 3ILXA 5DIZA 1SWVA 1Z2EA 4OKSA 2VQDA 5K3FA 1XYGA 2V45A 1DC7A 1SC9A 1EQUA 3FG9A 4R1OA 2QR5A 4DG8A 3MINB 3SFZA 3V32A 3O95A 1C29B 5LOVA 2D4AA 2AYXA 3LG2A 1LDMA 1QXSA 1L5KA 3FTNA 1JWLA 5I9NA 1VCIA 1VJGA 3FGZA 4E1AA 4UZFA 1M7BA 4ARZA 3FNEA 5CVCA 1KVUA 4DJTA 2PIAA 5EUMA 3UTCA 3AEKB 4MI1A 4WESA 5FLKA 1JFFA 3RRNA 3CJRA 4PG6A 1QHEA 3PTZA 2IK8A 4ZO9A 3KQTA 2FPRA 2Q41A 5FQNA 4CL2A 1L4FA 1Y9EA 4EVRA 4YQEA 4C6TA 1U6KA 2GTIA 4XPIA 3TPFA 5JAOA 4FYXA 1LC0A 3TLEA 1T5OA 4PF1A 1KC1A 2P6NA 2X0EA 5I7SA 5SYAA 1Y48E 3QY9A 3R24A 5KO2A 1NQWA 4KITB 1P2TA 3ONVA 1R88A 2YOHA 1WM1A 2IH5A 1JIVA 2PWZA 4RACA 5L7YA 4NAVA 4EMTA 3TSYA 5FUQA 3RTCA 1PW5A 3BXPA 3R0ZA 4RA6A 1ISFA 1ZM9A 5IAKA 2CVHA 2QI9C 3C6QA 2OV2A 5CDFE 5FD8A 4KDCA 2CMFA 4U0JA 4CQMD 3THXA 1UBKS 2ZU0C 3FIJA 3W3AA 4MRAA 2DBYA 1XTZA 1PUXA 1OA1A 1Q3TA 4FFMA 1NVMB 3CVXA 4FGSA 1RJDA 3L9WA 3OH8A 5ARDA 3X1KA 2ASEA 1WHSB 3OZBA 1D2NA 2IYSA 4N9WA 5JJLA 4OXQA 3M5PA 1K6MA 1W29A 4GP9A 2ICAA 5HCIA 2FWJA 2P77A 4X3CA 4YO8A 2PV7A 3RYHB 5AVZA 4AY3A 2ZIUB 1SHTX 2LKDA 1NPYA 1I4WA 4QWWA 3VYVA 4LQCA 2BRUC 4L5BA 4HXEB 4J9UE 3O4GA 3NU1A 5KX5F 3UHFA 1SPXA 4XCXA 1N4DA 4AJ9A 2QGNA 2PQ0A 4CL8A 2BH9A 4DNXA 4J0KA 3RT7A 1SKMA 4RTJA 1L7DA 4GC9A 2HF2A 1VSVA 1L9XA 1Q74A 1V4VA 1I3MA 2IHKA 1II0A 1N1MA 2QX6A 2Y6UA 3LPLA 5EKSA 4B82A 1W0JA 2WJPA 5EP2A 2HQSA 1GUBA 4C2UA 1IBCA 3L8MA 4KPUA 2Z83A 1K2VN 4CUKA 4A26A 2H8KA 2BBOA 4IMRA 3UXYA 5AO9A 3ICOA 3JZFA 3I45A 3S8YA 1S5PA 3F9IA 4I7EA 4DB4A 4HYYA 3RBVA 2QP9X 5GGYA 4B31A 2SCUB 1I5EA 4C4OA 2VHWA 5C52B 3AESB 5CDSA 2FWIA 1FFHA 4U3JB 3FOFC 3QHQA 1JEQA 1UDCA 3GOQA 1T9DA 3IAEA 2O5VA 3MTEA 4MX8A 4L78A 3QX8A 3V1LA 4BLQA 4DZTA 4FFOA 4N7BA 3EN0A 2PMFA 4JI4B 1WY5A 4DE5A 4D2IA 1U28A 5CIWA 2FR1A 4LYEA 3SVTA 1JG7A 5I7WA 1V5IA 1SURA 3NT4A 4QUAA 3WLHA 5J63A 4B43A 4Z86A 4F8YA 5CIQA 2R4UA 1KOJA 4JELA 4JFRA 2BN4A 5DM60 2VJYA 1WXIA 4U9HS 2ZVDA 4ZOQI 4N6NA 6NULA 1O0BA 2YOGA 3TH5A 2JBAA 6LDHA 1GHTA 1P9RA 1XAGA 3B1JA 3VV2A 1G6Q1 2PU5A 2BT4A 1TVMA 2A5YB 1T4CB 3AFNA 3CKLA 3HDTA 1ZRMA 1NM5C 5SY9A 3U4DA 4XWOA 2V8BA 3OT4A 4IVPA 1FS5A 2DFLA 3UYLA 3AR6A 1WPRA 1UC9A 1TFUA 4OL9A 3VOBA 4B4UA 1XQYA 3OQOA 5D8DA 1CE8A 1M8GA 3HL0A 1E1NA 2DFDA 3JQ6A 1GQFA 3PR1A 1VPWA 5IARA 3UBTA 3ND5A 1JHVA 3S81A 2WFLB 3MF4A 1FMCA 3WQHA 1AZSC 2IC5A 1TAQA 3VU9B 1BEUB 1MR3F 1ZJ4A 2EFGA 4IR7A 4U1RA 1QH8B 1A9TA 3L07A 4Q48A 2YVUA 5FBRB 5HKBA 1NLMA 2DLNA 3K1TA 1QG2A 4ZTBA 3DEFA 4CG3A 2IBSA 1QRSA 1NW7A 1R0BA 1K75A 3UMFA 3CVYA 3D6MA 1PTJA 4ONEA 3C8DA 2HOQA 3OEHD 4UUPA 4INJA 4K46A 5LBIA 3SF8B 3MJ4A 1TVEA 4WZBB 5EE1A 1SU7A 3H0CA 2V4MA 1X1AA 3A2MA 4W7HA 3RIGA 1U63A 2RAVA 2XWPA 1V4NA 2Q0QA 3RH0A 5NULA 3FWNA 4J07A 3LECA 3W5SA 2WB2A 2J0SA 1DDIA 1X42A 1JW9B 2IYEA 2QXYA 2Y77A 2ZS9A 3WNQA 4MVJD 4K03A 3TL6A 3I39X 5C35A 4OLBA 3DMRA 1VGRA 2WUDA 3CZPA 2RHOA 3UB2A 4LY9A 3SXUA 2I29A 2V9ZA 3UWPA 3KPUA 5H5JA 3GRVA 4I4CA 3NTOA 4P0TA 2DH6A 2BRUA 1FPMA 4CLHA 1WMSA 1C9KA 1K7XB 3PKJA 4N8DA 4AY6A 1EFVB 4H1WA 3QOXA 3TIVA 4AJPA 2HREA 2NQ8A 2V98A 5AW7A 4G89A 1PEYA 4KLCA 3T5TA 5B7PA 2IKQA 2HRZA 1ESEA 5EWMB 2BSXA 3L3BA 3C6MA 1P1CA 4ESHA 2FF7A 3T3MB 5G40A 1AE1A 3IAM6 3WK4A 5ICSA 1LDGA 5KMGA 3OU7A 3HVKA 3R0XA 1R27A 4TQAA 5T4HA 1LK0A 1QG0A 5E7QA 2N0SA 2EL7A 3AILA 1JIQA 3LOPA 2DTEA 1Z6AA 3DNMA 1P4AA 3ELWA 2VDMB 3MOGA 4TMWA 2JEYA 4CV0A 4KYVA 4N5DA 5CU7A 1QIDA 2DPMA 2Y2VA 1ZGCA 4RSRA 2IDMA 2PXHA 4X1IA 4JYAB 1ODLA 3DLTA 1YA8A 4IS2A 3ZV6A 4K9PA 1E4EA 4W82A 3OUUA 3FOAA 3RFFA 3MMZA 4G5SA 2BMJA 2RAFA 3AU9A 4HNRA 1WPGA 2MT9A 2WTMA 4XIJA 3TIIA 2QORA 4LI3X 4B6QA 3KZNA 3HO1A 2R79A 4X63A 4WH0A 3KYCB 3CRVA 4X44A 1W6RA 3AWIA 3EZ9A 5B4VA 5BVGA 1KKUA 4JEUA 5CLJA 3ZCVA 2F8SA 1YQQA 2OAQ1 4RORA 1XZMA 2C82A 2JGFA 2YHAA 3FRJA 2AMYA 2OHOA 3LH5A 4NECA 1G0NA 1YR9A 3EOZA 2HJWA 4LRYA 4YROA 3R5JA 4PSAA 3Q5EA 3U4GA 2PHZA 3C7AA 4I50A 4ACAA 2JB9A 5F21A 2M6LA 2C98A 4FN5A 1TQHA 1CR1A 1IH8A 1VLLA 4OMDA 4RHXA 1KK0A 3AL3A 3M82A 4QU5A 3WLLA 1GCIA 1OU0A 1AZLA 3HYCA 4NOJA 4LFCB 2ERCA 2JDIA 3LX6A 3E5MA 1AK9A 5CMLA 3PI6A 1UMBA 4RMGA 4FD3A 3RS9A 4E2FA 4E4YA 3JCZA 3KKOA 4KQFA 4F6RA 1ZP6A 4A6EA 2C77A 1H85A 3JQAB 4CM9D 4D74A 4FZ5A 1BD3A 3CW9A 3NBKA 4DLXA 1T5LA 4EI2A 1UXHA 2ZYGA 3EIOA 3PFGA 3I62A 4KDRA 4RGQA 2XODA 5C9ZA 4J0JA 4QDKA 4H08A 2VJOA 3EQ6A 5H80A 2PU7A 3DVSX 2H3EA 1RQ2A 3H1PA 4Q3EA 4JLJA 3EH1A 2AXEA 3DO6A 2BI4A 2XE7A 3I9FA 2ZTMA 1HQYE 4ND8B 3HUDA 1FTQA 2X7XA 1F9AA 3D81A 4NEHB 3BE5A 1M73E 4OBBA 3USZA 3CH7A 4M3NA 2D0OB 5JXJA 1WP9A 3OWXA 1GRQA 1ECBA 1FX0B 4ZV7A 4P80A 1EESA 1N2XA 2Z2XA 1SCAA 1EQ2A 4WVFA 4A36A 1NBWB 4IUDS 4QBHA 4TXJA 3BEDA 3AV3A 3OIUA 3QBEA 1PL6A 1XI2A 4JCOA 5C31A 1IN4A 3HLYA 4H77A 5JCZA 3EWAA 2ZYHA 4OP3A 3KSRA 1YQEA 2GFQA 1P1FA 3EAQA 3IT3A 5FNVF 5LSAA 2NTEA 3L5OA 5AIBA 2KJQA 4L07A 2XYQA 1RRPA 1OX4B 4QPPA 1TL7C 3T1NA 1LDBA 3FNFA 5FPSA 2IHBA 2AA3A 2O8NA 3IPLA 4H7PA 3OIYA 3ZW9A 1O57A 3KUUA 4MWSA 3WYGA 2A35A 2XDWA 1JDPA 1KDPA 3OX1A 5IM5A 1SJ9A 1N5LA 1CIVA 4HDKB 4TL8A 2IXAA 3SVLA 4S35A 3ZWXA 3HUUA 4O25A 4XGIA 3LDUA 3SQMA 2Y0EA 3BFVA 3E70C 1YB1A 4MIYA 5BYJA 3U37A 1VGVA 4BFSA 4B3IA 4E5YA 4DV3B 1G7CA 1QCCA 3DKKA 4BVLA 4LZNA 1SXHA 3KJFA 3VVLA 1HT1E 4Z6KA 3H0EA 2XE4A 4G26A 3D6JA 3EUFA 1G8GA 5D1NA 4S05A 3CY6A 4ZZIA 1YR1A 2JFWA 2LNDA 3CEAA 4NVRA 1XL0A 3U5TA 2EV9A 3SC4A 1A9ZA 1T3HA 3GD7A 3L7LA 4QDZA 5EP3A 5JARA 4S1TA 4BNXA 1OD6A 2FY8A 1D6JA 2IXTA 2O7RA 4ENWA 4JC0A 3W6NA 2R751 1FBTA 1PR6A 3I2GA 1KI6B 2FZ4A 4UCFA 4GAEA 1M67A 4O4JA 5ENZA 1VSBA 4UOZA 2D2IA 1X14A 2AW5A 1WD7A 2G04A 2IYLD 4NJEB 2DZDA 3HNOA 4QATA 3EDYA 5EZ6B 5FWXA 3LUBA 1ESMA 4QDJA 1ENZA 3EEFA 3NNDA 2AN3A 3ZHYA 3AWDA 1Z45A 3H9CA 3AIKA 2PX6A 3EHDA 4YRBA 5A03A 2UDPA 3HU2A 5KSZA 1MA3A 4TOIA 3H87A 2CHUA 4PICA 2I1QA 2RG7A 3CLUD 5LUBA 3PXCX 1NJ5A 4WNAA 3BGWA 4R8MA 3UAOA 3A4YA 5EXPA 1QC5B 3H2KA 2CV2A 2PXXA 1EFRD 3V42A 1XCLA 1GNLA 5C4MA 1NG1A 4N03A 4LOIA 3H75A 1KYYA 1WZUA 1TE2A 4RF3A 4A0HA 3I2IA 4ZCTA 1L1QA 6ABPA 4JBNA 1RWPA 2YVKA 4LHVA 4BTEA 4BATA 4K9SA 5AOCA 1V8ZA 3GGDA 1PZEA 3O7WA 2P8SA 2QNBA 3F97A 1W76A 1SHUX 5IX8A 2YW9A 1L8QA 3S1AA 5K8CA 3WGOA 2MWMA 4EJFA 1T4BA 4BLPA 1NOIA 4J49A 3H5AA 5HA5A 1I94B 5J1TB 1ZG3A 2BKEA 4EYSA 1W36C 2YHUA 3R3SA 1W88A 4Q4JB 1G8FA 4CU2A 1GTSA 1V4BA 4AS3A 4U7WA 1VG9B 3TR0A 3LNCA 2FWAA 4PPYA 1LW7A 2JJ8A 1WB6A 3PA8A 3LXUX 1V47A 1N57A 1WOMA 2ANBA 2HIHA 2PRYA 4JITA 2BGLA 2JLUA 4PYLA 3MJFA 3ORYA 2QAGA 1T0HB 3JWIA 2X8JA 1ULHA 3AL2A 4RDCA 5KNBD 3REFA 4V3BA 4BE9A 2NMVA 1FOEB 1PJ2A 4ZAFA 4CV2A 4DR7B 2R4TA 3IBSA 3M4ZA 3P2OA 3R6LA 2MSDB 16PKA 1QRTA 1OBVA 4WACA 3ZY3A 1SQ6A 3EGXB 4RHEA 4OK3A 4YREA 2V8OA 4O1MA 3G2KA 4ZCSA 3MS7A 4MZDA 3ZE2B 1T2FA 4K2HA 4TL7A 1RSZA 1K1EA 3C6KA 3BCUA 4RCVA 4I8IA 3D2LA 4M9CA 3ZWPA 4ACBA 3V80A 1A95A 1GCOA 3ND7A 1VL0A 1POWA 1Q0TA 4WZAB 2X0RA 3K70B 1DDGA 2WR8A 2NXJA 4NC9A 4AJKA 2Y4NA 2KLBA 2P27A 4UHJA 5K0FA 1TQ8A 1YSCA 1ZR4A 2H65A 1KRXA 3B82A 1E2EA 3MUNA 1BROA 1X1QA 3STHA 5HUHA 1SBTA 3RVRA 1DRKA 2H2DA 2P68A 4C29A 2GAAA 5B1HA 2J0QA 1OWOA 2MSEB 1AKEA 3QYPA 2PX3A 3GLUA 2PGNA 2I55A 2P1RA 4MA5A 4OYYA 3VPGA 1N5IA 5HPYB 3ILSA 3FYDA 3QVWA 2I65A 3CKYA 1F4LA 4F06A 4RA9B 2NXEA 2WP0A 1SG9A 3CRZA 5AM4A 5TQ0A 4V3CA 2G1UA 4Z9AA 2XQIA 3AFGA 3RHFA 4EEXA 2ZBUA 2AS0A 4JJZA 3R5KA 1DT5A 1DEKA 1XTPA 1OAAA 5IXJA 1Z13A 1SVLA 4XWKA 1SRRA 3OF5A 5JY1A 2HCJB 3OZUA 1REQA 1JE0A 3KXKA 3RS0A 4NBSA 2OB1A 2K2WA 4WLUA 3RE1A 1E0DA 4GX5A 3BEOA 3HMKA 3QELA 4OYRA 1JTFA 2UZ3A 3V7UA 1NJ2A 4NCBA 2IT1A 1GGMA 1TPZA 2QZPA 3JU3A 1I6MA 1N2CA 3OZTA 4FYMA 2AG8A 5JPIA 5ITWA 4OCZA 3MB8A 3FCUB 3LA8A 5C1PA 1JAIA 1T25A 1GPMA 5JSUA 3U31A 3BTUA 1WG8A 3JQFA 2M1XA 2O06A 1RCTE 4QEKA 4DSZA 4MJLA 1D9XA 3DZFA 4EGAA 2JFYA 2PT6A 4L1KA 4G5GA 2WJYA 1IOVA 4HFMA 1NQXA 3INGA 4D44A 3SPXA 3E05A 1NPDA 5CH8A 4B2IA 4Z4FA 3Q3JB 5KNLA 1CY1A 4X54A 3ZCQA 1CUZA 4U2EA 2PUAA 3BCHA 4NBWA 5MN5A 2E89A 4TV8F 1SO8A 3KWFA 5CAEA 2VTBA 1M9NA 5BT8A 4I5IA 4Q7KA 1D7AA 4ND2A 5CD9A 4HFJA 3RUHA 1R0SA 4AF8A 1J2YA 3JWGA 4C0XA 1EFKA 2O8DA 4XB1A 1SXJA 2NG1A 4IG9A 1BZYA 4YAGA 2N47A 3T4PA 4CM8B 3Q7TA 1NHWA 2AG1A 2IELA 3S2EA 4E2XA 2DAPA 5LB4A 5DOVA 1NP3A 4AUKA 5JRDS 1ORDA 4UAGA 1B0PA 1X9IA 3I73A 3BHNA 4N5LA 5KJ1A 1QQ6A 3ANYB 1C9EA 4W1PA 3FDJA 4ZRNA 3F4KA 4BFWA 2DECA 2VPYA 4W1SA 2NLOA 4W1RA 1RAFA 3INRA 4OHZA 1JKXA 2FJPA 2XQJA 5KJEA 2HH9A 5EQDA 5I9TA 1T2CA 4BFVA 2REXB 5GY7A 2FMHA 4Y9RA 3R0QA 4EKIA 2IVZA 2W5UA 2Q99A 3SIWA 1RVDA 1HG1A 1TD9A 2Y1DA 3INYA 3NBQA 2H9IA 4JVMA 3UG7A 3VHQA 3E1KA 3R5TA 3MELA 4Q15A 3DXXA 3O9ZA 1WXXA 3TBKA 1V11B 2PVCA 1KE1A 1GY8A 5E9JA 4EEKA 5IH7A 4A6DA 1MJHA 4KWHA 2WUGA 4BJ3A 1WBJB 5A7GA 1AC5A 4QA9A 3H2ZA 1SFRA 1SKYE 3HNRA 3IAXA 3S2YA 2Y1EA 2C29D 2NPOA 3CLTC 1ZD3A 3V4RA 4FWTA 1UZNA 1EK1A 3UGTA 4D0RA 3ESQA 4P86A 2I87A 1NI3A 3W5DA 4MUEA 3R9XA 2AR7A 1BJTA 1P7VA 5F7OA 3AGQA 4JBYA 5DNEA 1FUUA 3BA1A 3D8NA 3I76A 3LT0A 2ZGVA 2XE8A 1CP2A 3NIBA 4JYPA 1EFUA 4K8OA 5ALFA 3KPYA 3DV2A 3LCMA 4OFWA 3U62A 3PS9A 3K6SB 1IZ0A 3BMQB 5KWEA 1PGNA 4KR6A 1KH2A 3EPPA 2W6JA 5GP1A 4UM9B 1K5GA 4OMCA 1G55A 2F55A 2C61A 1D8AA 3G85A 3RC2A 4NDAA 2J6IA 2EBFX 4JQCA 3GDHA 1B8OA 4EO9A 4LV5B 4CTMA 2D5IA 2BGUA 3DO5A 2BPOA 5CXQA 2WQ7A 2XF8A 4F45A 2W2MA 3T41A 1UK8A 4D96A 4FB5A 3I9OA 1D5CA 4IIVA 3BWCA 5EJGA 3CG4A 3ISVA 2XT9A 4Y2JA 5J9FA 2K87A 3D4LA 1ZCJA 2DTDA 2I3GA 5J4KA 4GR5A 1X7XA 2O05A 1ORWA 5CLQA 1VJRA 1QH0A 4JBWA 3W5AA 3PQ7A 3DFMA 5FFMA 4B85A 3OQ1A 2AD5A 4D98A 4EPYA 1DE0A 4BKOA 2YHIA 1TYDE 3Q7EA 1YRLA 3BTSA 1OIXA 1G8MA 4REQB 5GONA 2HU7A 5ILOA 2AYYA 4J2OA 2QF7A 4QYMA 4HF7A 5BWBA 3V8BA 2ZAIA 4Q4DA 4UBNA 3BC1A 4BVAA 1FB5A 4UBMA 1EJBA 5SV2A 1Z33A 2R8OA 3ZWBA 4EDHA 5L7TA 1V39A 3ORFA 5AHKA 4FZ3A 4DEXA 1YR8A 3OIWA 4LG1A 4MW5A 2EZ9A 2G83A 2PH1A 2EC5A 3OOSA 4PRZA 3USCS 5LZ5A 1QHGA 2IYVA 2VXCA 2FZEA 3RSHA 4AJ2A 1FP2A 1Q50A 3PQDA 2V0GA 2I80A 5IMBA 3M1AA 1QPBA 3L43A 3ER6A 3SX4A 1Z8FA 1SHLA 1Y8ZA 3PVSA 4ARSA 4HFRA 3W5VA 3CUEF 1Z6TA 3G8YA 3I01A 1C9JA 5EINA 4LXIA 2ZJ7A 5DV9A 4D5GA 3DUFB 1J97A 3GLTA 4QQKA 1MOQA 1O6GA 2DX7A 4QNRA 5JW6A 4C22A 2XIQA 1EFTA 1P4GA 1I6LA 1LFAA 3A05A 3FKSA 4D9NA 5K5EA 4XR9A 1C1HA 2YXEA 10MHA 4EIWA 3CW8X 3PC7A 2J3IA 2XIJA 5F2OA 4J4HA 3AINA 5D3MA 4PYRA 5CT8A 4AB1A 3ONDA 4IDBA 4BV3A 5T6MA 4YT4A 4HXFB 3FZGA 3OTIA 4TRRA 3VOTA 1I4EB 1NKTA 4Y6GB 2ACKA 5EZYF 2WKQA 1CDZA 2ZIEA 4ZODA 3E9DA 1IFXA 2FQXA 3CC8A 1X7ZB 2XMRA 5DRTA 3SBXA 4Q1EA 2G9QA 4C0LA 2V6JA 3CZ4A 1ZHFA 3M5CA 7GPBA 3PUWA 4Y2GA 2BMFA 4YDHB 2ZZMA 1BVYF 1IZZA 4F84A 2PR2A 2E6UX 2NWQA 2C2BA 1SBCA 4OLJA 4H4CA 5FIUA 3FJYA 2CNDA 3I5MA 1NXTA 1MG5A 1QHSA 1SR8A 2G88A 2R8EA 3HPRA 2R7MA 3JATA 4TSFA 4W8GA 4NDZA 1E92A 3K2EA 1NJGA 4OSPA 4A2CA 4DQUA 5HS6A 5T4EA 2KE5A 3WVNA 1DX4A 3CUKA 3P94A 2B2CA 4JP8A 4TV9F 1NW3A 4MR7B 1QTQA 1JYSA 1IN8A 3BWYA 2W2NA 4KUEA 4J4TA 1AKNA 1EJ0A 1Q1EA 5LXTB 4P1ZA 3GFBA 4JASB 2AFHB 1M8KA 1QS0A 1NBMD 1SUPA 2FQQA 3GLHA 2ZFUA 5JU6A 3PHJA 4LWQA 4ILEA 3AHCA 2HQ1A 4OREX 5EHGA 3TSAA 4DBLE 1DVRA 2ERYA 1UBTS 4TSKA 4O2AB 4YAFA 3PUXA 5J2TB 3RM3A 1NGSA 3IQDB 1GPYA 1E3SA 4H0FA 5EWLA 3M5WA 3IDFA 2UZ0A 1V5GA 4O1HA 4PFSA 2P9ZA 2C1XA 2TMKA 1RLJA 1QYRA 2RAUA 3AR8A 3B9BA 2WG1A 1WHTB 4UUBA 2JLWA 3DTTA 3ULKA 1O5IA 2F8LA 1H2HA 2PKXA 1CS4C 3EVCA 3FRHA 3PYLA 3RS3A 5JZOA 4AN1A 4RF2A 1TVKB 2CJWB 3KQYA 4TUYA 1V41E 2XKAA 2QQ0A 4KE6A 4C0JA 5CFLA 2J3DA 3FCEA 5BSFA 3ZWAA 2ZWPA 3UWDA 2B4KA 2YQ4A 3K9QO 1RMQA 4JR0A 3LCCA 1KFBB 5FTJA 3SJZA 1ZH0A 1XYYA 4KIUA 1AQIA 3BIXA 121PA 1ZUNB 3G9ZA 3M7IA 4IEFB 1V25A 1PJAA 3H2SA 4FGJA 4XGQA 5CX1A 1QHYA 3ZWCA 4DMKA 3FF4A 2B3TA 1DEXA 3IPXA 3KALA 3IAS6 3G1UA 3TLJA 1TXGA 1MJGM 3HU5A 4BQSA 1WXQA 3JQ8A 1D2GA 2RBEA 4IOJA 3C15C 3RHTA 3ZV5A 4I1RA 2NUAA 2IZ1A 2QX8A 3ZKWA 1O89A 1C9YA 1N7GA 1PJQA 1CTQA 3DR5A 4MIKA 1A71A 1MIOB 2D2EA 3UK6A 1RPZA 4QVGA 1OBCA 2WP8J 1ENYA 4ND1A 3TJZA 3NV7A 1GQYA 3LE8A 4KQGA 1U31A 5A3JA 2PD3A 4TVBA 4MGYR 2B0CA 5CB0A 1KWGA 3ZI0A 1FE8A 4D6XA 1YASA 2H7CA 1B2LA 2IIQA 5BWCA 4GEGA 1AXEA 2ZJ3A 1JS1X 1K27A 1N6KA 5H3CA 1DQZA 1PWZA 1N7JA 3H2BA 3LC2O 4OXRA 2Y9PB 1XMSA 1FMTA 2V4ZA 5AVKA 4ZRMA 4GFDA 1O4VA 1J90A 3QU9A 3TKYA 3TLYA 4P3OA 1CS0B 3ZDQA 4PEVA 4O4IF 4MJ3A 3T3HA 1HLPA 3FKQA 3TEFA 5FUMA 4J0IA 4BO8A 4YMTA 4D9HA 1DBQA 2CLEB 4RQUA 2VI5A 4R05A 3DZBA 2G80A 4XTCS 2EGUA 1KFEB 1PFVA 1CZOA 5E6RA 2PKCA 4AVYA 4FXPA 4Y1GA 2JGAA 1YK1A 2DERA 4BP1A 1BYIA 3UMVA 2AN9A 1UDRA 2OZPA 2QUHA 4Z2AA 3WMEA 3JQCA 1T8YA 1XDUA 5KHLB 1E58A 3B1XA 2UXBB 5BOSA 4MEBA 3DMGA 4TTQA 3BWMA 4DXAA 4XH9B 5JWOA 1KI4A 4PLFA 2WMYA 2VDLB 1NVKA 3L7MA 2PGOA 3DS8A 5LOVF 1QGOA 1J0EA 1PR4A 3F1KA 5IH3A 1JKJB 3I6ZA 3A9RA 2VUSA 4CT5A 2WJZB 4IJQA 1YDHA 1N75A 2PUWA 1UOEA 3MBKA 2IYOA 3RS7A 2ZATA 4YYEA 4Z4HA 2V65A 5LU9A 3NX4A 1XTVA 3Q7QA 2VBIA 4L4RA 3UKOA 3VZRA 3GU3A 4URUR 4B4DA 4HDCA 2G5GX 3CUVA 4V0SA 3HABA 5EKDA 2YZNA 1NMQA 3ZY6A 2RDMA 3JVIA 1VPLA 1ZW6A 4Q00A 4LZPA 3SF0A 3L06A 1VQ1A 1I30A 2C3YA 5LNK6 2C57A 5BV8A 3HUTA 4LN1A 5T5QA 1W47A 4Y6SA 3EVFA 4BKQA 3IR7A 4HB0A 2AR9A 1O94C 4ZJZA 5L6LB 2BYTA 4RFLA 2NUBA 3JZDA 2A58A 2OQ2A 5I8ZA 3R7AA 1TTTA 1A9PA 1Y37A 3OHSX 4C4YA 5AKGA 1JFVA 1YVRA 2WK1A 3IX7A 5JCJA 4B45A 2DUWA 3QQPA 4RV4A 4KX3A 4BJ5A 4DMMA 1MGPA 1W2GA 2CCGA 4H3VA 5KYTA 1TC1A 4A5OA 4EJSC 3THYB 2Q5IA 3X1WA 2XNDD 1EVKA 4U2KA 4JUDX 4NPHA 1KJ8A 4IDAA 4MW9A 1D9ZA 3UVEA 4E6EA 1KPHA 1SU8A 4BO5A 5JPCA 3HEAA 1A5BB 3V9PA 1KAQA 2R5NA 1LTHR 2GM3A 3EARA 4INAA 821PA 1VLZA 2IY9A 4JEHA 4DV7B 2H57A 5KVVA 2GYUA 2GM4A 2BGIA 4IF4A 2CLLB 3O6VA 1PT5A 4HT3B 1XJ5A 4PSVA 4PIMA 1RLOA 3QEMA 5CD1A 1D3AA 3O8RA 3K0FB 5CA0B 2VQFB 1G6KA 3U2QA 2BFPA 4ZVPA 4KZKA 4B3HA 2O2DA 3DFKA 4J0EA 2VHXA 2RIPA 3HBAA 4JBLA 3GT7A 2QOEA 2J6BA 5LJLA 1KIFA 5EA2A 2F43B 1IHYA 1EB9A 1ZSVA 1Z8NA 2GA8A 2XYRA 5GZ6A 4IDNA 2RC5A 4BU0A 4X66B 3IGFA 4G5XA 2OCLA 2H48A 4AJJA 1FYDA 1GVNB 1AS0A 2POQX 1FSSA 1SKUA 5C1OA 3EPJA 1BQ4A 2C96A 3B9QA 1YCDA 4C87A 1GLNA 4OIFA 5KTKA 1XRMA 3GUCA 1JHPA 3NEPX 3PEVA 3UJ6A 5DNAA 5H9VA 4XRGA 1W48A 3KZCA 4EZIA 3C3WA 2HHAA 3NDRA 4LF7B 3UMGA 1OVGA 2C5FA 2WM9B 3VTFA 4J16A 1BOOA 1XDBA 2P2SA 3OFVA 4MQ5A 3PEEA 3ABZA 4MIEA 4K6KA 4RHTA 1FPQA 2WA1A 3OU2A 3N75A 3IHLA 4H1HA 3RVNA 2X13A 3I05A 5A7FA 3BOSA 4YRIA 5LQJA 3PENA 3OCYA 1RJ9B 1RQ7A 1OAOC 1TLLA 2JIBA 1I4TD 2P0AA 3MHPA 2PN1A 4M38A 1H0SA 4XUGB 5A6VA 3J80A 4V1CA 2IWHA 3AMVA 3HBFA 3DYIA 4DBVO 2Q0XA 1TM3E 1RHQA 5JFGA 3EVNA 1P77A 3ID6C 4OG2A 3I2KA 1EINA 4FHDA 1JDBC 1KO4A 1TYAE 4KWTA 3T15A 4C0WA 4C6HA 1BHSA 2P5YA 4G0XA 3HTXA 3EFBA 4F3TA 4Q6BA 5B3JC 5FOTA 2KBEA 5CDYA 1AN9A 1ZBDA 3OPQA 4I6JA 4BEWA 1Z5UA 3GO4A 4C7XA 3DAPA 3E9MA 4DV2B 2ZXFA 4GE0A 5ERGB 3OEWA 2JD0A 2ZVPX 5JAPA 1O94A 5JSZB 5K3FB 1S2GA 2CXQA 4KVAA 4YT8A 5L3SB 4JEIA 3KOXA 2J85A 1D1QA 2Z5LA 4NBRA 1B0UA 1QPZA 1M6HA 2HA6A 3T5BA 1KQ3A 4QASA 3QBJA 1A8UA 1MEJA 5IM4F 3PRYA 3LHIA 4ARZB 4KO2S 4MUMA 1QQTA 1SBZA 3AXSA 1A1VA 4G8BA 3U3XA 5K7SA 4GUDA 1JFFB 4G0NA 2I33A 4CBVA 1RVV1 1VHLA 2YN2A 3AOEA 3GFQA 1F1JA 1JMYA 2QMOA 2VPIA 2JLXA 2XAAA 4C6TB 1OH6A 1RTTA 1WXFA 4XPIB 2ALJA 1X70A 2PZJA 1SMKA 3OZSA 3TIXB 1TC2A 1R4AA 1W87A 4F8JA 2RAPA 3CVVA 5BV7A 1YRAA 2WHRA 4GO1A 1EZ4A 1CIPA 4NYJR 3QIAA 2E48A 2OCKA 2JPDA 1UBFA 3AGPA 2VPPA 3A3YA 3F5QA 4PZPA 4RHYA 1MNQA 3KIPA 4JAVC 1FFGA 2FOXA 2DMRA 5MGBA 1HURA 2NT4A 3GLSA 1Y4ZA 3QFTA 1Y82A 4HATA 1J49A 1BAPA 1LPAB 3TPCA 5HIAA 1N4AA 1XPOA 1P4SA 5LBUA 1FQJA 2YBEA 4B09A 1PVOA 1JXOA 3UB4A 4IHKA 1NIPA 3IOBA 4PZ9A 3FMGA 2XQKA 4X9XA 3CZRA 3VO2A 3COPA 1B2RA 2Q5CA 3JQ7A 4EHNA 5C8ZA 3BQNB 3BMOA 3PGA1 1J6UA 5TMPA 2GQ0A 1FF9A 1NTOA 3CURA 4JODA 4YMSA 2AEMA 2W2QA 3PA6A 4PW0A 4R6WA 4CQMA 4EW2A 1II9A 3ZDDA 4PZEA 4HVLA 1RPJA 2EX0A 4GOND 3MMPA 5JSYA 3WNCA 3G2NA 4IQ8A 1NHGA 2BKLA 3WDMA 1DUVG 1O97C 4OK6A 1Q0RA 2OGZA 5FWAA 3WQSB 3ZK7A 2ZJZA 5K6TA 4GLBA 3BMCB 4ZYVA 3I1JA 2PMCA 5BMVB 1YV9A 2X15A 1H2AS 2QROA 1W5AA 4H1TA 3TPZA 4YO7A 1SIWA 1ZOPA 4YJ2A 3UK1A 3B1KA 5K6AA 3HM2A 2IX3A 1E3MA 4GM4A 2JLSA 4JH0A 3UEOA 1M5RA 1XHFA 2O2SA 4RMHA 1DHRA 2O20A 3U4HA 2QRNA 5B1IA 4DILA 2KYRA 3LQ4A 4EY3A 3D7NA 4DTCA 1HQCA 4F91B 3IUBA 3JQBC 5DM0A 5L45A 3COYA 4C20A 2C4TA 2JI8A 4N47A 1E4YA 7ABPA 2Y05A 5IG2A 4MRRA 1J7JA 5LQAA 2HRQA 3IIEA 3BSYA 3JPYA 4G56A 4HQFA 4W5JA 5AFSA 1ONPA 3W5CA 2QTFA 2WSSD 3H4IA 5HSGA 2IV2X 1XMPA 5AW2A 3KVRA 5J4VA 5ADVA 2V55B 4F1KA 5CLFA 4NBNA 2FN7A 4A0SA 2CVQA 4RHUA 4MVYA 3DH0A 2CWWA 5IP5A 4CR6A 2WWYA 3ZI4A 4Q02A 2J41A 2JBAB 2VSXA 5DK6A 1PNVA 4QPZA 4MIOA 3W34A 3ZY4A 3AEUA 3ROEA 3VTKA 2BISA 1Q84A 1R2QA 1ZXLA 2VA8A 4JA2A 4JLNA 4QOHA 3LKDA 4CM6A 3A4VA 2J3JA 2VDQB 5DHRA 5FR1A 3KQWA 4XQGA 3Q3CA 3ZC3A 3ZJYA 1SG0A 4H7IA 5AHXA 1GUYA 2C5LA 5P8WA 2NVBA 3CLRC 4N5HX 4YQZA 2ILVA 2RGBA 3NUZA 2VIIA 2QQ5A 2YWFA 5AK5A 3VSBA 1TI7A 2AHRA 5HKOA 1ZMOA 2VJLA 4M54A 2FSIA 2YH2A 4Q3LA 1I4OA 4LRXA 4UBJA 4O29A 1E9DA 5EIEA 4Q1CA 4OX9B 3N2KB 1U2DC 4YRCA 3ORSA 1ZK4A 5KSPA 1YCHA 4H35A 1M2FA 2HD4A 1Q6YA 2DBQA 3O8BA 4FZJA 2VJQA 1S3IA 4UDXX 2YW2A 3Q9UA 4IIDA 4WNIA 1R0RE 2FW7A 1V9LA 3UPTA 1XNQB 1M2JA 2SICE 3PXEA 1KE2A 2VKTA 1E69A 2OQRA 3ZDYB 2B4RO 4DDUA 2GN1A 1JHOA 1T1SA 2IYYA 2OAP1 4FE3A 5TF4A 1TW2A 3NO4A 2K4MA 3R7BA 3QE2A 4DCOA 1UPUA 3NOOA 4GF5A 1UMDA 3NB0A 4KYUA 4WY8A 4ZJYA 3GRZA 1ONSA 3AF4A 4C9BA 2OA0A 2QUIA 3OEHA 4M7RA 1WNFA 2OYSA 4QWMA 4C4PA 2CJFA 4MW4A 3C6ZA 1Q7RA 1B23P 3E0XA 4RU1A 3QJ5A 4Y1RB 3KEOA 4MW0A 2YIMA 4ICIA 4PSDA 1XQXA 2E4ZA 4LK3A 1T34A 5B7NA 2F9MA 2HEGA 4EY8A 2CXRA 5CIYA 3AF1A 4LGMA 2P4QA 1K97A 5C37A 3BSWA 2Z8XA 1G6OA 3DOCA 3T7DA 4MVJA 3K73O 3VAZA 4HLDA 4YRMA 3B9PA 2IYNA 3V8NA 2GEDA 3Q87B 1H93A 4JJ8A 5D3ZA 1PT7A